BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig438

Length=835
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_008345982.1|  PREDICTED: polyadenylate-binding protein 2-like    151   6e-39   
ref|XP_008220252.1|  PREDICTED: polyadenylate-binding protein 2-like    151   4e-38   Prunus mume [ume]
ref|XP_007226962.1|  hypothetical protein PRUPE_ppa002618mg             151   4e-38   Prunus persica
ref|XP_008393785.1|  PREDICTED: polyadenylate-binding protein 2-like    151   5e-38   
ref|XP_006434728.1|  hypothetical protein CICLE_v10000537mg             148   4e-37   
gb|KDO84108.1|  hypothetical protein CISIN_1g006282mg                   148   4e-37   Citrus sinensis [apfelsine]
ref|XP_010110808.1|  Polyadenylate-binding protein 2                    148   5e-37   Morus notabilis
gb|KDO84107.1|  hypothetical protein CISIN_1g006282mg                   148   7e-37   Citrus sinensis [apfelsine]
ref|XP_006434727.1|  hypothetical protein CICLE_v10000537mg             148   7e-37   Citrus clementina [clementine]
ref|XP_006473293.1|  PREDICTED: polyadenylate-binding protein 8-like    148   7e-37   Citrus sinensis [apfelsine]
ref|XP_004291087.1|  PREDICTED: polyadenylate-binding protein 2-like    147   8e-37   Fragaria vesca subsp. vesca
dbj|BAM15222.1|  poly(A)-binding protein                                147   1e-36   Nicotiana tabacum [American tobacco]
ref|XP_009606599.1|  PREDICTED: polyadenylate-binding protein 2-l...    147   1e-36   Nicotiana tomentosiformis
ref|XP_009606598.1|  PREDICTED: polyadenylate-binding protein 2-l...    147   1e-36   Nicotiana tomentosiformis
ref|XP_009359888.1|  PREDICTED: polyadenylate-binding protein 2-like    146   2e-36   Pyrus x bretschneideri [bai li]
ref|XP_011074396.1|  PREDICTED: polyadenylate-binding protein 8-like    146   3e-36   Sesamum indicum [beniseed]
ref|XP_008378021.1|  PREDICTED: polyadenylate-binding protein 2-like    146   3e-36   
ref|XP_011074395.1|  PREDICTED: polyadenylate-binding protein 8-like    146   4e-36   Sesamum indicum [beniseed]
gb|KHN12798.1|  Polyadenylate-binding protein 2                         145   4e-36   Glycine soja [wild soybean]
ref|XP_003550332.1|  PREDICTED: polyadenylate-binding protein 8-like    145   4e-36   Glycine max [soybeans]
ref|XP_006342637.1|  PREDICTED: polyadenylate-binding protein 8-like    145   5e-36   
ref|XP_012068315.1|  PREDICTED: polyadenylate-binding protein 2-like    145   6e-36   
emb|CAN72942.1|  hypothetical protein VITISV_011270                     136   2e-35   Vitis vinifera
ref|XP_004252758.1|  PREDICTED: polyadenylate-binding protein 2-like    143   4e-35   Solanum lycopersicum
gb|EPS70556.1|  hypothetical protein M569_04204                         134   5e-35   Genlisea aurea
ref|XP_007160868.1|  hypothetical protein PHAVU_001G023500g             142   6e-35   Phaseolus vulgaris [French bean]
ref|XP_003589160.1|  Polyadenylate-binding protein                      142   7e-35   Medicago truncatula
ref|XP_009782956.1|  PREDICTED: polyadenylate-binding protein 2-l...    142   1e-34   Nicotiana sylvestris
ref|XP_009782955.1|  PREDICTED: polyadenylate-binding protein 2-l...    142   1e-34   Nicotiana sylvestris
ref|XP_004499046.1|  PREDICTED: polyadenylate-binding protein 2-l...    141   1e-34   
ref|XP_004499044.1|  PREDICTED: polyadenylate-binding protein 2-l...    141   1e-34   Cicer arietinum [garbanzo]
ref|XP_004505404.1|  PREDICTED: polyadenylate-binding protein 2-like    140   3e-34   
ref|XP_006357465.1|  PREDICTED: polyadenylate-binding protein 8-like    137   3e-34   
gb|ACJ85797.1|  unknown                                                 139   6e-34   Medicago truncatula
ref|XP_003603074.1|  Poly(A)-binding protein                            139   9e-34   Medicago truncatula
ref|XP_010028424.1|  PREDICTED: polyadenylate-binding protein 2         139   9e-34   Eucalyptus grandis [rose gum]
ref|XP_008364810.1|  PREDICTED: polyadenylate-binding protein 8-like    139   9e-34   
ref|XP_011017176.1|  PREDICTED: polyadenylate-binding protein 8-like    139   1e-33   Populus euphratica
gb|EYU36334.1|  hypothetical protein MIMGU_mgv1a002624mg                139   1e-33   Erythranthe guttata [common monkey flower]
ref|XP_003529405.1|  PREDICTED: polyadenylate-binding protein 8-like    139   1e-33   Glycine max [soybeans]
ref|XP_006574897.1|  PREDICTED: polyadenylate-binding protein 8-like    139   2e-33   Glycine max [soybeans]
gb|KHN05826.1|  Polyadenylate-binding protein 2                         139   2e-33   Glycine soja [wild soybean]
ref|XP_004140705.1|  PREDICTED: polyadenylate-binding protein 8-like    139   2e-33   Cucumis sativus [cucumbers]
ref|XP_008456142.1|  PREDICTED: polyadenylate-binding protein 2-l...    139   2e-33   Cucumis melo [Oriental melon]
emb|CDP01307.1|  unnamed protein product                                138   2e-33   Coffea canephora [robusta coffee]
gb|KDO59775.1|  hypothetical protein CISIN_1g010577mg                   135   3e-33   Citrus sinensis [apfelsine]
ref|XP_002301171.2|  hypothetical protein POPTR_0002s12570g             138   3e-33   Populus trichocarpa [western balsam poplar]
ref|XP_006374904.1|  hypothetical protein POPTR_0014s02550g             137   4e-33   Populus trichocarpa [western balsam poplar]
ref|XP_006421220.1|  hypothetical protein CICLE_v10006478mg             129   5e-33   
ref|XP_011029544.1|  PREDICTED: polyadenylate-binding protein 2-like    137   5e-33   Populus euphratica
ref|XP_002300227.1|  polyadenylate-binding family protein               137   6e-33   Populus trichocarpa [western balsam poplar]
ref|XP_010107907.1|  Polyadenylate-binding protein 2                    137   6e-33   Morus notabilis
gb|KDO59774.1|  hypothetical protein CISIN_1g010577mg                   135   6e-33   Citrus sinensis [apfelsine]
ref|XP_002510185.1|  polyadenylate-binding protein, putative            137   6e-33   Ricinus communis
ref|XP_011000826.1|  PREDICTED: polyadenylate-binding protein 8-like    137   6e-33   Populus euphratica
ref|XP_009775186.1|  PREDICTED: polyadenylate-binding protein 2-like    137   7e-33   Nicotiana sylvestris
ref|XP_002313862.1|  polyadenylate-binding family protein               137   7e-33   
ref|XP_009408013.1|  PREDICTED: polyadenylate-binding protein 2-like    137   7e-33   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011000130.1|  PREDICTED: polyadenylate-binding protein 8-like    136   1e-32   Populus euphratica
gb|KGN43917.1|  hypothetical protein Csa_7G073530                       136   1e-32   Cucumis sativus [cucumbers]
ref|XP_008454965.1|  PREDICTED: polyadenylate-binding protein 2         136   1e-32   Cucumis melo [Oriental melon]
ref|NP_001292658.1|  polyadenylate-binding protein 2                    136   1e-32   Cucumis sativus [cucumbers]
ref|XP_007201197.1|  hypothetical protein PRUPE_ppa002607mg             136   2e-32   Prunus persica
gb|KDO59773.1|  hypothetical protein CISIN_1g010577mg                   134   2e-32   Citrus sinensis [apfelsine]
ref|XP_003607922.1|  Poly(A)-binding protein                            135   3e-32   Medicago truncatula
ref|XP_009613515.1|  PREDICTED: polyadenylate-binding protein 2-like    135   3e-32   Nicotiana tomentosiformis
ref|XP_009600995.1|  PREDICTED: polyadenylate-binding protein 8-like    135   3e-32   Nicotiana tomentosiformis
emb|CDO97200.1|  unnamed protein product                                135   3e-32   Coffea canephora [robusta coffee]
ref|XP_009768210.1|  PREDICTED: polyadenylate-binding protein 8-like    135   4e-32   Nicotiana sylvestris
ref|XP_010540373.1|  PREDICTED: polyadenylate-binding protein 2-like    134   4e-32   Tarenaya hassleriana [spider flower]
emb|CDO97198.1|  unnamed protein product                                135   4e-32   Coffea canephora [robusta coffee]
ref|XP_008236485.1|  PREDICTED: polyadenylate-binding protein 8         135   4e-32   Prunus mume [ume]
ref|XP_006422975.1|  hypothetical protein CICLE_v10027999mg             134   5e-32   Citrus clementina [clementine]
ref|XP_004304018.1|  PREDICTED: polyadenylate-binding protein 8-like    134   6e-32   Fragaria vesca subsp. vesca
gb|AFP74112.1|  poly-A binding protein                                  134   7e-32   Nicotiana benthamiana
ref|XP_008364682.1|  PREDICTED: polyadenylate-binding protein 2-like    126   1e-31   Malus domestica [apple tree]
gb|AAK30205.1|AF349964_1  poly(A)-binding protein                       133   2e-31   Daucus carota [carrots]
ref|XP_008373847.1|  PREDICTED: polyadenylate-binding protein 8-like    133   2e-31   
ref|XP_010322992.1|  PREDICTED: polyadenylate-binding protein 2-like    129   2e-31   
gb|KCW66376.1|  hypothetical protein EUGRSUZ_F00193                     131   2e-31   Eucalyptus grandis [rose gum]
ref|XP_006346392.1|  PREDICTED: polyadenylate-binding protein 8-like    132   3e-31   Solanum tuberosum [potatoes]
ref|XP_002518733.1|  polyadenylate-binding protein, putative            132   3e-31   Ricinus communis
gb|KCW66375.1|  hypothetical protein EUGRSUZ_F00193                     132   3e-31   Eucalyptus grandis [rose gum]
ref|XP_010059905.1|  PREDICTED: polyadenylate-binding protein 2-like    132   4e-31   Eucalyptus grandis [rose gum]
ref|XP_010688794.1|  PREDICTED: polyadenylate-binding protein 2-like    132   5e-31   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009415843.1|  PREDICTED: polyadenylate-binding protein 2-like    132   5e-31   Musa acuminata subsp. malaccensis [pisang utan]
dbj|BAJ53194.1|  JHL03K20.3                                             131   6e-31   Jatropha curcas
dbj|BAJ95976.1|  predicted protein                                      130   7e-31   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002883899.1|  hypothetical protein ARALYDRAFT_899764             131   7e-31   Arabidopsis lyrata subsp. lyrata
ref|XP_012079275.1|  PREDICTED: polyadenylate-binding protein 4-like    131   7e-31   Jatropha curcas
ref|XP_010519297.1|  PREDICTED: polyadenylate-binding protein 8-like    131   7e-31   Tarenaya hassleriana [spider flower]
ref|XP_004230758.1|  PREDICTED: polyadenylate-binding protein 8-like    131   9e-31   Solanum lycopersicum
ref|XP_010270544.1|  PREDICTED: polyadenylate-binding protein 2-l...    130   1e-30   Nelumbo nucifera [Indian lotus]
ref|XP_010270536.1|  PREDICTED: polyadenylate-binding protein 2-l...    130   1e-30   Nelumbo nucifera [Indian lotus]
ref|XP_006855143.1|  PREDICTED: polyadenylate-binding protein 2         130   1e-30   Amborella trichopoda
ref|XP_010928350.1|  PREDICTED: polyadenylate-binding protein 8-l...    130   2e-30   Elaeis guineensis
ref|XP_010691731.1|  PREDICTED: polyadenylate-binding protein 2-like    130   2e-30   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010928349.1|  PREDICTED: polyadenylate-binding protein 2-l...    130   2e-30   Elaeis guineensis
dbj|BAJ86310.1|  predicted protein                                      130   3e-30   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CDY67365.1|  BnaA03g57640D                                          125   3e-30   Brassica napus [oilseed rape]
ref|XP_002285190.1|  PREDICTED: polyadenylate-binding protein 2         129   3e-30   Vitis vinifera
emb|CBI19489.3|  unnamed protein product                                129   3e-30   Vitis vinifera
ref|XP_002284923.1|  PREDICTED: polyadenylate-binding protein 8 i...    129   4e-30   Vitis vinifera
ref|XP_009136272.1|  PREDICTED: polyadenylate-binding protein 2-l...    128   5e-30   Brassica rapa
ref|XP_009136273.1|  PREDICTED: polyadenylate-binding protein 2-l...    128   5e-30   Brassica rapa
ref|XP_007017178.1|  Poly(A) binding protein 8 isoform 1                128   7e-30   
ref|XP_010263472.1|  PREDICTED: polyadenylate-binding protein 2-like    129   7e-30   Nelumbo nucifera [Indian lotus]
gb|KDO79130.1|  hypothetical protein CISIN_1g006290mg                   127   7e-30   Citrus sinensis [apfelsine]
ref|XP_008788846.1|  PREDICTED: polyadenylate-binding protein 2-like    127   2e-29   Phoenix dactylifera
ref|XP_003580095.1|  PREDICTED: polyadenylate-binding protein 2-like    127   2e-29   Brachypodium distachyon [annual false brome]
gb|KHG04753.1|  Polyadenylate-binding 2 -like protein                   126   2e-29   Gossypium arboreum [tree cotton]
gb|AFW58789.1|  hypothetical protein ZEAMMB73_983608                    125   3e-29   
gb|KDO79129.1|  hypothetical protein CISIN_1g006290mg                   127   3e-29   Citrus sinensis [apfelsine]
ref|NP_001275799.1|  poly A-binding protein 2                           127   3e-29   Citrus sinensis [apfelsine]
ref|XP_010526963.1|  PREDICTED: polyadenylate-binding protein 2-like    126   3e-29   Tarenaya hassleriana [spider flower]
dbj|BAJ53195.1|  JHL03K20.4                                             125   6e-29   Jatropha curcas
ref|XP_012079276.1|  PREDICTED: polyadenylate-binding protein 4-like    125   6e-29   Jatropha curcas
ref|XP_006409548.1|  hypothetical protein EUTSA_v10022589mg             125   7e-29   Eutrema salsugineum [saltwater cress]
gb|KFK40021.1|  hypothetical protein AALP_AA3G319900                    125   7e-29   Arabis alpina [alpine rockcress]
gb|KHG19377.1|  Polyadenylate-binding protein 1-like 2                  125   8e-29   Gossypium arboreum [tree cotton]
gb|KJB32340.1|  hypothetical protein B456_005G236500                    125   9e-29   Gossypium raimondii
gb|EYU36333.1|  hypothetical protein MIMGU_mgv1a002664mg                125   9e-29   Erythranthe guttata [common monkey flower]
ref|NP_001151785.1|  LOC100285420                                       125   1e-28   Zea mays [maize]
ref|XP_010447142.1|  PREDICTED: polyadenylate-binding protein 2-like    125   1e-28   Camelina sativa [gold-of-pleasure]
ref|XP_010432464.1|  PREDICTED: polyadenylate-binding protein 2-like    125   1e-28   Camelina sativa [gold-of-pleasure]
gb|KJB32341.1|  hypothetical protein B456_005G236500                    125   1e-28   Gossypium raimondii
ref|XP_008663371.1|  PREDICTED: polyadenylate-binding protein 2-like    125   1e-28   
ref|XP_010447143.1|  PREDICTED: polyadenylate-binding protein 2         124   2e-28   Camelina sativa [gold-of-pleasure]
ref|XP_010555994.1|  PREDICTED: polyadenylate-binding protein 8         124   2e-28   Tarenaya hassleriana [spider flower]
gb|EYU42687.1|  hypothetical protein MIMGU_mgv1a002746mg                124   2e-28   Erythranthe guttata [common monkey flower]
ref|XP_002960874.1|  hypothetical protein SELMODRAFT_21095              124   2e-28   
ref|XP_010906556.1|  PREDICTED: polyadenylate-binding protein 2-l...    124   2e-28   Elaeis guineensis
ref|XP_006425947.1|  hypothetical protein CICLE_v10025109mg             124   2e-28   
ref|XP_006425948.1|  hypothetical protein CICLE_v10025109mg             124   3e-28   Citrus clementina [clementine]
ref|XP_010530761.1|  PREDICTED: LOW QUALITY PROTEIN: polyadenylat...    124   3e-28   Tarenaya hassleriana [spider flower]
emb|CDX89664.1|  BnaC03g45780D                                          124   3e-28   
ref|XP_004978120.1|  PREDICTED: polyadenylate-binding protein 2-like    124   3e-28   
ref|XP_011092553.1|  PREDICTED: polyadenylate-binding protein 2-like    124   4e-28   Sesamum indicum [beniseed]
ref|XP_008795896.1|  PREDICTED: polyadenylate-binding protein 2-like    123   5e-28   Phoenix dactylifera
ref|XP_003525892.1|  PREDICTED: polyadenylate-binding protein 8-like    123   5e-28   Glycine max [soybeans]
ref|XP_006494495.1|  PREDICTED: polyadenylate-binding protein 4         123   6e-28   
gb|KJB14630.1|  hypothetical protein B456_002G134900                    121   6e-28   Gossypium raimondii
ref|XP_002283105.1|  PREDICTED: polyadenylate-binding protein 2         123   6e-28   Vitis vinifera
gb|KJB14634.1|  hypothetical protein B456_002G134900                    121   6e-28   Gossypium raimondii
ref|XP_006283328.1|  hypothetical protein CARUB_v10004368mg             122   7e-28   Capsella rubella
ref|XP_007042478.1|  Poly(A) binding protein 8                          122   8e-28   
ref|XP_010437669.1|  PREDICTED: polyadenylate-binding protein 2-like    122   1e-27   Camelina sativa [gold-of-pleasure]
ref|XP_006279092.1|  hypothetical protein CARUB_v10012708mg             121   1e-27   
ref|XP_007047341.1|  Poly(A) binding protein 8                          122   1e-27   
gb|KJB14631.1|  hypothetical protein B456_002G134900                    120   1e-27   Gossypium raimondii
gb|KHG16756.1|  Polyadenylate-binding 2 -like protein                   120   1e-27   Gossypium arboreum [tree cotton]
gb|KJB63883.1|  hypothetical protein B456_010G021800                    120   2e-27   Gossypium raimondii
ref|XP_010093503.1|  Polyadenylate-binding protein 2                    121   2e-27   Morus notabilis
ref|XP_006661030.1|  PREDICTED: polyadenylate-binding protein 8-like    121   2e-27   
ref|XP_010432462.1|  PREDICTED: polyadenylate-binding protein 2-l...    121   2e-27   Camelina sativa [gold-of-pleasure]
gb|KJB63884.1|  hypothetical protein B456_010G021800                    120   2e-27   Gossypium raimondii
gb|KJB14633.1|  hypothetical protein B456_002G134900                    121   3e-27   Gossypium raimondii
gb|KJB14632.1|  hypothetical protein B456_002G134900                    121   3e-27   Gossypium raimondii
gb|KJB14629.1|  hypothetical protein B456_002G134900                    121   3e-27   Gossypium raimondii
ref|XP_009398670.1|  PREDICTED: polyadenylate-binding protein 2-like    121   3e-27   Musa acuminata subsp. malaccensis [pisang utan]
gb|EYU37653.1|  hypothetical protein MIMGU_mgv1a002809mg                120   3e-27   Erythranthe guttata [common monkey flower]
ref|NP_001062583.1|  Os09g0115400                                       121   3e-27   
ref|XP_006578034.1|  PREDICTED: polyadenylate-binding protein 8 i...    120   4e-27   Glycine max [soybeans]
ref|XP_009395913.1|  PREDICTED: polyadenylate-binding protein 2-like    120   4e-27   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB63885.1|  hypothetical protein B456_010G021800                    120   4e-27   Gossypium raimondii
ref|XP_006578033.1|  PREDICTED: polyadenylate-binding protein 8 i...    120   4e-27   Glycine max [soybeans]
ref|XP_002448132.1|  hypothetical protein SORBIDRAFT_06g021850          120   4e-27   Sorghum bicolor [broomcorn]
ref|XP_003523956.1|  PREDICTED: polyadenylate-binding protein 8 i...    120   4e-27   Glycine max [soybeans]
ref|XP_003544466.1|  PREDICTED: polyadenylate-binding protein 8-like    120   4e-27   Glycine max [soybeans]
gb|KJB29450.1|  hypothetical protein B456_005G101600                    120   5e-27   Gossypium raimondii
ref|XP_012074453.1|  PREDICTED: polyadenylate-binding protein 3         120   5e-27   Jatropha curcas
ref|XP_007153580.1|  hypothetical protein PHAVU_003G0475000g            111   5e-27   Phaseolus vulgaris [French bean]
gb|KJB63886.1|  hypothetical protein B456_010G021800                    120   5e-27   Gossypium raimondii
gb|KJB58541.1|  hypothetical protein B456_009G214100                    120   6e-27   Gossypium raimondii
ref|XP_006412276.1|  hypothetical protein EUTSA_v10024683mg             119   6e-27   
ref|XP_003573691.1|  PREDICTED: polyadenylate-binding protein 2-like    120   7e-27   Brachypodium distachyon [annual false brome]
ref|XP_001761820.1|  predicted protein                                  117   9e-27   
gb|AAQ56342.1|  putative poly(A)-binding protein                        117   9e-27   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002891531.1|  PAB8 binding protein 8                             120   9e-27   Arabidopsis lyrata subsp. lyrata
ref|XP_006412275.1|  hypothetical protein EUTSA_v10024683mg             119   9e-27   Eutrema salsugineum [saltwater cress]
ref|NP_001053248.1|  Os04g0504800                                       119   1e-26   
gb|EEC77593.1|  hypothetical protein OsI_16552                          119   1e-26   Oryza sativa Indica Group [Indian rice]
emb|CDY62723.1|  BnaC03g77220D                                          119   1e-26   Brassica napus [oilseed rape]
ref|XP_002869174.1|  predicted protein                                  119   1e-26   
ref|NP_564554.1|  poly(A) binding protein 8                             119   1e-26   Arabidopsis thaliana [mouse-ear cress]
emb|CAE02947.3|  OSJNBa0014K14.19                                       119   1e-26   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006393217.1|  hypothetical protein EUTSA_v10011289mg             119   1e-26   Eutrema salsugineum [saltwater cress]
emb|CDY54068.1|  BnaCnng26160D                                          119   2e-26   Brassica napus [oilseed rape]
gb|KJB79362.1|  hypothetical protein B456_013G046000                    116   2e-26   Gossypium raimondii
gb|KJB79364.1|  hypothetical protein B456_013G046000                    117   2e-26   Gossypium raimondii
ref|XP_010030473.1|  PREDICTED: polyadenylate-binding protein 2-like    110   2e-26   
ref|XP_009342699.1|  PREDICTED: polyadenylate-binding protein 3         118   3e-26   Pyrus x bretschneideri [bai li]
ref|XP_008337230.1|  PREDICTED: polyadenylate-binding protein 3-like    118   3e-26   
emb|CDX71223.1|  BnaC07g05020D                                          118   3e-26   
ref|NP_001061515.1|  Os08g0314800                                       118   4e-26   
ref|XP_009147891.1|  PREDICTED: polyadenylate-binding protein 8         118   4e-26   Brassica rapa
ref|XP_004956317.1|  PREDICTED: polyadenylate-binding protein 2-like    118   4e-26   Setaria italica
gb|AAB38974.1|  poly(A)-binding protein                                 117   5e-26   Triticum aestivum [Canadian hard winter wheat]
gb|KHG04776.1|  Polyadenylate-binding 2 -like protein                   117   5e-26   Gossypium arboreum [tree cotton]
gb|KJB79365.1|  hypothetical protein B456_013G046000                    116   5e-26   Gossypium raimondii
gb|EMT11582.1|  Polyadenylate-binding protein 2                         115   6e-26   
tpg|DAA39540.1|  TPA: hypothetical protein ZEAMMB73_983793              113   7e-26   
ref|XP_009335160.1|  PREDICTED: polyadenylate-binding protein 3         117   7e-26   
ref|XP_002985732.1|  hypothetical protein SELMODRAFT_122762             117   8e-26   
ref|XP_002974435.1|  hypothetical protein SELMODRAFT_101161             117   8e-26   
emb|CDY51957.1|  BnaA08g11610D                                          117   8e-26   Brassica napus [oilseed rape]
dbj|BAJ96406.1|  predicted protein                                      117   8e-26   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KHN43945.1|  Polyadenylate-binding protein 2                         108   8e-26   Glycine soja [wild soybean]
ref|XP_009108756.1|  PREDICTED: polyadenylate-binding protein 2         116   9e-26   Brassica rapa
ref|NP_195137.5|  polyadenylate-binding protein 2                       117   9e-26   Arabidopsis thaliana [mouse-ear cress]
gb|KJB79363.1|  hypothetical protein B456_013G046000                    117   9e-26   Gossypium raimondii
gb|KJB79366.1|  hypothetical protein B456_013G046000                    117   9e-26   Gossypium raimondii
gb|KFK30042.1|  hypothetical protein AALP_AA7G209600                    116   1e-25   Arabis alpina [alpine rockcress]
ref|XP_003576878.1|  PREDICTED: polyadenylate-binding protein 2-like    117   1e-25   Brachypodium distachyon [annual false brome]
gb|KHG12838.1|  ELAV-like protein 2                                     116   1e-25   Gossypium arboreum [tree cotton]
dbj|BAJ97269.1|  predicted protein                                      117   1e-25   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_007143592.1|  hypothetical protein PHAVU_007G084800g             115   1e-25   Phaseolus vulgaris [French bean]
gb|KFK35979.1|  hypothetical protein AALP_AA4G062600                    116   1e-25   Arabis alpina [alpine rockcress]
emb|CDY36634.1|  BnaA07g04230D                                          116   1e-25   Brassica napus [oilseed rape]
ref|XP_001780529.1|  predicted protein                                  116   1e-25   
gb|AID60122.1|  poly(A) binding protein 8                               115   2e-25   Brassica napus [oilseed rape]
ref|XP_007143593.1|  hypothetical protein PHAVU_007G084800g             115   3e-25   Phaseolus vulgaris [French bean]
emb|CDX75397.1|  BnaA01g03050D                                          115   3e-25   
dbj|BAJ90169.1|  predicted protein                                      115   3e-25   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002527095.1|  polyadenylate-binding protein, putative            115   3e-25   Ricinus communis
ref|XP_009119410.1|  PREDICTED: polyadenylate-binding protein 2         115   3e-25   Brassica rapa
emb|CBI32381.3|  unnamed protein product                                115   5e-25   Vitis vinifera
emb|CDX69025.1|  BnaC01g04280D                                          114   5e-25   
ref|XP_011044832.1|  PREDICTED: polyadenylate-binding protein 3-like    114   6e-25   Populus euphratica
tpg|DAA39542.1|  TPA: hypothetical protein ZEAMMB73_983793              114   7e-25   
tpg|DAA39541.1|  TPA: hypothetical protein ZEAMMB73_983793              114   7e-25   
ref|XP_010681423.1|  PREDICTED: polyadenylate-binding protein 5         114   7e-25   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008651618.1|  PREDICTED: uncharacterized protein LOC100381...    114   7e-25   
ref|XP_009117148.1|  PREDICTED: polyadenylate-binding protein 2         114   8e-25   Brassica rapa
gb|AAL86321.1|  putative poly(A)-binding protein                        113   1e-24   Arabidopsis thaliana [mouse-ear cress]
emb|CAN80948.1|  hypothetical protein VITISV_016699                     107   1e-24   Vitis vinifera
ref|XP_002307526.2|  hypothetical protein POPTR_0005s22040g             113   2e-24   
ref|XP_001779388.1|  predicted protein                                  112   3e-24   
gb|KHN04485.1|  Polyadenylate-binding protein 2                         112   3e-24   Glycine soja [wild soybean]
ref|XP_006473877.1|  PREDICTED: polyadenylate-binding protein 3-like    112   3e-24   Citrus sinensis [apfelsine]
ref|XP_006434548.1|  hypothetical protein CICLE_v10003530mg             112   3e-24   Citrus clementina [clementine]
gb|KDO83840.1|  hypothetical protein CISIN_1g006641mg                   112   3e-24   Citrus sinensis [apfelsine]
ref|XP_009386708.1|  PREDICTED: polyadenylate-binding protein 2-l...    112   4e-24   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009386707.1|  PREDICTED: polyadenylate-binding protein 2-l...    112   4e-24   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_001770548.1|  predicted protein                                  112   4e-24   
ref|XP_009386706.1|  PREDICTED: polyadenylate-binding protein 2-l...    112   4e-24   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009386705.1|  PREDICTED: polyadenylate-binding protein 2-l...    112   4e-24   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002987288.1|  hypothetical protein SELMODRAFT_269256             111   5e-24   Selaginella moellendorffii
emb|CBI18330.3|  unnamed protein product                                105   6e-24   Vitis vinifera
ref|XP_010925352.1|  PREDICTED: polyadenylate-binding protein 2-like    111   6e-24   Elaeis guineensis
ref|XP_010549246.1|  PREDICTED: polyadenylate-binding protein 2-l...    108   8e-24   Tarenaya hassleriana [spider flower]
ref|XP_010549243.1|  PREDICTED: polyadenylate-binding protein 2-l...    108   9e-24   Tarenaya hassleriana [spider flower]
gb|KJB40265.1|  hypothetical protein B456_007G054700                    110   9e-24   Gossypium raimondii
ref|XP_010549241.1|  PREDICTED: polyadenylate-binding protein 8-l...    109   1e-23   Tarenaya hassleriana [spider flower]
gb|KJB40266.1|  hypothetical protein B456_007G054700                    110   1e-23   Gossypium raimondii
ref|XP_002961040.1|  hypothetical protein SELMODRAFT_74731              110   1e-23   
gb|KHG25571.1|  Polyadenylate-binding protein 1-like 2                  110   1e-23   Gossypium arboreum [tree cotton]
gb|KJB40264.1|  hypothetical protein B456_007G054700                    110   2e-23   Gossypium raimondii
ref|XP_002966972.1|  hypothetical protein SELMODRAFT_168822             110   2e-23   
gb|KJB40263.1|  hypothetical protein B456_007G054700                    110   2e-23   Gossypium raimondii
emb|CAA81127.1|  poly(A)-mRNA binding protein                           110   2e-23   Anemia phyllitidis
ref|XP_007201196.1|  hypothetical protein PRUPE_ppa002584mg             109   3e-23   Prunus persica
gb|KHG15542.1|  Polyadenylate-binding 3 -like protein                   108   3e-23   Gossypium arboreum [tree cotton]
ref|XP_008237538.1|  PREDICTED: polyadenylate-binding protein 3-like    109   4e-23   
ref|XP_010261307.1|  PREDICTED: LOW QUALITY PROTEIN: polyadenylat...    109   4e-23   
gb|KEH43623.1|  polyadenylate-binding protein                           109   4e-23   Medicago truncatula
gb|KHN32825.1|  Polyadenylate-binding protein 2                         109   4e-23   Glycine soja [wild soybean]
ref|XP_011042916.1|  PREDICTED: polyadenylate-binding protein 3-like    108   6e-23   Populus euphratica
ref|XP_011026320.1|  PREDICTED: polyadenylate-binding protein 3         108   6e-23   Populus euphratica
ref|XP_002300896.1|  Polyadenylate-binding protein 5                    108   6e-23   Populus trichocarpa [western balsam poplar]
ref|XP_008456718.1|  PREDICTED: polyadenylate-binding protein 3         108   8e-23   Cucumis melo [Oriental melon]
ref|XP_006842170.1|  PREDICTED: polyadenylate-binding protein 5         108   9e-23   
gb|KGN46101.1|  hypothetical protein Csa_6G052760                       108   1e-22   Cucumis sativus [cucumbers]
ref|XP_004140947.2|  PREDICTED: polyadenylate-binding protein 3         108   1e-22   Cucumis sativus [cucumbers]
ref|XP_007513597.1|  predicted protein                                  107   1e-22   Bathycoccus prasinos
ref|XP_007140277.1|  hypothetical protein PHAVU_008G098700g             107   2e-22   Phaseolus vulgaris [French bean]
ref|XP_008787484.1|  PREDICTED: polyadenylate-binding protein 2-like    108   2e-22   
ref|XP_010645822.1|  PREDICTED: LOW QUALITY PROTEIN: polyadenylat...    107   2e-22   
ref|XP_003556172.1|  PREDICTED: polyadenylate-binding protein 3-l...    107   2e-22   Glycine max [soybeans]
ref|XP_003055549.1|  predicted protein                                  106   3e-22   
ref|XP_010089427.1|  Polyadenylate-binding protein 3                    106   3e-22   
emb|CAN75447.1|  hypothetical protein VITISV_030926                     106   4e-22   
ref|XP_011459765.1|  PREDICTED: LOW QUALITY PROTEIN: polyadenylat...    106   5e-22   
ref|XP_010531254.1|  PREDICTED: polyadenylate-binding protein 4         105   5e-22   
emb|CBI29360.3|  unnamed protein product                                105   5e-22   
ref|XP_001418998.1|  predicted protein                                  105   5e-22   
gb|EPS61542.1|  hypothetical protein M569_13255                         104   6e-22   
ref|XP_010527159.1|  PREDICTED: polyadenylate-binding protein 4-like    105   1e-21   
ref|XP_009786468.1|  PREDICTED: polyadenylate-binding protein 3-l...    105   1e-21   
ref|XP_009786467.1|  PREDICTED: polyadenylate-binding protein 3-l...    105   1e-21   
ref|XP_004496415.1|  PREDICTED: polyadenylate-binding protein 3-l...    104   1e-21   
ref|XP_004496416.1|  PREDICTED: polyadenylate-binding protein 3-l...    104   1e-21   
ref|XP_002503581.1|  predicted protein                                  104   1e-21   
ref|XP_011100720.1|  PREDICTED: polyadenylate-binding protein 3         104   2e-21   
ref|XP_010466073.1|  PREDICTED: polyadenylate-binding protein 8-like    101   2e-21   
ref|XP_008793488.1|  PREDICTED: polyadenylate-binding protein 3         103   2e-21   
gb|KJB66300.1|  hypothetical protein B456_010G134400                    103   2e-21   
ref|XP_009608720.1|  PREDICTED: polyadenylate-binding protein 3         103   3e-21   
ref|XP_002890531.1|  PAB3 binding protein 3                             103   3e-21   
ref|XP_010915083.1|  PREDICTED: polyadenylate-binding protein 3         103   4e-21   
ref|XP_006406512.1|  hypothetical protein EUTSA_v10020750mg             101   4e-21   
ref|XP_010908819.1|  PREDICTED: polyadenylate-binding protein 7-l...    102   5e-21   
tpg|DAA37054.1|  TPA: hypothetical protein ZEAMMB73_066622            96.7    5e-21   
ref|XP_011092554.1|  PREDICTED: polyadenylate-binding protein 2-like    103   5e-21   
gb|KJJ12281.1|  Polyadenylate-binding protein                           103   5e-21   
gb|KEH26027.1|  polyadenylate-binding protein                           102   6e-21   
ref|XP_010908818.1|  PREDICTED: polyadenylate-binding protein 7-l...    102   6e-21   
ref|XP_006499892.1|  PREDICTED: polyadenylate-binding protein 1-l...    100   6e-21   
ref|XP_003637173.1|  Polyadenylate-binding protein                      102   7e-21   
ref|XP_010507660.1|  PREDICTED: polyadenylate-binding protein 8-like  99.8    7e-21   
ref|XP_010460042.1|  PREDICTED: polyadenylate-binding protein 3-like    102   7e-21   
ref|XP_010498759.1|  PREDICTED: polyadenylate-binding protein 3-l...    102   8e-21   
ref|XP_010477542.1|  PREDICTED: polyadenylate-binding protein 3         102   8e-21   
ref|XP_010417088.1|  PREDICTED: polyadenylate-binding protein 4-like    102   9e-21   
dbj|GAA88742.1|  polyadenylate-binding protein                          102   1e-20   
gb|AAG02117.1|AF293840_1  poly(A) binding protein                       102   1e-20   
gb|AAC25510.1|  Strong similarity to gb|M97657 poly(A)-binding pr...    102   1e-20   
ref|NP_173690.1|  polyadenylate-binding protein 3                       102   1e-20   
emb|CDK24264.1|  unnamed protein product                                102   1e-20   
ref|XP_002888846.1|  hypothetical protein ARALYDRAFT_339396             102   1e-20   
emb|CDY41472.1|  BnaA08g20740D                                          102   1e-20   
ref|XP_006304937.1|  hypothetical protein CARUB_v10011423mg             102   1e-20   
ref|XP_003740776.1|  PREDICTED: polyadenylate-binding protein 1-like    102   1e-20   
ref|XP_007695897.1|  hypothetical protein COCSADRAFT_270468             102   1e-20   
sp|A2Q848.1|PABP_ASPNC  RecName: Full=Polyadenylate-binding prote...    102   1e-20   
gb|EUN23000.1|  hypothetical protein COCVIDRAFT_41297                   102   1e-20   
ref|XP_007693838.1|  hypothetical protein COCMIDRAFT_110979             102   1e-20   
ref|XP_010521108.1|  PREDICTED: polyadenylate-binding protein 3 i...    101   1e-20   
ref|XP_009110128.1|  PREDICTED: polyadenylate-binding protein 3         102   1e-20   
ref|XP_008020859.1|  hypothetical protein SETTUDRAFT_152841             102   1e-20   
ref|XP_010521107.1|  PREDICTED: polyadenylate-binding protein 3 i...    101   1e-20   
ref|XP_007713955.1|  hypothetical protein COCCADRAFT_100504             102   1e-20   
ref|XP_006301512.1|  hypothetical protein CARUB_v10021938mg             102   1e-20   
gb|EMD93565.1|  hypothetical protein COCHEDRAFT_1096208                 102   1e-20   
ref|XP_010487871.1|  PREDICTED: polyadenylate-binding protein 8-like  99.4    1e-20   
ref|XP_001388739.2|  polyadenylate-binding protein, cytoplasmic a...    102   1e-20   
gb|KGO67120.1|  Nucleotide-binding, alpha-beta plait                    102   1e-20   
ref|XP_003080474.1|  polyadenylate-binding protein, putative / PA...    100   2e-20   
ref|XP_002561222.1|  Pc16g09030                                         102   2e-20   
ref|XP_003305701.1|  hypothetical protein PTT_18612                     102   2e-20   
gb|EKV11320.1|  Polyadenylate-binding protein                           102   2e-20   
emb|CDM26481.1|  Polyadenylate binding protein, human types 1, 2,...    102   2e-20   
ref|XP_001931782.1|  polyadenylate-binding protein                      101   2e-20   
ref|XP_001265244.1|  polyadenylate-binding protein                      101   2e-20   
ref|XP_003519971.2|  PREDICTED: polyadenylate-binding protein 3-like    101   2e-20   
emb|CDY67921.1|  BnaC08g49200D                                          101   2e-20   
emb|CEF98830.1|  Polyadenylate-binding protein/Hyperplastic disc ...    101   2e-20   
gb|EYE94447.1|  polyadenylate binding protein                           101   2e-20   
emb|CDY36684.1|  BnaCnng07860D                                          101   2e-20   
ref|XP_006404818.1|  hypothetical protein EUTSA_v10000075mg             101   2e-20   
ref|XP_010429282.1|  PREDICTED: polyadenylate-binding protein 4         101   2e-20   
emb|CDX68303.1|  BnaA07g23430D                                          100   2e-20   
ref|XP_002878680.1|  PAB4 binding protein 4                             100   3e-20   
ref|XP_009104896.1|  PREDICTED: polyadenylate-binding protein 5-like    100   3e-20   
ref|XP_006499890.1|  PREDICTED: polyadenylate-binding protein 1-l...    100   3e-20   
ref|XP_006499888.1|  PREDICTED: polyadenylate-binding protein 1-l...    100   3e-20   
gb|EDL06360.1|  mCG5434                                                 100   3e-20   
ref|NP_177322.2|  polyadenylate-binding protein 5                       100   3e-20   
gb|AAF43230.1|AC012654_14  Identical to the polyadenylate-binding...    100   3e-20   
ref|XP_006499889.1|  PREDICTED: polyadenylate-binding protein 1-l...    100   3e-20   
ref|XP_010428010.1|  PREDICTED: polyadenylate-binding protein 5-l...    100   3e-20   
gb|AAA32832.1|  poly(A)-binding protein                                 100   3e-20   
gb|AAI58031.1|  1810053B01Rik protein                                   100   3e-20   
ref|NP_001107551.1|  polyadenylate-binding protein 1-like               100   3e-20   
ref|XP_010428009.1|  PREDICTED: polyadenylate-binding protein 5-l...    100   3e-20   
ref|XP_007019672.1|  Polyadenylate-binding protein 3-binding prot...    100   3e-20   
gb|KIY98360.1|  hypothetical protein MNEG_9600                        98.6    3e-20   
gb|EMF13249.1|  polyadenylate binding protein                           100   4e-20   
ref|XP_003085306.1|  PREDICTED: polyadenylate-binding protein 1-l...  96.3    5e-20   
ref|XP_008773846.1|  PREDICTED: LOW QUALITY PROTEIN: polyadenylat...  99.8    5e-20   
gb|KFK41598.1|  hypothetical protein AALP_AA2G149300                    100   5e-20   
ref|XP_001269718.1|  polyadenylate-binding protein                      100   5e-20   
emb|CDY19686.1|  BnaC09g29420D                                        92.4    6e-20   
ref|XP_006295403.1|  hypothetical protein CARUB_v10024499mg             100   6e-20   
ref|XP_003234302.1|  polyadenylate-binding protein                      100   6e-20   
gb|KFK44367.1|  hypothetical protein AALP_AA1G248100                  99.8    6e-20   
ref|XP_007606496.1|  PREDICTED: polyadenylate-binding protein 1-l...  95.9    7e-20   
ref|XP_230831.6|  PREDICTED: polyadenylate-binding protein 1-like...  99.4    8e-20   
ref|XP_007530931.1|  PREDICTED: polyadenylate-binding protein 1-like  97.1    8e-20   
ref|XP_010471184.1|  PREDICTED: polyadenylate-binding protein 5 i...  99.8    8e-20   
ref|XP_010471183.1|  PREDICTED: polyadenylate-binding protein 5 i...  99.8    8e-20   
ref|XP_006227465.1|  PREDICTED: polyadenylate-binding protein 1-l...  95.5    9e-20   
gb|KIW02029.1|  polyadenylate-binding protein, cytoplasmic and nu...  99.4    1e-19   
gb|EME45325.1|  hypothetical protein DOTSEDRAFT_71152                 99.4    1e-19   
gb|EHK44276.1|  hypothetical protein TRIATDRAFT_79372                 99.4    1e-19   
gb|KGO47080.1|  Polyadenylate-binding protein/Hyperplastic disc p...    100   1e-19   
ref|XP_007782154.1|  hypothetical protein W97_06239                   99.4    1e-19   
gb|KGO38810.1|  Polyadenylate-binding protein/Hyperplastic disc p...    100   1e-19   
ref|XP_010415886.1|  PREDICTED: polyadenylate-binding protein 5-like  99.0    1e-19   
ref|XP_004631075.1|  PREDICTED: polyadenylate-binding protein 1-like  98.6    1e-19   
ref|XP_001689671.1|  polyadenylate-binding protein RB47               98.6    1e-19   
gb|EPS71718.1|  hypothetical protein M569_03039                       98.6    1e-19   
gb|EGD98532.1|  polyadenylate-binding protein                         99.0    1e-19   
ref|XP_003650660.1|  hypothetical protein THITE_2110364               99.0    1e-19   
ref|XP_007924751.1|  hypothetical protein MYCFIDRAFT_202901           99.0    2e-19   
gb|AAC39368.1|  poly(A) binding protein RB47                          98.6    2e-19   
emb|CDQ74679.1|  unnamed protein product                              93.6    2e-19   
ref|XP_004947932.1|  PREDICTED: polyadenylate-binding protein 4 i...  95.1    2e-19   
ref|XP_011126919.1|  hypothetical protein AOL_s00193g6                99.0    2e-19   
gb|ERE71628.1|  polyadenylate-binding protein 1                       98.2    2e-19   
ref|XP_007643296.1|  PREDICTED: polyadenylate-binding protein 1-l...  98.2    2e-19   
emb|CDY38939.1|  BnaA04g13600D                                        98.6    2e-19   
emb|CDX89562.1|  BnaC04g35810D                                        98.6    2e-19   
ref|XP_007643297.1|  PREDICTED: polyadenylate-binding protein 1-l...  98.2    2e-19   
ref|XP_007674710.1|  hypothetical protein BAUCODRAFT_86883            99.0    2e-19   
ref|XP_010629780.1|  PREDICTED: polyadenylate-binding protein 1-l...  97.8    2e-19   
ref|XP_009140459.1|  PREDICTED: polyadenylate-binding protein 4-like  98.2    2e-19   
ref|XP_007643295.1|  PREDICTED: polyadenylate-binding protein 1-l...  98.2    2e-19   
ref|XP_005363203.1|  PREDICTED: polyadenylate-binding protein 1-like  98.2    2e-19   
ref|XP_008946126.1|  PREDICTED: polyadenylate-binding protein 1-like  94.7    2e-19   
ref|XP_003020804.1|  hypothetical protein TRV_05080                   98.6    2e-19   
ref|XP_010763222.1|  polyadenylate-binding protein, cytoplasmic a...  98.6    2e-19   
ref|XP_004947931.1|  PREDICTED: polyadenylate-binding protein 4 i...  95.5    2e-19   
gb|EEH16345.2|  polyadenylate-binding protein, cytoplasmic and nu...  98.6    2e-19   
ref|XP_001804541.1|  hypothetical protein SNOG_14351                  98.6    2e-19   
ref|XP_002797705.1|  polyadenylate-binding protein                    98.6    2e-19   
gb|EWC45777.1|  cytoplasmic and nuclear polyadenylate-binding pro...  98.6    2e-19   
ref|XP_005392518.1|  PREDICTED: polyadenylate-binding protein 1-l...  95.5    2e-19   
ref|XP_008849251.1|  PREDICTED: polyadenylate-binding protein 1-like  97.8    2e-19   
ref|XP_010629777.1|  PREDICTED: polyadenylate-binding protein 1-l...  97.8    2e-19   
ref|XP_001820045.1|  polyadenylate-binding protein, cytoplasmic a...  98.2    2e-19   
ref|XP_008778836.1|  PREDICTED: polyadenylate-binding protein 7-like  97.8    2e-19   
ref|NP_001005062.1|  embryonic polyadenylate-binding protein          97.8    2e-19   
ref|NP_179916.1|  poly(A) binding protein 4                           98.2    2e-19   
gb|AAP06467.1|  similar to GenBank Accession Number AJ298278 poly...  95.1    3e-19   
ref|XP_004890186.1|  PREDICTED: polyadenylate-binding protein 1-like  97.8    3e-19   
gb|EHB06494.1|  Polyadenylate-binding protein 1-like protein          97.8    3e-19   
ref|XP_010629779.1|  PREDICTED: polyadenylate-binding protein 1-l...  97.8    3e-19   
ref|XP_009028811.1|  hypothetical protein HELRODRAFT_69344            97.8    3e-19   
ref|XP_009117286.1|  PREDICTED: polyadenylate-binding protein 4-like  97.8    3e-19   
gb|KJK65222.1|  polyadenylate binding protein types 1 2 3 4 famil...  98.2    3e-19   
gb|EZF28641.1|  polyadenylate-binding protein, cytoplasmic and nu...  98.2    3e-19   
emb|CBY41581.1|  unnamed protein product                              97.8    3e-19   
gb|AAK25927.1|AF360217_1  putative poly(A) binding protein            97.8    3e-19   
ref|XP_003175547.1|  hypothetical protein MGYG_03072                  98.2    3e-19   
ref|XP_002374401.1|  polyadenylate-binding protein                    98.2    3e-19   
gb|KEQ91913.1|  hypothetical protein AUEXF2481DRAFT_8143              98.2    3e-19   
ref|XP_002602357.1|  hypothetical protein BRAFLDRAFT_234358           97.8    3e-19   
ref|XP_003012489.1|  hypothetical protein ARB_01449                   98.2    3e-19   
ref|XP_001212967.1|  polyadenylate-binding protein                    98.2    3e-19   
ref|XP_003467726.1|  PREDICTED: polyadenylate-binding protein 1-like  97.8    3e-19   
ref|XP_003843853.1|  hypothetical protein LEMA_P015040.1              98.2    3e-19   
gb|EZF28640.1|  polyadenylate-binding protein, cytoplasmic and nu...  98.2    3e-19   
gb|EPS27914.1|  hypothetical protein PDE_02858                        98.2    3e-19   
ref|XP_004367288.1|  RNA-binding region RNP-1 domain-containing p...  97.4    3e-19   
gb|EGE02140.1|  polyadenylate-binding protein                         98.2    3e-19   
gb|KEQ73889.1|  polyadenylate binding protein                         98.2    3e-19   
ref|XP_750167.1|  polyadenylate-binding protein                       98.2    3e-19   
emb|CDY46079.1|  BnaA09g42030D                                        97.8    3e-19   
gb|KFO30242.1|  Polyadenylate-binding protein 1-like                  97.8    3e-19   
gb|KEQ60986.1|  polyadenylate binding protein                         97.8    3e-19   
emb|CCW68988.1|  unnamed protein product                              97.4    3e-19   
ref|XP_009105835.1|  PREDICTED: polyadenylate-binding protein 5       97.8    3e-19   
emb|CDX96344.1|  BnaA07g29550D                                        97.8    3e-19   
ref|XP_006971135.1|  PREDICTED: polyadenylate-binding protein 1-like  97.4    3e-19   
gb|KIK57761.1|  hypothetical protein GYMLUDRAFT_172381                97.8    4e-19   
ref|XP_004253267.1|  PREDICTED: polyadenylate-binding protein 3 i...  97.4    4e-19   
gb|KFQ83733.1|  Embryonic polyadenylate-binding protein A             92.4    4e-19   
emb|CDY37935.1|  BnaC02g20760D                                        97.4    4e-19   
ref|XP_004177123.1|  PREDICTED: embryonic polyadenylate-binding p...  92.4    4e-19   
ref|XP_010314905.1|  PREDICTED: polyadenylate-binding protein 3 i...  97.4    4e-19   
gb|KFQ21293.1|  Embryonic polyadenylate-binding protein               93.2    4e-19   
ref|XP_004687466.1|  PREDICTED: polyadenylate-binding protein 1-like  95.1    4e-19   
gb|KEQ84320.1|  polyadenylate binding protein                         97.8    4e-19   
ref|XP_007582350.1|  putative polyadenylate-binding protein           97.8    4e-19   
ref|XP_001538421.1|  polyadenylate-binding protein                    97.8    4e-19   
gb|ESS69668.1|  polyadenylate-binding protein 1                       97.1    4e-19   
ref|XP_011377811.1|  PREDICTED: polyadenylate-binding protein 1-l...  93.2    4e-19   
ref|XP_002954016.1|  hypothetical protein VOLCADRAFT_82578            97.4    4e-19   
ref|XP_009402160.1|  PREDICTED: polyadenylate-binding protein 5-like  97.4    4e-19   
ref|XP_008273035.1|  PREDICTED: LOW QUALITY PROTEIN: polyadenylat...  97.1    4e-19   
gb|KKA77189.1|  RNA binding protein                                   97.4    4e-19   
dbj|GAM38174.1|  mRNA export shuttling protein                        97.4    4e-19   
ref|XP_006925281.1|  PREDICTED: polyadenylate-binding protein 1-l...  92.8    4e-19   
ref|XP_010144959.1|  PREDICTED: embryonic polyadenylate-binding p...  94.4    4e-19   
gb|EEH05941.1|  polyadenylate-binding protein                         97.4    4e-19   
ref|XP_004286685.1|  PREDICTED: polyadenylate-binding protein 1-l...  93.2    4e-19   
ref|XP_005604706.1|  PREDICTED: poly(A) binding protein, cytoplas...  97.1    4e-19   
gb|EKG13336.1|  hypothetical protein MPH_09618                        97.4    5e-19   
ref|XP_005392517.1|  PREDICTED: polyadenylate-binding protein 1 i...  96.7    5e-19   
ref|XP_004947087.1|  PREDICTED: embryonic polyadenylate-binding p...  94.7    5e-19   
ref|XP_001500563.2|  PREDICTED: poly(A) binding protein, cytoplas...  97.1    5e-19   
ref|XP_002150282.1|  polyadenylate-binding protein                    97.4    5e-19   
emb|CDX72826.1|  BnaC06g32740D                                        97.4    5e-19   
ref|XP_821518.1|  polyadenylate-binding protein 1                     97.1    5e-19   
ref|XP_009196080.1|  PREDICTED: LOW QUALITY PROTEIN: polyadenylat...  91.7    5e-19   
ref|XP_006873471.1|  PREDICTED: polyadenylate-binding protein 1-l...  92.8    5e-19   
ref|XP_006390745.1|  hypothetical protein EUTSA_v10018219mg           97.1    5e-19   
ref|XP_009925476.1|  PREDICTED: embryonic polyadenylate-binding p...  93.6    5e-19   
ref|XP_009669410.1|  PREDICTED: polyadenylate-binding protein 1-l...  94.4    5e-19   
ref|XP_006873472.1|  PREDICTED: polyadenylate-binding protein 1-l...  92.8    5e-19   
dbj|GAD92758.1|  polyadenylate-binding protein                        97.4    5e-19   
ref|XP_002114073.1|  hypothetical protein TRIADDRAFT_27786            97.1    5e-19   
ref|XP_007475886.1|  PREDICTED: polyadenylate-binding protein 1-l...  94.4    5e-19   
ref|XP_002483981.1|  polyadenylate-binding protein                    97.4    5e-19   
ref|XP_008587203.1|  PREDICTED: polyadenylate-binding protein 1-l...  94.4    6e-19   
ref|XP_006997946.1|  PREDICTED: polyadenylate-binding protein 1-l...  94.4    6e-19   
ref|XP_009314267.1|  polyadenylate-binding protein 1                  95.5    6e-19   
ref|XP_008994237.1|  PREDICTED: polyadenylate-binding protein 1-l...  94.4    6e-19   
ref|XP_009174923.1|  hypothetical protein T265_10323                  93.6    6e-19   



>ref|XP_008345982.1| PREDICTED: polyadenylate-binding protein 2-like [Malus domestica]
Length=411

 Score =   151 bits (382),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 77/114 (68%), Positives = 86/114 (75%), Gaps = 8/114 (7%)
 Frame = +1

Query  493  MAQIQVQHQSpvalangvpppgavglpapQSAAGAGNQLSTTSLYVGDLDPTVTDSQLYD  672
            MAQIQVQH     ++               +A GA  Q  +TSLYVGDLD  VTDSQLYD
Sbjct  1    MAQIQVQHHQQPPVSGPNSVAA--------NAGGAPQQFVSTSLYVGDLDQNVTDSQLYD  52

Query  673  LFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQDAARAMEVLNFTPVNSKSIR  834
            LFNQVGQVVSVRVCRD+S+RRSLGYGYVNYS PQDAARA+EVLNFTP+N+KSIR
Sbjct  53   LFNQVGQVVSVRVCRDLSTRRSLGYGYVNYSGPQDAARALEVLNFTPLNNKSIR  106


 Score = 55.1 bits (131),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 27/83 (33%), Positives = 47/83 (57%), Gaps = 1/83 (1%)
 Frame = +1

Query  580  QSAAGAGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVN  759
            Q   G  N+    ++YV ++  + T+ +L  +F + GQ+ SV V RD    +S  +G+VN
Sbjct  201  QERDGNWNKTKFNNVYVKNVSESTTEDELRXIFGEHGQITSVVVMRD-GEGKSRCFGFVN  259

Query  760  YSSPQDAARAMEVLNFTPVNSKS  828
            +  P+ AA+A+E LN   ++ K 
Sbjct  260  FEDPEAAAKAVEALNGKKIDEKE  282



>ref|XP_008220252.1| PREDICTED: polyadenylate-binding protein 2-like [Prunus mume]
Length=651

 Score =   151 bits (382),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 82/114 (72%), Positives = 91/114 (80%), Gaps = 10/114 (9%)
 Frame = +1

Query  493  MAQIQVQHQSpvalangvpppgavglpapQSAAGAGNQLSTTSLYVGDLDPTVTDSQLYD  672
            MAQIQVQHQ PV   NGV            +A GA  Q  +TSLYVGDLD  VTDSQLYD
Sbjct  1    MAQIQVQHQPPVTGPNGVAA----------NAGGAPGQFVSTSLYVGDLDQNVTDSQLYD  50

Query  673  LFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQDAARAMEVLNFTPVNSKSIR  834
            LFNQVGQVVSVRVCRD+S+RRSLGYGYVNYS+PQDAARA++VLNFTP+N+KSIR
Sbjct  51   LFNQVGQVVSVRVCRDLSTRRSLGYGYVNYSNPQDAARALDVLNFTPLNNKSIR  104


 Score = 53.9 bits (128),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 29/84 (35%), Positives = 51/84 (61%), Gaps = 1/84 (1%)
 Frame = +1

Query  580  QSAAGAGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVN  759
            QS   A ++    +LY+ +LD +++D +L +LF++ G V S +V RD     S G G+V 
Sbjct  302  QSMKEASDKFQGVNLYIKNLDDSISDEKLKELFSEYGTVSSCKVMRDPDG-NSRGSGFVA  360

Query  760  YSSPQDAARAMEVLNFTPVNSKSI  831
            +S+ ++A+RA+  +N   V SK +
Sbjct  361  FSTTEEASRALAEMNGKMVVSKPL  384



>ref|XP_007226962.1| hypothetical protein PRUPE_ppa002618mg [Prunus persica]
 ref|XP_007226963.1| hypothetical protein PRUPE_ppa002618mg [Prunus persica]
 gb|EMJ28161.1| hypothetical protein PRUPE_ppa002618mg [Prunus persica]
 gb|EMJ28162.1| hypothetical protein PRUPE_ppa002618mg [Prunus persica]
Length=651

 Score =   151 bits (382),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 82/114 (72%), Positives = 91/114 (80%), Gaps = 10/114 (9%)
 Frame = +1

Query  493  MAQIQVQHQSpvalangvpppgavglpapQSAAGAGNQLSTTSLYVGDLDPTVTDSQLYD  672
            MAQIQVQHQ PV   NGV            +A GA  Q  +TSLYVGDLD  VTDSQLYD
Sbjct  1    MAQIQVQHQPPVTGPNGVAA----------NAGGAPGQFVSTSLYVGDLDQNVTDSQLYD  50

Query  673  LFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQDAARAMEVLNFTPVNSKSIR  834
            LFNQVGQVVSVRVCRD+S+RRSLGYGYVNYS+PQDAARA++VLNFTP+N+KSIR
Sbjct  51   LFNQVGQVVSVRVCRDLSTRRSLGYGYVNYSNPQDAARALDVLNFTPLNNKSIR  104


 Score = 54.7 bits (130),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 29/84 (35%), Positives = 51/84 (61%), Gaps = 1/84 (1%)
 Frame = +1

Query  580  QSAAGAGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVN  759
            QS   A ++    +LY+ +LD +++D +L +LF++ G V S +V RD     S G G+V 
Sbjct  302  QSMKEASDKFQGVNLYIKNLDDSISDEKLKELFSEYGTVTSCKVMRDPDG-NSRGSGFVA  360

Query  760  YSSPQDAARAMEVLNFTPVNSKSI  831
            +S+ ++A+RA+  +N   V SK +
Sbjct  361  FSTTEEASRALAEMNGKMVVSKPL  384



>ref|XP_008393785.1| PREDICTED: polyadenylate-binding protein 2-like [Malus domestica]
 ref|XP_008351992.1| PREDICTED: polyadenylate-binding protein 2-like [Malus domestica]
Length=649

 Score =   151 bits (382),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 77/114 (68%), Positives = 86/114 (75%), Gaps = 8/114 (7%)
 Frame = +1

Query  493  MAQIQVQHQSpvalangvpppgavglpapQSAAGAGNQLSTTSLYVGDLDPTVTDSQLYD  672
            MAQIQVQH     ++               +A GA  Q  +TSLYVGDLD  VTDSQLYD
Sbjct  1    MAQIQVQHHQQPPVSGPNSVAA--------NAGGAPQQFVSTSLYVGDLDQNVTDSQLYD  52

Query  673  LFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQDAARAMEVLNFTPVNSKSIR  834
            LFNQVGQVVSVRVCRD+S+RRSLGYGYVNYS PQDAARA+EVLNFTP+N+KSIR
Sbjct  53   LFNQVGQVVSVRVCRDLSTRRSLGYGYVNYSGPQDAARALEVLNFTPLNNKSIR  106


 Score = 53.9 bits (128),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 27/83 (33%), Positives = 47/83 (57%), Gaps = 1/83 (1%)
 Frame = +1

Query  580  QSAAGAGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVN  759
            Q   G  N+    ++YV ++  + T+ +L  +F + GQ+ SV V RD    +S  +G+VN
Sbjct  201  QERDGNWNKTKFNNVYVKNVSESTTEDELRXIFGEHGQITSVVVMRD-GEGKSRCFGFVN  259

Query  760  YSSPQDAARAMEVLNFTPVNSKS  828
            +  P+ AA+A+E LN   ++ K 
Sbjct  260  FEDPEAAAKAVEALNGKKIDEKE  282



>ref|XP_006434728.1| hypothetical protein CICLE_v10000537mg [Citrus clementina]
 gb|ESR47968.1| hypothetical protein CICLE_v10000537mg [Citrus clementina]
Length=519

 Score =   148 bits (373),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 77/114 (68%), Positives = 92/114 (81%), Gaps = 12/114 (11%)
 Frame = +1

Query  493  MAQIQVQHQSpvalangvpppgavglpapQSAAGAGNQLSTTSLYVGDLDPTVTDSQLYD  672
            MAQIQVQHQ+ ++  NGV            +A  +GNQ  TTSLYVGDLD  VTDSQLYD
Sbjct  1    MAQIQVQHQAQMSGPNGV------------AAGASGNQFLTTSLYVGDLDFNVTDSQLYD  48

Query  673  LFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQDAARAMEVLNFTPVNSKSIR  834
            LF+QVGQV+SVRVCRD+S+RRSLGYGYVNY++P DAARA++VLNFTP+N+KSIR
Sbjct  49   LFSQVGQVLSVRVCRDLSTRRSLGYGYVNYANPADAARALDVLNFTPLNNKSIR  102


 Score = 52.0 bits (123),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 25/77 (32%), Positives = 48/77 (62%), Gaps = 1/77 (1%)
 Frame = +1

Query  601  NQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQDA  780
            ++    +LY+ +L  ++ D +L +LF++ G + S +V RD S   S G G+V +S+P++A
Sbjct  307  DKFQGLNLYIKNLGDSIDDEKLKELFSEFGTITSCKVMRDPSG-ISKGSGFVAFSTPEEA  365

Query  781  ARAMEVLNFTPVNSKSI  831
            +RA+  +N   + SK +
Sbjct  366  SRALAEMNGKMIVSKPL  382



>gb|KDO84108.1| hypothetical protein CISIN_1g006282mg [Citrus sinensis]
Length=593

 Score =   148 bits (374),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 77/114 (68%), Positives = 92/114 (81%), Gaps = 12/114 (11%)
 Frame = +1

Query  493  MAQIQVQHQSpvalangvpppgavglpapQSAAGAGNQLSTTSLYVGDLDPTVTDSQLYD  672
            MAQIQVQHQ+ ++  NGV            +A  +GNQ  TTSLYVGDLD  VTDSQLYD
Sbjct  1    MAQIQVQHQAQMSGPNGV------------AAGASGNQFLTTSLYVGDLDFNVTDSQLYD  48

Query  673  LFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQDAARAMEVLNFTPVNSKSIR  834
            LF+QVGQV+SVRVCRD+S+RRSLGYGYVNY++P DAARA++VLNFTP+N+KSIR
Sbjct  49   LFSQVGQVLSVRVCRDLSTRRSLGYGYVNYANPADAARALDVLNFTPLNNKSIR  102


 Score = 52.4 bits (124),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 25/77 (32%), Positives = 48/77 (62%), Gaps = 1/77 (1%)
 Frame = +1

Query  601  NQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQDA  780
            ++    +LY+ +L  ++ D +L +LF++ G + S +V RD S   S G G+V +S+P++A
Sbjct  307  DKFQGLNLYIKNLGDSIDDEKLKELFSEFGTITSCKVMRDPSG-ISKGSGFVAFSTPEEA  365

Query  781  ARAMEVLNFTPVNSKSI  831
            +RA+  +N   + SK +
Sbjct  366  SRALAEMNGKMIVSKPL  382



>ref|XP_010110808.1| Polyadenylate-binding protein 2 [Morus notabilis]
 gb|EXC28180.1| Polyadenylate-binding protein 2 [Morus notabilis]
Length=639

 Score =   148 bits (374),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 75/114 (66%), Positives = 86/114 (75%), Gaps = 14/114 (12%)
 Frame = +1

Query  493  MAQIQVQHQSpvalangvpppgavglpapQSAAGAGNQLSTTSLYVGDLDPTVTDSQLYD  672
            MAQIQVQHQ+PV                       G Q   TSLYVGDL+P+VTDSQLYD
Sbjct  1    MAQIQVQHQAPVVAP--------------NGVPAGGGQYVPTSLYVGDLEPSVTDSQLYD  46

Query  673  LFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQDAARAMEVLNFTPVNSKSIR  834
            LFNQVGQVVSVRVCRD+++RRSLGYGYVNYS+PQDAARA++VLNFTP+N+K IR
Sbjct  47   LFNQVGQVVSVRVCRDLTTRRSLGYGYVNYSNPQDAARALDVLNFTPLNNKPIR  100



>gb|KDO84107.1| hypothetical protein CISIN_1g006282mg [Citrus sinensis]
Length=652

 Score =   148 bits (373),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 77/114 (68%), Positives = 92/114 (81%), Gaps = 12/114 (11%)
 Frame = +1

Query  493  MAQIQVQHQSpvalangvpppgavglpapQSAAGAGNQLSTTSLYVGDLDPTVTDSQLYD  672
            MAQIQVQHQ+ ++  NGV            +A  +GNQ  TTSLYVGDLD  VTDSQLYD
Sbjct  1    MAQIQVQHQAQMSGPNGV------------AAGASGNQFLTTSLYVGDLDFNVTDSQLYD  48

Query  673  LFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQDAARAMEVLNFTPVNSKSIR  834
            LF+QVGQV+SVRVCRD+S+RRSLGYGYVNY++P DAARA++VLNFTP+N+KSIR
Sbjct  49   LFSQVGQVLSVRVCRDLSTRRSLGYGYVNYANPADAARALDVLNFTPLNNKSIR  102


 Score = 52.4 bits (124),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 25/77 (32%), Positives = 48/77 (62%), Gaps = 1/77 (1%)
 Frame = +1

Query  601  NQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQDA  780
            ++    +LY+ +L  ++ D +L +LF++ G + S +V RD S   S G G+V +S+P++A
Sbjct  307  DKFQGLNLYIKNLGDSIDDEKLKELFSEFGTITSCKVMRDPSG-ISKGSGFVAFSTPEEA  365

Query  781  ARAMEVLNFTPVNSKSI  831
            +RA+  +N   + SK +
Sbjct  366  SRALAEMNGKMIVSKPL  382



>ref|XP_006434727.1| hypothetical protein CICLE_v10000537mg [Citrus clementina]
 gb|ESR47967.1| hypothetical protein CICLE_v10000537mg [Citrus clementina]
Length=651

 Score =   148 bits (373),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 77/114 (68%), Positives = 92/114 (81%), Gaps = 12/114 (11%)
 Frame = +1

Query  493  MAQIQVQHQSpvalangvpppgavglpapQSAAGAGNQLSTTSLYVGDLDPTVTDSQLYD  672
            MAQIQVQHQ+ ++  NGV            +A  +GNQ  TTSLYVGDLD  VTDSQLYD
Sbjct  1    MAQIQVQHQAQMSGPNGV------------AAGASGNQFLTTSLYVGDLDFNVTDSQLYD  48

Query  673  LFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQDAARAMEVLNFTPVNSKSIR  834
            LF+QVGQV+SVRVCRD+S+RRSLGYGYVNY++P DAARA++VLNFTP+N+KSIR
Sbjct  49   LFSQVGQVLSVRVCRDLSTRRSLGYGYVNYANPADAARALDVLNFTPLNNKSIR  102


 Score = 52.4 bits (124),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 25/77 (32%), Positives = 48/77 (62%), Gaps = 1/77 (1%)
 Frame = +1

Query  601  NQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQDA  780
            ++    +LY+ +L  ++ D +L +LF++ G + S +V RD S   S G G+V +S+P++A
Sbjct  307  DKFQGLNLYIKNLGDSIDDEKLKELFSEFGTITSCKVMRDPSG-ISKGSGFVAFSTPEEA  365

Query  781  ARAMEVLNFTPVNSKSI  831
            +RA+  +N   + SK +
Sbjct  366  SRALAEMNGKMIVSKPL  382



>ref|XP_006473293.1| PREDICTED: polyadenylate-binding protein 8-like [Citrus sinensis]
Length=652

 Score =   148 bits (373),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 77/114 (68%), Positives = 92/114 (81%), Gaps = 12/114 (11%)
 Frame = +1

Query  493  MAQIQVQHQSpvalangvpppgavglpapQSAAGAGNQLSTTSLYVGDLDPTVTDSQLYD  672
            MAQIQVQHQ+ ++  NGV            +A  +GNQ  TTSLYVGDLD  VTDSQLYD
Sbjct  1    MAQIQVQHQAQMSGPNGV------------AAGASGNQFLTTSLYVGDLDFNVTDSQLYD  48

Query  673  LFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQDAARAMEVLNFTPVNSKSIR  834
            LF+QVGQV+SVRVCRD+S+RRSLGYGYVNY++P DAARA++VLNFTP+N+KSIR
Sbjct  49   LFSQVGQVLSVRVCRDLSTRRSLGYGYVNYANPADAARALDVLNFTPLNNKSIR  102


 Score = 52.0 bits (123),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 25/77 (32%), Positives = 48/77 (62%), Gaps = 1/77 (1%)
 Frame = +1

Query  601  NQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQDA  780
            ++    +LY+ +L  ++ D +L +LF++ G + S +V RD S   S G G+V +S+P++A
Sbjct  307  DKFQGLNLYIKNLGDSIDDEKLKELFSEFGTITSCKVMRDPSG-ISKGSGFVAFSTPEEA  365

Query  781  ARAMEVLNFTPVNSKSI  831
            +RA+  +N   + SK +
Sbjct  366  SRALAEMNGKMIVSKPL  382



>ref|XP_004291087.1| PREDICTED: polyadenylate-binding protein 2-like [Fragaria vesca 
subsp. vesca]
Length=631

 Score =   147 bits (372),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 79/114 (69%), Positives = 89/114 (78%), Gaps = 13/114 (11%)
 Frame = +1

Query  493  MAQIQVQHQSpvalangvpppgavglpapQSAAGAGNQLSTTSLYVGDLDPTVTDSQLYD  672
            MAQIQVQHQ+PV   N                 GA  Q+ +TSLYVGDLD  VTDSQLYD
Sbjct  1    MAQIQVQHQAPVTGPN-------------GGGGGAQQQMVSTSLYVGDLDLNVTDSQLYD  47

Query  673  LFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQDAARAMEVLNFTPVNSKSIR  834
            LFNQ+GQVVSVRVCRD+S+RRSLGYGYVNYS+PQDAARA+EVLNFTP+N+KSIR
Sbjct  48   LFNQIGQVVSVRVCRDLSTRRSLGYGYVNYSNPQDAARALEVLNFTPLNNKSIR  101


 Score = 54.7 bits (130),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 27/75 (36%), Positives = 45/75 (60%), Gaps = 1/75 (1%)
 Frame = +1

Query  580  QSAAGAGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVN  759
            Q   GA ++   +++YV ++    TD  L  +F + G + S  V RD    +S G+G+VN
Sbjct  196  QERDGALHKTKFSNVYVKNISEGTTDDDLKKIFGEHGPITSAVVMRD-GEGKSRGFGFVN  254

Query  760  YSSPQDAARAMEVLN  804
            + +P DAA+A+E+LN
Sbjct  255  FDNPDDAAKAVELLN  269


 Score = 51.6 bits (122),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 28/84 (33%), Positives = 49/84 (58%), Gaps = 1/84 (1%)
 Frame = +1

Query  580  QSAAGAGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVN  759
             S   A ++    +LY+ +LD ++ D +L +LF++ G V S +V RD     S G G+V 
Sbjct  299  HSMKEASDKFQGVNLYIKNLDDSIDDEKLKELFSEYGTVTSCKVMRDPEG-VSRGSGFVA  357

Query  760  YSSPQDAARAMEVLNFTPVNSKSI  831
            +S+ ++A+RA+  +N   V SK +
Sbjct  358  FSTSEEASRALTEMNGKMVVSKPL  381



>dbj|BAM15222.1| poly(A)-binding protein [Nicotiana tabacum]
Length=657

 Score =   147 bits (372),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 83/114 (73%), Positives = 92/114 (81%), Gaps = 4/114 (4%)
 Frame = +1

Query  493  MAQIQVQHQSpvalangvpppgavglpapQSAAGAGNQLSTTSLYVGDLDPTVTDSQLYD  672
            MAQIQVQHQSPVA  NGV      G  A  +  G    L++TSLYVGDL+  VTDSQLYD
Sbjct  1    MAQIQVQHQSPVAGGNGVVAAAVGGAAAVATPGG----LTSTSLYVGDLEFNVTDSQLYD  56

Query  673  LFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQDAARAMEVLNFTPVNSKSIR  834
            LFNQVGQVVSVRVCRD+S+RRSLGYGYVNYS+P DA+RAME+LNFTPVN KSIR
Sbjct  57   LFNQVGQVVSVRVCRDLSTRRSLGYGYVNYSNPNDASRAMEMLNFTPVNGKSIR  110


 Score = 54.7 bits (130),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 30/84 (36%), Positives = 52/84 (62%), Gaps = 1/84 (1%)
 Frame = +1

Query  580  QSAAGAGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVN  759
            Q+A  A ++    +LYV +LD T+ D +L +LF++ G + S +V RD S   S G G+V 
Sbjct  308  QTAKEAVDKYQGLNLYVKNLDDTIDDEKLKELFSEFGTITSCKVMRDPSG-ISRGSGFVA  366

Query  760  YSSPQDAARAMEVLNFTPVNSKSI  831
            +S+ ++A+RA+  +N   + SK +
Sbjct  367  FSTSEEASRALSEMNGKMIVSKPL  390



>ref|XP_009606599.1| PREDICTED: polyadenylate-binding protein 2-like isoform X2 [Nicotiana 
tomentosiformis]
Length=657

 Score =   147 bits (372),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 83/114 (73%), Positives = 92/114 (81%), Gaps = 4/114 (4%)
 Frame = +1

Query  493  MAQIQVQHQSpvalangvpppgavglpapQSAAGAGNQLSTTSLYVGDLDPTVTDSQLYD  672
            MAQIQVQHQSPVA  NGV      G  A  +  G    L++TSLYVGDL+  VTDSQLYD
Sbjct  1    MAQIQVQHQSPVAGGNGVVAAAVGGAAAVATPGG----LTSTSLYVGDLEFNVTDSQLYD  56

Query  673  LFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQDAARAMEVLNFTPVNSKSIR  834
            LFNQVGQVVSVRVCRD+S+RRSLGYGYVNYS+P DA+RAME+LNFTPVN KSIR
Sbjct  57   LFNQVGQVVSVRVCRDLSTRRSLGYGYVNYSNPNDASRAMEMLNFTPVNGKSIR  110


 Score = 54.7 bits (130),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 30/84 (36%), Positives = 52/84 (62%), Gaps = 1/84 (1%)
 Frame = +1

Query  580  QSAAGAGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVN  759
            Q+A  A ++    +LYV +LD T+ D +L +LF++ G + S +V RD S   S G G+V 
Sbjct  308  QTAKEAVDKYQGLNLYVKNLDDTIDDEKLKELFSEFGTITSCKVMRDPSG-ISRGSGFVA  366

Query  760  YSSPQDAARAMEVLNFTPVNSKSI  831
            +S+ ++A+RA+  +N   + SK +
Sbjct  367  FSTSEEASRALSEMNGKMIVSKPL  390



>ref|XP_009606598.1| PREDICTED: polyadenylate-binding protein 2-like isoform X1 [Nicotiana 
tomentosiformis]
Length=660

 Score =   147 bits (371),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 83/114 (73%), Positives = 92/114 (81%), Gaps = 4/114 (4%)
 Frame = +1

Query  493  MAQIQVQHQSpvalangvpppgavglpapQSAAGAGNQLSTTSLYVGDLDPTVTDSQLYD  672
            MAQIQVQHQSPVA  NGV      G  A  +  G    L++TSLYVGDL+  VTDSQLYD
Sbjct  1    MAQIQVQHQSPVAGGNGVVAAAVGGAAAVATPGG----LTSTSLYVGDLEFNVTDSQLYD  56

Query  673  LFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQDAARAMEVLNFTPVNSKSIR  834
            LFNQVGQVVSVRVCRD+S+RRSLGYGYVNYS+P DA+RAME+LNFTPVN KSIR
Sbjct  57   LFNQVGQVVSVRVCRDLSTRRSLGYGYVNYSNPNDASRAMEMLNFTPVNGKSIR  110


 Score = 54.7 bits (130),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 30/84 (36%), Positives = 52/84 (62%), Gaps = 1/84 (1%)
 Frame = +1

Query  580  QSAAGAGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVN  759
            Q+A  A ++    +LYV +LD T+ D +L +LF++ G + S +V RD S   S G G+V 
Sbjct  308  QTAKEAVDKYQGLNLYVKNLDDTIDDEKLKELFSEFGTITSCKVMRDPSG-ISRGSGFVA  366

Query  760  YSSPQDAARAMEVLNFTPVNSKSI  831
            +S+ ++A+RA+  +N   + SK +
Sbjct  367  FSTSEEASRALSEMNGKMIVSKPL  390



>ref|XP_009359888.1| PREDICTED: polyadenylate-binding protein 2-like [Pyrus x bretschneideri]
 ref|XP_009359896.1| PREDICTED: polyadenylate-binding protein 2-like [Pyrus x bretschneideri]
Length=650

 Score =   146 bits (369),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 69/84 (82%), Positives = 76/84 (90%), Gaps = 0/84 (0%)
 Frame = +1

Query  583  SAAGAGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNY  762
            +A GA  Q  +TSLYVGDLD  VTDSQLYDLFNQVGQVVSVRVCRD+S+RRSLGYGYVNY
Sbjct  24   NAGGAPPQFVSTSLYVGDLDQNVTDSQLYDLFNQVGQVVSVRVCRDLSTRRSLGYGYVNY  83

Query  763  SSPQDAARAMEVLNFTPVNSKSIR  834
            S PQDAARA+EVLNFTP+N+KSIR
Sbjct  84   SGPQDAARALEVLNFTPLNNKSIR  107


 Score = 53.9 bits (128),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 29/84 (35%), Positives = 51/84 (61%), Gaps = 1/84 (1%)
 Frame = +1

Query  580  QSAAGAGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVN  759
            QS   A ++    +LY+ +LD +++D +L +LF++ G V S +V RD     S G G+V 
Sbjct  305  QSMKEASDKFQGVNLYIKNLDDSISDEKLKELFSEYGTVSSCKVMRDPDG-NSRGSGFVA  363

Query  760  YSSPQDAARAMEVLNFTPVNSKSI  831
            +S+ ++A+RA+  +N   V SK +
Sbjct  364  FSTAEEASRALAEMNGKMVVSKPL  387


 Score = 52.8 bits (125),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 27/83 (33%), Positives = 46/83 (55%), Gaps = 1/83 (1%)
 Frame = +1

Query  580  QSAAGAGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVN  759
            Q   G  N+    ++YV ++  + T+ +L  +F + GQ+ SV V RD    +S  +G+VN
Sbjct  202  QERDGNWNKTKFNNVYVKNISESTTEDELRKIFGEHGQITSVVVMRD-GEGKSRCFGFVN  260

Query  760  YSSPQDAARAMEVLNFTPVNSKS  828
            +  P+ AA A+E LN   ++ K 
Sbjct  261  FEDPEAAATAVEALNGKKIDEKE  283



>ref|XP_011074396.1| PREDICTED: polyadenylate-binding protein 8-like [Sesamum indicum]
Length=654

 Score =   146 bits (368),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 79/114 (69%), Positives = 89/114 (78%), Gaps = 6/114 (5%)
 Frame = +1

Query  493  MAQIQVQHQSpvalangvpppgavglpapQSAAGAGNQLSTTSLYVGDLDPTVTDSQLYD  672
            MAQIQVQHQ+  A         +       +AA A  Q  +TSLYVGDLD  VTDSQLYD
Sbjct  1    MAQIQVQHQNVAAAGPNGVAAPS------GAAAAAAGQFMSTSLYVGDLDLNVTDSQLYD  54

Query  673  LFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQDAARAMEVLNFTPVNSKSIR  834
            LFNQVGQVVSVRVCRD+S+RRSLGYGYVNYS+PQDAARA+EVLNFTP+N+KSIR
Sbjct  55   LFNQVGQVVSVRVCRDLSTRRSLGYGYVNYSNPQDAARALEVLNFTPLNNKSIR  108


 Score = 57.8 bits (138),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 30/84 (36%), Positives = 52/84 (62%), Gaps = 1/84 (1%)
 Frame = +1

Query  580  QSAAGAGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVN  759
            Q+A  A ++    +LY+ +LD ++ D +L +LF + G + S +V RD S   S G G+V 
Sbjct  306  QTAREAVDKFQGLNLYIKNLDDSIDDDKLKELFTEFGNITSCKVMRDPSG-ISRGSGFVA  364

Query  760  YSSPQDAARAMEVLNFTPVNSKSI  831
            +S+P++A+RA+  +N   V SK +
Sbjct  365  FSTPEEASRALSEMNGKMVVSKPL  388



>ref|XP_008378021.1| PREDICTED: polyadenylate-binding protein 2-like [Malus domestica]
Length=648

 Score =   146 bits (368),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 68/84 (81%), Positives = 76/84 (90%), Gaps = 0/84 (0%)
 Frame = +1

Query  583  SAAGAGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNY  762
            +A G   Q  +TSLYVGDLD  VTDSQLYDLFNQVGQVVSVRVCRD+S+RRSLGYGYVNY
Sbjct  23   NAGGGAPQFVSTSLYVGDLDQNVTDSQLYDLFNQVGQVVSVRVCRDLSTRRSLGYGYVNY  82

Query  763  SSPQDAARAMEVLNFTPVNSKSIR  834
            S+PQDAARA+EVLNFTP+N+KSIR
Sbjct  83   SAPQDAARALEVLNFTPLNNKSIR  106


 Score = 51.6 bits (122),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 26/83 (31%), Positives = 47/83 (57%), Gaps = 1/83 (1%)
 Frame = +1

Query  580  QSAAGAGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVN  759
            Q   G  N+    ++YV ++  + T+ +L  +F + GQ+ SV V RD    +S  +G+VN
Sbjct  201  QERDGNFNKTKFNNVYVKNISESTTEDELNKIFGEHGQITSVVVMRD-GEGKSRCFGFVN  259

Query  760  YSSPQDAARAMEVLNFTPVNSKS  828
            +  P+ AA+A++ LN   ++ K 
Sbjct  260  FEDPEAAAKAVDALNGXKIDEKE  282



>ref|XP_011074395.1| PREDICTED: polyadenylate-binding protein 8-like [Sesamum indicum]
Length=654

 Score =   146 bits (368),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 79/114 (69%), Positives = 88/114 (77%), Gaps = 6/114 (5%)
 Frame = +1

Query  493  MAQIQVQHQSpvalangvpppgavglpapQSAAGAGNQLSTTSLYVGDLDPTVTDSQLYD  672
            MAQIQVQHQ+  A                 +AA A  Q  +TSLYVGDLD  VTDSQLYD
Sbjct  1    MAQIQVQHQNVAAAGPNGVAAPG------GAAAAAAGQFMSTSLYVGDLDLNVTDSQLYD  54

Query  673  LFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQDAARAMEVLNFTPVNSKSIR  834
            LFNQVGQVVSVRVCRD+S+RRSLGYGYVNYS+PQDAARA+EVLNFTP+N+KSIR
Sbjct  55   LFNQVGQVVSVRVCRDLSTRRSLGYGYVNYSNPQDAARALEVLNFTPLNNKSIR  108


 Score = 57.4 bits (137),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 30/84 (36%), Positives = 52/84 (62%), Gaps = 1/84 (1%)
 Frame = +1

Query  580  QSAAGAGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVN  759
            Q+A  A ++    +LY+ +LD ++ D +L +LF + G + S +V RD S   S G G+V 
Sbjct  306  QTAREAIDKFQGLNLYIKNLDDSIDDDKLKELFTEFGTITSCKVMRDPSG-ISRGSGFVA  364

Query  760  YSSPQDAARAMEVLNFTPVNSKSI  831
            +S+P++A+RA+  +N   V SK +
Sbjct  365  FSTPEEASRALSEMNGKMVVSKPL  388



>gb|KHN12798.1| Polyadenylate-binding protein 2 [Glycine soja]
Length=654

 Score =   145 bits (367),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 77/114 (68%), Positives = 90/114 (79%), Gaps = 7/114 (6%)
 Frame = +1

Query  493  MAQIQVQHQSpvalangvpppgavglpapQSAAGAGNQLSTTSLYVGDLDPTVTDSQLYD  672
            MA+IQVQHQSPV+ A       A       +A    NQ  TTSLYVGDLD  V DSQLYD
Sbjct  1    MAEIQVQHQSPVSAAPPPNGGVA-------NAPNNANQFVTTSLYVGDLDQNVNDSQLYD  53

Query  673  LFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQDAARAMEVLNFTPVNSKSIR  834
            LFNQVGQVVSVRVCRD+++RRSLGYGYVN+S+PQDAARA++VLNFTP+N++SIR
Sbjct  54   LFNQVGQVVSVRVCRDLTTRRSLGYGYVNFSNPQDAARALDVLNFTPLNNRSIR  107


 Score = 53.5 bits (127),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/75 (35%), Positives = 47/75 (63%), Gaps = 1/75 (1%)
 Frame = +1

Query  580  QSAAGAGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVN  759
            QS   A ++    +LY+ +LD T++D +L ++F + G + S +V RD +   S G G+V 
Sbjct  305  QSIKEAADKYPGLNLYLKNLDDTISDEKLKEMFAEYGTITSCKVMRDPTGI-SRGSGFVA  363

Query  760  YSSPQDAARAMEVLN  804
            +S+P++A RA+  +N
Sbjct  364  FSTPEEATRALGEMN  378



>ref|XP_003550332.1| PREDICTED: polyadenylate-binding protein 8-like [Glycine max]
Length=654

 Score =   145 bits (367),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 77/114 (68%), Positives = 90/114 (79%), Gaps = 7/114 (6%)
 Frame = +1

Query  493  MAQIQVQHQSpvalangvpppgavglpapQSAAGAGNQLSTTSLYVGDLDPTVTDSQLYD  672
            MA+IQVQHQSPV+ A       A       +A    NQ  TTSLYVGDLD  V DSQLYD
Sbjct  1    MAEIQVQHQSPVSAAPPPNGGVA-------NAPNNANQFVTTSLYVGDLDQNVNDSQLYD  53

Query  673  LFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQDAARAMEVLNFTPVNSKSIR  834
            LFNQVGQVVSVRVCRD+++RRSLGYGYVN+S+PQDAARA++VLNFTP+N++SIR
Sbjct  54   LFNQVGQVVSVRVCRDLTTRRSLGYGYVNFSNPQDAARALDVLNFTPLNNRSIR  107


 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/75 (35%), Positives = 46/75 (61%), Gaps = 1/75 (1%)
 Frame = +1

Query  580  QSAAGAGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVN  759
            QS   A ++    +LY+ +LD T++D +L ++F   G + S +V RD +   S G G+V 
Sbjct  305  QSIKEAADKYPGLNLYLKNLDDTISDEKLKEMFADYGTITSCKVMRDPTGI-SRGSGFVA  363

Query  760  YSSPQDAARAMEVLN  804
            +S+P++A RA+  +N
Sbjct  364  FSTPEEATRALGEMN  378



>ref|XP_006342637.1| PREDICTED: polyadenylate-binding protein 8-like [Solanum tuberosum]
Length=665

 Score =   145 bits (367),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 84/117 (72%), Positives = 92/117 (79%), Gaps = 3/117 (3%)
 Frame = +1

Query  493  MAQIQVQHQSpvalangvpppgavglpapQSAAGA---GNQLSTTSLYVGDLDPTVTDSQ  663
            MAQIQVQHQ+PVA  NGV    A    A   AA      NQ ++TSLYVGDLD  +TDSQ
Sbjct  1    MAQIQVQHQTPVAGGNGVAVAAAAAGAAAAVAAPGGGVSNQFTSTSLYVGDLDFNITDSQ  60

Query  664  LYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQDAARAMEVLNFTPVNSKSIR  834
            LYDLFN VGQVVSVRVCRD+S+RRSLGYGYVNYS+P DAARAME+LNFTPVN KSIR
Sbjct  61   LYDLFNHVGQVVSVRVCRDLSTRRSLGYGYVNYSNPSDAARAMELLNFTPVNGKSIR  117


 Score = 58.2 bits (139),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 31/84 (37%), Positives = 52/84 (62%), Gaps = 1/84 (1%)
 Frame = +1

Query  580  QSAAGAGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVN  759
            Q+A  A ++    +LYV +LD T+ D +L +LF + G + S +V RD S   S G G+V 
Sbjct  315  QTAKEAVDKYQGVNLYVKNLDDTIDDEKLKELFAEFGTITSCKVMRDPSG-ISRGSGFVA  373

Query  760  YSSPQDAARAMEVLNFTPVNSKSI  831
            +S+P++A+RA+  +N   + SK +
Sbjct  374  FSTPEEASRALSEMNGKMIVSKPL  397


 Score = 52.0 bits (123),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 25/74 (34%), Positives = 42/74 (57%), Gaps = 1/74 (1%)
 Frame = +1

Query  607  LSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQDAAR  786
            +   ++YV +L  + TD +L ++F + G + S  V RD   + S G+G+VN+    DAA+
Sbjct  221  IKFNNVYVKNLAESATDDELKNVFGEFGSITSAVVMRDADGK-SKGFGFVNFEDADDAAK  279

Query  787  AMEVLNFTPVNSKS  828
            A+E LN    + K 
Sbjct  280  AVEALNGKKFDEKE  293



>ref|XP_012068315.1| PREDICTED: polyadenylate-binding protein 2-like [Jatropha curcas]
Length=653

 Score =   145 bits (366),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 75/114 (66%), Positives = 84/114 (74%), Gaps = 11/114 (10%)
 Frame = +1

Query  493  MAQIQVQHQSpvalangvpppgavglpapQSAAGAGNQLSTTSLYVGDLDPTVTDSQLYD  672
            MAQIQVQHQ+                    +A  AG     TSLYVGDLD  VTDSQLYD
Sbjct  1    MAQIQVQHQAAPVPGPNGV-----------AATQAGIPFMPTSLYVGDLDLNVTDSQLYD  49

Query  673  LFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQDAARAMEVLNFTPVNSKSIR  834
            LFNQVGQVVSVRVCRD+S+RRSLGYGYVNYS+PQDAARA++VLNFTP+N+K IR
Sbjct  50   LFNQVGQVVSVRVCRDLSTRRSLGYGYVNYSNPQDAARALDVLNFTPLNNKPIR  103


 Score = 56.2 bits (134),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 30/84 (36%), Positives = 51/84 (61%), Gaps = 1/84 (1%)
 Frame = +1

Query  580  QSAAGAGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVN  759
            QS   A ++    +LY+ +LD ++ D +L +LF+  G + S +V RD S   S G G+V 
Sbjct  301  QSMKEAVDKFQGVNLYIKNLDDSINDEKLKELFSDFGTITSCKVMRDPSG-ISRGSGFVA  359

Query  760  YSSPQDAARAMEVLNFTPVNSKSI  831
            +S+P++A+RA+  +N   V SK +
Sbjct  360  FSNPEEASRALAEMNGKMVVSKPL  383


 Score = 52.4 bits (124),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 29/83 (35%), Positives = 44/83 (53%), Gaps = 1/83 (1%)
 Frame = +1

Query  580  QSAAGAGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVN  759
            Q    A N+    ++YV +L  + TD  L + F + G + S  V RD   + S G+G+VN
Sbjct  198  QERETAFNKTKFNNVYVKNLSESTTDEDLKNTFGEYGAITSAVVMRDADGK-SKGFGFVN  256

Query  760  YSSPQDAARAMEVLNFTPVNSKS  828
            + +  DAARA+E LN    + K 
Sbjct  257  FENADDAARAVESLNGKKFDDKE  279



>emb|CAN72942.1| hypothetical protein VITISV_011270 [Vitis vinifera]
Length=185

 Score =   136 bits (343),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 73/116 (63%), Positives = 84/116 (72%), Gaps = 15/116 (13%)
 Frame = +1

Query  490  IMAQIQVQHQSpvalangvpppgavglpapQSAAGAG-NQLSTTSLYVGDLDPTVTDSQL  666
            + AQ+QVQ Q P                   SAAGAG NQ  TTSLYVGDL+  V D QL
Sbjct  1    MAAQVQVQPQGPGPAP--------------NSAAGAGGNQFVTTSLYVGDLELNVNDPQL  46

Query  667  YDLFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQDAARAMEVLNFTPVNSKSIR  834
            YDLFNQ+G VVSVRVCRD+S+RRSLGYGYVNYS+PQDAARA++VLNFTP+N K +R
Sbjct  47   YDLFNQMGAVVSVRVCRDLSTRRSLGYGYVNYSNPQDAARALDVLNFTPLNGKPLR  102



>ref|XP_004252758.1| PREDICTED: polyadenylate-binding protein 2-like [Solanum lycopersicum]
Length=666

 Score =   143 bits (361),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 84/117 (72%), Positives = 93/117 (79%), Gaps = 3/117 (3%)
 Frame = +1

Query  493  MAQIQVQHQSpvalangvpppgavglpapQSAAGAG---NQLSTTSLYVGDLDPTVTDSQ  663
            MAQIQVQHQ+PVA  NGV    A    A   AA  G   +Q ++TSLYVGDLD  +TDSQ
Sbjct  1    MAQIQVQHQTPVAGGNGVAVAAAAAGAAAAVAAPGGGATSQFTSTSLYVGDLDFNITDSQ  60

Query  664  LYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQDAARAMEVLNFTPVNSKSIR  834
            LYDLFN VGQVVSVRVCRD+S+RRSLGYGYVNYS+P DAARAME+LNFTPVN KSIR
Sbjct  61   LYDLFNHVGQVVSVRVCRDLSTRRSLGYGYVNYSNPSDAARAMELLNFTPVNGKSIR  117


 Score = 58.2 bits (139),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 31/84 (37%), Positives = 52/84 (62%), Gaps = 1/84 (1%)
 Frame = +1

Query  580  QSAAGAGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVN  759
            Q+A  A ++    +LYV +LD T+ D +L +LF + G + S +V RD S   S G G+V 
Sbjct  315  QTAKEAVDKYQGVNLYVKNLDDTIDDEKLKELFAEFGTITSCKVMRDPSG-ISRGSGFVA  373

Query  760  YSSPQDAARAMEVLNFTPVNSKSI  831
            +S+P++A+RA+  +N   + SK +
Sbjct  374  FSTPEEASRALSEMNGKMIVSKPL  397


 Score = 52.4 bits (124),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 25/70 (36%), Positives = 42/70 (60%), Gaps = 1/70 (1%)
 Frame = +1

Query  619  SLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQDAARAMEV  798
            ++YV +L  + TD +L ++F + G + S  V RD   + S G+G+VN+ +  DAA+A+E 
Sbjct  225  NVYVKNLAESATDDELKNVFGEFGTITSAVVMRDADGK-SKGFGFVNFENADDAAKAVEA  283

Query  799  LNFTPVNSKS  828
            LN    + K 
Sbjct  284  LNGKKFDEKE  293



>gb|EPS70556.1| hypothetical protein M569_04204, partial [Genlisea aurea]
Length=132

 Score =   134 bits (336),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 63/77 (82%), Positives = 73/77 (95%), Gaps = 0/77 (0%)
 Frame = +1

Query  604  QLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQDAA  783
            Q  TTSLYVGDLD +VTDSQL DLF+QVGQVVSVRVCRD+S+RRSLGYGYVNY++PQDAA
Sbjct  35   QFMTTSLYVGDLDFSVTDSQLADLFSQVGQVVSVRVCRDLSTRRSLGYGYVNYANPQDAA  94

Query  784  RAMEVLNFTPVNSKSIR  834
            RA+EVLNFTP+++KSIR
Sbjct  95   RALEVLNFTPLSNKSIR  111



>ref|XP_007160868.1| hypothetical protein PHAVU_001G023500g [Phaseolus vulgaris]
 gb|ESW32862.1| hypothetical protein PHAVU_001G023500g [Phaseolus vulgaris]
Length=651

 Score =   142 bits (359),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 77/115 (67%), Positives = 87/115 (76%), Gaps = 12/115 (10%)
 Frame = +1

Query  493  MAQIQVQ-HQSpvalangvpppgavglpapQSAAGAGNQLSTTSLYVGDLDPTVTDSQLY  669
            MAQIQ Q HQSPV+                 + A   NQ  TTSLYVGDLD  V DSQLY
Sbjct  1    MAQIQAQQHQSPVSAPPNGV-----------APAPNANQFVTTSLYVGDLDQNVNDSQLY  49

Query  670  DLFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQDAARAMEVLNFTPVNSKSIR  834
            DLFNQVGQVVSVRVCRD+++RRSLGYGYVNYS+PQDAARA++VLNFTP+N+KSIR
Sbjct  50   DLFNQVGQVVSVRVCRDLTTRRSLGYGYVNYSNPQDAARALDVLNFTPLNNKSIR  104


 Score = 54.3 bits (129),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 28/84 (33%), Positives = 50/84 (60%), Gaps = 1/84 (1%)
 Frame = +1

Query  580  QSAAGAGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVN  759
            QS   A ++    +LY+ +LD T++D  L D+F + G + S +V RD +   S G G+V 
Sbjct  302  QSIKEAADKFQGVNLYLKNLDDTLSDENLRDMFAEYGTISSYKVMRDPNG-ISRGSGFVA  360

Query  760  YSSPQDAARAMEVLNFTPVNSKSI  831
            +S+P++A+RA+  +N   +  K +
Sbjct  361  FSTPEEASRALAEMNGKMIAGKPL  384


 Score = 51.6 bits (122),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 29/79 (37%), Positives = 43/79 (54%), Gaps = 4/79 (5%)
 Frame = +1

Query  601  NQLSTTSL---YVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSP  771
            N LS T     YV +L  + TD +L  +F + G + S  V RD   + S  +G+VN+ +P
Sbjct  203  NALSKTKFNNVYVKNLSDSTTDEELKKVFGEYGTITSAVVMRDADGK-SKCFGFVNFENP  261

Query  772  QDAARAMEVLNFTPVNSKS  828
             DAA+A+E LN    + K 
Sbjct  262  DDAAKAVEGLNGKKFDEKE  280



>ref|XP_003589160.1| Polyadenylate-binding protein [Medicago truncatula]
 gb|AES59411.1| polyadenylate-binding protein [Medicago truncatula]
Length=647

 Score =   142 bits (358),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 72/114 (63%), Positives = 85/114 (75%), Gaps = 10/114 (9%)
 Frame = +1

Query  493  MAQIQVQHQSpvalangvpppgavglpapQSAAGAGNQLSTTSLYVGDLDPTVTDSQLYD  672
            MAQIQVQHQ+P  +                      NQ  TTSLYVGDL+  V DSQLYD
Sbjct  1    MAQIQVQHQTPAPVPAPSNGV----------VPNVANQFVTTSLYVGDLEVNVNDSQLYD  50

Query  673  LFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQDAARAMEVLNFTPVNSKSIR  834
            LFNQVGQVVSVRVCRD+++RRSLGYGYVN+++PQDAARA++VLNFTP+N+KSIR
Sbjct  51   LFNQVGQVVSVRVCRDLATRRSLGYGYVNFTNPQDAARALDVLNFTPMNNKSIR  104


 Score = 53.1 bits (126),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/77 (31%), Positives = 50/77 (65%), Gaps = 1/77 (1%)
 Frame = +1

Query  601  NQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQDA  780
            ++    +LY+ +LD ++TD +L ++F++ G + S ++ RD +   S G G+V +S+P++A
Sbjct  310  DKFQGLNLYLKNLDDSITDEKLKEMFSEFGTITSYKIMRDPNG-VSRGSGFVAFSTPEEA  368

Query  781  ARAMEVLNFTPVNSKSI  831
            +RA+  +N   + SK +
Sbjct  369  SRALGEMNGKMIVSKPL  385



>ref|XP_009782956.1| PREDICTED: polyadenylate-binding protein 2-like isoform X2 [Nicotiana 
sylvestris]
Length=658

 Score =   142 bits (358),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 86/114 (75%), Positives = 94/114 (82%), Gaps = 3/114 (3%)
 Frame = +1

Query  493  MAQIQVQHQSpvalangvpppgavglpapQSAAGAGNQLSTTSLYVGDLDPTVTDSQLYD  672
            MAQIQVQHQSPVA  NGV    AVG  A  +A      L++TSLYVGDLD  VTDSQLYD
Sbjct  1    MAQIQVQHQSPVAGGNGVAATAAVGGAAAVAAP---GGLASTSLYVGDLDFNVTDSQLYD  57

Query  673  LFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQDAARAMEVLNFTPVNSKSIR  834
            LFNQVGQVVSVRVCRD+S+RRSLGYGYVNYS+P DA+RAME+LNFTPVN KSIR
Sbjct  58   LFNQVGQVVSVRVCRDLSTRRSLGYGYVNYSNPNDASRAMEMLNFTPVNGKSIR  111


 Score = 56.2 bits (134),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 31/84 (37%), Positives = 52/84 (62%), Gaps = 1/84 (1%)
 Frame = +1

Query  580  QSAAGAGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVN  759
            Q+A  A ++    +LYV +LD T+ D +L +LF++ G + S +V RD S   S G G+V 
Sbjct  309  QTAKEAVDKYQGLNLYVKNLDDTIDDEKLKELFSEFGTITSCKVMRDPSG-VSRGSGFVA  367

Query  760  YSSPQDAARAMEVLNFTPVNSKSI  831
            +S+ +DA+RA+  +N   + SK +
Sbjct  368  FSTSEDASRALSEMNGKMIVSKPL  391



>ref|XP_009782955.1| PREDICTED: polyadenylate-binding protein 2-like isoform X1 [Nicotiana 
sylvestris]
Length=661

 Score =   142 bits (358),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 86/114 (75%), Positives = 94/114 (82%), Gaps = 3/114 (3%)
 Frame = +1

Query  493  MAQIQVQHQSpvalangvpppgavglpapQSAAGAGNQLSTTSLYVGDLDPTVTDSQLYD  672
            MAQIQVQHQSPVA  NGV    AVG  A  +A      L++TSLYVGDLD  VTDSQLYD
Sbjct  1    MAQIQVQHQSPVAGGNGVAATAAVGGAAAVAAP---GGLASTSLYVGDLDFNVTDSQLYD  57

Query  673  LFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQDAARAMEVLNFTPVNSKSIR  834
            LFNQVGQVVSVRVCRD+S+RRSLGYGYVNYS+P DA+RAME+LNFTPVN KSIR
Sbjct  58   LFNQVGQVVSVRVCRDLSTRRSLGYGYVNYSNPNDASRAMEMLNFTPVNGKSIR  111


 Score = 56.2 bits (134),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 31/84 (37%), Positives = 52/84 (62%), Gaps = 1/84 (1%)
 Frame = +1

Query  580  QSAAGAGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVN  759
            Q+A  A ++    +LYV +LD T+ D +L +LF++ G + S +V RD S   S G G+V 
Sbjct  309  QTAKEAVDKYQGLNLYVKNLDDTIDDEKLKELFSEFGTITSCKVMRDPSG-VSRGSGFVA  367

Query  760  YSSPQDAARAMEVLNFTPVNSKSI  831
            +S+ +DA+RA+  +N   + SK +
Sbjct  368  FSTSEDASRALSEMNGKMIVSKPL  391



>ref|XP_004499046.1| PREDICTED: polyadenylate-binding protein 2-like isoform X3 [Cicer 
arietinum]
Length=588

 Score =   141 bits (355),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 74/114 (65%), Positives = 86/114 (75%), Gaps = 10/114 (9%)
 Frame = +1

Query  493  MAQIQVQHQSpvalangvpppgavglpapQSAAGAGNQLSTTSLYVGDLDPTVTDSQLYD  672
            MAQ+QVQHQ+P A++                 A       TTSLYVGDLD  V+DSQLYD
Sbjct  1    MAQVQVQHQTPAAVSAPSNGV----------VAAPNPNFVTTSLYVGDLDLNVSDSQLYD  50

Query  673  LFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQDAARAMEVLNFTPVNSKSIR  834
            LFNQVGQVVSVRVCRD++SRRSLGYGYVN+S+PQDAA A+E+LNFTP+NSKSIR
Sbjct  51   LFNQVGQVVSVRVCRDLASRRSLGYGYVNFSNPQDAATALEMLNFTPLNSKSIR  104


 Score = 52.4 bits (124),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/77 (30%), Positives = 50/77 (65%), Gaps = 1/77 (1%)
 Frame = +1

Query  601  NQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQDA  780
            ++    +LY+ +LD +++D +L ++F++ G + S ++ RD +   S G G+V +S+P++A
Sbjct  309  DKFQGVNLYLKNLDDSISDEKLKEMFSEFGTIASYKIMRDPNGV-SRGSGFVAFSTPEEA  367

Query  781  ARAMEVLNFTPVNSKSI  831
            +RA+  +N   + SK +
Sbjct  368  SRALGEMNGKMIASKPL  384



>ref|XP_004499044.1| PREDICTED: polyadenylate-binding protein 2-like isoform X1 [Cicer 
arietinum]
 ref|XP_004499045.1| PREDICTED: polyadenylate-binding protein 2-like isoform X2 [Cicer 
arietinum]
Length=648

 Score =   141 bits (356),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 74/114 (65%), Positives = 86/114 (75%), Gaps = 10/114 (9%)
 Frame = +1

Query  493  MAQIQVQHQSpvalangvpppgavglpapQSAAGAGNQLSTTSLYVGDLDPTVTDSQLYD  672
            MAQ+QVQHQ+P A++                 A       TTSLYVGDLD  V+DSQLYD
Sbjct  1    MAQVQVQHQTPAAVSAPSNGV----------VAAPNPNFVTTSLYVGDLDLNVSDSQLYD  50

Query  673  LFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQDAARAMEVLNFTPVNSKSIR  834
            LFNQVGQVVSVRVCRD++SRRSLGYGYVN+S+PQDAA A+E+LNFTP+NSKSIR
Sbjct  51   LFNQVGQVVSVRVCRDLASRRSLGYGYVNFSNPQDAATALEMLNFTPLNSKSIR  104


 Score = 52.4 bits (124),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/77 (30%), Positives = 50/77 (65%), Gaps = 1/77 (1%)
 Frame = +1

Query  601  NQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQDA  780
            ++    +LY+ +LD +++D +L ++F++ G + S ++ RD +   S G G+V +S+P++A
Sbjct  309  DKFQGVNLYLKNLDDSISDEKLKEMFSEFGTIASYKIMRDPNGV-SRGSGFVAFSTPEEA  367

Query  781  ARAMEVLNFTPVNSKSI  831
            +RA+  +N   + SK +
Sbjct  368  SRALGEMNGKMIASKPL  384



>ref|XP_004505404.1| PREDICTED: polyadenylate-binding protein 2-like [Cicer arietinum]
Length=585

 Score =   140 bits (353),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 65/78 (83%), Positives = 73/78 (94%), Gaps = 0/78 (0%)
 Frame = +1

Query  601  NQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQDA  780
            NQ  TTSLYVGDLDP VTDSQLYDLFNQVGQVVSVRVCRD++SRRSLGYGYVNYS+PQDA
Sbjct  34   NQFVTTSLYVGDLDPNVTDSQLYDLFNQVGQVVSVRVCRDLTSRRSLGYGYVNYSNPQDA  93

Query  781  ARAMEVLNFTPVNSKSIR  834
            ARA++VLNFTP+ ++ IR
Sbjct  94   ARALDVLNFTPLINRPIR  111


 Score = 55.1 bits (131),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 30/84 (36%), Positives = 52/84 (62%), Gaps = 1/84 (1%)
 Frame = +1

Query  580  QSAAGAGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVN  759
            QS   A ++    +LYV +LD +++D +L +LF+  G + S +V RD +   S G G+V 
Sbjct  309  QSMKEAADKYQGANLYVKNLDDSISDEKLKELFSTFGAITSCKVMRDPNG-ISRGSGFVA  367

Query  760  YSSPQDAARAMEVLNFTPVNSKSI  831
            +S+P++A+RA+  +N   V SK +
Sbjct  368  FSTPEEASRALMDMNGKMVVSKPL  391



>ref|XP_006357465.1| PREDICTED: polyadenylate-binding protein 8-like [Solanum tuberosum]
Length=306

 Score =   137 bits (344),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 61/82 (74%), Positives = 70/82 (85%), Gaps = 0/82 (0%)
 Frame = +1

Query  589  AGAGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNYSS  768
             G  NQ   TSLY+GDLD  VTD+QLY LFNQ GQV+SVR+CRD S+RRSLGYG+VNYS+
Sbjct  116  GGVANQFKPTSLYIGDLDINVTDTQLYQLFNQAGQVISVRICRDFSTRRSLGYGFVNYSN  175

Query  769  PQDAARAMEVLNFTPVNSKSIR  834
            PQDAARAME+L+FTPVN KSIR
Sbjct  176  PQDAARAMEMLDFTPVNGKSIR  197



>gb|ACJ85797.1| unknown [Medicago truncatula]
Length=494

 Score =   139 bits (349),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 63/84 (75%), Positives = 77/84 (92%), Gaps = 0/84 (0%)
 Frame = +1

Query  583  SAAGAGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNY  762
            +AA   NQL+TTSLYVGDLD  VTDSQLYDLFNQ+GQVVSVR+CRD++S++SLGYGYVN+
Sbjct  13   AAAPVPNQLTTTSLYVGDLDHDVTDSQLYDLFNQIGQVVSVRICRDLASQQSLGYGYVNF  72

Query  763  SSPQDAARAMEVLNFTPVNSKSIR  834
            S+P DAA+AM+VLNFTP+N+K IR
Sbjct  73   SNPHDAAKAMDVLNFTPLNNKPIR  96


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 29/84 (35%), Positives = 49/84 (58%), Gaps = 1/84 (1%)
 Frame = +1

Query  580  QSAAGAGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVN  759
            QS     ++    +LY+ +LD +VTD +L +LF++ G V S ++ RD     S G G+V 
Sbjct  294  QSMKETVDKFYGANLYLKNLDDSVTDEKLSELFSEFGTVTSCKILRDPQG-ISRGSGFVA  352

Query  760  YSSPQDAARAMEVLNFTPVNSKSI  831
            +S+P++A RA+  +N   V  K +
Sbjct  353  FSTPEEATRALAEMNGKMVAGKPL  376



>ref|XP_003603074.1| Poly(A)-binding protein [Medicago truncatula]
 gb|AES73325.1| polyadenylate-binding protein [Medicago truncatula]
Length=622

 Score =   139 bits (350),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 63/84 (75%), Positives = 77/84 (92%), Gaps = 0/84 (0%)
 Frame = +1

Query  583  SAAGAGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNY  762
            +AA   NQL+TTSLYVGDLD  VTDSQLYDLFNQ+GQVVSVR+CRD++S++SLGYGYVN+
Sbjct  13   AAAPVPNQLTTTSLYVGDLDHDVTDSQLYDLFNQIGQVVSVRICRDLASQQSLGYGYVNF  72

Query  763  SSPQDAARAMEVLNFTPVNSKSIR  834
            S+P DAA+AM+VLNFTP+N+K IR
Sbjct  73   SNPHDAAKAMDVLNFTPLNNKPIR  96


 Score = 53.1 bits (126),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 29/84 (35%), Positives = 49/84 (58%), Gaps = 1/84 (1%)
 Frame = +1

Query  580  QSAAGAGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVN  759
            QS     ++    +LY+ +LD +VTD +L +LF++ G V S ++ RD     S G G+V 
Sbjct  294  QSMKETVDKFYGANLYLKNLDDSVTDEKLSELFSEFGTVTSCKILRDPQG-ISRGSGFVA  352

Query  760  YSSPQDAARAMEVLNFTPVNSKSI  831
            +S+P++A RA+  +N   V  K +
Sbjct  353  FSTPEEATRALAEMNGKMVAGKPL  376



>ref|XP_010028424.1| PREDICTED: polyadenylate-binding protein 2 [Eucalyptus grandis]
 gb|KCW55174.1| hypothetical protein EUGRSUZ_I01129 [Eucalyptus grandis]
Length=646

 Score =   139 bits (350),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 74/115 (64%), Positives = 84/115 (73%), Gaps = 19/115 (17%)
 Frame = +1

Query  493  MAQIQVQHQSpvalangvpppgavglpapQSAAGAG-NQLSTTSLYVGDLDPTVTDSQLY  669
            MAQ+QVQ Q+ +                      AG NQ +TTSLYVGDLD  VTDSQLY
Sbjct  1    MAQVQVQPQNAM------------------PGVNAGPNQYATTSLYVGDLDFNVTDSQLY  42

Query  670  DLFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQDAARAMEVLNFTPVNSKSIR  834
            DLFNQVGQVVSVRVCRD+++RRSLGYGYVNYS+P DAARAME LN+TP+N KSIR
Sbjct  43   DLFNQVGQVVSVRVCRDLTTRRSLGYGYVNYSNPVDAARAMEHLNYTPLNEKSIR  97


 Score = 55.8 bits (133),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 46/71 (65%), Gaps = 1/71 (1%)
 Frame = +1

Query  580  QSAAGAGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVN  759
            QS   A ++L   +LY+ +LD ++ D +L +LF+  G + S +V RD +   S G G+V 
Sbjct  295  QSMKEAADKLQGANLYIKNLDDSIDDEKLKELFSPFGNITSCKVMRDPNG-ISRGSGFVA  353

Query  760  YSSPQDAARAM  792
            +S+P++AARA+
Sbjct  354  FSTPEEAARAL  364



>ref|XP_008364810.1| PREDICTED: polyadenylate-binding protein 8-like [Malus domestica]
Length=652

 Score =   139 bits (350),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 63/77 (82%), Positives = 72/77 (94%), Gaps = 0/77 (0%)
 Frame = +1

Query  604  QLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQDAA  783
            Q  TTSLYVGDLDP VTDSQLYDLFNQ+GQVVSVRVCRD+S+RRSLGYGYVN+++PQDAA
Sbjct  26   QFVTTSLYVGDLDPNVTDSQLYDLFNQLGQVVSVRVCRDLSTRRSLGYGYVNFANPQDAA  85

Query  784  RAMEVLNFTPVNSKSIR  834
            RA++VLNFTPVN + IR
Sbjct  86   RALDVLNFTPVNGRPIR  102


 Score = 55.8 bits (133),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 31/84 (37%), Positives = 50/84 (60%), Gaps = 1/84 (1%)
 Frame = +1

Query  580  QSAAGAGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVN  759
            QS   A ++    +LYV +LD T+ D +L +LF+  G + S +V RD S   S G G+V 
Sbjct  300  QSMKEAADKYQGANLYVKNLDDTIADDKLQELFSPFGTIASCKVMRDPSG-ISRGSGFVA  358

Query  760  YSSPQDAARAMEVLNFTPVNSKSI  831
            +S+P++A RA+  +N   + SK +
Sbjct  359  FSTPEEANRALLEMNGKMIVSKPL  382



>ref|XP_011017176.1| PREDICTED: polyadenylate-binding protein 8-like [Populus euphratica]
Length=651

 Score =   139 bits (350),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 68/84 (81%), Positives = 75/84 (89%), Gaps = 1/84 (1%)
 Frame = +1

Query  586  AAGAGN-QLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNY  762
            AAG G  Q   TSLYVGDLD  VTDSQLYDLFNQVGQVVSVRVCRD+S+RRSLGYGYVNY
Sbjct  20   AAGPGAIQFVPTSLYVGDLDFNVTDSQLYDLFNQVGQVVSVRVCRDLSTRRSLGYGYVNY  79

Query  763  SSPQDAARAMEVLNFTPVNSKSIR  834
            S+PQDAARA++VLNFTP+N+K IR
Sbjct  80   SNPQDAARALDVLNFTPLNNKPIR  103


 Score = 53.5 bits (127),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 28/73 (38%), Positives = 46/73 (63%), Gaps = 1/73 (1%)
 Frame = +1

Query  613  TTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQDAARAM  792
              +LY+ +LD +V D +L +LF+  G + S +V RD S   S G G+V +S+P++A+RA+
Sbjct  311  AVNLYIKNLDDSVNDEKLKELFSDFGTITSCKVMRDPSG-ISRGSGFVAFSTPEEASRAL  369

Query  793  EVLNFTPVNSKSI  831
              +N   V SK +
Sbjct  370  AEMNGKMVVSKPL  382



>gb|EYU36334.1| hypothetical protein MIMGU_mgv1a002624mg [Erythranthe guttata]
Length=653

 Score =   139 bits (349),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 72/114 (63%), Positives = 82/114 (72%), Gaps = 9/114 (8%)
 Frame = +1

Query  493  MAQIQVQHQSpvalangvpppgavglpapQSAAGAGNQLSTTSLYVGDLDPTVTDSQLYD  672
            MAQ+QVQ Q+  A                     A  Q  +TSLYVGDLD +VTDSQLYD
Sbjct  1    MAQMQVQQQNVAAAGPNGASA---------PGGAASGQFLSTSLYVGDLDFSVTDSQLYD  51

Query  673  LFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQDAARAMEVLNFTPVNSKSIR  834
             FNQVGQVVSVRVCRD+S+RRSLGYGYVNYS+PQDAARA+E LNFTP+N+K IR
Sbjct  52   TFNQVGQVVSVRVCRDLSTRRSLGYGYVNYSNPQDAARALEALNFTPLNNKVIR  105


 Score = 51.6 bits (122),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 30/84 (36%), Positives = 49/84 (58%), Gaps = 1/84 (1%)
 Frame = +1

Query  580  QSAAGAGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVN  759
            Q++  A  +    +LYV +LD  + D +L +LF + G + S +V RD S   S G G+V 
Sbjct  303  QTSREAVEKFQGVNLYVKNLDDGIDDEKLKELFAEFGTITSCKVMRDPSG-ISRGSGFVA  361

Query  760  YSSPQDAARAMEVLNFTPVNSKSI  831
            +SS ++A+RA+  +N   V SK +
Sbjct  362  FSSAEEASRALSDMNGKMVVSKPL  385



>ref|XP_003529405.1| PREDICTED: polyadenylate-binding protein 8-like [Glycine max]
 gb|KHN43051.1| Polyadenylate-binding protein 2 [Glycine soja]
Length=651

 Score =   139 bits (349),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 62/77 (81%), Positives = 73/77 (95%), Gaps = 0/77 (0%)
 Frame = +1

Query  604  QLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQDAA  783
            Q  TTSLYVGDLDP VTD+QLYDLFNQ+GQVVSVRVCRD++SRRSLGYGYVN+S+PQDAA
Sbjct  27   QFVTTSLYVGDLDPNVTDAQLYDLFNQLGQVVSVRVCRDLTSRRSLGYGYVNFSNPQDAA  86

Query  784  RAMEVLNFTPVNSKSIR  834
            RA++VLNFTP+N++ IR
Sbjct  87   RALDVLNFTPLNNRPIR  103


 Score = 54.7 bits (130),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 30/84 (36%), Positives = 51/84 (61%), Gaps = 1/84 (1%)
 Frame = +1

Query  580  QSAAGAGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVN  759
            QS   A ++    +LYV +LD ++ D +L +LF+  G + S +V RD +   S G G+V 
Sbjct  301  QSMKEAADKYQGANLYVKNLDDSIGDEKLKELFSPFGTITSCKVMRDPNG-LSRGSGFVA  359

Query  760  YSSPQDAARAMEVLNFTPVNSKSI  831
            +S+P++A+RA+  +N   V SK +
Sbjct  360  FSTPEEASRALLEMNGKMVVSKPL  383



>ref|XP_006574897.1| PREDICTED: polyadenylate-binding protein 8-like [Glycine max]
Length=648

 Score =   139 bits (349),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 62/77 (81%), Positives = 73/77 (95%), Gaps = 0/77 (0%)
 Frame = +1

Query  604  QLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQDAA  783
            Q  TTSLYVGDLDP VTD+QLYDLFNQ+GQVVSVRVCRD++SRRSLGYGYVN+S+PQDAA
Sbjct  24   QFVTTSLYVGDLDPNVTDAQLYDLFNQLGQVVSVRVCRDLTSRRSLGYGYVNFSNPQDAA  83

Query  784  RAMEVLNFTPVNSKSIR  834
            RA++VLNFTP+N++ IR
Sbjct  84   RALDVLNFTPLNNRPIR  100


 Score = 52.0 bits (123),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 30/84 (36%), Positives = 50/84 (60%), Gaps = 1/84 (1%)
 Frame = +1

Query  580  QSAAGAGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVN  759
            QS   A ++    +LYV +LD ++ D +L +LF+  G + S +V RD +   S G G+V 
Sbjct  298  QSMKEAADKYQGANLYVKNLDDSLGDDKLKELFSPFGTITSCKVMRDPNG-ISRGSGFVA  356

Query  760  YSSPQDAARAMEVLNFTPVNSKSI  831
            +S+P +A+RA+  +N   V SK +
Sbjct  357  FSTPDEASRALLEMNGKMVVSKPL  380



>gb|KHN05826.1| Polyadenylate-binding protein 2 [Glycine soja]
Length=648

 Score =   139 bits (349),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 62/77 (81%), Positives = 73/77 (95%), Gaps = 0/77 (0%)
 Frame = +1

Query  604  QLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQDAA  783
            Q  TTSLYVGDLDP VTD+QLYDLFNQ+GQVVSVRVCRD++SRRSLGYGYVN+S+PQDAA
Sbjct  24   QFVTTSLYVGDLDPNVTDAQLYDLFNQLGQVVSVRVCRDLTSRRSLGYGYVNFSNPQDAA  83

Query  784  RAMEVLNFTPVNSKSIR  834
            RA++VLNFTP+N++ IR
Sbjct  84   RALDVLNFTPLNNRPIR  100


 Score = 52.0 bits (123),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 30/84 (36%), Positives = 50/84 (60%), Gaps = 1/84 (1%)
 Frame = +1

Query  580  QSAAGAGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVN  759
            QS   A ++    +LYV +LD ++ D +L +LF+  G + S +V RD +   S G G+V 
Sbjct  298  QSMKEAADKYQGANLYVKNLDDSLGDDKLKELFSPFGTITSCKVMRDPNG-ISRGSGFVA  356

Query  760  YSSPQDAARAMEVLNFTPVNSKSI  831
            +S+P +A+RA+  +N   V SK +
Sbjct  357  FSTPDEASRALLEMNGKMVVSKPL  380



>ref|XP_004140705.1| PREDICTED: polyadenylate-binding protein 8-like [Cucumis sativus]
 gb|KGN57514.1| hypothetical protein Csa_3G202720 [Cucumis sativus]
Length=654

 Score =   139 bits (349),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 65/83 (78%), Positives = 73/83 (88%), Gaps = 0/83 (0%)
 Frame = +1

Query  586  AAGAGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNYS  765
            AA  G    TTSLYVGDLD  VTDSQLYD+FNQVGQVVSVRVCRD+++RRSLGYGYVNYS
Sbjct  19   AANGGANFVTTSLYVGDLDLNVTDSQLYDIFNQVGQVVSVRVCRDLTTRRSLGYGYVNYS  78

Query  766  SPQDAARAMEVLNFTPVNSKSIR  834
            +PQDAARA++VLNFTP+N K IR
Sbjct  79   NPQDAARALDVLNFTPLNGKPIR  101


 Score = 50.8 bits (120),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 28/84 (33%), Positives = 49/84 (58%), Gaps = 1/84 (1%)
 Frame = +1

Query  580  QSAAGAGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVN  759
            Q+   A ++    +LY+ +LD ++ D +L +LF   G + S +V RD +   S G G+V 
Sbjct  299  QTMKEAADKYQGANLYIKNLDDSIGDDKLKELFAPFGTITSCKVMRDPNG-ISRGSGFVA  357

Query  760  YSSPQDAARAMEVLNFTPVNSKSI  831
            +S+P +A+RA+  +N   V SK +
Sbjct  358  FSTPDEASRALVEMNGKMVVSKPL  381



>ref|XP_008456142.1| PREDICTED: polyadenylate-binding protein 2-like isoform X1 [Cucumis 
melo]
Length=654

 Score =   139 bits (349),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 65/83 (78%), Positives = 73/83 (88%), Gaps = 0/83 (0%)
 Frame = +1

Query  586  AAGAGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNYS  765
            AA  G    TTSLYVGDLD  VTDSQLYD+FNQVGQVVSVRVCRD+++RRSLGYGYVNYS
Sbjct  19   AANGGANFVTTSLYVGDLDLNVTDSQLYDIFNQVGQVVSVRVCRDLTTRRSLGYGYVNYS  78

Query  766  SPQDAARAMEVLNFTPVNSKSIR  834
            +PQDAARA++VLNFTP+N K IR
Sbjct  79   NPQDAARALDVLNFTPLNGKPIR  101


 Score = 50.8 bits (120),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 28/84 (33%), Positives = 49/84 (58%), Gaps = 1/84 (1%)
 Frame = +1

Query  580  QSAAGAGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVN  759
            Q+   A ++    +LY+ +LD ++ D +L +LF   G + S +V RD +   S G G+V 
Sbjct  299  QTMKEAADKYQGANLYIKNLDDSIGDDKLKELFAPFGTITSCKVMRDPNG-ISRGSGFVA  357

Query  760  YSSPQDAARAMEVLNFTPVNSKSI  831
            +S+P +A+RA+  +N   V SK +
Sbjct  358  FSTPDEASRALVEMNGKMVVSKPL  381



>emb|CDP01307.1| unnamed protein product [Coffea canephora]
Length=658

 Score =   138 bits (348),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 65/78 (83%), Positives = 71/78 (91%), Gaps = 0/78 (0%)
 Frame = +1

Query  601  NQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQDA  780
            NQ  +TSLYVGDLD  VTDSQLYDLFNQVGQVVSVRVCRD+S+RRSL YGYVNYS+PQDA
Sbjct  38   NQFLSTSLYVGDLDVNVTDSQLYDLFNQVGQVVSVRVCRDLSTRRSLCYGYVNYSNPQDA  97

Query  781  ARAMEVLNFTPVNSKSIR  834
             RAM+VLNFTP+N KSIR
Sbjct  98   TRAMDVLNFTPINGKSIR  115


 Score = 51.2 bits (121),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 28/84 (33%), Positives = 51/84 (61%), Gaps = 1/84 (1%)
 Frame = +1

Query  580  QSAAGAGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVN  759
            Q+A    ++    +LYV +LD ++ D +L +LF+  G + S +V +D S   S G G+V 
Sbjct  313  QTAKEVVDKYQGLNLYVKNLDDSIDDDKLKELFSDFGTITSCKVMQDPSG-ISRGSGFVA  371

Query  760  YSSPQDAARAMEVLNFTPVNSKSI  831
            +++P++A+RA+  +N   V SK +
Sbjct  372  FTTPEEASRALSEMNGKMVISKPL  395



>gb|KDO59775.1| hypothetical protein CISIN_1g010577mg [Citrus sinensis]
Length=399

 Score =   135 bits (341),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 64/88 (73%), Positives = 75/88 (85%), Gaps = 3/88 (3%)
 Frame = +1

Query  580  QSAAGAG---NQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYG  750
            Q+  G G   NQ  TTSLYVGDL+  VTDSQLYDLFNQ+GQVVSVRVCRD+S+RRSLGYG
Sbjct  9    QNVNGGGANANQFGTTSLYVGDLEANVTDSQLYDLFNQMGQVVSVRVCRDLSTRRSLGYG  68

Query  751  YVNYSSPQDAARAMEVLNFTPVNSKSIR  834
            YVN+S+ Q+AARA+E+LNFTP+N K IR
Sbjct  69   YVNFSNAQEAARALEMLNFTPLNGKPIR  96


 Score = 54.3 bits (129),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 29/84 (35%), Positives = 50/84 (60%), Gaps = 1/84 (1%)
 Frame = +1

Query  580  QSAAGAGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVN  759
            Q+   A ++    +LY+ +LD ++ D +L  LF+  G + S +V RD S   S G G+V 
Sbjct  294  QNMKEAADKFQGANLYIKNLDDSIDDEKLKQLFSPFGSITSCKVMRDPSGI-SRGSGFVA  352

Query  760  YSSPQDAARAMEVLNFTPVNSKSI  831
            +S+P++A+RA+  +N   V SK +
Sbjct  353  FSTPEEASRALLEMNGKMVVSKPL  376



>ref|XP_002301171.2| hypothetical protein POPTR_0002s12570g [Populus trichocarpa]
 gb|EEE80444.2| hypothetical protein POPTR_0002s12570g [Populus trichocarpa]
Length=657

 Score =   138 bits (347),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 67/84 (80%), Positives = 75/84 (89%), Gaps = 1/84 (1%)
 Frame = +1

Query  586  AAGAGN-QLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNY  762
            AAG G  Q   TSLYVGDLD  VTDSQLYDLFNQVGQVVSVRVCRD+S+RRSLGYGYVNY
Sbjct  20   AAGPGAIQFVPTSLYVGDLDFNVTDSQLYDLFNQVGQVVSVRVCRDLSTRRSLGYGYVNY  79

Query  763  SSPQDAARAMEVLNFTPVNSKSIR  834
            S+PQDAARA++VLNFTP+N+K +R
Sbjct  80   SNPQDAARALDVLNFTPLNNKPLR  103


 Score = 52.4 bits (124),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 28/73 (38%), Positives = 45/73 (62%), Gaps = 1/73 (1%)
 Frame = +1

Query  613  TTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQDAARAM  792
              +LY+ +LD +V D +L +LF+  G + S +V  D S   S G G+V +S+P++A+RA+
Sbjct  311  AVNLYIKNLDDSVNDEKLKELFSDFGTITSCKVMHDPSG-ISRGSGFVAFSTPEEASRAL  369

Query  793  EVLNFTPVNSKSI  831
              LN   V SK +
Sbjct  370  AELNGKMVVSKPL  382



>ref|XP_006374904.1| hypothetical protein POPTR_0014s02550g [Populus trichocarpa]
 gb|ERP52701.1| hypothetical protein POPTR_0014s02550g [Populus trichocarpa]
Length=651

 Score =   137 bits (346),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 67/84 (80%), Positives = 75/84 (89%), Gaps = 1/84 (1%)
 Frame = +1

Query  586  AAGAGN-QLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNY  762
            AAG G  Q   TSLYVGDLD  VTDSQLYD+FNQVGQVVSVRVCRD+S+RRSLGYGYVNY
Sbjct  20   AAGPGAIQFVPTSLYVGDLDFNVTDSQLYDVFNQVGQVVSVRVCRDLSTRRSLGYGYVNY  79

Query  763  SSPQDAARAMEVLNFTPVNSKSIR  834
            S+PQDAARA++VLNFTP+N+K IR
Sbjct  80   SNPQDAARALDVLNFTPLNNKPIR  103


 Score = 52.8 bits (125),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/84 (33%), Positives = 50/84 (60%), Gaps = 1/84 (1%)
 Frame = +1

Query  580  QSAAGAGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVN  759
            QS     ++    +LY+ +LD ++ D +L +LF+  G + S +V RD S   S G G+V 
Sbjct  301  QSMKETVDKFQGLNLYIKNLDDSINDEKLKELFSDFGAITSCKVMRDPSG-ISRGSGFVA  359

Query  760  YSSPQDAARAMEVLNFTPVNSKSI  831
            +S+P++A+RA+  +N   + SK +
Sbjct  360  FSTPEEASRALAEMNGKMLISKPL  383



>ref|XP_006421220.1| hypothetical protein CICLE_v10006478mg [Citrus clementina]
 gb|ESR34460.1| hypothetical protein CICLE_v10006478mg [Citrus clementina]
Length=152

 Score =   129 bits (325),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 60/85 (71%), Positives = 73/85 (86%), Gaps = 0/85 (0%)
 Frame = +1

Query  580  QSAAGAGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVN  759
            ++A  +GNQL  TSLYVGDLD +V DSQLYDLF+ VGQV+SV +CRD+S+RRSLGY YVN
Sbjct  7    EAAGASGNQLLVTSLYVGDLDFSVIDSQLYDLFSLVGQVMSVTICRDLSTRRSLGYAYVN  66

Query  760  YSSPQDAARAMEVLNFTPVNSKSIR  834
            Y  P DAARA++VLNFTP+N+KSIR
Sbjct  67   YGDPADAARALDVLNFTPLNNKSIR  91



>ref|XP_011029544.1| PREDICTED: polyadenylate-binding protein 2-like [Populus euphratica]
Length=651

 Score =   137 bits (345),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 67/84 (80%), Positives = 75/84 (89%), Gaps = 1/84 (1%)
 Frame = +1

Query  586  AAGAGN-QLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNY  762
            AAG G  Q   TSLYVGDLD  VTDSQLYD+FNQVGQVVSVRVCRD+S+RRSLGYGYVNY
Sbjct  20   AAGPGAIQFVPTSLYVGDLDFNVTDSQLYDVFNQVGQVVSVRVCRDLSTRRSLGYGYVNY  79

Query  763  SSPQDAARAMEVLNFTPVNSKSIR  834
            S+PQDAARA++VLNFTP+N+K IR
Sbjct  80   SNPQDAARALDVLNFTPLNNKPIR  103


 Score = 52.8 bits (125),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/84 (33%), Positives = 50/84 (60%), Gaps = 1/84 (1%)
 Frame = +1

Query  580  QSAAGAGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVN  759
            QS     ++    +LY+ +LD ++ D +L +LF+  G + S +V RD S   S G G+V 
Sbjct  301  QSMKETVDKFQGLNLYIKNLDDSINDEKLKELFSDFGTITSCKVMRDPSG-ISRGSGFVA  359

Query  760  YSSPQDAARAMEVLNFTPVNSKSI  831
            +S+P++A+RA+  +N   + SK +
Sbjct  360  FSTPEEASRALAEMNGKMLISKPL  383



>ref|XP_002300227.1| polyadenylate-binding family protein [Populus trichocarpa]
 gb|EEE85032.1| polyadenylate-binding family protein [Populus trichocarpa]
Length=644

 Score =   137 bits (344),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 66/83 (80%), Positives = 74/83 (89%), Gaps = 1/83 (1%)
 Frame = +1

Query  589  AGAGN-QLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNYS  765
            AGA N    TTSLYVGDL+ +VTDSQLYDLFNQVGQVVSVRVCRD++SRRSLGYGYVNYS
Sbjct  15   AGANNPNFVTTSLYVGDLEASVTDSQLYDLFNQVGQVVSVRVCRDLTSRRSLGYGYVNYS  74

Query  766  SPQDAARAMEVLNFTPVNSKSIR  834
            +PQDAARA+E+LNFTP+N   IR
Sbjct  75   NPQDAARALEMLNFTPLNGSPIR  97


 Score = 54.7 bits (130),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 29/84 (35%), Positives = 51/84 (61%), Gaps = 1/84 (1%)
 Frame = +1

Query  580  QSAAGAGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVN  759
            QS   A ++    +LY+ +LD ++ D +L +LF+  G + S +V RD +   S G G+V 
Sbjct  295  QSMKEAADKFQGANLYIKNLDDSIGDEKLKELFSPFGTITSCKVMRDPNG-ISRGSGFVA  353

Query  760  YSSPQDAARAMEVLNFTPVNSKSI  831
            +S+P++A+RA+  +N   V SK +
Sbjct  354  FSTPEEASRALLEMNGKIVVSKPL  377



>ref|XP_010107907.1| Polyadenylate-binding protein 2 [Morus notabilis]
 gb|EXC17307.1| Polyadenylate-binding protein 2 [Morus notabilis]
Length=651

 Score =   137 bits (345),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 62/77 (81%), Positives = 71/77 (92%), Gaps = 0/77 (0%)
 Frame = +1

Query  604  QLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQDAA  783
            Q  TTSLYVGDLD  VTDSQLYDLFNQ+GQVVSVRVCRD+++RRSLGYGYVNYS+PQDAA
Sbjct  26   QFVTTSLYVGDLDQNVTDSQLYDLFNQLGQVVSVRVCRDLTTRRSLGYGYVNYSNPQDAA  85

Query  784  RAMEVLNFTPVNSKSIR  834
            RA+++LNFTP+N K IR
Sbjct  86   RALDMLNFTPLNGKPIR  102


 Score = 56.2 bits (134),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 29/84 (35%), Positives = 52/84 (62%), Gaps = 1/84 (1%)
 Frame = +1

Query  580  QSAAGAGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVN  759
            QS   A ++    +LY+ +LD +++D +L +LF Q G + S +V RD +   S G G+V 
Sbjct  300  QSMKEAADKYQGANLYIKNLDDSISDDKLKELFYQFGTITSCKVMRDPNG-ISRGSGFVA  358

Query  760  YSSPQDAARAMEVLNFTPVNSKSI  831
            +S+P++A+RA+  +N   + SK +
Sbjct  359  FSTPEEASRALVEMNGKMIVSKPL  382



>gb|KDO59774.1| hypothetical protein CISIN_1g010577mg [Citrus sinensis]
Length=454

 Score =   135 bits (341),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 64/88 (73%), Positives = 75/88 (85%), Gaps = 3/88 (3%)
 Frame = +1

Query  580  QSAAGAG---NQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYG  750
            Q+  G G   NQ  TTSLYVGDL+  VTDSQLYDLFNQ+GQVVSVRVCRD+S+RRSLGYG
Sbjct  9    QNVNGGGANANQFGTTSLYVGDLEANVTDSQLYDLFNQMGQVVSVRVCRDLSTRRSLGYG  68

Query  751  YVNYSSPQDAARAMEVLNFTPVNSKSIR  834
            YVN+S+ Q+AARA+E+LNFTP+N K IR
Sbjct  69   YVNFSNAQEAARALEMLNFTPLNGKPIR  96


 Score = 54.3 bits (129),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 29/84 (35%), Positives = 50/84 (60%), Gaps = 1/84 (1%)
 Frame = +1

Query  580  QSAAGAGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVN  759
            Q+   A ++    +LY+ +LD ++ D +L  LF+  G + S +V RD S   S G G+V 
Sbjct  294  QNMKEAADKFQGANLYIKNLDDSIDDEKLKQLFSPFGSITSCKVMRDPSGI-SRGSGFVA  352

Query  760  YSSPQDAARAMEVLNFTPVNSKSI  831
            +S+P++A+RA+  +N   V SK +
Sbjct  353  FSTPEEASRALLEMNGKMVVSKPL  376



>ref|XP_002510185.1| polyadenylate-binding protein, putative [Ricinus communis]
 gb|EEF52372.1| polyadenylate-binding protein, putative [Ricinus communis]
Length=658

 Score =   137 bits (345),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 75/114 (66%), Positives = 84/114 (74%), Gaps = 5/114 (4%)
 Frame = +1

Query  493  MAQIQVQHQSpvalangvpppgavglpapQSAAGAGNQLSTTSLYVGDLDPTVTDSQLYD  672
            MAQIQVQHQS  A A      GA       S          TSLYVGDLD  VTDSQLYD
Sbjct  1    MAQIQVQHQSAAAAAPIPGANGAAAAAGSGSVP-----YMPTSLYVGDLDLNVTDSQLYD  55

Query  673  LFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQDAARAMEVLNFTPVNSKSIR  834
            +FNQVGQVVSVRVCRD+++RRSLGYGYVNY+SPQDAARA+++LNFTP N+K IR
Sbjct  56   VFNQVGQVVSVRVCRDLTTRRSLGYGYVNYTSPQDAARALDILNFTPFNNKPIR  109


 Score = 55.5 bits (132),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 30/84 (36%), Positives = 51/84 (61%), Gaps = 1/84 (1%)
 Frame = +1

Query  580  QSAAGAGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVN  759
            QS   A ++    +LY+ +LD +++D  L +LF+  G + S +V RD S   S G G+V 
Sbjct  306  QSMKEAVDKYQGVNLYIKNLDDSISDENLKELFSDFGMITSCKVMRDPSG-ISRGSGFVA  364

Query  760  YSSPQDAARAMEVLNFTPVNSKSI  831
            +S+P++A+RA+  +N   V SK +
Sbjct  365  FSTPEEASRALAEMNGKMVVSKPL  388



>ref|XP_011000826.1| PREDICTED: polyadenylate-binding protein 8-like [Populus euphratica]
Length=643

 Score =   137 bits (344),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 67/83 (81%), Positives = 72/83 (87%), Gaps = 1/83 (1%)
 Frame = +1

Query  589  AGAGN-QLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNYS  765
             GA N    TTSLYVGDL+  VTDSQLYDLFNQVGQVVSVRVCRD++SRRSLGYGYVNYS
Sbjct  15   GGANNPNFVTTSLYVGDLEANVTDSQLYDLFNQVGQVVSVRVCRDLTSRRSLGYGYVNYS  74

Query  766  SPQDAARAMEVLNFTPVNSKSIR  834
            +PQDAARA+EVLNFTPVN   IR
Sbjct  75   NPQDAARALEVLNFTPVNGSPIR  97


 Score = 54.3 bits (129),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 28/84 (33%), Positives = 51/84 (61%), Gaps = 1/84 (1%)
 Frame = +1

Query  580  QSAAGAGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVN  759
            QS   A ++    +LY+ +LD ++ D ++ +LF+  G + S +V RD +   S G G+V 
Sbjct  295  QSMKEAADKFQGANLYIKNLDDSIGDEKIKELFSPFGTITSCKVMRDPNG-ISRGSGFVA  353

Query  760  YSSPQDAARAMEVLNFTPVNSKSI  831
            +S+P++A+RA+  +N   V SK +
Sbjct  354  FSTPEEASRALLEMNGKMVASKPL  377



>ref|XP_009775186.1| PREDICTED: polyadenylate-binding protein 2-like [Nicotiana sylvestris]
Length=662

 Score =   137 bits (344),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 64/74 (86%), Positives = 69/74 (93%), Gaps = 0/74 (0%)
 Frame = +1

Query  613  TTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQDAARAM  792
            +TSLYVGDLD  V DSQLYDLFNQVGQVVSVRVCRD+S+RRSLGYGYVNYS+P DAARAM
Sbjct  42   STSLYVGDLDFNVNDSQLYDLFNQVGQVVSVRVCRDLSTRRSLGYGYVNYSNPTDAARAM  101

Query  793  EVLNFTPVNSKSIR  834
            EVLNFTP+N KSIR
Sbjct  102  EVLNFTPINGKSIR  115


 Score = 55.5 bits (132),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 29/84 (35%), Positives = 52/84 (62%), Gaps = 1/84 (1%)
 Frame = +1

Query  580  QSAAGAGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVN  759
            Q+A    ++    +LY+ +LD T+ D +L +LF++ G V S +V RD S   S G G+V 
Sbjct  313  QTAKEVVDKYKGVNLYIKNLDDTIDDDKLKELFSEFGTVTSCKVMRDPSG-ISRGSGFVA  371

Query  760  YSSPQDAARAMEVLNFTPVNSKSI  831
            +S+P++A++A+  +N   + SK +
Sbjct  372  FSTPEEASKALSEMNGKMIVSKPL  395



>ref|XP_002313862.1| polyadenylate-binding family protein [Populus trichocarpa]
 gb|EEE87817.1| polyadenylate-binding family protein [Populus trichocarpa]
Length=642

 Score =   137 bits (344),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 67/83 (81%), Positives = 72/83 (87%), Gaps = 1/83 (1%)
 Frame = +1

Query  589  AGAGN-QLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNYS  765
             GA N    TTSLYVGDL+  VTDSQLYDLFNQVGQVVSVRVCRD++SRRSLGYGYVNYS
Sbjct  15   GGANNPNFVTTSLYVGDLEANVTDSQLYDLFNQVGQVVSVRVCRDLTSRRSLGYGYVNYS  74

Query  766  SPQDAARAMEVLNFTPVNSKSIR  834
            +PQDAARA+EVLNFTPVN   IR
Sbjct  75   NPQDAARALEVLNFTPVNGSPIR  97


 Score = 54.7 bits (130),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 28/84 (33%), Positives = 51/84 (61%), Gaps = 1/84 (1%)
 Frame = +1

Query  580  QSAAGAGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVN  759
            QS   A ++    +LY+ +LD ++ D ++ +LF+  G + S +V RD +   S G G+V 
Sbjct  295  QSMKEAADKFQGANLYIKNLDDSIGDEKIKELFSPFGTITSCKVMRDPNG-ISRGSGFVA  353

Query  760  YSSPQDAARAMEVLNFTPVNSKSI  831
            +S+P++A+RA+  +N   V SK +
Sbjct  354  FSTPEEASRALLEMNGKMVASKPL  377



>ref|XP_009408013.1| PREDICTED: polyadenylate-binding protein 2-like [Musa acuminata 
subsp. malaccensis]
Length=645

 Score =   137 bits (344),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 68/114 (60%), Positives = 82/114 (72%), Gaps = 16/114 (14%)
 Frame = +1

Query  493  MAQIQVQHQSpvalangvpppgavglpapQSAAGAGNQLSTTSLYVGDLDPTVTDSQLYD  672
            MAQIQ+Q Q+                    +A G G Q  +TSLYVGDLD  VTD+QLYD
Sbjct  1    MAQIQLQPQAVSGP----------------AAGGGGVQFPSTSLYVGDLDSGVTDAQLYD  44

Query  673  LFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQDAARAMEVLNFTPVNSKSIR  834
            +F+Q+GQVVSVRVCRDI++RRSLGY YVNY+ P DAARA+EVLNFTP+N K+IR
Sbjct  45   IFSQIGQVVSVRVCRDINTRRSLGYAYVNYNDPADAARAIEVLNFTPLNGKTIR  98


 Score = 51.6 bits (122),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 27/84 (32%), Positives = 48/84 (57%), Gaps = 1/84 (1%)
 Frame = +1

Query  580  QSAAGAGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVN  759
            QS   A  +    +LY+ +LD ++ D  L +LF+  G + S ++ RD +   S G G+V 
Sbjct  296  QSKQEATEKSQGVNLYLKNLDDSIGDDNLRELFSGFGAIASCKIMRDKNG-ASKGSGFVA  354

Query  760  YSSPQDAARAMEVLNFTPVNSKSI  831
            + SP+DA+RA+  +N   + +K +
Sbjct  355  FQSPEDASRALSEMNGKMIGNKPL  378



>ref|XP_011000130.1| PREDICTED: polyadenylate-binding protein 8-like [Populus euphratica]
Length=644

 Score =   136 bits (343),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 66/83 (80%), Positives = 74/83 (89%), Gaps = 1/83 (1%)
 Frame = +1

Query  589  AGAGN-QLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNYS  765
            AGA N    TTSLYVGDL+ +VTDSQLYDLFNQVGQVVSVRVCRD++SRRSLGYGYVNYS
Sbjct  15   AGANNPNFVTTSLYVGDLEGSVTDSQLYDLFNQVGQVVSVRVCRDLTSRRSLGYGYVNYS  74

Query  766  SPQDAARAMEVLNFTPVNSKSIR  834
            +PQDAARA+E+LNFTP+N   IR
Sbjct  75   NPQDAARALEMLNFTPLNGSPIR  97


 Score = 54.7 bits (130),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 29/84 (35%), Positives = 51/84 (61%), Gaps = 1/84 (1%)
 Frame = +1

Query  580  QSAAGAGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVN  759
            QS   A ++    +LY+ +LD ++ D +L +LF+  G + S +V RD +   S G G+V 
Sbjct  295  QSMKEAADKFQGANLYIKNLDDSIGDEKLKELFSPFGTITSCKVMRDPNG-ISRGSGFVA  353

Query  760  YSSPQDAARAMEVLNFTPVNSKSI  831
            +S+P++A+RA+  +N   V SK +
Sbjct  354  FSTPEEASRALLEMNGKIVVSKPL  377



>gb|KGN43917.1| hypothetical protein Csa_7G073530 [Cucumis sativus]
Length=649

 Score =   136 bits (343),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 65/84 (77%), Positives = 73/84 (87%), Gaps = 0/84 (0%)
 Frame = +1

Query  583  SAAGAGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNY  762
            +A G  NQ  TTSLYVGDLD  VTDSQLYDLFNQVGQVVSVRVCRD++SRRSLGYGYVNY
Sbjct  18   AANGGANQHVTTSLYVGDLDVNVTDSQLYDLFNQVGQVVSVRVCRDLTSRRSLGYGYVNY  77

Query  763  SSPQDAARAMEVLNFTPVNSKSIR  834
            S+P DA+RA++VLNFTP+N   IR
Sbjct  78   SNPVDASRALDVLNFTPLNGNPIR  101


 Score = 55.8 bits (133),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 31/84 (37%), Positives = 50/84 (60%), Gaps = 1/84 (1%)
 Frame = +1

Query  580  QSAAGAGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVN  759
            QS   A ++    +LYV +LD ++ D +L +LF   G + S +V RD +   S G G+V 
Sbjct  299  QSVKEAADKYQGANLYVKNLDDSIDDDKLKELFTGFGTITSCKVMRDPNG-ISRGSGFVA  357

Query  760  YSSPQDAARAMEVLNFTPVNSKSI  831
            +SSP++AARA+  +N   + SK +
Sbjct  358  FSSPEEAARALAEMNGRMIVSKPL  381



>ref|XP_008454965.1| PREDICTED: polyadenylate-binding protein 2 [Cucumis melo]
Length=649

 Score =   136 bits (343),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 65/84 (77%), Positives = 73/84 (87%), Gaps = 0/84 (0%)
 Frame = +1

Query  583  SAAGAGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNY  762
            +A G  NQ  TTSLYVGDLD  VTDSQLYDLFNQVGQVVSVRVCRD++SRRSLGYGYVNY
Sbjct  18   AANGGANQHVTTSLYVGDLDVNVTDSQLYDLFNQVGQVVSVRVCRDLTSRRSLGYGYVNY  77

Query  763  SSPQDAARAMEVLNFTPVNSKSIR  834
            S+P DA+RA++VLNFTP+N   IR
Sbjct  78   SNPVDASRALDVLNFTPLNGNPIR  101


 Score = 55.8 bits (133),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 31/84 (37%), Positives = 50/84 (60%), Gaps = 1/84 (1%)
 Frame = +1

Query  580  QSAAGAGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVN  759
            QS   A ++    +LYV +LD ++ D +L +LF   G + S +V RD +   S G G+V 
Sbjct  299  QSVKEAADKYQGANLYVKNLDDSIDDDKLKELFTGFGTITSCKVMRDPNG-ISRGSGFVA  357

Query  760  YSSPQDAARAMEVLNFTPVNSKSI  831
            +SSP++AARA+  +N   + SK +
Sbjct  358  FSSPEEAARALAEMNGRMIVSKPL  381



>ref|NP_001292658.1| polyadenylate-binding protein 2 [Cucumis sativus]
 gb|AAF63202.1|AF240679_1 poly(A)-binding protein [Cucumis sativus]
Length=649

 Score =   136 bits (343),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 65/84 (77%), Positives = 73/84 (87%), Gaps = 0/84 (0%)
 Frame = +1

Query  583  SAAGAGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNY  762
            +A G  NQ  TTSLYVGDLD  VTDSQLYDLFNQVGQVVSVRVCRD++SRRSLGYGYVNY
Sbjct  18   AANGGANQHVTTSLYVGDLDVNVTDSQLYDLFNQVGQVVSVRVCRDLTSRRSLGYGYVNY  77

Query  763  SSPQDAARAMEVLNFTPVNSKSIR  834
            S+P DA+RA++VLNFTP+N   IR
Sbjct  78   SNPVDASRALDVLNFTPLNGNPIR  101


 Score = 55.8 bits (133),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 31/84 (37%), Positives = 50/84 (60%), Gaps = 1/84 (1%)
 Frame = +1

Query  580  QSAAGAGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVN  759
            QS   A ++    +LYV +LD ++ D +L +LF   G + S +V RD +   S G G+V 
Sbjct  299  QSVKEAADKYQGANLYVKNLDDSIDDDKLKELFTGFGTITSCKVMRDPNG-ISRGSGFVA  357

Query  760  YSSPQDAARAMEVLNFTPVNSKSI  831
            +SSP++AARA+  +N   + SK +
Sbjct  358  FSSPEEAARALAEMNGRMIVSKPL  381



>ref|XP_007201197.1| hypothetical protein PRUPE_ppa002607mg [Prunus persica]
 gb|EMJ02396.1| hypothetical protein PRUPE_ppa002607mg [Prunus persica]
Length=653

 Score =   136 bits (342),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 62/74 (84%), Positives = 70/74 (95%), Gaps = 0/74 (0%)
 Frame = +1

Query  613  TTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQDAARAM  792
            TTSLYVGDLD  VTDSQLYDLFNQ+GQVVSVRVCRD+S+RRSLGYGYVNYS+PQDAARA+
Sbjct  31   TTSLYVGDLDQNVTDSQLYDLFNQLGQVVSVRVCRDLSTRRSLGYGYVNYSNPQDAARAL  90

Query  793  EVLNFTPVNSKSIR  834
            +VLNF+PVN + IR
Sbjct  91   DVLNFSPVNGRPIR  104


 Score = 55.5 bits (132),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 31/84 (37%), Positives = 49/84 (58%), Gaps = 1/84 (1%)
 Frame = +1

Query  580  QSAAGAGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVN  759
            QS   A ++    +LYV +LD T+ D +L +LF   G + S +V RD S   S G G+V 
Sbjct  302  QSMKEAADKYQGANLYVKNLDDTIGDEKLKELFAPFGTITSCKVMRDPSG-ISRGSGFVA  360

Query  760  YSSPQDAARAMEVLNFTPVNSKSI  831
            +S+P++A RA+  +N   + SK +
Sbjct  361  FSTPEEANRALLEMNGKMIVSKPL  384



>gb|KDO59773.1| hypothetical protein CISIN_1g010577mg [Citrus sinensis]
Length=507

 Score =   134 bits (338),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 64/88 (73%), Positives = 75/88 (85%), Gaps = 3/88 (3%)
 Frame = +1

Query  580  QSAAGAG---NQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYG  750
            Q+  G G   NQ  TTSLYVGDL+  VTDSQLYDLFNQ+GQVVSVRVCRD+S+RRSLGYG
Sbjct  9    QNVNGGGANANQFGTTSLYVGDLEANVTDSQLYDLFNQMGQVVSVRVCRDLSTRRSLGYG  68

Query  751  YVNYSSPQDAARAMEVLNFTPVNSKSIR  834
            YVN+S+ Q+AARA+E+LNFTP+N K IR
Sbjct  69   YVNFSNAQEAARALEMLNFTPLNGKPIR  96


 Score = 54.3 bits (129),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 29/84 (35%), Positives = 50/84 (60%), Gaps = 1/84 (1%)
 Frame = +1

Query  580  QSAAGAGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVN  759
            Q+   A ++    +LY+ +LD ++ D +L  LF+  G + S +V RD S   S G G+V 
Sbjct  294  QNMKEAADKFQGANLYIKNLDDSIDDEKLKQLFSPFGSITSCKVMRDPSGI-SRGSGFVA  352

Query  760  YSSPQDAARAMEVLNFTPVNSKSI  831
            +S+P++A+RA+  +N   V SK +
Sbjct  353  FSTPEEASRALLEMNGKMVVSKPL  376



>ref|XP_003607922.1| Poly(A)-binding protein [Medicago truncatula]
 gb|AES90119.1| polyadenylate-binding protein [Medicago truncatula]
Length=654

 Score =   135 bits (340),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 61/74 (82%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +1

Query  613  TTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQDAARAM  792
            TTSLYVGDLD  VTDSQLYDLFNQ+GQVVSVRVCRD+++RRSLGYGYVNYS+PQDAARA+
Sbjct  33   TTSLYVGDLDMNVTDSQLYDLFNQLGQVVSVRVCRDLTTRRSLGYGYVNYSNPQDAARAL  92

Query  793  EVLNFTPVNSKSIR  834
            +VLNFTP+N++ IR
Sbjct  93   DVLNFTPLNNRPIR  106


 Score = 55.5 bits (132),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 30/84 (36%), Positives = 51/84 (61%), Gaps = 1/84 (1%)
 Frame = +1

Query  580  QSAAGAGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVN  759
            QS   A ++    +LYV +LD ++ D +L +LF+  G + S +V RD +   S G G+V 
Sbjct  304  QSMKEAADKYQGANLYVKNLDDSIADEKLKELFSSYGTITSCKVMRDPNG-VSRGSGFVA  362

Query  760  YSSPQDAARAMEVLNFTPVNSKSI  831
            +S+P++A+RA+  +N   V SK +
Sbjct  363  FSTPEEASRALLEMNGKMVASKPL  386


 Score = 51.2 bits (121),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 27/83 (33%), Positives = 44/83 (53%), Gaps = 1/83 (1%)
 Frame = +1

Query  580  QSAAGAGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVN  759
            Q     G++    +++V +L  + TD +L   F + G + S  V RD    +S  +G+VN
Sbjct  201  QERESTGDRAKFNNVFVKNLSESTTDDELKKTFGEFGTITSAVVMRD-GDGKSKCFGFVN  259

Query  760  YSSPQDAARAMEVLNFTPVNSKS  828
            + S  DAARA+E LN   ++ K 
Sbjct  260  FESTDDAARAVEALNGKKIDDKE  282



>ref|XP_009613515.1| PREDICTED: polyadenylate-binding protein 2-like [Nicotiana tomentosiformis]
Length=663

 Score =   135 bits (340),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 63/74 (85%), Positives = 68/74 (92%), Gaps = 0/74 (0%)
 Frame = +1

Query  613  TTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQDAARAM  792
            +TSLYVGDLD  V DSQLYDLFNQVGQVVSVRVCRD+ +RRSLGYGYVNYS+P DAARAM
Sbjct  43   STSLYVGDLDFNVNDSQLYDLFNQVGQVVSVRVCRDLGTRRSLGYGYVNYSNPTDAARAM  102

Query  793  EVLNFTPVNSKSIR  834
            EVLNFTP+N KSIR
Sbjct  103  EVLNFTPINGKSIR  116


 Score = 55.5 bits (132),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 29/84 (35%), Positives = 52/84 (62%), Gaps = 1/84 (1%)
 Frame = +1

Query  580  QSAAGAGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVN  759
            Q+A    ++    +LY+ +LD T+ D +L +LF++ G V S +V RD S   S G G+V 
Sbjct  314  QTAKEVVDKYKGVNLYIKNLDDTIDDDKLKELFSEFGTVTSCKVMRDPSG-ISKGSGFVA  372

Query  760  YSSPQDAARAMEVLNFTPVNSKSI  831
            +S+P++A++A+  +N   + SK +
Sbjct  373  FSTPEEASKALSEMNGKMIVSKPL  396



>ref|XP_009600995.1| PREDICTED: polyadenylate-binding protein 8-like [Nicotiana tomentosiformis]
 gb|AAF66823.1|AF190655_1 poly(A)-binding protein [Nicotiana tabacum]
Length=649

 Score =   135 bits (339),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 64/84 (76%), Positives = 73/84 (87%), Gaps = 1/84 (1%)
 Frame = +1

Query  583  SAAGAGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNY  762
            +A G  NQ   TSLYVGDLD  VTDSQLYDLFNQ+GQVVSVRVCRD++S+RSLGYGYVNY
Sbjct  17   NAGGVNNQF-VTSLYVGDLDVNVTDSQLYDLFNQLGQVVSVRVCRDLTSQRSLGYGYVNY  75

Query  763  SSPQDAARAMEVLNFTPVNSKSIR  834
             +PQDAARA+EVLNFTP++ K IR
Sbjct  76   GNPQDAARALEVLNFTPLHGKPIR  99


 Score = 56.2 bits (134),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 31/84 (37%), Positives = 53/84 (63%), Gaps = 1/84 (1%)
 Frame = +1

Query  580  QSAAGAGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVN  759
            QSA  A ++    +LY+ +LD +++D +L +LF+  G + S +V RD S   S G G+V 
Sbjct  297  QSAKEAVDKSQGLNLYIKNLDDSISDEKLKELFSPYGTITSCKVMRDPSG-VSKGSGFVA  355

Query  760  YSSPQDAARAMEVLNFTPVNSKSI  831
            +S+P++A+RA+  +N   V SK +
Sbjct  356  FSNPEEASRALSEMNGKMVVSKPL  379



>emb|CDO97200.1| unnamed protein product [Coffea canephora]
Length=654

 Score =   135 bits (339),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 62/77 (81%), Positives = 69/77 (90%), Gaps = 0/77 (0%)
 Frame = +1

Query  604  QLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQDAA  783
            Q   TSLYVGDLD  VTDSQLYDLFNQVGQVVSVRVCRD+++RRSLGYGYVNY +PQDAA
Sbjct  28   QFVPTSLYVGDLDFNVTDSQLYDLFNQVGQVVSVRVCRDLTTRRSLGYGYVNYGNPQDAA  87

Query  784  RAMEVLNFTPVNSKSIR  834
            RA+E+LNFTP+N K IR
Sbjct  88   RALEILNFTPLNGKPIR  104


 Score = 53.9 bits (128),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 29/84 (35%), Positives = 51/84 (61%), Gaps = 1/84 (1%)
 Frame = +1

Query  580  QSAAGAGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVN  759
            QS   A ++    +LY+ +LD ++ D +L +LF+  G + S +V RD +   S G G+V 
Sbjct  302  QSVKEAADKSQGLNLYIKNLDDSINDDKLRELFSPFGTITSCKVMRDPNG-ISRGSGFVA  360

Query  760  YSSPQDAARAMEVLNFTPVNSKSI  831
            +S+P++A+RA+  +N   V SK +
Sbjct  361  FSTPEEASRALSEMNGKMVVSKPL  384



>ref|XP_009768210.1| PREDICTED: polyadenylate-binding protein 8-like [Nicotiana sylvestris]
Length=649

 Score =   135 bits (339),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 64/84 (76%), Positives = 73/84 (87%), Gaps = 1/84 (1%)
 Frame = +1

Query  583  SAAGAGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNY  762
            +A G  NQ   TSLYVGDLD  VTDSQLYDLFNQ+GQVVSVRVCRD++S+RSLGYGYVNY
Sbjct  17   NAGGVNNQF-VTSLYVGDLDVNVTDSQLYDLFNQLGQVVSVRVCRDLTSQRSLGYGYVNY  75

Query  763  SSPQDAARAMEVLNFTPVNSKSIR  834
             +PQDAARA+EVLNFTP++ K IR
Sbjct  76   GNPQDAARALEVLNFTPLHGKPIR  99


 Score = 56.2 bits (134),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 31/84 (37%), Positives = 53/84 (63%), Gaps = 1/84 (1%)
 Frame = +1

Query  580  QSAAGAGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVN  759
            QSA  A ++    +LY+ +LD +++D +L +LF+  G + S +V RD S   S G G+V 
Sbjct  297  QSAKEAVDKSQGLNLYIKNLDDSISDDKLKELFSPYGTITSCKVMRDPSG-VSKGSGFVA  355

Query  760  YSSPQDAARAMEVLNFTPVNSKSI  831
            +S+P++A+RA+  +N   V SK +
Sbjct  356  FSTPEEASRALSEMNGKMVVSKPL  379



>ref|XP_010540373.1| PREDICTED: polyadenylate-binding protein 2-like [Tarenaya hassleriana]
Length=620

 Score =   134 bits (338),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 66/114 (58%), Positives = 87/114 (76%), Gaps = 17/114 (15%)
 Frame = +1

Query  493  MAQIQVQHQSpvalangvpppgavglpapQSAAGAGNQLSTTSLYVGDLDPTVTDSQLYD  672
            MAQIQ++HQ P                   +AA A    +T SLYVGDLDP+VTD+QL+D
Sbjct  1    MAQIQLKHQPPSPNG---------------TAASASQ--ATMSLYVGDLDPSVTDAQLFD  43

Query  673  LFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQDAARAMEVLNFTPVNSKSIR  834
            LF+QVG V+SVRVCRD+++R+SLGYGYVN+S+PQDAA+AM++LNFTP+N+K+IR
Sbjct  44   LFSQVGSVISVRVCRDMNTRKSLGYGYVNFSNPQDAAKAMDILNFTPLNNKAIR  97


 Score = 60.8 bits (146),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 31/84 (37%), Positives = 53/84 (63%), Gaps = 1/84 (1%)
 Frame = +1

Query  580  QSAAGAGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVN  759
            QS   A  ++   +LYV +LD ++T+ +L +LF++ G V S ++ RD S   S G G+V 
Sbjct  295  QSLKEAAEKVQRANLYVKNLDDSITEEKLKELFSEFGSVTSCKILRDPSG-ISKGAGFVA  353

Query  760  YSSPQDAARAMEVLNFTPVNSKSI  831
            +S+P++A+RA+  +N   V SK +
Sbjct  354  FSTPEEASRAITEMNGKMVGSKPL  377



>emb|CDO97198.1| unnamed protein product [Coffea canephora]
Length=653

 Score =   135 bits (339),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 62/77 (81%), Positives = 69/77 (90%), Gaps = 0/77 (0%)
 Frame = +1

Query  604  QLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQDAA  783
            Q   TSLYVGDLD  VTDSQLYDLFNQVGQVVSVRVCRD+++RRSLGYGYVNY +PQDAA
Sbjct  27   QFVPTSLYVGDLDLHVTDSQLYDLFNQVGQVVSVRVCRDLTTRRSLGYGYVNYGNPQDAA  86

Query  784  RAMEVLNFTPVNSKSIR  834
            RA+E+LNFTP+N K IR
Sbjct  87   RALEILNFTPLNGKPIR  103


 Score = 51.2 bits (121),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 28/84 (33%), Positives = 50/84 (60%), Gaps = 1/84 (1%)
 Frame = +1

Query  580  QSAAGAGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVN  759
            QS   A ++    +LY+ +LD ++ D +L +LF+  G + S +V RD +   S G G+V 
Sbjct  301  QSIKEAADKSQGLNLYIKNLDDSINDDKLRELFSPFGVITSCKVMRDPNG-ISRGSGFVA  359

Query  760  YSSPQDAARAMEVLNFTPVNSKSI  831
            +S P++A+RA+  +N   + SK +
Sbjct  360  FSIPEEASRALSEMNGKMIVSKPL  383



>ref|XP_008236485.1| PREDICTED: polyadenylate-binding protein 8 [Prunus mume]
Length=653

 Score =   135 bits (339),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 61/74 (82%), Positives = 70/74 (95%), Gaps = 0/74 (0%)
 Frame = +1

Query  613  TTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQDAARAM  792
            TTSLYVGDLD  VTDSQLYDLFNQ+GQVVSVRVCRD+S+RRSLGYGYVNYS+PQDAARA+
Sbjct  31   TTSLYVGDLDQNVTDSQLYDLFNQLGQVVSVRVCRDLSTRRSLGYGYVNYSNPQDAARAL  90

Query  793  EVLNFTPVNSKSIR  834
            ++LNF+PVN + IR
Sbjct  91   DMLNFSPVNGRPIR  104


 Score = 55.5 bits (132),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 31/84 (37%), Positives = 49/84 (58%), Gaps = 1/84 (1%)
 Frame = +1

Query  580  QSAAGAGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVN  759
            QS   A ++    +LYV +LD T+ D +L +LF   G + S +V RD S   S G G+V 
Sbjct  302  QSMKEAADKYQGANLYVKNLDDTIGDEKLKELFAPFGTITSCKVMRDPSG-ISRGSGFVA  360

Query  760  YSSPQDAARAMEVLNFTPVNSKSI  831
            +S+P++A RA+  +N   + SK +
Sbjct  361  FSTPEEANRALLEMNGKMIVSKPL  384



>ref|XP_006422975.1| hypothetical protein CICLE_v10027999mg [Citrus clementina]
 ref|XP_006487035.1| PREDICTED: polyadenylate-binding protein 2-like [Citrus sinensis]
 gb|ESR36215.1| hypothetical protein CICLE_v10027999mg [Citrus clementina]
Length=645

 Score =   134 bits (338),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 64/88 (73%), Positives = 75/88 (85%), Gaps = 3/88 (3%)
 Frame = +1

Query  580  QSAAGAG---NQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYG  750
            Q+  G G   NQ  TTSLYVGDL+  VTDSQLYDLFNQ+GQVVSVRVCRD+S+RRSLGYG
Sbjct  9    QNVNGGGANANQFGTTSLYVGDLEANVTDSQLYDLFNQMGQVVSVRVCRDLSTRRSLGYG  68

Query  751  YVNYSSPQDAARAMEVLNFTPVNSKSIR  834
            YVN+S+ Q+AARA+E+LNFTP+N K IR
Sbjct  69   YVNFSNAQEAARALEMLNFTPLNGKPIR  96


 Score = 54.3 bits (129),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 29/84 (35%), Positives = 50/84 (60%), Gaps = 1/84 (1%)
 Frame = +1

Query  580  QSAAGAGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVN  759
            Q+   A ++    +LY+ +LD ++ D +L  LF+  G + S +V RD S   S G G+V 
Sbjct  294  QNMKEAADKFQGANLYIKNLDDSIDDEKLKQLFSPFGSITSCKVMRDPSGI-SRGSGFVA  352

Query  760  YSSPQDAARAMEVLNFTPVNSKSI  831
            +S+P++A+RA+  +N   V SK +
Sbjct  353  FSTPEEASRALLEMNGKMVVSKPL  376



>ref|XP_004304018.1| PREDICTED: polyadenylate-binding protein 8-like [Fragaria vesca 
subsp. vesca]
Length=651

 Score =   134 bits (337),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 60/74 (81%), Positives = 70/74 (95%), Gaps = 0/74 (0%)
 Frame = +1

Query  613  TTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQDAARAM  792
            TTSLYVGDLD  +TDSQLYDLFNQ+GQVVSVRVCRD+S+RRSLGYGYVNY++PQDAARA+
Sbjct  29   TTSLYVGDLDQNITDSQLYDLFNQLGQVVSVRVCRDLSTRRSLGYGYVNYANPQDAARAL  88

Query  793  EVLNFTPVNSKSIR  834
            +VLNFTP+N + IR
Sbjct  89   DVLNFTPINGRPIR  102


 Score = 54.7 bits (130),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 30/84 (36%), Positives = 49/84 (58%), Gaps = 1/84 (1%)
 Frame = +1

Query  580  QSAAGAGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVN  759
            QS   A ++    +LYV +LD ++ D +L +LF   G + S +V RD S   S G G+V 
Sbjct  300  QSMKEAADKYQGANLYVKNLDDSIVDDKLRELFTPFGTITSCKVMRDPSG-VSRGSGFVA  358

Query  760  YSSPQDAARAMEVLNFTPVNSKSI  831
            +S+P++A RA+  +N   + SK +
Sbjct  359  FSTPEEANRALAEMNGKMIVSKPL  382



>gb|AFP74112.1| poly-A binding protein, partial [Nicotiana benthamiana]
Length=643

 Score =   134 bits (337),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 64/84 (76%), Positives = 73/84 (87%), Gaps = 1/84 (1%)
 Frame = +1

Query  583  SAAGAGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNY  762
            +A G  NQ   TSLYVGDLD  VTDSQLYDLFNQ+GQVVSVRVCRD++S+RSLGYGYVNY
Sbjct  17   NAGGVNNQF-VTSLYVGDLDVNVTDSQLYDLFNQLGQVVSVRVCRDLTSQRSLGYGYVNY  75

Query  763  SSPQDAARAMEVLNFTPVNSKSIR  834
             +PQDAARA+EVLNFTP++ K IR
Sbjct  76   GNPQDAARALEVLNFTPLHGKPIR  99


 Score = 54.7 bits (130),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 31/84 (37%), Positives = 53/84 (63%), Gaps = 1/84 (1%)
 Frame = +1

Query  580  QSAAGAGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVN  759
            QSA  A ++    +LY+ +LD +++D +L +LF+  G + S +V RD S   S G G+V 
Sbjct  297  QSAQEAVDKSQGLNLYLKNLDDSISDDKLKELFSPYGTITSCKVMRDPSG-VSKGSGFVA  355

Query  760  YSSPQDAARAMEVLNFTPVNSKSI  831
            +S+P++A+RA+  +N   V SK +
Sbjct  356  FSTPEEASRALSEMNGKMVVSKPL  379



>ref|XP_008364682.1| PREDICTED: polyadenylate-binding protein 2-like [Malus domestica]
Length=181

 Score =   126 bits (317),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 60/77 (78%), Positives = 67/77 (87%), Gaps = 0/77 (0%)
 Frame = +1

Query  589  AGAGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNYSS  768
             G   Q  +TSLYVGDLD  VTDSQLYDLFNQVGQVVSVRVC+D+S+RRSLGYGYVNYS+
Sbjct  25   GGGAPQFVSTSLYVGDLDQNVTDSQLYDLFNQVGQVVSVRVCKDLSTRRSLGYGYVNYSA  84

Query  769  PQDAARAMEVLNFTPVN  819
             QDAARA+EVLNFTP+ 
Sbjct  85   LQDAARALEVLNFTPLK  101



>gb|AAK30205.1|AF349964_1 poly(A)-binding protein [Daucus carota]
Length=658

 Score =   133 bits (334),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 62/77 (81%), Positives = 72/77 (94%), Gaps = 0/77 (0%)
 Frame = +1

Query  604  QLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQDAA  783
            Q +TTSLYVGDLD +VTDSQLYDLFNQVGQVVSVRVCRD+S+ RSLGYGYVNYS+ QDA 
Sbjct  36   QFTTTSLYVGDLDQSVTDSQLYDLFNQVGQVVSVRVCRDLSTGRSLGYGYVNYSNQQDAT  95

Query  784  RAMEVLNFTPVNSKSIR  834
            RA++VLNFTP+N+K+IR
Sbjct  96   RAIDVLNFTPLNNKTIR  112


 Score = 55.5 bits (132),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 47/71 (66%), Gaps = 1/71 (1%)
 Frame = +1

Query  619  SLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQDAARAMEV  798
            +LYV +LD T+ D +L +LF++ G + S +V RD S   S G G+V +S+P++A+RA+  
Sbjct  323  NLYVKNLDDTIDDEKLKELFSEYGTITSCKVMRDPSG-ISRGSGFVAFSTPEEASRALGE  381

Query  799  LNFTPVNSKSI  831
            +N   + SK +
Sbjct  382  MNGKMIVSKPL  392



>ref|XP_008373847.1| PREDICTED: polyadenylate-binding protein 8-like [Malus domestica]
 ref|XP_008364535.1| PREDICTED: polyadenylate-binding protein 8-like [Malus domestica]
Length=658

 Score =   133 bits (334),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 60/74 (81%), Positives = 70/74 (95%), Gaps = 0/74 (0%)
 Frame = +1

Query  613  TTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQDAARAM  792
            TTSLYVGDLDP VTDSQLYDLF Q+GQVVSVRVCRD+S+RRSLGYGYVN+++PQDAARA+
Sbjct  32   TTSLYVGDLDPNVTDSQLYDLFYQLGQVVSVRVCRDLSTRRSLGYGYVNFANPQDAARAL  91

Query  793  EVLNFTPVNSKSIR  834
            +VLNF+PVN + IR
Sbjct  92   DVLNFSPVNGRPIR  105


 Score = 55.8 bits (133),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 31/84 (37%), Positives = 50/84 (60%), Gaps = 1/84 (1%)
 Frame = +1

Query  580  QSAAGAGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVN  759
            QS   A ++    +LYV +LD T+ D +L +LF+  G + S +V RD S   S G G+V 
Sbjct  303  QSMKEAADKYQGANLYVKNLDDTIADDKLQELFSPFGTITSCKVMRDPSG-VSRGSGFVA  361

Query  760  YSSPQDAARAMEVLNFTPVNSKSI  831
            +S+P++A RA+  +N   + SK +
Sbjct  362  FSTPEEANRALLEMNGKMIVSKPL  385



>ref|XP_010322992.1| PREDICTED: polyadenylate-binding protein 2-like [Solanum lycopersicum]
Length=301

 Score =   129 bits (324),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 57/82 (70%), Positives = 68/82 (83%), Gaps = 0/82 (0%)
 Frame = +1

Query  589  AGAGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNYSS  768
             G  NQ   TSLY+GDLD  VT +QL+ L NQ GQV+SVR+CRD S+RRSLGYG++NYS+
Sbjct  111  GGVANQFKPTSLYIGDLDINVTHTQLHQLLNQAGQVISVRICRDFSTRRSLGYGFINYSN  170

Query  769  PQDAARAMEVLNFTPVNSKSIR  834
            PQDAARAME+L+FTPVN KSIR
Sbjct  171  PQDAARAMEMLDFTPVNGKSIR  192



>gb|KCW66376.1| hypothetical protein EUGRSUZ_F00193 [Eucalyptus grandis]
Length=549

 Score =   131 bits (330),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 62/74 (84%), Positives = 69/74 (93%), Gaps = 0/74 (0%)
 Frame = +1

Query  613  TTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQDAARAM  792
            +TSLYVGDLD TV DSQLYDLFNQVGQVVSVRVCRD+S+RRSLGYGYVNYS PQDAARA+
Sbjct  35   STSLYVGDLDFTVNDSQLYDLFNQVGQVVSVRVCRDLSTRRSLGYGYVNYSDPQDAARAL  94

Query  793  EVLNFTPVNSKSIR  834
            + LNFT VN+K+IR
Sbjct  95   DALNFTLVNNKAIR  108


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 30/84 (36%), Positives = 50/84 (60%), Gaps = 1/84 (1%)
 Frame = +1

Query  580  QSAAGAGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVN  759
            QS     ++    +LYV +L+ ++ D +L +LF++ G + S +V RD +   S G G+V 
Sbjct  276  QSMKETVDKFQGVNLYVKNLNDSIDDEKLKELFSEFGTITSCKVMRDPNG-ISRGSGFVA  334

Query  760  YSSPQDAARAMEVLNFTPVNSKSI  831
            +SSP +AARA+  +N   V SK +
Sbjct  335  FSSPDEAARALAGMNNKMVVSKPL  358



>ref|XP_006346392.1| PREDICTED: polyadenylate-binding protein 8-like [Solanum tuberosum]
Length=643

 Score =   132 bits (332),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 69/114 (61%), Positives = 80/114 (70%), Gaps = 21/114 (18%)
 Frame = +1

Query  493  MAQIQVQHQSpvalangvpppgavglpapQSAAGAGNQLSTTSLYVGDLDPTVTDSQLYD  672
            MAQ+QVQ Q                     + AG  NQ   TSLYVGDLD  VTDSQLYD
Sbjct  1    MAQVQVQPQG--------------------ANAGGVNQF-VTSLYVGDLDVNVTDSQLYD  39

Query  673  LFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQDAARAMEVLNFTPVNSKSIR  834
            LFN +GQVVSVRVCRD++++RSLGYGYVNY +PQDAARA+EVLNFTP++ K IR
Sbjct  40   LFNHLGQVVSVRVCRDLTTQRSLGYGYVNYGNPQDAARALEVLNFTPLSGKPIR  93


 Score = 56.2 bits (134),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 30/84 (36%), Positives = 53/84 (63%), Gaps = 1/84 (1%)
 Frame = +1

Query  580  QSAAGAGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVN  759
            QSA  A ++    +LY+ +LD +++D +L ++F+  G + S +V RD S   S G G+V 
Sbjct  291  QSAKEAVDKSQGLNLYIKNLDDSISDDKLKEMFSTYGTITSCKVMRDPSG-GSKGSGFVA  349

Query  760  YSSPQDAARAMEVLNFTPVNSKSI  831
            +SSP++A+RA+  +N   + SK +
Sbjct  350  FSSPEEASRALAEMNGKMIVSKPL  373



>ref|XP_002518733.1| polyadenylate-binding protein, putative [Ricinus communis]
 gb|EEF43658.1| polyadenylate-binding protein, putative [Ricinus communis]
Length=644

 Score =   132 bits (332),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 62/82 (76%), Positives = 70/82 (85%), Gaps = 0/82 (0%)
 Frame = +1

Query  589  AGAGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNYSS  768
             GA     TTSLYVGDL+  VTDS LYDLFNQVGQVVSVRVCRD+++RRSLGYGYVNYSS
Sbjct  15   GGANAPYVTTSLYVGDLEANVTDSHLYDLFNQVGQVVSVRVCRDLTTRRSLGYGYVNYSS  74

Query  769  PQDAARAMEVLNFTPVNSKSIR  834
            PQDAARA+++LNFTP+N   IR
Sbjct  75   PQDAARALDMLNFTPLNGSPIR  96


 Score = 52.4 bits (124),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 28/84 (33%), Positives = 50/84 (60%), Gaps = 1/84 (1%)
 Frame = +1

Query  580  QSAAGAGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVN  759
            QS   A ++    +LY+ +LD ++ D +L  LF+  G + S +V RD +   S G G+V 
Sbjct  294  QSMKEAADKFQGANLYIKNLDDSIGDDRLKQLFSPFGTITSCKVMRDPNGI-SRGSGFVA  352

Query  760  YSSPQDAARAMEVLNFTPVNSKSI  831
            +S+P++A++A+  +N   V SK +
Sbjct  353  FSTPEEASKALMEMNGKMVVSKPL  376



>gb|KCW66375.1| hypothetical protein EUGRSUZ_F00193 [Eucalyptus grandis]
Length=627

 Score =   132 bits (331),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 62/74 (84%), Positives = 69/74 (93%), Gaps = 0/74 (0%)
 Frame = +1

Query  613  TTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQDAARAM  792
            +TSLYVGDLD TV DSQLYDLFNQVGQVVSVRVCRD+S+RRSLGYGYVNYS PQDAARA+
Sbjct  35   STSLYVGDLDFTVNDSQLYDLFNQVGQVVSVRVCRDLSTRRSLGYGYVNYSDPQDAARAL  94

Query  793  EVLNFTPVNSKSIR  834
            + LNFT VN+K+IR
Sbjct  95   DALNFTLVNNKAIR  108


 Score = 53.5 bits (127),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 30/84 (36%), Positives = 50/84 (60%), Gaps = 1/84 (1%)
 Frame = +1

Query  580  QSAAGAGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVN  759
            QS     ++    +LYV +L+ ++ D +L +LF++ G + S +V RD +   S G G+V 
Sbjct  276  QSMKETVDKFQGVNLYVKNLNDSIDDEKLKELFSEFGTITSCKVMRDPNG-ISRGSGFVA  334

Query  760  YSSPQDAARAMEVLNFTPVNSKSI  831
            +SSP +AARA+  +N   V SK +
Sbjct  335  FSSPDEAARALAGMNNKMVVSKPL  358



>ref|XP_010059905.1| PREDICTED: polyadenylate-binding protein 2-like [Eucalyptus grandis]
 gb|KCW66374.1| hypothetical protein EUGRSUZ_F00193 [Eucalyptus grandis]
Length=657

 Score =   132 bits (331),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 62/74 (84%), Positives = 69/74 (93%), Gaps = 0/74 (0%)
 Frame = +1

Query  613  TTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQDAARAM  792
            +TSLYVGDLD TV DSQLYDLFNQVGQVVSVRVCRD+S+RRSLGYGYVNYS PQDAARA+
Sbjct  35   STSLYVGDLDFTVNDSQLYDLFNQVGQVVSVRVCRDLSTRRSLGYGYVNYSDPQDAARAL  94

Query  793  EVLNFTPVNSKSIR  834
            + LNFT VN+K+IR
Sbjct  95   DALNFTLVNNKAIR  108


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 30/84 (36%), Positives = 50/84 (60%), Gaps = 1/84 (1%)
 Frame = +1

Query  580  QSAAGAGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVN  759
            QS     ++    +LYV +L+ ++ D +L +LF++ G + S +V RD +   S G G+V 
Sbjct  306  QSMKETVDKFQGVNLYVKNLNDSIDDEKLKELFSEFGTITSCKVMRDPNG-ISRGSGFVA  364

Query  760  YSSPQDAARAMEVLNFTPVNSKSI  831
            +SSP +AARA+  +N   V SK +
Sbjct  365  FSSPDEAARALAGMNNKMVVSKPL  388



>ref|XP_010688794.1| PREDICTED: polyadenylate-binding protein 2-like [Beta vulgaris 
subsp. vulgaris]
Length=661

 Score =   132 bits (331),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 60/74 (81%), Positives = 69/74 (93%), Gaps = 0/74 (0%)
 Frame = +1

Query  613  TTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQDAARAM  792
            TTSLYVGDLD  V DSQLYDLFNQ+GQVVSVRVCRD+++RRSLGYGYVN+S+PQDA RA+
Sbjct  44   TTSLYVGDLDINVNDSQLYDLFNQIGQVVSVRVCRDLTTRRSLGYGYVNFSNPQDAVRAL  103

Query  793  EVLNFTPVNSKSIR  834
            +VLNFTP+N KSIR
Sbjct  104  DVLNFTPLNGKSIR  117


 Score = 57.8 bits (138),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 31/84 (37%), Positives = 51/84 (61%), Gaps = 1/84 (1%)
 Frame = +1

Query  580  QSAAGAGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVN  759
            QS   A ++    +LY+ +LD T+ D +L +LF   G++ S +V RD S   S G G+V 
Sbjct  315  QSMKEAADKYQGANLYIKNLDDTIDDEKLKELFADYGKITSCKVMRDPSG-ISKGSGFVA  373

Query  760  YSSPQDAARAMEVLNFTPVNSKSI  831
            +SSP++A+RA+  +N   + SK +
Sbjct  374  FSSPEEASRALAEMNGKIIVSKPL  397



>ref|XP_009415843.1| PREDICTED: polyadenylate-binding protein 2-like [Musa acuminata 
subsp. malaccensis]
Length=651

 Score =   132 bits (331),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 72/114 (63%), Positives = 84/114 (74%), Gaps = 13/114 (11%)
 Frame = +1

Query  493  MAQIQVQHQSpvalangvpppgavglpapQSAAGAGNQLSTTSLYVGDLDPTVTDSQLYD  672
            MAQ+QVQ Q P  +AN               AAG  NQ  ++SLYVGDLD  VTDSQLYD
Sbjct  1    MAQVQVQPQPPNGMANNG------------GAAGV-NQFPSSSLYVGDLDVNVTDSQLYD  47

Query  673  LFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQDAARAMEVLNFTPVNSKSIR  834
            LF+Q+GQVVSVRVCRDI +RRSLGY YVNY+SP DAARA++ LNFTP+N+K IR
Sbjct  48   LFSQIGQVVSVRVCRDIGTRRSLGYAYVNYNSPVDAARALDALNFTPLNNKPIR  101


 Score = 57.0 bits (136),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 29/84 (35%), Positives = 50/84 (60%), Gaps = 1/84 (1%)
 Frame = +1

Query  580  QSAAGAGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVN  759
            QS   A ++    +LY+ +LD  + D  L +LF++ G + S ++ RD S   S G G+V 
Sbjct  299  QSIKEAADKYQGLNLYLKNLDDDIGDDSLKELFSEYGTITSCKIMRDPSG-ASKGSGFVA  357

Query  760  YSSPQDAARAMEVLNFTPVNSKSI  831
            +S+P++AARA+  +N   +N K +
Sbjct  358  FSTPEEAARALADMNGKMINGKPL  381



>dbj|BAJ53194.1| JHL03K20.3 [Jatropha curcas]
Length=642

 Score =   131 bits (330),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 59/83 (71%), Positives = 73/83 (88%), Gaps = 0/83 (0%)
 Frame = +1

Query  586  AAGAGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNYS  765
            A+  GNQ  +TSLYVGDL+  VT++QLYDLFNQ+GQ+VS+RVCRD++SRRSLGYGYVNY+
Sbjct  19   ASNGGNQFVSTSLYVGDLEQNVTETQLYDLFNQLGQIVSIRVCRDLTSRRSLGYGYVNYN  78

Query  766  SPQDAARAMEVLNFTPVNSKSIR  834
            +  DAA+A+EVLNFTPVN K IR
Sbjct  79   NVHDAAQALEVLNFTPVNGKPIR  101


 Score = 51.6 bits (122),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 26/77 (34%), Positives = 49/77 (64%), Gaps = 1/77 (1%)
 Frame = +1

Query  601  NQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQDA  780
            ++    +LYV +LD ++TD +L +LF++ G + S +V RD +   S G G+V YS+ ++A
Sbjct  306  DKFEGLNLYVKNLDDSITDDKLKELFSEFGTITSCKVMRDPNG-VSKGSGFVAYSTAEEA  364

Query  781  ARAMEVLNFTPVNSKSI  831
            ++A+  +N   + SK +
Sbjct  365  SKALTEMNGKMIVSKPL  381


 Score = 50.8 bits (120),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 27/81 (33%), Positives = 48/81 (59%), Gaps = 7/81 (9%)
 Frame = +1

Query  589  AGAGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNYSS  768
            +GAGN      +Y+ +LD  + +  L+D F+  G ++S +V  D S+ +SLGYG+V + +
Sbjct  114  SGAGN------IYIKNLDKAIDNKALHDTFSAFGNILSCKVATD-SAGQSLGYGFVQFDN  166

Query  769  PQDAARAMEVLNFTPVNSKSI  831
             + A  A++ LN   +N K +
Sbjct  167  EESAKNAIDKLNGMLLNDKQV  187



>dbj|BAJ95976.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=530

 Score =   130 bits (327),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 63/84 (75%), Positives = 71/84 (85%), Gaps = 1/84 (1%)
 Frame = +1

Query  586  AAGAGNQ-LSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNY  762
            A GA  Q L TTSLYVGDL+  VTDSQLY+LF+Q GQVVSVRVCRD++SRRSLGY YVNY
Sbjct  111  AGGAAQQPLPTTSLYVGDLEANVTDSQLYELFSQAGQVVSVRVCRDVNSRRSLGYAYVNY  170

Query  763  SSPQDAARAMEVLNFTPVNSKSIR  834
            S+P DAARAME LNF P+N+K IR
Sbjct  171  SNPMDAARAMEALNFAPLNNKPIR  194


 Score = 51.2 bits (121),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 26/84 (31%), Positives = 52/84 (62%), Gaps = 1/84 (1%)
 Frame = +1

Query  580  QSAAGAGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVN  759
            QS   A ++    +LY+ +LD  +TD QL +LF+  G++ S ++ RD +   S G G+V+
Sbjct  392  QSMKDAADKYQGQNLYLKNLDDGITDDQLRELFSNFGKITSCKIMRDQNG-VSKGSGFVS  450

Query  760  YSSPQDAARAMEVLNFTPVNSKSI  831
            +S+ ++A++A+  +N   ++ K +
Sbjct  451  FSTREEASQALTEMNGKMISGKPL  474



>ref|XP_002883899.1| hypothetical protein ARALYDRAFT_899764 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60158.1| hypothetical protein ARALYDRAFT_899764 [Arabidopsis lyrata subsp. 
lyrata]
Length=655

 Score =   131 bits (330),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 58/83 (70%), Positives = 71/83 (86%), Gaps = 0/83 (0%)
 Frame = +1

Query  586  AAGAGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNYS  765
             A A  Q  TTSLYVGDLDP VTDSQL+D F+Q+GQVVSVRVCRD+++RRSLGYGYVN++
Sbjct  30   GAAAAAQFGTTSLYVGDLDPNVTDSQLFDAFSQMGQVVSVRVCRDLATRRSLGYGYVNFT  89

Query  766  SPQDAARAMEVLNFTPVNSKSIR  834
            SPQDAARA++ LN+ P+N K +R
Sbjct  90   SPQDAARAIQELNYIPLNGKPVR  112


 Score = 57.0 bits (136),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 29/84 (35%), Positives = 52/84 (62%), Gaps = 1/84 (1%)
 Frame = +1

Query  580  QSAAGAGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVN  759
            QS   A ++  +++LYV +LD +V+D +L +LF   G V S +V RD +   S G G+V 
Sbjct  310  QSLKEAADKFQSSNLYVKNLDDSVSDEKLKELFTPYGTVTSCKVMRDPNG-MSRGSGFVA  368

Query  760  YSSPQDAARAMEVLNFTPVNSKSI  831
            +S+P++A +AM  ++   + +K +
Sbjct  369  FSTPEEATKAMSEMSGKMIENKPL  392


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/69 (36%), Positives = 43/69 (62%), Gaps = 1/69 (1%)
 Frame = +1

Query  598  GNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQD  777
            GN+   T++YV +L  + TD  L ++F + G++ S  V +D    +  G+G+VN+ +  D
Sbjct  213  GNKTIFTNVYVKNLAESTTDDDLKNIFGEFGKITSAVVMKD-GEGKPKGFGFVNFENADD  271

Query  778  AARAMEVLN  804
            AA+A+E LN
Sbjct  272  AAKAVESLN  280



>ref|XP_012079275.1| PREDICTED: polyadenylate-binding protein 4-like [Jatropha curcas]
 gb|KDP31970.1| hypothetical protein JCGZ_12431 [Jatropha curcas]
Length=642

 Score =   131 bits (329),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 59/83 (71%), Positives = 73/83 (88%), Gaps = 0/83 (0%)
 Frame = +1

Query  586  AAGAGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNYS  765
            A+  GNQ  +TSLYVGDL+  VT++QLYDLFNQ+GQ+VS+RVCRD++SRRSLGYGYVNY+
Sbjct  19   ASNGGNQFVSTSLYVGDLEQNVTETQLYDLFNQLGQIVSIRVCRDLTSRRSLGYGYVNYN  78

Query  766  SPQDAARAMEVLNFTPVNSKSIR  834
            +  DAA+A+EVLNFTPVN K IR
Sbjct  79   NVHDAAQALEVLNFTPVNGKPIR  101


 Score = 51.2 bits (121),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 26/77 (34%), Positives = 49/77 (64%), Gaps = 1/77 (1%)
 Frame = +1

Query  601  NQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQDA  780
            ++    +LYV +LD ++TD +L +LF++ G + S +V RD +   S G G+V YS+ ++A
Sbjct  306  DKFEGLNLYVKNLDDSITDDKLKELFSEFGTITSCKVMRDPNG-VSKGSGFVAYSTAEEA  364

Query  781  ARAMEVLNFTPVNSKSI  831
            ++A+  +N   + SK +
Sbjct  365  SKALTEMNGKMIVSKPL  381



>ref|XP_010519297.1| PREDICTED: polyadenylate-binding protein 8-like [Tarenaya hassleriana]
Length=649

 Score =   131 bits (329),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 60/77 (78%), Positives = 69/77 (90%), Gaps = 0/77 (0%)
 Frame = +1

Query  604  QLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQDAA  783
            QL TTSLYVGDLDPTVTDSQL++ F+QVGQVVSVRVCRD+S+RRSLGYGYVNY +PQDAA
Sbjct  23   QLGTTSLYVGDLDPTVTDSQLFETFSQVGQVVSVRVCRDMSTRRSLGYGYVNYGNPQDAA  82

Query  784  RAMEVLNFTPVNSKSIR  834
            RA+  LNF  +N K+IR
Sbjct  83   RALNELNFIALNGKAIR  99


 Score = 55.5 bits (132),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 31/84 (37%), Positives = 52/84 (62%), Gaps = 1/84 (1%)
 Frame = +1

Query  580  QSAAGAGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVN  759
            QS   A ++   ++LYV +LD ++ D +L +LF+  G + S +V +D S   S G G+V 
Sbjct  297  QSLKEAADRSQGSNLYVKNLDDSIADEKLKELFSPFGTITSCKVMKDPSG-VSKGSGFVA  355

Query  760  YSSPQDAARAMEVLNFTPVNSKSI  831
            +SSP++A+RA+  +N   V SK +
Sbjct  356  FSSPEEASRAIVEMNGKMVVSKPL  379


 Score = 55.1 bits (131),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 42/63 (67%), Gaps = 1/63 (2%)
 Frame = +1

Query  616  TSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQDAARAME  795
            T++YV ++  ++TD +L  +F + G + S  + RD    +S G+G+VN+ +P DAA+A+E
Sbjct  206  TNVYVKNISESMTDEELSKIFVEFGPITSCVIMRD-GEGKSKGFGFVNFENPDDAAKAVE  264

Query  796  VLN  804
             LN
Sbjct  265  ALN  267



>ref|XP_004230758.1| PREDICTED: polyadenylate-binding protein 8-like [Solanum lycopersicum]
Length=643

 Score =   131 bits (329),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 62/85 (73%), Positives = 72/85 (85%), Gaps = 0/85 (0%)
 Frame = +1

Query  580  QSAAGAGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVN  759
            Q A  +G     TSLYVGDLD  VTDSQLYDLFNQ+GQVVSVRVCRD++++RSLGYGYVN
Sbjct  9    QGANASGVNQFVTSLYVGDLDVNVTDSQLYDLFNQLGQVVSVRVCRDLTTQRSLGYGYVN  68

Query  760  YSSPQDAARAMEVLNFTPVNSKSIR  834
            Y +PQDAARA+EVLNFTP++ K IR
Sbjct  69   YGNPQDAARALEVLNFTPLSGKPIR  93


 Score = 57.0 bits (136),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 31/84 (37%), Positives = 53/84 (63%), Gaps = 1/84 (1%)
 Frame = +1

Query  580  QSAAGAGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVN  759
            QSA  A ++    +LY+ +LD +++D +L D+F+  G + S +V RD S   S G G+V 
Sbjct  291  QSAKEAVDKSQGLNLYIKNLDDSISDDKLKDMFSTYGTITSCKVMRDPSG-VSKGSGFVA  349

Query  760  YSSPQDAARAMEVLNFTPVNSKSI  831
            +SSP++A+RA+  +N   + SK +
Sbjct  350  FSSPEEASRALAEMNGKMIVSKPL  373



>ref|XP_010270544.1| PREDICTED: polyadenylate-binding protein 2-like isoform X2 [Nelumbo 
nucifera]
Length=648

 Score =   130 bits (328),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 72/114 (63%), Positives = 85/114 (75%), Gaps = 13/114 (11%)
 Frame = +1

Query  493  MAQIQVQHQSpvalangvpppgavglpapQSAAGAGNQLSTTSLYVGDLDPTVTDSQLYD  672
            MAQ+QVQ Q P++  NG   P              GNQ  +TSLYVGDL+  VTDSQLYD
Sbjct  1    MAQVQVQPQPPLSGPNGATNP-------------GGNQFVSTSLYVGDLELNVTDSQLYD  47

Query  673  LFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQDAARAMEVLNFTPVNSKSIR  834
            LF+Q+GQVVSVRVCRD+S+RRSLGY YVNYS+ QDAARA++VLNFTP+N K IR
Sbjct  48   LFSQLGQVVSVRVCRDLSTRRSLGYAYVNYSNTQDAARALDVLNFTPLNGKPIR  101


 Score = 55.8 bits (133),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 30/84 (36%), Positives = 53/84 (63%), Gaps = 1/84 (1%)
 Frame = +1

Query  580  QSAAGAGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVN  759
            QSA  A ++    +LYV +LD ++ D +L +LF++ G + S +V RD +   S G G+V 
Sbjct  299  QSAKEAVDKYQGVNLYVKNLDDSIGDDKLKELFSEFGTITSCKVMRDPNG-ISRGSGFVA  357

Query  760  YSSPQDAARAMEVLNFTPVNSKSI  831
            +S+P++A+RA+  +N   + SK +
Sbjct  358  FSAPEEASRALAEMNGKMIVSKPL  381



>ref|XP_010270536.1| PREDICTED: polyadenylate-binding protein 2-like isoform X1 [Nelumbo 
nucifera]
Length=654

 Score =   130 bits (328),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 72/114 (63%), Positives = 85/114 (75%), Gaps = 13/114 (11%)
 Frame = +1

Query  493  MAQIQVQHQSpvalangvpppgavglpapQSAAGAGNQLSTTSLYVGDLDPTVTDSQLYD  672
            MAQ+QVQ Q P++  NG   P              GNQ  +TSLYVGDL+  VTDSQLYD
Sbjct  1    MAQVQVQPQPPLSGPNGATNP-------------GGNQFVSTSLYVGDLELNVTDSQLYD  47

Query  673  LFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQDAARAMEVLNFTPVNSKSIR  834
            LF+Q+GQVVSVRVCRD+S+RRSLGY YVNYS+ QDAARA++VLNFTP+N K IR
Sbjct  48   LFSQLGQVVSVRVCRDLSTRRSLGYAYVNYSNTQDAARALDVLNFTPLNGKPIR  101


 Score = 55.8 bits (133),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 30/84 (36%), Positives = 53/84 (63%), Gaps = 1/84 (1%)
 Frame = +1

Query  580  QSAAGAGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVN  759
            QSA  A ++    +LYV +LD ++ D +L +LF++ G + S +V RD +   S G G+V 
Sbjct  299  QSAKEAVDKYQGVNLYVKNLDDSIGDDKLKELFSEFGTITSCKVMRDPNG-ISRGSGFVA  357

Query  760  YSSPQDAARAMEVLNFTPVNSKSI  831
            +S+P++A+RA+  +N   + SK +
Sbjct  358  FSAPEEASRALAEMNGKMIVSKPL  381



>ref|XP_006855143.1| PREDICTED: polyadenylate-binding protein 2 [Amborella trichopoda]
 gb|ERN16610.1| hypothetical protein AMTR_s00051p00026490 [Amborella trichopoda]
Length=654

 Score =   130 bits (328),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 68/114 (60%), Positives = 83/114 (73%), Gaps = 14/114 (12%)
 Frame = +1

Query  493  MAQIQVQHQSpvalangvpppgavglpapQSAAGAGNQLSTTSLYVGDLDPTVTDSQLYD  672
            MAQ+Q+Q Q P++                 +A   GNQ  +TSLYVGDL+  VTDSQLYD
Sbjct  1    MAQVQIQPQPPLSAQ--------------NAANNGGNQFVSTSLYVGDLEANVTDSQLYD  46

Query  673  LFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQDAARAMEVLNFTPVNSKSIR  834
            LF+Q+GQVVSVRVCRD+S+RRSLGY YVNYS+ QD+ARA+EVLNFT +N K IR
Sbjct  47   LFSQLGQVVSVRVCRDLSTRRSLGYAYVNYSNTQDSARALEVLNFTILNGKPIR  100


 Score = 54.7 bits (130),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 27/77 (35%), Positives = 50/77 (65%), Gaps = 1/77 (1%)
 Frame = +1

Query  601  NQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQDA  780
            ++    +LY+ +LD +++D +L +LF++ G + S +V RD +   S G G+V +SSP++A
Sbjct  305  DKFQGVNLYLKNLDDSISDDKLRELFSEFGTITSCKVMRDPNG-ISRGSGFVAFSSPEEA  363

Query  781  ARAMEVLNFTPVNSKSI  831
            +RA+  +N   V SK +
Sbjct  364  SRALAEMNGKIVVSKPL  380



>ref|XP_010928350.1| PREDICTED: polyadenylate-binding protein 8-like isoform X2 [Elaeis 
guineensis]
Length=633

 Score =   130 bits (326),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 59/78 (76%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = +1

Query  601  NQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQDA  780
            NQ  +TSLYVGDL+  VTD+QL+D+FNQVGQVVSVRVCRDI++RRSLGY YVNYS+P DA
Sbjct  28   NQFPSTSLYVGDLELNVTDAQLFDVFNQVGQVVSVRVCRDINTRRSLGYAYVNYSNPVDA  87

Query  781  ARAMEVLNFTPVNSKSIR  834
            ARA+E+LNFTP+N K IR
Sbjct  88   ARALEMLNFTPLNGKPIR  105


 Score = 50.8 bits (120),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 26/79 (33%), Positives = 48/79 (61%), Gaps = 1/79 (1%)
 Frame = +1

Query  595  AGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQ  774
            A ++    +LY+ +LD ++ D +L +LF++ G + S +V RD +   S G G+V + SP 
Sbjct  283  AADKNQGANLYLKNLDDSIGDDKLRELFSEFGTITSCKVMRDPNG-VSRGSGFVAFQSPD  341

Query  775  DAARAMEVLNFTPVNSKSI  831
            DA++A+  +N   + SK +
Sbjct  342  DASKALAEMNGRMIGSKPL  360



>ref|XP_010691731.1| PREDICTED: polyadenylate-binding protein 2-like [Beta vulgaris 
subsp. vulgaris]
Length=667

 Score =   130 bits (326),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 58/77 (75%), Positives = 72/77 (94%), Gaps = 0/77 (0%)
 Frame = +1

Query  604  QLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQDAA  783
            Q  TTSLYVGDL+  V+DSQLYD+FNQ+GQVVSVRVCRD+++RRSLGYGYVN+++PQDAA
Sbjct  34   QFVTTSLYVGDLEMNVSDSQLYDVFNQLGQVVSVRVCRDLTTRRSLGYGYVNFANPQDAA  93

Query  784  RAMEVLNFTPVNSKSIR  834
            RA++VLNFTP+N+K IR
Sbjct  94   RAIDVLNFTPLNNKPIR  110


 Score = 50.8 bits (120),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 27/75 (36%), Positives = 44/75 (59%), Gaps = 1/75 (1%)
 Frame = +1

Query  580  QSAAGAGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVN  759
            QS     +Q    +LY+ +LD T+ D +L +LF Q G + S ++ RD S   S G G+V 
Sbjct  308  QSVKEVVDQYQGKNLYIKNLDDTMDDDKLKELFTQFGTITSCKIMRDPSG-VSKGSGFVA  366

Query  760  YSSPQDAARAMEVLN  804
            +S+ ++A RA+  +N
Sbjct  367  FSTAEEATRALMEMN  381



>ref|XP_010928349.1| PREDICTED: polyadenylate-binding protein 2-like isoform X1 [Elaeis 
guineensis]
Length=658

 Score =   130 bits (326),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 59/78 (76%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = +1

Query  601  NQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQDA  780
            NQ  +TSLYVGDL+  VTD+QL+D+FNQVGQVVSVRVCRDI++RRSLGY YVNYS+P DA
Sbjct  28   NQFPSTSLYVGDLELNVTDAQLFDVFNQVGQVVSVRVCRDINTRRSLGYAYVNYSNPVDA  87

Query  781  ARAMEVLNFTPVNSKSIR  834
            ARA+E+LNFTP+N K IR
Sbjct  88   ARALEMLNFTPLNGKPIR  105


 Score = 51.2 bits (121),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 26/79 (33%), Positives = 48/79 (61%), Gaps = 1/79 (1%)
 Frame = +1

Query  595  AGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQ  774
            A ++    +LY+ +LD ++ D +L +LF++ G + S +V RD +   S G G+V + SP 
Sbjct  308  AADKNQGANLYLKNLDDSIGDDKLRELFSEFGTITSCKVMRDPNG-VSRGSGFVAFQSPD  366

Query  775  DAARAMEVLNFTPVNSKSI  831
            DA++A+  +N   + SK +
Sbjct  367  DASKALAEMNGRMIGSKPL  385



>dbj|BAJ86310.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=746

 Score =   130 bits (327),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 63/84 (75%), Positives = 71/84 (85%), Gaps = 1/84 (1%)
 Frame = +1

Query  586  AAGAGNQ-LSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNY  762
            A GA  Q L TTSLYVGDL+  VTDSQLY+LF+Q GQVVSVRVCRD++SRRSLGY YVNY
Sbjct  111  AGGAAQQPLPTTSLYVGDLEANVTDSQLYELFSQAGQVVSVRVCRDVNSRRSLGYAYVNY  170

Query  763  SSPQDAARAMEVLNFTPVNSKSIR  834
            S+P DAARAME LNF P+N+K IR
Sbjct  171  SNPMDAARAMEALNFAPLNNKPIR  194


 Score = 50.8 bits (120),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 26/84 (31%), Positives = 52/84 (62%), Gaps = 1/84 (1%)
 Frame = +1

Query  580  QSAAGAGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVN  759
            QS   A ++    +LY+ +LD  +TD QL +LF+  G++ S ++ RD +   S G G+V+
Sbjct  392  QSMKDAADKYQGQNLYLKNLDDGITDDQLRELFSNFGKITSCKIMRDQNG-VSKGSGFVS  450

Query  760  YSSPQDAARAMEVLNFTPVNSKSI  831
            +S+ ++A++A+  +N   ++ K +
Sbjct  451  FSTREEASQALTEMNGKMISGKPL  474



>emb|CDY67365.1| BnaA03g57640D [Brassica napus]
Length=292

 Score =   125 bits (315),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 55/79 (70%), Positives = 70/79 (89%), Gaps = 0/79 (0%)
 Frame = +1

Query  598  GNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQD  777
            G Q  TTSLYVGDLD +VTDSQL+D F+Q+GQVVSVRVCRD+++RRSLGYGYVN+++PQD
Sbjct  20   GAQFGTTSLYVGDLDASVTDSQLFDAFSQMGQVVSVRVCRDLATRRSLGYGYVNFATPQD  79

Query  778  AARAMEVLNFTPVNSKSIR  834
            AARA++ LN+ P+N K +R
Sbjct  80   AARAIQELNYIPLNGKPVR  98


 Score = 50.8 bits (120),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 26/70 (37%), Positives = 41/70 (59%), Gaps = 1/70 (1%)
 Frame = +1

Query  595  AGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQ  774
            A N    T++YV +L  + T+  L   F + G++ S  V RD    +S G+G+VN+   +
Sbjct  200  AANVTKFTNVYVKNLAESTTEDDLKSAFGKFGEITSAVVMRD-GDGKSKGFGFVNFEDAE  258

Query  775  DAARAMEVLN  804
            DAA+A+E LN
Sbjct  259  DAAKAVEGLN  268



>ref|XP_002285190.1| PREDICTED: polyadenylate-binding protein 2 [Vitis vinifera]
 emb|CAN65906.1| hypothetical protein VITISV_004873 [Vitis vinifera]
Length=648

 Score =   129 bits (325),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 60/77 (78%), Positives = 69/77 (90%), Gaps = 0/77 (0%)
 Frame = +1

Query  604  QLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQDAA  783
            Q  TTSLYVGDL+  V DSQLYDLF+Q+G VVSVRVCRD+S+RRSLGYGYVNYS+PQDAA
Sbjct  26   QFVTTSLYVGDLELNVNDSQLYDLFSQMGAVVSVRVCRDLSTRRSLGYGYVNYSNPQDAA  85

Query  784  RAMEVLNFTPVNSKSIR  834
            RA++VLNFTP+N K IR
Sbjct  86   RALDVLNFTPLNGKPIR  102


 Score = 55.8 bits (133),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 30/84 (36%), Positives = 51/84 (61%), Gaps = 1/84 (1%)
 Frame = +1

Query  580  QSAAGAGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVN  759
            Q+   A ++    +LY+ +LD ++ D +L +LF Q G + S +V RD +   S G G+V 
Sbjct  300  QNMKEAVDKFQGANLYIKNLDDSIGDDKLKELFAQFGTITSCKVMRDPNG-LSRGSGFVA  358

Query  760  YSSPQDAARAMEVLNFTPVNSKSI  831
            +SSP++A+RA+  +N   V SK +
Sbjct  359  FSSPEEASRALAEMNSKMVVSKPL  382



>emb|CBI19489.3| unnamed protein product [Vitis vinifera]
Length=621

 Score =   129 bits (324),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 60/84 (71%), Positives = 71/84 (85%), Gaps = 0/84 (0%)
 Frame = +1

Query  583  SAAGAGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNY  762
            + AG     +T SLYVGDLD  +TDSQLYDLF Q GQV+SVRVCRD+S+RRSLGYGYVNY
Sbjct  7    AVAGPNGVANTASLYVGDLDVNITDSQLYDLFIQAGQVLSVRVCRDLSTRRSLGYGYVNY  66

Query  763  SSPQDAARAMEVLNFTPVNSKSIR  834
            S+PQDAARA+++LNFTP+N K IR
Sbjct  67   SNPQDAARALDLLNFTPLNGKPIR  90



>ref|XP_002284923.1| PREDICTED: polyadenylate-binding protein 8 isoform X1 [Vitis 
vinifera]
 ref|XP_010664560.1| PREDICTED: polyadenylate-binding protein 8 isoform X2 [Vitis 
vinifera]
 emb|CAN76464.1| hypothetical protein VITISV_017035 [Vitis vinifera]
Length=640

 Score =   129 bits (324),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 60/84 (71%), Positives = 71/84 (85%), Gaps = 0/84 (0%)
 Frame = +1

Query  583  SAAGAGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNY  762
            + AG     +T SLYVGDLD  +TDSQLYDLF Q GQV+SVRVCRD+S+RRSLGYGYVNY
Sbjct  7    AVAGPNGVANTASLYVGDLDVNITDSQLYDLFIQAGQVLSVRVCRDLSTRRSLGYGYVNY  66

Query  763  SSPQDAARAMEVLNFTPVNSKSIR  834
            S+PQDAARA+++LNFTP+N K IR
Sbjct  67   SNPQDAARALDLLNFTPLNGKPIR  90



>ref|XP_009136272.1| PREDICTED: polyadenylate-binding protein 2-like isoform X1 [Brassica 
rapa]
Length=616

 Score =   128 bits (322),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 56/80 (70%), Positives = 71/80 (89%), Gaps = 0/80 (0%)
 Frame = +1

Query  595  AGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQ  774
            AG Q  TTSLYVGDLD +VTDSQL+D F+Q+GQVVSVRVCRD+++RRSLGYGYVN+++PQ
Sbjct  19   AGAQFGTTSLYVGDLDASVTDSQLFDAFSQMGQVVSVRVCRDLATRRSLGYGYVNFTTPQ  78

Query  775  DAARAMEVLNFTPVNSKSIR  834
            DAARA++ LN+ P+N K +R
Sbjct  79   DAARAIQELNYIPINGKPVR  98


 Score = 51.2 bits (121),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 25/79 (32%), Positives = 49/79 (62%), Gaps = 1/79 (1%)
 Frame = +1

Query  595  AGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQ  774
            A ++  + +LYV +LD +V++ +L ++F   G V S +V RD +   S G G+V +S+P+
Sbjct  304  AADKFQSCNLYVKNLDESVSEEKLKEMFAPYGTVTSSKVMRDTNGI-SRGAGFVAFSTPE  362

Query  775  DAARAMEVLNFTPVNSKSI  831
            +A +AM  ++   + +K +
Sbjct  363  EATKAMSEMSGKMIENKPL  381



>ref|XP_009136273.1| PREDICTED: polyadenylate-binding protein 2-like isoform X2 [Brassica 
rapa]
Length=614

 Score =   128 bits (322),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 56/80 (70%), Positives = 71/80 (89%), Gaps = 0/80 (0%)
 Frame = +1

Query  595  AGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQ  774
            AG Q  TTSLYVGDLD +VTDSQL+D F+Q+GQVVSVRVCRD+++RRSLGYGYVN+++PQ
Sbjct  19   AGAQFGTTSLYVGDLDASVTDSQLFDAFSQMGQVVSVRVCRDLATRRSLGYGYVNFTTPQ  78

Query  775  DAARAMEVLNFTPVNSKSIR  834
            DAARA++ LN+ P+N K +R
Sbjct  79   DAARAIQELNYIPINGKPVR  98


 Score = 51.2 bits (121),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 25/79 (32%), Positives = 49/79 (62%), Gaps = 1/79 (1%)
 Frame = +1

Query  595  AGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQ  774
            A ++  + +LYV +LD +V++ +L ++F   G V S +V RD +   S G G+V +S+P+
Sbjct  304  AADKFQSCNLYVKNLDESVSEEKLKEMFAPYGTVTSSKVMRDTNGI-SRGAGFVAFSTPE  362

Query  775  DAARAMEVLNFTPVNSKSI  831
            +A +AM  ++   + +K +
Sbjct  363  EATKAMSEMSGKMIENKPL  381



>ref|XP_007017178.1| Poly(A) binding protein 8 isoform 1 [Theobroma cacao]
 gb|EOY14403.1| Poly(A) binding protein 8 isoform 1 [Theobroma cacao]
Length=648

 Score =   128 bits (322),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 69/114 (61%), Positives = 84/114 (74%), Gaps = 12/114 (11%)
 Frame = +1

Query  493  MAQIQVQHQSpvalangvpppgavglpapQSAAGAGNQLSTTSLYVGDLDPTVTDSQLYD  672
            MAQIQVQHQ PV+  NGV            +    G Q   TSLYVGDLD TVTD QLY+
Sbjct  1    MAQIQVQHQPPVSGPNGV------------APGPGGAQFMPTSLYVGDLDVTVTDEQLYE  48

Query  673  LFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQDAARAMEVLNFTPVNSKSIR  834
            +F  V QVVSVRVCRD+++ RSLGYGYVNY++P+DAARA+++LNFTP+N+K IR
Sbjct  49   MFGSVAQVVSVRVCRDLATGRSLGYGYVNYNNPRDAARALDLLNFTPLNNKPIR  102


 Score = 57.4 bits (137),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 29/84 (35%), Positives = 51/84 (61%), Gaps = 1/84 (1%)
 Frame = +1

Query  580  QSAAGAGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVN  759
            Q+   A ++    +LY+ +LD ++ D  L +LF++ G + S +V RD S   S G G+V 
Sbjct  300  QTMKEAADKFQGVNLYIKNLDDSIGDENLKELFSEFGNITSCKVMRDPSG-ISKGSGFVA  358

Query  760  YSSPQDAARAMEVLNFTPVNSKSI  831
            +S+P++A+RA+  +N   V SK +
Sbjct  359  FSTPEEASRALAEMNGKMVVSKPL  382



>ref|XP_010263472.1| PREDICTED: polyadenylate-binding protein 2-like [Nelumbo nucifera]
Length=653

 Score =   129 bits (323),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 60/83 (72%), Positives = 72/83 (87%), Gaps = 0/83 (0%)
 Frame = +1

Query  586  AAGAGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNYS  765
            A   GNQ  ++SLYVGDL+  VTDSQLYDLF+Q+GQVVSVRVCRD+S+RRSLGY YVN+S
Sbjct  20   ANSGGNQFVSSSLYVGDLEFNVTDSQLYDLFSQLGQVVSVRVCRDLSTRRSLGYAYVNFS  79

Query  766  SPQDAARAMEVLNFTPVNSKSIR  834
            + QDAARA++VLNFTP+N K IR
Sbjct  80   NIQDAARALDVLNFTPLNGKPIR  102


 Score = 55.1 bits (131),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 28/84 (33%), Positives = 53/84 (63%), Gaps = 1/84 (1%)
 Frame = +1

Query  580  QSAAGAGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVN  759
            QS   A ++    +LYV +LD +++D +L +LF++ G + S +V RD +   S G G+V 
Sbjct  300  QSMKEAVDKFQGVNLYVKNLDDSISDEKLKELFSEFGTITSCKVMRDPNG-ISKGSGFVA  358

Query  760  YSSPQDAARAMEVLNFTPVNSKSI  831
            +++P++A+RA+  +N   V +K +
Sbjct  359  FTTPEEASRALAEMNGKMVVNKPL  382



>gb|KDO79130.1| hypothetical protein CISIN_1g006290mg [Citrus sinensis]
Length=467

 Score =   127 bits (318),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 69/114 (61%), Positives = 83/114 (73%), Gaps = 2/114 (2%)
 Frame = +1

Query  493  MAQIQVQHQSpvalangvpppgavglpapQSAAGAGNQLSTTSLYVGDLDPTVTDSQLYD  672
            MAQ+QVQ Q+PVA+A    P             G   Q  +TSLYVGDLD +V DSQLYD
Sbjct  1    MAQVQVQPQAPVAVAAQPSPATNGIAN--NGGVGDARQFVSTSLYVGDLDLSVNDSQLYD  58

Query  673  LFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQDAARAMEVLNFTPVNSKSIR  834
            LFNQ+GQVVSVRVCRD+S+RRSLGYGYVNY++  +A RA++ LNFTP+N K IR
Sbjct  59   LFNQMGQVVSVRVCRDLSTRRSLGYGYVNYNAAHEATRALDELNFTPLNGKPIR  112


 Score = 51.6 bits (122),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 27/84 (32%), Positives = 51/84 (61%), Gaps = 1/84 (1%)
 Frame = +1

Query  580  QSAAGAGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVN  759
            QS     ++    +LYV +LD +++D +L +LF++ G + S +V RD +   S G G+V 
Sbjct  310  QSLKETADKFEGLNLYVKNLDDSISDDKLKELFSEFGTITSCKVMRDPNG-ISRGSGFVA  368

Query  760  YSSPQDAARAMEVLNFTPVNSKSI  831
            +S+ ++A++A+  +N   V SK +
Sbjct  369  FSTAEEASKALTEMNGKMVVSKPL  392



>ref|XP_008788846.1| PREDICTED: polyadenylate-binding protein 2-like [Phoenix dactylifera]
Length=665

 Score =   127 bits (320),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 57/78 (73%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = +1

Query  601  NQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQDA  780
            NQ  +TSLYVGDL+ +VTDSQL+D+F+QVGQVVSVRVCRD+++RRSLGY YVNY +P DA
Sbjct  34   NQFPSTSLYVGDLELSVTDSQLFDVFHQVGQVVSVRVCRDVNTRRSLGYAYVNYINPVDA  93

Query  781  ARAMEVLNFTPVNSKSIR  834
            ARA+E+LNFTP+N K IR
Sbjct  94   ARALEMLNFTPLNGKPIR  111


 Score = 52.0 bits (123),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 26/79 (33%), Positives = 48/79 (61%), Gaps = 1/79 (1%)
 Frame = +1

Query  595  AGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQ  774
            A ++    +LY+ +LD ++ D +L +LF++ G + S +V RD +   S G G+V + SP 
Sbjct  314  AADKNQGANLYLKNLDDSIGDDKLRELFSEFGTITSCKVMRDPNG-ASRGSGFVAFQSPD  372

Query  775  DAARAMEVLNFTPVNSKSI  831
            DA++A+  +N   + SK +
Sbjct  373  DASKALVEMNGKMIGSKPL  391



>ref|XP_003580095.1| PREDICTED: polyadenylate-binding protein 2-like [Brachypodium 
distachyon]
Length=661

 Score =   127 bits (319),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 58/83 (70%), Positives = 71/83 (86%), Gaps = 0/83 (0%)
 Frame = +1

Query  586  AAGAGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNYS  765
            + G    L TTSLYVGDL+ +VTDSQLY+LF+Q GQVVSVRVCRD++SRRSLGY YVN+S
Sbjct  27   SVGVAQPLPTTSLYVGDLEASVTDSQLYELFSQAGQVVSVRVCRDVNSRRSLGYAYVNFS  86

Query  766  SPQDAARAMEVLNFTPVNSKSIR  834
            +P DAARA+E+LNF P+N+K IR
Sbjct  87   NPMDAARALEMLNFVPLNNKPIR  109



>gb|KHG04753.1| Polyadenylate-binding 2 -like protein [Gossypium arboreum]
Length=590

 Score =   126 bits (317),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 71/114 (62%), Positives = 83/114 (73%), Gaps = 11/114 (10%)
 Frame = +1

Query  493  MAQIQVQHQSpvalangvpppgavglpapQSAAGAGNQLSTTSLYVGDLDPTVTDSQLYD  672
            MAQIQVQHQ+PV+  NGV              A  G Q   TSLYVGDLD TVTD QLY 
Sbjct  1    MAQIQVQHQAPVSGPNGVA-----------PGASGGAQFMLTSLYVGDLDVTVTDEQLYQ  49

Query  673  LFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQDAARAMEVLNFTPVNSKSIR  834
            LF+QV  V SVRVCRD++S RSLGYGYVNY++ +DAARAM++LNFTP+N+K IR
Sbjct  50   LFSQVAPVASVRVCRDLASGRSLGYGYVNYNNLRDAARAMDLLNFTPLNNKPIR  103



>gb|AFW58789.1| hypothetical protein ZEAMMB73_983608 [Zea mays]
Length=412

 Score =   125 bits (313),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 59/83 (71%), Positives = 69/83 (83%), Gaps = 0/83 (0%)
 Frame = +1

Query  586  AAGAGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNYS  765
            A G    L TTSLYVGDL+  V+DSQLY+LF+Q GQVVSVRVCRD++SRRSLGY YVNYS
Sbjct  24   AVGVAQPLPTTSLYVGDLEGAVSDSQLYELFSQAGQVVSVRVCRDVTSRRSLGYAYVNYS  83

Query  766  SPQDAARAMEVLNFTPVNSKSIR  834
            +P DAARA+EVLNF  +N+K IR
Sbjct  84   NPLDAARALEVLNFAALNNKPIR  106



>gb|KDO79129.1| hypothetical protein CISIN_1g006290mg [Citrus sinensis]
Length=650

 Score =   127 bits (318),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 69/114 (61%), Positives = 83/114 (73%), Gaps = 2/114 (2%)
 Frame = +1

Query  493  MAQIQVQHQSpvalangvpppgavglpapQSAAGAGNQLSTTSLYVGDLDPTVTDSQLYD  672
            MAQ+QVQ Q+PVA+A    P             G   Q  +TSLYVGDLD +V DSQLYD
Sbjct  1    MAQVQVQPQAPVAVAAQPSPATNGIAN--NGGVGDARQFVSTSLYVGDLDLSVNDSQLYD  58

Query  673  LFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQDAARAMEVLNFTPVNSKSIR  834
            LFNQ+GQVVSVRVCRD+S+RRSLGYGYVNY++  +A RA++ LNFTP+N K IR
Sbjct  59   LFNQMGQVVSVRVCRDLSTRRSLGYGYVNYNAAHEATRALDELNFTPLNGKPIR  112


 Score = 51.2 bits (121),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 27/84 (32%), Positives = 51/84 (61%), Gaps = 1/84 (1%)
 Frame = +1

Query  580  QSAAGAGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVN  759
            QS     ++    +LYV +LD +++D +L +LF++ G + S +V RD +   S G G+V 
Sbjct  310  QSLKETADKFEGLNLYVKNLDDSISDDKLKELFSEFGTITSCKVMRDPNG-ISRGSGFVA  368

Query  760  YSSPQDAARAMEVLNFTPVNSKSI  831
            +S+ ++A++A+  +N   V SK +
Sbjct  369  FSTAEEASKALTEMNGKMVVSKPL  392



>ref|NP_001275799.1| poly A-binding protein 2 [Citrus sinensis]
 gb|AEV43365.1| poly A-binding protein 2 [Citrus sinensis]
 gb|KDO79128.1| hypothetical protein CISIN_1g006290mg [Citrus sinensis]
Length=652

 Score =   127 bits (318),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 69/114 (61%), Positives = 83/114 (73%), Gaps = 2/114 (2%)
 Frame = +1

Query  493  MAQIQVQHQSpvalangvpppgavglpapQSAAGAGNQLSTTSLYVGDLDPTVTDSQLYD  672
            MAQ+QVQ Q+PVA+A    P             G   Q  +TSLYVGDLD +V DSQLYD
Sbjct  1    MAQVQVQPQAPVAVAAQPSPATNGIAN--NGGVGDARQFVSTSLYVGDLDLSVNDSQLYD  58

Query  673  LFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQDAARAMEVLNFTPVNSKSIR  834
            LFNQ+GQVVSVRVCRD+S+RRSLGYGYVNY++  +A RA++ LNFTP+N K IR
Sbjct  59   LFNQMGQVVSVRVCRDLSTRRSLGYGYVNYNAAHEATRALDELNFTPLNGKPIR  112


 Score = 51.2 bits (121),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 27/84 (32%), Positives = 51/84 (61%), Gaps = 1/84 (1%)
 Frame = +1

Query  580  QSAAGAGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVN  759
            QS     ++    +LYV +LD +++D +L +LF++ G + S +V RD +   S G G+V 
Sbjct  310  QSLKETADKFEGLNLYVKNLDDSISDDKLKELFSEFGTITSCKVMRDPNG-ISRGSGFVA  368

Query  760  YSSPQDAARAMEVLNFTPVNSKSI  831
            +S+ ++A++A+  +N   V SK +
Sbjct  369  FSTAEEASKALTEMNGKMVVSKPL  392



>ref|XP_010526963.1| PREDICTED: polyadenylate-binding protein 2-like [Tarenaya hassleriana]
Length=638

 Score =   126 bits (317),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 58/80 (73%), Positives = 71/80 (89%), Gaps = 0/80 (0%)
 Frame = +1

Query  595  AGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQ  774
            +G Q  TTSLYVGDL+  VTDSQL+D+F+QVGQVVSVRVCRD+++RRSLGYGYVN+S+PQ
Sbjct  22   SGAQFGTTSLYVGDLEANVTDSQLFDVFSQVGQVVSVRVCRDLATRRSLGYGYVNFSNPQ  81

Query  775  DAARAMEVLNFTPVNSKSIR  834
            DAARA++ LNF  +N KSIR
Sbjct  82   DAARAIQELNFMTLNGKSIR  101


 Score = 51.2 bits (121),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 27/75 (36%), Positives = 43/75 (57%), Gaps = 1/75 (1%)
 Frame = +1

Query  580  QSAAGAGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVN  759
            Q    A N+   T+++V +L  + TD  L ++F + GQ+ S  V +D    +S G+G+VN
Sbjct  196  QERESAVNKTKFTNVFVKNLAESTTDDDLKNIFGEFGQITSAVVMKD-GDGKSKGFGFVN  254

Query  760  YSSPQDAARAMEVLN  804
            + S  DA  A+E LN
Sbjct  255  FESADDAGNAVESLN  269



>dbj|BAJ53195.1| JHL03K20.4 [Jatropha curcas]
Length=642

 Score =   125 bits (315),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 58/78 (74%), Positives = 68/78 (87%), Gaps = 0/78 (0%)
 Frame = +1

Query  601  NQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQDA  780
            NQ   TSLYVGDL+  VT++QLYDLFNQ GQVVS+RVCRD++SRRSLGYGYVNY++  DA
Sbjct  24   NQFVPTSLYVGDLEQNVTETQLYDLFNQHGQVVSIRVCRDLTSRRSLGYGYVNYNNVHDA  83

Query  781  ARAMEVLNFTPVNSKSIR  834
            A+A+EVLNFTPVN K IR
Sbjct  84   AQAIEVLNFTPVNGKPIR  101


 Score = 52.4 bits (124),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 27/77 (35%), Positives = 49/77 (64%), Gaps = 1/77 (1%)
 Frame = +1

Query  601  NQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQDA  780
            ++    +LYV +LD ++TD +L +LF++ G + S +V RD +   S G G+V +S+ ++A
Sbjct  306  DKFQGLNLYVKNLDDSITDDKLKELFSEFGTITSCKVMRDPNG-VSRGSGFVAFSTAEEA  364

Query  781  ARAMEVLNFTPVNSKSI  831
            +RA+  +N   V SK +
Sbjct  365  SRALTEMNGKMVVSKPL  381



>ref|XP_012079276.1| PREDICTED: polyadenylate-binding protein 4-like [Jatropha curcas]
Length=642

 Score =   125 bits (315),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 58/78 (74%), Positives = 68/78 (87%), Gaps = 0/78 (0%)
 Frame = +1

Query  601  NQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQDA  780
            NQ   TSLYVGDL+  VT++QLYDLFNQ GQVVS+RVCRD++SRRSLGYGYVNY++  DA
Sbjct  24   NQFVPTSLYVGDLEQNVTETQLYDLFNQHGQVVSIRVCRDLTSRRSLGYGYVNYNNVHDA  83

Query  781  ARAMEVLNFTPVNSKSIR  834
            A+A+EVLNFTPVN K IR
Sbjct  84   AQAIEVLNFTPVNGKPIR  101


 Score = 52.4 bits (124),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 27/77 (35%), Positives = 49/77 (64%), Gaps = 1/77 (1%)
 Frame = +1

Query  601  NQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQDA  780
            ++    +LYV +LD ++TD +L +LF++ G + S +V RD +   S G G+V +S+ ++A
Sbjct  306  DKFQGLNLYVKNLDDSITDDKLKELFSEFGTITSCKVMRDPNG-VSRGSGFVAFSTAEEA  364

Query  781  ARAMEVLNFTPVNSKSI  831
            +RA+  +N   V SK +
Sbjct  365  SRALTEMNGKMVVSKPL  381



>ref|XP_006409548.1| hypothetical protein EUTSA_v10022589mg [Eutrema salsugineum]
 gb|ESQ51001.1| hypothetical protein EUTSA_v10022589mg [Eutrema salsugineum]
Length=649

 Score =   125 bits (315),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 56/77 (73%), Positives = 68/77 (88%), Gaps = 0/77 (0%)
 Frame = +1

Query  604  QLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQDAA  783
            Q  TTSLYVGDLD  VTDSQL+D F+Q+GQVVSVRVCRD+++RRSLGYGYVN+SSPQDAA
Sbjct  29   QFGTTSLYVGDLDANVTDSQLFDAFSQMGQVVSVRVCRDLATRRSLGYGYVNFSSPQDAA  88

Query  784  RAMEVLNFTPVNSKSIR  834
            RA++ LN+ P+N K +R
Sbjct  89   RAIQELNYIPLNGKPVR  105


 Score = 55.5 bits (132),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 29/84 (35%), Positives = 53/84 (63%), Gaps = 1/84 (1%)
 Frame = +1

Query  580  QSAAGAGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVN  759
            QS   A ++  +++LYV +LD +V+D +L +LF   G V S +V RD +   S G G+V 
Sbjct  303  QSLKEAADKFQSSNLYVKNLDDSVSDEKLKELFAPYGTVTSCKVMRDPNG-ISRGSGFVA  361

Query  760  YSSPQDAARAMEVLNFTPVNSKSI  831
            +S+P++A +AM  ++   +++K +
Sbjct  362  FSTPEEATKAMSEMSGKMIDNKPL  385


 Score = 52.4 bits (124),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 25/63 (40%), Positives = 41/63 (65%), Gaps = 1/63 (2%)
 Frame = +1

Query  616  TSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQDAARAME  795
            T++YV +L  T TD +L + F + G++ S  V +D    +S G+G+VN+ +  DAA+A+E
Sbjct  212  TNVYVKNLAETTTDDELKNTFGEFGKITSAVVMKD-GDGKSKGFGFVNFDNADDAAKAVE  270

Query  796  VLN  804
             LN
Sbjct  271  ALN  273



>gb|KFK40021.1| hypothetical protein AALP_AA3G319900 [Arabis alpina]
Length=651

 Score =   125 bits (315),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 60/86 (70%), Positives = 73/86 (85%), Gaps = 3/86 (3%)
 Frame = +1

Query  586  AAGAGN---QLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYV  756
            AAG+G    Q  TTSLYVGDLD TVTDSQL+D F+Q+GQVVSVRVCRD+++RRSLGYGYV
Sbjct  21   AAGSGPNGAQFGTTSLYVGDLDATVTDSQLFDAFSQMGQVVSVRVCRDLTTRRSLGYGYV  80

Query  757  NYSSPQDAARAMEVLNFTPVNSKSIR  834
            N+SS QDAARA++ LN+ P+N K +R
Sbjct  81   NFSSAQDAARAIQELNYIPLNGKPVR  106


 Score = 55.5 bits (132),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 29/84 (35%), Positives = 52/84 (62%), Gaps = 1/84 (1%)
 Frame = +1

Query  580  QSAAGAGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVN  759
            QS   A ++  +++LYV +LD +V+D +L +LF   G V S +V RD +   S G G+V 
Sbjct  304  QSLKEAADKFQSSNLYVKNLDDSVSDEKLKELFTPYGTVTSCKVMRDPNG-ISRGSGFVA  362

Query  760  YSSPQDAARAMEVLNFTPVNSKSI  831
            +S+P++A +AM  ++   + +K +
Sbjct  363  FSTPEEATKAMSEMSGKMIENKPL  386


 Score = 51.6 bits (122),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 28/81 (35%), Positives = 46/81 (57%), Gaps = 7/81 (9%)
 Frame = +1

Query  589  AGAGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNYSS  768
            +GAGN      +++ +LD ++    L+D F+  G ++S +V  D  S +S GYG+V Y +
Sbjct  119  SGAGN------IFIKNLDKSIDHKALHDTFSTFGNIISCKVAVD-GSGQSKGYGFVQYET  171

Query  769  PQDAARAMEVLNFTPVNSKSI  831
             + A RAM  LN   +N K +
Sbjct  172  EESAQRAMAQLNGMLLNDKQV  192



>gb|KHG19377.1| Polyadenylate-binding protein 1-like 2 [Gossypium arboreum]
Length=647

 Score =   125 bits (314),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 52/73 (71%), Positives = 67/73 (92%), Gaps = 0/73 (0%)
 Frame = +1

Query  616  TSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQDAARAME  795
            TSLYVGDLDP+VT++QLY+ FN +GQ+++VR+C D+S+RRSLGYGYVNY +PQDAARA+E
Sbjct  26   TSLYVGDLDPSVTETQLYEYFNHIGQLLTVRLCTDLSTRRSLGYGYVNYGNPQDAARALE  85

Query  796  VLNFTPVNSKSIR  834
            +LNFTP+N K IR
Sbjct  86   LLNFTPLNGKPIR  98


 Score = 58.5 bits (140),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 30/84 (36%), Positives = 53/84 (63%), Gaps = 1/84 (1%)
 Frame = +1

Query  580  QSAAGAGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVN  759
            Q+   A ++    +LYV +LD +++D +L +LF+Q G + S +V RD S   S G G+V 
Sbjct  296  QTMKEAADKFQGANLYVKNLDDSISDEKLKELFSQYGTITSCKVMRDPSG-ISKGSGFVA  354

Query  760  YSSPQDAARAMEVLNFTPVNSKSI  831
            +S+P++A+RA+  +N   V +K +
Sbjct  355  FSTPEEASRALAEMNGKMVVNKPL  378


 Score = 51.2 bits (121),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 24/62 (39%), Positives = 38/62 (61%), Gaps = 1/62 (2%)
 Frame = +1

Query  619  SLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQDAARAMEV  798
            ++YV +L  + TD  L   F + G + S  V RD+  + S G+G++N+ +  DAARA+E 
Sbjct  206  NVYVKNLSESTTDEDLNKTFGEFGPITSAVVMRDVDGK-SKGFGFINFENADDAARAVES  264

Query  799  LN  804
            LN
Sbjct  265  LN  266



>gb|KJB32340.1| hypothetical protein B456_005G236500 [Gossypium raimondii]
Length=647

 Score =   125 bits (314),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 52/73 (71%), Positives = 67/73 (92%), Gaps = 0/73 (0%)
 Frame = +1

Query  616  TSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQDAARAME  795
            TSLYVGDLDP+VT++QLY+ FN +GQ+++VR+C D+S+RRSLGYGYVNY +PQDAARA+E
Sbjct  26   TSLYVGDLDPSVTETQLYEYFNHIGQLLTVRLCTDLSTRRSLGYGYVNYGNPQDAARALE  85

Query  796  VLNFTPVNSKSIR  834
            +LNFTP+N K IR
Sbjct  86   LLNFTPLNGKPIR  98


 Score = 58.5 bits (140),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 30/84 (36%), Positives = 53/84 (63%), Gaps = 1/84 (1%)
 Frame = +1

Query  580  QSAAGAGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVN  759
            Q+   A ++    +LYV +LD +++D +L +LF+Q G + S +V RD S   S G G+V 
Sbjct  296  QTMKEAADKFQGANLYVKNLDDSISDEKLKELFSQYGTITSCKVMRDPSG-ISKGSGFVA  354

Query  760  YSSPQDAARAMEVLNFTPVNSKSI  831
            +S+P++A+RA+  +N   V +K +
Sbjct  355  FSTPEEASRALAEMNGKMVINKPL  378



>gb|EYU36333.1| hypothetical protein MIMGU_mgv1a002664mg [Erythranthe guttata]
Length=649

 Score =   125 bits (314),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 60/77 (78%), Positives = 68/77 (88%), Gaps = 0/77 (0%)
 Frame = +1

Query  604  QLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQDAA  783
            Q  +TSLYVGDLD  VTDSQLYDLFNQV QVVSVRVCRD+S+RRSLGYGYVNYS+PQDAA
Sbjct  26   QFLSTSLYVGDLDFNVTDSQLYDLFNQVAQVVSVRVCRDLSTRRSLGYGYVNYSNPQDAA  85

Query  784  RAMEVLNFTPVNSKSIR  834
            RA+E LNF  + +K+IR
Sbjct  86   RALESLNFALLGNKNIR  102



>ref|NP_001151785.1| LOC100285420 [Zea mays]
 gb|ACG44303.1| polyadenylate-binding protein 2 [Zea mays]
 tpg|DAA37055.1| TPA: polyadenylate-binding protein 2 [Zea mays]
Length=660

 Score =   125 bits (314),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 57/81 (70%), Positives = 70/81 (86%), Gaps = 0/81 (0%)
 Frame = +1

Query  592  GAGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSP  771
            G    L TTSLYVGDL+ +V+DSQLY+LF+Q GQVVSVRVCRD++SRRSLGY YVN+++P
Sbjct  32   GVAQPLPTTSLYVGDLEGSVSDSQLYELFSQAGQVVSVRVCRDVTSRRSLGYAYVNFNNP  91

Query  772  QDAARAMEVLNFTPVNSKSIR  834
             DAARA+EVLNF P+N+K IR
Sbjct  92   LDAARALEVLNFAPLNNKPIR  112



>ref|XP_010447142.1| PREDICTED: polyadenylate-binding protein 2-like [Camelina sativa]
Length=632

 Score =   125 bits (313),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 62/114 (54%), Positives = 79/114 (69%), Gaps = 5/114 (4%)
 Frame = +1

Query  493  MAQIQVQHQSpvalangvpppgavglpapQSAAGAGNQLSTTSLYVGDLDPTVTDSQLYD  672
            MAQ+Q+Q Q+       +              A A  Q  TTSLYVGDLD  VTDSQL+D
Sbjct  1    MAQVQLQGQAANGSTVAITSAPVTS-----GGAAAATQFGTTSLYVGDLDLNVTDSQLFD  55

Query  673  LFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQDAARAMEVLNFTPVNSKSIR  834
             F+Q+GQVVSVRVCRD+++RRSLGYGYVN+++PQDAARA++ LN+ P+  K IR
Sbjct  56   AFSQMGQVVSVRVCRDLATRRSLGYGYVNFTNPQDAARAIQELNYIPLYGKPIR  109


 Score = 58.2 bits (139),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 29/84 (35%), Positives = 52/84 (62%), Gaps = 1/84 (1%)
 Frame = +1

Query  580  QSAAGAGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVN  759
            Q+   A ++  +++LYV +LDP+++D +L ++F+  G V S +V RD +   S G G+V 
Sbjct  307  QNLKEAADKFQSSNLYVKNLDPSISDEKLKEIFSPFGTVTSCKVMRDPNG-TSKGSGFVA  365

Query  760  YSSPQDAARAMEVLNFTPVNSKSI  831
            +S P++A  AM  L+   + SK +
Sbjct  366  FSIPEEATEAMSQLSGKMIESKPL  389


 Score = 53.9 bits (128),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 30/81 (37%), Positives = 49/81 (60%), Gaps = 7/81 (9%)
 Frame = +1

Query  589  AGAGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNYSS  768
            +GAGN      +++ +LD ++    L+D F+  G +VS +V  D SS +S GYG+V Y+S
Sbjct  122  SGAGN------IFIKNLDDSIDHKALHDTFSTFGNIVSCKVAVD-SSGQSKGYGFVQYAS  174

Query  769  PQDAARAMEVLNFTPVNSKSI  831
             + A +A+E LN   +N K +
Sbjct  175  EESAQKAIEKLNGMLLNDKQV  195



>ref|XP_010432464.1| PREDICTED: polyadenylate-binding protein 2-like [Camelina sativa]
Length=632

 Score =   125 bits (313),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 63/114 (55%), Positives = 79/114 (69%), Gaps = 5/114 (4%)
 Frame = +1

Query  493  MAQIQVQHQSpvalangvpppgavglpapQSAAGAGNQLSTTSLYVGDLDPTVTDSQLYD  672
            MAQ+Q+Q Q+       V              A A  Q  TTSLYVGDLD  VTDSQL+D
Sbjct  1    MAQVQLQGQAANGSTVAVTSAPVTS-----GGAAAATQFGTTSLYVGDLDLNVTDSQLFD  55

Query  673  LFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQDAARAMEVLNFTPVNSKSIR  834
             F+Q+GQVVSVRVCRD+++RRSLGYGYVN+++PQDAARA++ LN+ P+  K IR
Sbjct  56   AFSQMGQVVSVRVCRDLATRRSLGYGYVNFTNPQDAARAIQELNYIPLYGKPIR  109


 Score = 58.2 bits (139),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 29/84 (35%), Positives = 52/84 (62%), Gaps = 1/84 (1%)
 Frame = +1

Query  580  QSAAGAGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVN  759
            Q+   A ++  +++LYV +LDP+++D +L ++F+  G V S +V RD +   S G G+V 
Sbjct  307  QNLKEAADKFQSSNLYVKNLDPSISDEKLKEIFSPFGTVTSCKVMRDPNG-TSKGSGFVA  365

Query  760  YSSPQDAARAMEVLNFTPVNSKSI  831
            +S P++A  AM  L+   + SK +
Sbjct  366  FSIPEEATEAMSQLSGKMIESKPL  389


 Score = 54.7 bits (130),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 30/81 (37%), Positives = 49/81 (60%), Gaps = 7/81 (9%)
 Frame = +1

Query  589  AGAGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNYSS  768
            +GAGN      +++ +LD ++    L+D F+  G +VS +V  D SS +S GYG+V Y+S
Sbjct  122  SGAGN------IFIKNLDESIDHKALHDTFSTFGNIVSCKVAVD-SSGQSKGYGFVQYAS  174

Query  769  PQDAARAMEVLNFTPVNSKSI  831
             + A +A+E LN   +N K +
Sbjct  175  EESAQKAIEKLNGMLLNDKQV  195



>gb|KJB32341.1| hypothetical protein B456_005G236500 [Gossypium raimondii]
Length=634

 Score =   125 bits (313),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 52/73 (71%), Positives = 67/73 (92%), Gaps = 0/73 (0%)
 Frame = +1

Query  616  TSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQDAARAME  795
            TSLYVGDLDP+VT++QLY+ FN +GQ+++VR+C D+S+RRSLGYGYVNY +PQDAARA+E
Sbjct  26   TSLYVGDLDPSVTETQLYEYFNHIGQLLTVRLCTDLSTRRSLGYGYVNYGNPQDAARALE  85

Query  796  VLNFTPVNSKSIR  834
            +LNFTP+N K IR
Sbjct  86   LLNFTPLNGKPIR  98


 Score = 58.2 bits (139),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 30/84 (36%), Positives = 53/84 (63%), Gaps = 1/84 (1%)
 Frame = +1

Query  580  QSAAGAGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVN  759
            Q+   A ++    +LYV +LD +++D +L +LF+Q G + S +V RD S   S G G+V 
Sbjct  296  QTMKEAADKFQGANLYVKNLDDSISDEKLKELFSQYGTITSCKVMRDPSG-ISKGSGFVA  354

Query  760  YSSPQDAARAMEVLNFTPVNSKSI  831
            +S+P++A+RA+  +N   V +K +
Sbjct  355  FSTPEEASRALAEMNGKMVINKPL  378



>ref|XP_008663371.1| PREDICTED: polyadenylate-binding protein 2-like [Zea mays]
Length=652

 Score =   125 bits (313),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 59/83 (71%), Positives = 69/83 (83%), Gaps = 0/83 (0%)
 Frame = +1

Query  586  AAGAGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNYS  765
            A G    L TTSLYVGDL+  V+DSQLY+LF+Q GQVVSVRVCRD++SRRSLGY YVNYS
Sbjct  24   AVGVAQPLPTTSLYVGDLEGAVSDSQLYELFSQAGQVVSVRVCRDVTSRRSLGYAYVNYS  83

Query  766  SPQDAARAMEVLNFTPVNSKSIR  834
            +P DAARA+EVLNF  +N+K IR
Sbjct  84   NPLDAARALEVLNFAALNNKPIR  106



>ref|XP_010447143.1| PREDICTED: polyadenylate-binding protein 2 [Camelina sativa]
Length=632

 Score =   124 bits (312),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 62/114 (54%), Positives = 79/114 (69%), Gaps = 5/114 (4%)
 Frame = +1

Query  493  MAQIQVQHQSpvalangvpppgavglpapQSAAGAGNQLSTTSLYVGDLDPTVTDSQLYD  672
            MAQ+Q+Q Q+       V              A A  Q  TTSLYVGDLD  VTDSQL+D
Sbjct  1    MAQVQLQGQAANGSTVAVTSAPVTS-----GGAAAATQFGTTSLYVGDLDLNVTDSQLFD  55

Query  673  LFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQDAARAMEVLNFTPVNSKSIR  834
             F+Q+GQVVSVR+CRD+++RRSLGYGYVN+++PQDAARA++ LN+ P+  K IR
Sbjct  56   AFSQMGQVVSVRICRDLATRRSLGYGYVNFTNPQDAARAIQELNYIPLYGKPIR  109


 Score = 58.2 bits (139),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 29/84 (35%), Positives = 52/84 (62%), Gaps = 1/84 (1%)
 Frame = +1

Query  580  QSAAGAGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVN  759
            Q+   A ++  +++LYV +LDP+++D +L ++F+  G V S +V RD +   S G G+V 
Sbjct  307  QNLKEAADKFQSSNLYVKNLDPSISDEKLKEIFSPFGTVTSCKVMRDPNG-TSKGSGFVA  365

Query  760  YSSPQDAARAMEVLNFTPVNSKSI  831
            +S P++A  AM  L+   + SK +
Sbjct  366  FSIPEEATEAMSQLSGKMIESKPL  389


 Score = 54.3 bits (129),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 30/81 (37%), Positives = 49/81 (60%), Gaps = 7/81 (9%)
 Frame = +1

Query  589  AGAGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNYSS  768
            +GAGN      +++ +LD ++    L+D F+  G +VS +V  D SS +S GYG+V Y+S
Sbjct  122  SGAGN------IFIKNLDDSIDHKALHDTFSTFGNIVSCKVAVD-SSGQSKGYGFVQYAS  174

Query  769  PQDAARAMEVLNFTPVNSKSI  831
             + A +A+E LN   +N K +
Sbjct  175  EESAQKAIEKLNGMLLNDKQV  195


 Score = 50.8 bits (120),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 25/68 (37%), Positives = 40/68 (59%), Gaps = 1/68 (1%)
 Frame = +1

Query  601  NQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQDA  780
            N+   T++YV +L    TD  L   F + G++ S  V +D    +S G+G+VN+ +  DA
Sbjct  211  NKTKFTNVYVKNLGENTTDDDLKTAFAEYGKITSAVVMKD-GDGKSKGFGFVNFENADDA  269

Query  781  ARAMEVLN  804
            A+A+E LN
Sbjct  270  AKAVEALN  277



>ref|XP_010555994.1| PREDICTED: polyadenylate-binding protein 8 [Tarenaya hassleriana]
Length=646

 Score =   124 bits (312),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 57/77 (74%), Positives = 67/77 (87%), Gaps = 0/77 (0%)
 Frame = +1

Query  604  QLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQDAA  783
            Q+ TTSLYVGDLDPTVTDSQL++ F QVGQVVSVRVCRD+++RRSLGYGYVNY + QDAA
Sbjct  24   QMGTTSLYVGDLDPTVTDSQLFEAFGQVGQVVSVRVCRDMTTRRSLGYGYVNYGNSQDAA  83

Query  784  RAMEVLNFTPVNSKSIR  834
            RA+  LNF  +N K+IR
Sbjct  84   RALNELNFIALNGKAIR  100


 Score = 58.9 bits (141),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 33/84 (39%), Positives = 54/84 (64%), Gaps = 1/84 (1%)
 Frame = +1

Query  580  QSAAGAGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVN  759
            QS   A ++   ++LYV +LD ++TD +L +LF+  G + S +V RD  S  S G G+V+
Sbjct  298  QSLKEAADRSQGSNLYVKNLDDSITDEKLKELFSSFGTITSYKVMRD-QSGVSKGSGFVS  356

Query  760  YSSPQDAARAMEVLNFTPVNSKSI  831
            +SSP++A+RA+  +N   V SK +
Sbjct  357  FSSPEEASRAIAEMNGKMVVSKPL  380


 Score = 52.0 bits (123),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 23/70 (33%), Positives = 42/70 (60%), Gaps = 1/70 (1%)
 Frame = +1

Query  619  SLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQDAARAMEV  798
            ++YV  +  ++TD ++  +F + G + S  + RD    +S G+G+VN+ +P DAA+A+E 
Sbjct  208  NVYVKSISESMTDEEMKKVFGEFGLITSCVIMRD-GEGKSKGFGFVNFENPDDAAKAVEA  266

Query  799  LNFTPVNSKS  828
            LN    + K 
Sbjct  267  LNGKKFDEKE  276



>gb|EYU42687.1| hypothetical protein MIMGU_mgv1a002746mg [Erythranthe guttata]
Length=642

 Score =   124 bits (311),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 58/84 (69%), Positives = 71/84 (85%), Gaps = 0/84 (0%)
 Frame = +1

Query  583  SAAGAGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNY  762
            +AA +G     TSLYVGDL+P VTDSQLYDLF+Q+G+VVSVRVCRD++SR SLGYGYVNY
Sbjct  16   NAASSGGAPFVTSLYVGDLEPNVTDSQLYDLFSQMGEVVSVRVCRDLTSRGSLGYGYVNY  75

Query  763  SSPQDAARAMEVLNFTPVNSKSIR  834
            S+PQ+A RA+  LNFTP+N K +R
Sbjct  76   SNPQNAERAIIELNFTPLNGKPVR  99


 Score = 55.1 bits (131),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 31/84 (37%), Positives = 49/84 (58%), Gaps = 1/84 (1%)
 Frame = +1

Query  580  QSAAGAGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVN  759
            QS   A ++   ++LYV +LD T+ D QL +LF   G + S +V RD     S G G+V 
Sbjct  297  QSVKEAVDKSQGSNLYVKNLDDTIGDDQLNELFAAFGTITSCKVMRDPKG-ISRGSGFVA  355

Query  760  YSSPQDAARAMEVLNFTPVNSKSI  831
            +SSP++A+RA+  +N   +  K +
Sbjct  356  FSSPEEASRALTEMNGKMITGKPL  379



>ref|XP_002960874.1| hypothetical protein SELMODRAFT_21095, partial [Selaginella moellendorffii]
 ref|XP_002967138.1| hypothetical protein SELMODRAFT_10868, partial [Selaginella moellendorffii]
 gb|EFJ31737.1| hypothetical protein SELMODRAFT_10868, partial [Selaginella moellendorffii]
 gb|EFJ38413.1| hypothetical protein SELMODRAFT_21095, partial [Selaginella moellendorffii]
Length=619

 Score =   124 bits (310),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 53/74 (72%), Positives = 68/74 (92%), Gaps = 0/74 (0%)
 Frame = +1

Query  613  TTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQDAARAM  792
            +TSLYVGDLDP V+++QLYDLFNQ+GQV+S+RVCRD+ +RRSLGY YVNY++ QDA RA+
Sbjct  3    STSLYVGDLDPNVSENQLYDLFNQIGQVLSIRVCRDLMTRRSLGYAYVNYNNVQDATRAL  62

Query  793  EVLNFTPVNSKSIR  834
            E+LNFTPVN K++R
Sbjct  63   ELLNFTPVNGKAVR  76



>ref|XP_010906556.1| PREDICTED: polyadenylate-binding protein 2-like isoform X1 [Elaeis 
guineensis]
Length=654

 Score =   124 bits (311),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 71/114 (62%), Positives = 83/114 (73%), Gaps = 10/114 (9%)
 Frame = +1

Query  493  MAQIQVQHQSpvalangvpppgavglpapQSAAGAGNQLSTTSLYVGDLDPTVTDSQLYD  672
            MAQIQVQ Q+PV+   G              + G GNQ  +TSLYVGDL+  VTD+QLY+
Sbjct  1    MAQIQVQQQTPVSGPAGTG----------AESGGGGNQFPSTSLYVGDLELNVTDAQLYE  50

Query  673  LFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQDAARAMEVLNFTPVNSKSIR  834
             F+QVGQVVSVRVCRDI+SRRSLGY YVNYS+P DAARA+EVLNF  +N K IR
Sbjct  51   TFSQVGQVVSVRVCRDINSRRSLGYAYVNYSNPIDAARALEVLNFNSLNGKPIR  104


 Score = 53.9 bits (128),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 27/79 (34%), Positives = 46/79 (58%), Gaps = 1/79 (1%)
 Frame = +1

Query  595  AGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQ  774
            A  Q    +LY+ +LD  + D +L +LF++ G + S +V RD +   S G G+V + SP 
Sbjct  307  AAGQFQGANLYLKNLDDNIGDDKLRELFSEFGTITSCKVMRDPNG-VSRGSGFVAFKSPN  365

Query  775  DAARAMEVLNFTPVNSKSI  831
            DA++A+  +N   + SK +
Sbjct  366  DASKALVEMNGKMIGSKPL  384



>ref|XP_006425947.1| hypothetical protein CICLE_v10025109mg [Citrus clementina]
 gb|ESR39187.1| hypothetical protein CICLE_v10025109mg [Citrus clementina]
Length=650

 Score =   124 bits (311),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 57/83 (69%), Positives = 68/83 (82%), Gaps = 0/83 (0%)
 Frame = +1

Query  586  AAGAGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNYS  765
              G   Q  +TSLYVGDLD +V DSQLYDLFNQ+GQVVSVRVCRD+S+RRSLGYGYVNY+
Sbjct  30   GVGDARQFVSTSLYVGDLDLSVNDSQLYDLFNQMGQVVSVRVCRDLSTRRSLGYGYVNYN  89

Query  766  SPQDAARAMEVLNFTPVNSKSIR  834
            +  +A RA++ LNFTP+N K IR
Sbjct  90   AAHEATRALDELNFTPLNGKPIR  112


 Score = 51.2 bits (121),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 27/84 (32%), Positives = 51/84 (61%), Gaps = 1/84 (1%)
 Frame = +1

Query  580  QSAAGAGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVN  759
            QS     ++    +LYV +LD +++D +L +LF++ G + S +V RD +   S G G+V 
Sbjct  310  QSLKETADKFEGLNLYVKNLDDSISDDKLKELFSEFGTITSCKVMRDPNG-ISRGSGFVA  368

Query  760  YSSPQDAARAMEVLNFTPVNSKSI  831
            +S+ ++A++A+  +N   V SK +
Sbjct  369  FSTAEEASKALTEMNGKMVVSKPL  392



>ref|XP_006425948.1| hypothetical protein CICLE_v10025109mg [Citrus clementina]
 gb|ESR39188.1| hypothetical protein CICLE_v10025109mg [Citrus clementina]
Length=652

 Score =   124 bits (311),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 57/83 (69%), Positives = 68/83 (82%), Gaps = 0/83 (0%)
 Frame = +1

Query  586  AAGAGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNYS  765
              G   Q  +TSLYVGDLD +V DSQLYDLFNQ+GQVVSVRVCRD+S+RRSLGYGYVNY+
Sbjct  30   GVGDARQFVSTSLYVGDLDLSVNDSQLYDLFNQMGQVVSVRVCRDLSTRRSLGYGYVNYN  89

Query  766  SPQDAARAMEVLNFTPVNSKSIR  834
            +  +A RA++ LNFTP+N K IR
Sbjct  90   AAHEATRALDELNFTPLNGKPIR  112


 Score = 51.2 bits (121),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 27/84 (32%), Positives = 51/84 (61%), Gaps = 1/84 (1%)
 Frame = +1

Query  580  QSAAGAGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVN  759
            QS     ++    +LYV +LD +++D +L +LF++ G + S +V RD +   S G G+V 
Sbjct  310  QSLKETADKFEGLNLYVKNLDDSISDDKLKELFSEFGTITSCKVMRDPNG-ISRGSGFVA  368

Query  760  YSSPQDAARAMEVLNFTPVNSKSI  831
            +S+ ++A++A+  +N   V SK +
Sbjct  369  FSTAEEASKALTEMNGKMVVSKPL  392



>ref|XP_010530761.1| PREDICTED: LOW QUALITY PROTEIN: polyadenylate-binding protein 
2 [Tarenaya hassleriana]
Length=649

 Score =   124 bits (311),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 57/77 (74%), Positives = 67/77 (87%), Gaps = 0/77 (0%)
 Frame = +1

Query  604  QLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQDAA  783
            Q  TTSLYVGDL+  VTDSQL+D F QVGQVVSVRVCRD+++RRSLGYGYVN+S+PQDAA
Sbjct  26   QFGTTSLYVGDLEANVTDSQLFDAFGQVGQVVSVRVCRDLATRRSLGYGYVNFSNPQDAA  85

Query  784  RAMEVLNFTPVNSKSIR  834
            RA++ LNF  +N KSIR
Sbjct  86   RAIQELNFATLNGKSIR  102


 Score = 53.5 bits (127),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 28/84 (33%), Positives = 50/84 (60%), Gaps = 1/84 (1%)
 Frame = +1

Query  580  QSAAGAGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVN  759
            Q+   A  +   ++LYV +LD +V+D +L +LF+  G + S +V RD S   S G G+V 
Sbjct  300  QNIKEAAEKFQGSNLYVKNLDDSVSDEKLKELFSPFGTITSCKVMRDPSG-VSKGSGFVA  358

Query  760  YSSPQDAARAMEVLNFTPVNSKSI  831
            +++P++A +AM  +    + SK +
Sbjct  359  FTTPEEATKAMSEMTGRMIVSKPL  382


 Score = 50.8 bits (120),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 26/75 (35%), Positives = 42/75 (56%), Gaps = 1/75 (1%)
 Frame = +1

Query  580  QSAAGAGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVN  759
            Q      N++  T++YV +L  +  D  L  +F + G++ S  V +D    +S G+G+VN
Sbjct  197  QERESTANKMKFTNVYVKNLAESTNDDDLKSIFGEFGKITSAVVMKD-GDGKSKGFGFVN  255

Query  760  YSSPQDAARAMEVLN  804
            + S   AARA+E LN
Sbjct  256  FESADAAARAVESLN  270



>emb|CDX89664.1| BnaC03g45780D [Brassica napus]
Length=614

 Score =   124 bits (310),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 55/80 (69%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = +1

Query  595  AGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQ  774
            AG Q  TTSLYVGDLD +VTDSQL+D F+Q+GQVVSVRVCRD+++RRSLGYGYVN+++PQ
Sbjct  19   AGAQFGTTSLYVGDLDASVTDSQLFDAFSQMGQVVSVRVCRDLATRRSLGYGYVNFTTPQ  78

Query  775  DAARAMEVLNFTPVNSKSIR  834
            DAARA++ LN+  +N K +R
Sbjct  79   DAARAIQELNYISLNGKPVR  98


 Score = 52.8 bits (125),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/79 (32%), Positives = 49/79 (62%), Gaps = 1/79 (1%)
 Frame = +1

Query  595  AGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQ  774
            A ++  + +LYV +LD +++D +L ++F   G V S +V RD +   S G G+V +S+P+
Sbjct  303  AADKFQSCNLYVKNLDESISDEKLKEMFAPCGTVTSSKVMRDTNGI-SRGAGFVAFSTPE  361

Query  775  DAARAMEVLNFTPVNSKSI  831
            +A +AM  ++   + +K +
Sbjct  362  EATKAMSEMSGKMIENKPL  380



>ref|XP_004978120.1| PREDICTED: polyadenylate-binding protein 2-like [Setaria italica]
Length=692

 Score =   124 bits (311),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 58/76 (76%), Positives = 68/76 (89%), Gaps = 0/76 (0%)
 Frame = +1

Query  607  LSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQDAAR  786
            L TTSLYVGDL+ +VTDSQLY+LF+Q GQVVSVRVCRD++SRRSLGY YVN+S+P DAAR
Sbjct  37   LPTTSLYVGDLEGSVTDSQLYELFSQAGQVVSVRVCRDVTSRRSLGYAYVNFSNPMDAAR  96

Query  787  AMEVLNFTPVNSKSIR  834
            A+EVLNF  +NSK IR
Sbjct  97   ALEVLNFALLNSKPIR  112



>ref|XP_011092553.1| PREDICTED: polyadenylate-binding protein 2-like [Sesamum indicum]
Length=644

 Score =   124 bits (310),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 59/84 (70%), Positives = 69/84 (82%), Gaps = 0/84 (0%)
 Frame = +1

Query  583  SAAGAGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNY  762
            +AA +G     TSLYVGDLD  VTDSQLYDLF+Q+G V+SVRVCRD++SRRSLGYGYVNY
Sbjct  15   NAASSGGAPFVTSLYVGDLDANVTDSQLYDLFSQMGDVLSVRVCRDLTSRRSLGYGYVNY  74

Query  763  SSPQDAARAMEVLNFTPVNSKSIR  834
             +PQDA RA+  LNFTP+N K IR
Sbjct  75   GNPQDAERALIDLNFTPLNGKPIR  98


 Score = 56.2 bits (134),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 30/81 (37%), Positives = 49/81 (60%), Gaps = 7/81 (9%)
 Frame = +1

Query  589  AGAGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNYSS  768
            +GAGN      +++ +LD  +    L+D F+  G ++S +V  D SS +SLGYG+V Y+S
Sbjct  111  SGAGN------IFIKNLDKEIDHKALHDTFSSFGSILSCKVATD-SSGQSLGYGFVQYAS  163

Query  769  PQDAARAMEVLNFTPVNSKSI  831
             + A +A+E LN   +N K +
Sbjct  164  EESAQKAIEKLNGMLLNGKQV  184


 Score = 54.3 bits (129),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 29/75 (39%), Positives = 47/75 (63%), Gaps = 1/75 (1%)
 Frame = +1

Query  580  QSAAGAGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVN  759
            QS   A ++   ++LYV +LD T+ D +L +LF+  G + S +V RD     S G G+V 
Sbjct  296  QSVKEAVDKSQGSNLYVKNLDDTIDDDKLKELFSPFGSITSCKVMRDPKG-ISRGSGFVA  354

Query  760  YSSPQDAARAMEVLN  804
            +SSP++A+RA+  +N
Sbjct  355  FSSPEEASRALSEMN  369



>ref|XP_008795896.1| PREDICTED: polyadenylate-binding protein 2-like [Phoenix dactylifera]
Length=660

 Score =   123 bits (309),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 56/78 (72%), Positives = 68/78 (87%), Gaps = 0/78 (0%)
 Frame = +1

Query  601  NQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQDA  780
            NQ  +TSLYVGDL+  VTD+QL++ F+Q+GQVVSVRVCRDI++RRSLGY YVNYS+P DA
Sbjct  27   NQFPSTSLYVGDLELNVTDAQLFETFSQLGQVVSVRVCRDINTRRSLGYAYVNYSNPVDA  86

Query  781  ARAMEVLNFTPVNSKSIR  834
             RA+EVLNFTP+N K IR
Sbjct  87   GRALEVLNFTPLNGKPIR  104


 Score = 55.5 bits (132),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 28/79 (35%), Positives = 49/79 (62%), Gaps = 1/79 (1%)
 Frame = +1

Query  595  AGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQ  774
            A +Q   T+LY+ +LD ++ D +L +LF++ G + S +V RD +   S G G+V + SP 
Sbjct  307  AADQYQGTNLYLKNLDDSIGDDKLRELFSEFGTITSCKVMRDPNG-ASRGSGFVAFMSPN  365

Query  775  DAARAMEVLNFTPVNSKSI  831
            DA++A+  +N   + SK +
Sbjct  366  DASKALAEMNGKMIGSKPL  384



>ref|XP_003525892.1| PREDICTED: polyadenylate-binding protein 8-like [Glycine max]
Length=630

 Score =   123 bits (308),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 55/84 (65%), Positives = 73/84 (87%), Gaps = 0/84 (0%)
 Frame = +1

Query  583  SAAGAGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNY  762
            +A+GA   ++T SLYVGDLD  V D QLYDLFNQV QVVSVR+CRD+++++SLGYGYVN+
Sbjct  13   AASGANPSMTTISLYVGDLDHDVNDPQLYDLFNQVAQVVSVRICRDVATQQSLGYGYVNF  72

Query  763  SSPQDAARAMEVLNFTPVNSKSIR  834
            S+ +DAA+A++VLNFTP+N K+IR
Sbjct  73   SNARDAAKAIDVLNFTPLNGKTIR  96



>ref|XP_006494495.1| PREDICTED: polyadenylate-binding protein 4 [Citrus sinensis]
Length=663

 Score =   123 bits (308),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 57/81 (70%), Positives = 68/81 (84%), Gaps = 0/81 (0%)
 Frame = +1

Query  592  GAGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSP  771
            G   Q  +TSLYVGDLD +V DSQLYDLFNQ+GQVVSVRVCRD+S+RRSLGYGYVNY++ 
Sbjct  41   GDARQFVSTSLYVGDLDLSVNDSQLYDLFNQMGQVVSVRVCRDLSTRRSLGYGYVNYNAA  100

Query  772  QDAARAMEVLNFTPVNSKSIR  834
             +A RA++ LNFTP+N K IR
Sbjct  101  HEATRALDELNFTPLNGKPIR  121


 Score = 50.8 bits (120),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 27/84 (32%), Positives = 51/84 (61%), Gaps = 1/84 (1%)
 Frame = +1

Query  580  QSAAGAGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVN  759
            QS     ++    +LYV +LD +++D +L +LF++ G + S +V RD +   S G G+V 
Sbjct  319  QSLKETADKFEGLNLYVKNLDDSISDDKLKELFSEFGTITSCKVMRDPNG-ISRGSGFVA  377

Query  760  YSSPQDAARAMEVLNFTPVNSKSI  831
            +S+ ++A++A+  +N   V SK +
Sbjct  378  FSTAEEASKALTEMNGKMVVSKPL  401



>gb|KJB14630.1| hypothetical protein B456_002G134900 [Gossypium raimondii]
Length=423

 Score =   121 bits (303),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 71/114 (62%), Positives = 83/114 (73%), Gaps = 11/114 (10%)
 Frame = +1

Query  493  MAQIQVQHQSpvalangvpppgavglpapQSAAGAGNQLSTTSLYVGDLDPTVTDSQLYD  672
            MAQIQVQHQ+PV+  NGV              A  G Q   TSLYVGDLD TVTD QLY 
Sbjct  1    MAQIQVQHQAPVSGPNGV-----------APGAAGGAQFMLTSLYVGDLDVTVTDEQLYQ  49

Query  673  LFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQDAARAMEVLNFTPVNSKSIR  834
            LF+QV  V SVRVCRD++S RSLGYGYVNY++ +DAARAM++LNFTP+N+K IR
Sbjct  50   LFSQVAPVASVRVCRDLASGRSLGYGYVNYNNLRDAARAMDLLNFTPLNNKPIR  103


 Score = 55.8 bits (133),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 29/84 (35%), Positives = 51/84 (61%), Gaps = 1/84 (1%)
 Frame = +1

Query  580  QSAAGAGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVN  759
            Q+   A ++    +LY+ +LD ++ D  L +LF++ G + S +V RD S   S G G+V 
Sbjct  301  QTMKEAADKSQGANLYIKNLDDSIGDETLKELFSEFGNITSCKVMRDPSG-ISKGSGFVA  359

Query  760  YSSPQDAARAMEVLNFTPVNSKSI  831
            +S+P++A+RA+  +N   V SK +
Sbjct  360  FSTPEEASRALAEMNGKMVVSKPL  383


 Score = 51.6 bits (122),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 27/83 (33%), Positives = 44/83 (53%), Gaps = 1/83 (1%)
 Frame = +1

Query  580  QSAAGAGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVN  759
            Q    A N+    ++YV +L  + TD  L  +F + G++ S  V RD   + S  +G+VN
Sbjct  198  QERETALNKAKFNNVYVKNLSKSTTDEDLKTIFGEYGEITSAVVMRDADGK-SKCFGFVN  256

Query  760  YSSPQDAARAMEVLNFTPVNSKS  828
            + +  DAA+A+E LN    + K 
Sbjct  257  FENADDAAKAVEALNGKKFDDKE  279



>ref|XP_002283105.1| PREDICTED: polyadenylate-binding protein 2 [Vitis vinifera]
 emb|CBI21386.3| unnamed protein product [Vitis vinifera]
Length=654

 Score =   123 bits (308),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 56/77 (73%), Positives = 66/77 (86%), Gaps = 0/77 (0%)
 Frame = +1

Query  604  QLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQDAA  783
            Q  +TSLYVGDL+  VTDS LYDLF Q+G VVSVRVCRD+S+RRSLGYGYVNY + QDAA
Sbjct  28   QFVSTSLYVGDLESNVTDSHLYDLFGQLGPVVSVRVCRDLSTRRSLGYGYVNYGNTQDAA  87

Query  784  RAMEVLNFTPVNSKSIR  834
            RA+++LNFTP+N K IR
Sbjct  88   RALDMLNFTPLNGKPIR  104


 Score = 52.0 bits (123),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 29/84 (35%), Positives = 51/84 (61%), Gaps = 1/84 (1%)
 Frame = +1

Query  580  QSAAGAGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVN  759
            QS   A ++    +LYV +LD ++ D +L +LF++ G + S +V RD +   S G G+V 
Sbjct  302  QSLKEAVDKFQGLNLYVKNLDDSIADDKLRELFSEFGTITSCKVMRDPNG-ISRGSGFVA  360

Query  760  YSSPQDAARAMEVLNFTPVNSKSI  831
            +S+ ++A+RA+  +N   V SK +
Sbjct  361  FSTAEEASRALADMNGKMVASKPL  384



>gb|KJB14634.1| hypothetical protein B456_002G134900 [Gossypium raimondii]
Length=455

 Score =   121 bits (303),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 71/114 (62%), Positives = 83/114 (73%), Gaps = 11/114 (10%)
 Frame = +1

Query  493  MAQIQVQHQSpvalangvpppgavglpapQSAAGAGNQLSTTSLYVGDLDPTVTDSQLYD  672
            MAQIQVQHQ+PV+  NGV              A  G Q   TSLYVGDLD TVTD QLY 
Sbjct  1    MAQIQVQHQAPVSGPNGV-----------APGAAGGAQFMLTSLYVGDLDVTVTDEQLYQ  49

Query  673  LFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQDAARAMEVLNFTPVNSKSIR  834
            LF+QV  V SVRVCRD++S RSLGYGYVNY++ +DAARAM++LNFTP+N+K IR
Sbjct  50   LFSQVAPVASVRVCRDLASGRSLGYGYVNYNNLRDAARAMDLLNFTPLNNKPIR  103


 Score = 55.5 bits (132),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 29/84 (35%), Positives = 51/84 (61%), Gaps = 1/84 (1%)
 Frame = +1

Query  580  QSAAGAGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVN  759
            Q+   A ++    +LY+ +LD ++ D  L +LF++ G + S +V RD S   S G G+V 
Sbjct  301  QTMKEAADKSQGANLYIKNLDDSIGDETLKELFSEFGNITSCKVMRDPSG-ISKGSGFVA  359

Query  760  YSSPQDAARAMEVLNFTPVNSKSI  831
            +S+P++A+RA+  +N   V SK +
Sbjct  360  FSTPEEASRALAEMNGKMVVSKPL  383


 Score = 50.8 bits (120),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 27/83 (33%), Positives = 45/83 (54%), Gaps = 1/83 (1%)
 Frame = +1

Query  580  QSAAGAGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVN  759
            Q    A N+    ++YV +L  + TD  L  +F + G++ S  V RD +  +S  +G+VN
Sbjct  198  QERETALNKAKFNNVYVKNLSKSTTDEDLKTIFGEYGEITSAVVMRD-ADGKSKCFGFVN  256

Query  760  YSSPQDAARAMEVLNFTPVNSKS  828
            + +  DAA+A+E LN    + K 
Sbjct  257  FENADDAAKAVEALNGKKFDDKE  279



>ref|XP_006283328.1| hypothetical protein CARUB_v10004368mg [Capsella rubella]
 gb|EOA16226.1| hypothetical protein CARUB_v10004368mg [Capsella rubella]
Length=629

 Score =   122 bits (307),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 62/114 (54%), Positives = 79/114 (69%), Gaps = 8/114 (7%)
 Frame = +1

Query  493  MAQIQVQHQSpvalangvpppgavglpapQSAAGAGNQLSTTSLYVGDLDPTVTDSQLYD  672
            MAQ+Q+Q Q+         P              A +Q  TTSLYVGDLD  VTDSQL+D
Sbjct  1    MAQVQLQGQAANGSTVAAAPVT--------PGGAAASQFGTTSLYVGDLDLNVTDSQLFD  52

Query  673  LFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQDAARAMEVLNFTPVNSKSIR  834
             F+Q+GQVVSVRVCRD+++RRSLGYGYVN+++PQDAARA++ LN+ P+  K IR
Sbjct  53   AFSQMGQVVSVRVCRDLATRRSLGYGYVNFTNPQDAARAIQELNYIPLYGKPIR  106


 Score = 60.5 bits (145),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 30/84 (36%), Positives = 53/84 (63%), Gaps = 1/84 (1%)
 Frame = +1

Query  580  QSAAGAGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVN  759
            Q+   A ++  +++LYV +LDP+++D +L ++F+  G V S +V RD +   S G G+V 
Sbjct  304  QNLKEAADKFQSSNLYVKNLDPSISDEKLKEIFSPFGTVTSCKVMRDPNG-TSKGSGFVA  362

Query  760  YSSPQDAARAMEVLNFTPVNSKSI  831
            +SSP++A  AM  L+   + SK +
Sbjct  363  FSSPEEATEAMSQLSGKMIESKPL  386


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 29/81 (36%), Positives = 48/81 (59%), Gaps = 7/81 (9%)
 Frame = +1

Query  589  AGAGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNYSS  768
            +GAGN      +++ +LD ++    L+D F+  G +VS +V  D S + S GYG+V Y+S
Sbjct  119  SGAGN------IFIKNLDESIDHKALHDTFSTFGNIVSCKVAVDASGQ-SKGYGFVQYAS  171

Query  769  PQDAARAMEVLNFTPVNSKSI  831
             + A +A+E LN   +N K +
Sbjct  172  EESAQQAIEKLNGMLLNDKQV  192



>ref|XP_007042478.1| Poly(A) binding protein 8 [Theobroma cacao]
 gb|EOX98309.1| Poly(A) binding protein 8 [Theobroma cacao]
Length=645

 Score =   122 bits (307),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 55/77 (71%), Positives = 69/77 (90%), Gaps = 0/77 (0%)
 Frame = +1

Query  604  QLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQDAA  783
            Q  TTSLYVGDLD +VT++QLY+ F Q+GQVV+VRVC+D+S+RRSLGYGYVNYS+PQDAA
Sbjct  23   QFVTTSLYVGDLDLSVTETQLYEYFTQMGQVVTVRVCKDLSTRRSLGYGYVNYSNPQDAA  82

Query  784  RAMEVLNFTPVNSKSIR  834
            RA+++LNFT +N K IR
Sbjct  83   RALDLLNFTLLNGKPIR  99


 Score = 56.6 bits (135),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 29/84 (35%), Positives = 52/84 (62%), Gaps = 1/84 (1%)
 Frame = +1

Query  580  QSAAGAGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVN  759
            Q+   A ++    +LYV +LD +++D  L +LF+Q G + S +V RD +   S G G+V 
Sbjct  297  QTMKEAADKFQGANLYVKNLDDSISDENLKELFSQYGTITSCKVMRDPNG-ISKGSGFVA  355

Query  760  YSSPQDAARAMEVLNFTPVNSKSI  831
            +S+P++A+RA+  +N   + SK +
Sbjct  356  FSTPEEASRALVEMNGKMIVSKPL  379



>ref|XP_010437669.1| PREDICTED: polyadenylate-binding protein 2-like [Camelina sativa]
Length=633

 Score =   122 bits (306),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 55/83 (66%), Positives = 69/83 (83%), Gaps = 0/83 (0%)
 Frame = +1

Query  586  AAGAGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNYS  765
             A A  Q  TTSLYVGDLD  VTDSQL+D F+Q+GQVVSVR+CRD+++RRSLGYGYVN++
Sbjct  28   GAAAATQFGTTSLYVGDLDLNVTDSQLFDAFSQMGQVVSVRICRDLATRRSLGYGYVNFT  87

Query  766  SPQDAARAMEVLNFTPVNSKSIR  834
            +PQDAARA++ LN+ P+  K IR
Sbjct  88   NPQDAARAIQELNYIPLYGKPIR  110


 Score = 58.2 bits (139),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 29/84 (35%), Positives = 52/84 (62%), Gaps = 1/84 (1%)
 Frame = +1

Query  580  QSAAGAGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVN  759
            Q+   A ++  +++LYV +LDP+++D +L ++F+  G V S +V RD +   S G G+V 
Sbjct  308  QNLKEAADKFQSSNLYVKNLDPSISDEKLKEIFSPFGTVTSCKVMRDPNG-TSKGSGFVA  366

Query  760  YSSPQDAARAMEVLNFTPVNSKSI  831
            +S P++A  AM  L+   + SK +
Sbjct  367  FSIPEEATEAMSQLSGKMIESKPL  390


 Score = 54.3 bits (129),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 30/81 (37%), Positives = 49/81 (60%), Gaps = 7/81 (9%)
 Frame = +1

Query  589  AGAGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNYSS  768
            +GAGN      +++ +LD ++    L+D F+  G +VS +V  D SS +S GYG+V Y+S
Sbjct  123  SGAGN------IFIKNLDDSIDHKALHDTFSTFGNIVSCKVAVD-SSGQSKGYGFVQYAS  175

Query  769  PQDAARAMEVLNFTPVNSKSI  831
             + A +A+E LN   +N K +
Sbjct  176  EESAQKAIEKLNGMLLNDKQV  196



>ref|XP_006279092.1| hypothetical protein CARUB_v10012708mg [Capsella rubella]
 gb|EOA11990.1| hypothetical protein CARUB_v10012708mg [Capsella rubella]
Length=571

 Score =   121 bits (304),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 62/114 (54%), Positives = 78/114 (68%), Gaps = 8/114 (7%)
 Frame = +1

Query  493  MAQIQVQHQSpvalangvpppgavglpapQSAAGAGNQLSTTSLYVGDLDPTVTDSQLYD  672
            MAQ+Q+Q Q+         P              A  Q  TTSLYVGDLD  VTDSQL+D
Sbjct  1    MAQVQLQGQAANGSTVAAAPVT--------PGGAAAAQFGTTSLYVGDLDLNVTDSQLFD  52

Query  673  LFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQDAARAMEVLNFTPVNSKSIR  834
             F+Q+GQVVSVRVCRD+++RRSLGYGYVN+++PQDAARA++ LN+ P+  K IR
Sbjct  53   AFSQMGQVVSVRVCRDLATRRSLGYGYVNFTNPQDAARAIQELNYIPLYGKPIR  106


 Score = 60.1 bits (144),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 30/84 (36%), Positives = 53/84 (63%), Gaps = 1/84 (1%)
 Frame = +1

Query  580  QSAAGAGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVN  759
            Q+   A ++  +++LYV +LDP+++D +L ++F+  G V S +V RD +   S G G+V 
Sbjct  304  QNLKEAADKFQSSNLYVKNLDPSISDEKLKEIFSPFGTVTSCKVMRDPNG-TSKGSGFVA  362

Query  760  YSSPQDAARAMEVLNFTPVNSKSI  831
            +SSP++A  AM  L+   + SK +
Sbjct  363  FSSPEEATEAMSQLSGKMIESKPL  386


 Score = 53.5 bits (127),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 29/81 (36%), Positives = 49/81 (60%), Gaps = 7/81 (9%)
 Frame = +1

Query  589  AGAGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNYSS  768
            +GAGN      +++ +LD ++    L+D F+  G +VS ++  D SS +S GYG+V Y+S
Sbjct  119  SGAGN------IFIKNLDESIDHKALHDTFSTFGNIVSCKIAVD-SSGQSKGYGFVQYAS  171

Query  769  PQDAARAMEVLNFTPVNSKSI  831
             + A +A+E LN   +N K +
Sbjct  172  EESAQQAIEKLNGMLLNDKQV  192


 Score = 51.2 bits (121),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 26/68 (38%), Positives = 41/68 (60%), Gaps = 1/68 (1%)
 Frame = +1

Query  601  NQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQDA  780
            N+   T++YV +L    TD  L + F + G++ S  V +D    +S G+G+VN+ +  DA
Sbjct  208  NKSKFTNVYVKNLGENTTDDDLMNAFAEYGKITSAVVMKD-GDGKSKGFGFVNFENADDA  266

Query  781  ARAMEVLN  804
            ARA+E LN
Sbjct  267  ARAVEALN  274



>ref|XP_007047341.1| Poly(A) binding protein 8 [Theobroma cacao]
 gb|EOX91498.1| Poly(A) binding protein 8 [Theobroma cacao]
Length=659

 Score =   122 bits (306),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 59/81 (73%), Positives = 71/81 (88%), Gaps = 1/81 (1%)
 Frame = +1

Query  595  AGNQLS-TTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSP  771
            AGN ++ TTSLYVGDLD +VT+SQLYD F+ VG VVSVRVC+D+SSRRSLGYGYVNYS+ 
Sbjct  34   AGNGVNLTTSLYVGDLDLSVTESQLYDFFSHVGTVVSVRVCKDLSSRRSLGYGYVNYSNT  93

Query  772  QDAARAMEVLNFTPVNSKSIR  834
             +AARA++VLNFTP+N K IR
Sbjct  94   HEAARALDVLNFTPINGKPIR  114



>gb|KJB14631.1| hypothetical protein B456_002G134900 [Gossypium raimondii]
Length=509

 Score =   120 bits (302),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 71/114 (62%), Positives = 83/114 (73%), Gaps = 11/114 (10%)
 Frame = +1

Query  493  MAQIQVQHQSpvalangvpppgavglpapQSAAGAGNQLSTTSLYVGDLDPTVTDSQLYD  672
            MAQIQVQHQ+PV+  NGV              A  G Q   TSLYVGDLD TVTD QLY 
Sbjct  1    MAQIQVQHQAPVSGPNGV-----------APGAAGGAQFMLTSLYVGDLDVTVTDEQLYQ  49

Query  673  LFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQDAARAMEVLNFTPVNSKSIR  834
            LF+QV  V SVRVCRD++S RSLGYGYVNY++ +DAARAM++LNFTP+N+K IR
Sbjct  50   LFSQVAPVASVRVCRDLASGRSLGYGYVNYNNLRDAARAMDLLNFTPLNNKPIR  103


 Score = 55.5 bits (132),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 29/84 (35%), Positives = 51/84 (61%), Gaps = 1/84 (1%)
 Frame = +1

Query  580  QSAAGAGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVN  759
            Q+   A ++    +LY+ +LD ++ D  L +LF++ G + S +V RD S   S G G+V 
Sbjct  301  QTMKEAADKSQGANLYIKNLDDSIGDETLKELFSEFGNITSCKVMRDPSG-ISKGSGFVA  359

Query  760  YSSPQDAARAMEVLNFTPVNSKSI  831
            +S+P++A+RA+  +N   V SK +
Sbjct  360  FSTPEEASRALAEMNGKMVVSKPL  383



>gb|KHG16756.1| Polyadenylate-binding 2 -like protein [Gossypium arboreum]
Length=514

 Score =   120 bits (302),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 63/114 (55%), Positives = 80/114 (70%), Gaps = 12/114 (11%)
 Frame = +1

Query  493  MAQIQVQHQSpvalangvpppgavglpapQSAAGAGNQLSTTSLYVGDLDPTVTDSQLYD  672
            MAQ+QVQH +PV+    V            ++   G Q   TSLYVGDLD +VTD QLY 
Sbjct  1    MAQVQVQHHAPVSGPISV------------ASGHGGAQFMPTSLYVGDLDVSVTDEQLYQ  48

Query  673  LFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQDAARAMEVLNFTPVNSKSIR  834
             F +V  VVSVRVCRD ++ RSLGYGYVNY++P+DAARA+++LNFTP+N+K IR
Sbjct  49   TFGEVAPVVSVRVCRDTATGRSLGYGYVNYNNPRDAARALDLLNFTPMNNKPIR  102


 Score = 54.7 bits (130),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 27/68 (40%), Positives = 43/68 (63%), Gaps = 1/68 (1%)
 Frame = +1

Query  601  NQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQDA  780
            N++   ++YV +L  T TD +L  +F + G++ SV V RD   + S  +G+VN+ +  DA
Sbjct  140  NKVKFNNVYVKNLSDTTTDEELKTVFGEHGEITSVVVMRDADGK-SKCFGFVNFENADDA  198

Query  781  ARAMEVLN  804
            ARA+E LN
Sbjct  199  ARAVEALN  206



>gb|KJB63883.1| hypothetical protein B456_010G021800 [Gossypium raimondii]
Length=461

 Score =   120 bits (300),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 63/114 (55%), Positives = 81/114 (71%), Gaps = 12/114 (11%)
 Frame = +1

Query  493  MAQIQVQHQSpvalangvpppgavglpapQSAAGAGNQLSTTSLYVGDLDPTVTDSQLYD  672
            MAQI+VQ Q  +++ N V            +    G Q   TSLYVGDLD TVTD QL+ 
Sbjct  1    MAQIEVQRQPAISVPNAV------------APQTGGVQFIPTSLYVGDLDVTVTDEQLFQ  48

Query  673  LFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQDAARAMEVLNFTPVNSKSIR  834
            LF QV +V SVR+CRD+++ RSLGYGYVNYS+P+DAARA+++LNFTP+N+K IR
Sbjct  49   LFGQVARVASVRICRDLATGRSLGYGYVNYSNPRDAARALDLLNFTPLNNKPIR  102


 Score = 62.8 bits (151),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 31/84 (37%), Positives = 55/84 (65%), Gaps = 1/84 (1%)
 Frame = +1

Query  580  QSAAGAGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVN  759
            Q+   A ++L   +LYV +LD ++ D +L +LF++ G+++S +V RD S   S G G+V 
Sbjct  300  QTVKEAADKLKGMNLYVKNLDDSIDDEKLKELFSEYGKIISCKVMRDPSG-VSKGSGFVA  358

Query  760  YSSPQDAARAMEVLNFTPVNSKSI  831
            +S+P++A+RA+  +N   V SK +
Sbjct  359  FSTPEEASRALAEMNHKLVVSKPL  382



>ref|XP_010093503.1| Polyadenylate-binding protein 2 [Morus notabilis]
 gb|EXB54169.1| Polyadenylate-binding protein 2 [Morus notabilis]
Length=647

 Score =   121 bits (304),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 55/75 (73%), Positives = 69/75 (92%), Gaps = 0/75 (0%)
 Frame = +1

Query  610  STTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQDAARA  789
            +TTSLYVGDL+ +V ++QLYDLF+QVGQVVSVRVCRD+SSRRSLGYGYVN+S+PQ+A+RA
Sbjct  27   ATTSLYVGDLEGSVNETQLYDLFSQVGQVVSVRVCRDLSSRRSLGYGYVNFSNPQEASRA  86

Query  790  MEVLNFTPVNSKSIR  834
            ++V+NF  VN K IR
Sbjct  87   LDVMNFASVNGKPIR  101


 Score = 50.8 bits (120),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 46/71 (65%), Gaps = 1/71 (1%)
 Frame = +1

Query  619  SLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQDAARAMEV  798
            +LYV +LD +VTD +L +LF+  G + S +V RD +   S G G+V +S+ ++A+RA+  
Sbjct  312  NLYVKNLDDSVTDEKLRELFSDFGTITSCKVMRDPNG-ISRGSGFVAFSTAEEASRALSE  370

Query  799  LNFTPVNSKSI  831
            +N   V SK +
Sbjct  371  MNGKMVVSKPL  381



>ref|XP_006661030.1| PREDICTED: polyadenylate-binding protein 8-like, partial [Oryza 
brachyantha]
Length=627

 Score =   121 bits (303),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 55/76 (72%), Positives = 65/76 (86%), Gaps = 0/76 (0%)
 Frame = +1

Query  607  LSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQDAAR  786
               TSLYVGDLD +V D+QL+D+F QVG VVSVRVCRD+++RRSLGY YVNYSSP DAAR
Sbjct  2    FPATSLYVGDLDVSVQDAQLFDVFAQVGGVVSVRVCRDVNTRRSLGYAYVNYSSPADAAR  61

Query  787  AMEVLNFTPVNSKSIR  834
            A+E+LNFTP+N K IR
Sbjct  62   ALEMLNFTPINGKPIR  77


 Score = 54.3 bits (129),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 28/79 (35%), Positives = 49/79 (62%), Gaps = 1/79 (1%)
 Frame = +1

Query  595  AGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQ  774
            A ++   T+LY+ +LD ++ D +L +LF + G + S +V RD S+  S G G+V + S +
Sbjct  280  AADKYQNTNLYLKNLDDSIDDDKLRELFAEFGTITSCKVMRD-SNGVSRGSGFVAFKSAE  338

Query  775  DAARAMEVLNFTPVNSKSI  831
            DA+RA+  +N   + SK +
Sbjct  339  DASRALAEMNSKMIGSKPL  357



>ref|XP_010432462.1| PREDICTED: polyadenylate-binding protein 2-like isoform X1 [Camelina 
sativa]
 ref|XP_010432463.1| PREDICTED: polyadenylate-binding protein 2-like isoform X2 [Camelina 
sativa]
Length=632

 Score =   121 bits (303),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 55/83 (66%), Positives = 69/83 (83%), Gaps = 0/83 (0%)
 Frame = +1

Query  586  AAGAGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNYS  765
             A A  Q  TTSLYVGDLD  VTDSQL+D F+Q+GQVVSVRVCRD+++RRSLGYGYVN++
Sbjct  27   GAAAATQFGTTSLYVGDLDLNVTDSQLFDAFSQMGQVVSVRVCRDLATRRSLGYGYVNFT  86

Query  766  SPQDAARAMEVLNFTPVNSKSIR  834
            +PQDA+RA++ LN+ P+  K IR
Sbjct  87   NPQDASRAIQELNYIPLYGKPIR  109


 Score = 57.8 bits (138),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 29/84 (35%), Positives = 52/84 (62%), Gaps = 1/84 (1%)
 Frame = +1

Query  580  QSAAGAGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVN  759
            Q+   A ++  +++LYV +LDP+++D +L ++F+  G V S +V RD +   S G G+V 
Sbjct  307  QNLKEAADKFQSSNLYVKNLDPSISDEKLKEIFSPFGTVTSCKVMRDPNG-TSKGSGFVA  365

Query  760  YSSPQDAARAMEVLNFTPVNSKSI  831
            +S P++A  AM  L+   + SK +
Sbjct  366  FSIPEEATEAMSQLSGKMIESKPL  389


 Score = 54.3 bits (129),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 30/81 (37%), Positives = 49/81 (60%), Gaps = 7/81 (9%)
 Frame = +1

Query  589  AGAGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNYSS  768
            +GAGN      +++ +LD ++    L+D F+  G +VS +V  D SS +S GYG+V Y+S
Sbjct  122  SGAGN------IFIKNLDDSIDHKALHDTFSTFGNIVSCKVAVD-SSGQSKGYGFVQYAS  174

Query  769  PQDAARAMEVLNFTPVNSKSI  831
             + A +A+E LN   +N K +
Sbjct  175  EESAQKAIEKLNGMLLNDKQV  195



>gb|KJB63884.1| hypothetical protein B456_010G021800 [Gossypium raimondii]
Length=501

 Score =   120 bits (300),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 63/114 (55%), Positives = 81/114 (71%), Gaps = 12/114 (11%)
 Frame = +1

Query  493  MAQIQVQHQSpvalangvpppgavglpapQSAAGAGNQLSTTSLYVGDLDPTVTDSQLYD  672
            MAQI+VQ Q  +++ N V            +    G Q   TSLYVGDLD TVTD QL+ 
Sbjct  1    MAQIEVQRQPAISVPNAV------------APQTGGVQFIPTSLYVGDLDVTVTDEQLFQ  48

Query  673  LFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQDAARAMEVLNFTPVNSKSIR  834
            LF QV +V SVR+CRD+++ RSLGYGYVNYS+P+DAARA+++LNFTP+N+K IR
Sbjct  49   LFGQVARVASVRICRDLATGRSLGYGYVNYSNPRDAARALDLLNFTPLNNKPIR  102


 Score = 62.4 bits (150),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 31/84 (37%), Positives = 55/84 (65%), Gaps = 1/84 (1%)
 Frame = +1

Query  580  QSAAGAGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVN  759
            Q+   A ++L   +LYV +LD ++ D +L +LF++ G+++S +V RD S   S G G+V 
Sbjct  300  QTVKEAADKLKGMNLYVKNLDDSIDDEKLKELFSEYGKIISCKVMRDPSG-VSKGSGFVA  358

Query  760  YSSPQDAARAMEVLNFTPVNSKSI  831
            +S+P++A+RA+  +N   V SK +
Sbjct  359  FSTPEEASRALAEMNHKLVVSKPL  382



>gb|KJB14633.1| hypothetical protein B456_002G134900 [Gossypium raimondii]
Length=645

 Score =   121 bits (303),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 71/114 (62%), Positives = 83/114 (73%), Gaps = 11/114 (10%)
 Frame = +1

Query  493  MAQIQVQHQSpvalangvpppgavglpapQSAAGAGNQLSTTSLYVGDLDPTVTDSQLYD  672
            MAQIQVQHQ+PV+  NGV              A  G Q   TSLYVGDLD TVTD QLY 
Sbjct  1    MAQIQVQHQAPVSGPNGV-----------APGAAGGAQFMLTSLYVGDLDVTVTDEQLYQ  49

Query  673  LFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQDAARAMEVLNFTPVNSKSIR  834
            LF+QV  V SVRVCRD++S RSLGYGYVNY++ +DAARAM++LNFTP+N+K IR
Sbjct  50   LFSQVAPVASVRVCRDLASGRSLGYGYVNYNNLRDAARAMDLLNFTPLNNKPIR  103


 Score = 55.5 bits (132),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 29/84 (35%), Positives = 51/84 (61%), Gaps = 1/84 (1%)
 Frame = +1

Query  580  QSAAGAGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVN  759
            Q+   A ++    +LY+ +LD ++ D  L +LF++ G + S +V RD S   S G G+V 
Sbjct  301  QTMKEAADKSQGANLYIKNLDDSIGDETLKELFSEFGNITSCKVMRDPSG-ISKGSGFVA  359

Query  760  YSSPQDAARAMEVLNFTPVNSKSI  831
            +S+P++A+RA+  +N   V SK +
Sbjct  360  FSTPEEASRALAEMNGKMVVSKPL  383



>gb|KJB14632.1| hypothetical protein B456_002G134900 [Gossypium raimondii]
Length=652

 Score =   121 bits (303),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 71/114 (62%), Positives = 83/114 (73%), Gaps = 11/114 (10%)
 Frame = +1

Query  493  MAQIQVQHQSpvalangvpppgavglpapQSAAGAGNQLSTTSLYVGDLDPTVTDSQLYD  672
            MAQIQVQHQ+PV+  NGV              A  G Q   TSLYVGDLD TVTD QLY 
Sbjct  1    MAQIQVQHQAPVSGPNGV-----------APGAAGGAQFMLTSLYVGDLDVTVTDEQLYQ  49

Query  673  LFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQDAARAMEVLNFTPVNSKSIR  834
            LF+QV  V SVRVCRD++S RSLGYGYVNY++ +DAARAM++LNFTP+N+K IR
Sbjct  50   LFSQVAPVASVRVCRDLASGRSLGYGYVNYNNLRDAARAMDLLNFTPLNNKPIR  103


 Score = 55.5 bits (132),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 29/84 (35%), Positives = 51/84 (61%), Gaps = 1/84 (1%)
 Frame = +1

Query  580  QSAAGAGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVN  759
            Q+   A ++    +LY+ +LD ++ D  L +LF++ G + S +V RD S   S G G+V 
Sbjct  301  QTMKEAADKSQGANLYIKNLDDSIGDETLKELFSEFGNITSCKVMRDPSG-ISKGSGFVA  359

Query  760  YSSPQDAARAMEVLNFTPVNSKSI  831
            +S+P++A+RA+  +N   V SK +
Sbjct  360  FSTPEEASRALAEMNGKMVVSKPL  383



>gb|KJB14629.1| hypothetical protein B456_002G134900 [Gossypium raimondii]
Length=651

 Score =   121 bits (303),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 71/114 (62%), Positives = 83/114 (73%), Gaps = 11/114 (10%)
 Frame = +1

Query  493  MAQIQVQHQSpvalangvpppgavglpapQSAAGAGNQLSTTSLYVGDLDPTVTDSQLYD  672
            MAQIQVQHQ+PV+  NGV              A  G Q   TSLYVGDLD TVTD QLY 
Sbjct  1    MAQIQVQHQAPVSGPNGV-----------APGAAGGAQFMLTSLYVGDLDVTVTDEQLYQ  49

Query  673  LFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQDAARAMEVLNFTPVNSKSIR  834
            LF+QV  V SVRVCRD++S RSLGYGYVNY++ +DAARAM++LNFTP+N+K IR
Sbjct  50   LFSQVAPVASVRVCRDLASGRSLGYGYVNYNNLRDAARAMDLLNFTPLNNKPIR  103


 Score = 55.5 bits (132),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 29/84 (35%), Positives = 51/84 (61%), Gaps = 1/84 (1%)
 Frame = +1

Query  580  QSAAGAGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVN  759
            Q+   A ++    +LY+ +LD ++ D  L +LF++ G + S +V RD S   S G G+V 
Sbjct  301  QTMKEAADKSQGANLYIKNLDDSIGDETLKELFSEFGNITSCKVMRDPSG-ISKGSGFVA  359

Query  760  YSSPQDAARAMEVLNFTPVNSKSI  831
            +S+P++A+RA+  +N   V SK +
Sbjct  360  FSTPEEASRALAEMNGKMVVSKPL  383



>ref|XP_009398670.1| PREDICTED: polyadenylate-binding protein 2-like [Musa acuminata 
subsp. malaccensis]
Length=643

 Score =   121 bits (303),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 55/77 (71%), Positives = 67/77 (87%), Gaps = 0/77 (0%)
 Frame = +1

Query  604  QLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQDAA  783
            Q S+TSLYVGDLDP VTD+QLYD+F+Q+G VVSVRVCRD+++R SLGY YVNY+   DAA
Sbjct  23   QFSSTSLYVGDLDPGVTDAQLYDVFSQIGAVVSVRVCRDMNTRFSLGYAYVNYNDAADAA  82

Query  784  RAMEVLNFTPVNSKSIR  834
            RA+EVLNF P+N K+IR
Sbjct  83   RALEVLNFMPLNGKTIR  99



>gb|EYU37653.1| hypothetical protein MIMGU_mgv1a002809mg [Erythranthe guttata]
Length=635

 Score =   120 bits (302),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 54/82 (66%), Positives = 64/82 (78%), Gaps = 0/82 (0%)
 Frame = +1

Query  589  AGAGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNYSS  768
            A +G     TSLYVGDL+  +TDSQLYDLF Q+G+VVSVR+CRD++SR SLGYGYVNY  
Sbjct  18   ASSGGAPPVTSLYVGDLEANITDSQLYDLFQQIGEVVSVRICRDLTSRESLGYGYVNYGD  77

Query  769  PQDAARAMEVLNFTPVNSKSIR  834
            PQ A RA+E LNFTP N + IR
Sbjct  78   PQHAERALEELNFTPFNGRPIR  99


 Score = 57.0 bits (136),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 31/81 (38%), Positives = 48/81 (59%), Gaps = 7/81 (9%)
 Frame = +1

Query  589  AGAGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNYSS  768
            +GAGN      +Y+ +LD  +    L+D F+  G ++S +V  D SS +S+GYG+V Y+S
Sbjct  112  SGAGN------IYIKNLDKEIDHKALHDTFSTFGNILSCKVATD-SSDQSMGYGFVQYAS  164

Query  769  PQDAARAMEVLNFTPVNSKSI  831
               A RA+E LN   +N K +
Sbjct  165  EDSAQRAIESLNGMLLNGKQV  185


 Score = 51.2 bits (121),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 31/84 (37%), Positives = 46/84 (55%), Gaps = 1/84 (1%)
 Frame = +1

Query  580  QSAAGAGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVN  759
            QS   A      T+LYV +LD  + D +L +LF+  G + S +V RD     S G G+V 
Sbjct  297  QSLKEAAENSQGTNLYVKNLDDGIDDDKLKELFSPFGSITSCKVMRDPKG-ISRGSGFVA  355

Query  760  YSSPQDAARAMEVLNFTPVNSKSI  831
            +SSP +A RA+  +N   V +K +
Sbjct  356  FSSPDEANRALSEMNGKIVVNKPL  379



>ref|NP_001062583.1| Os09g0115400 [Oryza sativa Japonica Group]
 dbj|BAD16229.1| putative poly(A)-binding protein [Oryza sativa Japonica Group]
 dbj|BAF24497.1| Os09g0115400 [Oryza sativa Japonica Group]
 gb|EAZ08133.1| hypothetical protein OsI_30396 [Oryza sativa Indica Group]
 gb|EAZ43770.1| hypothetical protein OsJ_28392 [Oryza sativa Japonica Group]
 gb|ACA50516.1| poly(A)-binding protein [Oryza sativa Japonica Group]
 dbj|BAG90618.1| unnamed protein product [Oryza sativa Japonica Group]
Length=662

 Score =   121 bits (303),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 55/76 (72%), Positives = 65/76 (86%), Gaps = 0/76 (0%)
 Frame = +1

Query  607  LSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQDAAR  786
               TSLYVGDLD +V D+QL+D+F QVG VVSVRVCRD+++RRSLGY YVNYSSP DAAR
Sbjct  37   FPATSLYVGDLDVSVQDAQLFDVFAQVGGVVSVRVCRDVNTRRSLGYAYVNYSSPADAAR  96

Query  787  AMEVLNFTPVNSKSIR  834
            A+E+LNFTP+N K IR
Sbjct  97   ALEMLNFTPINGKPIR  112


 Score = 54.3 bits (129),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 30/79 (38%), Positives = 49/79 (62%), Gaps = 1/79 (1%)
 Frame = +1

Query  595  AGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQ  774
            A ++   T+LY+ +LD +V D +L +LF + G + S +V RD S+  S G G+V + S +
Sbjct  315  AADKYQNTNLYLKNLDDSVDDDKLRELFAEYGTITSCKVMRD-SNGVSRGSGFVAFKSAE  373

Query  775  DAARAMEVLNFTPVNSKSI  831
            DA+RA+  +N   V SK +
Sbjct  374  DASRALAEMNSKMVGSKPL  392



>ref|XP_006578034.1| PREDICTED: polyadenylate-binding protein 8 isoform X3 [Glycine 
max]
Length=623

 Score =   120 bits (301),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 55/84 (65%), Positives = 70/84 (83%), Gaps = 0/84 (0%)
 Frame = +1

Query  583  SAAGAGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNY  762
            +A+GA   L+T SLYVGDL   V D QLYDLFNQV QVVSVR+CRD+++++SLGYGYVN+
Sbjct  13   AASGANPSLTTISLYVGDLHHDVNDPQLYDLFNQVAQVVSVRICRDVATQQSLGYGYVNF  72

Query  763  SSPQDAARAMEVLNFTPVNSKSIR  834
            S+  DAA+A++VLNFTP+N K IR
Sbjct  73   SNAHDAAKAIDVLNFTPLNGKIIR  96



>ref|XP_009395913.1| PREDICTED: polyadenylate-binding protein 2-like [Musa acuminata 
subsp. malaccensis]
Length=652

 Score =   120 bits (302),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 55/77 (71%), Positives = 67/77 (87%), Gaps = 0/77 (0%)
 Frame = +1

Query  604  QLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQDAA  783
            Q  TTSLYVGDL  +VTD+Q+YDLF+Q+  VVSVRVCRD+++RRSLGY YVNYS+P DAA
Sbjct  26   QFPTTSLYVGDLQASVTDAQVYDLFSQIAPVVSVRVCRDVNTRRSLGYAYVNYSNPVDAA  85

Query  784  RAMEVLNFTPVNSKSIR  834
             A+EVLNFTP+N+K IR
Sbjct  86   TALEVLNFTPLNNKPIR  102



>gb|KJB63885.1| hypothetical protein B456_010G021800 [Gossypium raimondii]
Length=579

 Score =   120 bits (300),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 63/114 (55%), Positives = 81/114 (71%), Gaps = 12/114 (11%)
 Frame = +1

Query  493  MAQIQVQHQSpvalangvpppgavglpapQSAAGAGNQLSTTSLYVGDLDPTVTDSQLYD  672
            MAQI+VQ Q  +++ N V            +    G Q   TSLYVGDLD TVTD QL+ 
Sbjct  1    MAQIEVQRQPAISVPNAV------------APQTGGVQFIPTSLYVGDLDVTVTDEQLFQ  48

Query  673  LFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQDAARAMEVLNFTPVNSKSIR  834
            LF QV +V SVR+CRD+++ RSLGYGYVNYS+P+DAARA+++LNFTP+N+K IR
Sbjct  49   LFGQVARVASVRICRDLATGRSLGYGYVNYSNPRDAARALDLLNFTPLNNKPIR  102


 Score = 62.4 bits (150),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 31/84 (37%), Positives = 55/84 (65%), Gaps = 1/84 (1%)
 Frame = +1

Query  580  QSAAGAGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVN  759
            Q+   A ++L   +LYV +LD ++ D +L +LF++ G+++S +V RD S   S G G+V 
Sbjct  259  QTVKEAADKLKGMNLYVKNLDDSIDDEKLKELFSEYGKIISCKVMRDPSG-VSKGSGFVA  317

Query  760  YSSPQDAARAMEVLNFTPVNSKSI  831
            +S+P++A+RA+  +N   V SK +
Sbjct  318  FSTPEEASRALAEMNHKLVVSKPL  341



>ref|XP_006578033.1| PREDICTED: polyadenylate-binding protein 8 isoform X2 [Glycine 
max]
Length=624

 Score =   120 bits (301),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 55/84 (65%), Positives = 70/84 (83%), Gaps = 0/84 (0%)
 Frame = +1

Query  583  SAAGAGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNY  762
            +A+GA   L+T SLYVGDL   V D QLYDLFNQV QVVSVR+CRD+++++SLGYGYVN+
Sbjct  13   AASGANPSLTTISLYVGDLHHDVNDPQLYDLFNQVAQVVSVRICRDVATQQSLGYGYVNF  72

Query  763  SSPQDAARAMEVLNFTPVNSKSIR  834
            S+  DAA+A++VLNFTP+N K IR
Sbjct  73   SNAHDAAKAIDVLNFTPLNGKIIR  96



>ref|XP_002448132.1| hypothetical protein SORBIDRAFT_06g021850 [Sorghum bicolor]
 gb|EES12460.1| hypothetical protein SORBIDRAFT_06g021850 [Sorghum bicolor]
Length=664

 Score =   120 bits (302),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 56/76 (74%), Positives = 68/76 (89%), Gaps = 0/76 (0%)
 Frame = +1

Query  607  LSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQDAAR  786
            L TTSLYVGDL+ +V+DSQLY+LF+Q GQVVSVRVCRD++SRRSLGY YVN+S+P DAAR
Sbjct  43   LPTTSLYVGDLEGSVSDSQLYELFSQAGQVVSVRVCRDVTSRRSLGYAYVNFSNPLDAAR  102

Query  787  AMEVLNFTPVNSKSIR  834
            A+EVLNF  +N+K IR
Sbjct  103  ALEVLNFAVLNNKPIR  118



>ref|XP_003523956.1| PREDICTED: polyadenylate-binding protein 8 isoform X1 [Glycine 
max]
 gb|ABC47841.1| poly(A)-binding protein [Glycine max]
Length=630

 Score =   120 bits (301),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 55/84 (65%), Positives = 70/84 (83%), Gaps = 0/84 (0%)
 Frame = +1

Query  583  SAAGAGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNY  762
            +A+GA   L+T SLYVGDL   V D QLYDLFNQV QVVSVR+CRD+++++SLGYGYVN+
Sbjct  13   AASGANPSLTTISLYVGDLHHDVNDPQLYDLFNQVAQVVSVRICRDVATQQSLGYGYVNF  72

Query  763  SSPQDAARAMEVLNFTPVNSKSIR  834
            S+  DAA+A++VLNFTP+N K IR
Sbjct  73   SNAHDAAKAIDVLNFTPLNGKIIR  96



>ref|XP_003544466.1| PREDICTED: polyadenylate-binding protein 8-like [Glycine max]
 gb|KHN35693.1| Polyadenylate-binding protein 2 [Glycine soja]
Length=652

 Score =   120 bits (302),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 72/114 (63%), Positives = 86/114 (75%), Gaps = 9/114 (8%)
 Frame = +1

Query  493  MAQIQVQHQSpvalangvpppgavglpapQSAAGAGNQLSTTSLYVGDLDPTVTDSQLYD  672
            MAQIQVQHQSPV+                 +A    NQ  TTSLYVGDL+  V D+QLYD
Sbjct  1    MAQIQVQHQSPVSAPPPNGVA---------NAPNNPNQFVTTSLYVGDLEQNVNDAQLYD  51

Query  673  LFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQDAARAMEVLNFTPVNSKSIR  834
            LFNQV QVVSVRVCRD+++RRSLGYGYVN+S+PQDAARA++VLNFTP+N++ IR
Sbjct  52   LFNQVVQVVSVRVCRDLTTRRSLGYGYVNFSNPQDAARALDVLNFTPLNNRPIR  105


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 29/79 (37%), Positives = 43/79 (54%), Gaps = 4/79 (5%)
 Frame = +1

Query  601  NQLSTTSL---YVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSP  771
            N LS T     YV +L  + TD +L   F + G + S  + RD   + S  +G+VN+ +P
Sbjct  204  NALSKTKFNNVYVKNLSESTTDEELMKFFGEYGTITSAVIMRDADGK-SRCFGFVNFENP  262

Query  772  QDAARAMEVLNFTPVNSKS  828
             DAA+A+E LN   V+ K 
Sbjct  263  DDAAKAVEGLNGKKVDDKE  281


 Score = 51.6 bits (122),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 25/84 (30%), Positives = 50/84 (60%), Gaps = 1/84 (1%)
 Frame = +1

Query  580  QSAAGAGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVN  759
            QS   + ++    +LY+ +LD T++D +L ++F + G + S +V RD +     G G+V 
Sbjct  303  QSIKESADKYQGVNLYLKNLDDTISDEKLKEMFAEYGTITSCKVMRDPTGI-GRGSGFVA  361

Query  760  YSSPQDAARAMEVLNFTPVNSKSI  831
            +S+P++A+RA+  +N   +  K +
Sbjct  362  FSTPEEASRALGEMNGKMIAGKPL  385



>gb|KJB29450.1| hypothetical protein B456_005G101600 [Gossypium raimondii]
Length=648

 Score =   120 bits (301),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 62/114 (54%), Positives = 79/114 (69%), Gaps = 12/114 (11%)
 Frame = +1

Query  493  MAQIQVQHQSpvalangvpppgavglpapQSAAGAGNQLSTTSLYVGDLDPTVTDSQLYD  672
            MAQ+QVQH + V+    V            ++   G Q   TSLYVGDLD +VTD QLY 
Sbjct  1    MAQVQVQHHASVSGPISV------------ASGHGGAQFMPTSLYVGDLDVSVTDEQLYQ  48

Query  673  LFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQDAARAMEVLNFTPVNSKSIR  834
             F +V  VVSVRVCRD ++ RSLGYGYVNY++P+DAARA+++LNFTP+N+K IR
Sbjct  49   TFGEVAPVVSVRVCRDTATGRSLGYGYVNYNNPRDAARALDLLNFTPMNNKPIR  102


 Score = 54.7 bits (130),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 27/70 (39%), Positives = 44/70 (63%), Gaps = 1/70 (1%)
 Frame = +1

Query  595  AGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQ  774
            A N++   ++YV +L  T TD +L  +F + G++ SV V RD   + S  +G+VN+ +  
Sbjct  202  APNKVKFNNVYVKNLSDTTTDEELKTIFGEHGEITSVVVMRDADGK-SKCFGFVNFENAD  260

Query  775  DAARAMEVLN  804
            DAA+A+E LN
Sbjct  261  DAAKAVEALN  270


 Score = 53.9 bits (128),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 26/82 (32%), Positives = 50/82 (61%), Gaps = 1/82 (1%)
 Frame = +1

Query  580  QSAAGAGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVN  759
            Q+   A ++    +LY+ +LD ++ D +L  +F++ G + S ++ RD S   S G G+V 
Sbjct  300  QNMKEASDKFQGLNLYIKNLDDSIGDEKLKKMFSEFGNITSCKIMRDPSGI-SKGSGFVA  358

Query  760  YSSPQDAARAMEVLNFTPVNSK  825
            +S+P++A+RA+  +N   + SK
Sbjct  359  FSTPEEASRALAEMNGKMIVSK  380



>ref|XP_012074453.1| PREDICTED: polyadenylate-binding protein 3 [Jatropha curcas]
 gb|KDP36031.1| hypothetical protein JCGZ_09997 [Jatropha curcas]
Length=640

 Score =   120 bits (301),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 56/76 (74%), Positives = 64/76 (84%), Gaps = 0/76 (0%)
 Frame = +1

Query  607  LSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQDAAR  786
             S  SLYVGDL+  V+DSQLYDLF+QV QVVSVRVCRD + R SLGYGYVN+S+PQDAA+
Sbjct  26   FSNLSLYVGDLEQNVSDSQLYDLFSQVAQVVSVRVCRDQAKRSSLGYGYVNFSNPQDAAK  85

Query  787  AMEVLNFTPVNSKSIR  834
            AME LNFTP+N K IR
Sbjct  86   AMEALNFTPLNGKPIR  101



>ref|XP_007153580.1| hypothetical protein PHAVU_003G0475000g, partial [Phaseolus vulgaris]
 gb|ESW25574.1| hypothetical protein PHAVU_003G0475000g, partial [Phaseolus vulgaris]
Length=85

 Score =   111 bits (278),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 52/59 (88%), Positives = 56/59 (95%), Gaps = 0/59 (0%)
 Frame = +1

Query  601  NQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQD  777
            NQ  TTSLYVGDLDP VTDSQLYDLFNQ+GQVVSVRVCRD++SRRSLGYGYVNYS+PQD
Sbjct  27   NQFVTTSLYVGDLDPNVTDSQLYDLFNQLGQVVSVRVCRDLTSRRSLGYGYVNYSNPQD  85



>gb|KJB63886.1| hypothetical protein B456_010G021800 [Gossypium raimondii]
Length=620

 Score =   120 bits (301),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 63/114 (55%), Positives = 81/114 (71%), Gaps = 12/114 (11%)
 Frame = +1

Query  493  MAQIQVQHQSpvalangvpppgavglpapQSAAGAGNQLSTTSLYVGDLDPTVTDSQLYD  672
            MAQI+VQ Q  +++ N V            +    G Q   TSLYVGDLD TVTD QL+ 
Sbjct  1    MAQIEVQRQPAISVPNAV------------APQTGGVQFIPTSLYVGDLDVTVTDEQLFQ  48

Query  673  LFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQDAARAMEVLNFTPVNSKSIR  834
            LF QV +V SVR+CRD+++ RSLGYGYVNYS+P+DAARA+++LNFTP+N+K IR
Sbjct  49   LFGQVARVASVRICRDLATGRSLGYGYVNYSNPRDAARALDLLNFTPLNNKPIR  102


 Score = 62.4 bits (150),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 31/84 (37%), Positives = 55/84 (65%), Gaps = 1/84 (1%)
 Frame = +1

Query  580  QSAAGAGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVN  759
            Q+   A ++L   +LYV +LD ++ D +L +LF++ G+++S +V RD S   S G G+V 
Sbjct  300  QTVKEAADKLKGMNLYVKNLDDSIDDEKLKELFSEYGKIISCKVMRDPSG-VSKGSGFVA  358

Query  760  YSSPQDAARAMEVLNFTPVNSKSI  831
            +S+P++A+RA+  +N   V SK +
Sbjct  359  FSTPEEASRALAEMNHKLVVSKPL  382



>gb|KJB58541.1| hypothetical protein B456_009G214100 [Gossypium raimondii]
Length=650

 Score =   120 bits (301),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 64/114 (56%), Positives = 82/114 (72%), Gaps = 12/114 (11%)
 Frame = +1

Query  493  MAQIQVQHQSpvalangvpppgavglpapQSAAGAGNQLSTTSLYVGDLDPTVTDSQLYD  672
            MAQI VQ+Q+PV+  N V            +    G Q   TSLYVGDLD +VTD QL+ 
Sbjct  1    MAQIHVQYQAPVSGPNCV------------APGPGGPQFMLTSLYVGDLDASVTDEQLFQ  48

Query  673  LFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQDAARAMEVLNFTPVNSKSIR  834
             F+QV QV SVRVCRD+++ RSLGYGYVNY++P+DAARA+++LNFTP+N+K IR
Sbjct  49   TFSQVAQVASVRVCRDLATGRSLGYGYVNYNNPRDAARALDLLNFTPLNNKPIR  102


 Score = 56.6 bits (135),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 30/84 (36%), Positives = 51/84 (61%), Gaps = 1/84 (1%)
 Frame = +1

Query  580  QSAAGAGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVN  759
            Q+   A ++L   +LY+ +LD  + D  L +LF++ G + S +V RD S   S G G+V 
Sbjct  300  QTLKEAADKLQGLNLYIKNLDDGIGDEALKELFSEFGTITSCKVMRDPSG-ISKGSGFVA  358

Query  760  YSSPQDAARAMEVLNFTPVNSKSI  831
            +S+P++A+RA+  +N   V SK +
Sbjct  359  FSTPEEASRALAEMNGKMVVSKPL  382



>ref|XP_006412276.1| hypothetical protein EUTSA_v10024683mg [Eutrema salsugineum]
 gb|ESQ53729.1| hypothetical protein EUTSA_v10024683mg [Eutrema salsugineum]
Length=599

 Score =   119 bits (299),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 54/77 (70%), Positives = 67/77 (87%), Gaps = 0/77 (0%)
 Frame = +1

Query  604  QLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQDAA  783
            Q  TTSLYVGDLD  VTDSQL+D F+Q+GQVVSVRVCRD+++RRSLGYGYVN+++PQDAA
Sbjct  32   QFGTTSLYVGDLDFNVTDSQLFDAFSQMGQVVSVRVCRDLATRRSLGYGYVNFTNPQDAA  91

Query  784  RAMEVLNFTPVNSKSIR  834
            RA++ LN+ P+  K IR
Sbjct  92   RAIQELNYIPLYGKPIR  108


 Score = 58.9 bits (141),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/84 (35%), Positives = 53/84 (63%), Gaps = 1/84 (1%)
 Frame = +1

Query  580  QSAAGAGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVN  759
            Q+   A ++  +++LYV +LDP+++D +L ++F+  G V S +V RD +   S G G+V 
Sbjct  281  QNLKEAADKFQSSNLYVKNLDPSISDEKLKEIFSPFGTVTSCKVMRDPNG-ISKGSGFVA  339

Query  760  YSSPQDAARAMEVLNFTPVNSKSI  831
            +S+P++A  AM  L+   + SK +
Sbjct  340  FSTPEEATEAMSQLSGKMIESKPL  363


 Score = 51.6 bits (122),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 26/70 (37%), Positives = 44/70 (63%), Gaps = 1/70 (1%)
 Frame = +1

Query  595  AGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQ  774
            + N+   T++YV +L  + TD  L + F++ G++ S  V +D    +S G+G+VN+ +  
Sbjct  183  SANKTKFTNVYVKNLAESTTDDDLKNTFSEYGKITSAVVMKD-GDGKSKGFGFVNFENAD  241

Query  775  DAARAMEVLN  804
            DAARA+E LN
Sbjct  242  DAARAVESLN  251



>ref|XP_003573691.1| PREDICTED: polyadenylate-binding protein 2-like [Brachypodium 
distachyon]
Length=663

 Score =   120 bits (301),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 55/73 (75%), Positives = 65/73 (89%), Gaps = 0/73 (0%)
 Frame = +1

Query  616  TSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQDAARAME  795
            TSLYVGDLD +V D+QL+D+F+QVG VVSVRVCRD+++R SLGY YVN+SSP DAARAME
Sbjct  42   TSLYVGDLDVSVQDAQLFDVFSQVGSVVSVRVCRDVNTRMSLGYAYVNFSSPADAARAME  101

Query  796  VLNFTPVNSKSIR  834
            +LNFTPVN K IR
Sbjct  102  MLNFTPVNGKPIR  114



>ref|XP_001761820.1| predicted protein [Physcomitrella patens]
 gb|EDQ73261.1| predicted protein [Physcomitrella patens]
Length=439

 Score =   117 bits (294),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 53/80 (66%), Positives = 68/80 (85%), Gaps = 0/80 (0%)
 Frame = +1

Query  595  AGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQ  774
            A  Q  +TSLYVGDL+P V+++QLY++F+QVGQVVS+RVCRD+ +RRSLGY YVNY++ Q
Sbjct  17   APTQFVSTSLYVGDLEPNVSEAQLYEMFSQVGQVVSIRVCRDLITRRSLGYSYVNYNNAQ  76

Query  775  DAARAMEVLNFTPVNSKSIR  834
            DA RA+E+LNFT VN K IR
Sbjct  77   DATRALELLNFTGVNGKPIR  96


 Score = 52.0 bits (123),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 44/71 (62%), Gaps = 1/71 (1%)
 Frame = +1

Query  619  SLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQDAARAMEV  798
            +LY+ +LD TV D ++ +LF + G + S +V RD    +S G G+V +SSP +A RA+  
Sbjct  307  NLYLKNLDDTVDDEKIRELFAEYGTITSCKVMRDHQG-QSKGSGFVAFSSPDEATRAVTE  365

Query  799  LNFTPVNSKSI  831
            +N   V +K +
Sbjct  366  MNGKMVGNKPL  376



>gb|AAQ56342.1| putative poly(A)-binding protein [Oryza sativa Japonica Group]
 gb|EAZ06502.1| hypothetical protein OsI_28747 [Oryza sativa Indica Group]
 gb|EAZ42278.1| hypothetical protein OsJ_26851 [Oryza sativa Japonica Group]
Length=456

 Score =   117 bits (294),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 53/76 (70%), Positives = 65/76 (86%), Gaps = 0/76 (0%)
 Frame = +1

Query  607  LSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQDAAR  786
               TSLYVGDLD +V D+QL+D+F+QVG VVSVRVCRD+++R SLGY YVN+SSP DAAR
Sbjct  36   FQATSLYVGDLDVSVQDAQLFDVFSQVGSVVSVRVCRDVNTRLSLGYAYVNFSSPADAAR  95

Query  787  AMEVLNFTPVNSKSIR  834
            A+E+LNFTP+N K IR
Sbjct  96   ALEMLNFTPINGKPIR  111



>ref|XP_002891531.1| PAB8 binding protein 8 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH67790.1| PAB8 binding protein 8 [Arabidopsis lyrata subsp. lyrata]
Length=669

 Score =   120 bits (300),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 54/77 (70%), Positives = 67/77 (87%), Gaps = 0/77 (0%)
 Frame = +1

Query  604  QLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQDAA  783
            Q  TTSLYVGDLD TVTDSQL++ F+Q GQVVSVRVCRD+++RRSLGYGYVNY++PQDA+
Sbjct  35   QQGTTSLYVGDLDATVTDSQLFEAFSQAGQVVSVRVCRDMTTRRSLGYGYVNYATPQDAS  94

Query  784  RAMEVLNFTPVNSKSIR  834
            RA+  LNF  +N ++IR
Sbjct  95   RALNELNFMALNGRAIR  111


 Score = 53.1 bits (126),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 29/84 (35%), Positives = 51/84 (61%), Gaps = 1/84 (1%)
 Frame = +1

Query  580  QSAAGAGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVN  759
            QS   A ++   ++LYV +LD +VTD +L + F   G + S +V RD +   S G G+V 
Sbjct  309  QSLKEAADKSQGSNLYVKNLDESVTDDKLREHFAPFGTITSCKVMRDPTG-VSRGSGFVA  367

Query  760  YSSPQDAARAMEVLNFTPVNSKSI  831
            +S+P++A+RA+  +N   + +K +
Sbjct  368  FSTPEEASRAITEMNGKMIVTKPL  391


 Score = 51.6 bits (122),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 24/70 (34%), Positives = 44/70 (63%), Gaps = 1/70 (1%)
 Frame = +1

Query  595  AGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQ  774
            +G ++  T++YV +L  +++D +L  +F + G   S  + RD    +S G+G+VN+ +  
Sbjct  211  SGEKVKFTNVYVKNLSESLSDEELNKVFGEFGVTTSCVIMRD-GEGKSKGFGFVNFENSD  269

Query  775  DAARAMEVLN  804
            DAARA++ LN
Sbjct  270  DAARAVDALN  279



>ref|XP_006412275.1| hypothetical protein EUTSA_v10024683mg [Eutrema salsugineum]
 gb|ESQ53728.1| hypothetical protein EUTSA_v10024683mg [Eutrema salsugineum]
Length=624

 Score =   119 bits (299),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 54/77 (70%), Positives = 67/77 (87%), Gaps = 0/77 (0%)
 Frame = +1

Query  604  QLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQDAA  783
            Q  TTSLYVGDLD  VTDSQL+D F+Q+GQVVSVRVCRD+++RRSLGYGYVN+++PQDAA
Sbjct  32   QFGTTSLYVGDLDFNVTDSQLFDAFSQMGQVVSVRVCRDLATRRSLGYGYVNFTNPQDAA  91

Query  784  RAMEVLNFTPVNSKSIR  834
            RA++ LN+ P+  K IR
Sbjct  92   RAIQELNYIPLYGKPIR  108


 Score = 58.9 bits (141),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/84 (35%), Positives = 53/84 (63%), Gaps = 1/84 (1%)
 Frame = +1

Query  580  QSAAGAGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVN  759
            Q+   A ++  +++LYV +LDP+++D +L ++F+  G V S +V RD +   S G G+V 
Sbjct  306  QNLKEAADKFQSSNLYVKNLDPSISDEKLKEIFSPFGTVTSCKVMRDPNG-ISKGSGFVA  364

Query  760  YSSPQDAARAMEVLNFTPVNSKSI  831
            +S+P++A  AM  L+   + SK +
Sbjct  365  FSTPEEATEAMSQLSGKMIESKPL  388


 Score = 51.6 bits (122),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 26/70 (37%), Positives = 44/70 (63%), Gaps = 1/70 (1%)
 Frame = +1

Query  595  AGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQ  774
            + N+   T++YV +L  + TD  L + F++ G++ S  V +D    +S G+G+VN+ +  
Sbjct  208  SANKTKFTNVYVKNLAESTTDDDLKNTFSEYGKITSAVVMKD-GDGKSKGFGFVNFENAD  266

Query  775  DAARAMEVLN  804
            DAARA+E LN
Sbjct  267  DAARAVESLN  276



>ref|NP_001053248.1| Os04g0504800 [Oryza sativa Japonica Group]
 emb|CAE05558.1| OSJNBb0116K07.11 [Oryza sativa Japonica Group]
 dbj|BAF15162.1| Os04g0504800 [Oryza sativa Japonica Group]
 dbj|BAG90316.1| unnamed protein product [Oryza sativa Japonica Group]
Length=659

 Score =   119 bits (299),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 54/72 (75%), Positives = 65/72 (90%), Gaps = 0/72 (0%)
 Frame = +1

Query  619  SLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQDAARAMEV  798
            SLYVGDL+ +VTDSQLY+LF+Q GQV+SVRVCRDISSRRSLGY YVN+++P DAARA+E+
Sbjct  40   SLYVGDLEASVTDSQLYELFSQAGQVMSVRVCRDISSRRSLGYAYVNFNNPVDAARALEL  99

Query  799  LNFTPVNSKSIR  834
            LNF P+N K IR
Sbjct  100  LNFAPLNGKPIR  111



>gb|EEC77593.1| hypothetical protein OsI_16552 [Oryza sativa Indica Group]
Length=659

 Score =   119 bits (298),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 54/72 (75%), Positives = 65/72 (90%), Gaps = 0/72 (0%)
 Frame = +1

Query  619  SLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQDAARAMEV  798
            SLYVGDL+ +VTDSQLY+LF+Q GQV+SVRVCRDISSRRSLGY YVN+++P DAARA+E+
Sbjct  40   SLYVGDLEASVTDSQLYELFSQAGQVMSVRVCRDISSRRSLGYAYVNFNNPVDAARALEL  99

Query  799  LNFTPVNSKSIR  834
            LNF P+N K IR
Sbjct  100  LNFAPLNGKPIR  111



>emb|CDY62723.1| BnaC03g77220D [Brassica napus]
Length=617

 Score =   119 bits (297),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 54/84 (64%), Positives = 71/84 (85%), Gaps = 0/84 (0%)
 Frame = +1

Query  583  SAAGAGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNY  762
            ++A A  Q+ TTSLYVGDLD  VTDSQL++ F+Q+GQVVSVRVCRD+++R+SLGYGYVN 
Sbjct  10   TSAAAPAQIGTTSLYVGDLDLNVTDSQLFEAFSQMGQVVSVRVCRDLATRKSLGYGYVNL  69

Query  763  SSPQDAARAMEVLNFTPVNSKSIR  834
            ++PQDAARA++ +NF P+  K IR
Sbjct  70   ANPQDAARAIQEMNFMPLYGKPIR  93


 Score = 60.5 bits (145),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 31/84 (37%), Positives = 52/84 (62%), Gaps = 1/84 (1%)
 Frame = +1

Query  580  QSAAGAGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVN  759
            Q+   A  +  +++LYV +LDP+++D +L ++F+  G V S +V RD S   S G G+V 
Sbjct  291  QNLKEAAEKFQSSNLYVKNLDPSISDEKLKEIFSPFGTVTSCKVMRDPSG-ISKGSGFVA  349

Query  760  YSSPQDAARAMEVLNFTPVNSKSI  831
            +S+P++A  AM  L+   V SK +
Sbjct  350  FSTPEEATEAMSQLSGKMVESKPL  373


 Score = 52.8 bits (125),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/70 (37%), Positives = 43/70 (61%), Gaps = 1/70 (1%)
 Frame = +1

Query  595  AGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQ  774
            + N+   T++YV +L  + TD  L   F++ G++ S  V +D    +S G+G+VN+ +  
Sbjct  193  SANKTKFTNVYVKNLGESTTDDDLKKAFSEYGKITSAVVMKD-GEGKSKGFGFVNFENAD  251

Query  775  DAARAMEVLN  804
            DAARA+E LN
Sbjct  252  DAARAVEALN  261



>ref|XP_002869174.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH45433.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=625

 Score =   119 bits (298),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 65/114 (57%), Positives = 82/114 (72%), Gaps = 6/114 (5%)
 Frame = +1

Query  493  MAQIQVQHQSpvalangvpppgavglpapQSAAGAGNQLSTTSLYVGDLDPTVTDSQLYD  672
            MAQ+Q+Q Q+P      V         A  +AAG G    TTSLYVGDLD  VTDSQL+D
Sbjct  1    MAQVQLQGQTPNGSTVAVTSAPVTSGGA--TAAGFG----TTSLYVGDLDVNVTDSQLFD  54

Query  673  LFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQDAARAMEVLNFTPVNSKSIR  834
             F+Q+G VVSVRVCRD+++RRSLGYGYVN+++PQDAARA++ LN+ P+  K IR
Sbjct  55   AFSQMGPVVSVRVCRDLATRRSLGYGYVNFTNPQDAARAIQELNYIPLYGKPIR  108


 Score = 59.7 bits (143),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 29/84 (35%), Positives = 53/84 (63%), Gaps = 1/84 (1%)
 Frame = +1

Query  580  QSAAGAGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVN  759
            Q+   A ++  +++LYV +LDP+++D +L ++F+  G V S +V RD +   S G G+V 
Sbjct  306  QNLKEAADKFQSSNLYVKNLDPSISDEKLKEIFSPFGTVTSCKVMRDPNG-TSKGSGFVA  364

Query  760  YSSPQDAARAMEVLNFTPVNSKSI  831
            +S+P++A  AM  L+   + SK +
Sbjct  365  FSTPEEATEAMSQLSGKMIESKPL  388


 Score = 52.8 bits (125),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/68 (38%), Positives = 42/68 (62%), Gaps = 1/68 (1%)
 Frame = +1

Query  601  NQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQDA  780
            N+   T++YV +L  + TD  L + F + G++ S  V +D    +S G+G+VN+ +  DA
Sbjct  210  NKTKFTNVYVKNLAESTTDDDLKNAFGEYGKITSAVVMKD-GDGKSKGFGFVNFENADDA  268

Query  781  ARAMEVLN  804
            ARA+E LN
Sbjct  269  ARAVESLN  276



>ref|NP_564554.1| poly(A) binding protein 8 [Arabidopsis thaliana]
 ref|NP_001185184.1| poly(A) binding protein 8 [Arabidopsis thaliana]
 sp|Q9FXA2.1|PABP8_ARATH RecName: Full=Polyadenylate-binding protein 8; Short=PABP-8; 
Short=Poly(A)-binding protein 8 [Arabidopsis thaliana]
 gb|AAG13056.1|AC011807_15 Putative Poly-A Binding Protein [Arabidopsis thaliana]
 gb|AAK43894.1|AF370517_1 Putative Poly-A Binding Protein [Arabidopsis thaliana]
 gb|AAL47336.1| putative Poly-A Binding Protein [Arabidopsis thaliana]
 gb|AEE32472.1| poly(A) binding protein 8 [Arabidopsis thaliana]
 gb|AEE32473.1| poly(A) binding protein 8 [Arabidopsis thaliana]
Length=671

 Score =   119 bits (298),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 54/77 (70%), Positives = 66/77 (86%), Gaps = 0/77 (0%)
 Frame = +1

Query  604  QLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQDAA  783
            Q  TTSLYVGDLD TVTDSQL++ F Q GQVVSVRVCRD+++RRSLGYGYVNY++PQDA+
Sbjct  41   QQGTTSLYVGDLDATVTDSQLFEAFTQAGQVVSVRVCRDMTTRRSLGYGYVNYATPQDAS  100

Query  784  RAMEVLNFTPVNSKSIR  834
            RA+  LNF  +N ++IR
Sbjct  101  RALNELNFMALNGRAIR  117


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 30/84 (36%), Positives = 50/84 (60%), Gaps = 1/84 (1%)
 Frame = +1

Query  580  QSAAGAGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVN  759
            QS   A ++   ++LYV +LD +VTD +L + F   G + S +V RD S   S G G+V 
Sbjct  315  QSLKEAADKSQGSNLYVKNLDESVTDDKLREHFAPFGTITSCKVMRDPSG-VSRGSGFVA  373

Query  760  YSSPQDAARAMEVLNFTPVNSKSI  831
            +S+P++A RA+  +N   + +K +
Sbjct  374  FSTPEEATRAITEMNGKMIVTKPL  397


 Score = 50.8 bits (120),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 24/70 (34%), Positives = 44/70 (63%), Gaps = 1/70 (1%)
 Frame = +1

Query  595  AGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQ  774
            +G ++  T++YV +L  +++D +L  +F + G   S  + RD    +S G+G+VN+ +  
Sbjct  217  SGEKVKFTNVYVKNLSESLSDEELNKVFGEFGVTTSCVIMRD-GEGKSKGFGFVNFENSD  275

Query  775  DAARAMEVLN  804
            DAARA++ LN
Sbjct  276  DAARAVDALN  285



>emb|CAE02947.3| OSJNBa0014K14.19 [Oryza sativa Japonica Group]
Length=657

 Score =   119 bits (298),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 54/72 (75%), Positives = 65/72 (90%), Gaps = 0/72 (0%)
 Frame = +1

Query  619  SLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQDAARAMEV  798
            SLYVGDL+ +VTDSQLY+LF+Q GQV+SVRVCRDISSRRSLGY YVN+++P DAARA+E+
Sbjct  40   SLYVGDLEASVTDSQLYELFSQAGQVMSVRVCRDISSRRSLGYAYVNFNNPVDAARALEL  99

Query  799  LNFTPVNSKSIR  834
            LNF P+N K IR
Sbjct  100  LNFAPLNGKPIR  111



>ref|XP_006393217.1| hypothetical protein EUTSA_v10011289mg [Eutrema salsugineum]
 gb|ESQ30503.1| hypothetical protein EUTSA_v10011289mg [Eutrema salsugineum]
Length=669

 Score =   119 bits (298),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 54/77 (70%), Positives = 67/77 (87%), Gaps = 0/77 (0%)
 Frame = +1

Query  604  QLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQDAA  783
            Q  TTSLYVGDLD TVTDSQL++ F+Q GQVVSVRVCRD+++RRSLGYGYVNY++PQDA+
Sbjct  33   QQGTTSLYVGDLDQTVTDSQLFEAFSQAGQVVSVRVCRDMTTRRSLGYGYVNYATPQDAS  92

Query  784  RAMEVLNFTPVNSKSIR  834
            RA+  LNF  +N ++IR
Sbjct  93   RALNELNFMALNGRAIR  109


 Score = 54.3 bits (129),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 30/84 (36%), Positives = 50/84 (60%), Gaps = 1/84 (1%)
 Frame = +1

Query  580  QSAAGAGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVN  759
            QS   A ++   ++LYV +LD +VTD +L + F   G + S +V RD S   S G G+V 
Sbjct  307  QSLKEAADKSQGSNLYVKNLDESVTDEKLREHFTAFGTITSCKVMRDPSG-VSRGSGFVA  365

Query  760  YSSPQDAARAMEVLNFTPVNSKSI  831
            +S+P++A RA+  +N   + +K +
Sbjct  366  FSTPEEATRAIAEMNGKMIVTKPL  389


 Score = 54.3 bits (129),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 26/70 (37%), Positives = 43/70 (61%), Gaps = 1/70 (1%)
 Frame = +1

Query  595  AGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQ  774
            +G ++   ++YV +L  ++TD +L  +F + G   S  + RD    +S G+G+VN+ S  
Sbjct  209  SGEKVKFNNVYVKNLSESLTDEELNKVFGEFGSTTSCVIMRD-GEGKSKGFGFVNFESSD  267

Query  775  DAARAMEVLN  804
            DAARA+E LN
Sbjct  268  DAARAVEALN  277



>emb|CDY54068.1| BnaCnng26160D [Brassica napus]
Length=653

 Score =   119 bits (297),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 54/77 (70%), Positives = 66/77 (86%), Gaps = 0/77 (0%)
 Frame = +1

Query  604  QLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQDAA  783
            Q  TTSLYVGDLD TVTDSQL++ F+Q GQVVSVRVCRD+++RRSLGYGYVNY++PQDA 
Sbjct  25   QQGTTSLYVGDLDQTVTDSQLFEAFSQAGQVVSVRVCRDMTTRRSLGYGYVNYATPQDAT  84

Query  784  RAMEVLNFTPVNSKSIR  834
            RA+  LNF  +N ++IR
Sbjct  85   RALNELNFMALNGRAIR  101


 Score = 54.7 bits (130),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 30/84 (36%), Positives = 51/84 (61%), Gaps = 1/84 (1%)
 Frame = +1

Query  580  QSAAGAGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVN  759
            QS   A ++   ++LYV +LD +VTD +L + F   G + S +V RD +   S G G+V 
Sbjct  299  QSLKEAADKSQGSNLYVKNLDESVTDEKLREHFTPFGTITSCKVMRDPTG-VSRGSGFVA  357

Query  760  YSSPQDAARAMEVLNFTPVNSKSI  831
            +S+P++A+RA+  +N   + SK +
Sbjct  358  FSTPEEASRAIAEMNGKMIVSKPL  381


 Score = 52.4 bits (124),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/70 (34%), Positives = 44/70 (63%), Gaps = 1/70 (1%)
 Frame = +1

Query  595  AGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQ  774
            +G ++   ++YV +L  +++D +L  +F + G   S  + RD    +S G+G+VN+ S +
Sbjct  201  SGEKVKFNNVYVKNLSESMSDEELKKVFGEFGVTTSCVIMRD-GEGKSKGFGFVNFESSE  259

Query  775  DAARAMEVLN  804
            DAA+A+E LN
Sbjct  260  DAAKAVEALN  269



>gb|KJB79362.1| hypothetical protein B456_013G046000 [Gossypium raimondii]
Length=417

 Score =   116 bits (291),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 52/77 (68%), Positives = 65/77 (84%), Gaps = 0/77 (0%)
 Frame = +1

Query  604  QLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQDAA  783
            Q   TSLYVGDLD +VT++QLYD F  VG V++VRVC+D+S+RRSLGYGYVNY +PQDAA
Sbjct  23   QFVPTSLYVGDLDSSVTEAQLYDYFAHVGPVLTVRVCKDLSTRRSLGYGYVNYGNPQDAA  82

Query  784  RAMEVLNFTPVNSKSIR  834
            RA+++LNFT +N K IR
Sbjct  83   RALDLLNFTLLNGKPIR  99


 Score = 60.5 bits (145),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 32/84 (38%), Positives = 53/84 (63%), Gaps = 1/84 (1%)
 Frame = +1

Query  580  QSAAGAGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVN  759
            QS   A ++    +LYV +LD +++D +L +LF+Q G + S +V RD S   S G G+V 
Sbjct  297  QSMKEAADKFQGANLYVKNLDDSISDEKLKELFSQYGTITSYKVMRDPSG-ISKGSGFVA  355

Query  760  YSSPQDAARAMEVLNFTPVNSKSI  831
            +S+P++A+RA+  +N   V SK +
Sbjct  356  FSTPEEASRALAEMNGKMVVSKPL  379



>gb|KJB79364.1| hypothetical protein B456_013G046000 [Gossypium raimondii]
Length=516

 Score =   117 bits (293),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 52/77 (68%), Positives = 65/77 (84%), Gaps = 0/77 (0%)
 Frame = +1

Query  604  QLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQDAA  783
            Q   TSLYVGDLD +VT++QLYD F  VG V++VRVC+D+S+RRSLGYGYVNY +PQDAA
Sbjct  23   QFVPTSLYVGDLDSSVTEAQLYDYFAHVGPVLTVRVCKDLSTRRSLGYGYVNYGNPQDAA  82

Query  784  RAMEVLNFTPVNSKSIR  834
            RA+++LNFT +N K IR
Sbjct  83   RALDLLNFTLLNGKPIR  99


 Score = 60.1 bits (144),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 32/84 (38%), Positives = 53/84 (63%), Gaps = 1/84 (1%)
 Frame = +1

Query  580  QSAAGAGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVN  759
            QS   A ++    +LYV +LD +++D +L +LF+Q G + S +V RD S   S G G+V 
Sbjct  297  QSMKEAADKFQGANLYVKNLDDSISDEKLKELFSQYGTITSYKVMRDPSG-ISKGSGFVA  355

Query  760  YSSPQDAARAMEVLNFTPVNSKSI  831
            +S+P++A+RA+  +N   V SK +
Sbjct  356  FSTPEEASRALAEMNGKMVVSKPL  379



>ref|XP_010030473.1| PREDICTED: polyadenylate-binding protein 2-like [Eucalyptus grandis]
Length=122

 Score =   110 bits (276),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 53/72 (74%), Positives = 61/72 (85%), Gaps = 0/72 (0%)
 Frame = +1

Query  619  SLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQDAARAMEV  798
            SLYV DLD  VTDSQLYDLFNQV Q+ S+ VCRD+++RRSLGYGYVNYS+P DAARA+EV
Sbjct  2    SLYVDDLDSNVTDSQLYDLFNQVVQLASICVCRDLTTRRSLGYGYVNYSNPTDAARALEV  61

Query  799  LNFTPVNSKSIR  834
            LN T +N K IR
Sbjct  62   LNSTNLNEKPIR  73



>ref|XP_009342699.1| PREDICTED: polyadenylate-binding protein 3 [Pyrus x bretschneideri]
Length=664

 Score =   118 bits (296),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 52/76 (68%), Positives = 61/76 (80%), Gaps = 0/76 (0%)
 Frame = +1

Query  607  LSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQDAAR  786
                SLYVGDLDP+V ++QLYDLFNQ+GQ+VS+RVCRD S  +SLGY YVNY  PQ AA 
Sbjct  46   FGNVSLYVGDLDPSVNEAQLYDLFNQMGQIVSIRVCRDQSRMQSLGYAYVNYGDPQHAAN  105

Query  787  AMEVLNFTPVNSKSIR  834
            A+EVLNFTP+N K IR
Sbjct  106  ALEVLNFTPINGKPIR  121


 Score = 51.2 bits (121),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 27/72 (38%), Positives = 42/72 (58%), Gaps = 1/72 (1%)
 Frame = +1

Query  616  TSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQDAARAME  795
            T++YV +L  T TD  L   F + G + S  V RD  S +S  +G+VN+  P++AA A+E
Sbjct  228  TNVYVKNLSETTTDEDLKKTFGEHGNITSAVVMRD-GSGKSRCFGFVNFEKPEEAAAAIE  286

Query  796  VLNFTPVNSKSI  831
             LN + V+   +
Sbjct  287  KLNGSTVSGDKV  298



>ref|XP_008337230.1| PREDICTED: polyadenylate-binding protein 3-like [Malus domestica]
Length=646

 Score =   118 bits (296),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 52/76 (68%), Positives = 61/76 (80%), Gaps = 0/76 (0%)
 Frame = +1

Query  607  LSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQDAAR  786
                SLYVGDLDP+V ++QLYDLFNQ+GQ+VS+RVCRD S  +SLGY YVNY  PQ AA 
Sbjct  29   FGNVSLYVGDLDPSVNEAQLYDLFNQMGQIVSIRVCRDQSRMQSLGYAYVNYGDPQHAAN  88

Query  787  AMEVLNFTPVNSKSIR  834
            A+EVLNFTP+N K IR
Sbjct  89   ALEVLNFTPINGKPIR  104


 Score = 51.2 bits (121),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 27/72 (38%), Positives = 42/72 (58%), Gaps = 1/72 (1%)
 Frame = +1

Query  616  TSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQDAARAME  795
            T++YV +L  T TD  L   F + G + S  V RD  S +S  +G+VN+  P++AA A+E
Sbjct  211  TNVYVKNLSETTTDEDLKKTFGEHGNITSAVVMRD-GSGKSRCFGFVNFEKPEEAAAAIE  269

Query  796  VLNFTPVNSKSI  831
             LN + V+   +
Sbjct  270  KLNGSTVSGDKV  281



>emb|CDX71223.1| BnaC07g05020D [Brassica napus]
Length=638

 Score =   118 bits (295),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 51/85 (60%), Positives = 71/85 (84%), Gaps = 0/85 (0%)
 Frame = +1

Query  580  QSAAGAGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVN  759
            Q+  G+G    TTSLYVGDL   VTD+QL++ F+Q+GQVV+VRVCRD+++RRSLGYGYVN
Sbjct  9    QNPNGSGTAGGTTSLYVGDLHANVTDAQLFEAFSQMGQVVTVRVCRDLATRRSLGYGYVN  68

Query  760  YSSPQDAARAMEVLNFTPVNSKSIR  834
            +++PQDAARA++ +N+ P+N K +R
Sbjct  69   FATPQDAARAIQEMNYIPLNGKPVR  93


 Score = 55.1 bits (131),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 28/84 (33%), Positives = 53/84 (63%), Gaps = 1/84 (1%)
 Frame = +1

Query  580  QSAAGAGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVN  759
            QS   A ++  +++LYV +LD +++D +L +LF   G V S +V RD +   S G G+V 
Sbjct  291  QSLREAADKFQSSNLYVKNLDDSISDEKLKELFTPYGTVTSCKVMRDPNG-ISRGSGFVA  349

Query  760  YSSPQDAARAMEVLNFTPVNSKSI  831
            +S+P++A++AM  ++   + +K +
Sbjct  350  FSTPEEASKAMSEMSGKMIENKPL  373


 Score = 50.8 bits (120),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 26/71 (37%), Positives = 41/71 (58%), Gaps = 1/71 (1%)
 Frame = +1

Query  616  TSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQDAARAME  795
            T++YV +L  + TD  L + F + G + S  V +D    +S G+G+VN+ +  DAA+A+E
Sbjct  200  TNVYVKNLAESTTDDDLKNTFGEFGNITSAVVMKD-GDGKSKGFGFVNFDNADDAAKAVE  258

Query  796  VLNFTPVNSKS  828
             LN    N K 
Sbjct  259  ALNGKTFNDKE  269



>ref|NP_001061515.1| Os08g0314800 [Oryza sativa Japonica Group]
 dbj|BAC92404.1| putative polyadenylate-binding protein [Oryza sativa Japonica 
Group]
 dbj|BAC92537.1| putative polyadenylate-binding protein [Oryza sativa Japonica 
Group]
 dbj|BAF23429.1| Os08g0314800 [Oryza sativa Japonica Group]
 dbj|BAG89395.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAI39945.1| putative poly(A)-binding protein [Oryza sativa Indica Group]
Length=660

 Score =   118 bits (295),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 53/76 (70%), Positives = 65/76 (86%), Gaps = 0/76 (0%)
 Frame = +1

Query  607  LSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQDAAR  786
               TSLYVGDLD +V D+QL+D+F+QVG VVSVRVCRD+++R SLGY YVN+SSP DAAR
Sbjct  36   FQATSLYVGDLDVSVQDAQLFDVFSQVGSVVSVRVCRDVNTRLSLGYAYVNFSSPADAAR  95

Query  787  AMEVLNFTPVNSKSIR  834
            A+E+LNFTP+N K IR
Sbjct  96   ALEMLNFTPINGKPIR  111



>ref|XP_009147891.1| PREDICTED: polyadenylate-binding protein 8 [Brassica rapa]
 emb|CDY51045.1| BnaA06g03080D [Brassica napus]
Length=653

 Score =   118 bits (295),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 53/74 (72%), Positives = 65/74 (88%), Gaps = 0/74 (0%)
 Frame = +1

Query  613  TTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQDAARAM  792
            TTSLYVGDLD TVTDSQL++ F+Q GQVVSVRVCRD+++RRSLGYGYVNY++PQDA RA+
Sbjct  30   TTSLYVGDLDQTVTDSQLFEAFSQAGQVVSVRVCRDMTTRRSLGYGYVNYATPQDATRAL  89

Query  793  EVLNFTPVNSKSIR  834
              LNF  +N ++IR
Sbjct  90   NELNFMALNGRAIR  103


 Score = 54.7 bits (130),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 30/84 (36%), Positives = 51/84 (61%), Gaps = 1/84 (1%)
 Frame = +1

Query  580  QSAAGAGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVN  759
            QS   A ++   ++LYV +LD +VTD +L + F   G + S +V RD +   S G G+V 
Sbjct  301  QSLKEAADKSQGSNLYVKNLDESVTDEKLREHFTSFGTITSCKVMRDPTG-VSRGSGFVA  359

Query  760  YSSPQDAARAMEVLNFTPVNSKSI  831
            +S+P++A+RA+  +N   + SK +
Sbjct  360  FSTPEEASRAIAEMNGKMIVSKPL  383


 Score = 52.4 bits (124),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/70 (34%), Positives = 44/70 (63%), Gaps = 1/70 (1%)
 Frame = +1

Query  595  AGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQ  774
            +G ++   ++YV +L  +++D +L  +F + G   S  + RD    +S G+G+VN+ S +
Sbjct  203  SGEKVKFNNVYVKNLSESMSDEELKKVFGEFGVTTSCVIMRD-GEGKSKGFGFVNFESSE  261

Query  775  DAARAMEVLN  804
            DAA+A+E LN
Sbjct  262  DAAKAVEALN  271



>ref|XP_004956317.1| PREDICTED: polyadenylate-binding protein 2-like [Setaria italica]
Length=664

 Score =   118 bits (295),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 53/73 (73%), Positives = 65/73 (89%), Gaps = 0/73 (0%)
 Frame = +1

Query  616  TSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQDAARAME  795
            TSLYVGDL  +V D+QL+D+F+QVG VVSVRVCRDI+SR+SLGY YVNY++P DAARA+E
Sbjct  42   TSLYVGDLHESVQDAQLFDVFSQVGGVVSVRVCRDINSRKSLGYAYVNYNNPADAARALE  101

Query  796  VLNFTPVNSKSIR  834
            +LNFTP+N K IR
Sbjct  102  LLNFTPINGKPIR  114


 Score = 51.6 bits (122),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 27/72 (38%), Positives = 45/72 (63%), Gaps = 1/72 (1%)
 Frame = +1

Query  616  TSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQDAARAME  795
            +++YV +L  TVTD +L ++F + G + S  V RD S  +S  +G+VN+ +  DAA+A++
Sbjct  221  SNVYVKNLSETVTDDELKEMFGKYGTITSAVVMRD-SDGKSRCFGFVNFENADDAAQAVQ  279

Query  796  VLNFTPVNSKSI  831
             LN    N K +
Sbjct  280  ELNGKVFNDKEL  291



>gb|AAB38974.1| poly(A)-binding protein [Triticum aestivum]
Length=651

 Score =   117 bits (294),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 51/76 (67%), Positives = 65/76 (86%), Gaps = 0/76 (0%)
 Frame = +1

Query  607  LSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQDAAR  786
               TSLYVGDLD +V D+QL+D+F Q+G VVSVRVCRD++SR+SLGY YVNY++P DAAR
Sbjct  29   FPATSLYVGDLDVSVQDAQLFDVFAQIGGVVSVRVCRDVTSRKSLGYAYVNYNTPADAAR  88

Query  787  AMEVLNFTPVNSKSIR  834
            A+E+LNFTP+N + IR
Sbjct  89   ALEMLNFTPINGRPIR  104


 Score = 54.7 bits (130),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 30/79 (38%), Positives = 48/79 (61%), Gaps = 1/79 (1%)
 Frame = +1

Query  595  AGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQ  774
            A ++   T+LY+ +LD TV D +L +LF + G + S +V RD S+  S G G+V + S  
Sbjct  307  AADKYQNTNLYLKNLDDTVDDEKLRELFAEFGTITSCKVMRD-SNGASRGSGFVAFKSAD  365

Query  775  DAARAMEVLNFTPVNSKSI  831
            DA+RA+  +N   V +K +
Sbjct  366  DASRALAEMNNKMVGNKPL  384



>gb|KHG04776.1| Polyadenylate-binding 2 -like protein [Gossypium arboreum]
Length=622

 Score =   117 bits (293),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 65/114 (57%), Positives = 82/114 (72%), Gaps = 12/114 (11%)
 Frame = +1

Query  493  MAQIQVQHQSpvalangvpppgavglpapQSAAGAGNQLSTTSLYVGDLDPTVTDSQLYD  672
            MAQI VQ+Q+P++  NGV P               G Q   TSLYVGDLD +VTD QL+ 
Sbjct  1    MAQIHVQYQAPISGPNGVAPRL------------GGPQFMLTSLYVGDLDASVTDEQLFQ  48

Query  673  LFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQDAARAMEVLNFTPVNSKSIR  834
             F+QV QV SVRVCRD+++ RSLGYGYVNY++P+DAARA+ +LNFTP+N+K IR
Sbjct  49   TFSQVAQVASVRVCRDLATGRSLGYGYVNYNNPRDAARALNLLNFTPLNNKPIR  102



>gb|KJB79365.1| hypothetical protein B456_013G046000 [Gossypium raimondii]
Length=522

 Score =   116 bits (291),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 52/77 (68%), Positives = 65/77 (84%), Gaps = 0/77 (0%)
 Frame = +1

Query  604  QLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQDAA  783
            Q   TSLYVGDLD +VT++QLYD F  VG V++VRVC+D+S+RRSLGYGYVNY +PQDAA
Sbjct  23   QFVPTSLYVGDLDSSVTEAQLYDYFAHVGPVLTVRVCKDLSTRRSLGYGYVNYGNPQDAA  82

Query  784  RAMEVLNFTPVNSKSIR  834
            RA+++LNFT +N K IR
Sbjct  83   RALDLLNFTLLNGKPIR  99


 Score = 60.1 bits (144),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 32/84 (38%), Positives = 53/84 (63%), Gaps = 1/84 (1%)
 Frame = +1

Query  580  QSAAGAGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVN  759
            QS   A ++    +LYV +LD +++D +L +LF+Q G + S +V RD S   S G G+V 
Sbjct  297  QSMKEAADKFQGANLYVKNLDDSISDEKLKELFSQYGTITSYKVMRDPSG-ISKGSGFVA  355

Query  760  YSSPQDAARAMEVLNFTPVNSKSI  831
            +S+P++A+RA+  +N   V SK +
Sbjct  356  FSTPEEASRALAEMNGKMVVSKPL  379



>gb|EMT11582.1| Polyadenylate-binding protein 2 [Aegilops tauschii]
Length=433

 Score =   115 bits (288),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 53/73 (73%), Positives = 64/73 (88%), Gaps = 0/73 (0%)
 Frame = +1

Query  616  TSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQDAARAME  795
            TSLYVGDLD +V D+QL+D+F+QVG VVSVRVCRD+++R SLGY YVN+S P DAARA+E
Sbjct  17   TSLYVGDLDVSVQDAQLFDVFSQVGSVVSVRVCRDVNTRMSLGYAYVNFSIPADAARALE  76

Query  796  VLNFTPVNSKSIR  834
            +LNFTPVN K IR
Sbjct  77   MLNFTPVNGKPIR  89



>tpg|DAA39540.1| TPA: hypothetical protein ZEAMMB73_983793 [Zea mays]
Length=281

 Score =   113 bits (283),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 52/73 (71%), Positives = 64/73 (88%), Gaps = 0/73 (0%)
 Frame = +1

Query  616  TSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQDAARAME  795
            TSLYVGDL  +V D+QL+D+F+QVG VVSVRVCRDI+SR+SLGY YVNY++  DAARA+E
Sbjct  35   TSLYVGDLHESVQDAQLFDVFSQVGGVVSVRVCRDINSRKSLGYAYVNYNNQGDAARALE  94

Query  796  VLNFTPVNSKSIR  834
            +LNFTP+N K IR
Sbjct  95   LLNFTPINGKPIR  107



>ref|XP_009335160.1| PREDICTED: polyadenylate-binding protein 3 [Pyrus x bretschneideri]
Length=648

 Score =   117 bits (293),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 51/72 (71%), Positives = 60/72 (83%), Gaps = 0/72 (0%)
 Frame = +1

Query  619  SLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQDAARAMEV  798
            SLYVGDLDP+V ++QLYDLFNQ+GQ+VS+RVCRD +   SLGY YVNY  PQ AA A+EV
Sbjct  33   SLYVGDLDPSVNEAQLYDLFNQMGQIVSIRVCRDQNRMHSLGYAYVNYGDPQHAANALEV  92

Query  799  LNFTPVNSKSIR  834
            LNFTP+N K IR
Sbjct  93   LNFTPINGKPIR  104



>ref|XP_002985732.1| hypothetical protein SELMODRAFT_122762 [Selaginella moellendorffii]
 gb|EFJ13310.1| hypothetical protein SELMODRAFT_122762 [Selaginella moellendorffii]
Length=635

 Score =   117 bits (292),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 53/78 (68%), Positives = 66/78 (85%), Gaps = 0/78 (0%)
 Frame = +1

Query  601  NQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQDA  780
            NQ  +TSLYVGDLDP VT+ QLYD+FNQV  V+S+RVCRD+ S+RSLGY YVNY++ QDA
Sbjct  32   NQFFSTSLYVGDLDPNVTEGQLYDVFNQVAPVLSIRVCRDLISKRSLGYAYVNYNTGQDA  91

Query  781  ARAMEVLNFTPVNSKSIR  834
            +RA+E+LNF+ VN K IR
Sbjct  92   SRALEMLNFSLVNGKPIR  109


 Score = 51.2 bits (121),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 44/71 (62%), Gaps = 1/71 (1%)
 Frame = +1

Query  619  SLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQDAARAMEV  798
            +LY+ +LD T+ D +L +LF+  G ++S +V RD     S G G+V +S+ ++A RAM  
Sbjct  320  NLYLKNLDDTIDDDKLRELFHGFGTIISCKVMRDPQG-HSKGSGFVAFSTTEEANRAMTE  378

Query  799  LNFTPVNSKSI  831
            +N   V +K I
Sbjct  379  MNGRMVANKPI  389



>ref|XP_002974435.1| hypothetical protein SELMODRAFT_101161 [Selaginella moellendorffii]
 gb|EFJ24657.1| hypothetical protein SELMODRAFT_101161 [Selaginella moellendorffii]
Length=642

 Score =   117 bits (292),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 53/78 (68%), Positives = 66/78 (85%), Gaps = 0/78 (0%)
 Frame = +1

Query  601  NQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQDA  780
            NQ  +TSLYVGDLDP VT+ QLYD+FNQV  V+S+RVCRD+ S+RSLGY YVNY++ QDA
Sbjct  32   NQFFSTSLYVGDLDPNVTEGQLYDVFNQVAPVLSIRVCRDLISKRSLGYAYVNYNTGQDA  91

Query  781  ARAMEVLNFTPVNSKSIR  834
            +RA+E+LNF+ VN K IR
Sbjct  92   SRALEMLNFSLVNGKPIR  109


 Score = 51.2 bits (121),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 44/71 (62%), Gaps = 1/71 (1%)
 Frame = +1

Query  619  SLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQDAARAMEV  798
            +LY+ +LD T+ D +L +LF+  G ++S +V RD     S G G+V +S+ ++A RAM  
Sbjct  320  NLYLKNLDDTIDDDKLRELFHGFGTIISCKVMRDPQG-HSKGSGFVAFSTTEEANRAMTE  378

Query  799  LNFTPVNSKSI  831
            +N   V +K I
Sbjct  379  MNGRMVANKPI  389



>emb|CDY51957.1| BnaA08g11610D [Brassica napus]
Length=619

 Score =   117 bits (292),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 51/76 (67%), Positives = 67/76 (88%), Gaps = 0/76 (0%)
 Frame = +1

Query  607  LSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQDAAR  786
            + TTSLYVGDLD  VTDSQL++ F+Q+GQVVSVRVCRD+++R+SLGYGYVN+++PQDAAR
Sbjct  20   IGTTSLYVGDLDLNVTDSQLFEAFSQMGQVVSVRVCRDLATRKSLGYGYVNFANPQDAAR  79

Query  787  AMEVLNFTPVNSKSIR  834
            A++ +NF P+  K IR
Sbjct  80   AIQEMNFMPLYGKPIR  95


 Score = 60.1 bits (144),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 31/84 (37%), Positives = 52/84 (62%), Gaps = 1/84 (1%)
 Frame = +1

Query  580  QSAAGAGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVN  759
            Q+   A  +  +++LYV +LDP+++D +L ++F+  G V S +V RD S   S G G+V 
Sbjct  293  QNLKEAAEKFQSSNLYVKNLDPSISDEKLKEIFSPFGTVTSCKVMRDPSG-ISKGSGFVA  351

Query  760  YSSPQDAARAMEVLNFTPVNSKSI  831
            +S+P++A  AM  L+   V SK +
Sbjct  352  FSTPEEATEAMSQLSGKMVESKPL  375


 Score = 52.8 bits (125),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/70 (37%), Positives = 43/70 (61%), Gaps = 1/70 (1%)
 Frame = +1

Query  595  AGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQ  774
            + N+   T++YV +L  + TD  L   F++ G++ S  V +D    +S G+G+VN+ +  
Sbjct  195  SANKTKFTNVYVKNLGESTTDDDLKKAFSEYGKITSAVVMKD-GEGKSKGFGFVNFENAD  253

Query  775  DAARAMEVLN  804
            DAARA+E LN
Sbjct  254  DAARAVEALN  263



>dbj|BAJ96406.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=744

 Score =   117 bits (293),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 51/76 (67%), Positives = 65/76 (86%), Gaps = 0/76 (0%)
 Frame = +1

Query  607  LSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQDAAR  786
               TSLYVGDLD +V D+QL+D+F Q+G VVSVRVCRD++SR+SLGY YVNY++P DAAR
Sbjct  122  FPATSLYVGDLDVSVQDAQLFDVFAQIGGVVSVRVCRDVTSRKSLGYAYVNYNTPADAAR  181

Query  787  AMEVLNFTPVNSKSIR  834
            A+E+LNFTP+N + IR
Sbjct  182  ALEMLNFTPINGRPIR  197


 Score = 54.7 bits (130),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 30/79 (38%), Positives = 48/79 (61%), Gaps = 1/79 (1%)
 Frame = +1

Query  595  AGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQ  774
            A ++   T+LY+ +LD TV D +L +LF + G + S +V RD S+  S G G+V + S  
Sbjct  400  AADKYQNTNLYLKNLDDTVDDEKLRELFAEFGTITSCKVMRD-SNGASRGSGFVAFKSAD  458

Query  775  DAARAMEVLNFTPVNSKSI  831
            DA+RA+  +N   V +K +
Sbjct  459  DASRALAEMNNKMVGNKPL  477



>gb|KHN43945.1| Polyadenylate-binding protein 2 [Glycine soja]
Length=95

 Score =   108 bits (270),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 49/74 (66%), Positives = 59/74 (80%), Gaps = 0/74 (0%)
 Frame = +1

Query  586  AAGAGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNYS  765
               AGNQ  TTSLYVGDLDP + D+QLYDLFNQ+ QV+SVRVCRD+++RRSLGYGYVN+S
Sbjct  18   GGAAGNQFVTTSLYVGDLDPNIMDAQLYDLFNQLEQVISVRVCRDLTTRRSLGYGYVNFS  77

Query  766  SPQDAARAMEVLNF  807
            +PQDA   +    F
Sbjct  78   NPQDAVVLLSCYIF  91



>ref|XP_009108756.1| PREDICTED: polyadenylate-binding protein 2 [Brassica rapa]
Length=619

 Score =   116 bits (291),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 51/76 (67%), Positives = 67/76 (88%), Gaps = 0/76 (0%)
 Frame = +1

Query  607  LSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQDAAR  786
            + TTSLYVGDLD  VTDSQL++ F+Q+GQVVSVRVCRD+++R+SLGYGYVN+++PQDAAR
Sbjct  20   IGTTSLYVGDLDLNVTDSQLFEAFSQMGQVVSVRVCRDLATRKSLGYGYVNFANPQDAAR  79

Query  787  AMEVLNFTPVNSKSIR  834
            A++ +NF P+  K IR
Sbjct  80   AIQEMNFMPLYGKPIR  95


 Score = 60.1 bits (144),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 31/84 (37%), Positives = 52/84 (62%), Gaps = 1/84 (1%)
 Frame = +1

Query  580  QSAAGAGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVN  759
            Q+   A  +  +++LYV +LDP+++D +L ++F+  G V S +V RD S   S G G+V 
Sbjct  293  QNLKEAAEKFQSSNLYVKNLDPSISDEKLKEIFSPFGTVTSCKVMRDPSG-ISKGSGFVA  351

Query  760  YSSPQDAARAMEVLNFTPVNSKSI  831
            +S+P++A  AM  L+   V SK +
Sbjct  352  FSTPEEATEAMSQLSGKMVESKPL  375


 Score = 52.8 bits (125),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/70 (37%), Positives = 43/70 (61%), Gaps = 1/70 (1%)
 Frame = +1

Query  595  AGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQ  774
            + N+   T++YV +L  + TD  L   F++ G++ S  V +D    +S G+G+VN+ +  
Sbjct  195  SANKTKFTNVYVKNLGESTTDDDLKKAFSEYGKITSAVVMKD-GEGKSKGFGFVNFENAD  253

Query  775  DAARAMEVLN  804
            DAARA+E LN
Sbjct  254  DAARAVEALN  263



>ref|NP_195137.5| polyadenylate-binding protein 2 [Arabidopsis thaliana]
 sp|P42731.1|PABP2_ARATH RecName: Full=Polyadenylate-binding protein 2; Short=PABP-2; 
Short=Poly(A)-binding protein 2 [Arabidopsis thaliana]
 gb|AAA61780.1| poly(A)-binding protein [Arabidopsis thaliana]
 emb|CAA17561.1| poly(A)-binding protein [Arabidopsis thaliana]
 emb|CAB80128.1| poly(A)-binding protein [Arabidopsis thaliana]
 gb|AAN86187.1| putative polyadenylate-binding protein 2 (PABP2) [Arabidopsis 
thaliana]
 gb|AEE86325.1| polyadenylate-binding protein 2 [Arabidopsis thaliana]
Length=629

 Score =   117 bits (292),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 61/114 (54%), Positives = 76/114 (67%), Gaps = 6/114 (5%)
 Frame = +1

Query  493  MAQIQVQHQSpvalangvpppgavglpapQSAAGAGNQLSTTSLYVGDLDPTVTDSQLYD  672
            MAQ+Q+Q Q+P      V    A       S      Q   TSLYVGDLD  VTDSQL+D
Sbjct  1    MAQVQLQGQTPNGSTAAVTSAPAT------SGGATATQFGNTSLYVGDLDFNVTDSQLFD  54

Query  673  LFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQDAARAMEVLNFTPVNSKSIR  834
             F Q+G VV+VRVCRD+ +RRSLGYGYVN+++PQDAARA++ LN+ P+  K IR
Sbjct  55   AFGQMGTVVTVRVCRDLVTRRSLGYGYVNFTNPQDAARAIQELNYIPLYGKPIR  108


 Score = 58.2 bits (139),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 28/84 (33%), Positives = 53/84 (63%), Gaps = 1/84 (1%)
 Frame = +1

Query  580  QSAAGAGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVN  759
            Q+   A ++  +++LYV +LDP+++D +L ++F+  G V S +V RD +   S G G+V 
Sbjct  306  QNLKEAADKFQSSNLYVKNLDPSISDEKLKEIFSPFGTVTSSKVMRDPNG-TSKGSGFVA  364

Query  760  YSSPQDAARAMEVLNFTPVNSKSI  831
            +++P++A  AM  L+   + SK +
Sbjct  365  FATPEEATEAMSQLSGKMIESKPL  388


 Score = 53.1 bits (126),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/68 (38%), Positives = 42/68 (62%), Gaps = 1/68 (1%)
 Frame = +1

Query  601  NQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQDA  780
            N+   T++YV +L  + TD  L + F + G++ S  V +D    +S G+G+VN+ +  DA
Sbjct  210  NKTKFTNVYVKNLAESTTDDDLKNAFGEYGKITSAVVMKD-GEGKSKGFGFVNFENADDA  268

Query  781  ARAMEVLN  804
            ARA+E LN
Sbjct  269  ARAVESLN  276



>gb|KJB79363.1| hypothetical protein B456_013G046000 [Gossypium raimondii]
Length=648

 Score =   117 bits (292),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 52/77 (68%), Positives = 65/77 (84%), Gaps = 0/77 (0%)
 Frame = +1

Query  604  QLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQDAA  783
            Q   TSLYVGDLD +VT++QLYD F  VG V++VRVC+D+S+RRSLGYGYVNY +PQDAA
Sbjct  23   QFVPTSLYVGDLDSSVTEAQLYDYFAHVGPVLTVRVCKDLSTRRSLGYGYVNYGNPQDAA  82

Query  784  RAMEVLNFTPVNSKSIR  834
            RA+++LNFT +N K IR
Sbjct  83   RALDLLNFTLLNGKPIR  99


 Score = 60.1 bits (144),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 32/84 (38%), Positives = 53/84 (63%), Gaps = 1/84 (1%)
 Frame = +1

Query  580  QSAAGAGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVN  759
            QS   A ++    +LYV +LD +++D +L +LF+Q G + S +V RD S   S G G+V 
Sbjct  297  QSMKEAADKFQGANLYVKNLDDSISDEKLKELFSQYGTITSYKVMRDPSG-ISKGSGFVA  355

Query  760  YSSPQDAARAMEVLNFTPVNSKSI  831
            +S+P++A+RA+  +N   V SK +
Sbjct  356  FSTPEEASRALAEMNGKMVVSKPL  379



>gb|KJB79366.1| hypothetical protein B456_013G046000 [Gossypium raimondii]
Length=649

 Score =   117 bits (292),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 52/77 (68%), Positives = 65/77 (84%), Gaps = 0/77 (0%)
 Frame = +1

Query  604  QLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQDAA  783
            Q   TSLYVGDLD +VT++QLYD F  VG V++VRVC+D+S+RRSLGYGYVNY +PQDAA
Sbjct  23   QFVPTSLYVGDLDSSVTEAQLYDYFAHVGPVLTVRVCKDLSTRRSLGYGYVNYGNPQDAA  82

Query  784  RAMEVLNFTPVNSKSIR  834
            RA+++LNFT +N K IR
Sbjct  83   RALDLLNFTLLNGKPIR  99


 Score = 60.1 bits (144),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 32/84 (38%), Positives = 53/84 (63%), Gaps = 1/84 (1%)
 Frame = +1

Query  580  QSAAGAGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVN  759
            QS   A ++    +LYV +LD +++D +L +LF+Q G + S +V RD S   S G G+V 
Sbjct  297  QSMKEAADKFQGANLYVKNLDDSISDEKLKELFSQYGTITSYKVMRDPSG-ISKGSGFVA  355

Query  760  YSSPQDAARAMEVLNFTPVNSKSI  831
            +S+P++A+RA+  +N   V SK +
Sbjct  356  FSTPEEASRALAEMNGKMVVSKPL  379



>gb|KFK30042.1| hypothetical protein AALP_AA7G209600 [Arabis alpina]
Length=632

 Score =   116 bits (291),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 52/77 (68%), Positives = 66/77 (86%), Gaps = 0/77 (0%)
 Frame = +1

Query  604  QLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQDAA  783
            Q  TTSLYVGDLD  VTDSQ+++ F+Q+GQVVSVRVCRD+ +RRSLGYGYVN+++PQDAA
Sbjct  33   QFGTTSLYVGDLDFNVTDSQIFEAFSQMGQVVSVRVCRDVDTRRSLGYGYVNFANPQDAA  92

Query  784  RAMEVLNFTPVNSKSIR  834
            RA++ LN+ P+  K IR
Sbjct  93   RAIQELNYIPLFGKPIR  109


 Score = 62.8 bits (151),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/84 (38%), Positives = 52/84 (62%), Gaps = 1/84 (1%)
 Frame = +1

Query  580  QSAAGAGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVN  759
            Q+   A  +  +++LYV +LDPT++D +L DLF+  G V S +V RD +   S G G+V 
Sbjct  307  QNLKEAAEKFQSSNLYVKNLDPTISDEKLKDLFSPFGTVTSCKVMRDPTG-ISKGSGFVA  365

Query  760  YSSPQDAARAMEVLNFTPVNSKSI  831
            +S+P++A  AM  L+   + SK +
Sbjct  366  FSTPEEATEAMSQLSGKMIESKPL  389



>ref|XP_003576878.1| PREDICTED: polyadenylate-binding protein 2-like [Brachypodium 
distachyon]
Length=653

 Score =   117 bits (292),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 50/76 (66%), Positives = 65/76 (86%), Gaps = 0/76 (0%)
 Frame = +1

Query  607  LSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQDAAR  786
               TSLYVGDLD +V D+QL+D+F Q+G VVSVRVCRD+++R+SLGY YVNY++P DAAR
Sbjct  31   FPATSLYVGDLDMSVQDAQLFDVFAQIGGVVSVRVCRDVTTRKSLGYAYVNYNTPADAAR  90

Query  787  AMEVLNFTPVNSKSIR  834
            A+E+LNFTP+N + IR
Sbjct  91   ALEMLNFTPINGRPIR  106


 Score = 55.8 bits (133),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 30/77 (39%), Positives = 48/77 (62%), Gaps = 1/77 (1%)
 Frame = +1

Query  601  NQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQDA  780
            ++   T+LY+ +LD TV D +L +LF + G + S +V RD S+  S G G+V + S +DA
Sbjct  311  DKYQNTNLYLKNLDDTVDDEKLRELFAEFGAITSCKVMRD-SNGASRGSGFVAFKSAEDA  369

Query  781  ARAMEVLNFTPVNSKSI  831
            +RA+  +N   V SK +
Sbjct  370  SRALAEMNNKMVGSKPL  386



>gb|KHG12838.1| ELAV-like protein 2 [Gossypium arboreum]
Length=648

 Score =   116 bits (291),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 52/77 (68%), Positives = 65/77 (84%), Gaps = 0/77 (0%)
 Frame = +1

Query  604  QLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQDAA  783
            Q   TSLYVGDLD +VT++QLYD F  VG V++VRVC+D+S+RRSLGYGYVNY +PQDAA
Sbjct  23   QFVPTSLYVGDLDSSVTEAQLYDYFAHVGPVLTVRVCKDLSTRRSLGYGYVNYGNPQDAA  82

Query  784  RAMEVLNFTPVNSKSIR  834
            RA+++LNFT +N K IR
Sbjct  83   RALDLLNFTLLNGKPIR  99


 Score = 60.5 bits (145),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 32/84 (38%), Positives = 53/84 (63%), Gaps = 1/84 (1%)
 Frame = +1

Query  580  QSAAGAGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVN  759
            QS   A ++    +LYV +LD +++D +L +LF+Q G + S +V RD S   S G G+V 
Sbjct  297  QSMKEAADKFQGANLYVKNLDDSISDEKLKELFSQYGIITSCKVMRDTSG-ISKGSGFVA  355

Query  760  YSSPQDAARAMEVLNFTPVNSKSI  831
            +S+P++A+RA+  +N   V SK +
Sbjct  356  FSTPEEASRALAEMNGKMVVSKPL  379



>dbj|BAJ97269.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=663

 Score =   117 bits (292),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 53/72 (74%), Positives = 64/72 (89%), Gaps = 0/72 (0%)
 Frame = +1

Query  619  SLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQDAARAMEV  798
            SLYVGDLD +V D+QL+D+F+QVG VVSVRVCRD+++R SLGY YVN+SSP DAARA+E+
Sbjct  43   SLYVGDLDVSVQDAQLFDVFSQVGSVVSVRVCRDVNTRMSLGYAYVNFSSPADAARALEM  102

Query  799  LNFTPVNSKSIR  834
            LNFTPVN K IR
Sbjct  103  LNFTPVNGKPIR  114



>ref|XP_007143592.1| hypothetical protein PHAVU_007G084800g [Phaseolus vulgaris]
 gb|ESW15586.1| hypothetical protein PHAVU_007G084800g [Phaseolus vulgaris]
Length=527

 Score =   115 bits (288),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 55/84 (65%), Positives = 63/84 (75%), Gaps = 0/84 (0%)
 Frame = +1

Query  583  SAAGAGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNY  762
            S A  G   S  SLYVGDLD  V + QLYDLF+QV Q+VS+RVCRD S R SLGY YVN+
Sbjct  21   STALGGGPFSNASLYVGDLDGNVNEEQLYDLFSQVAQIVSIRVCRDQSKRSSLGYAYVNF  80

Query  763  SSPQDAARAMEVLNFTPVNSKSIR  834
            S+ QDA+ AME+LNFTPVN K IR
Sbjct  81   STAQDASNAMELLNFTPVNGKPIR  104


 Score = 54.7 bits (130),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 27/70 (39%), Positives = 43/70 (61%), Gaps = 1/70 (1%)
 Frame = +1

Query  616  TSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQDAARAME  795
            T++YV +   T TD  L  LF   G + S  + +D++ + S G+G+VN+ SP  AA A+E
Sbjct  210  TNVYVKNFSETFTDDDLTKLFGSYGTITSATLMKDMNGK-SRGFGFVNFQSPDSAAAAVE  268

Query  796  VLNFTPVNSK  825
            VLN + ++ K
Sbjct  269  VLNGSTIDDK  278



>gb|KFK35979.1| hypothetical protein AALP_AA4G062600 [Arabis alpina]
Length=671

 Score =   116 bits (291),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 53/74 (72%), Positives = 66/74 (89%), Gaps = 0/74 (0%)
 Frame = +1

Query  613  TTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQDAARAM  792
            TTSLYVGDLD TVTDSQL++ F+Q GQVVSVRVCRD+++RRSLGYGYVNY++PQDA+RA+
Sbjct  37   TTSLYVGDLDQTVTDSQLFEAFSQSGQVVSVRVCRDMTTRRSLGYGYVNYATPQDASRAL  96

Query  793  EVLNFTPVNSKSIR  834
              LNF  +N ++IR
Sbjct  97   NDLNFMSLNGRAIR  110


 Score = 53.9 bits (128),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 30/84 (36%), Positives = 51/84 (61%), Gaps = 1/84 (1%)
 Frame = +1

Query  580  QSAAGAGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVN  759
            QS   A ++   ++LYV +LD TVTD +L + F   G + S +V RD S   S G G+V 
Sbjct  308  QSLKEAADKSQGSNLYVKNLDETVTDDKLREHFAPFGTITSCKVMRDPSG-VSRGSGFVA  366

Query  760  YSSPQDAARAMEVLNFTPVNSKSI  831
            +S+P++A++A+  +N   + +K +
Sbjct  367  FSTPEEASKAITEMNGKMIVTKPL  390



>emb|CDY36634.1| BnaA07g04230D [Brassica napus]
Length=649

 Score =   116 bits (290),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 50/85 (59%), Positives = 70/85 (82%), Gaps = 0/85 (0%)
 Frame = +1

Query  580  QSAAGAGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVN  759
            Q+  G+G    T SLYVGDL   VTD+QL++ F+Q+GQVV+VRVCRD+++RRSLGYGYVN
Sbjct  9    QNPNGSGKAGGTMSLYVGDLHANVTDAQLFEAFSQMGQVVTVRVCRDLATRRSLGYGYVN  68

Query  760  YSSPQDAARAMEVLNFTPVNSKSIR  834
            +++PQDAARA++ +N+ P+N K +R
Sbjct  69   FATPQDAARAIQEMNYIPLNGKPVR  93


 Score = 53.5 bits (127),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 28/84 (33%), Positives = 51/84 (61%), Gaps = 1/84 (1%)
 Frame = +1

Query  580  QSAAGAGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVN  759
            QS   A ++  ++ LYV +LD +++D +L +LF   G V S +V RD +   S G G+V 
Sbjct  291  QSLREAADKFQSSKLYVKNLDDSISDEKLKELFTPYGTVTSCKVMRDPNG-ISRGSGFVA  349

Query  760  YSSPQDAARAMEVLNFTPVNSKSI  831
             S+P++A++AM  ++   + +K +
Sbjct  350  LSTPEEASKAMSEMSGKMIENKPL  373



>ref|XP_001780529.1| predicted protein [Physcomitrella patens]
 gb|EDQ54623.1| predicted protein [Physcomitrella patens]
Length=647

 Score =   116 bits (290),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 52/80 (65%), Positives = 66/80 (83%), Gaps = 0/80 (0%)
 Frame = +1

Query  595  AGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQ  774
            A NQ  +TS+YVGDL+  V+++QLY++F+Q G VVS+RVCRD+ +RRSLGY YVNY S Q
Sbjct  17   APNQFVSTSVYVGDLEHNVSEAQLYEIFSQTGPVVSIRVCRDLITRRSLGYAYVNYHSAQ  76

Query  775  DAARAMEVLNFTPVNSKSIR  834
            DA RA+E+LNFTPVN K IR
Sbjct  77   DATRALELLNFTPVNGKPIR  96


 Score = 51.2 bits (121),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 26/71 (37%), Positives = 44/71 (62%), Gaps = 1/71 (1%)
 Frame = +1

Query  619  SLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQDAARAMEV  798
            +LY+ +LD  V D +L +LF + G + S +V +D    +S G G+V +S+P++A RA+  
Sbjct  307  NLYLKNLDDAVDDEKLRELFAEYGTITSCKVMKDPQG-QSRGSGFVAFSTPEEATRAVTE  365

Query  799  LNFTPVNSKSI  831
            +N   V SK +
Sbjct  366  MNTKMVGSKPL  376



>gb|AID60122.1| poly(A) binding protein 8 [Brassica napus]
 gb|AID60165.1| polyA binding protein 8 [Brassica napus]
Length=606

 Score =   115 bits (288),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 53/85 (62%), Positives = 67/85 (79%), Gaps = 0/85 (0%)
 Frame = +1

Query  580  QSAAGAGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVN  759
            Q+      Q  TTSLYVGDLD  VTDSQL++ F+Q+GQVVSVRVCRD ++RRSLGYGYVN
Sbjct  5    QTTVAPATQFGTTSLYVGDLDLNVTDSQLFEAFSQMGQVVSVRVCRDSATRRSLGYGYVN  64

Query  760  YSSPQDAARAMEVLNFTPVNSKSIR  834
            +++P DAARA++ LN+ P+  K IR
Sbjct  65   FTNPPDAARAIQELNYIPLYGKPIR  89


 Score = 53.1 bits (126),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/68 (37%), Positives = 41/68 (60%), Gaps = 0/68 (0%)
 Frame = +1

Query  601  NQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQDA  780
            N+   T++YV +L  + TD  L   F + G++ S  V +D    +S G+G+VN+ +  DA
Sbjct  191  NKTKFTNVYVKNLAESTTDDDLKSAFAEYGEITSAVVMKDGEGGKSKGFGFVNFENADDA  250

Query  781  ARAMEVLN  804
            A+A+E LN
Sbjct  251  AKAVESLN  258


 Score = 52.8 bits (125),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/79 (35%), Positives = 47/79 (59%), Gaps = 1/79 (1%)
 Frame = +1

Query  595  AGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQ  774
            A  +  +++LYV +LD +V+D  L ++F+  G V S +V RD S   S G G+V +S+P+
Sbjct  293  AAERFQSSNLYVKNLDSSVSDETLKEMFSPFGTVTSCKVMRDPSGI-SKGSGFVAFSTPE  351

Query  775  DAARAMEVLNFTPVNSKSI  831
            +A  AM  ++   V  K +
Sbjct  352  EATEAMSQMSGKMVEGKPL  370



>ref|XP_007143593.1| hypothetical protein PHAVU_007G084800g [Phaseolus vulgaris]
 gb|ESW15587.1| hypothetical protein PHAVU_007G084800g [Phaseolus vulgaris]
Length=636

 Score =   115 bits (288),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 55/84 (65%), Positives = 63/84 (75%), Gaps = 0/84 (0%)
 Frame = +1

Query  583  SAAGAGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNY  762
            S A  G   S  SLYVGDLD  V + QLYDLF+QV Q+VS+RVCRD S R SLGY YVN+
Sbjct  21   STALGGGPFSNASLYVGDLDGNVNEEQLYDLFSQVAQIVSIRVCRDQSKRSSLGYAYVNF  80

Query  763  SSPQDAARAMEVLNFTPVNSKSIR  834
            S+ QDA+ AME+LNFTPVN K IR
Sbjct  81   STAQDASNAMELLNFTPVNGKPIR  104


 Score = 55.1 bits (131),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 27/70 (39%), Positives = 43/70 (61%), Gaps = 1/70 (1%)
 Frame = +1

Query  616  TSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQDAARAME  795
            T++YV +   T TD  L  LF   G + S  + +D++ + S G+G+VN+ SP  AA A+E
Sbjct  210  TNVYVKNFSETFTDDDLTKLFGSYGTITSATLMKDMNGK-SRGFGFVNFQSPDSAAAAVE  268

Query  796  VLNFTPVNSK  825
            VLN + ++ K
Sbjct  269  VLNGSTIDDK  278



>emb|CDX75397.1| BnaA01g03050D [Brassica napus]
Length=616

 Score =   115 bits (287),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 53/85 (62%), Positives = 67/85 (79%), Gaps = 0/85 (0%)
 Frame = +1

Query  580  QSAAGAGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVN  759
            Q+      Q  TTSLYVGDLD  VTDSQL++ F+Q+GQVVSVRVCRD ++RRSLGYGYVN
Sbjct  5    QTTVAPATQFGTTSLYVGDLDLNVTDSQLFEAFSQMGQVVSVRVCRDSATRRSLGYGYVN  64

Query  760  YSSPQDAARAMEVLNFTPVNSKSIR  834
            +++P DAARA++ LN+ P+  K IR
Sbjct  65   FTNPPDAARAIQELNYIPLYGKPIR  89


 Score = 52.8 bits (125),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/68 (37%), Positives = 41/68 (60%), Gaps = 0/68 (0%)
 Frame = +1

Query  601  NQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQDA  780
            N+   T++YV +L  + TD  L   F + G++ S  V +D    +S G+G+VN+ +  DA
Sbjct  191  NKTKFTNVYVKNLAESTTDDDLKSAFAEYGEITSAVVMKDGEGGKSKGFGFVNFENADDA  250

Query  781  ARAMEVLN  804
            A+A+E LN
Sbjct  251  AKAVESLN  258


 Score = 52.8 bits (125),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/79 (35%), Positives = 47/79 (59%), Gaps = 1/79 (1%)
 Frame = +1

Query  595  AGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQ  774
            A  +  +++LYV +LD +V+D  L ++F+  G V S +V RD S   S G G+V +S+P+
Sbjct  293  AAERFQSSNLYVKNLDSSVSDETLKEMFSPFGTVTSCKVMRDPSGI-SKGSGFVAFSTPE  351

Query  775  DAARAMEVLNFTPVNSKSI  831
            +A  AM  ++   V  K +
Sbjct  352  EATEAMSQMSGKMVEGKPL  370



>dbj|BAJ90169.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ87575.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=663

 Score =   115 bits (288),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 52/71 (73%), Positives = 63/71 (89%), Gaps = 0/71 (0%)
 Frame = +1

Query  622  LYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQDAARAMEVL  801
            LYVGDLD +V D+QL+D+F+QVG VVSVRVCRD+++R SLGY YVN+SSP DAARA+E+L
Sbjct  44   LYVGDLDVSVQDAQLFDVFSQVGSVVSVRVCRDVNTRMSLGYAYVNFSSPADAARALEML  103

Query  802  NFTPVNSKSIR  834
            NFTPVN K IR
Sbjct  104  NFTPVNGKPIR  114



>ref|XP_002527095.1| polyadenylate-binding protein, putative [Ricinus communis]
 gb|EEF35258.1| polyadenylate-binding protein, putative [Ricinus communis]
Length=657

 Score =   115 bits (288),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 52/77 (68%), Positives = 62/77 (81%), Gaps = 0/77 (0%)
 Frame = +1

Query  604  QLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQDAA  783
            Q +  SLYVGDL+  V + QLYDLF+Q+ QVVSVRVCRD + R SLGYGYVN+S+PQDAA
Sbjct  41   QFANLSLYVGDLEQNVNEEQLYDLFSQIAQVVSVRVCRDQTKRSSLGYGYVNFSNPQDAA  100

Query  784  RAMEVLNFTPVNSKSIR  834
             AM+ LNFTP+N K IR
Sbjct  101  NAMKALNFTPLNGKPIR  117



>ref|XP_009119410.1| PREDICTED: polyadenylate-binding protein 2 [Brassica rapa]
Length=634

 Score =   115 bits (287),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 50/85 (59%), Positives = 70/85 (82%), Gaps = 0/85 (0%)
 Frame = +1

Query  580  QSAAGAGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVN  759
            Q+  G+G    TTSLYVGDL   VTD+QL++ F+Q+GQVV+VRVCRD+++ RSLGYGYVN
Sbjct  9    QNPNGSGTAGGTTSLYVGDLHANVTDAQLFEAFSQMGQVVTVRVCRDLATWRSLGYGYVN  68

Query  760  YSSPQDAARAMEVLNFTPVNSKSIR  834
            +++PQDAARA++ +N+ P+N K +R
Sbjct  69   FATPQDAARAIQEMNYIPLNGKPVR  93


 Score = 53.1 bits (126),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 27/84 (32%), Positives = 52/84 (62%), Gaps = 1/84 (1%)
 Frame = +1

Query  580  QSAAGAGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVN  759
            QS   A ++  +++LYV +LD +++D +L +LF   G V S +V RD +   S G G+V 
Sbjct  291  QSLREAADKFQSSNLYVTNLDDSISDEKLKELFTPYGTVTSWKVMRDPNG-ISRGSGFVA  349

Query  760  YSSPQDAARAMEVLNFTPVNSKSI  831
            +S+P++A++ M  ++   + +K +
Sbjct  350  FSTPEEASKKMSEMSGKMIENKPL  373


 Score = 52.4 bits (124),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 26/63 (41%), Positives = 40/63 (63%), Gaps = 1/63 (2%)
 Frame = +1

Query  616  TSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQDAARAME  795
            T++YV +L  + TD  L + F + G ++S  V +D    +S G+GYVN+ +  DAARA+E
Sbjct  200  TNVYVKNLAESTTDDDLKNTFGEFGNIISALVMKD-RDVKSKGFGYVNFDNADDAARAVE  258

Query  796  VLN  804
             LN
Sbjct  259  TLN  261



>emb|CBI32381.3| unnamed protein product [Vitis vinifera]
Length=766

 Score =   115 bits (288),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 52/77 (68%), Positives = 66/77 (86%), Gaps = 0/77 (0%)
 Frame = +1

Query  604  QLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQDAA  783
            + ++ SLYVGDLD  VTDSQL+DLF+Q+ QVVS+RVCRD ++ RSLGYGYVNY+  +DAA
Sbjct  165  RFASASLYVGDLDLNVTDSQLHDLFSQLAQVVSIRVCRDSTTHRSLGYGYVNYTDLEDAA  224

Query  784  RAMEVLNFTPVNSKSIR  834
            RA++VLNFTP+N K IR
Sbjct  225  RALDVLNFTPLNGKPIR  241


 Score = 99.8 bits (247),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 46/58 (79%), Positives = 52/58 (90%), Gaps = 0/58 (0%)
 Frame = +1

Query  604  QLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQD  777
            Q  TTSLYVGDL+  V DSQLYDLF+Q+G VVSVRVCRD+S+RRSLGYGYVNYS+PQD
Sbjct  26   QFVTTSLYVGDLELNVNDSQLYDLFSQMGAVVSVRVCRDLSTRRSLGYGYVNYSNPQD  83


 Score = 56.2 bits (134),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 30/84 (36%), Positives = 51/84 (61%), Gaps = 1/84 (1%)
 Frame = +1

Query  580  QSAAGAGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVN  759
            Q+   A ++    +LY+ +LD ++ D +L +LF Q G + S +V RD +   S G G+V 
Sbjct  439  QNMKEAVDKFQGANLYIKNLDDSIGDDKLKELFAQFGTITSCKVMRDPNG-LSRGSGFVA  497

Query  760  YSSPQDAARAMEVLNFTPVNSKSI  831
            +SSP++A+RA+  +N   V SK +
Sbjct  498  FSSPEEASRALAEMNSKMVVSKPL  521



>emb|CDX69025.1| BnaC01g04280D [Brassica napus]
Length=611

 Score =   114 bits (286),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 53/85 (62%), Positives = 67/85 (79%), Gaps = 0/85 (0%)
 Frame = +1

Query  580  QSAAGAGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVN  759
            Q+      Q  TTSLYVGDLD  VTDSQL++ F+Q+GQVVSVRVCRD ++RRSLGYGYVN
Sbjct  5    QTTVAPAAQFGTTSLYVGDLDLNVTDSQLFEAFSQMGQVVSVRVCRDSATRRSLGYGYVN  64

Query  760  YSSPQDAARAMEVLNFTPVNSKSIR  834
            +++P DAARA++ LN+ P+  K IR
Sbjct  65   FTNPPDAARAIQELNYIPLYGKPIR  89


 Score = 54.7 bits (130),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 29/79 (37%), Positives = 48/79 (61%), Gaps = 1/79 (1%)
 Frame = +1

Query  595  AGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQ  774
            A  +  +++LYV +LD +V+D +L ++F+  G V S +V RD S   S G G+V +S+P+
Sbjct  293  AAERFQSSNLYVKNLDSSVSDEKLKEMFSPFGTVTSCKVMRDPSGI-SKGSGFVAFSTPE  351

Query  775  DAARAMEVLNFTPVNSKSI  831
            +A  AM  L+   V  K +
Sbjct  352  EATEAMSQLSGKMVEGKPL  370


 Score = 53.1 bits (126),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/68 (37%), Positives = 41/68 (60%), Gaps = 0/68 (0%)
 Frame = +1

Query  601  NQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQDA  780
            N+   T++YV +L  + TD  L   F + G++ S  V +D    +S G+G+VN+ +  DA
Sbjct  191  NKTKFTNVYVKNLAESTTDDDLKSAFAEYGEITSAVVMKDGEGGKSKGFGFVNFENADDA  250

Query  781  ARAMEVLN  804
            A+A+E LN
Sbjct  251  AKAVESLN  258



>ref|XP_011044832.1| PREDICTED: polyadenylate-binding protein 3-like [Populus euphratica]
Length=648

 Score =   114 bits (286),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 51/77 (66%), Positives = 63/77 (82%), Gaps = 0/77 (0%)
 Frame = +1

Query  604  QLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQDAA  783
            Q   +SLYVGDL+  V + QL+DLF+QV QVVS+RVCRD + R SLGY YVN+S+PQDAA
Sbjct  28   QFPNSSLYVGDLEHNVNEGQLFDLFSQVAQVVSIRVCRDQARRASLGYAYVNFSNPQDAA  87

Query  784  RAMEVLNFTPVNSKSIR  834
             AME+LNFTP+N K+IR
Sbjct  88   NAMELLNFTPLNGKAIR  104


 Score = 53.9 bits (128),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 41/70 (59%), Gaps = 1/70 (1%)
 Frame = +1

Query  616  TSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQDAARAME  795
            T++YV +L  T +D  L   F+  G + S  V +D  S +S G+G+VN+ SP  AA A+E
Sbjct  211  TNVYVKNLSETTSDEDLEKFFSNYGAITSAIVMKD-QSGKSKGFGFVNFQSPDSAAAAVE  269

Query  796  VLNFTPVNSK  825
             LN T  N K
Sbjct  270  KLNGTTFNDK  279


 Score = 52.4 bits (124),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 25/76 (33%), Positives = 45/76 (59%), Gaps = 1/76 (1%)
 Frame = +1

Query  604  QLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQDAA  783
            +L   +LY+ +LD  + D +L +LF++ G + S +V  D     S G G+V +S+P++A+
Sbjct  310  KLKAANLYLKNLDDKIDDEKLKELFSEFGSITSCKVMLD-QQGLSKGSGFVAFSTPEEAS  368

Query  784  RAMEVLNFTPVNSKSI  831
            RAM  +N   +  K +
Sbjct  369  RAMNGMNGKMIGKKPL  384



>tpg|DAA39542.1| TPA: hypothetical protein ZEAMMB73_983793 [Zea mays]
Length=648

 Score =   114 bits (285),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 52/76 (68%), Positives = 64/76 (84%), Gaps = 0/76 (0%)
 Frame = +1

Query  607  LSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQDAAR  786
               TSLYVGDL  +V D+QL+D+F+QVG VVSVRVCRDI+SR+SLGY YVNY++  DAAR
Sbjct  32   FPATSLYVGDLHESVQDAQLFDVFSQVGGVVSVRVCRDINSRKSLGYAYVNYNNQGDAAR  91

Query  787  AMEVLNFTPVNSKSIR  834
            A+E+LNFTP+N K IR
Sbjct  92   ALELLNFTPINGKPIR  107


 Score = 51.2 bits (121),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 27/76 (36%), Positives = 45/76 (59%), Gaps = 1/76 (1%)
 Frame = +1

Query  604  QLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQDAA  783
            +   T+LY+ +L+  + D +L +LF + G + S +V RD S+  S G G+V + S +DA 
Sbjct  313  KFQNTNLYLKNLEENIDDEKLRELFAEYGNITSCKVMRD-SNGVSRGSGFVAFKSAEDAN  371

Query  784  RAMEVLNFTPVNSKSI  831
            RA+  +N   V SK +
Sbjct  372  RALTEMNGKMVGSKPL  387



>tpg|DAA39541.1| TPA: hypothetical protein ZEAMMB73_983793 [Zea mays]
Length=654

 Score =   114 bits (285),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 52/76 (68%), Positives = 64/76 (84%), Gaps = 0/76 (0%)
 Frame = +1

Query  607  LSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQDAAR  786
               TSLYVGDL  +V D+QL+D+F+QVG VVSVRVCRDI+SR+SLGY YVNY++  DAAR
Sbjct  32   FPATSLYVGDLHESVQDAQLFDVFSQVGGVVSVRVCRDINSRKSLGYAYVNYNNQGDAAR  91

Query  787  AMEVLNFTPVNSKSIR  834
            A+E+LNFTP+N K IR
Sbjct  92   ALELLNFTPINGKPIR  107


 Score = 51.2 bits (121),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 27/76 (36%), Positives = 45/76 (59%), Gaps = 1/76 (1%)
 Frame = +1

Query  604  QLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQDAA  783
            +   T+LY+ +L+  + D +L +LF + G + S +V RD S+  S G G+V + S +DA 
Sbjct  313  KFQNTNLYLKNLEENIDDEKLRELFAEYGNITSCKVMRD-SNGVSRGSGFVAFKSAEDAN  371

Query  784  RAMEVLNFTPVNSKSI  831
            RA+  +N   V SK +
Sbjct  372  RALTEMNGKMVGSKPL  387



>ref|XP_010681423.1| PREDICTED: polyadenylate-binding protein 5 [Beta vulgaris subsp. 
vulgaris]
Length=648

 Score =   114 bits (285),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 54/82 (66%), Positives = 61/82 (74%), Gaps = 0/82 (0%)
 Frame = +1

Query  589  AGAGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNYSS  768
            A A  +    SLYVGDLD  V +SQLYDLF+QV  +VSVRVCRD   R SLGY YVN+ S
Sbjct  21   ANAAVEFGNMSLYVGDLDANVNESQLYDLFSQVAPIVSVRVCRDQHKRSSLGYAYVNFGS  80

Query  769  PQDAARAMEVLNFTPVNSKSIR  834
            PQDAA A+EVLNFTPVN + IR
Sbjct  81   PQDAANALEVLNFTPVNGRPIR  102



>ref|XP_008651618.1| PREDICTED: uncharacterized protein LOC100381531 isoform X1 [Zea 
mays]
Length=656

 Score =   114 bits (285),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 52/73 (71%), Positives = 64/73 (88%), Gaps = 0/73 (0%)
 Frame = +1

Query  616  TSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQDAARAME  795
            TSLYVGDL  +V D+QL+D+F+QVG VVSVRVCRDI+SR+SLGY YVNY++  DAARA+E
Sbjct  34   TSLYVGDLHESVQDAQLFDVFSQVGGVVSVRVCRDINSRKSLGYAYVNYNNTSDAARALE  93

Query  796  VLNFTPVNSKSIR  834
            +LNFTP+N K IR
Sbjct  94   LLNFTPINGKPIR  106


 Score = 51.2 bits (121),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 27/76 (36%), Positives = 45/76 (59%), Gaps = 1/76 (1%)
 Frame = +1

Query  604  QLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQDAA  783
            +   T+LY+ +LD  + D +L ++F + G + S +V RD S   S G G+V++ S +DA 
Sbjct  312  KFQNTNLYLKNLDDNIDDEKLREIFAEYGNITSCKVMRD-SYGVSRGSGFVSFKSAEDAN  370

Query  784  RAMEVLNFTPVNSKSI  831
            RA+  +N   V SK +
Sbjct  371  RALTEMNGKMVGSKPL  386



>ref|XP_009117148.1| PREDICTED: polyadenylate-binding protein 2 [Brassica rapa]
Length=613

 Score =   114 bits (284),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 52/85 (61%), Positives = 66/85 (78%), Gaps = 0/85 (0%)
 Frame = +1

Query  580  QSAAGAGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVN  759
            Q+         TTSLYVGDLD  VTDSQL++ F+Q+GQVVSVRVCRD ++RRSLGYGYVN
Sbjct  5    QTTVAPATHFGTTSLYVGDLDLNVTDSQLFEAFSQMGQVVSVRVCRDSATRRSLGYGYVN  64

Query  760  YSSPQDAARAMEVLNFTPVNSKSIR  834
            +++P DAARA++ LN+ P+  K IR
Sbjct  65   FTNPPDAARAIQELNYIPLYGKPIR  89


 Score = 53.1 bits (126),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/68 (37%), Positives = 41/68 (60%), Gaps = 0/68 (0%)
 Frame = +1

Query  601  NQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQDA  780
            N+   T++YV +L  + TD  L   F + G++ S  V +D    +S G+G+VN+ +  DA
Sbjct  191  NKTKFTNVYVKNLAESTTDDDLKSAFAEYGEITSAVVMKDGEGGKSKGFGFVNFENADDA  250

Query  781  ARAMEVLN  804
            A+A+E LN
Sbjct  251  AKAVESLN  258



>gb|AAL86321.1| putative poly(A)-binding protein [Arabidopsis thaliana]
Length=613

 Score =   113 bits (283),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 52/84 (62%), Positives = 64/84 (76%), Gaps = 0/84 (0%)
 Frame = +1

Query  583  SAAGAGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNY  762
            S      Q   TSLYVGDLD  VTDSQL+D F Q+G VV+VRVCRD+ +RRSLGYGYVN+
Sbjct  9    SGGATATQFGNTSLYVGDLDFNVTDSQLFDAFGQMGTVVTVRVCRDLVTRRSLGYGYVNF  68

Query  763  SSPQDAARAMEVLNFTPVNSKSIR  834
            ++PQDAARA++ LN+ P+  K IR
Sbjct  69   TNPQDAARAIQELNYIPLYGKPIR  92


 Score = 57.8 bits (138),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 28/84 (33%), Positives = 53/84 (63%), Gaps = 1/84 (1%)
 Frame = +1

Query  580  QSAAGAGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVN  759
            Q+   A ++  +++LYV +LDP+++D +L ++F+  G V S +V RD +   S G G+V 
Sbjct  290  QNLKEAADKFQSSNLYVKNLDPSISDEKLKEIFSPFGTVTSSKVMRDPNG-TSKGSGFVA  348

Query  760  YSSPQDAARAMEVLNFTPVNSKSI  831
            +++P++A  AM  L+   + SK +
Sbjct  349  FATPEEATEAMSQLSGKMIESKPL  372


 Score = 52.0 bits (123),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 26/68 (38%), Positives = 42/68 (62%), Gaps = 1/68 (1%)
 Frame = +1

Query  601  NQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQDA  780
            N+   T++YV +L  + TD  L + F + G++ S  V +D    +S G+G+VN+ +  DA
Sbjct  194  NKTKFTNVYVKNLAESTTDDDLKNAFGEYGKITSAVVMKD-GEGKSKGFGFVNFENADDA  252

Query  781  ARAMEVLN  804
            ARA+E LN
Sbjct  253  ARAVESLN  260



>emb|CAN80948.1| hypothetical protein VITISV_016699 [Vitis vinifera]
Length=183

 Score =   107 bits (268),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 50/84 (60%), Positives = 65/84 (77%), Gaps = 0/84 (0%)
 Frame = +1

Query  583  SAAGAGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNY  762
            ++ G  NQL +TSLYVG L+  VTDS L+DLF Q+G VVSV++C D+S+RRSL YG VN+
Sbjct  7    TSNGGENQLXSTSLYVGGLESNVTDSHLFDLFGQLGPVVSVQICCDLSTRRSLNYGCVNH  66

Query  763  SSPQDAARAMEVLNFTPVNSKSIR  834
             +PQD ARA++VLNFT +N K  R
Sbjct  67   GNPQDTARALDVLNFTLLNGKPTR  90



>ref|XP_002307526.2| hypothetical protein POPTR_0005s22040g [Populus trichocarpa]
 gb|EEE94522.2| hypothetical protein POPTR_0005s22040g [Populus trichocarpa]
Length=649

 Score =   113 bits (282),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 50/77 (65%), Positives = 63/77 (82%), Gaps = 0/77 (0%)
 Frame = +1

Query  604  QLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQDAA  783
            Q   +SLYVGDL+  V + QL+DLF+QV QVVS+RVCRD + R SLGY YVN+S+PQDA+
Sbjct  29   QFPNSSLYVGDLEHNVNEGQLFDLFSQVAQVVSIRVCRDQARRASLGYAYVNFSNPQDAS  88

Query  784  RAMEVLNFTPVNSKSIR  834
             AME+LNFTP+N K+IR
Sbjct  89   NAMELLNFTPLNGKAIR  105


 Score = 54.3 bits (129),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 41/70 (59%), Gaps = 1/70 (1%)
 Frame = +1

Query  616  TSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQDAARAME  795
            T++YV +L  T +D  L   F+  G + S  V +D  S +S G+G+VN+ SP  AA A+E
Sbjct  212  TNVYVKNLSETTSDEDLKKFFSNYGSITSAIVMKD-QSGKSKGFGFVNFQSPDSAAAAVE  270

Query  796  VLNFTPVNSK  825
             LN T  N K
Sbjct  271  KLNGTTFNDK  280


 Score = 50.8 bits (120),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 24/76 (32%), Positives = 45/76 (59%), Gaps = 1/76 (1%)
 Frame = +1

Query  604  QLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQDAA  783
            +L   +LY+ +LD  + D +L +LF++ G + S +V  D     S G G+V +S+P++A+
Sbjct  311  KLKAANLYLKNLDDKIDDEKLKELFSEFGSITSCKVMLD-QQGLSKGSGFVAFSTPEEAS  369

Query  784  RAMEVLNFTPVNSKSI  831
            RA+  +N   +  K +
Sbjct  370  RALNGMNGKMIGKKPL  385



>ref|XP_001779388.1| predicted protein [Physcomitrella patens]
 gb|EDQ55778.1| predicted protein [Physcomitrella patens]
Length=650

 Score =   112 bits (281),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 50/74 (68%), Positives = 64/74 (86%), Gaps = 0/74 (0%)
 Frame = +1

Query  613  TTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQDAARAM  792
            +TSLYVGDL+P V+++QLY+LF QVGQVVS+RVCRD+ +RRSLGY YVNY+S QDA RA+
Sbjct  27   STSLYVGDLEPNVSEAQLYELFTQVGQVVSIRVCRDLITRRSLGYAYVNYNSAQDATRAL  86

Query  793  EVLNFTPVNSKSIR  834
            E+LNF+ +N   IR
Sbjct  87   ELLNFSVLNGNPIR  100


 Score = 53.5 bits (127),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 29/71 (41%), Positives = 44/71 (62%), Gaps = 1/71 (1%)
 Frame = +1

Query  619  SLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQDAARAMEV  798
            +LY+ +LD TV D +L +LF   G + S +V RD    +S G G+V +SSP++A RA+  
Sbjct  311  NLYLKNLDDTVDDEKLRELFADYGTITSCKVMRDPQG-QSRGSGFVAFSSPEEATRAVTE  369

Query  799  LNFTPVNSKSI  831
            +N   V SK +
Sbjct  370  MNGKMVGSKPL  380



>gb|KHN04485.1| Polyadenylate-binding protein 2, partial [Glycine soja]
Length=606

 Score =   112 bits (280),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 50/72 (69%), Positives = 62/72 (86%), Gaps = 0/72 (0%)
 Frame = +1

Query  619  SLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQDAARAMEV  798
            SLYVGDL   V D QLYDLFNQV QVVSVR+CRD+++++SLGYGYVN+S+  DAA+A++V
Sbjct  1    SLYVGDLHHDVNDPQLYDLFNQVAQVVSVRICRDVATQQSLGYGYVNFSNAHDAAKAIDV  60

Query  799  LNFTPVNSKSIR  834
            LNFTP+N K IR
Sbjct  61   LNFTPLNGKIIR  72



>ref|XP_006473877.1| PREDICTED: polyadenylate-binding protein 3-like [Citrus sinensis]
Length=637

 Score =   112 bits (280),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 56/82 (68%), Positives = 62/82 (76%), Gaps = 4/82 (5%)
 Frame = +1

Query  589  AGAGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNYSS  768
            +G GN     SLYVGDL+  V +SQLYDLF+QV QVVSVRVCRD S R SLGY YVNYS+
Sbjct  23   SGYGN----VSLYVGDLEQNVNESQLYDLFSQVAQVVSVRVCRDQSKRSSLGYAYVNYSN  78

Query  769  PQDAARAMEVLNFTPVNSKSIR  834
            PQDAA A E LNF P+N K IR
Sbjct  79   PQDAANAKEALNFMPINGKPIR  100


 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 30/70 (43%), Positives = 41/70 (59%), Gaps = 1/70 (1%)
 Frame = +1

Query  616  TSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQDAARAME  795
            T++YV +L  TVTD  L  +F   G + S  V +D S  +S  +G+VN+ SP  AA A+E
Sbjct  207  TNVYVNNLAETVTDEDLKKIFGHFGTITSAIVMKD-SDGKSRCFGFVNFQSPDAAAAAVE  265

Query  796  VLNFTPVNSK  825
             LN T  N K
Sbjct  266  KLNGTTNNDK  275



>ref|XP_006434548.1| hypothetical protein CICLE_v10003530mg [Citrus clementina]
 gb|ESR47788.1| hypothetical protein CICLE_v10003530mg [Citrus clementina]
Length=637

 Score =   112 bits (280),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 56/82 (68%), Positives = 62/82 (76%), Gaps = 4/82 (5%)
 Frame = +1

Query  589  AGAGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNYSS  768
            +G GN     SLYVGDL+  V +SQLYDLF+QV QVVSVRVCRD S R SLGY YVNYS+
Sbjct  23   SGYGN----VSLYVGDLEQNVNESQLYDLFSQVAQVVSVRVCRDQSKRSSLGYAYVNYSN  78

Query  769  PQDAARAMEVLNFTPVNSKSIR  834
            PQDAA A E LNF P+N K IR
Sbjct  79   PQDAANAKEALNFMPINGKPIR  100


 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 30/70 (43%), Positives = 41/70 (59%), Gaps = 1/70 (1%)
 Frame = +1

Query  616  TSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQDAARAME  795
            T++YV +L  TVTD  L  +F   G + S  V +D S  +S  +G+VN+ SP  AA A+E
Sbjct  207  TNVYVNNLAETVTDEDLKKIFGHFGTITSAIVMKD-SDGKSRCFGFVNFQSPDAAAAAVE  265

Query  796  VLNFTPVNSK  825
             LN T  N K
Sbjct  266  KLNGTTNNDK  275



>gb|KDO83840.1| hypothetical protein CISIN_1g006641mg [Citrus sinensis]
Length=637

 Score =   112 bits (280),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 56/82 (68%), Positives = 62/82 (76%), Gaps = 4/82 (5%)
 Frame = +1

Query  589  AGAGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNYSS  768
            +G GN     SLYVGDL+  V +SQLYDLF+QV QVVSVRVCRD S R SLGY YVNYS+
Sbjct  23   SGYGN----VSLYVGDLEQNVNESQLYDLFSQVAQVVSVRVCRDQSKRSSLGYAYVNYSN  78

Query  769  PQDAARAMEVLNFTPVNSKSIR  834
            PQDAA A E LNF P+N K IR
Sbjct  79   PQDAANAKEALNFMPINGKPIR  100


 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 30/70 (43%), Positives = 41/70 (59%), Gaps = 1/70 (1%)
 Frame = +1

Query  616  TSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQDAARAME  795
            T++YV +L  TVTD  L  +F   G + S  V +D S  +S  +G+VN+ SP  AA A+E
Sbjct  207  TNVYVNNLAETVTDEDLKKIFGHFGTITSAIVMKD-SDGKSRCFGFVNFQSPDAAAAAVE  265

Query  796  VLNFTPVNSK  825
             LN T  N K
Sbjct  266  KLNGTTNNDK  275



>ref|XP_009386708.1| PREDICTED: polyadenylate-binding protein 2-like isoform X4 [Musa 
acuminata subsp. malaccensis]
Length=652

 Score =   112 bits (280),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 57/114 (50%), Positives = 77/114 (68%), Gaps = 12/114 (11%)
 Frame = +1

Query  493  MAQIQVQHQSpvalangvpppgavglpapQSAAGAGNQLSTTSLYVGDLDPTVTDSQLYD  672
            MAQ  +QHQ+P    +               A+  G   S TSLYVGDL  +VTD+Q+YD
Sbjct  1    MAQAPMQHQAPNGTVDNNI------------ASAGGGHSSPTSLYVGDLHGSVTDAQVYD  48

Query  673  LFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQDAARAMEVLNFTPVNSKSIR  834
            LF+Q+G ++SVRVC D+++ RSLGY YVN+ +P DAA A++VLNFTP+N+K IR
Sbjct  49   LFSQIGPLLSVRVCHDVNTHRSLGYAYVNFINPADAATALDVLNFTPLNNKPIR  102



>ref|XP_009386707.1| PREDICTED: polyadenylate-binding protein 2-like isoform X3 [Musa 
acuminata subsp. malaccensis]
Length=653

 Score =   112 bits (280),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 57/114 (50%), Positives = 77/114 (68%), Gaps = 12/114 (11%)
 Frame = +1

Query  493  MAQIQVQHQSpvalangvpppgavglpapQSAAGAGNQLSTTSLYVGDLDPTVTDSQLYD  672
            MAQ  +QHQ+P    +               A+  G   S TSLYVGDL  +VTD+Q+YD
Sbjct  1    MAQAPMQHQAPNGTVDNNI------------ASAGGGHSSPTSLYVGDLHGSVTDAQVYD  48

Query  673  LFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQDAARAMEVLNFTPVNSKSIR  834
            LF+Q+G ++SVRVC D+++ RSLGY YVN+ +P DAA A++VLNFTP+N+K IR
Sbjct  49   LFSQIGPLLSVRVCHDVNTHRSLGYAYVNFINPADAATALDVLNFTPLNNKPIR  102



>ref|XP_001770548.1| predicted protein [Physcomitrella patens]
 gb|EDQ64717.1| predicted protein [Physcomitrella patens]
Length=645

 Score =   112 bits (280),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 50/74 (68%), Positives = 65/74 (88%), Gaps = 0/74 (0%)
 Frame = +1

Query  613  TTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQDAARAM  792
            +TSLYVGDL+ TV+++QLY++F+QVGQVVS+RVCRD+ +RRSLGY YVNY++ QDA RA+
Sbjct  23   STSLYVGDLESTVSEAQLYEIFSQVGQVVSIRVCRDLITRRSLGYAYVNYNNAQDATRAL  82

Query  793  EVLNFTPVNSKSIR  834
            E+LNF  VN K IR
Sbjct  83   ELLNFNAVNGKPIR  96


 Score = 54.7 bits (130),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 46/71 (65%), Gaps = 1/71 (1%)
 Frame = +1

Query  619  SLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQDAARAMEV  798
            +LY+ +LD T+ D +L ++F++ G +VS +V RD   + S G G+V +SSP +A RA+  
Sbjct  307  NLYLKNLDDTIDDEKLREIFSEYGTIVSCKVMRDPQGQ-SRGSGFVAFSSPDEATRAVTE  365

Query  799  LNFTPVNSKSI  831
            +N   V SK +
Sbjct  366  MNGKMVGSKPL  376



>ref|XP_009386706.1| PREDICTED: polyadenylate-binding protein 2-like isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=657

 Score =   112 bits (280),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 57/114 (50%), Positives = 77/114 (68%), Gaps = 12/114 (11%)
 Frame = +1

Query  493  MAQIQVQHQSpvalangvpppgavglpapQSAAGAGNQLSTTSLYVGDLDPTVTDSQLYD  672
            MAQ  +QHQ+P    +               A+  G   S TSLYVGDL  +VTD+Q+YD
Sbjct  1    MAQAPMQHQAPNGTVDNNI------------ASAGGGHSSPTSLYVGDLHGSVTDAQVYD  48

Query  673  LFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQDAARAMEVLNFTPVNSKSIR  834
            LF+Q+G ++SVRVC D+++ RSLGY YVN+ +P DAA A++VLNFTP+N+K IR
Sbjct  49   LFSQIGPLLSVRVCHDVNTHRSLGYAYVNFINPADAATALDVLNFTPLNNKPIR  102



>ref|XP_009386705.1| PREDICTED: polyadenylate-binding protein 2-like isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=658

 Score =   112 bits (280),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 57/114 (50%), Positives = 77/114 (68%), Gaps = 12/114 (11%)
 Frame = +1

Query  493  MAQIQVQHQSpvalangvpppgavglpapQSAAGAGNQLSTTSLYVGDLDPTVTDSQLYD  672
            MAQ  +QHQ+P    +               A+  G   S TSLYVGDL  +VTD+Q+YD
Sbjct  1    MAQAPMQHQAPNGTVDNNI------------ASAGGGHSSPTSLYVGDLHGSVTDAQVYD  48

Query  673  LFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQDAARAMEVLNFTPVNSKSIR  834
            LF+Q+G ++SVRVC D+++ RSLGY YVN+ +P DAA A++VLNFTP+N+K IR
Sbjct  49   LFSQIGPLLSVRVCHDVNTHRSLGYAYVNFINPADAATALDVLNFTPLNNKPIR  102



>ref|XP_002987288.1| hypothetical protein SELMODRAFT_269256 [Selaginella moellendorffii]
 ref|XP_002989195.1| hypothetical protein SELMODRAFT_269487 [Selaginella moellendorffii]
 gb|EFJ09789.1| hypothetical protein SELMODRAFT_269487 [Selaginella moellendorffii]
 gb|EFJ11603.1| hypothetical protein SELMODRAFT_269256 [Selaginella moellendorffii]
Length=567

 Score =   111 bits (277),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 45/76 (59%), Positives = 65/76 (86%), Gaps = 0/76 (0%)
 Frame = +1

Query  607  LSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQDAAR  786
             ++T+LYVGDLDP+V ++Q++D+F Q+G V+SVR+CRD+ ++RSLGY YVNY++ QDA+R
Sbjct  12   FASTALYVGDLDPSVNEAQIFDIFKQIGNVMSVRLCRDMVTKRSLGYAYVNYNNTQDASR  71

Query  787  AMEVLNFTPVNSKSIR  834
            A+E LNF PVN K +R
Sbjct  72   AIEELNFMPVNGKPVR  87



>emb|CBI18330.3| unnamed protein product [Vitis vinifera]
Length=145

 Score =   105 bits (261),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 49/84 (58%), Positives = 64/84 (76%), Gaps = 0/84 (0%)
 Frame = +1

Query  583  SAAGAGNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNY  762
            ++ G  NQL +TSLYVG L+  VTDS L+DLF Q+G VVSV++C D+S+RRSL YG VN+
Sbjct  4    TSNGGENQLVSTSLYVGGLESNVTDSHLFDLFGQLGPVVSVQICCDLSTRRSLNYGCVNH  63

Query  763  SSPQDAARAMEVLNFTPVNSKSIR  834
             +PQD  RA++VLNFT +N K  R
Sbjct  64   GNPQDTVRALDVLNFTHLNGKPTR  87



>ref|XP_010925352.1| PREDICTED: polyadenylate-binding protein 2-like [Elaeis guineensis]
Length=650

 Score =   111 bits (278),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 51/79 (65%), Positives = 61/79 (77%), Gaps = 0/79 (0%)
 Frame = +1

Query  598  GNQLSTTSLYVGDLDPTVTDSQLYDLFNQVGQVVSVRVCRDISSRRSLGYGYVNYSSPQD  777
            G      SLYVGDLD +VT+ QL+D+F+Q+G V SVRVCRD   R SLGY YVN+ +PQD
Sbjct  27   GGAFGNASLYVGDLDLSVTEGQLFDVFSQIGPVASVRVCRDQIHRVSLGYAYVNFHNPQD  86

Query  778  AARAMEVLNFTPVNSKSIR  834
            A+RA+EVLNFTPVN K IR
Sbjct  87   ASRALEVLNFTPVNGKPIR  105



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1785100074290