BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig432

Length=1157
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CAN80052.1|  hypothetical protein VITISV_020270                     135   2e-33   Vitis vinifera
ref|XP_009771172.1|  PREDICTED: probable methyltransferase PMT26        142   3e-33   Nicotiana sylvestris
gb|EYU23728.1|  hypothetical protein MIMGU_mgv1a001484mg                140   8e-33   Erythranthe guttata [common monkey flower]
ref|XP_004239625.1|  PREDICTED: probable methyltransferase PMT26        140   2e-32   Solanum lycopersicum
ref|XP_009590749.1|  PREDICTED: probable methyltransferase PMT26        139   2e-32   Nicotiana tomentosiformis
ref|XP_006345748.1|  PREDICTED: probable methyltransferase PMT26-...    138   8e-32   Solanum tuberosum [potatoes]
emb|CAN60874.1|  hypothetical protein VITISV_030592                     134   2e-31   Vitis vinifera
emb|CBI37509.3|  unnamed protein product                                134   1e-30   Vitis vinifera
ref|XP_002266357.1|  PREDICTED: probable methyltransferase PMT26        134   2e-30   Vitis vinifera
ref|XP_011099715.1|  PREDICTED: probable methyltransferase PMT26        132   5e-30   Sesamum indicum [beniseed]
ref|XP_011031158.1|  PREDICTED: probable methyltransferase PMT26 ...    131   2e-29   Populus euphratica
ref|XP_011031156.1|  PREDICTED: probable methyltransferase PMT26 ...    131   2e-29   Populus euphratica
ref|XP_011031160.1|  PREDICTED: probable methyltransferase PMT26 ...    129   1e-28   Populus euphratica
ref|XP_011031157.1|  PREDICTED: probable methyltransferase PMT26 ...    129   1e-28   Populus euphratica
ref|XP_011031161.1|  PREDICTED: probable methyltransferase PMT26 ...    129   1e-28   Populus euphratica
ref|XP_010027631.1|  PREDICTED: probable methyltransferase PMT26        127   3e-28   Eucalyptus grandis [rose gum]
ref|XP_010090820.1|  putative methyltransferase PMT26                   127   4e-28   Morus notabilis
ref|XP_008462649.1|  PREDICTED: probable methyltransferase PMT26        125   1e-27   Cucumis melo [Oriental melon]
ref|XP_004143348.1|  PREDICTED: probable methyltransferase PMT26        125   2e-27   Cucumis sativus [cucumbers]
ref|XP_002516311.1|  ATP binding protein, putative                      124   3e-27   Ricinus communis
ref|XP_004288094.1|  PREDICTED: probable methyltransferase PMT26        123   5e-27   Fragaria vesca subsp. vesca
ref|XP_003602639.1|  Ankyrin-like protein                               120   1e-26   
ref|XP_004502956.1|  PREDICTED: probable methyltransferase PMT26-...    122   2e-26   Cicer arietinum [garbanzo]
ref|XP_003602638.1|  Ankyrin-like protein                               120   2e-26   
ref|XP_011022921.1|  PREDICTED: probable methyltransferase PMT26        119   9e-26   Populus euphratica
ref|XP_003602637.1|  Ankyrin-like protein                               119   9e-26   Medicago truncatula
ref|XP_008360714.1|  PREDICTED: probable methyltransferase PMT26        119   1e-25   
ref|XP_007214544.1|  hypothetical protein PRUPE_ppa001471mg             117   5e-25   Prunus persica
ref|XP_002309924.1|  dehydration-responsive family protein              117   5e-25   
ref|XP_008227415.1|  PREDICTED: probable methyltransferase PMT26        117   6e-25   Prunus mume [ume]
ref|XP_007048444.1|  S-adenosyl-L-methionine-dependent methyltran...    117   6e-25   
ref|XP_011078779.1|  PREDICTED: probable methyltransferase PMT26        117   6e-25   Sesamum indicum [beniseed]
ref|XP_007137790.1|  hypothetical protein PHAVU_009G155600g             115   3e-24   Phaseolus vulgaris [French bean]
ref|XP_003526869.1|  PREDICTED: probable methyltransferase PMT26-...    113   1e-23   Glycine max [soybeans]
gb|KHN09623.1|  Putative methyltransferase PMT26                        113   1e-23   Glycine soja [wild soybean]
ref|XP_003523221.1|  PREDICTED: probable methyltransferase PMT26-...    112   2e-23   Glycine max [soybeans]
ref|XP_012078344.1|  PREDICTED: probable methyltransferase PMT24        111   5e-23   Jatropha curcas
ref|XP_002307464.2|  hypothetical protein POPTR_0005s20670g             110   1e-22   
gb|KDO51661.1|  hypothetical protein CISIN_1g003776mg                   109   1e-22   Citrus sinensis [apfelsine]
ref|XP_009355841.1|  PREDICTED: probable methyltransferase PMT26        109   2e-22   Pyrus x bretschneideri [bai li]
ref|XP_007019267.1|  S-adenosyl-L-methionine-dependent methyltran...    109   2e-22   
gb|KDO51659.1|  hypothetical protein CISIN_1g003776mg                   108   3e-22   Citrus sinensis [apfelsine]
ref|XP_010270331.1|  PREDICTED: probable methyltransferase PMT26 ...    108   4e-22   Nelumbo nucifera [Indian lotus]
ref|XP_010270332.1|  PREDICTED: probable methyltransferase PMT26 ...    108   5e-22   Nelumbo nucifera [Indian lotus]
ref|XP_006432154.1|  hypothetical protein CICLE_v10000328mg             108   6e-22   Citrus clementina [clementine]
ref|XP_008394173.1|  PREDICTED: probable methyltransferase PMT26 ...    108   6e-22   
ref|XP_008394175.1|  PREDICTED: probable methyltransferase PMT26 ...    108   6e-22   
ref|XP_002306259.2|  dehydration-responsive family protein              106   2e-21   
emb|CDP04655.1|  unnamed protein product                                105   3e-21   Coffea canephora [robusta coffee]
gb|KJB48928.1|  hypothetical protein B456_008G094300                    103   1e-20   Gossypium raimondii
gb|KJB48927.1|  hypothetical protein B456_008G094300                    103   2e-20   Gossypium raimondii
gb|KJB29131.1|  hypothetical protein B456_005G086100                    103   2e-20   Gossypium raimondii
ref|XP_010277710.1|  PREDICTED: probable methyltransferase PMT24        103   2e-20   Nelumbo nucifera [Indian lotus]
ref|XP_011006302.1|  PREDICTED: probable methyltransferase PMT24 ...    103   2e-20   Populus euphratica
ref|XP_011006303.1|  PREDICTED: probable methyltransferase PMT24 ...    103   2e-20   Populus euphratica
ref|XP_012070600.1|  PREDICTED: probable methyltransferase PMT26        103   2e-20   Jatropha curcas
gb|KJB29129.1|  hypothetical protein B456_005G086100                    102   2e-20   Gossypium raimondii
ref|XP_002285889.2|  PREDICTED: probable methyltransferase PMT24        102   3e-20   Vitis vinifera
gb|KJB29128.1|  hypothetical protein B456_005G086100                    102   3e-20   Gossypium raimondii
gb|KHG21530.1|  hypothetical protein F383_05601                         102   3e-20   Gossypium arboreum [tree cotton]
gb|KJB29130.1|  hypothetical protein B456_005G086100                    102   4e-20   Gossypium raimondii
ref|XP_002520274.1|  ATP binding protein, putative                      100   1e-19   Ricinus communis
ref|XP_004503920.1|  PREDICTED: probable methyltransferase PMT26-...    100   2e-19   Cicer arietinum [garbanzo]
ref|XP_010674444.1|  PREDICTED: probable methyltransferase PMT26        100   2e-19   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006580338.1|  PREDICTED: probable methyltransferase PMT26-...  99.8    3e-19   Glycine max [soybeans]
gb|KHN34092.1|  Putative methyltransferase PMT26                      99.8    3e-19   Glycine soja [wild soybean]
ref|XP_002300957.2|  hypothetical protein POPTR_0002s07640g           99.0    5e-19   Populus trichocarpa [western balsam poplar]
dbj|BAC43570.1|  putative ankyrin                                     94.0    6e-19   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006584650.1|  PREDICTED: probable methyltransferase PMT26-...  98.2    1e-18   Glycine max [soybeans]
gb|KDO83500.1|  hypothetical protein CISIN_1g015557mg                 94.0    7e-18   Citrus sinensis [apfelsine]
ref|XP_002864883.1|  hypothetical protein ARALYDRAFT_496597           95.1    1e-17   
ref|XP_007159858.1|  hypothetical protein PHAVU_002G273700g           94.7    1e-17   Phaseolus vulgaris [French bean]
ref|XP_010546331.1|  PREDICTED: probable methyltransferase PMT26      94.7    1e-17   Tarenaya hassleriana [spider flower]
ref|XP_006434319.1|  hypothetical protein CICLE_v10000311mg           93.6    2e-17   
ref|XP_006472883.1|  PREDICTED: probable methyltransferase PMT25-...  93.2    4e-17   Citrus sinensis [apfelsine]
ref|XP_006434317.1|  hypothetical protein CICLE_v10000311mg           93.2    4e-17   
ref|NP_201208.2|  putative methyltransferase PMT26                    92.8    6e-17   Arabidopsis thaliana [mouse-ear cress]
dbj|BAB10271.1|  ankyrin-like protein                                 92.8    6e-17   Arabidopsis thaliana [mouse-ear cress]
gb|KHG06416.1|  hypothetical protein F383_32222                       91.7    1e-16   Gossypium arboreum [tree cotton]
gb|KJB59346.1|  hypothetical protein B456_009G250600                  90.9    3e-16   Gossypium raimondii
ref|XP_006394213.1|  hypothetical protein EUTSA_v10003654mg           89.7    6e-16   Eutrema salsugineum [saltwater cress]
gb|KHG22120.1|  hypothetical protein F383_28461                       89.0    1e-15   Gossypium arboreum [tree cotton]
gb|KJB71369.1|  hypothetical protein B456_011G118900                  88.6    1e-15   Gossypium raimondii
ref|XP_010521110.1|  PREDICTED: probable methyltransferase PMT26      88.6    1e-15   Tarenaya hassleriana [spider flower]
gb|KJB40479.1|  hypothetical protein B456_007G066000                  88.6    2e-15   Gossypium raimondii
ref|XP_003630288.1|  Ankyrin-like protein                             88.2    2e-15   Medicago truncatula
ref|XP_006281931.1|  hypothetical protein CARUB_v10028139mg           88.2    2e-15   Capsella rubella
ref|XP_007199628.1|  hypothetical protein PRUPE_ppa001750mg           88.2    2e-15   
gb|KHG04009.1|  hypothetical protein F383_29196                       86.7    5e-15   Gossypium arboreum [tree cotton]
ref|XP_008244575.1|  PREDICTED: probable methyltransferase PMT24      86.3    7e-15   Prunus mume [ume]
ref|XP_006847154.2|  PREDICTED: probable methyltransferase PMT26      85.9    1e-14   Amborella trichopoda
gb|ERN08735.1|  hypothetical protein AMTR_s00017p00240980             85.9    1e-14   Amborella trichopoda
ref|XP_010461320.1|  PREDICTED: probable methyltransferase PMT26      85.9    1e-14   
ref|XP_010444329.1|  PREDICTED: probable methyltransferase PMT26      85.5    1e-14   Camelina sativa [gold-of-pleasure]
gb|KHG15143.1|  hypothetical protein F383_09666                       85.1    2e-14   Gossypium arboreum [tree cotton]
ref|XP_010484172.1|  PREDICTED: probable methyltransferase PMT26      84.7    2e-14   Camelina sativa [gold-of-pleasure]
ref|XP_008345949.1|  PREDICTED: probable methyltransferase PMT26      83.2    6e-14   
ref|XP_008371671.1|  PREDICTED: probable methyltransferase PMT26      83.2    6e-14   
ref|XP_007137499.1|  hypothetical protein PHAVU_009G132000g           83.2    8e-14   Phaseolus vulgaris [French bean]
ref|XP_009360657.1|  PREDICTED: probable methyltransferase PMT24      81.6    3e-13   Pyrus x bretschneideri [bai li]
ref|XP_006578949.1|  PREDICTED: probable methyltransferase PMT26-...  81.3    4e-13   Glycine max [soybeans]
ref|XP_009150474.1|  PREDICTED: probable methyltransferase PMT26      81.3    4e-13   Brassica rapa
emb|CDY39830.1|  BnaC02g42880D                                        80.9    5e-13   Brassica napus [oilseed rape]
gb|AAP72961.1|  putative ankyrin-like protein                         80.9    5e-13   Lactuca sativa [cultivated lettuce]
emb|CDY33300.1|  BnaA01g19670D                                        77.8    5e-13   Brassica napus [oilseed rape]
ref|XP_010930722.1|  PREDICTED: probable methyltransferase PMT26      79.7    1e-12   Elaeis guineensis
ref|XP_009366818.1|  PREDICTED: probable methyltransferase PMT24      79.3    1e-12   Pyrus x bretschneideri [bai li]
emb|CDX84478.1|  BnaC03g50220D                                        78.2    3e-12   
ref|XP_003527960.1|  PREDICTED: probable methyltransferase PMT26-...  78.2    3e-12   Glycine max [soybeans]
ref|XP_008781596.1|  PREDICTED: probable methyltransferase PMT26      78.2    4e-12   Phoenix dactylifera
ref|XP_010412715.1|  PREDICTED: probable methyltransferase PMT27      76.6    8e-12   Camelina sativa [gold-of-pleasure]
ref|XP_006290554.1|  hypothetical protein CARUB_v10016641mg           77.0    8e-12   Capsella rubella
ref|XP_009149307.1|  PREDICTED: probable methyltransferase PMT27      76.6    1e-11   Brassica rapa
ref|XP_010515490.1|  PREDICTED: probable methyltransferase PMT27      76.3    2e-11   Camelina sativa [gold-of-pleasure]
ref|XP_010503787.1|  PREDICTED: probable methyltransferase PMT27      76.3    2e-11   Camelina sativa [gold-of-pleasure]
ref|XP_009410679.1|  PREDICTED: probable methyltransferase PMT26      75.5    3e-11   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY26534.1|  BnaC01g23650D                                        75.5    3e-11   Brassica napus [oilseed rape]
ref|XP_009383568.1|  PREDICTED: probable methyltransferase PMT26      75.5    3e-11   
ref|XP_009130433.1|  PREDICTED: probable methyltransferase PMT26      74.3    6e-11   Brassica rapa
emb|CDY31339.1|  BnaA02g34020D                                        74.3    6e-11   Brassica napus [oilseed rape]
ref|XP_004289881.1|  PREDICTED: probable methyltransferase PMT24      74.3    7e-11   Fragaria vesca subsp. vesca
ref|XP_010426649.1|  PREDICTED: probable methyltransferase PMT27      74.3    7e-11   Camelina sativa [gold-of-pleasure]
ref|NP_190676.1|  putative methyltransferase PMT27                    72.8    2e-10   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009414612.1|  PREDICTED: probable methyltransferase PMT24      72.4    2e-10   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008783335.1|  PREDICTED: probable methyltransferase PMT26      72.4    3e-10   Phoenix dactylifera
gb|ERM96302.1|  hypothetical protein AMTR_s00001p00185010             72.0    4e-10   Amborella trichopoda
dbj|BAH19463.1|  AT1G29470                                            67.8    5e-10   Arabidopsis thaliana [mouse-ear cress]
emb|CDY43782.1|  BnaA06g23180D                                        71.6    5e-10   Brassica napus [oilseed rape]
ref|XP_009115787.1|  PREDICTED: probable methyltransferase PMT27      71.2    6e-10   Brassica rapa
ref|XP_004502550.1|  PREDICTED: probable methyltransferase PMT26-...  70.9    8e-10   Cicer arietinum [garbanzo]
ref|XP_010911089.1|  PREDICTED: probable methyltransferase PMT26      70.9    8e-10   Elaeis guineensis
gb|EPS72711.1|  hypothetical protein M569_02048                       65.1    1e-09   Genlisea aurea
gb|KHN36073.1|  Putative methyltransferase PMT27                      70.1    2e-09   Glycine soja [wild soybean]
ref|XP_003516560.1|  PREDICTED: probable methyltransferase PMT27-...  70.1    2e-09   Glycine max [soybeans]
ref|XP_010557710.1|  PREDICTED: probable methyltransferase PMT27      68.9    3e-09   Tarenaya hassleriana [spider flower]
ref|XP_010112029.1|  putative methyltransferase PMT24                 68.9    3e-09   Morus notabilis
ref|XP_006403957.1|  hypothetical protein EUTSA_v10010109mg           68.9    4e-09   Eutrema salsugineum [saltwater cress]
ref|XP_010501645.1|  PREDICTED: probable methyltransferase PMT24      68.6    4e-09   
ref|XP_006415572.1|  hypothetical protein EUTSA_v10006884mg           68.6    5e-09   Eutrema salsugineum [saltwater cress]
ref|XP_010460728.1|  PREDICTED: probable methyltransferase PMT24      67.8    7e-09   Camelina sativa [gold-of-pleasure]
ref|XP_007158605.1|  hypothetical protein PHAVU_002G166600g           67.8    9e-09   Phaseolus vulgaris [French bean]
ref|XP_006303155.1|  hypothetical protein CARUB_v10008372mg           67.0    1e-08   
ref|XP_010547883.1|  PREDICTED: probable methyltransferase PMT26      67.0    1e-08   Tarenaya hassleriana [spider flower]
ref|XP_010478312.1|  PREDICTED: probable methyltransferase PMT24 ...  67.0    1e-08   Camelina sativa [gold-of-pleasure]
ref|XP_010469377.1|  PREDICTED: probable methyltransferase PMT25      66.6    2e-08   Camelina sativa [gold-of-pleasure]
ref|XP_010908928.1|  PREDICTED: probable methyltransferase PMT26      66.6    2e-08   Elaeis guineensis
ref|XP_010679252.1|  PREDICTED: probable methyltransferase PMT26      66.2    2e-08   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002893569.1|  hypothetical protein ARALYDRAFT_473159           66.2    3e-08   
dbj|BAE99079.1|  hypothetical protein                                 65.5    4e-08   Arabidopsis thaliana [mouse-ear cress]
ref|NP_174240.2|  putative methyltransferase PMT24                    65.5    4e-08   Arabidopsis thaliana [mouse-ear cress]
emb|CDX94669.1|  BnaC07g09890D                                        65.1    5e-08   
gb|KEH35375.1|  methyltransferase PMT26-like protein, putative        64.7    7e-08   Medicago truncatula
ref|XP_010533385.1|  PREDICTED: probable methyltransferase PMT24      64.7    8e-08   Tarenaya hassleriana [spider flower]
ref|NP_001140988.1|  uncharacterized protein LOC100273067             63.5    1e-07   
ref|XP_010509773.1|  PREDICTED: probable methyltransferase PMT25      64.3    1e-07   Camelina sativa [gold-of-pleasure]
ref|XP_010413759.1|  PREDICTED: probable methyltransferase PMT25      63.9    1e-07   Camelina sativa [gold-of-pleasure]
ref|XP_002881329.1|  hypothetical protein ARALYDRAFT_482372           63.2    2e-07   
dbj|BAE99717.1|  hypothetical protein                                 62.8    3e-07   Arabidopsis thaliana [mouse-ear cress]
ref|NP_180977.1|  putative methyltransferase PMT25                    62.8    3e-07   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006410572.1|  hypothetical protein EUTSA_v10016285mg           62.4    4e-07   Eutrema salsugineum [saltwater cress]
ref|XP_008805853.1|  PREDICTED: probable methyltransferase PMT26      62.4    4e-07   Phoenix dactylifera
ref|XP_009102852.1|  PREDICTED: probable methyltransferase PMT24      62.0    5e-07   Brassica rapa
emb|CDX90190.1|  BnaA08g17940D                                        62.0    6e-07   
ref|XP_009109665.1|  PREDICTED: probable methyltransferase PMT24      61.6    6e-07   
ref|XP_006295874.1|  hypothetical protein CARUB_v10025004mg           61.6    8e-07   Capsella rubella
ref|XP_007046783.1|  S-adenosyl-L-methionine-dependent methyltran...  61.2    9e-07   
gb|AAG51752.1|AC068667_31  unknown protein; 55790-52851               61.2    9e-07   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002458871.1|  hypothetical protein SORBIDRAFT_03g041910        60.8    1e-06   Sorghum bicolor [broomcorn]
gb|ACN28572.1|  unknown                                               60.8    1e-06   Zea mays [maize]
ref|XP_002876067.1|  hypothetical protein ARALYDRAFT_485459           57.0    2e-06   
ref|XP_009115236.1|  PREDICTED: probable methyltransferase PMT24 ...  60.1    2e-06   Brassica rapa
emb|CDX99828.1|  BnaC05g22500D                                        60.1    2e-06   
emb|CDY48339.1|  BnaA09g26820D                                        60.1    2e-06   Brassica napus [oilseed rape]
gb|ADK88116.1|  AtIII19x5-like protein                                55.8    2e-06   Arabidopsis halleri
ref|XP_010527657.1|  PREDICTED: probable methyltransferase PMT24      60.1    2e-06   Tarenaya hassleriana [spider flower]
ref|XP_009115237.1|  PREDICTED: probable methyltransferase PMT24 ...  60.1    2e-06   Brassica rapa
ref|XP_004970814.1|  PREDICTED: probable methyltransferase PMT26-...  59.3    4e-06   Setaria italica
emb|CDY44314.1|  BnaA07g07980D                                        59.3    4e-06   Brassica napus [oilseed rape]
ref|XP_010679826.1|  PREDICTED: probable methyltransferase PMT27      59.3    4e-06   Beta vulgaris subsp. vulgaris [field beet]
emb|CDM85080.1|  unnamed protein product                              59.3    4e-06   Triticum aestivum [Canadian hard winter wheat]
gb|EMT17461.1|  hypothetical protein F775_31288                       58.9    5e-06   
ref|XP_006828886.2|  PREDICTED: probable methyltransferase PMT24      58.9    5e-06   
emb|CDY66721.1|  BnaC03g76010D                                        58.5    5e-06   Brassica napus [oilseed rape]
ref|XP_010030876.1|  PREDICTED: probable methyltransferase PMT27      58.9    6e-06   Eucalyptus grandis [rose gum]
ref|XP_010271514.1|  PREDICTED: probable methyltransferase PMT27      58.2    9e-06   
gb|ADK88118.1|  AtIII19x5-like protein                                53.5    1e-05   Arabidopsis halleri
gb|KHN16949.1|  Putative methyltransferase PMT26                      57.8    1e-05   Glycine soja [wild soybean]
ref|XP_008241902.1|  PREDICTED: probable methyltransferase PMT27      57.8    1e-05   Prunus mume [ume]
ref|XP_007203224.1|  hypothetical protein PRUPE_ppa000863mg           57.4    2e-05   Prunus persica
emb|CDY17234.1|  BnaA05g09540D                                        57.0    2e-05   Brassica napus [oilseed rape]
ref|XP_009143789.1|  PREDICTED: probable methyltransferase PMT25      57.0    2e-05   Brassica rapa
gb|ABA96619.1|  dehydration-responsive protein, putative              57.0    2e-05   Oryza sativa Japonica Group [Japonica rice]
gb|EAZ19833.1|  hypothetical protein OsJ_35417                        57.0    2e-05   Oryza sativa Japonica Group [Japonica rice]
emb|CDX84330.1|  BnaC04g10920D                                        56.6    3e-05   
gb|EAY82457.1|  hypothetical protein OsI_37674                        56.6    3e-05   Oryza sativa Indica Group [Indian rice]
ref|XP_006365916.1|  PREDICTED: probable methyltransferase PMT24-...  55.8    6e-05   Solanum tuberosum [potatoes]
ref|XP_009411900.1|  PREDICTED: probable methyltransferase PMT26      55.5    6e-05   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010679267.1|  PREDICTED: probable methyltransferase PMT26      53.9    2e-04   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_003580900.1|  PREDICTED: probable methyltransferase PMT26      53.9    2e-04   Brachypodium distachyon [annual false brome]
ref|XP_010063906.1|  PREDICTED: probable methyltransferase PMT25 ...  53.5    3e-04   Eucalyptus grandis [rose gum]
ref|NP_001045015.1|  Os01g0883900                                     53.1    4e-04   
ref|XP_006645134.1|  PREDICTED: probable methyltransferase PMT26-...  53.1    4e-04   Oryza brachyantha
ref|XP_010263954.1|  PREDICTED: probable methyltransferase PMT27      52.8    4e-04   Nelumbo nucifera [Indian lotus]
ref|XP_002310282.2|  hypothetical protein POPTR_0007s13620g           52.8    4e-04   
gb|EAY76734.1|  hypothetical protein OsI_04689                        52.8    4e-04   Oryza sativa Indica Group [Indian rice]
dbj|BAD82580.1|  ankyrin-like protein                                 52.8    4e-04   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011025891.1|  PREDICTED: LOW QUALITY PROTEIN: probable met...  52.8    5e-04   Populus euphratica
ref|XP_011658034.1|  PREDICTED: probable methyltransferase PMT27      52.4    6e-04   Cucumis sativus [cucumbers]
ref|XP_009346291.1|  PREDICTED: probable methyltransferase PMT27      52.4    6e-04   Pyrus x bretschneideri [bai li]
ref|XP_004237701.1|  PREDICTED: probable methyltransferase PMT24      52.4    7e-04   Solanum lycopersicum



>emb|CAN80052.1| hypothetical protein VITISV_020270 [Vitis vinifera]
Length=226

 Score =   135 bits (339),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 66/110 (60%), Positives = 80/110 (73%), Gaps = 20/110 (18%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            MALGKYSRVDGR+++ NYCS  T++ FVA+CLVGVWMMTSSSVVPVQNS+VS+QE+K ++
Sbjct  1    MALGKYSRVDGRRSTTNYCSAATLVAFVALCLVGVWMMTSSSVVPVQNSDVSTQETKDEV  60

Query  540  KTQVNESNESDTGsnesnnasdesntsdGGKAKQFEDTPGDLPDDATKGD  689
            K QV ESN+SDT                    +QFED+ GDL DDA KGD
Sbjct  61   KQQVVESNDSDT--------------------RQFEDSSGDLTDDAKKGD  90



>ref|XP_009771172.1| PREDICTED: probable methyltransferase PMT26 [Nicotiana sylvestris]
 ref|XP_009771173.1| PREDICTED: probable methyltransferase PMT26 [Nicotiana sylvestris]
Length=807

 Score =   142 bits (358),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 79/111 (71%), Positives = 92/111 (83%), Gaps = 2/111 (2%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            MALGKYSRVDGRK+S +YCSTVTI+VFVA+CLVGVWMMTSSSVVPVQNS+VSSQ   +D 
Sbjct  1    MALGKYSRVDGRKSS-SYCSTVTIVVFVALCLVGVWMMTSSSVVPVQNSDVSSQGKTSDA  59

Query  540  KTQVNESNESDTGsnesnnasdesntsdG-GKAKQFEDTPGDLPDDATKGD  689
             TQV+ES ES  G +ESNN + + +     GK+KQFED PGDLP+DATKGD
Sbjct  60   TTQVSESKESSNGGSESNNNAGDESNPTDEGKSKQFEDNPGDLPEDATKGD  110


 Score = 65.5 bits (158),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 31/37 (84%), Positives = 35/37 (95%), Gaps = 0/37 (0%)
 Frame = +3

Query  1044  SXNEVFPSGAQSELLNETTTQNGAFPTQATESKNERK  1154
             S NEVFPSGAQS+LLNETTTQNGAF TQA+ESKNE++
Sbjct  225   SSNEVFPSGAQSDLLNETTTQNGAFSTQASESKNEKE  261



>gb|EYU23728.1| hypothetical protein MIMGU_mgv1a001484mg [Erythranthe guttata]
Length=810

 Score =   140 bits (354),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 75/111 (68%), Positives = 88/111 (79%), Gaps = 2/111 (2%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            MALGKYSRVDGRK+S  YCSTVTI+VFVA+CLVGVWMMTSS+VVPVQ S+V SQE+K +L
Sbjct  1    MALGKYSRVDGRKSSSGYCSTVTIVVFVALCLVGVWMMTSSTVVPVQPSDV-SQENKNEL  59

Query  540  KTQVNESNESDTGsnesnnasdesntsdG-GKAKQFEDTPGDLPDDATKGD  689
            KT V E+N  +     +N  +  +N  +G GK KQFED PGDLPDDATKGD
Sbjct  60   KTDVTETNAENQNDATNNEDNSNANEDNGEGKQKQFEDNPGDLPDDATKGD  110


 Score = 52.0 bits (123),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 24/34 (71%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = +3

Query  1053  EVFPSGAQSELLNETTTQNGAFPTQATESKNERK  1154
             EVFPSG+Q EL NE+T QNG+F TQATESK E++
Sbjct  231   EVFPSGSQLELTNESTVQNGSFSTQATESKKEKE  264



>ref|XP_004239625.1| PREDICTED: probable methyltransferase PMT26 [Solanum lycopersicum]
 ref|XP_010321299.1| PREDICTED: probable methyltransferase PMT26 [Solanum lycopersicum]
Length=813

 Score =   140 bits (352),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 82/111 (74%), Positives = 93/111 (84%), Gaps = 2/111 (2%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            MALGKYSRVDGRK+S NYCSTVTI+VFVA+CLVGVWMMTSSSVVP QN ++SSQ  KTDL
Sbjct  1    MALGKYSRVDGRKSS-NYCSTVTIVVFVALCLVGVWMMTSSSVVPDQNLDLSSQGKKTDL  59

Query  540  KTQVNESNES-DTGsnesnnasdesntsdGGKAKQFEDTPGDLPDDATKGD  689
             TQV E  ES + G+  +N A DESN +D GK+KQFEDT GDLP+DATKGD
Sbjct  60   STQVTEGKESYNGGNESNNKAGDESNPTDEGKSKQFEDTLGDLPEDATKGD  110


 Score = 53.5 bits (127),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 26/38 (68%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = +3

Query  1044  SXNEVFPSGAQSELLNETTTQNGAFPTQATESKNERKL  1157
             S + V  SG QS+LLNETTTQNGAF TQA+ESKNE+++
Sbjct  231   SSSAVLSSGTQSDLLNETTTQNGAFLTQASESKNEKEM  268



>ref|XP_009590749.1| PREDICTED: probable methyltransferase PMT26 [Nicotiana tomentosiformis]
 ref|XP_009590750.1| PREDICTED: probable methyltransferase PMT26 [Nicotiana tomentosiformis]
Length=807

 Score =   139 bits (351),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 82/111 (74%), Positives = 95/111 (86%), Gaps = 2/111 (2%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            MALGKYSRVDGRK+S +YCSTVTI+VFVA+CLVGVWMMTSSSVVPVQNS+VSSQ   +D 
Sbjct  1    MALGKYSRVDGRKSS-SYCSTVTIVVFVALCLVGVWMMTSSSVVPVQNSDVSSQGKNSDA  59

Query  540  KTQVNESNES-DTGsnesnnasdesntsdGGKAKQFEDTPGDLPDDATKGD  689
             TQV+ S ES + G+  +NNA DESN +D GK+KQFED PGDLP+DATKGD
Sbjct  60   ATQVSGSKESYNGGNESNNNAGDESNPTDEGKSKQFEDNPGDLPEDATKGD  110


 Score = 65.1 bits (157),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 31/37 (84%), Positives = 35/37 (95%), Gaps = 0/37 (0%)
 Frame = +3

Query  1044  SXNEVFPSGAQSELLNETTTQNGAFPTQATESKNERK  1154
             S NEVFPSGAQS+LLNETTTQNGAF TQA+ESKNE++
Sbjct  225   SPNEVFPSGAQSDLLNETTTQNGAFSTQASESKNEKE  261



>ref|XP_006345748.1| PREDICTED: probable methyltransferase PMT26-like [Solanum tuberosum]
Length=813

 Score =   138 bits (347),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 80/111 (72%), Positives = 91/111 (82%), Gaps = 2/111 (2%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            MALGKYSRVDGRK+S NYCSTVTI+VFVA+CLVGVWMMTSSSVVP QN ++SSQ  K DL
Sbjct  1    MALGKYSRVDGRKSS-NYCSTVTIVVFVALCLVGVWMMTSSSVVPDQNLDLSSQGKKNDL  59

Query  540  KTQVNESNES-DTGsnesnnasdesntsdGGKAKQFEDTPGDLPDDATKGD  689
             TQV E  ES + G+  +N A DE N +D GK+KQFEDT GDLP+DATKGD
Sbjct  60   STQVTEGKESYNGGNESNNKAGDEGNPTDEGKSKQFEDTLGDLPEDATKGD  110


 Score = 55.8 bits (133),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 27/38 (71%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = +3

Query  1044  SXNEVFPSGAQSELLNETTTQNGAFPTQATESKNERKL  1157
             S + VF SG QS+LLNETTTQNGAF TQA+ESKNE+++
Sbjct  231   SSSAVFSSGTQSDLLNETTTQNGAFLTQASESKNEKEM  268



>emb|CAN60874.1| hypothetical protein VITISV_030592 [Vitis vinifera]
Length=485

 Score =   134 bits (337),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 67/110 (61%), Positives = 81/110 (74%), Gaps = 20/110 (18%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            MALGKYSRVDGR+++ NYCST T++ FVA+CLVGVWMMTSSSVVPVQNS+VS+QE+K ++
Sbjct  1    MALGKYSRVDGRRSTTNYCSTATLVAFVALCLVGVWMMTSSSVVPVQNSDVSTQETKDEV  60

Query  540  KTQVNESNESDTGsnesnnasdesntsdGGKAKQFEDTPGDLPDDATKGD  689
            K QV ESN+SDT                    +QFED+ GDL DDA KGD
Sbjct  61   KQQVVESNDSDT--------------------RQFEDSSGDLTDDAKKGD  90


 Score = 59.7 bits (143),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/35 (83%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = +3

Query  1050  NEVFPSGAQSELLNETTTQNGAFPTQATESKNERK  1154
             NEVFPSGA SELLNETTTQNGAF TQA ESK E++
Sbjct  252   NEVFPSGAMSELLNETTTQNGAFLTQAAESKKEKE  286



>emb|CBI37509.3| unnamed protein product [Vitis vinifera]
Length=761

 Score =   134 bits (336),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 67/110 (61%), Positives = 81/110 (74%), Gaps = 20/110 (18%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            MALGKYSRVDGR+++ NYCST T++ FVA+CLVGVWMMTSSSVVPVQNS+VS+QE+K ++
Sbjct  1    MALGKYSRVDGRRSTTNYCSTATLVAFVALCLVGVWMMTSSSVVPVQNSDVSTQETKDEV  60

Query  540  KTQVNESNESDTGsnesnnasdesntsdGGKAKQFEDTPGDLPDDATKGD  689
            K QV ESN+SDT                    +QFED+ GDL DDA KGD
Sbjct  61   KQQVVESNDSDT--------------------RQFEDSSGDLTDDAKKGD  90


 Score = 60.8 bits (146),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 29/35 (83%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = +3

Query  1050  NEVFPSGAQSELLNETTTQNGAFPTQATESKNERK  1154
             NEVFPSGA SELLNETTTQNGAF TQA ESK E++
Sbjct  188   NEVFPSGAMSELLNETTTQNGAFLTQAAESKKEKE  222



>ref|XP_002266357.1| PREDICTED: probable methyltransferase PMT26 [Vitis vinifera]
Length=825

 Score =   134 bits (336),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 67/110 (61%), Positives = 81/110 (74%), Gaps = 20/110 (18%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            MALGKYSRVDGR+++ NYCST T++ FVA+CLVGVWMMTSSSVVPVQNS+VS+QE+K ++
Sbjct  1    MALGKYSRVDGRRSTTNYCSTATLVAFVALCLVGVWMMTSSSVVPVQNSDVSTQETKDEV  60

Query  540  KTQVNESNESDTGsnesnnasdesntsdGGKAKQFEDTPGDLPDDATKGD  689
            K QV ESN+SDT                    +QFED+ GDL DDA KGD
Sbjct  61   KQQVVESNDSDT--------------------RQFEDSSGDLTDDAKKGD  90


 Score = 60.5 bits (145),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/35 (83%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = +3

Query  1050  NEVFPSGAQSELLNETTTQNGAFPTQATESKNERK  1154
             NEVFPSGA SELLNETTTQNGAF TQA ESK E++
Sbjct  252   NEVFPSGAMSELLNETTTQNGAFLTQAAESKKEKE  286



>ref|XP_011099715.1| PREDICTED: probable methyltransferase PMT26 [Sesamum indicum]
Length=818

 Score =   132 bits (333),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 71/114 (62%), Positives = 87/114 (76%), Gaps = 5/114 (4%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            MALGKYSRVDGRK+S +YCSTVT++VFVA+CLVGVWMMTSSSVVPVQNS+V SQE+K ++
Sbjct  1    MALGKYSRVDGRKSSSSYCSTVTVVVFVALCLVGVWMMTSSSVVPVQNSDV-SQENKNEV  59

Query  540  KTQVNESNESDTGsnesnnasdesntsdG----GKAKQFEDTPGDLPDDATKGD  689
            KT V ESN  +     ++  S      +G    G+ KQFED+ GDLP+DATK D
Sbjct  60   KTPVTESNAENNNDARNDENSKPVVEDNGPRDEGQQKQFEDSQGDLPEDATKVD  113


 Score = 60.1 bits (144),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/35 (80%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +3

Query  1053  EVFPSGAQSELLNETTTQNGAFPTQATESKNERKL  1157
             EVFPSGAQSELLNE+TTQNG+F TQATESKN +++
Sbjct  239   EVFPSGAQSELLNESTTQNGSFSTQATESKNAKEV  273



>ref|XP_011031158.1| PREDICTED: probable methyltransferase PMT26 isoform X3 [Populus 
euphratica]
 ref|XP_011031159.1| PREDICTED: probable methyltransferase PMT26 isoform X4 [Populus 
euphratica]
Length=830

 Score =   131 bits (329),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 65/114 (57%), Positives = 80/114 (70%), Gaps = 12/114 (11%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            MALGKYSRVD R+ + +YCSTVT++VFV +CLVG WMMTSSSVVP QN +V +QE+K ++
Sbjct  1    MALGKYSRVDNRRHNSSYCSTVTVVVFVGLCLVGAWMMTSSSVVPGQNVDVPAQENKNEV  60

Query  540  KTQVNESNESDTGsnesnnasdesntsdGGKAKQFEDTPGDLPDDATKGDIATP  701
            K QV ESNE +T  +                 KQFED PGDLP+DATKGD + P
Sbjct  61   KQQVTESNEINTTESNEI------------NTKQFEDNPGDLPEDATKGDTSMP  102



>ref|XP_011031156.1| PREDICTED: probable methyltransferase PMT26 isoform X1 [Populus 
euphratica]
Length=846

 Score =   131 bits (329),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 65/114 (57%), Positives = 80/114 (70%), Gaps = 12/114 (11%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            MALGKYSRVD R+ + +YCSTVT++VFV +CLVG WMMTSSSVVP QN +V +QE+K ++
Sbjct  1    MALGKYSRVDNRRHNSSYCSTVTVVVFVGLCLVGAWMMTSSSVVPGQNVDVPAQENKNEV  60

Query  540  KTQVNESNESDTGsnesnnasdesntsdGGKAKQFEDTPGDLPDDATKGDIATP  701
            K QV ESNE +T  +                 KQFED PGDLP+DATKGD + P
Sbjct  61   KQQVTESNEINTTESNEI------------NTKQFEDNPGDLPEDATKGDTSMP  102



>ref|XP_011031160.1| PREDICTED: probable methyltransferase PMT26 isoform X5 [Populus 
euphratica]
Length=828

 Score =   129 bits (323),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 64/110 (58%), Positives = 78/110 (71%), Gaps = 12/110 (11%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            MALGKYSRVD R+ + +YCSTVT++VFV +CLVG WMMTSSSVVP QN +V +QE+K ++
Sbjct  1    MALGKYSRVDNRRHNSSYCSTVTVVVFVGLCLVGAWMMTSSSVVPGQNVDVPAQENKNEV  60

Query  540  KTQVNESNESDTGsnesnnasdesntsdGGKAKQFEDTPGDLPDDATKGD  689
            K QV ESNE +T  +                 KQFED PGDLP+DATKGD
Sbjct  61   KQQVTESNEINTTESNEI------------NTKQFEDNPGDLPEDATKGD  98



>ref|XP_011031157.1| PREDICTED: probable methyltransferase PMT26 isoform X2 [Populus 
euphratica]
Length=836

 Score =   129 bits (323),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 64/110 (58%), Positives = 78/110 (71%), Gaps = 12/110 (11%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            MALGKYSRVD R+ + +YCSTVT++VFV +CLVG WMMTSSSVVP QN +V +QE+K ++
Sbjct  1    MALGKYSRVDNRRHNSSYCSTVTVVVFVGLCLVGAWMMTSSSVVPGQNVDVPAQENKNEV  60

Query  540  KTQVNESNESDTGsnesnnasdesntsdGGKAKQFEDTPGDLPDDATKGD  689
            K QV ESNE +T  +                 KQFED PGDLP+DATKGD
Sbjct  61   KQQVTESNEINTTESNEI------------NTKQFEDNPGDLPEDATKGD  98



>ref|XP_011031161.1| PREDICTED: probable methyltransferase PMT26 isoform X6 [Populus 
euphratica]
Length=828

 Score =   129 bits (323),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 64/110 (58%), Positives = 78/110 (71%), Gaps = 12/110 (11%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            MALGKYSRVD R+ + +YCSTVT++VFV +CLVG WMMTSSSVVP QN +V +QE+K ++
Sbjct  1    MALGKYSRVDNRRHNSSYCSTVTVVVFVGLCLVGAWMMTSSSVVPGQNVDVPAQENKNEV  60

Query  540  KTQVNESNESDTGsnesnnasdesntsdGGKAKQFEDTPGDLPDDATKGD  689
            K QV ESNE +T  +                 KQFED PGDLP+DATKGD
Sbjct  61   KQQVTESNEINTTESNEI------------NTKQFEDNPGDLPEDATKGD  98



>ref|XP_010027631.1| PREDICTED: probable methyltransferase PMT26 [Eucalyptus grandis]
 gb|KCW54199.1| hypothetical protein EUGRSUZ_I00186 [Eucalyptus grandis]
Length=814

 Score =   127 bits (319),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 66/110 (60%), Positives = 79/110 (72%), Gaps = 1/110 (1%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            MALGKY+RVD R++S +YCSTVTI VFVA+CLVGVWMMTSSSVVPVQN +V SQE+K+++
Sbjct  1    MALGKYTRVDNRRSSSSYCSTVTIAVFVALCLVGVWMMTSSSVVPVQNVDV-SQETKSEV  59

Query  540  KTQVNESNESDTGsnesnnasdesntsdGGKAKQFEDTPGDLPDDATKGD  689
            K QV E+N         N    +          QFED PGDLP+DATKGD
Sbjct  60   KEQVVENNNEVKEQAYENVDEVKEQEKKDSNTSQFEDNPGDLPEDATKGD  109


 Score = 64.3 bits (155),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 31/37 (84%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = +3

Query  1044  SXNEVFPSGAQSELLNETTTQNGAFPTQATESKNERK  1154
             S +EVFPSGAQSELLNETTTQNGAF TQA ESKNE++
Sbjct  234   SPSEVFPSGAQSELLNETTTQNGAFSTQAAESKNEKE  270



>ref|XP_010090820.1| putative methyltransferase PMT26 [Morus notabilis]
 gb|EXB40945.1| putative methyltransferase PMT26 [Morus notabilis]
Length=816

 Score =   127 bits (318),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 72/133 (54%), Positives = 84/133 (63%), Gaps = 40/133 (30%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQN--------SEVS  515
            MALGKY+RVD R++S +YCSTVTI+VFVA+CLVGVWMMTSSSVVPVQN        SEV 
Sbjct  1    MALGKYTRVDNRRSSSSYCSTVTIVVFVALCLVGVWMMTSSSVVPVQNVDVSPENKSEVK  60

Query  516  SQESKTDLKTQV---------------NESNESDTGsnesnnasdesntsdGGKAKQFED  650
            +QESKT++  QV               NESNES+                  G  +QFED
Sbjct  61   AQESKTEVSEQVSENNENNVNNESNAGNESNESNE-----------------GNTRQFED  103

Query  651  TPGDLPDDATKGD  689
             PGDLP+DATKGD
Sbjct  104  NPGDLPEDATKGD  116


 Score = 55.8 bits (133),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 26/34 (76%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +3

Query  1053  EVFPSGAQSELLNETTTQNGAFPTQATESKNERK  1154
             EV+PSGAQSELLNET TQN A+ TQA ESKNE++
Sbjct  238   EVYPSGAQSELLNETATQNSAWKTQAAESKNEKE  271



>ref|XP_008462649.1| PREDICTED: probable methyltransferase PMT26 [Cucumis melo]
Length=822

 Score =   125 bits (314),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 65/110 (59%), Positives = 77/110 (70%), Gaps = 21/110 (19%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            MALGKYSRVD R++S +YCSTVTI+VFVA+CLVG+WM+TSSSVVPVQN +V  QE+K   
Sbjct  1    MALGKYSRVDNRRSSSSYCSTVTIVVFVALCLVGIWMLTSSSVVPVQNIDV-PQENKNLA  59

Query  540  KTQVNESNESDTGsnesnnasdesntsdGGKAKQFEDTPGDLPDDATKGD  689
            K+QV E+NE                    GK + FED PGDLPDDA KGD
Sbjct  60   KSQVIETNE--------------------GKTQPFEDNPGDLPDDARKGD  89


 Score = 57.0 bits (136),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/34 (79%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +3

Query  1053  EVFPSGAQSELLNETTTQNGAFPTQATESKNERK  1154
             E FPSGAQSELLNET+TQNGA+ TQA ESKNE++
Sbjct  245   EEFPSGAQSELLNETSTQNGAWSTQAAESKNEKE  278



>ref|XP_004143348.1| PREDICTED: probable methyltransferase PMT26 [Cucumis sativus]
 gb|KGN48314.1| hypothetical protein Csa_6G476050 [Cucumis sativus]
Length=830

 Score =   125 bits (313),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 65/110 (59%), Positives = 77/110 (70%), Gaps = 21/110 (19%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            MALGKYSRVD R++S +YCSTVTI+VFVA+CLVG+WM+TSSSVVPVQN +V  QE+K   
Sbjct  1    MALGKYSRVDNRRSSSSYCSTVTIVVFVALCLVGIWMLTSSSVVPVQNIDV-PQENKNLA  59

Query  540  KTQVNESNESDTGsnesnnasdesntsdGGKAKQFEDTPGDLPDDATKGD  689
            K+QV E+NE                    GK + FED PGDLPDDA KGD
Sbjct  60   KSQVIETNE--------------------GKTQPFEDNPGDLPDDARKGD  89


 Score = 57.0 bits (136),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/34 (79%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +3

Query  1053  EVFPSGAQSELLNETTTQNGAFPTQATESKNERK  1154
             E FPSGAQSELLNET+TQNGA+ TQA ESKNE++
Sbjct  253   EEFPSGAQSELLNETSTQNGAWSTQAAESKNEKE  286



>ref|XP_002516311.1| ATP binding protein, putative [Ricinus communis]
 gb|EEF46058.1| ATP binding protein, putative [Ricinus communis]
Length=814

 Score =   124 bits (312),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 62/110 (56%), Positives = 78/110 (71%), Gaps = 20/110 (18%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            MALGKY+R+D R+ S NYCSTVTI+VFVA+CLVGVWMMTSSSVVP Q+ +V +Q++K+++
Sbjct  1    MALGKYTRIDTRRQSTNYCSTVTIVVFVALCLVGVWMMTSSSVVPGQSVDVPAQDTKSEV  60

Query  540  KTQVNESNESDTGsnesnnasdesntsdGGKAKQFEDTPGDLPDDATKGD  689
            K +   SNES                      KQFED+PGDLP+DATKGD
Sbjct  61   KEEAPPSNES--------------------SGKQFEDSPGDLPEDATKGD  90


 Score = 57.8 bits (138),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 26/33 (79%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = +3

Query  1053  EVFPSGAQSELLNETTTQNGAFPTQATESKNER  1151
             E+FPSGAQSELLNET TQNG++ TQA ESKNE+
Sbjct  237   EIFPSGAQSELLNETATQNGSWSTQAAESKNEK  269



>ref|XP_004288094.1| PREDICTED: probable methyltransferase PMT26 [Fragaria vesca subsp. 
vesca]
Length=800

 Score =   123 bits (309),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 64/112 (57%), Positives = 83/112 (74%), Gaps = 23/112 (21%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            MA+GKYSRVD R+++ +YCSTVTI+VFVA+CLVGVWMMTSSSVVPVQN +V +QE+K+++
Sbjct  1    MAMGKYSRVDNRRSAASYCSTVTIVVFVALCLVGVWMMTSSSVVPVQNVDV-AQENKSEV  59

Query  540  --KTQVNESNESDTGsnesnnasdesntsdGGKAKQFEDTPGDLPDDATKGD  689
              + QV+E++E                    G +KQFED PGDLP+DATKGD
Sbjct  60   VKEEQVSETSE--------------------GNSKQFEDNPGDLPEDATKGD  91


 Score = 54.3 bits (129),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/37 (70%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = +3

Query  1044  SXNEVFPSGAQSELLNETTTQNGAFPTQATESKNERK  1154
             S  EVFPS AQSELLNETT QNG++ TQ+ ESKNE++
Sbjct  220   SSTEVFPSVAQSELLNETTVQNGSWSTQSAESKNEKE  256



>ref|XP_003602639.1| Ankyrin-like protein [Medicago truncatula]
Length=501

 Score =   120 bits (300),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 66/116 (57%), Positives = 82/116 (71%), Gaps = 28/116 (24%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESK---  530
            MALGKYSRVDGR++S +YCSTVTI+VFVA+ L+GVWMMTSSSVVPVQN +V  QESK   
Sbjct  1    MALGKYSRVDGRRSS-SYCSTVTIVVFVALALIGVWMMTSSSVVPVQNEDV-PQESKSEV  58

Query  531  ---TDLKTQVNESNESDTGsnesnnasdesntsdGGKAKQFEDTPGDLPDDATKGD  689
               T+++ QV+E++ S+                    A+QFED PGDLP+DATKGD
Sbjct  59   KEQTEVREQVSETDNSN--------------------ARQFEDNPGDLPEDATKGD  94


 Score = 63.2 bits (152),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 30/38 (79%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +3

Query  1044  SXNEVFPSGAQSELLNETTTQNGAFPTQATESKNERKL  1157
             S NEVFPSGAQSELLNETTTQ G+F TQA ESKNE+++
Sbjct  211   SSNEVFPSGAQSELLNETTTQTGSFSTQAAESKNEKEI  248



>ref|XP_004502956.1| PREDICTED: probable methyltransferase PMT26-like [Cicer arietinum]
Length=803

 Score =   122 bits (305),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 67/112 (60%), Positives = 83/112 (74%), Gaps = 19/112 (17%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            MA+GKYSRVDGR++S +YCSTVTI+VFVA+CL+GVWMMTSSSVVPV N + +SQESK ++
Sbjct  1    MAVGKYSRVDGRRSSTSYCSTVTIVVFVALCLIGVWMMTSSSVVPVGNGD-ASQESKNEV  59

Query  540  KTQVNESNE--SDTGsnesnnasdesntsdGGKAKQFEDTPGDLPDDATKGD  689
             T+ +E  E  SDT               D G ++QFED PGDLP+DATKGD
Sbjct  60   -TEQSEVKEQVSDT---------------DNGNSRQFEDNPGDLPEDATKGD  95


 Score = 59.3 bits (142),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 28/37 (76%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = +3

Query  1044  SXNEVFPSGAQSELLNETTTQNGAFPTQATESKNERK  1154
             S NEVFPSGAQSELLNE TTQ G++ TQA ESKNE++
Sbjct  223   SSNEVFPSGAQSELLNENTTQTGSWSTQAAESKNEKE  259



>ref|XP_003602638.1| Ankyrin-like protein [Medicago truncatula]
Length=508

 Score =   120 bits (300),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 66/116 (57%), Positives = 82/116 (71%), Gaps = 28/116 (24%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESK---  530
            MALGKYSRVDGR++S +YCSTVTI+VFVA+ L+GVWMMTSSSVVPVQN +V  QESK   
Sbjct  1    MALGKYSRVDGRRSS-SYCSTVTIVVFVALALIGVWMMTSSSVVPVQNEDV-PQESKSEV  58

Query  531  ---TDLKTQVNESNESDTGsnesnnasdesntsdGGKAKQFEDTPGDLPDDATKGD  689
               T+++ QV+E++ S+                    A+QFED PGDLP+DATKGD
Sbjct  59   KEQTEVREQVSETDNSN--------------------ARQFEDNPGDLPEDATKGD  94


 Score = 63.2 bits (152),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 30/38 (79%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +3

Query  1044  SXNEVFPSGAQSELLNETTTQNGAFPTQATESKNERKL  1157
             S NEVFPSGAQSELLNETTTQ G+F TQA ESKNE+++
Sbjct  211   SSNEVFPSGAQSELLNETTTQTGSFSTQAAESKNEKEI  248



>ref|XP_011022921.1| PREDICTED: probable methyltransferase PMT26 [Populus euphratica]
Length=840

 Score =   119 bits (299),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 63/113 (56%), Positives = 78/113 (69%), Gaps = 20/113 (18%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            MALGKYSRVD R+ + +YCSTVTI VFV +CLVGVWMMTSSSVVP Q+ +V +QE+K ++
Sbjct  1    MALGKYSRVDNRRQNSSYCSTVTITVFVGLCLVGVWMMTSSSVVPGQSVDVPAQENKNEV  60

Query  540  KTQVNESNESDTGsnesnnasdesntsdGGKAKQFEDTPGDLPDDATKGDIAT  698
            K QV ESNE +                     KQ ED+PGDLP+DAT+GD +T
Sbjct  61   KQQVPESNEIN--------------------PKQPEDSPGDLPEDATQGDSST  93


 Score = 53.9 bits (128),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/34 (74%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +3

Query  1053  EVFPSGAQSELLNETTTQNGAFPTQATESKNERK  1154
             E+ PSGAQSELLNETTTQ+G++ TQA ESKNE++
Sbjct  263   ELLPSGAQSELLNETTTQSGSWSTQAAESKNEKE  296



>ref|XP_003602637.1| Ankyrin-like protein [Medicago truncatula]
 gb|AES72888.1| methyltransferase PMT26-like protein, putative [Medicago truncatula]
Length=789

 Score =   119 bits (299),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 66/116 (57%), Positives = 82/116 (71%), Gaps = 28/116 (24%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESK---  530
            MALGKYSRVDGR++S +YCSTVTI+VFVA+ L+GVWMMTSSSVVPVQN +V  QESK   
Sbjct  1    MALGKYSRVDGRRSS-SYCSTVTIVVFVALALIGVWMMTSSSVVPVQNEDV-PQESKSEV  58

Query  531  ---TDLKTQVNESNESDTGsnesnnasdesntsdGGKAKQFEDTPGDLPDDATKGD  689
               T+++ QV+E++ S+                    A+QFED PGDLP+DATKGD
Sbjct  59   KEQTEVREQVSETDNSN--------------------ARQFEDNPGDLPEDATKGD  94


 Score = 63.5 bits (153),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 30/38 (79%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +3

Query  1044  SXNEVFPSGAQSELLNETTTQNGAFPTQATESKNERKL  1157
             S NEVFPSGAQSELLNETTTQ G+F TQA ESKNE+++
Sbjct  211   SSNEVFPSGAQSELLNETTTQTGSFSTQAAESKNEKEI  248



>ref|XP_008360714.1| PREDICTED: probable methyltransferase PMT26 [Malus domestica]
Length=840

 Score =   119 bits (298),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 66/111 (59%), Positives = 80/111 (72%), Gaps = 15/111 (14%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPN-YCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTD  536
            MALGKY+RVD R+ S N YCSTVTI+VFVA+CL  VWMMTSSSVVPVQN +V  QE+K+D
Sbjct  1    MALGKYTRVDSRRPSSNGYCSTVTIVVFVALCLAAVWMMTSSSVVPVQNVDV-PQENKSD  59

Query  537  LKTQVNESNESDTGsnesnnasdesntsdGGKAKQFEDTPGDLPDDATKGD  689
            L    NE + +D G  E  + +++         +QFED PGDLPDDATKGD
Sbjct  60   L----NEQDSNDVGVKEQVSDTND---------RQFEDNPGDLPDDATKGD  97


 Score = 57.8 bits (138),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 28/37 (76%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = +3

Query  1044  SXNEVFPSGAQSELLNETTTQNGAFPTQATESKNERK  1154
             S NEVFPS AQSELLNETTTQNG++ TQ  ESKNE++
Sbjct  260   SSNEVFPSIAQSELLNETTTQNGSWSTQLAESKNEKE  296



>ref|XP_007214544.1| hypothetical protein PRUPE_ppa001471mg [Prunus persica]
 gb|EMJ15743.1| hypothetical protein PRUPE_ppa001471mg [Prunus persica]
Length=819

 Score =   117 bits (294),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 65/120 (54%), Positives = 81/120 (68%), Gaps = 30/120 (25%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPN-YCSTVTIIVFVAVCLVGVWMMTSSSVVPVQN--------SEV  512
            MA GKY+RVD R++S + YCSTVTI+VFVA+CLVGVWMMTSSSVVPVQN        SE+
Sbjct  1    MATGKYTRVDNRRSSASSYCSTVTIVVFVALCLVGVWMMTSSSVVPVQNVDVPQEKKSEL  60

Query  513  SSQE-SKTDLKTQVNESNESDTGsnesnnasdesntsdGGKAKQFEDTPGDLPDDATKGD  689
            + Q+ +K D+K QV+++NE                    G  +QFED PGDLP+DATKGD
Sbjct  61   NEQDNNKVDVKEQVSDTNE--------------------GTTRQFEDNPGDLPEDATKGD  100


 Score = 56.6 bits (135),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 27/37 (73%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = +3

Query  1044  SXNEVFPSGAQSELLNETTTQNGAFPTQATESKNERK  1154
             S NEVFPS AQSELLNET TQNG++ TQ+ ESKNE++
Sbjct  239   SSNEVFPSVAQSELLNETATQNGSWSTQSAESKNEKE  275



>ref|XP_002309924.1| dehydration-responsive family protein [Populus trichocarpa]
 gb|EEE90374.1| dehydration-responsive family protein [Populus trichocarpa]
Length=824

 Score =   117 bits (293),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 61/110 (55%), Positives = 75/110 (68%), Gaps = 20/110 (18%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            MALGKYSRVD R+ + +YCSTVTI VFV +CLVGVWMMTSSSVVP Q+ +  +QE+K ++
Sbjct  1    MALGKYSRVDNRRQNSSYCSTVTITVFVGLCLVGVWMMTSSSVVPGQSVDAPAQENKNEV  60

Query  540  KTQVNESNESDTGsnesnnasdesntsdGGKAKQFEDTPGDLPDDATKGD  689
            K QV ESNE +                     KQ ED+PGDLP+DAT+GD
Sbjct  61   KQQVPESNEIN--------------------PKQPEDSPGDLPEDATQGD  90


 Score = 54.7 bits (130),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/37 (70%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = +3

Query  1044  SXNEVFPSGAQSELLNETTTQNGAFPTQATESKNERK  1154
             S  E+ PSGAQSELLNETTTQ+G++ TQA ESKNE++
Sbjct  244   SSGELLPSGAQSELLNETTTQSGSWSTQAAESKNEKE  280



>ref|XP_008227415.1| PREDICTED: probable methyltransferase PMT26 [Prunus mume]
Length=819

 Score =   117 bits (293),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 65/120 (54%), Positives = 81/120 (68%), Gaps = 30/120 (25%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPN-YCSTVTIIVFVAVCLVGVWMMTSSSVVPVQN--------SEV  512
            MA GKY+RVD R++S + YCSTVTI+VFVA+CLVGVWMMTSSSVVPVQN        SE+
Sbjct  1    MATGKYTRVDNRRSSASSYCSTVTIVVFVALCLVGVWMMTSSSVVPVQNVDVPQEKKSEL  60

Query  513  SSQE-SKTDLKTQVNESNESDTGsnesnnasdesntsdGGKAKQFEDTPGDLPDDATKGD  689
            + Q+ +K D+K QV+++NE                    G  +QFED PGDLP+DATKGD
Sbjct  61   NEQDNNKVDVKEQVSDNNE--------------------GTTRQFEDNPGDLPEDATKGD  100


 Score = 58.5 bits (140),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 28/37 (76%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
 Frame = +3

Query  1044  SXNEVFPSGAQSELLNETTTQNGAFPTQATESKNERK  1154
             S NEVFPS AQSELLNET TQNG++ TQ+TESKNE++
Sbjct  239   SSNEVFPSVAQSELLNETATQNGSWSTQSTESKNEKE  275



>ref|XP_007048444.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein [Theobroma cacao]
 gb|EOX92601.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein [Theobroma cacao]
Length=815

 Score =   117 bits (293),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 61/114 (54%), Positives = 73/114 (64%), Gaps = 18/114 (16%)
 Frame = +3

Query  360  MALGKYSRVDG---RKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESK  530
            MALGKYSRVD    R +S  YCSTVTI+VFV +CLVG+WMMTSSSVVP+QN + ++QE K
Sbjct  1    MALGKYSRVDNNGRRSSSSTYCSTVTIVVFVGLCLVGIWMMTSSSVVPLQNGDDTAQEKK  60

Query  531  TDLKTQVNESNESDTGsnesnnasdesntsdGGKAKQFEDTPGDLPDDATKGDI  692
             ++K QV    +   G               G    QFED PGDLP+DATKGD 
Sbjct  61   NEVKDQVTPVIDESNG---------------GSNTAQFEDNPGDLPEDATKGDF  99


 Score = 61.2 bits (147),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 29/37 (78%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = +3

Query  1044  SXNEVFPSGAQSELLNETTTQNGAFPTQATESKNERK  1154
             S NEVFPSGAQSELLNE   QNG+F TQATESKNE++
Sbjct  237   SSNEVFPSGAQSELLNENMAQNGSFSTQATESKNEKE  273



>ref|XP_011078779.1| PREDICTED: probable methyltransferase PMT26 [Sesamum indicum]
Length=817

 Score =   117 bits (293),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 65/113 (58%), Positives = 79/113 (70%), Gaps = 4/113 (4%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            MALGKYSRVDGR+ S  YCSTV+I+V VA+CLVGVWMMTSSS VP QNS+V SQE+   +
Sbjct  1    MALGKYSRVDGRRTSSGYCSTVSIVVVVALCLVGVWMMTSSSTVPGQNSDV-SQENNNGV  59

Query  540  KTQVNESNESDTGsnesnnasdesntsdG---GKAKQFEDTPGDLPDDATKGD  689
            K  V ESN+ +   + +       + +     G  KQFED PGDLP+DATKGD
Sbjct  60   KAHVAESNDQNNNDSNNERNKGAVDENHSSEEGNLKQFEDNPGDLPEDATKGD  112


 Score = 59.7 bits (143),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 28/34 (82%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = +3

Query  1053  EVFPSGAQSELLNETTTQNGAFPTQATESKNERK  1154
             EVFPSGAQSELLNE+TT+NGAF TQATESK E++
Sbjct  238   EVFPSGAQSELLNESTTENGAFSTQATESKKEKE  271



>ref|XP_007137790.1| hypothetical protein PHAVU_009G155600g [Phaseolus vulgaris]
 gb|ESW09784.1| hypothetical protein PHAVU_009G155600g [Phaseolus vulgaris]
Length=818

 Score =   115 bits (287),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 59/110 (54%), Positives = 77/110 (70%), Gaps = 15/110 (14%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            MALGKY+RVDGR++S ++CSTVT++VFVA+CLVGVWMMTSSSVVPV N +  +QE+K ++
Sbjct  1    MALGKYTRVDGRRSS-SWCSTVTVVVFVALCLVGVWMMTSSSVVPVNNGD-EAQETKNEV  58

Query  540  KTQVNESNESDTGsnesnnasdesntsdGGKAKQFEDTPGDLPDDATKGD  689
            K Q +   E+             +        +QFED PGDLP+DATKGD
Sbjct  59   KEQTDIKEEA-------------AIEIGNSNTRQFEDNPGDLPEDATKGD  95



>ref|XP_003526869.1| PREDICTED: probable methyltransferase PMT26-like isoform X1 [Glycine 
max]
 ref|XP_006581774.1| PREDICTED: probable methyltransferase PMT26-like isoform X2 [Glycine 
max]
Length=806

 Score =   113 bits (282),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 58/110 (53%), Positives = 76/110 (69%), Gaps = 13/110 (12%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            MALGKY+RVDGR++S ++CSTVT++VFVA+CLVGVWMMTSSSVVPV+N +  +QE+K  +
Sbjct  1    MALGKYARVDGRRSS-SWCSTVTVVVFVALCLVGVWMMTSSSVVPVRNGD-EAQENKNQV  58

Query  540  KTQVNESNESDTGsnesnnasdesntsdGGKAKQFEDTPGDLPDDATKGD  689
            K Q   +   +             +       +QFED PGDLP+DATKGD
Sbjct  59   KEQTEPTEVKEA-----------VSEVSNSNMRQFEDNPGDLPEDATKGD  97



>gb|KHN09623.1| Putative methyltransferase PMT26 [Glycine soja]
Length=806

 Score =   113 bits (282),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 58/110 (53%), Positives = 76/110 (69%), Gaps = 13/110 (12%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            MALGKY+RVDGR++S ++CSTVT++VFVA+CLVGVWMMTSSSVVPV+N +  +QE+K  +
Sbjct  1    MALGKYARVDGRRSS-SWCSTVTVVVFVALCLVGVWMMTSSSVVPVRNGD-EAQENKNQV  58

Query  540  KTQVNESNESDTGsnesnnasdesntsdGGKAKQFEDTPGDLPDDATKGD  689
            K Q   +   +             +       +QFED PGDLP+DATKGD
Sbjct  59   KEQTEPTEVKEA-----------VSEVSNSNMRQFEDNPGDLPEDATKGD  97



>ref|XP_003523221.1| PREDICTED: probable methyltransferase PMT26-like isoform X1 [Glycine 
max]
 ref|XP_006578784.1| PREDICTED: probable methyltransferase PMT26-like isoform X2 [Glycine 
max]
 gb|KHN31166.1| Putative methyltransferase PMT26 [Glycine soja]
Length=810

 Score =   112 bits (280),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 61/116 (53%), Positives = 80/116 (69%), Gaps = 28/116 (24%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            MALGKY+RVDGR++S ++CSTVT+++FVA+CLVGVWMMTSSSVVPV+N +  +QE+K  +
Sbjct  1    MALGKYARVDGRRSS-SWCSTVTVVMFVALCLVGVWMMTSSSVVPVRNGD-EAQENKNQV  58

Query  540  KTQ------VNESNESDTGsnesnnasdesntsdGGKAKQFEDTPGDLPDDATKGD  689
            K Q      V+E + S+T                    +QFED PGDLP+DATKGD
Sbjct  59   KEQAEVKEAVSEVSNSNT--------------------RQFEDNPGDLPEDATKGD  94



>ref|XP_012078344.1| PREDICTED: probable methyltransferase PMT24 [Jatropha curcas]
 gb|KDP32896.1| hypothetical protein JCGZ_12188 [Jatropha curcas]
Length=813

 Score =   111 bits (278),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 58/108 (54%), Positives = 72/108 (67%), Gaps = 24/108 (22%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            MA+GKYSRVDGRK+S +YCST+ ++VFVA CLVGVWM+ SSSVVP+QNS+ SSQE   D+
Sbjct  1    MAMGKYSRVDGRKSS-SYCSTIMVVVFVAFCLVGVWMLMSSSVVPIQNSDSSSQEPVNDV  59

Query  540  KTQVNESNESDTGsnesnnasdesntsdGGKAKQFEDTPGDLPDDATK  683
            K  V ESN                       +KQFED+ GDLP++A K
Sbjct  60   KQTVIESN-----------------------SKQFEDSSGDLPEEAMK  84


 Score = 55.8 bits (133),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 25/34 (74%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +3

Query  1053  EVFPSGAQSELLNETTTQNGAFPTQATESKNERK  1154
             EVFP+G+QSELLNET +QNGA+ TQA ES+NE+K
Sbjct  235   EVFPAGSQSELLNETDSQNGAWSTQAVESQNEKK  268



>ref|XP_002307464.2| hypothetical protein POPTR_0005s20670g [Populus trichocarpa]
 gb|EEE94460.2| hypothetical protein POPTR_0005s20670g [Populus trichocarpa]
Length=826

 Score =   110 bits (275),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 60/110 (55%), Positives = 72/110 (65%), Gaps = 25/110 (23%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            MA+GKYSRVDG+K+S NYCST+T++VFVA+CLVG WM  SSS V VQNS+ SSQE   D+
Sbjct  1    MAMGKYSRVDGKKSS-NYCSTITVVVFVALCLVGAWMFMSSS-VSVQNSDSSSQEKVNDV  58

Query  540  KTQVNESNESDTGsnesnnasdesntsdGGKAKQFEDTPGDLPDDATKGD  689
            K    E+N                       +KQFED+PGDLPDDATK D
Sbjct  59   KRVAGENN-----------------------SKQFEDSPGDLPDDATKED  85



>gb|KDO51661.1| hypothetical protein CISIN_1g003776mg [Citrus sinensis]
Length=595

 Score =   109 bits (272),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 61/112 (54%), Positives = 75/112 (67%), Gaps = 22/112 (20%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMT---SSSVVPVQNSEVSSQESK  530
            MA GKY+RVDGR+++ +YCSTVTI VFVA+CLVGVWMMT   SSSVVPVQN +  +QE K
Sbjct  1    MANGKYTRVDGRRSASSYCSTVTITVFVALCLVGVWMMTSSSSSSVVPVQNVDEPAQEKK  60

Query  531  TDLKTQVNESNESDTGsnesnnasdesntsdGGKAKQFEDTPGDLPDDATKG  686
            ++ K Q+ ESNES +                    +QFED   DLP+DATKG
Sbjct  61   SEAKEQLTESNESSSN-------------------QQFEDNNADLPEDATKG  93


 Score = 58.2 bits (139),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 28/37 (76%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = +3

Query  1044  SXNEVFPSGAQSELLNETTTQNGAFPTQATESKNERK  1154
             S NE+FPSGAQ EL NETTTQ G+F TQATESKNE++
Sbjct  216   SSNELFPSGAQLELTNETTTQKGSFSTQATESKNEKE  252



>ref|XP_009355841.1| PREDICTED: probable methyltransferase PMT26 [Pyrus x bretschneideri]
 ref|XP_009355842.1| PREDICTED: probable methyltransferase PMT26 [Pyrus x bretschneideri]
Length=820

 Score =   109 bits (273),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 60/114 (53%), Positives = 75/114 (66%), Gaps = 25/114 (22%)
 Frame = +3

Query  369  GKYSRVDGRKASPN--YCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDLK  542
            GKY+RVD R+ S     CSTVT++VFVA+CLVGVWMMTSSSVVP+QN +V ++E+K++LK
Sbjct  5    GKYTRVDNRRPSSGSGCCSTVTVVVFVALCLVGVWMMTSSSVVPIQNVDVPTEENKSELK  64

Query  543  TQVN-----ESNESDTGsnesnnasdesntsdGGKAKQFEDTPGDLPDDATKGD  689
             Q +     +   SDT                   A+QFED PGDLPDDATKGD
Sbjct  65   EQGSNNVGVKEQASDTN------------------ARQFEDNPGDLPDDATKGD  100


 Score = 55.8 bits (133),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 27/37 (73%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = +3

Query  1044  SXNEVFPSGAQSELLNETTTQNGAFPTQATESKNERK  1154
             S NEVFPS AQSELLNETTTQN ++ TQ+ ESKNE++
Sbjct  240   SSNEVFPSVAQSELLNETTTQNSSWSTQSAESKNEKE  276



>ref|XP_007019267.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein [Theobroma cacao]
 gb|EOY16492.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein [Theobroma cacao]
Length=837

 Score =   109 bits (272),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 59/110 (54%), Positives = 72/110 (65%), Gaps = 24/110 (22%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            MAL KYSRVDGRK+S +YCST TI+VFVA CLVG+WM  SSSVVPVQNSE+SSQE+  ++
Sbjct  1    MALAKYSRVDGRKSS-SYCSTATIVVFVAFCLVGIWMFMSSSVVPVQNSELSSQETTNEV  59

Query  540  KTQVNESNESDTGsnesnnasdesntsdGGKAKQFEDTPGDLPDDATKGD  689
            K  V +S                        +KQF+DT GDLP+ AT+ D
Sbjct  60   KPTVPKS-----------------------VSKQFDDTSGDLPEGATRED  86


 Score = 54.3 bits (129),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/37 (65%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = +3

Query  1044  SXNEVFPSGAQSELLNETTTQNGAFPTQATESKNERK  1154
             + NE+ P+GAQSE+L E+TTQNGA+ TQA ES+NE+K
Sbjct  257   ASNEMLPAGAQSEILTESTTQNGAWSTQAVESQNEKK  293



>gb|KDO51659.1| hypothetical protein CISIN_1g003776mg [Citrus sinensis]
 gb|KDO51660.1| hypothetical protein CISIN_1g003776mg [Citrus sinensis]
Length=796

 Score =   108 bits (271),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 61/112 (54%), Positives = 75/112 (67%), Gaps = 22/112 (20%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMT---SSSVVPVQNSEVSSQESK  530
            MA GKY+RVDGR+++ +YCSTVTI VFVA+CLVGVWMMT   SSSVVPVQN +  +QE K
Sbjct  1    MANGKYTRVDGRRSASSYCSTVTITVFVALCLVGVWMMTSSSSSSVVPVQNVDEPAQEKK  60

Query  531  TDLKTQVNESNESDTGsnesnnasdesntsdGGKAKQFEDTPGDLPDDATKG  686
            ++ K Q+ ESNES +                    +QFED   DLP+DATKG
Sbjct  61   SEAKEQLTESNESSSN-------------------QQFEDNNADLPEDATKG  93


 Score = 58.5 bits (140),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 28/37 (76%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = +3

Query  1044  SXNEVFPSGAQSELLNETTTQNGAFPTQATESKNERK  1154
             S NE+FPSGAQ EL NETTTQ G+F TQATESKNE++
Sbjct  216   SSNELFPSGAQLELTNETTTQKGSFSTQATESKNEKE  252



>ref|XP_010270331.1| PREDICTED: probable methyltransferase PMT26 isoform X1 [Nelumbo 
nucifera]
Length=808

 Score =   108 bits (270),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 61/113 (54%), Positives = 76/113 (67%), Gaps = 24/113 (21%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            MA GK +R D R++S +YCSTVTIIVFVA+CLVGVWMMTSSSVVPVQ  + SSQ++ T++
Sbjct  1    MAFGKNARADSRRSSSSYCSTVTIIVFVALCLVGVWMMTSSSVVPVQRVDTSSQDTNTEV  60

Query  540  KTQVNESNESDTGsnesnnasdesntsdGGKAKQFEDTPGDLPDDATKGDIAT  698
            K QV ES                        ++QFED+PGDLP+DA KGD +T
Sbjct  61   K-QVTESG-----------------------SRQFEDSPGDLPEDAMKGDSST  89


 Score = 58.2 bits (139),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 26/34 (76%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = +3

Query  1050  NEVFPSGAQSELLNETTTQNGAFPTQATESKNER  1151
             +EVFP+G+QSE+LNETTT+NGAF TQA ESKNE+
Sbjct  231   SEVFPAGSQSEILNETTTENGAFSTQAVESKNEK  264



>ref|XP_010270332.1| PREDICTED: probable methyltransferase PMT26 isoform X2 [Nelumbo 
nucifera]
Length=807

 Score =   108 bits (269),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 61/113 (54%), Positives = 76/113 (67%), Gaps = 24/113 (21%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            MA GK +R D R++S +YCSTVTIIVFVA+CLVGVWMMTSSSVVPVQ  + SSQ++ T++
Sbjct  1    MAFGKNARADSRRSSSSYCSTVTIIVFVALCLVGVWMMTSSSVVPVQRVDTSSQDTNTEV  60

Query  540  KTQVNESNESDTGsnesnnasdesntsdGGKAKQFEDTPGDLPDDATKGDIAT  698
            K QV ES                        ++QFED+PGDLP+DA KGD +T
Sbjct  61   K-QVTESG-----------------------SRQFEDSPGDLPEDAMKGDSST  89


 Score = 58.2 bits (139),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 26/34 (76%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = +3

Query  1050  NEVFPSGAQSELLNETTTQNGAFPTQATESKNER  1151
             +EVFP+G+QSE+LNETTT+NGAF TQA ESKNE+
Sbjct  231   SEVFPAGSQSEILNETTTENGAFSTQAVESKNEK  264



>ref|XP_006432154.1| hypothetical protein CICLE_v10000328mg [Citrus clementina]
 ref|XP_006465082.1| PREDICTED: probable methyltransferase PMT26-like [Citrus sinensis]
 gb|ESR45394.1| hypothetical protein CICLE_v10000328mg [Citrus clementina]
Length=796

 Score =   108 bits (269),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 61/112 (54%), Positives = 75/112 (67%), Gaps = 22/112 (20%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMT---SSSVVPVQNSEVSSQESK  530
            MA GKY+RVDGR+++ +YCSTVTI VFVA+CLVGVWMMT   SSSVVPVQN +  +QE K
Sbjct  1    MANGKYTRVDGRRSASSYCSTVTITVFVALCLVGVWMMTSSSSSSVVPVQNVDEPAQEKK  60

Query  531  TDLKTQVNESNESDTGsnesnnasdesntsdGGKAKQFEDTPGDLPDDATKG  686
            ++ K Q+ ESNES +                    +QFED   DLP+DATKG
Sbjct  61   SEAKEQLPESNESSSN-------------------QQFEDNNADLPEDATKG  93


 Score = 58.5 bits (140),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 28/37 (76%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = +3

Query  1044  SXNEVFPSGAQSELLNETTTQNGAFPTQATESKNERK  1154
             S NE+FPSGAQ EL NETTTQ G+F TQATESKNE++
Sbjct  216   SSNELFPSGAQLELTNETTTQKGSFSTQATESKNEKE  252



>ref|XP_008394173.1| PREDICTED: probable methyltransferase PMT26 isoform X1 [Malus 
domestica]
 ref|XP_008394174.1| PREDICTED: probable methyltransferase PMT26 isoform X1 [Malus 
domestica]
Length=820

 Score =   108 bits (269),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 61/114 (54%), Positives = 74/114 (65%), Gaps = 25/114 (22%)
 Frame = +3

Query  369  GKYSRVDGRKASP--NYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDLK  542
            GKY+RVD R+ S     CSTVT+ VFVA+CLVGVWMMTSSSVVP+QN +V ++ESK++LK
Sbjct  5    GKYTRVDNRRPSSASGCCSTVTVGVFVALCLVGVWMMTSSSVVPIQNVDVPTEESKSELK  64

Query  543  TQVN-----ESNESDTGsnesnnasdesntsdGGKAKQFEDTPGDLPDDATKGD  689
             Q +     +   SDT                   A+QFED PGDLPDDATKGD
Sbjct  65   EQGSNNVGVKEQASDTN------------------ARQFEDNPGDLPDDATKGD  100


 Score = 55.8 bits (133),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 27/37 (73%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = +3

Query  1044  SXNEVFPSGAQSELLNETTTQNGAFPTQATESKNERK  1154
             S NEVFPS AQSELLNETTTQN ++ TQ+ ESKNE++
Sbjct  240   SSNEVFPSVAQSELLNETTTQNSSWSTQSAESKNEKE  276



>ref|XP_008394175.1| PREDICTED: probable methyltransferase PMT26 isoform X2 [Malus 
domestica]
Length=807

 Score =   108 bits (269),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 61/114 (54%), Positives = 74/114 (65%), Gaps = 25/114 (22%)
 Frame = +3

Query  369  GKYSRVDGRKASP--NYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDLK  542
            GKY+RVD R+ S     CSTVT+ VFVA+CLVGVWMMTSSSVVP+QN +V ++ESK++LK
Sbjct  5    GKYTRVDNRRPSSASGCCSTVTVGVFVALCLVGVWMMTSSSVVPIQNVDVPTEESKSELK  64

Query  543  TQVN-----ESNESDTGsnesnnasdesntsdGGKAKQFEDTPGDLPDDATKGD  689
             Q +     +   SDT                   A+QFED PGDLPDDATKGD
Sbjct  65   EQGSNNVGVKEQASDTN------------------ARQFEDNPGDLPDDATKGD  100


 Score = 55.8 bits (133),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 27/37 (73%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = +3

Query  1044  SXNEVFPSGAQSELLNETTTQNGAFPTQATESKNERK  1154
             S NEVFPS AQSELLNETTTQN ++ TQ+ ESKNE++
Sbjct  227   SSNEVFPSVAQSELLNETTTQNSSWSTQSAESKNEKE  263



>ref|XP_002306259.2| dehydration-responsive family protein [Populus trichocarpa]
 gb|EEE93255.2| dehydration-responsive family protein [Populus trichocarpa]
Length=796

 Score =   106 bits (264),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 49/72 (68%), Positives = 60/72 (83%), Gaps = 0/72 (0%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            MALGKYSRVD R+ + +YCSTVTI+VFV +CLVG WMMTSSSVVP QN +V +QE+K ++
Sbjct  1    MALGKYSRVDNRRHNSSYCSTVTIVVFVGLCLVGAWMMTSSSVVPGQNVDVPAQENKNEV  60

Query  540  KTQVNESNESDT  575
            K QV ESNE +T
Sbjct  61   KQQVTESNEINT  72



>emb|CDP04655.1| unnamed protein product [Coffea canephora]
Length=766

 Score =   105 bits (263),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 60/110 (55%), Positives = 69/110 (63%), Gaps = 33/110 (30%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            MALGKYSRVDGRK+S NYCSTVTI+VFVA+CLVGVWMMTSSS     N  V+S+ S    
Sbjct  1    MALGKYSRVDGRKSSTNYCSTVTIVVFVALCLVGVWMMTSSS-----NKNVNSESS----  51

Query  540  KTQVNESNESDTGsnesnnasdesntsdGGKAKQFEDTPGDLPDDATKGD  689
                ++ NE+                    K  QFED PGDLP+DATKGD
Sbjct  52   ----SKGNEN--------------------KPNQFEDNPGDLPEDATKGD  77


 Score = 61.6 bits (148),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 29/34 (85%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = +3

Query  1053  EVFPSGAQSELLNETTTQNGAFPTQATESKNERK  1154
             EVFPSGAQSELLNETTTQNG+F TQA ESKNE++
Sbjct  187   EVFPSGAQSELLNETTTQNGSFSTQAAESKNEKE  220



>gb|KJB48928.1| hypothetical protein B456_008G094300 [Gossypium raimondii]
Length=688

 Score =   103 bits (257),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 59/118 (50%), Positives = 72/118 (61%), Gaps = 25/118 (21%)
 Frame = +3

Query  360  MALGKYSRVDG------RKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQ  521
            MALGKYSRVD       RK+S +YCSTVTI+VFV +CLVG+WM+TSSSVVPVQ    S++
Sbjct  1    MALGKYSRVDNNNNNNNRKSSSSYCSTVTIVVFVGLCLVGIWMLTSSSVVPVQTGNGSAE  60

Query  522  ESKTDLKTQVN--ESNESDTGsnesnnasdesntsdGGKAKQFEDTPGDLPDDATKGD  689
            E K  ++ QV    S+ +D+                      FED  GDLPDDATKGD
Sbjct  61   EKKNQVEDQVTPVSSDNNDS-----------------SNTSDFEDNRGDLPDDATKGD  101


 Score = 58.9 bits (141),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 29/37 (78%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = +3

Query  1044  SXNEVFPSGAQSELLNETTTQNGAFPTQATESKNERK  1154
             S NEVFPSGAQSELLNET TQ G+F TQATESK E++
Sbjct  236   SSNEVFPSGAQSELLNETVTQTGSFSTQATESKVEKE  272



>gb|KJB48927.1| hypothetical protein B456_008G094300 [Gossypium raimondii]
 gb|KJB48929.1| hypothetical protein B456_008G094300 [Gossypium raimondii]
 gb|KJB48930.1| hypothetical protein B456_008G094300 [Gossypium raimondii]
Length=813

 Score =   103 bits (257),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 59/118 (50%), Positives = 72/118 (61%), Gaps = 25/118 (21%)
 Frame = +3

Query  360  MALGKYSRVDG------RKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQ  521
            MALGKYSRVD       RK+S +YCSTVTI+VFV +CLVG+WM+TSSSVVPVQ    S++
Sbjct  1    MALGKYSRVDNNNNNNNRKSSSSYCSTVTIVVFVGLCLVGIWMLTSSSVVPVQTGNGSAE  60

Query  522  ESKTDLKTQVN--ESNESDTGsnesnnasdesntsdGGKAKQFEDTPGDLPDDATKGD  689
            E K  ++ QV    S+ +D+                      FED  GDLPDDATKGD
Sbjct  61   EKKNQVEDQVTPVSSDNNDS-----------------SNTSDFEDNRGDLPDDATKGD  101


 Score = 59.3 bits (142),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 29/37 (78%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = +3

Query  1044  SXNEVFPSGAQSELLNETTTQNGAFPTQATESKNERK  1154
             S NEVFPSGAQSELLNET TQ G+F TQATESK E++
Sbjct  236   SSNEVFPSGAQSELLNETVTQTGSFSTQATESKVEKE  272



>gb|KJB29131.1| hypothetical protein B456_005G086100 [Gossypium raimondii]
Length=589

 Score =   103 bits (256),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 52/108 (48%), Positives = 70/108 (65%), Gaps = 24/108 (22%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            MA+ KYSRVDGRK+S +YCST  I+VFVA CLVG+WM  SSSVVP++NS++SSQE++ + 
Sbjct  1    MAMAKYSRVDGRKSS-SYCSTAVIVVFVAFCLVGIWMFMSSSVVPLENSDLSSQETRNEA  59

Query  540  KTQVNESNESDTGsnesnnasdesntsdGGKAKQFEDTPGDLPDDATK  683
            K  + E                       G +KQF+DT GD+ +DAT+
Sbjct  60   KQTLQE-----------------------GVSKQFDDTSGDISEDATR  84


 Score = 52.0 bits (123),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +3

Query  1050  NEVFPSGAQSELLNETTTQNGAFPTQATESKNERKL  1157
             NE+ P+ AQSE+L E+TTQNGA+ TQA ES+NE+K 
Sbjct  242   NEILPTAAQSEILTESTTQNGAWSTQAEESQNEKKW  277



>ref|XP_010277710.1| PREDICTED: probable methyltransferase PMT24 [Nelumbo nucifera]
Length=866

 Score =   103 bits (257),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 54/110 (49%), Positives = 70/110 (64%), Gaps = 25/110 (23%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            MA GK +RVD R++S  YCSTVT++ FVA+CLVGVWMM SS+VVPVQN ++SS E+  ++
Sbjct  1    MAFGKNARVDSRRSSSTYCSTVTLVAFVALCLVGVWMMASSNVVPVQNIDMSSSETNNEV  60

Query  540  KTQVNESNESDTGsnesnnasdesntsdGGKAKQFEDTPGDLPDDATKGD  689
            K QV ES                        + QFED+PGDLP+D+ K D
Sbjct  61   K-QVTES------------------------SAQFEDSPGDLPEDSVKRD  85


 Score = 61.6 bits (148),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 28/35 (80%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +3

Query  1050  NEVFPSGAQSELLNETTTQNGAFPTQATESKNERK  1154
             NEVFP+G+QSE+LNETTTQNGAF TQA ESKNE++
Sbjct  289   NEVFPAGSQSEILNETTTQNGAFSTQALESKNEKE  323



>ref|XP_011006302.1| PREDICTED: probable methyltransferase PMT24 isoform X1 [Populus 
euphratica]
Length=826

 Score =   103 bits (256),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 57/110 (52%), Positives = 69/110 (63%), Gaps = 25/110 (23%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            MA+GKYSRVDG+KAS NYCST++++VFVA+CLVG WM  SSS V VQNS+ SSQE   D+
Sbjct  1    MAMGKYSRVDGKKAS-NYCSTISVVVFVALCLVGAWMFMSSS-VSVQNSDSSSQEKVNDV  58

Query  540  KTQVNESNESDTGsnesnnasdesntsdGGKAKQFEDTPGDLPDDATKGD  689
                 E+N                       +KQFED+ GDLPDDA K D
Sbjct  59   NRVAGENN-----------------------SKQFEDSAGDLPDDAIKED  85



>ref|XP_011006303.1| PREDICTED: probable methyltransferase PMT24 isoform X2 [Populus 
euphratica]
Length=812

 Score =   103 bits (256),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 57/110 (52%), Positives = 69/110 (63%), Gaps = 25/110 (23%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            MA+GKYSRVDG+KAS NYCST++++VFVA+CLVG WM  SSS V VQNS+ SSQE   D+
Sbjct  1    MAMGKYSRVDGKKAS-NYCSTISVVVFVALCLVGAWMFMSSS-VSVQNSDSSSQEKVNDV  58

Query  540  KTQVNESNESDTGsnesnnasdesntsdGGKAKQFEDTPGDLPDDATKGD  689
                 E+N                       +KQFED+ GDLPDDA K D
Sbjct  59   NRVAGENN-----------------------SKQFEDSAGDLPDDAIKED  85



>ref|XP_012070600.1| PREDICTED: probable methyltransferase PMT26 [Jatropha curcas]
 gb|KDP39437.1| hypothetical protein JCGZ_03719 [Jatropha curcas]
Length=850

 Score =   103 bits (256),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 58/110 (53%), Positives = 75/110 (68%), Gaps = 20/110 (18%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            MA GKY+R+D R+   NYC+TVT++VFVA+C VGVWMMTSSS+VP Q+ +V +QE+  ++
Sbjct  1    MATGKYTRIDARRQPTNYCTTVTVVVFVALCFVGVWMMTSSSIVPGQSVDVPAQENNNEV  60

Query  540  KTQVNESNESDTGsnesnnasdesntsdGGKAKQFEDTPGDLPDDATKGD  689
            K QV ES ES+T                    KQFED+PGDLP+D TKGD
Sbjct  61   KEQVTESKESNT--------------------KQFEDSPGDLPEDETKGD  90


 Score = 57.8 bits (138),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 27/35 (77%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +3

Query  1053  EVFPSGAQSELLNETTTQNGAFPTQATESKNERKL  1157
             EVFPSGAQSELLNETTTQ+G++ TQA ESKNE+++
Sbjct  272   EVFPSGAQSELLNETTTQSGSWSTQAAESKNEKEV  306



>gb|KJB29129.1| hypothetical protein B456_005G086100 [Gossypium raimondii]
Length=686

 Score =   102 bits (255),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 52/108 (48%), Positives = 70/108 (65%), Gaps = 24/108 (22%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            MA+ KYSRVDGRK+S +YCST  I+VFVA CLVG+WM  SSSVVP++NS++SSQE++ + 
Sbjct  1    MAMAKYSRVDGRKSS-SYCSTAVIVVFVAFCLVGIWMFMSSSVVPLENSDLSSQETRNEA  59

Query  540  KTQVNESNESDTGsnesnnasdesntsdGGKAKQFEDTPGDLPDDATK  683
            K  + E                       G +KQF+DT GD+ +DAT+
Sbjct  60   KQTLQE-----------------------GVSKQFDDTSGDISEDATR  84


 Score = 52.4 bits (124),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +3

Query  1050  NEVFPSGAQSELLNETTTQNGAFPTQATESKNERKL  1157
             NE+ P+ AQSE+L E+TTQNGA+ TQA ES+NE+K 
Sbjct  242   NEILPTAAQSEILTESTTQNGAWSTQAEESQNEKKW  277



>ref|XP_002285889.2| PREDICTED: probable methyltransferase PMT24 [Vitis vinifera]
 ref|XP_010664148.1| PREDICTED: probable methyltransferase PMT24 [Vitis vinifera]
Length=844

 Score =   102 bits (255),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 49/110 (45%), Positives = 73/110 (66%), Gaps = 24/110 (22%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            MA+GKYSRVDGR++S NYCST+ I+VFV VCLVGVWMM SSS+VP+QNS++ S ++  ++
Sbjct  1    MAMGKYSRVDGRRSS-NYCSTIAIVVFVGVCLVGVWMMMSSSIVPIQNSDLVSDDTPHEV  59

Query  540  KTQVNESNESDTGsnesnnasdesntsdGGKAKQFEDTPGDLPDDATKGD  689
            + ++++++ +                       QFED+ G+ P DA KG+
Sbjct  60   QKKIDDNDST-----------------------QFEDSSGNFPLDAAKGE  86


 Score = 53.5 bits (127),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/37 (65%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = +3

Query  1044  SXNEVFPSGAQSELLNETTTQNGAFPTQATESKNERK  1154
             + NEVFP+GAQSE+LNE+ T NGA+ TQ  ESKNE++
Sbjct  263   ASNEVFPAGAQSEILNESNTGNGAWSTQMVESKNEKE  299



>gb|KJB29128.1| hypothetical protein B456_005G086100 [Gossypium raimondii]
 gb|KJB29132.1| hypothetical protein B456_005G086100 [Gossypium raimondii]
Length=821

 Score =   102 bits (255),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 52/108 (48%), Positives = 70/108 (65%), Gaps = 24/108 (22%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            MA+ KYSRVDGRK+S +YCST  I+VFVA CLVG+WM  SSSVVP++NS++SSQE++ + 
Sbjct  1    MAMAKYSRVDGRKSS-SYCSTAVIVVFVAFCLVGIWMFMSSSVVPLENSDLSSQETRNEA  59

Query  540  KTQVNESNESDTGsnesnnasdesntsdGGKAKQFEDTPGDLPDDATK  683
            K  + E                       G +KQF+DT GD+ +DAT+
Sbjct  60   KQTLQE-----------------------GVSKQFDDTSGDISEDATR  84


 Score = 52.8 bits (125),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +3

Query  1050  NEVFPSGAQSELLNETTTQNGAFPTQATESKNERKL  1157
             NE+ P+ AQSE+L E+TTQNGA+ TQA ES+NE+K 
Sbjct  242   NEILPTAAQSEILTESTTQNGAWSTQAEESQNEKKW  277



>gb|KHG21530.1| hypothetical protein F383_05601 [Gossypium arboreum]
Length=810

 Score =   102 bits (255),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 52/108 (48%), Positives = 70/108 (65%), Gaps = 24/108 (22%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            MA+ KYSRVDGRK+S +YCST  I+VFVA CLVG+WM  SSSVVP++NS++SSQE++ + 
Sbjct  1    MAMAKYSRVDGRKSS-SYCSTAVIVVFVAFCLVGIWMFMSSSVVPLENSDLSSQETRNEA  59

Query  540  KTQVNESNESDTGsnesnnasdesntsdGGKAKQFEDTPGDLPDDATK  683
            K  + E                       G +KQF+DT GD+ +DAT+
Sbjct  60   KQTLQE-----------------------GVSKQFDDTSGDISEDATR  84



>gb|KJB29130.1| hypothetical protein B456_005G086100 [Gossypium raimondii]
Length=858

 Score =   102 bits (254),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 52/108 (48%), Positives = 70/108 (65%), Gaps = 24/108 (22%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            MA+ KYSRVDGRK+S +YCST  I+VFVA CLVG+WM  SSSVVP++NS++SSQE++ + 
Sbjct  1    MAMAKYSRVDGRKSS-SYCSTAVIVVFVAFCLVGIWMFMSSSVVPLENSDLSSQETRNEA  59

Query  540  KTQVNESNESDTGsnesnnasdesntsdGGKAKQFEDTPGDLPDDATK  683
            K  + E                       G +KQF+DT GD+ +DAT+
Sbjct  60   KQTLQE-----------------------GVSKQFDDTSGDISEDATR  84


 Score = 52.8 bits (125),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +3

Query  1050  NEVFPSGAQSELLNETTTQNGAFPTQATESKNERKL  1157
             NE+ P+ AQSE+L E+TTQNGA+ TQA ES+NE+K 
Sbjct  242   NEILPTAAQSEILTESTTQNGAWSTQAEESQNEKKW  277



>ref|XP_002520274.1| ATP binding protein, putative [Ricinus communis]
 gb|EEF42060.1| ATP binding protein, putative [Ricinus communis]
Length=802

 Score =   100 bits (250),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 54/110 (49%), Positives = 71/110 (65%), Gaps = 24/110 (22%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            MA+GKYSRVDGRK+S +Y ST+ ++VFVA+CLVGVWM+ SS+V PVQNS   SQE+  ++
Sbjct  1    MAMGKYSRVDGRKSS-SYFSTIAVVVFVALCLVGVWMLMSSTVAPVQNSNSPSQETVNEV  59

Query  540  KTQVNESNESDTGsnesnnasdesntsdGGKAKQFEDTPGDLPDDATKGD  689
            K   +E+                        +KQFED+ GDLP+DATK D
Sbjct  60   KQTGSENT-----------------------SKQFEDSSGDLPEDATKED  86


 Score = 55.5 bits (132),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 25/34 (74%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +3

Query  1053  EVFPSGAQSELLNETTTQNGAFPTQATESKNERK  1154
             EVFP+G+QSELLNET  QNGA+ TQA ES+NE+K
Sbjct  224   EVFPAGSQSELLNETDAQNGAWSTQAVESQNEKK  257



>ref|XP_004503920.1| PREDICTED: probable methyltransferase PMT26-like isoform X1 [Cicer 
arietinum]
 ref|XP_004503921.1| PREDICTED: probable methyltransferase PMT26-like isoform X2 [Cicer 
arietinum]
Length=819

 Score =   100 bits (249),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 55/108 (51%), Positives = 75/108 (69%), Gaps = 15/108 (14%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            MA  KY+R+D +++  +YCSTVTI+VFVA+CLVG+WMMTSSSVVPVQN +  SQE+K+++
Sbjct  1    MAQAKYTRIDNKRSPSSYCSTVTIVVFVALCLVGLWMMTSSSVVPVQNVD-ESQETKSEV  59

Query  540  KTQVNESNESDTGsnesnnasdesntsdGGKAKQFEDTPGDLPDDATK  683
            K    ES+E            +++  +    A+QFED  GDL DDATK
Sbjct  60   K----ESSE----------VVEQATDTTNTNARQFEDKQGDLSDDATK  93


 Score = 55.1 bits (131),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/35 (74%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +3

Query  1050  NEVFPSGAQSELLNETTTQNGAFPTQATESKNERK  1154
             NEVFPS  Q+ELLNETTTQ G+F TQA ESKNE++
Sbjct  241   NEVFPSVGQTELLNETTTQTGSFSTQAAESKNEKE  275



>ref|XP_010674444.1| PREDICTED: probable methyltransferase PMT26 [Beta vulgaris subsp. 
vulgaris]
Length=811

 Score =   100 bits (249),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 56/111 (50%), Positives = 76/111 (68%), Gaps = 12/111 (11%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMT-SSSVVPVQNSEVSSQESKTD  536
            MALG+Y+RVDG+K+S NYCSTVT++VFVA+CLVGVWMMT SSS  P Q+ ++  ++ KT+
Sbjct  1    MALGRYTRVDGKKSS-NYCSTVTVVVFVALCLVGVWMMTSSSSDSPPQDIDLPQEKQKTE  59

Query  537  LKTQVNESNESDTGsnesnnasdesntsdGGKAKQFEDTPGDLPDDATKGD  689
            +K  V    + D   + + +             +QFED PGDLP+DATKGD
Sbjct  60   VKPDVVTEVKPDVAKDINESP----------PTQQFEDNPGDLPEDATKGD  100


 Score = 53.1 bits (126),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 24/34 (71%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = +3

Query  1053  EVFPSGAQSELLNETTTQNGAFPTQATESKNERK  1154
             EVFPSGAQS+LLNE+  QNG+F TQA ES NE++
Sbjct  235   EVFPSGAQSDLLNESAIQNGSFSTQAAESNNEKE  268



>ref|XP_006580338.1| PREDICTED: probable methyltransferase PMT26-like isoform X1 [Glycine 
max]
 ref|XP_006580339.1| PREDICTED: probable methyltransferase PMT26-like isoform X2 [Glycine 
max]
Length=831

 Score = 99.8 bits (247),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 52/110 (47%), Positives = 70/110 (64%), Gaps = 21/110 (19%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            MA  KY+R+D  K   +YCSTVTI+VFVA+CL G+WMMTSSSV PVQN +V SQE+ +++
Sbjct  1    MAQAKYTRIDNNKRPSSYCSTVTIVVFVALCLFGIWMMTSSSVTPVQNVDV-SQENNSEV  59

Query  540  KTQVNESNESDTGsnesnnasdesntsdGGKAKQFEDTPGDLPDDATKGD  689
            K Q  + + +++                    +QFED  GDL +DATKGD
Sbjct  60   KEQATDPSNNNS--------------------QQFEDNRGDLSEDATKGD  89


 Score = 57.8 bits (138),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 27/35 (77%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = +3

Query  1050  NEVFPSGAQSELLNETTTQNGAFPTQATESKNERK  1154
             NEV+PS AQSELLNE+TTQNG+F TQA ESKNE++
Sbjct  255   NEVYPSVAQSELLNESTTQNGSFTTQAAESKNEKE  289



>gb|KHN34092.1| Putative methyltransferase PMT26 [Glycine soja]
Length=849

 Score = 99.8 bits (247),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 52/110 (47%), Positives = 70/110 (64%), Gaps = 21/110 (19%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            MA  KY+R+D  K   +YCSTVTI+VFVA+CL G+WMMTSSSV PVQN +V SQE+ +++
Sbjct  1    MAQAKYTRIDNNKRPSSYCSTVTIVVFVALCLFGIWMMTSSSVTPVQNVDV-SQENNSEV  59

Query  540  KTQVNESNESDTGsnesnnasdesntsdGGKAKQFEDTPGDLPDDATKGD  689
            K Q  + + +++                    +QFED  GDL +DATKGD
Sbjct  60   KEQATDPSNNNS--------------------QQFEDNRGDLSEDATKGD  89


 Score = 57.8 bits (138),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 27/35 (77%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = +3

Query  1050  NEVFPSGAQSELLNETTTQNGAFPTQATESKNERK  1154
             NEV+PS AQSELLNE+TTQNG+F TQA ESKNE++
Sbjct  273   NEVYPSVAQSELLNESTTQNGSFTTQAAESKNEKE  307



>ref|XP_002300957.2| hypothetical protein POPTR_0002s07640g [Populus trichocarpa]
 gb|ABK94843.1| unknown [Populus trichocarpa]
 gb|EEE80230.2| hypothetical protein POPTR_0002s07640g [Populus trichocarpa]
Length=817

 Score = 99.0 bits (245),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 57/110 (52%), Positives = 68/110 (62%), Gaps = 28/110 (25%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            M +GKYSRVDGRK+S NYCST T++VFVA+CLVG WM  SSSV PVQNS+ SSQE   ++
Sbjct  1    MPMGKYSRVDGRKSS-NYCSTTTVVVFVALCLVGAWMFISSSV-PVQNSDPSSQE---NV  55

Query  540  KTQVNESNESDTGsnesnnasdesntsdGGKAKQFEDTPGDLPDDATKGD  689
            K    E+                        +K FED PGDLP+DATK D
Sbjct  56   KRVAGEN-----------------------ISKHFEDIPGDLPEDATKED  82



>dbj|BAC43570.1| putative ankyrin [Arabidopsis thaliana]
Length=202

 Score = 94.0 bits (232),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 47/110 (43%), Positives = 65/110 (59%), Gaps = 19/110 (17%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            MA  +Y+R+D R+ S NYCSTVT++VFVA+CLVG+WMMTSSSV P QN +  S ++K  +
Sbjct  1    MAQPRYTRIDNRRPSSNYCSTVTVVVFVALCLVGIWMMTSSSVGPAQNVDEVSLDNKDGI  60

Query  540  KTQVNESNESDTGsnesnnasdesntsdGGKAKQFEDTPGDLPDDATKGD  689
            K Q+    E                    G  ++FED P + P++  KGD
Sbjct  61   KKQMTPPAEE-------------------GNGQKFEDAPVETPNEDKKGD  91



>ref|XP_006584650.1| PREDICTED: probable methyltransferase PMT26-like isoform X1 [Glycine 
max]
 ref|XP_006584651.1| PREDICTED: probable methyltransferase PMT26-like isoform X2 [Glycine 
max]
 ref|XP_006584652.1| PREDICTED: probable methyltransferase PMT26-like isoform X3 [Glycine 
max]
Length=842

 Score = 98.2 bits (243),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 55/111 (50%), Positives = 70/111 (63%), Gaps = 16/111 (14%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPN-YCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTD  536
            MA  KY+R+D     P+ YCSTVTI+VFVA+CL G+WMMTSSSV PVQN +V SQE+  +
Sbjct  1    MAQAKYTRIDNNNKRPSSYCSTVTIVVFVALCLFGIWMMTSSSVTPVQNVDV-SQENNNE  59

Query  537  LKTQVNESNESDTGsnesnnasdesntsdGGKAKQFEDTPGDLPDDATKGD  689
            +K Q +E+ E  T                   ++QFED  GDL +DATKGD
Sbjct  60   VKEQ-SEAKEQPTD-------------PSNNNSQQFEDNRGDLSEDATKGD  96


 Score = 57.8 bits (138),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 27/35 (77%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = +3

Query  1050  NEVFPSGAQSELLNETTTQNGAFPTQATESKNERK  1154
             NEV+PS AQSELLNE+TTQNG+F TQA ESKNE++
Sbjct  266   NEVYPSVAQSELLNESTTQNGSFTTQAAESKNEKE  300



>gb|KDO83500.1| hypothetical protein CISIN_1g015557mg [Citrus sinensis]
Length=404

 Score = 94.0 bits (232),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 42/66 (64%), Positives = 58/66 (88%), Gaps = 1/66 (2%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            MA+GKYSRVDGRK+S  YCSTVT++VFV +CLVGVWM+ SS+VVPV++ E+SS E+ +++
Sbjct  1    MAMGKYSRVDGRKSS-GYCSTVTVVVFVGLCLVGVWMLMSSTVVPVRDPELSSGEAISEV  59

Query  540  KTQVNE  557
            K +V+E
Sbjct  60   KQRVSE  65



>ref|XP_002864883.1| hypothetical protein ARALYDRAFT_496597 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH41142.1| hypothetical protein ARALYDRAFT_496597 [Arabidopsis lyrata subsp. 
lyrata]
Length=821

 Score = 95.1 bits (235),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 48/110 (44%), Positives = 65/110 (59%), Gaps = 19/110 (17%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            MA  +Y+R+D R+ S NYCSTVT++VFVA+CLVG+WMMTSSSV P QN +  S ++K  +
Sbjct  1    MAQPRYTRIDNRRPSSNYCSTVTVVVFVALCLVGIWMMTSSSVGPAQNVDEVSLDNKDGI  60

Query  540  KTQVNESNESDTGsnesnnasdesntsdGGKAKQFEDTPGDLPDDATKGD  689
            K Q+    E                    G  ++FED  GD P++  KGD
Sbjct  61   KKQMTPPTEE-------------------GNGQKFEDASGDTPNEDKKGD  91



>ref|XP_007159858.1| hypothetical protein PHAVU_002G273700g [Phaseolus vulgaris]
 gb|ESW31852.1| hypothetical protein PHAVU_002G273700g [Phaseolus vulgaris]
Length=832

 Score = 94.7 bits (234),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 55/111 (50%), Positives = 72/111 (65%), Gaps = 10/111 (9%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPN-YCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTD  536
            MA  KYSR+D  K S + Y STVTI+VFVA+CL G+WMMTSSSVVPVQN +V SQ++K +
Sbjct  1    MAQAKYSRIDNNKRSASSYFSTVTIVVFVALCLFGIWMMTSSSVVPVQNVDV-SQDNKNE  59

Query  537  LKTQVNESNESDTGsnesnnasdesntsdGGKAKQFEDTPGDLPDDATKGD  689
            ++ Q        +G  E +    ++       ++QFED  GDL DDA KGD
Sbjct  60   VQDQ--------SGVIEQSEGKKQATDPSNKSSQQFEDNQGDLSDDAAKGD  102



>ref|XP_010546331.1| PREDICTED: probable methyltransferase PMT26 [Tarenaya hassleriana]
Length=838

 Score = 94.7 bits (234),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 47/104 (45%), Positives = 66/104 (63%), Gaps = 19/104 (18%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            MA G+YSR+D R++S +YCSTVT++VFVA+CLVG+WMMTSSSV PV+N +  S E+K  +
Sbjct  1    MAQGRYSRIDNRRSSSSYCSTVTVVVFVALCLVGIWMMTSSSVGPVENVDEVSLENKDGM  60

Query  540  KTQVNESNESDTGsnesnnasdesntsdGGKAKQFEDTPGDLPD  671
            K Q+N   +                    G ++ +ED  GDLP+
Sbjct  61   KKQLNPPTDD-------------------GGSQAYEDKNGDLPN  85



>ref|XP_006434319.1| hypothetical protein CICLE_v10000311mg [Citrus clementina]
 ref|XP_006434320.1| hypothetical protein CICLE_v10000311mg [Citrus clementina]
 gb|ESR47559.1| hypothetical protein CICLE_v10000311mg [Citrus clementina]
 gb|ESR47560.1| hypothetical protein CICLE_v10000311mg [Citrus clementina]
Length=581

 Score = 93.6 bits (231),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 42/66 (64%), Positives = 58/66 (88%), Gaps = 1/66 (2%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            MA+GKYSRVDGRK+S  YCSTVT++VFV +CLVGVWM+ SS+VVPV++ E+SS E+ +++
Sbjct  1    MAMGKYSRVDGRKSS-GYCSTVTVVVFVGLCLVGVWMLMSSTVVPVRDPELSSGEAISEV  59

Query  540  KTQVNE  557
            K +V+E
Sbjct  60   KQRVSE  65



>ref|XP_006472883.1| PREDICTED: probable methyltransferase PMT25-like [Citrus sinensis]
Length=808

 Score = 93.2 bits (230),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 42/66 (64%), Positives = 58/66 (88%), Gaps = 1/66 (2%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            MA+GKYSRVDGRK+S  YCSTVT++VFV +CLVGVWM+ SS+VVPV++ E+SS E+ +++
Sbjct  1    MAMGKYSRVDGRKSS-GYCSTVTVVVFVGLCLVGVWMLMSSTVVPVRDPELSSGEAISEV  59

Query  540  KTQVNE  557
            K +V+E
Sbjct  60   KQRVSE  65



>ref|XP_006434317.1| hypothetical protein CICLE_v10000311mg [Citrus clementina]
 ref|XP_006434318.1| hypothetical protein CICLE_v10000311mg [Citrus clementina]
 gb|ESR47557.1| hypothetical protein CICLE_v10000311mg [Citrus clementina]
 gb|ESR47558.1| hypothetical protein CICLE_v10000311mg [Citrus clementina]
Length=808

 Score = 93.2 bits (230),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 42/66 (64%), Positives = 58/66 (88%), Gaps = 1/66 (2%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            MA+GKYSRVDGRK+S  YCSTVT++VFV +CLVGVWM+ SS+VVPV++ E+SS E+ +++
Sbjct  1    MAMGKYSRVDGRKSS-GYCSTVTVVVFVGLCLVGVWMLMSSTVVPVRDPELSSGEAISEV  59

Query  540  KTQVNE  557
            K +V+E
Sbjct  60   KQRVSE  65



>ref|NP_201208.2| putative methyltransferase PMT26 [Arabidopsis thaliana]
 sp|Q8L7V3.1|PMTQ_ARATH RecName: Full=Probable methyltransferase PMT26 [Arabidopsis thaliana]
 gb|AAM78114.1| AT5g64030/MBM17_13 [Arabidopsis thaliana]
 gb|AAO23578.1| At5g64030/MBM17_13 [Arabidopsis thaliana]
 gb|AED97831.1| putative methyltransferase PMT26 [Arabidopsis thaliana]
Length=829

 Score = 92.8 bits (229),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 47/110 (43%), Positives = 65/110 (59%), Gaps = 19/110 (17%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            MA  +Y+R+D R+ S NYCSTVT++VFVA+CLVG+WMMTSSSV P QN +  S ++K  +
Sbjct  1    MAQPRYTRIDNRRPSSNYCSTVTVVVFVALCLVGIWMMTSSSVGPAQNVDEVSLDNKDGI  60

Query  540  KTQVNESNESDTGsnesnnasdesntsdGGKAKQFEDTPGDLPDDATKGD  689
            K Q+    E                    G  ++FED P + P++  KGD
Sbjct  61   KKQMTPPAEE-------------------GNGQKFEDAPVETPNEDKKGD  91



>dbj|BAB10271.1| ankyrin-like protein [Arabidopsis thaliana]
Length=786

 Score = 92.8 bits (229),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 47/110 (43%), Positives = 65/110 (59%), Gaps = 19/110 (17%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            MA  +Y+R+D R+ S NYCSTVT++VFVA+CLVG+WMMTSSSV P QN +  S ++K  +
Sbjct  1    MAQPRYTRIDNRRPSSNYCSTVTVVVFVALCLVGIWMMTSSSVGPAQNVDEVSLDNKDGI  60

Query  540  KTQVNESNESDTGsnesnnasdesntsdGGKAKQFEDTPGDLPDDATKGD  689
            K Q+    E                    G  ++FED P + P++  KGD
Sbjct  61   KKQMTPPAEE-------------------GNGQKFEDAPVETPNEDKKGD  91



>gb|KHG06416.1| hypothetical protein F383_32222 [Gossypium arboreum]
Length=820

 Score = 91.7 bits (226),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 56/122 (46%), Positives = 67/122 (55%), Gaps = 35/122 (29%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPN----YCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQES  527
            MALGKYSRVD    +      YCSTVTI+VFV +CLVG+WM+TSSSVVPV+    S++E 
Sbjct  1    MALGKYSRVDNNNNNRKSSSSYCSTVTIVVFVGLCLVGIWMLTSSSVVPVETGNGSAEEK  60

Query  528  KTDLKTQV--------NESNESDTGsnesnnasdesntsdGGKAKQFEDTPGDLPDDATK  683
            K  ++ QV        + SN SD                       FED  GDL DDATK
Sbjct  61   KNQVEDQVTPVTSDNNDSSNTSD-----------------------FEDNRGDLLDDATK  97

Query  684  GD  689
            GD
Sbjct  98   GD  99


 Score = 59.3 bits (142),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 29/37 (78%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = +3

Query  1044  SXNEVFPSGAQSELLNETTTQNGAFPTQATESKNERK  1154
             S NEVFPSGAQSELLNET TQ G+F TQATESK E++
Sbjct  243   SSNEVFPSGAQSELLNETVTQTGSFSTQATESKIEKE  279



>gb|KJB59346.1| hypothetical protein B456_009G250600 [Gossypium raimondii]
 gb|KJB59347.1| hypothetical protein B456_009G250600 [Gossypium raimondii]
Length=833

 Score = 90.9 bits (224),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 50/110 (45%), Positives = 65/110 (59%), Gaps = 24/110 (22%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            MA GKYSRVDGRK+S +YCS  TI+VFV  CLVG+WM  SSS+VPV+NSE  S E+  ++
Sbjct  1    MATGKYSRVDGRKSS-SYCSLATIVVFVIFCLVGIWMFMSSSIVPVKNSEFLSVETGNEV  59

Query  540  KTQVNESNESDTGsnesnnasdesntsdGGKAKQFEDTPGDLPDDATKGD  689
            K  ++ S+                       +KQF+DT GDL    T+ D
Sbjct  60   KQTLSRSD-----------------------SKQFDDTSGDLSGAETRED  86


 Score = 54.3 bits (129),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/35 (69%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +3

Query  1044  SXNEVFPSGAQSELLNETTTQNGAFPTQATESKNE  1148
             + NE+ P+GAQSE+L ETTTQNGA+ TQA ES+NE
Sbjct  253   ASNEILPAGAQSEILTETTTQNGAWSTQAVESQNE  287



>ref|XP_006394213.1| hypothetical protein EUTSA_v10003654mg [Eutrema salsugineum]
 gb|ESQ31499.1| hypothetical protein EUTSA_v10003654mg [Eutrema salsugineum]
Length=831

 Score = 89.7 bits (221),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 46/110 (42%), Positives = 64/110 (58%), Gaps = 19/110 (17%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            MA  +Y+R+D R+ S NYCSTVT++VFVA+CLVG+WMMTSSSV P QN +V S ++K  +
Sbjct  1    MAQPRYTRIDNRRPSSNYCSTVTVVVFVALCLVGIWMMTSSSVGPAQNVDVVSLDNKDGI  60

Query  540  KTQVNESNESDTGsnesnnasdesntsdGGKAKQFEDTPGDLPDDATKGD  689
            K Q +   E                    G  ++FED   + P+   KG+
Sbjct  61   KKQSSPPAEE-------------------GNGQKFEDASSETPNQEKKGN  91



>gb|KHG22120.1| hypothetical protein F383_28461 [Gossypium arboreum]
Length=834

 Score = 89.0 bits (219),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 48/108 (44%), Positives = 64/108 (59%), Gaps = 24/108 (22%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            MA GKYSRVDGRK+S +YCS  TI+VF+  CLVG+WM  SSS+VPV+NSE  S E+  ++
Sbjct  1    MATGKYSRVDGRKSS-SYCSIATIVVFLIFCLVGIWMFMSSSIVPVKNSEFLSMETGNEM  59

Query  540  KTQVNESNESDTGsnesnnasdesntsdGGKAKQFEDTPGDLPDDATK  683
            K  +++S                        +KQF+DT GDL    T+
Sbjct  60   KQTLSKS-----------------------VSKQFDDTSGDLSGAETR  84


 Score = 56.6 bits (135),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 25/37 (68%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = +3

Query  1044  SXNEVFPSGAQSELLNETTTQNGAFPTQATESKNERK  1154
             + NE+ P+GAQSE+L ETTTQNGA+ TQA ES+NE+K
Sbjct  253   ASNEILPAGAQSEILTETTTQNGAWSTQAVESQNEKK  289



>gb|KJB71369.1| hypothetical protein B456_011G118900 [Gossypium raimondii]
Length=1015

 Score = 88.6 bits (218),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 58/119 (49%), Positives = 70/119 (59%), Gaps = 26/119 (22%)
 Frame = +3

Query  360  MALGKYSRVD-------GRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSS  518
            MALGKY RVD        R +S +Y STVTI+VFV +CLVG+WMMTSSSV+P QN +  +
Sbjct  1    MALGKYGRVDYNNNANGRRSSSSSYGSTVTIVVFVGLCLVGIWMMTSSSVIPDQNVDDVA  60

Query  519  QESKTDLKTQVNE--SNESDTGsnesnnasdesntsdGGKAKQFEDTPGDLPDDATKGD  689
             E KTDL  QV    SN +D+ +                   QFED PG LP+DA KGD
Sbjct  61   HEKKTDLDDQVTPVISNSNDSNNIV-----------------QFEDNPGVLPEDARKGD  102



>ref|XP_010521110.1| PREDICTED: probable methyltransferase PMT26 [Tarenaya hassleriana]
 ref|XP_010521118.1| PREDICTED: probable methyltransferase PMT26 [Tarenaya hassleriana]
Length=861

 Score = 88.6 bits (218),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 40/65 (62%), Positives = 51/65 (78%), Gaps = 0/65 (0%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            MA G+YSR+D R+ S +YCSTVT++VFVA+CLVGVWMMTSSS  P QN +  S E+K  +
Sbjct  1    MAQGRYSRIDNRRPSSSYCSTVTVVVFVALCLVGVWMMTSSSDGPSQNVDEVSLENKDGM  60

Query  540  KTQVN  554
            K Q+N
Sbjct  61   KKQLN  65



>gb|KJB40479.1| hypothetical protein B456_007G066000 [Gossypium raimondii]
Length=899

 Score = 88.6 bits (218),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 49/116 (42%), Positives = 66/116 (57%), Gaps = 24/116 (21%)
 Frame = +3

Query  360  MALGKYSRVDGRK-ASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTD  536
            MALG+Y+RVD     S +YCSTVTI++F+ +CLVG+WM+TSS VVPVQN +  ++E K  
Sbjct  1    MALGRYNRVDNNNNKSSSYCSTVTIVIFMGLCLVGIWMITSSWVVPVQNGDDPAEEKKNQ  60

Query  537  LKTQVN----ESNESDTGsnesnnasdesntsdGGKAKQFEDTPGDLPDDATKGDI  692
            LK QV     +SN+ D                      QFED P DL  D  + ++
Sbjct  61   LKDQVETVIVDSNDRDN-------------------KPQFEDKPNDLRKDGPEKNL  97


 Score = 53.1 bits (126),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 26/36 (72%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +3

Query  1044  SXNEVFPSGAQSELLNETTTQNGAFPTQATESKNER  1151
             S NEVFPS AQSELLNET  QNG+F TQA ES  E+
Sbjct  317   SSNEVFPSVAQSELLNETMIQNGSFTTQAAESNKEK  352



>ref|XP_003630288.1| Ankyrin-like protein [Medicago truncatula]
 gb|AET04764.1| methyltransferase PMT26-like protein, putative [Medicago truncatula]
Length=826

 Score = 88.2 bits (217),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 50/116 (43%), Positives = 64/116 (55%), Gaps = 30/116 (26%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQN------SEVSSQ  521
            MA  +YSR+D +++  +YCSTVTI+VFVA+CLVG+WMMT SSVVPVQN      +EV  Q
Sbjct  1    MAQARYSRIDNKRSPSSYCSTVTIVVFVALCLVGLWMMT-SSVVPVQNVDESTKNEVKGQ  59

Query  522  ESKTDLKTQVNESNESDTGsnesnnasdesntsdGGKAKQFEDTPGDLPDDATKGD  689
                D  T +  SN                        + FED  GDLP ++TK D
Sbjct  60   SEAKDQATDITNSN-----------------------PQNFEDKKGDLPQESTKED  92


 Score = 54.7 bits (130),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/33 (79%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = +3

Query  1050  NEVFPSGAQSELLNETTTQNGAFPTQATESKNE  1148
             NE+ PSGAQSELLNETTTQ G+F TQA ESK+E
Sbjct  241   NELLPSGAQSELLNETTTQTGSFSTQAAESKSE  273



>ref|XP_006281931.1| hypothetical protein CARUB_v10028139mg [Capsella rubella]
 gb|EOA14829.1| hypothetical protein CARUB_v10028139mg [Capsella rubella]
Length=817

 Score = 88.2 bits (217),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 45/110 (41%), Positives = 64/110 (58%), Gaps = 19/110 (17%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            MA  +Y+R+D R+ S NYCSTVT++VFVA+CLVG+WMMTSSSV P QN +  S ++K  +
Sbjct  1    MAQPRYTRIDNRRPSSNYCSTVTVVVFVALCLVGIWMMTSSSVGPAQNVDEVSLDNKDGI  60

Query  540  KTQVNESNESDTGsnesnnasdesntsdGGKAKQFEDTPGDLPDDATKGD  689
            K Q+    E                    G  ++F+   G+ P++  KGD
Sbjct  61   KKQMTPPAED-------------------GNGQKFDGASGETPNEDKKGD  91



>ref|XP_007199628.1| hypothetical protein PRUPE_ppa001750mg [Prunus persica]
 gb|EMJ00827.1| hypothetical protein PRUPE_ppa001750mg [Prunus persica]
Length=771

 Score = 88.2 bits (217),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 49/110 (45%), Positives = 66/110 (60%), Gaps = 24/110 (22%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            MA+GKYSRVDGR+ S N CST +++VFVA CLVGVWM+  S+VVP+QN + SS+E+  ++
Sbjct  1    MAVGKYSRVDGRR-SLNCCSTTSLVVFVAFCLVGVWMLM-STVVPIQNQDSSSEETVNEV  58

Query  540  KTQVNESNESDTGsnesnnasdesntsdGGKAKQFEDTPGDLPDDATKGD  689
            K Q     +S                      KQFED+ G+LP+   K D
Sbjct  59   KWQTTTDKDS----------------------KQFEDSSGELPETVIKRD  86



>gb|KHG04009.1| hypothetical protein F383_29196 [Gossypium arboreum]
Length=770

 Score = 86.7 bits (213),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 49/116 (42%), Positives = 65/116 (56%), Gaps = 24/116 (21%)
 Frame = +3

Query  360  MALGKYSRVDGRK-ASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTD  536
            MALG+Y+RVD     S +YCSTVTI++F+ +CLVG+WM+TSS VVPVQN +  ++E K  
Sbjct  1    MALGRYNRVDNNNNKSSSYCSTVTIVIFMGLCLVGIWMITSSWVVPVQNGDDPAEEKKNQ  60

Query  537  LKTQVN----ESNESDTGsnesnnasdesntsdGGKAKQFEDTPGDLPDDATKGDI  692
            LK QV     +SN+ D                      QFED   DL  D  + D+
Sbjct  61   LKDQVETVIVDSNDRDN-------------------KPQFEDKRNDLHKDGLEKDL  97


 Score = 52.0 bits (123),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 25/36 (69%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +3

Query  1044  SXNEVFPSGAQSELLNETTTQNGAFPTQATESKNER  1151
             S NEVFPS AQSELLNET   NG+F TQA ES  E+
Sbjct  207   SSNEVFPSVAQSELLNETMIHNGSFTTQAAESNKEK  242



>ref|XP_008244575.1| PREDICTED: probable methyltransferase PMT24 [Prunus mume]
Length=815

 Score = 86.3 bits (212),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 48/110 (44%), Positives = 65/110 (59%), Gaps = 24/110 (22%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            MA+GKYSRVDGR+ S N CST +++VFVA CLVGVWM+  S+VVP+QN + SS+E+  ++
Sbjct  1    MAVGKYSRVDGRR-SLNCCSTTSLVVFVAFCLVGVWMLM-STVVPIQNQDSSSEETVNEV  58

Query  540  KTQVNESNESDTGsnesnnasdesntsdGGKAKQFEDTPGDLPDDATKGD  689
            K Q     +                       KQFED+ G+LP+   K D
Sbjct  59   KRQTTTDKD----------------------PKQFEDSSGELPETVIKRD  86



>ref|XP_006847154.2| PREDICTED: probable methyltransferase PMT26 [Amborella trichopoda]
 ref|XP_011624369.1| PREDICTED: probable methyltransferase PMT26 [Amborella trichopoda]
Length=851

 Score = 85.9 bits (211),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 54/112 (48%), Positives = 66/112 (59%), Gaps = 20/112 (18%)
 Frame = +3

Query  360  MALGKYSR--VDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKT  533
            MALGK  R  VD R +S +YCSTVT++VFV +CLVGVWMMTSS+V PVQ   +S     T
Sbjct  2    MALGKNPRGGVDRRSSSSSYCSTVTLVVFVGLCLVGVWMMTSSAVGPVQRVNLSP----T  57

Query  534  DLKTQVNESNESDTGsnesnnasdesntsdGGKAKQFEDTPGDLPDDATKGD  689
            D + ++ E  E D                     + FEDTPGDLPDDA +GD
Sbjct  58   DPEPKITE-QEKD-------------QRVAASDTQTFEDTPGDLPDDAIQGD  95



>gb|ERN08735.1| hypothetical protein AMTR_s00017p00240980 [Amborella trichopoda]
Length=850

 Score = 85.9 bits (211),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 54/112 (48%), Positives = 66/112 (59%), Gaps = 20/112 (18%)
 Frame = +3

Query  360  MALGKYSR--VDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKT  533
            MALGK  R  VD R +S +YCSTVT++VFV +CLVGVWMMTSS+V PVQ   +S     T
Sbjct  1    MALGKNPRGGVDRRSSSSSYCSTVTLVVFVGLCLVGVWMMTSSAVGPVQRVNLSP----T  56

Query  534  DLKTQVNESNESDTGsnesnnasdesntsdGGKAKQFEDTPGDLPDDATKGD  689
            D + ++ E  E D                     + FEDTPGDLPDDA +GD
Sbjct  57   DPEPKITE-QEKD-------------QRVAASDTQTFEDTPGDLPDDAIQGD  94



>ref|XP_010461320.1| PREDICTED: probable methyltransferase PMT26 [Camelina sativa]
Length=819

 Score = 85.9 bits (211),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 44/110 (40%), Positives = 67/110 (61%), Gaps = 16/110 (15%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            MA  +Y+R+D R+ S NYCSTVT++VFVA+CLVG+WMMTSSSV P Q+ +  S ++K  +
Sbjct  1    MAQPRYTRIDNRRPSSNYCSTVTVVVFVALCLVGIWMMTSSSVGPAQSVDEVSLDNKDGI  60

Query  540  KTQVNESNESDTGsnesnnasdesntsdGGKAKQFEDTPGDLPDDATKGD  689
            K Q+     ++                +G   ++ ED+ G+ P++  KGD
Sbjct  61   KKQMTPPPPAE----------------EGNNGQKSEDSSGETPNEDKKGD  94


 Score = 52.8 bits (125),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 25/31 (81%), Positives = 28/31 (90%), Gaps = 0/31 (0%)
 Frame = +3

Query  1062  PSGAQSELLNETTTQNGAFPTQATESKNERK  1154
             P GAQ ELLNETTTQNG+F TQATESKNE++
Sbjct  245   PPGAQLELLNETTTQNGSFSTQATESKNEKE  275



>ref|XP_010444329.1| PREDICTED: probable methyltransferase PMT26 [Camelina sativa]
Length=822

 Score = 85.5 bits (210),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 45/110 (41%), Positives = 64/110 (58%), Gaps = 17/110 (15%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            MA  +Y+R+D R+ S NYCSTVT++VFVA+CLVG+WMMTSSSV P Q+ E  S ++K  +
Sbjct  1    MAQPRYTRIDNRRPSSNYCSTVTVVVFVALCLVGIWMMTSSSVGPAQSVEEVSLDNKDVI  60

Query  540  KTQVNESNESDTGsnesnnasdesntsdGGKAKQFEDTPGDLPDDATKGD  689
            K Q+      +                 G   ++ ED  G+ P++  KGD
Sbjct  61   KKQMTPPPAEE-----------------GNNGQKSEDASGETPNEDKKGD  93


 Score = 52.8 bits (125),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 25/31 (81%), Positives = 28/31 (90%), Gaps = 0/31 (0%)
 Frame = +3

Query  1062  PSGAQSELLNETTTQNGAFPTQATESKNERK  1154
             P GAQ ELLNETTTQNG+F TQATESKNE++
Sbjct  248   PPGAQLELLNETTTQNGSFSTQATESKNEKE  278



>gb|KHG15143.1| hypothetical protein F383_09666 [Gossypium arboreum]
Length=891

 Score = 85.1 bits (209),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 57/119 (48%), Positives = 69/119 (58%), Gaps = 26/119 (22%)
 Frame = +3

Query  360  MALGKYSRVD-------GRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSS  518
            MALGKY RVD        R +S +Y STVTI+VFV +CLVG+WMMTSSSV+P QN +  +
Sbjct  1    MALGKYGRVDYNNNANGRRSSSSSYGSTVTIVVFVGLCLVGIWMMTSSSVIPDQNVDDVA  60

Query  519  QESKTDLKTQVNE--SNESDTGsnesnnasdesntsdGGKAKQFEDTPGDLPDDATKGD  689
             E KTDL  QV    SN +D+ +                   QFED  G LP+DA KGD
Sbjct  61   HEKKTDLDDQVTPIISNSNDSNNTV-----------------QFEDNSGVLPEDARKGD  102



>ref|XP_010484172.1| PREDICTED: probable methyltransferase PMT26 [Camelina sativa]
 ref|XP_010484174.1| PREDICTED: probable methyltransferase PMT26 [Camelina sativa]
Length=821

 Score = 84.7 bits (208),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 44/110 (40%), Positives = 64/110 (58%), Gaps = 17/110 (15%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            MA  +Y+R+D R+ S NYCSTVT++VFVA+CLVG+WMMTSSSV P Q+ +  S ++K  +
Sbjct  1    MAQPRYTRIDNRRPSSNYCSTVTVVVFVALCLVGIWMMTSSSVGPAQSFDEVSLDNKDGI  60

Query  540  KTQVNESNESDTGsnesnnasdesntsdGGKAKQFEDTPGDLPDDATKGD  689
            K Q+      +                 G   ++ ED  G+ P++  KGD
Sbjct  61   KKQMTPPPAEE-----------------GNNGQKSEDASGETPNEDKKGD  93


 Score = 52.8 bits (125),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 25/31 (81%), Positives = 28/31 (90%), Gaps = 0/31 (0%)
 Frame = +3

Query  1062  PSGAQSELLNETTTQNGAFPTQATESKNERK  1154
             P GAQ ELLNETTTQNG+F TQATESKNE++
Sbjct  247   PPGAQLELLNETTTQNGSFSTQATESKNEKE  277



>ref|XP_008345949.1| PREDICTED: probable methyltransferase PMT26 [Malus domestica]
Length=497

 Score = 83.2 bits (204),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 49/111 (44%), Positives = 65/111 (59%), Gaps = 26/111 (23%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            MA+GKYSRVDGRK+S N CST +++VFVA CL+GVWM+  S+VVP+QN   SS+E+  ++
Sbjct  1    MAVGKYSRVDGRKSS-NCCSTTSLVVFVAFCLIGVWMLM-STVVPIQNQGSSSEETMDEV  58

Query  540  KTQV-NESNESDTGsnesnnasdesntsdGGKAKQFEDTPGDLPDDATKGD  689
              QV  E N                       +KQFED+ G+L     K D
Sbjct  59   NRQVITEKN-----------------------SKQFEDSSGELSGTLAKED  86



>ref|XP_008371671.1| PREDICTED: probable methyltransferase PMT26 [Malus domestica]
Length=502

 Score = 83.2 bits (204),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 49/111 (44%), Positives = 65/111 (59%), Gaps = 26/111 (23%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            MA+GKYSRVDGRK+S N CST +++VFVA CL+GVWM+  S+VVP+QN   SS+E+  ++
Sbjct  1    MAVGKYSRVDGRKSS-NCCSTTSLVVFVAFCLIGVWMLM-STVVPIQNQGSSSEETMDEV  58

Query  540  KTQV-NESNESDTGsnesnnasdesntsdGGKAKQFEDTPGDLPDDATKGD  689
              QV  E N                       +KQFED+ G+L     K D
Sbjct  59   NRQVITEKN-----------------------SKQFEDSSGELSGTLAKED  86



>ref|XP_007137499.1| hypothetical protein PHAVU_009G132000g [Phaseolus vulgaris]
 gb|ESW09493.1| hypothetical protein PHAVU_009G132000g [Phaseolus vulgaris]
Length=833

 Score = 83.2 bits (204),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 50/113 (44%), Positives = 67/113 (59%), Gaps = 27/113 (24%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            M LGK SR +GRK S NYCSTV+I VFVA CLVGVW++  S++VP+QNS +   E+  D+
Sbjct  1    MVLGKNSRGEGRKLS-NYCSTVSIAVFVAFCLVGVWIVM-STIVPIQNSVIPVSETLNDV  58

Query  540  KTQVNESNESDTGsnesnnasdesntsdGGKAKQFEDTPGDLPDDATKGDIAT  698
            K       +SDT                    KQFE+  GD+P+++T+GD  T
Sbjct  59   KNV-----QSDT--------------------KQFEERSGDIPEESTEGDSQT  86



>ref|XP_009360657.1| PREDICTED: probable methyltransferase PMT24 [Pyrus x bretschneideri]
Length=805

 Score = 81.6 bits (200),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 48/110 (44%), Positives = 62/110 (56%), Gaps = 24/110 (22%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            MA+GKYSRVDGRK+S N CS  +++VFVA CL+GVWM+  S+VVP+QN   SS+E+  D+
Sbjct  1    MAVGKYSRVDGRKSS-NCCSKTSLVVFVAFCLIGVWMLM-STVVPIQNQGSSSEETMDDV  58

Query  540  KTQVNESNESDTGsnesnnasdesntsdGGKAKQFEDTPGDLPDDATKGD  689
              QV     S                      KQFED+ G+L     K D
Sbjct  59   NRQVITQKNS----------------------KQFEDSSGELSGTVAKED  86



>ref|XP_006578949.1| PREDICTED: probable methyltransferase PMT26-like isoform X1 [Glycine 
max]
 ref|XP_006578950.1| PREDICTED: probable methyltransferase PMT26-like isoform X2 [Glycine 
max]
Length=834

 Score = 81.3 bits (199),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 50/115 (43%), Positives = 68/115 (59%), Gaps = 29/115 (25%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNS--EVSSQESKT  533
            MALGK SR +GRK S NYCSTV++ VFVA CLVGVW++  SS+VP+QNS  +VS  ++  
Sbjct  1    MALGKNSRGEGRKLS-NYCSTVSVAVFVAFCLVGVWIVM-SSIVPIQNSVIQVSETDTIN  58

Query  534  DLKTQVNESNESDTGsnesnnasdesntsdGGKAKQFEDTPGDLPDDATKGDIAT  698
            D+K   ++S                         KQFED  GD+ +++T+GD  T
Sbjct  59   DVKNVASDS-------------------------KQFEDRSGDISEESTQGDSQT  88



>ref|XP_009150474.1| PREDICTED: probable methyltransferase PMT26 [Brassica rapa]
Length=975

 Score = 81.3 bits (199),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 35/64 (55%), Positives = 48/64 (75%), Gaps = 0/64 (0%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            MA  +Y+R+D R+ S NYCSTVT++VFVA+CLVG+WMMTSS V P QN +  S ++   +
Sbjct  1    MAQVRYTRLDNRRPSSNYCSTVTVVVFVALCLVGIWMMTSSYVGPAQNVDEVSLDTNDGI  60

Query  540  KTQV  551
            K Q+
Sbjct  61   KKQM  64



>emb|CDY39830.1| BnaC02g42880D [Brassica napus]
Length=772

 Score = 80.9 bits (198),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 45/111 (41%), Positives = 64/111 (58%), Gaps = 18/111 (16%)
 Frame = +3

Query  360  MALGKYSRVDG-RKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTD  536
            MA  +Y+R+D  R+ S +YCSTVTI+VFVA+CLVG+WMMTSSS+ P Q+ +V   ++K  
Sbjct  1    MAQPRYTRIDNTRRPSSSYCSTVTIVVFVALCLVGIWMMTSSSLGPDQSVDVVPLDNKDG  60

Query  537  LKTQVNESNESDTGsnesnnasdesntsdGGKAKQFEDTPGDLPDDATKGD  689
            +K Q+    E D                  G  ++ ED  G+ P +  KGD
Sbjct  61   IKNQMTPPAEEDR-----------------GNGQKPEDATGETPKEEKKGD  94



>gb|AAP72961.1| putative ankyrin-like protein [Lactuca sativa]
Length=721

 Score = 80.9 bits (198),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 47/105 (45%), Positives = 60/105 (57%), Gaps = 26/105 (25%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            MA GKYSRVDG+K+S   CST TI+V   VCL+GVWM  S+SV P QN ++ +Q SKT+ 
Sbjct  1    MAQGKYSRVDGKKSS---CSTATIVVVFGVCLIGVWMFMSTSVAPGQNQDLPAQHSKTES  57

Query  540  KTQVNESNESDTGsnesnnasdesntsdGGKAKQFEDTPGDLPDD  674
            K +V+ +N S                        FED  GDLP+D
Sbjct  58   KAKVS-TNPSPL----------------------FEDNSGDLPED  79



>emb|CDY33300.1| BnaA01g19670D [Brassica napus]
Length=239

 Score = 77.8 bits (190),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 41/110 (37%), Positives = 69/110 (63%), Gaps = 8/110 (7%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            MA GK  R + R +S +Y ST+T++VFVA+C++GVWM++S+S++P Q S+ ++       
Sbjct  1    MAFGK-GRGNKRSSSTSYASTITMVVFVALCVIGVWMLSSNSIIPPQISQANT-------  52

Query  540  KTQVNESNESDTGsnesnnasdesntsdGGKAKQFEDTPGDLPDDATKGD  689
            +T ++E+  +D  ++ + N   E    +  +   FED PG LPDDA K +
Sbjct  53   RTVISETERADVSASSNGNDEPEPTRQESDEHPTFEDNPGKLPDDAIKSE  102



>ref|XP_010930722.1| PREDICTED: probable methyltransferase PMT26 [Elaeis guineensis]
Length=887

 Score = 79.7 bits (195),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 48/110 (44%), Positives = 61/110 (55%), Gaps = 31/110 (28%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            MA G+  R D R++S + CST T+IVFVA+CLVGVWMMTSS+VVPV  S   S       
Sbjct  1    MAFGRSPRTDNRRSS-SQCSTATLIVFVALCLVGVWMMTSSTVVPVDMSSSGS-------  52

Query  540  KTQVNESNESDTGsnesnnasdesntsdGGKAKQFEDTPGDLPDDATKGD  689
            K QV++++                       +KQFEDT GD+PD   K D
Sbjct  53   KQQVSQTD-----------------------SKQFEDTSGDIPDGVMKKD  79


 Score = 53.9 bits (128),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/35 (71%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +3

Query  1053  EVFPSGAQSELLNETTTQNGAFPTQATESKNERKL  1157
             EVFP  AQSELLNET TQNGA+ TQA ES+NE+++
Sbjct  306   EVFPDVAQSELLNETNTQNGAWSTQAAESRNEKEV  340



>ref|XP_009366818.1| PREDICTED: probable methyltransferase PMT24 [Pyrus x bretschneideri]
 ref|XP_009366819.1| PREDICTED: probable methyltransferase PMT24 [Pyrus x bretschneideri]
Length=805

 Score = 79.3 bits (194),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 48/111 (43%), Positives = 65/111 (59%), Gaps = 26/111 (23%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            MA+GKYSRVDGRK S N CST +++VFVA CL+GVWM+  S+VVP+QN   SS+E+  ++
Sbjct  1    MAVGKYSRVDGRK-SWNCCSTTSLVVFVAFCLIGVWMLM-STVVPIQNQGSSSEETVDEV  58

Query  540  KTQ-VNESNESDTGsnesnnasdesntsdGGKAKQFEDTPGDLPDDATKGD  689
            K Q + + N                        KQ ED+ G+L +  TK D
Sbjct  59   KRQTITDKN-----------------------LKQVEDSLGELSETVTKED  86



>emb|CDX84478.1| BnaC03g50220D [Brassica napus]
Length=840

 Score = 78.2 bits (191),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 32/48 (67%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQN  503
            MA  +Y+R+D R+ S NYCSTVT++VFVA+CLVG+WMMTSS V P QN
Sbjct  1    MAQVRYTRLDNRRPSSNYCSTVTVVVFVALCLVGIWMMTSSYVGPAQN  48



>ref|XP_003527960.1| PREDICTED: probable methyltransferase PMT26-like [Glycine max]
Length=835

 Score = 78.2 bits (191),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 48/112 (43%), Positives = 65/112 (58%), Gaps = 30/112 (27%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKT--  533
            MALGK S+  GRK S NYCSTV++ VFVA CLVGVW++  SS+VP+QNS +   E++T  
Sbjct  1    MALGKNSQGKGRKLS-NYCSTVSVAVFVAFCLVGVWIVL-SSIVPIQNSVIQVSETETIN  58

Query  534  -DLKTQVNESNESDTGsnesnnasdesntsdGGKAKQFEDTPGDLPDDATKG  686
             D+K   ++S                         KQFED  GD+ +D+T+G
Sbjct  59   DDVKNVASDS-------------------------KQFEDRSGDISEDSTRG  85



>ref|XP_008781596.1| PREDICTED: probable methyltransferase PMT26 [Phoenix dactylifera]
Length=886

 Score = 78.2 bits (191),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 47/112 (42%), Positives = 61/112 (54%), Gaps = 35/112 (31%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQE--SKT  533
            MA G+  R+D R+ S + CST T++VFVA+CLVGVWMMTSS+VVPV  S   S++  S+T
Sbjct  1    MAFGRSPRMDNRRPS-SQCSTATLVVFVALCLVGVWMMTSSTVVPVDMSSSGSKQRVSQT  59

Query  534  DLKTQVNESNESDTGsnesnnasdesntsdGGKAKQFEDTPGDLPDDATKGD  689
            D                                +KQFED+ GD+PD A K D
Sbjct  60   D--------------------------------SKQFEDSSGDIPDGAMKKD  79


 Score = 53.5 bits (127),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/35 (69%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +3

Query  1053  EVFPSGAQSELLNETTTQNGAFPTQATESKNERKL  1157
             EVFP   QSELLNET TQNGA+ TQA ES+NE+++
Sbjct  306   EVFPDATQSELLNETNTQNGAWSTQAVESRNEKEV  340



>ref|XP_010412715.1| PREDICTED: probable methyltransferase PMT27 [Camelina sativa]
 ref|XP_010412717.1| PREDICTED: probable methyltransferase PMT27 [Camelina sativa]
Length=467

 Score = 76.6 bits (187),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 43/108 (40%), Positives = 68/108 (63%), Gaps = 8/108 (7%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            MA GK  R + R ++ +Y ST+T+I+FVA+C++GVWM++S+SV+P Q ++ S+       
Sbjct  1    MAFGK-GRGNKRASTSSYASTITMIIFVALCVIGVWMLSSNSVIPPQITQGST-------  52

Query  540  KTQVNESNESDTGsnesnnasdesntsdGGKAKQFEDTPGDLPDDATK  683
            +T V+E+  SD  ++ + N   E    +  +   FED PG LPDDA K
Sbjct  53   RTVVSETERSDVSASSNGNDEPEPTNKESDEQPAFEDNPGKLPDDAVK  100



>ref|XP_006290554.1| hypothetical protein CARUB_v10016641mg [Capsella rubella]
 gb|EOA23452.1| hypothetical protein CARUB_v10016641mg [Capsella rubella]
Length=967

 Score = 77.0 bits (188),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 43/111 (39%), Positives = 71/111 (64%), Gaps = 8/111 (7%)
 Frame = +3

Query  357  RMALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTD  536
            +MA GK  R + R ++ +Y ST+T+I+FVA+C++GVWM++S+SV+P Q ++ S+      
Sbjct  52   KMAFGK-GRGNKRTSTSSYASTITMIIFVALCVIGVWMLSSNSVIPPQITQGST------  104

Query  537  LKTQVNESNESDTGsnesnnasdesntsdGGKAKQFEDTPGDLPDDATKGD  689
             +T V+E+  SD  ++ ++N   E    +  +   FED PG LPDDA K +
Sbjct  105  -RTVVSETERSDLSASSNSNDEPEPTKQESDEQPAFEDNPGKLPDDAVKSE  154



>ref|XP_009149307.1| PREDICTED: probable methyltransferase PMT27 [Brassica rapa]
Length=902

 Score = 76.6 bits (187),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 41/110 (37%), Positives = 69/110 (63%), Gaps = 8/110 (7%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            MA GK  R + R +S +Y ST+T++VFVA+C++GVWM++S+S++P Q S+ ++       
Sbjct  1    MAFGK-GRGNKRSSSTSYASTITMVVFVALCVIGVWMLSSNSIIPPQISQANT-------  52

Query  540  KTQVNESNESDTGsnesnnasdesntsdGGKAKQFEDTPGDLPDDATKGD  689
            +T ++E+  +D  ++ + N   E    +  +   FED PG LPDDA K +
Sbjct  53   RTVISETERADVSASSNGNDEPEPTRQESDEHPTFEDNPGKLPDDAIKSE  102



>ref|XP_010515490.1| PREDICTED: probable methyltransferase PMT27 [Camelina sativa]
Length=912

 Score = 76.3 bits (186),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 43/110 (39%), Positives = 69/110 (63%), Gaps = 8/110 (7%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            MA GK  R + R ++ +Y ST+T+I+FVA+C++GVWM++S+SV+P Q ++ S+       
Sbjct  1    MAFGK-GRGNKRASTSSYASTITMIIFVALCVIGVWMLSSNSVIPPQITQGST-------  52

Query  540  KTQVNESNESDTGsnesnnasdesntsdGGKAKQFEDTPGDLPDDATKGD  689
            +T V+E+  SD  ++ + N   E    +  +   FED PG LPDDA K +
Sbjct  53   RTVVSETERSDVSASSNGNDEPEPTNKESEEQPAFEDNPGKLPDDAVKSE  102



>ref|XP_010503787.1| PREDICTED: probable methyltransferase PMT27 [Camelina sativa]
Length=913

 Score = 76.3 bits (186),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 43/110 (39%), Positives = 69/110 (63%), Gaps = 8/110 (7%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            MA GK  R + R ++ +Y ST+T+I+FVA+C++GVWM++S+SV+P Q ++ S+       
Sbjct  1    MAFGK-GRGNKRASTSSYASTITMIIFVALCVIGVWMLSSNSVIPPQITQGST-------  52

Query  540  KTQVNESNESDTGsnesnnasdesntsdGGKAKQFEDTPGDLPDDATKGD  689
            +T V+E+  SD  ++ + N   E    +  +   FED PG LPDDA K +
Sbjct  53   RTVVSETERSDVSASSNGNDEPEPTNKESEEQPAFEDNPGKLPDDAVKSE  102



>ref|XP_009410679.1| PREDICTED: probable methyltransferase PMT26 [Musa acuminata subsp. 
malaccensis]
Length=797

 Score = 75.5 bits (184),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 34/67 (51%), Positives = 50/67 (75%), Gaps = 3/67 (4%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            MA G+ SR D R+ S +YCST+T++VFVA+CLVG WMMTSS++ P   +EV S  +K+D+
Sbjct  1    MAFGRSSRTDTRRTSSSYCSTMTLVVFVALCLVGAWMMTSSAMAP---AEVPSSATKSDM  57

Query  540  KTQVNES  560
              +V+ +
Sbjct  58   SDKVSRT  64


 Score = 62.4 bits (150),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 28/36 (78%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = +3

Query  1050  NEVFPSGAQSELLNETTTQNGAFPTQATESKNERKL  1157
             NEVFPSGAQ+ELLNET+TQNGA+ TQA ESKNE+++
Sbjct  216   NEVFPSGAQTELLNETSTQNGAWSTQAVESKNEKEI  251



>emb|CDY26534.1| BnaC01g23650D [Brassica napus]
Length=767

 Score = 75.5 bits (184),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 40/110 (36%), Positives = 69/110 (63%), Gaps = 8/110 (7%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            MA GK  R + R +S +Y ST+T++VFVA+C++GVWM++S+S++P Q S+ ++       
Sbjct  1    MAFGK-GRGNKRSSSTSYASTITMVVFVALCVIGVWMLSSNSIIPPQISQANT-------  52

Query  540  KTQVNESNESDTGsnesnnasdesntsdGGKAKQFEDTPGDLPDDATKGD  689
            +T ++E+  +D  ++ + N   E    +  +   +ED PG LPDDA K +
Sbjct  53   RTVISETERADVSASSNGNDEPEPTRQESDEHPTYEDNPGKLPDDAIKSE  102



>ref|XP_009383568.1| PREDICTED: probable methyltransferase PMT26 [Musa acuminata subsp. 
malaccensis]
Length=883

 Score = 75.5 bits (184),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 37/69 (54%), Positives = 56/69 (81%), Gaps = 5/69 (7%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSS-VVPVQNSEVSSQESKTD  536
            MA  + + +D R++S ++CSTVT++ F+A+CLVGVWMMTSSS VVP+   ++SS ESK+D
Sbjct  1    MAFRRSAMMDARRSS-SHCSTVTLVAFIALCLVGVWMMTSSSTVVPI---DMSSPESKSD  56

Query  537  LKTQVNESN  563
            +K QV+E++
Sbjct  57   MKQQVSETD  65


 Score = 57.8 bits (138),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 27/33 (82%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = +3

Query  1053  EVFPSGAQSELLNETTTQNGAFPTQATESKNER  1151
             EVFP GAQSELLNET+TQNGA+ TQATESK E+
Sbjct  305   EVFPDGAQSELLNETSTQNGAWSTQATESKKEK  337



>ref|XP_009130433.1| PREDICTED: probable methyltransferase PMT26 [Brassica rapa]
 ref|XP_009130434.1| PREDICTED: probable methyltransferase PMT26 [Brassica rapa]
Length=764

 Score = 74.3 bits (181),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 34/65 (52%), Positives = 50/65 (77%), Gaps = 1/65 (2%)
 Frame = +3

Query  360  MALGKYSRVDG-RKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTD  536
            MA  +Y+R+D  R+ + +YCSTVTI+VFVA+CLVG+WMMTSSS+ P Q+ +V   ++K  
Sbjct  1    MAQPRYTRIDNTRRPASSYCSTVTIVVFVALCLVGIWMMTSSSLGPDQSVDVVPLDNKDG  60

Query  537  LKTQV  551
            +K Q+
Sbjct  61   IKNQM  65



>emb|CDY31339.1| BnaA02g34020D [Brassica napus]
Length=764

 Score = 74.3 bits (181),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 34/65 (52%), Positives = 50/65 (77%), Gaps = 1/65 (2%)
 Frame = +3

Query  360  MALGKYSRVDG-RKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTD  536
            MA  +Y+R+D  R+ + +YCSTVTI+VFVA+CLVG+WMMTSSS+ P Q+ +V   ++K  
Sbjct  1    MAQPRYTRIDNTRRPASSYCSTVTIVVFVALCLVGIWMMTSSSLGPDQSVDVVPLDNKDG  60

Query  537  LKTQV  551
            +K Q+
Sbjct  61   IKNQM  65



>ref|XP_004289881.1| PREDICTED: probable methyltransferase PMT24 [Fragaria vesca subsp. 
vesca]
Length=797

 Score = 74.3 bits (181),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 35/59 (59%), Positives = 47/59 (80%), Gaps = 2/59 (3%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTD  536
            MA+GKYSRVDG+K S N CST +++VFVA CLVGVWM+ SS+ VP+Q   +S++E+  D
Sbjct  1    MAMGKYSRVDGKK-SLNCCSTTSLVVFVAFCLVGVWMLMSSA-VPIQTQSLSTEENLAD  57



>ref|XP_010426649.1| PREDICTED: probable methyltransferase PMT27 [Camelina sativa]
Length=914

 Score = 74.3 bits (181),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 42/110 (38%), Positives = 69/110 (63%), Gaps = 8/110 (7%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            MA GK  R + R ++ +Y ST+T+I+FVA+C++GVWM++S+SV+P Q ++ S+       
Sbjct  1    MAFGK-GRGNKRASTSSYASTITMIIFVALCVIGVWMLSSNSVIPPQITQGST-------  52

Query  540  KTQVNESNESDTGsnesnnasdesntsdGGKAKQFEDTPGDLPDDATKGD  689
            +T V+E+  SD  ++ + N   E    +  +   FED PG LP+DA K +
Sbjct  53   RTVVSETERSDVSASSNGNDEPEPTNKESEEQPAFEDNPGKLPEDAVKSE  102



>ref|NP_190676.1| putative methyltransferase PMT27 [Arabidopsis thaliana]
 sp|Q9SD39.1|PMTR_ARATH RecName: Full=Probable methyltransferase PMT27 [Arabidopsis thaliana]
 emb|CAB62629.1| putative protein [Arabidopsis thaliana]
 gb|AEE78746.1| putative methyltransferase PMT27 [Arabidopsis thaliana]
Length=895

 Score = 72.8 bits (177),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 40/110 (36%), Positives = 67/110 (61%), Gaps = 8/110 (7%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            MA G+  R + R ++ +Y ST+T+++FVA+C+ GVWM++S+SV+P Q ++ S+       
Sbjct  1    MAFGR-GRGNKRTSTSSYASTITMVIFVALCVFGVWMLSSNSVIPPQITQGST-------  52

Query  540  KTQVNESNESDTGsnesnnasdesntsdGGKAKQFEDTPGDLPDDATKGD  689
            +  V E+  SD  ++ + N   E    +  + + FED PG LPDDA K +
Sbjct  53   RAAVAETERSDVSASSNGNDEPEPTKQESDEQQAFEDNPGKLPDDAVKSE  102



>ref|XP_009414612.1| PREDICTED: probable methyltransferase PMT24 [Musa acuminata subsp. 
malaccensis]
Length=817

 Score = 72.4 bits (176),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 44/110 (40%), Positives = 63/110 (57%), Gaps = 29/110 (26%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            MA G+ SR+DGR  S + CST TI+VFVA+CLVGVWMMTSS+V+PV   E++  +S+T+ 
Sbjct  1    MAFGRSSRLDGRGTS-SLCSTTTIVVFVALCLVGVWMMTSSTVIPV---EMADTQSETND  56

Query  540  KTQVNESNESDTGsnesnnasdesntsdGGKAKQFEDTPGDLPDDATKGD  689
            K   ++S                         + FE+  GD+ +D+T  D
Sbjct  57   KVAKSDS-------------------------RSFENRSGDVTNDSTSSD  81


 Score = 60.8 bits (146),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 28/36 (78%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +3

Query  1050  NEVFPSGAQSELLNETTTQNGAFPTQATESKNERKL  1157
             NEVFPSGAQSELLNET TQNGA+ +QA ESKNE+++
Sbjct  239   NEVFPSGAQSELLNETNTQNGAWSSQAAESKNEKEV  274



>ref|XP_008783335.1| PREDICTED: probable methyltransferase PMT26 [Phoenix dactylifera]
Length=807

 Score = 72.4 bits (176),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 49/108 (45%), Positives = 63/108 (58%), Gaps = 26/108 (24%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            MA GK SR D R+ S ++CST TI+VFVA+CLVGVWMMTSS+V PV   E+S   SK+D 
Sbjct  1    MAFGKSSRADARRTSSSFCSTTTIVVFVALCLVGVWMMTSSTVTPV---EMSPPSSKSDA  57

Query  540  KTQVNESNESDTGsnesnnasdesntsdGGKAKQFEDTPGDLPDDATK  683
            K QV E++                       +K FED  GD+ +D+ K
Sbjct  58   KDQVPETD-----------------------SKPFEDNSGDITEDSEK  82


 Score = 61.6 bits (148),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 28/38 (74%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +3

Query  1044  SXNEVFPSGAQSELLNETTTQNGAFPTQATESKNERKL  1157
             + NEVFPSGAQSELLNET TQNGA+ TQA ES+NE+++
Sbjct  224   ASNEVFPSGAQSELLNETNTQNGAWSTQAAESRNEKEV  261



>gb|ERM96302.1| hypothetical protein AMTR_s00001p00185010 [Amborella trichopoda]
Length=918

 Score = 72.0 bits (175),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 35/93 (38%), Positives = 49/93 (53%), Gaps = 25/93 (27%)
 Frame = +3

Query  411  YCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDLKTQVNESNESDTGsnes  590
            YCST+T+ +FV  CL+GVWM+TSS+V P Q    +    + + +TQV+ S          
Sbjct  17   YCSTITMTMFVCFCLLGVWMLTSSAVAPGQRGGFAQSTIRKETRTQVSSS----------  66

Query  591  nnasdesntsdGGKAKQFEDTPGDLPDDATKGD  689
                           + +ED PGDLPDDA +GD
Sbjct  67   ---------------RAYEDNPGDLPDDAIRGD  84



>dbj|BAH19463.1| AT1G29470 [Arabidopsis thaliana]
Length=154

 Score = 67.8 bits (164),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 30/62 (48%), Positives = 43/62 (69%), Gaps = 1/62 (2%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            MA+GKYSRVDG+K+S  Y  T+TI++ V++CLVG WM  SS   P ++ + S+ E   D+
Sbjct  1    MAMGKYSRVDGKKSS-GYGLTITIVLIVSLCLVGAWMFMSSWSAPTESIDFSANERTKDV  59

Query  540  KT  545
             T
Sbjct  60   DT  61



>emb|CDY43782.1| BnaA06g23180D [Brassica napus]
Length=799

 Score = 71.6 bits (174),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSS  482
            MA  +Y+R+D R+ S NYCSTVT++VFVA+CLVG+WMMTSS
Sbjct  1    MAQVRYTRLDNRRPSSNYCSTVTVVVFVALCLVGIWMMTSS  41



>ref|XP_009115787.1| PREDICTED: probable methyltransferase PMT27 [Brassica rapa]
Length=898

 Score = 71.2 bits (173),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 39/110 (35%), Positives = 67/110 (61%), Gaps = 8/110 (7%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            MA GK  R + R ++ +Y ST+T++VFVA+C+VGVWM++++S +P Q ++ ++       
Sbjct  1    MAFGK-GRGNKRTSTSSYASTITMVVFVALCVVGVWMLSTNSFIPSQITQATT-------  52

Query  540  KTQVNESNESDTGsnesnnasdesntsdGGKAKQFEDTPGDLPDDATKGD  689
            +T + E+  SD  ++ + N   E    +  +   F+D PG LPDDA K +
Sbjct  53   RTVIAETERSDVSASSNGNEEPEPTKPESDEHPTFQDNPGKLPDDAVKSE  102



>ref|XP_004502550.1| PREDICTED: probable methyltransferase PMT26-like [Cicer arietinum]
Length=782

 Score = 70.9 bits (172),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 49/114 (43%), Positives = 66/114 (58%), Gaps = 25/114 (22%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            MA GK SR DGR  S NYCSTV + VFVA CLVG+W++  SS+VPVQ+S +  Q S T +
Sbjct  1    MAPGKNSRGDGRNLS-NYCSTVPVAVFVAFCLVGIWIVM-SSIVPVQDSVM--QVSDTII  56

Query  540  KTQVNESNESDTGsnesnnasdesntsdGGKAKQFEDTPGDLPDDATKGDIATP  701
            + Q N +N+  TG                   +QFED  GD+ +++ + D  TP
Sbjct  57   EVQ-NIANQ--TG------------------LRQFEDKLGDIQEESARRDTQTP  89



>ref|XP_010911089.1| PREDICTED: probable methyltransferase PMT26 [Elaeis guineensis]
 ref|XP_010911096.1| PREDICTED: probable methyltransferase PMT26 [Elaeis guineensis]
Length=799

 Score = 70.9 bits (172),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 48/108 (44%), Positives = 63/108 (58%), Gaps = 26/108 (24%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            MA GK SR D R+ S ++CST TI+VFVA+CLVGVWMMTSS+V PV   ++S   SK+D 
Sbjct  1    MAFGKSSRADARRTSSSFCSTTTIVVFVALCLVGVWMMTSSTVTPV---DMSPPSSKSDA  57

Query  540  KTQVNESNESDTGsnesnnasdesntsdGGKAKQFEDTPGDLPDDATK  683
            K QV E++                       +K FED  GD+ +D+ K
Sbjct  58   KDQVPETD-----------------------SKLFEDNSGDITEDSEK  82


 Score = 62.4 bits (150),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 29/38 (76%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +3

Query  1044  SXNEVFPSGAQSELLNETTTQNGAFPTQATESKNERKL  1157
             + NEVFPSGAQSELLNET TQNGA+ TQA ESKNE+++
Sbjct  225   ASNEVFPSGAQSELLNETNTQNGAWSTQAAESKNEKEV  262



>gb|EPS72711.1| hypothetical protein M569_02048, partial [Genlisea aurea]
Length=80

 Score = 65.1 bits (157),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 42/65 (65%), Positives = 48/65 (74%), Gaps = 1/65 (2%)
 Frame = +3

Query  369  GKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDLKTQ  548
            G +SRVDGRK+S NYCSTVT+ VFVAVCLVGVW+ TSSSV P Q  +  S E K D+KT 
Sbjct  1    GNFSRVDGRKSSSNYCSTVTVTVFVAVCLVGVWVFTSSSVTPFQTLD-GSDEPKNDVKTS  59

Query  549  VNESN  563
            V   N
Sbjct  60   VTGDN  64



>gb|KHN36073.1| Putative methyltransferase PMT27 [Glycine soja]
Length=796

 Score = 70.1 bits (170),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 36/99 (36%), Positives = 54/99 (55%), Gaps = 0/99 (0%)
 Frame = +3

Query  393  RKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDLKTQVNESNESD  572
            + +SP+Y ST+TI+VF+A+C+ GVWM+TS+SVVP Q        ++T + T    ++E  
Sbjct  9    KSSSPSYVSTLTILVFIALCVFGVWMLTSNSVVPPQTQSDEDTSTRTAIDTSATTNDELS  68

Query  573  TGsnesnnasdesntsdGGKAKQFEDTPGDLPDDATKGD  689
            +  +     S             + D PG LPDDA K D
Sbjct  69   SSEDSHETTSKSGEKEKDNPTAVYGDNPGHLPDDAIKAD  107



>ref|XP_003516560.1| PREDICTED: probable methyltransferase PMT27-like [Glycine max]
Length=796

 Score = 70.1 bits (170),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 36/99 (36%), Positives = 54/99 (55%), Gaps = 0/99 (0%)
 Frame = +3

Query  393  RKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDLKTQVNESNESD  572
            + +SP+Y ST+TI+VF+A+C+ GVWM+TS+SVVP Q        ++T + T    ++E  
Sbjct  9    KSSSPSYVSTLTILVFIALCVFGVWMLTSNSVVPPQTQSDEDTSTRTAIDTSATTNDELS  68

Query  573  TGsnesnnasdesntsdGGKAKQFEDTPGDLPDDATKGD  689
            +  +     S             + D PG LPDDA K D
Sbjct  69   SSEDSHETTSKSGEKEKDNPTAVYGDNPGHLPDDAIKAD  107



>ref|XP_010557710.1| PREDICTED: probable methyltransferase PMT27 [Tarenaya hassleriana]
Length=868

 Score = 68.9 bits (167),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 42/110 (38%), Positives = 60/110 (55%), Gaps = 28/110 (25%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            MA+GK +R + R A+ +Y STVT ++FVA+C++GVWM++S+SV P Q +  S++ +    
Sbjct  1    MAVGK-TRGNKRSATTSYASTVTTVIFVALCVIGVWMLSSNSVTPPQITRASTRTAS---  56

Query  540  KTQVNESNESDTGsnesnnasdesntsdGGKAKQFEDTPGDLPDDATKGD  689
               V ESNE                     +   FED PG LPDDA   D
Sbjct  57   ---VTESNE---------------------QQPVFEDNPGKLPDDAIMSD  82



>ref|XP_010112029.1| putative methyltransferase PMT24 [Morus notabilis]
 gb|EXC32448.1| putative methyltransferase PMT24 [Morus notabilis]
Length=739

 Score = 68.9 bits (167),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 42/101 (42%), Positives = 54/101 (53%), Gaps = 21/101 (21%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            MALGKY+RV+GRK+S N CST++++VFVA CLVG+W+  SS+V      EV S      L
Sbjct  1    MALGKYTRVEGRKSS-NCCSTISVVVFVAFCLVGIWVFMSSTVPDEDQEEVPS------L  53

Query  540  KTQVNESNESDTGsnesnnasdesntsdGGKAKQFEDTPGD  662
               VN+  +                       KQFEDT GD
Sbjct  54   DNTVNDVTKQHV--------------VADDNPKQFEDTSGD  80



>ref|XP_006403957.1| hypothetical protein EUTSA_v10010109mg [Eutrema salsugineum]
 gb|ESQ45410.1| hypothetical protein EUTSA_v10010109mg [Eutrema salsugineum]
Length=914

 Score = 68.9 bits (167),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 41/111 (37%), Positives = 66/111 (59%), Gaps = 9/111 (8%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            MA GK  R + R ++ +Y ST+T+++FVA+C++GVWM++S+SV+P Q +  S+       
Sbjct  1    MAFGK-GRGNKRSSTTSYASTITMVIFVALCVIGVWMLSSNSVIPPQITGAST-------  52

Query  540  KTQVNESNESD-TGsnesnnasdesntsdGGKAKQFEDTPGDLPDDATKGD  689
            +T + E+  SD   ++ + N   E    +      FED PG LPDDA K +
Sbjct  53   RTAIAETERSDVVSASSNGNDEPEPTKPESDDQPAFEDNPGKLPDDAVKSE  103



>ref|XP_010501645.1| PREDICTED: probable methyltransferase PMT24, partial [Camelina 
sativa]
Length=721

 Score = 68.6 bits (166),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 48/71 (68%), Gaps = 1/71 (1%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            MA+GKYSRVDG+K+S  Y  T+TI++ V++CLVG WM  SS   P ++ + SS E+  D+
Sbjct  1    MAMGKYSRVDGKKSS-GYGLTITIVLIVSLCLVGAWMFMSSWSAPTESIDFSSSETSKDV  59

Query  540  KTQVNESNESD  572
            +T      +SD
Sbjct  60   ETTTKSDFKSD  70



>ref|XP_006415572.1| hypothetical protein EUTSA_v10006884mg [Eutrema salsugineum]
 gb|ESQ33925.1| hypothetical protein EUTSA_v10006884mg [Eutrema salsugineum]
Length=761

 Score = 68.6 bits (166),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 46/62 (74%), Gaps = 1/62 (2%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            MA+GKYSRVDG+K+S  Y  T+TI++FV++CLVG WM  SS   P ++ + S+ E+  D+
Sbjct  1    MAMGKYSRVDGKKSS-GYGLTITIVLFVSLCLVGAWMFMSSWSAPTESVDFSATETTKDV  59

Query  540  KT  545
            +T
Sbjct  60   ET  61



>ref|XP_010460728.1| PREDICTED: probable methyltransferase PMT24 [Camelina sativa]
 ref|XP_010460729.1| PREDICTED: probable methyltransferase PMT24 [Camelina sativa]
Length=764

 Score = 67.8 bits (164),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 47/71 (66%), Gaps = 1/71 (1%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            MA+GKYSRVDG+K+S  Y  T+TI++ V +CLVG WM  SS   P ++ + SS E+  D+
Sbjct  1    MAMGKYSRVDGKKSS-GYGLTITIVLIVTLCLVGAWMFMSSWSAPTESIDFSSSETSKDV  59

Query  540  KTQVNESNESD  572
            +T      +SD
Sbjct  60   ETTTKSDFKSD  70



>ref|XP_007158605.1| hypothetical protein PHAVU_002G166600g [Phaseolus vulgaris]
 gb|ESW30599.1| hypothetical protein PHAVU_002G166600g [Phaseolus vulgaris]
Length=828

 Score = 67.8 bits (164),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 43/114 (38%), Positives = 59/114 (52%), Gaps = 5/114 (4%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            MAL K  +   R +SP+Y ST+TI VF+A+C+ GVWM+TS SV   Q+ E  +     D 
Sbjct  1    MALFKTRK---RSSSPSYVSTLTIFVFIALCVFGVWMLTSKSV--TQSDEDIATRMSLDT  55

Query  540  KTQVNESNESDTGsnesnnasdesntsdGGKAKQFEDTPGDLPDDATKGDIATP  701
                N+   + +    S  A+  +     G +  F D PG LPDDA K D   P
Sbjct  56   SATTNDELSTTSHEIASKIAAKIAEKRKDGSSSVFGDNPGHLPDDAIKSDEKNP  109



>ref|XP_006303155.1| hypothetical protein CARUB_v10008372mg [Capsella rubella]
 ref|XP_006303156.1| hypothetical protein CARUB_v10008372mg [Capsella rubella]
 gb|EOA36053.1| hypothetical protein CARUB_v10008372mg [Capsella rubella]
 gb|EOA36054.1| hypothetical protein CARUB_v10008372mg [Capsella rubella]
Length=767

 Score = 67.0 bits (162),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 50/76 (66%), Gaps = 4/76 (5%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            MA+GKYSRVDG+K+S  Y  T+TI++ V++CLVG WM  SS   P ++ + S+ E+  D+
Sbjct  1    MAMGKYSRVDGKKSS-GYGLTITIVLIVSLCLVGAWMFMSSWSAPTESIDFSASETSKDV  59

Query  540  KTQVN---ESNESDTG  578
            +T      +S E D G
Sbjct  60   ETSTKSDFKSEEVDRG  75



>ref|XP_010547883.1| PREDICTED: probable methyltransferase PMT26 [Tarenaya hassleriana]
Length=706

 Score = 67.0 bits (162),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 44/109 (40%), Positives = 54/109 (50%), Gaps = 27/109 (25%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            MAL + SR+D R+    YCST +I+VFVA+ LVGVWMMTS S V V   +  S E K + 
Sbjct  1    MALVRNSRMDNRRYLSGYCSTGSIVVFVALGLVGVWMMTSQSSVGVTTFDEQSLEKKGEA  60

Query  540  KTQVNESNESDTGsnesnnasdesntsdGGKAKQFEDTPGDLPDDATKG  686
            K QV  S +                           D+ GDLP DA KG
Sbjct  61   KEQVTPSTK---------------------------DSRGDLPGDAAKG  82


 Score = 59.3 bits (142),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 26/34 (76%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +3

Query  1050  NEVFPSGAQSELLNETTTQNGAFPTQATESKNER  1151
             N++ PSGAQSELLNET + NG+FPTQATESKNE+
Sbjct  128   NDILPSGAQSELLNETASANGSFPTQATESKNEK  161



>ref|XP_010478312.1| PREDICTED: probable methyltransferase PMT24 isoform X1 [Camelina 
sativa]
 ref|XP_010478313.1| PREDICTED: probable methyltransferase PMT24 isoform X2 [Camelina 
sativa]
 ref|XP_010478314.1| PREDICTED: probable methyltransferase PMT24 isoform X3 [Camelina 
sativa]
Length=769

 Score = 67.0 bits (162),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 50/76 (66%), Gaps = 4/76 (5%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            MA+G+YSRVDG+K+S  Y  T+TI++ V++CLVG WM  SS   P ++ + SS E+  D+
Sbjct  1    MAMGRYSRVDGKKSS-GYGLTITIVLIVSLCLVGAWMFMSSWSAPTESIDFSSSETSKDV  59

Query  540  KTQVN---ESNESDTG  578
            +T      +S E D G
Sbjct  60   ETTTKSDFKSEEVDRG  75



>ref|XP_010469377.1| PREDICTED: probable methyltransferase PMT25 [Camelina sativa]
Length=779

 Score = 66.6 bits (161),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 31/61 (51%), Positives = 45/61 (74%), Gaps = 1/61 (2%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            MA+GKYSRVDG+K+S +Y  TVTI++ +++CLVG WM TSS   P  + + SS E+  D+
Sbjct  1    MAMGKYSRVDGKKSS-SYGLTVTIVLVISLCLVGAWMFTSSWSAPADSVDYSSSETAKDV  59

Query  540  K  542
            +
Sbjct  60   E  60



>ref|XP_010908928.1| PREDICTED: probable methyltransferase PMT26 [Elaeis guineensis]
Length=800

 Score = 66.6 bits (161),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 39/71 (55%), Positives = 52/71 (73%), Gaps = 3/71 (4%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            MA GK SR D R+ S ++CST TI+VFVA+CLVG+WMMTSS V P++   +S   SK+D+
Sbjct  1    MAFGKASRTDARRTSSSFCSTTTIVVFVALCLVGIWMMTSSIVNPLEMFPLS---SKSDV  57

Query  540  KTQVNESNESD  572
            K QV E++  D
Sbjct  58   KDQVPETDSKD  68


 Score = 58.5 bits (140),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 28/36 (78%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = +3

Query  1050  NEVFPSGAQSELLNETTTQNGAFPTQATESKNERKL  1157
             NEVFPSGAQSELLNET TQN A+ TQA ESKNE+++
Sbjct  227   NEVFPSGAQSELLNETNTQNVAWSTQAAESKNEKEV  262



>ref|XP_010679252.1| PREDICTED: probable methyltransferase PMT26 [Beta vulgaris subsp. 
vulgaris]
Length=788

 Score = 66.2 bits (160),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 44/111 (40%), Positives = 61/111 (55%), Gaps = 24/111 (22%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            MA G+Y+RVDGRK+S NYCSTV I+V V+ CL+G WM  SSS  P     +S   SK   
Sbjct  1    MATGRYTRVDGRKSS-NYCSTVVIVVIVSACLIGAWMTMSSSADPAGAVGISLGLSKDVK  59

Query  540  KTQVNESNESDTGsnesnnasdesntsdGGKAKQFEDTPGDLPDDATKGDI  692
            + +++E +                       +K+FED  GDLP+D  KG++
Sbjct  60   QPKMSEKS-----------------------SKEFEDNSGDLPEDGLKGNV  87



>ref|XP_002893569.1| hypothetical protein ARALYDRAFT_473159 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69828.1| hypothetical protein ARALYDRAFT_473159 [Arabidopsis lyrata subsp. 
lyrata]
Length=771

 Score = 66.2 bits (160),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 45/128 (35%), Positives = 65/128 (51%), Gaps = 28/128 (22%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQE-----  524
            MA+GKYSRVDG+K+S  Y  T+TI++ V++CLVG WM  SS   P ++ + S+ E     
Sbjct  1    MAMGKYSRVDGKKSS-GYGLTITIVLIVSLCLVGAWMFMSSWSAPTESIDFSANERTKDV  59

Query  525  ---SKTDLKTQ-------------------VNESNESDTGsnesnnasdesntsdGGKAK  638
               +K+D K++                   V ESNE  T   +S   +    T  G   K
Sbjct  60   DTTTKSDFKSEEVDRGSKSFSDEKNDETEVVTESNEEKTDPEKSGEENSGEKTESGEGKK  119

Query  639  QFEDTPGD  662
            +F+D  GD
Sbjct  120  EFDDKNGD  127



>dbj|BAE99079.1| hypothetical protein [Arabidopsis thaliana]
Length=770

 Score = 65.5 bits (158),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 34/75 (45%), Positives = 49/75 (65%), Gaps = 3/75 (4%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            MA+GKYSRVDG+K+S  Y  T+TI++ V++CLVG WM  SS   P ++ + S+ E   D+
Sbjct  1    MAMGKYSRVDGKKSS-GYGLTITIVLIVSLCLVGAWMFMSSWSAPTESIDFSANERTKDV  59

Query  540  KTQVNE--SNESDTG  578
             T  ++  S E D G
Sbjct  60   DTTKSDFKSEEVDRG  74



>ref|NP_174240.2| putative methyltransferase PMT24 [Arabidopsis thaliana]
 ref|NP_001031109.1| putative methyltransferase PMT24 [Arabidopsis thaliana]
 sp|Q6NPR7.1|PMTO_ARATH RecName: Full=Probable methyltransferase PMT24 [Arabidopsis thaliana]
 gb|AAR23721.1| At1g29470 [Arabidopsis thaliana]
 gb|AEE31093.1| putative methyltransferase PMT24 [Arabidopsis thaliana]
 gb|AEE31094.1| putative methyltransferase PMT24 [Arabidopsis thaliana]
Length=770

 Score = 65.5 bits (158),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 34/75 (45%), Positives = 49/75 (65%), Gaps = 3/75 (4%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            MA+GKYSRVDG+K+S  Y  T+TI++ V++CLVG WM  SS   P ++ + S+ E   D+
Sbjct  1    MAMGKYSRVDGKKSS-GYGLTITIVLIVSLCLVGAWMFMSSWSAPTESIDFSANERTKDV  59

Query  540  KTQVNE--SNESDTG  578
             T  ++  S E D G
Sbjct  60   DTTKSDFKSEEVDRG  74



>emb|CDX94669.1| BnaC07g09890D [Brassica napus]
Length=749

 Score = 65.1 bits (157),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/62 (48%), Positives = 45/62 (73%), Gaps = 1/62 (2%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            MA+GKYSRVDG+K+S  Y  T+TI++ V++CLVG WM  SS   P ++ + SS ++  D+
Sbjct  1    MAMGKYSRVDGKKSS-GYGLTITIVLVVSLCLVGAWMFMSSWSAPTESVDFSSNQTPKDV  59

Query  540  KT  545
            +T
Sbjct  60   ET  61



>gb|KEH35375.1| methyltransferase PMT26-like protein, putative [Medicago truncatula]
Length=755

 Score = 64.7 bits (156),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 42/115 (37%), Positives = 61/115 (53%), Gaps = 26/115 (23%)
 Frame = +3

Query  360  MALGKYSRV-DGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTD  536
            MAL K SR  DGR +S NYCST  + VFVA CLVG+W +  SS+VP+Q+S +   E+  +
Sbjct  1    MALVKNSRGGDGRNSS-NYCSTFPVAVFVAFCLVGIW-IAMSSIVPLQDSVMEVSETINE  58

Query  537  LKTQVNESNESDTGsnesnnasdesntsdGGKAKQFEDTPGDLPDDATKGDIATP  701
            +K   N++                        ++Q+ED  GD P+++   D  TP
Sbjct  59   VKNIANQTG-----------------------SRQYEDKIGDTPNESAMRDNLTP  90



>ref|XP_010533385.1| PREDICTED: probable methyltransferase PMT24 [Tarenaya hassleriana]
Length=783

 Score = 64.7 bits (156),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 29/61 (48%), Positives = 47/61 (77%), Gaps = 1/61 (2%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            MA+GKYSRVDG+K+S +Y  T+T+++FV++CLVG WM  SSS    ++ ++ S+E+  D+
Sbjct  1    MAMGKYSRVDGKKSS-SYGLTITVLLFVSLCLVGAWMFMSSSSATDESVDLPSRETTKDV  59

Query  540  K  542
            +
Sbjct  60   E  60



>ref|NP_001140988.1| uncharacterized protein LOC100273067 [Zea mays]
 gb|ACF85115.1| unknown [Zea mays]
 gb|AFW84364.1| hypothetical protein ZEAMMB73_169809 [Zea mays]
 gb|AFW84365.1| hypothetical protein ZEAMMB73_169809 [Zea mays]
Length=343

 Score = 63.5 bits (153),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 25/52 (48%), Positives = 40/52 (77%), Gaps = 5/52 (10%)
 Frame = +3

Query  360  MALGKYSRVDGRK-----ASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQ  500
            MA G+  ++DGR+     +S ++C+T T+++FVA+CLVG WMMTSS+V P++
Sbjct  1    MAFGRGGKMDGRRPSSSSSSSSFCTTTTVVLFVALCLVGAWMMTSSTVFPLE  52


 Score = 60.1 bits (144),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 27/36 (75%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = +3

Query  1050  NEVFPSGAQSELLNETTTQNGAFPTQATESKNERKL  1157
             NEVFP GAQSELL E+ TQNG+FPTQA ESKNE+++
Sbjct  215   NEVFPDGAQSELLKESNTQNGSFPTQAAESKNEKEV  250



>ref|XP_010509773.1| PREDICTED: probable methyltransferase PMT25 [Camelina sativa]
Length=771

 Score = 64.3 bits (155),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 44/61 (72%), Gaps = 1/61 (2%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            MA+GKYSRVDG+K+S +Y  TVTI++ + +CLVG WM TSS   P  + + SS ++  D+
Sbjct  1    MAMGKYSRVDGKKSS-SYGLTVTIVLVIFLCLVGAWMFTSSWSAPADSVDYSSSDTAKDV  59

Query  540  K  542
            +
Sbjct  60   E  60



>ref|XP_010413759.1| PREDICTED: probable methyltransferase PMT25 [Camelina sativa]
Length=779

 Score = 63.9 bits (154),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 44/61 (72%), Gaps = 1/61 (2%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            MA+GKYSRVDG+K+S +Y  TVTI++ +++CLVG WM TSS   P  + + SS +   D+
Sbjct  1    MAMGKYSRVDGKKSS-SYGLTVTIVLVISLCLVGAWMFTSSWSAPADSVDYSSSDIAKDV  59

Query  540  K  542
            +
Sbjct  60   E  60



>ref|XP_002881329.1| hypothetical protein ARALYDRAFT_482372 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57588.1| hypothetical protein ARALYDRAFT_482372 [Arabidopsis lyrata subsp. 
lyrata]
Length=773

 Score = 63.2 bits (152),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/61 (48%), Positives = 43/61 (70%), Gaps = 1/61 (2%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            MA+GKYSRVDG+K+S  Y  T+TI++ +++CLVG WM  SSS  P  +   SS ++  D+
Sbjct  1    MAMGKYSRVDGKKSS-TYGLTITIVLLLSLCLVGAWMFMSSSSAPANSVGYSSSDTAKDV  59

Query  540  K  542
            +
Sbjct  60   E  60



>dbj|BAE99717.1| hypothetical protein [Arabidopsis thaliana]
 dbj|BAH20160.1| AT2G34300 [Arabidopsis thaliana]
Length=770

 Score = 62.8 bits (151),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 31/68 (46%), Positives = 46/68 (68%), Gaps = 6/68 (9%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQE-----  524
            MA+GKYSRVDG+K+S +Y  T+TI++ +++CLVG WM  SS   P  ++  SS +     
Sbjct  1    MAMGKYSRVDGKKSS-SYGLTITIVLLLSLCLVGTWMFMSSWSAPADSAGYSSTDTAKDV  59

Query  525  SKTDLKTQ  548
            SK DL+ +
Sbjct  60   SKNDLRKE  67



>ref|NP_180977.1| putative methyltransferase PMT25 [Arabidopsis thaliana]
 ref|NP_001031477.1| putative methyltransferase PMT25 [Arabidopsis thaliana]
 sp|Q0WT31.2|PMTP_ARATH RecName: Full=Probable methyltransferase PMT25 [Arabidopsis thaliana]
 gb|AAC27406.1| unknown protein [Arabidopsis thaliana]
 gb|AEC08950.1| putative methyltransferase PMT25 [Arabidopsis thaliana]
 gb|AEC08951.1| putative methyltransferase PMT25 [Arabidopsis thaliana]
Length=770

 Score = 62.8 bits (151),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 31/68 (46%), Positives = 46/68 (68%), Gaps = 6/68 (9%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQE-----  524
            MA+GKYSRVDG+K+S +Y  T+TI++ +++CLVG WM  SS   P  ++  SS +     
Sbjct  1    MAMGKYSRVDGKKSS-SYGLTITIVLLLSLCLVGTWMFMSSWSAPADSAGYSSTDTAKDV  59

Query  525  SKTDLKTQ  548
            SK DL+ +
Sbjct  60   SKNDLRKE  67



>ref|XP_006410572.1| hypothetical protein EUTSA_v10016285mg [Eutrema salsugineum]
 ref|XP_006410573.1| hypothetical protein EUTSA_v10016285mg [Eutrema salsugineum]
 gb|ESQ52025.1| hypothetical protein EUTSA_v10016285mg [Eutrema salsugineum]
 gb|ESQ52026.1| hypothetical protein EUTSA_v10016285mg [Eutrema salsugineum]
Length=771

 Score = 62.4 bits (150),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 29/61 (48%), Positives = 44/61 (72%), Gaps = 1/61 (2%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            MA+GKYSRVDG+K+S +Y  T+TI++ V++CLVG WM  SS   P  ++  SS ++  D+
Sbjct  1    MAMGKYSRVDGKKSS-SYGLTITIVLVVSLCLVGAWMFMSSWSAPADSAVYSSSDTGKDV  59

Query  540  K  542
            +
Sbjct  60   E  60



>ref|XP_008805853.1| PREDICTED: probable methyltransferase PMT26 [Phoenix dactylifera]
 ref|XP_008805854.1| PREDICTED: probable methyltransferase PMT26 [Phoenix dactylifera]
Length=806

 Score = 62.4 bits (150),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 29/36 (81%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +3

Query  1050  NEVFPSGAQSELLNETTTQNGAFPTQATESKNERKL  1157
             NEVFPSGAQSELLNET TQNGA+ TQA ESKNE+++
Sbjct  225   NEVFPSGAQSELLNETNTQNGAWSTQAVESKNEKEV  260


 Score = 61.6 bits (148),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 38/71 (54%), Positives = 52/71 (73%), Gaps = 3/71 (4%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            MALGK SR D R+ S ++ ST TI+VFVA+CLVG+WMMTSS+V P+    +S   SK++ 
Sbjct  1    MALGKGSRADSRRTSSSFRSTTTIVVFVALCLVGIWMMTSSTVTPLG---MSPPSSKSNA  57

Query  540  KTQVNESNESD  572
            K QV+E++  D
Sbjct  58   KGQVSETDSKD  68



>ref|XP_009102852.1| PREDICTED: probable methyltransferase PMT24 [Brassica rapa]
Length=750

 Score = 62.0 bits (149),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 45/63 (71%), Gaps = 2/63 (3%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNS-EVSSQESKTD  536
            MA+GKYSRVDG+K+S  Y  T+TI++ V++CLVG WM  SS   P + S + SS ++  D
Sbjct  1    MAMGKYSRVDGKKSS-GYGLTITIVLVVSLCLVGAWMFMSSWSAPTEESVDFSSTQTPKD  59

Query  537  LKT  545
            ++T
Sbjct  60   VET  62



>emb|CDX90190.1| BnaA08g17940D [Brassica napus]
Length=687

 Score = 62.0 bits (149),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 31/78 (40%), Positives = 48/78 (62%), Gaps = 9/78 (12%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQE-----  524
            MA+G+YSRVDG+K+S ++  T+TI++ V++ LVG WM  SS   P ++ + SS +     
Sbjct  1    MAMGRYSRVDGKKSSSSFGLTITIVLIVSLSLVGAWMFMSSWSAPTESIDFSSSQTTTKD  60

Query  525  ----SKTDLKTQVNESNE  566
                SK+D   + NE  E
Sbjct  61   VETTSKSDFTNEKNEETE  78



>ref|XP_009109665.1| PREDICTED: probable methyltransferase PMT24 [Brassica rapa]
 ref|XP_009109666.1| PREDICTED: probable methyltransferase PMT24 [Brassica rapa]
Length=682

 Score = 61.6 bits (148),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 31/78 (40%), Positives = 48/78 (62%), Gaps = 9/78 (12%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQE-----  524
            MA+G+YSRVDG+K+S ++  T+TI++ V++ LVG WM  SS   P ++ + SS +     
Sbjct  1    MAMGRYSRVDGKKSSSSFGLTITIVLIVSLSLVGAWMFMSSWSAPTESIDFSSSQTTTKD  60

Query  525  ----SKTDLKTQVNESNE  566
                SK+D   + NE  E
Sbjct  61   VETTSKSDFTNEKNEETE  78



>ref|XP_006295874.1| hypothetical protein CARUB_v10025004mg [Capsella rubella]
 gb|EOA28772.1| hypothetical protein CARUB_v10025004mg [Capsella rubella]
Length=777

 Score = 61.6 bits (148),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 28/62 (45%), Positives = 44/62 (71%), Gaps = 1/62 (2%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            MA+GKYSRVDG+K+S ++  T+TI+V +++CLVG WM  SS   P  + + SS  +  D+
Sbjct  1    MAMGKYSRVDGKKSS-SHGLTITIVVILSLCLVGAWMFMSSWSAPADSVDYSSSNTAKDV  59

Query  540  KT  545
            ++
Sbjct  60   ES  61



>ref|XP_007046783.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein [Theobroma cacao]
 gb|EOX90940.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein [Theobroma cacao]
Length=920

 Score = 61.2 bits (147),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 45/110 (41%), Positives = 59/110 (54%), Gaps = 12/110 (11%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            MA+G  SR + R +S +Y ST+T +VFV +C+ GVWM+TS+SV P Q +           
Sbjct  1    MAIGGKSRSNKRSSSVSYASTITTVVFVTLCVFGVWMLTSNSVAPPQTT-----------  49

Query  540  KTQVNESNESDTGsnesnnasdesntsdGGKAKQFEDTPGDLPDDATKGD  689
             T+    N +D+    SN      N     KA  FED PG LPDDA K D
Sbjct  50   TTRTAADNNADSTFPSSNEEQITKNNDHKDKAV-FEDNPGQLPDDAIKPD  98



>gb|AAG51752.1|AC068667_31 unknown protein; 55790-52851 [Arabidopsis thaliana]
Length=768

 Score = 61.2 bits (147),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 32/73 (44%), Positives = 47/73 (64%), Gaps = 3/73 (4%)
 Frame = +3

Query  366  LGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDLKT  545
            +GKYSRVDG+K+S  Y  T+TI++ V++CLVG WM  SS   P ++ + S+ E   D+ T
Sbjct  1    MGKYSRVDGKKSS-GYGLTITIVLIVSLCLVGAWMFMSSWSAPTESIDFSANERTKDVDT  59

Query  546  QVNE--SNESDTG  578
              ++  S E D G
Sbjct  60   TKSDFKSEEVDRG  72



>ref|XP_002458871.1| hypothetical protein SORBIDRAFT_03g041910 [Sorghum bicolor]
 gb|EES03991.1| hypothetical protein SORBIDRAFT_03g041910 [Sorghum bicolor]
Length=791

 Score = 60.8 bits (146),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 27/36 (75%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = +3

Query  1050  NEVFPSGAQSELLNETTTQNGAFPTQATESKNERKL  1157
             NEVFP GAQSELL E+ TQNG+FPTQA ESKNE+++
Sbjct  214   NEVFPDGAQSELLKESNTQNGSFPTQAAESKNEKEV  249



>gb|ACN28572.1| unknown [Zea mays]
 gb|AFW84363.1| hypothetical protein ZEAMMB73_169809 [Zea mays]
Length=792

 Score = 60.8 bits (146),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 27/36 (75%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = +3

Query  1050  NEVFPSGAQSELLNETTTQNGAFPTQATESKNERKL  1157
             NEVFP GAQSELL E+ TQNG+FPTQA ESKNE+++
Sbjct  215   NEVFPDGAQSELLKESNTQNGSFPTQAAESKNEKEV  250


 Score = 60.5 bits (145),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/54 (48%), Positives = 41/54 (76%), Gaps = 5/54 (9%)
 Frame = +3

Query  360  MALGKYSRVDGRK-----ASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNS  506
            MA G+  ++DGR+     +S ++C+T T+++FVA+CLVG WMMTSS+V P++ S
Sbjct  1    MAFGRGGKMDGRRPSSSSSSSSFCTTTTVVLFVALCLVGAWMMTSSTVFPLEIS  54



>ref|XP_002876067.1| hypothetical protein ARALYDRAFT_485459 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH52326.1| hypothetical protein ARALYDRAFT_485459 [Arabidopsis lyrata subsp. 
lyrata]
Length=134

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 48/71 (68%), Gaps = 8/71 (11%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            MA G+  R + R ++ +Y ST+T+++FVA+C+ GVWM++S+SV+P Q ++ S+       
Sbjct  1    MAFGR-GRGNKRTSTSSYASTITMVIFVALCVFGVWMLSSNSVIPPQITQGST-------  52

Query  540  KTQVNESNESD  572
            +T V E+  SD
Sbjct  53   RTAVAETERSD  63



>ref|XP_009115236.1| PREDICTED: probable methyltransferase PMT24 isoform X1 [Brassica 
rapa]
Length=753

 Score = 60.1 bits (144),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/62 (45%), Positives = 44/62 (71%), Gaps = 1/62 (2%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            MA+GKYSRVDG+K+S  Y  T+TI++ V++ +VG WM  SS   P ++ + SS ++  D+
Sbjct  1    MAMGKYSRVDGKKSS-GYGLTITIVLIVSLSMVGAWMFMSSWSAPTESIDFSSSQTTKDV  59

Query  540  KT  545
            +T
Sbjct  60   ET  61



>emb|CDX99828.1| BnaC05g22500D [Brassica napus]
Length=750

 Score = 60.1 bits (144),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/62 (45%), Positives = 44/62 (71%), Gaps = 1/62 (2%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            MA+GKYSRVDG+K+S  Y  T+TI++ V++ +VG WM  SS   P ++ + SS ++  D+
Sbjct  1    MAMGKYSRVDGKKSS-GYGLTITIVLIVSLSMVGAWMFMSSWSAPTESIDFSSSQTTKDV  59

Query  540  KT  545
            +T
Sbjct  60   ET  61



>emb|CDY48339.1| BnaA09g26820D [Brassica napus]
Length=756

 Score = 60.1 bits (144),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/62 (45%), Positives = 44/62 (71%), Gaps = 1/62 (2%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            MA+GKYSRVDG+K+S  Y  T+TI++ V++ +VG WM  SS   P ++ + SS ++  D+
Sbjct  1    MAMGKYSRVDGKKSS-GYGLTITIVLIVSLSMVGAWMFMSSWSAPTESIDFSSSQTTKDV  59

Query  540  KT  545
            +T
Sbjct  60   ET  61



>gb|ADK88116.1| AtIII19x5-like protein, partial [Arabidopsis halleri]
 gb|ADK88117.1| AtIII19x5-like protein, partial [Arabidopsis halleri]
 gb|ADK88119.1| AtIII19x5-like protein, partial [Arabidopsis halleri]
 gb|ADK88120.1| AtIII19x5-like protein, partial [Arabidopsis halleri]
 gb|ADK88121.1| AtIII19x5-like protein, partial [Arabidopsis halleri]
 gb|ADK88122.1| AtIII19x5-like protein, partial [Arabidopsis halleri]
 gb|ADK88123.1| AtIII19x5-like protein, partial [Arabidopsis halleri]
 gb|ADK88124.1| AtIII19x5-like protein, partial [Arabidopsis halleri]
 gb|ADK88125.1| AtIII19x5-like protein, partial [Arabidopsis halleri]
 gb|ADK88126.1| AtIII19x5-like protein, partial [Arabidopsis halleri]
 gb|ADK88127.1| AtIII19x5-like protein, partial [Arabidopsis halleri]
 gb|ADK88128.1| AtIII19x5-like protein, partial [Arabidopsis halleri]
 gb|ADK88129.1| AtIII19x5-like protein, partial [Arabidopsis halleri]
 gb|ADK88130.1| AtIII19x5-like protein, partial [Arabidopsis halleri]
 gb|ADK88131.1| AtIII19x5-like protein, partial [Arabidopsis halleri]
 gb|ADK88132.1| AtIII19x5-like protein, partial [Arabidopsis halleri]
 gb|ADK88133.1| AtIII19x5-like protein, partial [Arabidopsis halleri]
 gb|ADK88134.1| AtIII19x5-like protein, partial [Arabidopsis halleri]
 gb|ADK88135.1| AtIII19x5-like protein, partial [Arabidopsis halleri]
 gb|ADK88136.1| AtIII19x5-like protein, partial [Arabidopsis halleri]
 gb|ADK88137.1| AtIII19x5-like protein, partial [Arabidopsis halleri]
 gb|ADK88138.1| AtIII19x5-like protein, partial [Arabidopsis halleri]
 gb|ADK88139.1| AtIII19x5-like protein, partial [Arabidopsis halleri]
Length=69

 Score = 55.8 bits (133),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 48/71 (68%), Gaps = 8/71 (11%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            MA G+  R + R ++ +Y ST+T+++FVA+C+ GVWM++S+SV+P Q ++ S+       
Sbjct  1    MAFGR-GRGNKRTSTSSYASTITMVIFVALCVFGVWMLSSNSVIPPQITQGST-------  52

Query  540  KTQVNESNESD  572
            +T V E+  SD
Sbjct  53   RTAVAETERSD  63



>ref|XP_010527657.1| PREDICTED: probable methyltransferase PMT24 [Tarenaya hassleriana]
Length=790

 Score = 60.1 bits (144),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 24/38 (63%), Positives = 32/38 (84%), Gaps = 1/38 (3%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMM  473
            MA+GKYSRVDGRK+S NY  T+T+++FV++CL G WM 
Sbjct  1    MAMGKYSRVDGRKSS-NYGLTITVVMFVSLCLFGAWMF  37



>ref|XP_009115237.1| PREDICTED: probable methyltransferase PMT24 isoform X2 [Brassica 
rapa]
Length=725

 Score = 60.1 bits (144),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/62 (45%), Positives = 44/62 (71%), Gaps = 1/62 (2%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            MA+GKYSRVDG+K+S  Y  T+TI++ V++ +VG WM  SS   P ++ + SS ++  D+
Sbjct  1    MAMGKYSRVDGKKSS-GYGLTITIVLIVSLSMVGAWMFMSSWSAPTESIDFSSSQTTKDV  59

Query  540  KT  545
            +T
Sbjct  60   ET  61



>ref|XP_004970814.1| PREDICTED: probable methyltransferase PMT26-like [Setaria italica]
Length=797

 Score = 59.3 bits (142),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 26/36 (72%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = +3

Query  1050  NEVFPSGAQSELLNETTTQNGAFPTQATESKNERKL  1157
             NEVFP GA+SELL E+ TQNG+FPTQA ESKNE+++
Sbjct  220   NEVFPDGAESELLKESNTQNGSFPTQAAESKNEKEV  255



>emb|CDY44314.1| BnaA07g07980D [Brassica napus]
Length=744

 Score = 59.3 bits (142),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 27/49 (55%), Positives = 36/49 (73%), Gaps = 1/49 (2%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNS  506
            MA+GKYSRVDG+K+S  Y  T+TI++ V++CLVG WM  SS   P + S
Sbjct  1    MAMGKYSRVDGKKSS-GYGLTITIVLAVSLCLVGAWMFMSSWSAPTEES  48



>ref|XP_010679826.1| PREDICTED: probable methyltransferase PMT27 [Beta vulgaris subsp. 
vulgaris]
Length=953

 Score = 59.3 bits (142),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 41/124 (33%), Positives = 59/124 (48%), Gaps = 38/124 (31%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPN-YCSTVTIIVFVAVCLVGVWMMTSSSVV-------------PV  497
            MA G+  R + R +S N Y ST+T +VF+A+C++GVWM+TS + +             P 
Sbjct  1    MAFGRM-RNNKRPSSSNSYVSTITTVVFIALCVLGVWMLTSDNAISPNATTRTSTTTTPN  59

Query  498  QNSEVSSQESKTDLKTQVNESNESDTGsnesnnasdesntsdGGKAKQFEDTPGDLPDDA  677
            ++ +V     K+D     N+ N+  T                      FED PGDLPDDA
Sbjct  60   ESHDV----IKSDDPVTFNKPNDRATSGT-------------------FEDNPGDLPDDA  96

Query  678  TKGD  689
             K D
Sbjct  97   LKND  100



>emb|CDM85080.1| unnamed protein product [Triticum aestivum]
Length=803

 Score = 59.3 bits (142),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 26/35 (74%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = +3

Query  1050  NEVFPSGAQSELLNETTTQNGAFPTQATESKNERK  1154
             NEVFP GAQSELL E+ T+NG+FPTQA ESKNE++
Sbjct  226   NEVFPDGAQSELLKESNTENGSFPTQAAESKNEKE  260



>gb|EMT17461.1| hypothetical protein F775_31288 [Aegilops tauschii]
Length=795

 Score = 58.9 bits (141),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 26/35 (74%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = +3

Query  1050  NEVFPSGAQSELLNETTTQNGAFPTQATESKNERK  1154
             NEVFP GAQSELL E+ T+NG+FPTQA ESKNE++
Sbjct  218   NEVFPDGAQSELLKESNTENGSFPTQAAESKNEKE  252



>ref|XP_006828886.2| PREDICTED: probable methyltransferase PMT24 [Amborella trichopoda]
Length=896

 Score = 58.9 bits (141),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 30/87 (34%), Positives = 43/87 (49%), Gaps = 25/87 (29%)
 Frame = +3

Query  429  IIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDLKTQVNESNESDTGsnesnnasde  608
            + +FV  CL+GVWM+TSS+V P Q    +    + + +TQV+ S                
Sbjct  1    MTMFVCFCLLGVWMLTSSAVAPGQRGGFAQSTIRKETRTQVSSS----------------  44

Query  609  sntsdGGKAKQFEDTPGDLPDDATKGD  689
                     + +ED PGDLPDDA +GD
Sbjct  45   ---------RAYEDNPGDLPDDAIRGD  62



>emb|CDY66721.1| BnaC03g76010D, partial [Brassica napus]
Length=529

 Score = 58.5 bits (140),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 25/56 (45%), Positives = 40/56 (71%), Gaps = 0/56 (0%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQES  527
            MA+G+YSRVDG K+S ++  T+TI++ V++ LVG WM  SS   P ++ + SS ++
Sbjct  1    MAMGRYSRVDGNKSSSSFGLTITIVLIVSLSLVGAWMFMSSWSAPTESIDFSSSQA  56



>ref|XP_010030876.1| PREDICTED: probable methyltransferase PMT27 [Eucalyptus grandis]
 gb|KCW56680.1| hypothetical protein EUGRSUZ_I02378 [Eucalyptus grandis]
Length=964

 Score = 58.9 bits (141),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 47/110 (43%), Positives = 63/110 (57%), Gaps = 6/110 (5%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            MA+G+ SR + R +  +Y STVT IVFV +C+VGVWM+TS S +P Q +   S  S T  
Sbjct  1    MAIGRSSRGNKRSSYTSYTSTVTTIVFVTLCVVGVWMLTSDSFIPPQTTTKRSSSSSTTA  60

Query  540  KTQVNESNESDTGsnesnnasdesntsdGGKAKQFEDTPGDLPDDATKGD  689
             T    +   D  S+ S    D+ +T+       +ED PGDLPDDA K D
Sbjct  61   ATTAATATNDDFSSSSSVKTDDKKDTTS------YEDNPGDLPDDAIKSD  104



>ref|XP_010271514.1| PREDICTED: probable methyltransferase PMT27 [Nelumbo nucifera]
Length=983

 Score = 58.2 bits (139),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 32/93 (34%), Positives = 47/93 (51%), Gaps = 21/93 (23%)
 Frame = +3

Query  411  YCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDLKTQVNESNESDTGsnes  590
            Y ST+T+++FVA C++G+WM+TSS+++P Q++  S+  S  D                  
Sbjct  42   YVSTITVVIFVASCVIGLWMLTSSTLIPRQSTRTSNDISSAD------------------  83

Query  591  nnasdesntsdGGKAKQFEDTPGDLPDDATKGD  689
               S  +       A  F D   DLPDDA KGD
Sbjct  84   ---SHLAKVDPRKDAPAFGDAQRDLPDDALKGD  113



>gb|ADK88118.1| AtIII19x5-like protein, partial [Arabidopsis halleri]
Length=69

 Score = 53.5 bits (127),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 23/54 (43%), Positives = 42/54 (78%), Gaps = 1/54 (2%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQ  521
            MA G+  R + R ++ +Y ST+T+++FVA+C+ GVWM++S+SV+P Q ++ S++
Sbjct  1    MAFGR-GRGNKRTSTSSYASTITMVIFVALCVFGVWMLSSNSVIPPQITQGSTR  53



>gb|KHN16949.1| Putative methyltransferase PMT26 [Glycine soja]
Length=832

 Score = 57.8 bits (138),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 27/35 (77%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = +3

Query  1050  NEVFPSGAQSELLNETTTQNGAFPTQATESKNERK  1154
             NEV+PS AQSELLNE+TTQNG+F TQA ESKNE++
Sbjct  256   NEVYPSVAQSELLNESTTQNGSFTTQAAESKNEKE  290



>ref|XP_008241902.1| PREDICTED: probable methyltransferase PMT27 [Prunus mume]
Length=983

 Score = 57.8 bits (138),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 42/100 (42%), Positives = 60/100 (60%), Gaps = 7/100 (7%)
 Frame = +3

Query  411  YCSTVTIIVFVAVCLVGVWMMTSSSV-VPVQNSEVSSQ---ESKTD--LKTQVN-ESNES  569
            Y STVTI VF+AVC+  VWM+  S+  VP Q +  S++    + TD    T +N  S+E 
Sbjct  16   YASTVTITVFIAVCVFAVWMLNYSNTGVPPQTTNRSTRTPTTASTDDTTNTALNMASSED  75

Query  570  DTGsnesnnasdesntsdGGKAKQFEDTPGDLPDDATKGD  689
            D     + + S++++ ++G   K FED PGDLPDDA K D
Sbjct  76   DQVQVITKSTSNDNSNNNGENPKAFEDNPGDLPDDAIKSD  115



>ref|XP_007203224.1| hypothetical protein PRUPE_ppa000863mg [Prunus persica]
 gb|EMJ04423.1| hypothetical protein PRUPE_ppa000863mg [Prunus persica]
Length=977

 Score = 57.4 bits (137),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 38/100 (38%), Positives = 55/100 (55%), Gaps = 7/100 (7%)
 Frame = +3

Query  411  YCSTVTIIVFVAVCLVGVWMMTSSSV-VPVQNSEVSSQESKTDLKTQVNE------SNES  569
            Y STVTI VF+AVC+  VWM+  S+  VP Q +  S++ + T              S+E 
Sbjct  16   YASTVTITVFIAVCVFAVWMLNYSNTGVPPQTTNRSTRIATTASTDDTTNTALNMASSED  75

Query  570  DTGsnesnnasdesntsdGGKAKQFEDTPGDLPDDATKGD  689
            D     + + S++++ ++    K FED PGDLPDDA K D
Sbjct  76   DQAQVITKSTSNDNSNNNSENPKAFEDNPGDLPDDAIKSD  115



>emb|CDY17234.1| BnaA05g09540D [Brassica napus]
Length=762

 Score = 57.0 bits (136),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/39 (62%), Positives = 33/39 (85%), Gaps = 1/39 (3%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMT  476
            MA+GKYSRVDG+K+S +Y  T+TI++ V++CLVG WM T
Sbjct  1    MAMGKYSRVDGKKSS-SYGLTITIVLVVSLCLVGTWMFT  38



>ref|XP_009143789.1| PREDICTED: probable methyltransferase PMT25 [Brassica rapa]
Length=762

 Score = 57.0 bits (136),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/39 (62%), Positives = 33/39 (85%), Gaps = 1/39 (3%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMT  476
            MA+GKYSRVDG+K+S +Y  T+TI++ V++CLVG WM T
Sbjct  1    MAMGKYSRVDGKKSS-SYGLTITIVLVVSLCLVGTWMFT  38



>gb|ABA96619.1| dehydration-responsive protein, putative [Oryza sativa Japonica 
Group]
Length=990

 Score = 57.0 bits (136),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/50 (50%), Positives = 36/50 (72%), Gaps = 8/50 (16%)
 Frame = +3

Query  372  KYSRVDG--------RKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPV  497
            +Y R+DG        R++SP+ CST TI++FVA+CLVG WMM+S+  VP+
Sbjct  8    RYQRLDGNGGGGGGGRRSSPSSCSTATIVLFVALCLVGAWMMSSTGNVPM  57



>gb|EAZ19833.1| hypothetical protein OsJ_35417 [Oryza sativa Japonica Group]
Length=990

 Score = 57.0 bits (136),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/50 (50%), Positives = 36/50 (72%), Gaps = 8/50 (16%)
 Frame = +3

Query  372  KYSRVDG--------RKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPV  497
            +Y R+DG        R++SP+ CST TI++FVA+CLVG WMM+S+  VP+
Sbjct  8    RYQRLDGNGGGGGGGRRSSPSSCSTATIVLFVALCLVGAWMMSSTGNVPM  57



>emb|CDX84330.1| BnaC04g10920D [Brassica napus]
Length=713

 Score = 56.6 bits (135),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 24/39 (62%), Positives = 33/39 (85%), Gaps = 1/39 (3%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMT  476
            MA+GKYSRVDG+K+S +Y  T+TI++ V++CLVG WM T
Sbjct  1    MAMGKYSRVDGKKSS-SYGLTITIVLIVSLCLVGTWMFT  38



>gb|EAY82457.1| hypothetical protein OsI_37674 [Oryza sativa Indica Group]
Length=932

 Score = 56.6 bits (135),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 25/50 (50%), Positives = 36/50 (72%), Gaps = 8/50 (16%)
 Frame = +3

Query  372  KYSRVDG--------RKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPV  497
            +Y R+DG        R++SP+ CST TI++FVA+CLVG WMM+S+  VP+
Sbjct  8    RYQRLDGNGGGGGGGRRSSPSSCSTATIVLFVALCLVGAWMMSSTGNVPM  57



>ref|XP_006365916.1| PREDICTED: probable methyltransferase PMT24-like [Solanum tuberosum]
Length=768

 Score = 55.8 bits (133),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 26/54 (48%), Positives = 39/54 (72%), Gaps = 2/54 (4%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSV-VPVQNSEVSS  518
            MA G YS   GRK+S ++CS +T++ F+ +  VG+WM+ SSS  + +QNSE+SS
Sbjct  1    MAGGSYSHSGGRKSS-DFCSKLTVVTFLGISCVGIWMLISSSFSITLQNSEISS  53



>ref|XP_009411900.1| PREDICTED: probable methyltransferase PMT26 [Musa acuminata subsp. 
malaccensis]
 ref|XP_009411901.1| PREDICTED: probable methyltransferase PMT26 [Musa acuminata subsp. 
malaccensis]
Length=750

 Score = 55.5 bits (132),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 22/46 (48%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPV  497
            MA G+  + + R++S +YC   TI+VFVA+C VG+WM++S ++VPV
Sbjct  1    MAFGRNMQTNNRRSS-SYCLKTTILVFVALCFVGIWMLSSLNIVPV  45


 Score = 52.0 bits (123),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 25/36 (69%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +3

Query  1050  NEVFPSGAQSELLNETTTQNGAFPTQATESKNERKL  1157
             +EVFPSG QSELL ET  QNGA+ TQA ESKNE ++
Sbjct  172   SEVFPSGDQSELLKETNGQNGAWSTQAVESKNEEEV  207



>ref|XP_010679267.1| PREDICTED: probable methyltransferase PMT26 [Beta vulgaris subsp. 
vulgaris]
 ref|XP_010679271.1| PREDICTED: probable methyltransferase PMT26 [Beta vulgaris subsp. 
vulgaris]
 ref|XP_010679275.1| PREDICTED: probable methyltransferase PMT26 [Beta vulgaris subsp. 
vulgaris]
Length=669

 Score = 53.9 bits (128),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/42 (55%), Positives = 31/42 (74%), Gaps = 1/42 (2%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSS  485
            MALG+Y+RVDG+  SPN+C  + I+ FV+ CL+  WM  SSS
Sbjct  1    MALGRYARVDGQN-SPNHCLVICIVGFVSTCLMAAWMTMSSS  41



>ref|XP_003580900.1| PREDICTED: probable methyltransferase PMT26 [Brachypodium distachyon]
Length=716

 Score = 53.9 bits (128),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 27/52 (52%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = +3

Query  360  MALGKYSRVDGRK---ASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNS  506
            MALG ++R+D R+    S +YCS  T++VFVA+CLVGVWM +S  V P   S
Sbjct  1    MALG-HTRLDVRRLQQHSSSYCSATTVVVFVALCLVGVWMASSMLVTPADFS  51



>ref|XP_010063906.1| PREDICTED: probable methyltransferase PMT25 isoform X1 [Eucalyptus 
grandis]
 ref|XP_010063907.1| PREDICTED: probable methyltransferase PMT25 isoform X2 [Eucalyptus 
grandis]
 gb|KCW71194.1| hypothetical protein EUGRSUZ_F04285 [Eucalyptus grandis]
Length=825

 Score = 53.5 bits (127),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 29/66 (44%), Positives = 41/66 (62%), Gaps = 3/66 (5%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWM-MTSSSVVPVQNSEVSSQESKTD  536
            MA G     D RK SPNYCS ++++VFVA  L  +W+ + SSS  PV+N  +  QE+ + 
Sbjct  1    MASGNIRLFDVRK-SPNYCSRISLVVFVAFSLFAIWIFLPSSSTFPVENPNLLYQENDS-  58

Query  537  LKTQVN  554
            L  +VN
Sbjct  59   LGHRVN  64



>ref|NP_001045015.1| Os01g0883900 [Oryza sativa Japonica Group]
 dbj|BAF06929.1| Os01g0883900 [Oryza sativa Japonica Group]
 dbj|BAG94735.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG99723.1| unnamed protein product [Oryza sativa Japonica Group]
Length=806

 Score = 53.1 bits (126),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 24/35 (69%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +3

Query  1050  NEVFPSGAQSELLNETTTQNGAFPTQATESKNERK  1154
             NEVFP GAQSELL E+ T+NG+F TQ  ESKNE++
Sbjct  229   NEVFPDGAQSELLKESNTENGSFKTQDAESKNEKE  263


 Score = 52.8 bits (125),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 27/49 (55%), Positives = 41/49 (84%), Gaps = 2/49 (4%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPN--YCSTVTIIVFVAVCLVGVWMMTSSSVVPVQ  500
            MA G+ S++DGR++SP+   C+T T++VFVA+CLVG WMMTSS++ P++
Sbjct  1    MAFGRGSKMDGRRSSPSSSLCTTTTVVVFVALCLVGAWMMTSSTIFPLE  49



>ref|XP_006645134.1| PREDICTED: probable methyltransferase PMT26-like [Oryza brachyantha]
Length=798

 Score = 53.1 bits (126),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 24/35 (69%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +3

Query  1050  NEVFPSGAQSELLNETTTQNGAFPTQATESKNERK  1154
             NEVFP GAQSELL E+ T+NG+F TQ  ESKNE++
Sbjct  221   NEVFPDGAQSELLKESNTENGSFSTQDAESKNEKE  255



>ref|XP_010263954.1| PREDICTED: probable methyltransferase PMT27 [Nelumbo nucifera]
Length=934

 Score = 52.8 bits (125),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 33/104 (32%), Positives = 50/104 (48%), Gaps = 25/104 (24%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            MA GK +R   R  S +Y STVT+++F+A+C++G+WM+TSS +     S  +   S T+ 
Sbjct  1    MAFGK-ARSSKRSPS-SYTSTVTMVIFIAICVIGLWMLTSSFIPRQTTSTANDLSSSTNS  58

Query  540  KTQVNESNESDTGsnesnnasdesntsdGGKAKQFEDTPGDLPD  671
            +T     +                          FED+ GDLPD
Sbjct  59   RTHYQHKD-----------------------PPAFEDSQGDLPD  79



>ref|XP_002310282.2| hypothetical protein POPTR_0007s13620g [Populus trichocarpa]
 gb|EEE90732.2| hypothetical protein POPTR_0007s13620g [Populus trichocarpa]
Length=847

 Score = 52.8 bits (125),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 30/93 (32%), Positives = 50/93 (54%), Gaps = 6/93 (6%)
 Frame = +3

Query  411  YCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDLKTQVNESNESDTGsnes  590
            Y ST+T I F+A+C +GVWM+TS+   P    + ++  +K  + T  + + ++D   +  
Sbjct  16   YTSTLTTIAFIALCAIGVWMLTSN---PQVTPQTTTHVAKPVITTTTDIAADADVSISNE  72

Query  591  nnasdesntsdGGKAKQFEDTPGDLPDDATKGD  689
               ++  +         +ED PGDLPDDA K D
Sbjct  73   VEHTESRSKK---DTHVYEDNPGDLPDDAIKSD  102



>gb|EAY76734.1| hypothetical protein OsI_04689 [Oryza sativa Indica Group]
Length=798

 Score = 52.8 bits (125),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 24/35 (69%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +3

Query  1050  NEVFPSGAQSELLNETTTQNGAFPTQATESKNERK  1154
             NEVFP GAQSELL E+ T+NG+F TQ  ESKNE++
Sbjct  221   NEVFPDGAQSELLKESNTENGSFKTQDAESKNEKE  255



>dbj|BAD82580.1| ankyrin-like protein [Oryza sativa Japonica Group]
 gb|EAZ14397.1| hypothetical protein OsJ_04316 [Oryza sativa Japonica Group]
Length=798

 Score = 52.8 bits (125),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 24/35 (69%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +3

Query  1050  NEVFPSGAQSELLNETTTQNGAFPTQATESKNERK  1154
             NEVFP GAQSELL E+ T+NG+F TQ  ESKNE++
Sbjct  221   NEVFPDGAQSELLKESNTENGSFKTQDAESKNEKE  255



>ref|XP_011025891.1| PREDICTED: LOW QUALITY PROTEIN: probable methyltransferase PMT27 
[Populus euphratica]
Length=1039

 Score = 52.8 bits (125),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 32/93 (34%), Positives = 51/93 (55%), Gaps = 6/93 (6%)
 Frame = +3

Query  411  YCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDLKTQVNESNESDTGsnes  590
            Y ST+T I F+A+C +GVWM+TS+  V  Q    ++  +K  + T  + + ++D   +  
Sbjct  16   YTSTLTTIAFIALCAIGVWMLTSNPQVTPQ---TTTHVTKPVITTTTDIAADADVSISNE  72

Query  591  nnasdesntsdGGKAKQFEDTPGDLPDDATKGD  689
               ++  +  D      +ED PGDLPDDA K D
Sbjct  73   VERTESRSKKD---THVYEDNPGDLPDDAIKSD  102



>ref|XP_011658034.1| PREDICTED: probable methyltransferase PMT27 [Cucumis sativus]
 gb|KGN48886.1| hypothetical protein Csa_6G504660 [Cucumis sativus]
Length=928

 Score = 52.4 bits (124),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 43/110 (39%), Positives = 61/110 (55%), Gaps = 4/110 (4%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            MALG+        +S +Y STVT +VF+A+C++GVWM+TS+S VP Q +  +S +S T  
Sbjct  1    MALGRPRSSKRSSSSSSYASTVTTVVFLALCVLGVWMLTSNSAVPPQTTTRTSSDSSTSS  60

Query  540  KTQVNESNESDTGsnesnnasdesntsdGGKAKQFEDTPGDLPDDATKGD  689
             + +  + +  + S E      E   S       FED PGDLP DA K D
Sbjct  61   TSTIATTTDFVSSSEEPQLPKSEDKESTPA----FEDNPGDLPLDAIKSD  106



>ref|XP_009346291.1| PREDICTED: probable methyltransferase PMT27 [Pyrus x bretschneideri]
Length=962

 Score = 52.4 bits (124),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 38/97 (39%), Positives = 57/97 (59%), Gaps = 17/97 (18%)
 Frame = +3

Query  420  TVTIIVFVAVCLVGVWMMT-SSSVVPVQNSEV------SSQESKTDLKTQVNESNESDTG  578
            TVTI+VF+AVC++ VWM+  S+S VP  ++        SS ++ +DL   + +S  S   
Sbjct  22   TVTIMVFIAVCVLAVWMLNYSNSGVPQTSTSARTATISSSDDAASDLV--ITKSTNS---  76

Query  579  snesnnasdesntsdGGKAKQFEDTPGDLPDDATKGD  689
                   ++++N ++  K K FED PGDLPDDA K D
Sbjct  77   -----YDNNDNNNNNNEKPKAFEDNPGDLPDDAIKSD  108



>ref|XP_004237701.1| PREDICTED: probable methyltransferase PMT24 [Solanum lycopersicum]
Length=768

 Score = 52.4 bits (124),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 24/54 (44%), Positives = 38/54 (70%), Gaps = 2/54 (4%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSV-VPVQNSEVSS  518
            MA   YS   GRK+S ++CS +T++ F+ +  +G+WM+ SSS  + +QNSE+SS
Sbjct  1    MAGESYSHSGGRKSS-DFCSKLTVVTFLGISCIGIWMLISSSFSITLQNSEISS  53



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3138588462517