BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig419

Length=924
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_003540159.1|  PREDICTED: serine/threonine-protein kinase S...    224   1e-66   Glycine max [soybeans]
ref|XP_009776074.1|  PREDICTED: serine/threonine-protein kinase S...    223   3e-66   Nicotiana sylvestris
ref|XP_009621087.1|  PREDICTED: serine/threonine-protein kinase S...    223   5e-66   Nicotiana tomentosiformis
ref|XP_002303162.2|  hypothetical protein POPTR_0003s01110g             222   8e-66   Populus trichocarpa [western balsam poplar]
gb|KDO50087.1|  hypothetical protein CISIN_1g0187341mg                  216   8e-66   Citrus sinensis [apfelsine]
ref|XP_009602813.1|  PREDICTED: serine/threonine-protein kinase S...    222   8e-66   Nicotiana tomentosiformis
gb|KHN45467.1|  Serine/threonine-protein kinase SRK2B                   222   9e-66   Glycine soja [wild soybean]
ref|XP_009804586.1|  PREDICTED: serine/threonine-protein kinase S...    221   2e-65   Nicotiana sylvestris
ref|XP_006384980.1|  hypothetical protein POPTR_0004s22770g             215   2e-65   
ref|XP_009774903.1|  PREDICTED: serine/threonine-protein kinase S...    216   2e-65   Nicotiana sylvestris
ref|NP_001274892.1|  serine/threonine-protein kinase SRK2B-like         221   2e-65   Solanum tuberosum [potatoes]
ref|XP_004230475.1|  PREDICTED: serine/threonine-protein kinase S...    221   2e-65   Solanum lycopersicum
gb|EYU26515.1|  hypothetical protein MIMGU_mgv1a009739mg                220   3e-65   Erythranthe guttata [common monkey flower]
ref|XP_006384983.1|  kinase family protein                              219   6e-65   
ref|XP_006384982.1|  hypothetical protein POPTR_0004s22790g             220   8e-65   
ref|XP_011028283.1|  PREDICTED: serine/threonine-protein kinase S...    218   3e-64   Populus euphratica
emb|CBI29763.3|  unnamed protein product                                217   3e-64   Vitis vinifera
ref|XP_002269221.1|  PREDICTED: serine/threonine-protein kinase S...    218   4e-64   Vitis vinifera
emb|CAN78793.1|  hypothetical protein VITISV_028464                     218   4e-64   Vitis vinifera
ref|XP_011028282.1|  PREDICTED: serine/threonine-protein kinase S...    216   4e-64   Populus euphratica
ref|XP_007148531.1|  hypothetical protein PHAVU_006G216400g             217   5e-64   Phaseolus vulgaris [French bean]
ref|XP_011464827.1|  PREDICTED: serine/threonine-protein kinase S...    217   5e-64   Fragaria vesca subsp. vesca
emb|CDO97575.1|  unnamed protein product                                217   7e-64   Coffea canephora [robusta coffee]
ref|XP_010242684.1|  PREDICTED: serine/threonine-protein kinase S...    217   7e-64   Nelumbo nucifera [Indian lotus]
ref|XP_008218556.1|  PREDICTED: serine/threonine-protein kinase S...    217   7e-64   Prunus mume [ume]
ref|XP_003592981.1|  Serine/threonine protein kinase                    214   7e-64   
ref|XP_011009382.1|  PREDICTED: serine/threonine-protein kinase S...    216   1e-63   Populus euphratica
ref|XP_006431824.1|  hypothetical protein CICLE_v10001672mg             216   1e-63   Citrus clementina [clementine]
ref|XP_009348751.1|  PREDICTED: serine/threonine-protein kinase S...    216   2e-63   Pyrus x bretschneideri [bai li]
ref|XP_010101152.1|  Serine/threonine-protein kinase SAPK7              216   2e-63   Morus notabilis
gb|KJB79237.1|  hypothetical protein B456_013G038800                    215   3e-63   Gossypium raimondii
gb|AFK33547.1|  unknown                                                 215   3e-63   Medicago truncatula
ref|XP_003592980.1|  Serine/threonine protein kinase                    215   3e-63   Medicago truncatula
gb|KJB79236.1|  hypothetical protein B456_013G038800                    215   4e-63   Gossypium raimondii
ref|XP_011087723.1|  PREDICTED: serine/threonine-protein kinase S...    214   4e-63   Sesamum indicum [beniseed]
ref|XP_011092341.1|  PREDICTED: serine/threonine-protein kinase S...    215   5e-63   Sesamum indicum [beniseed]
ref|XP_006471015.1|  PREDICTED: serine/threonine-protein kinase S...    214   6e-63   Citrus sinensis [apfelsine]
ref|XP_007222266.1|  hypothetical protein PRUPE_ppa007946mg             214   1e-62   Prunus persica
gb|KHG21689.1|  Serine/threonine-protein kinase SRK2B                   212   1e-62   Gossypium arboreum [tree cotton]
gb|EYU35455.1|  hypothetical protein MIMGU_mgv1a008963mg                213   2e-62   Erythranthe guttata [common monkey flower]
gb|KJB47471.1|  hypothetical protein B456_008G027800                    210   3e-62   Gossypium raimondii
ref|XP_002530676.1|  Serine/threonine-protein kinase ASK1, putative     213   3e-62   Ricinus communis
ref|XP_008361703.1|  PREDICTED: serine/threonine-protein kinase S...    212   4e-62   
ref|XP_008339496.1|  PREDICTED: serine/threonine-protein kinase S...    212   4e-62   
ref|XP_007042267.1|  SNF1-related protein kinase 2.10 isoform 2         212   4e-62   
ref|XP_010547458.1|  PREDICTED: serine/threonine-protein kinase S...    212   6e-62   Tarenaya hassleriana [spider flower]
gb|KJB47472.1|  hypothetical protein B456_008G027800                    211   7e-62   Gossypium raimondii
gb|KHG21217.1|  Serine/threonine-protein kinase SRK2B                   209   1e-61   Gossypium arboreum [tree cotton]
ref|XP_009104154.1|  PREDICTED: serine/threonine-protein kinase S...    211   1e-61   Brassica rapa
gb|KJB47468.1|  hypothetical protein B456_008G027800                    211   1e-61   Gossypium raimondii
emb|CDY20973.1|  BnaA08g25520D                                          211   1e-61   Brassica napus [oilseed rape]
ref|XP_004485476.1|  PREDICTED: serine/threonine-protein kinase S...    210   3e-61   Cicer arietinum [garbanzo]
ref|XP_007042266.1|  SNF1-related protein kinase 2.10 isoform 1         211   5e-61   
ref|XP_003531593.1|  PREDICTED: serine/threonine-protein kinase S...    209   5e-61   Glycine max [soybeans]
gb|KFK43389.1|  hypothetical protein AALP_AA1G119700                    209   9e-61   Arabis alpina [alpine rockcress]
gb|AAO69666.1|  protein kinase SPK-3                                    202   9e-61   Phaseolus acutifolius
ref|XP_012071302.1|  PREDICTED: serine/threonine-protein kinase S...    208   1e-60   Jatropha curcas
ref|XP_009144406.1|  PREDICTED: serine/threonine-protein kinase S...    208   1e-60   Brassica rapa
ref|XP_006300518.1|  hypothetical protein CARUB_v10020517mg             207   5e-60   Capsella rubella
ref|XP_006847010.1|  PREDICTED: serine/threonine-protein kinase S...    206   6e-60   
gb|AFK42988.1|  unknown                                                 206   7e-60   Lotus japonicus
ref|XP_010418041.1|  PREDICTED: serine/threonine-protein kinase S...    207   7e-60   Camelina sativa [gold-of-pleasure]
ref|XP_010430082.1|  PREDICTED: serine/threonine-protein kinase S...    207   7e-60   Camelina sativa [gold-of-pleasure]
gb|AFK42326.1|  unknown                                                 206   8e-60   Lotus japonicus
ref|XP_008449831.1|  PREDICTED: serine/threonine-protein kinase S...    206   8e-60   Cucumis melo [Oriental melon]
ref|XP_010473290.1|  PREDICTED: serine/threonine-protein kinase S...    206   8e-60   Camelina sativa [gold-of-pleasure]
ref|XP_006426422.1|  hypothetical protein CICLE_v10025965mg             206   8e-60   Citrus clementina [clementine]
ref|XP_006466196.1|  PREDICTED: serine/threonine-protein kinase S...    206   8e-60   Citrus sinensis [apfelsine]
ref|XP_006392094.1|  hypothetical protein EUTSA_v10023544mg             206   1e-59   Eutrema salsugineum [saltwater cress]
ref|NP_001236743.1|  protein kinase 3                                   206   1e-59   Glycine max [soybeans]
gb|KEH35656.1|  sucrose non-fermenting-like kinase 2 family protein     206   1e-59   Medicago truncatula
gb|KGN54755.1|  hypothetical protein Csa_4G453650                       205   2e-59   Cucumis sativus [cucumbers]
ref|XP_007049926.1|  Kinase superfamily protein isoform 1               205   2e-59   
ref|XP_010096415.1|  Serine/threonine-protein kinase SRK2A              205   2e-59   
ref|XP_007049927.1|  Kinase superfamily protein isoform 2               205   2e-59   
ref|XP_007049928.1|  Kinase superfamily protein isoform 3               205   2e-59   Theobroma cacao [chocolate]
ref|XP_004144354.1|  PREDICTED: serine/threonine-protein kinase S...    205   2e-59   Cucumis sativus [cucumbers]
gb|KHN17430.1|  Serine/threonine-protein kinase SAPK7                   204   4e-59   Glycine soja [wild soybean]
ref|XP_009355252.1|  PREDICTED: serine/threonine-protein kinase S...    204   4e-59   Pyrus x bretschneideri [bai li]
ref|XP_007159914.1|  hypothetical protein PHAVU_002G278200g             204   5e-59   Phaseolus vulgaris [French bean]
gb|AFK41211.1|  unknown                                                 198   6e-59   Lotus japonicus
gb|AFK47198.1|  unknown                                                 204   6e-59   Medicago truncatula
gb|AET04893.2|  sucrose non-fermenting-like kinase 2 family protein     204   7e-59   Medicago truncatula
ref|XP_003630417.1|  Serine/threonine protein kinase                    204   8e-59   
gb|KHG01745.1|  Serine/threonine-protein kinase SAPK7                   201   9e-59   Gossypium arboreum [tree cotton]
ref|NP_001238298.1|  protein kinase                                     203   9e-59   Glycine max [soybeans]
ref|XP_003526896.1|  PREDICTED: serine/threonine-protein kinase S...    203   1e-58   Glycine max [soybeans]
gb|KHN09673.1|  Serine/threonine-protein kinase SRK2A                   203   1e-58   Glycine soja [wild soybean]
gb|AFK36100.1|  unknown                                                 202   2e-58   Medicago truncatula
emb|CDY03768.1|  BnaC01g28850D                                          208   2e-58   
ref|XP_004503013.1|  PREDICTED: serine/threonine-protein kinase S...    202   2e-58   Cicer arietinum [garbanzo]
gb|KJB71410.1|  hypothetical protein B456_011G121900                    201   5e-58   Gossypium raimondii
gb|AID23890.1|  sucrose non-fermenting 1-related protein kinase 2       201   6e-58   Gossypium hirsutum [American cotton]
gb|AFP49839.1|  SNF1-related kinase                                     197   6e-58   Cucumis sativus [cucumbers]
gb|AIO02852.1|  phloem small RNA-binding protein kinase 1               201   6e-58   Cucurbita maxima [Boston marrow]
gb|KHN31217.1|  Serine/threonine-protein kinase SRK2A                   201   6e-58   Glycine soja [wild soybean]
ref|XP_002886574.1|  hypothetical protein ARALYDRAFT_475237             201   6e-58   
dbj|BAN15745.1|  subfamily 2 of SNF1-related protein kinase             201   7e-58   Dianthus caryophyllus [carnation]
ref|XP_008442077.1|  PREDICTED: serine/threonine-protein kinase S...    201   9e-58   Cucumis melo [Oriental melon]
ref|XP_004503865.1|  PREDICTED: serine/threonine-protein kinase S...    201   9e-58   Cicer arietinum [garbanzo]
ref|NP_001242600.1|  uncharacterized protein LOC100804018               201   1e-57   
ref|NP_176290.1|  SNF1-related protein kinase 2.10                      201   2e-57   Arabidopsis thaliana [mouse-ear cress]
gb|AAM67112.1|  putative serine/threonine-protein kinase                201   2e-57   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008347910.1|  PREDICTED: serine/threonine-protein kinase S...    199   5e-57   
ref|XP_002513284.1|  Serine/threonine-protein kinase SAPK7, putative    192   6e-57   
ref|XP_010930862.1|  PREDICTED: serine/threonine-protein kinase S...    199   6e-57   Elaeis guineensis
emb|CAA06503.1|  protein kinase                                         199   6e-57   Craterostigma plantagineum
ref|XP_007137814.1|  hypothetical protein PHAVU_009G157800g             198   7e-57   Phaseolus vulgaris [French bean]
ref|XP_010025673.1|  PREDICTED: serine/threonine-protein kinase S...    198   1e-56   Eucalyptus grandis [rose gum]
ref|XP_009780712.1|  PREDICTED: serine/threonine-protein kinase S...    198   2e-56   Nicotiana sylvestris
ref|XP_004146378.1|  PREDICTED: serine/threonine-protein kinase S...    197   2e-56   Cucumis sativus [cucumbers]
gb|KGN54829.1|  hypothetical protein Csa_4G515040                       197   2e-56   Cucumis sativus [cucumbers]
ref|XP_006417402.1|  hypothetical protein EUTSA_v10007985mg             197   2e-56   Eutrema salsugineum [saltwater cress]
ref|XP_009602316.1|  PREDICTED: serine/threonine-protein kinase S...    197   3e-56   Nicotiana tomentosiformis
emb|CAE54589.1|  serine/threonine protein kinase                        194   3e-56   Fagus sylvatica
emb|CAE54075.1|  serine/threonine-protein kinase                        197   4e-56   Fagus sylvatica
ref|XP_010533957.1|  PREDICTED: serine/threonine-protein kinase S...    196   6e-56   Tarenaya hassleriana [spider flower]
gb|ACU23651.1|  unknown                                                 195   2e-55   Glycine max [soybeans]
gb|ABG81507.1|  serine/threonine protein kinase                         195   2e-55   Camellia sinensis [black tea]
gb|EPS60016.1|  hypothetical protein M569_14789                         195   2e-55   Genlisea aurea
emb|CDP20535.1|  unnamed protein product                                194   2e-55   Coffea canephora [robusta coffee]
ref|XP_010492159.1|  PREDICTED: serine/threonine-protein kinase S...    194   3e-55   Camelina sativa [gold-of-pleasure]
gb|AAA33004.1|  serine/threonine protein kinase                         194   3e-55   Brassica napus [oilseed rape]
gb|ADP24128.1|  serine/threonine protein kinase                         194   3e-55   Brassica napus [oilseed rape]
ref|XP_006305166.1|  hypothetical protein CARUB_v10009533mg             194   4e-55   Capsella rubella
emb|CDY34860.1|  BnaA09g47860D                                          194   4e-55   Brassica napus [oilseed rape]
ref|XP_012087257.1|  PREDICTED: serine/threonine-protein kinase S...    194   4e-55   Jatropha curcas
emb|CDX97923.1|  BnaA06g06740D                                          194   6e-55   
ref|XP_002267922.1|  PREDICTED: serine/threonine-protein kinase S...    194   6e-55   Vitis vinifera
gb|AAA33003.1|  serine/threonine protein kinase                         193   8e-55   Brassica napus [oilseed rape]
ref|XP_010475982.1|  PREDICTED: serine/threonine-protein kinase S...    193   1e-54   Camelina sativa [gold-of-pleasure]
emb|CDY34668.1|  BnaC08g42270D                                          193   1e-54   Brassica napus [oilseed rape]
ref|XP_010458473.1|  PREDICTED: serine/threonine-protein kinase S...    193   1e-54   
ref|XP_004239628.1|  PREDICTED: serine/threonine-protein kinase S...    192   2e-54   Solanum lycopersicum
ref|XP_010065455.1|  PREDICTED: serine/threonine-protein kinase S...    192   2e-54   Eucalyptus grandis [rose gum]
ref|XP_006652300.1|  PREDICTED: serine/threonine-protein kinase S...    192   3e-54   Oryza brachyantha
gb|AIZ68211.1|  serine/threonine-protein kinase SAPK7                   192   3e-54   Ornithogalum longebracteatum [sea-onion]
emb|CDY19332.1|  BnaC05g08410D                                          193   3e-54   Brassica napus [oilseed rape]
ref|XP_003579766.1|  PREDICTED: serine/threonine-protein kinase S...    191   4e-54   
gb|EYU20561.1|  hypothetical protein MIMGU_mgv1a009810mg                190   6e-54   Erythranthe guttata [common monkey flower]
emb|CDX84430.1|  BnaC03g50700D                                          191   6e-54   
ref|XP_006384384.1|  kinase SPK-3 family protein                        191   6e-54   
ref|XP_006394252.1|  hypothetical protein EUTSA_v10004481mg             191   6e-54   Eutrema salsugineum [saltwater cress]
ref|XP_009150418.1|  PREDICTED: serine/threonine-protein kinase S...    191   7e-54   Brassica rapa
ref|XP_009406104.1|  PREDICTED: serine/threonine-protein kinase S...    191   8e-54   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009118223.1|  PREDICTED: serine/threonine-protein kinase S...    191   9e-54   Brassica rapa
ref|XP_002325309.2|  hypothetical protein POPTR_0019s00790g             190   1e-53   Populus trichocarpa [western balsam poplar]
ref|NP_001052827.1|  Os04g0432000                                       190   1e-53   
emb|CAE54588.1|  serin/threonine protein kinase                         190   1e-53   Fagus sylvatica
gb|AFW71756.1|  putative snRK/SAPK family protein kinase                185   1e-53   
ref|XP_002892611.1|  hypothetical protein ARALYDRAFT_888390             190   1e-53   Arabidopsis lyrata subsp. lyrata
ref|XP_010065453.1|  PREDICTED: serine/threonine-protein kinase S...    190   2e-53   Eucalyptus grandis [rose gum]
ref|XP_011097123.1|  PREDICTED: serine/threonine-protein kinase S...    189   2e-53   Sesamum indicum [beniseed]
ref|XP_008781505.1|  PREDICTED: serine/threonine-protein kinase S...    189   3e-53   Phoenix dactylifera
gb|EEC73377.1|  hypothetical protein OsI_07615                          189   3e-53   Oryza sativa Indica Group [Indian rice]
ref|XP_011001254.1|  PREDICTED: serine/threonine-protein kinase S...    189   4e-53   Populus euphratica
ref|XP_008784212.1|  PREDICTED: serine/threonine-protein kinase S...    189   4e-53   Phoenix dactylifera
emb|CAE03037.3|  OSJNBa0084A10.12                                       190   5e-53   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010444281.1|  PREDICTED: serine/threonine-protein kinase S...    188   5e-53   Camelina sativa [gold-of-pleasure]
gb|ACN33610.1|  unknown                                                 188   6e-53   Zea mays [maize]
ref|NP_001149107.1|  LOC100282729                                       188   6e-53   Zea mays [maize]
ref|XP_010547692.1|  PREDICTED: serine/threonine-protein kinase S...    188   6e-53   Tarenaya hassleriana [spider flower]
gb|ACG50011.1|  SnRK2.7                                                 188   7e-53   Zea mays [maize]
ref|NP_172563.1|  serine/threonine-protein kinase SRK2A                 188   9e-53   Arabidopsis thaliana [mouse-ear cress]
gb|AGT16423.1|  hypothetical protein SHCRBa_145_O09_R_60                188   1e-52   Saccharum hybrid cultivar R570
gb|EMT04089.1|  Serine/threonine-protein kinase SAPK7                   188   1e-52   
dbj|BAH56941.1|  AT5G63650                                              187   1e-52   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001031021.2|  serine/threonine-protein kinase SRK2A              188   1e-52   Arabidopsis thaliana [mouse-ear cress]
gb|EMS63561.1|  Serine/threonine-protein kinase SAPK7                   188   1e-52   Triticum urartu
gb|AFW62591.1|  putative snRK/SAPK family protein kinase                182   2e-52   
dbj|BAE99712.1|  serine/threonine-protein kinase                        187   2e-52   Arabidopsis thaliana [mouse-ear cress]
gb|AAM65503.1|  serine/threonine-protein kinase                         187   2e-52   Arabidopsis thaliana [mouse-ear cress]
ref|NP_201170.1|  serine/threonine-protein kinase SRK2H                 187   2e-52   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010484120.1|  PREDICTED: serine/threonine-protein kinase S...    187   2e-52   Camelina sativa [gold-of-pleasure]
ref|XP_010911872.1|  PREDICTED: serine/threonine-protein kinase S...    187   3e-52   Elaeis guineensis
ref|XP_009148434.1|  PREDICTED: serine/threonine-protein kinase S...    186   3e-52   Brassica rapa
ref|NP_001047099.1|  Os02g0551100                                       186   4e-52   
ref|XP_010460858.1|  PREDICTED: serine/threonine-protein kinase S...    186   6e-52   Camelina sativa [gold-of-pleasure]
ref|XP_009383517.1|  PREDICTED: serine/threonine-protein kinase S...    186   6e-52   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006280694.1|  hypothetical protein CARUB_v10026657mg             186   7e-52   Capsella rubella
ref|XP_004975639.1|  PREDICTED: serine/threonine-protein kinase S...    185   8e-52   Setaria italica
ref|XP_002866567.1|  serine/threonine-protein kinase                    185   1e-51   Arabidopsis lyrata subsp. lyrata
ref|XP_003575110.1|  PREDICTED: serine/threonine-protein kinase S...    185   1e-51   
gb|ACN35772.1|  unknown                                                 185   1e-51   Zea mays [maize]
ref|XP_002453967.1|  hypothetical protein SORBIDRAFT_04g022410          185   1e-51   Sorghum bicolor [broomcorn]
gb|AFW71759.1|  putative snRK/SAPK family protein kinase                185   2e-51   
ref|NP_001105274.1|  uncharacterized protein LOC542190                  184   3e-51   Zea mays [maize]
ref|NP_001274891.1|  serine/threonine-protein kinase SAPK7-like         184   3e-51   Solanum tuberosum [potatoes]
emb|CDY20594.1|  BnaC08g14640D                                          181   2e-50   Brassica napus [oilseed rape]
ref|NP_001136796.1|  uncharacterized LOC100216941                       182   2e-50   Zea mays [maize]
ref|XP_004952838.1|  PREDICTED: serine/threonine-protein kinase S...    184   3e-50   
gb|ACG33803.1|  serine/threonine-protein kinase SAPK6                   181   3e-50   Zea mays [maize]
ref|XP_010546285.1|  PREDICTED: serine/threonine-protein kinase S...    181   4e-50   
ref|XP_006647363.1|  PREDICTED: serine/threonine-protein kinase S...    181   6e-50   Oryza brachyantha
gb|ACG50010.1|  SnRK2.6                                                 181   6e-50   Zea mays [maize]
ref|XP_004144372.2|  PREDICTED: serine/threonine-protein kinase S...    184   7e-50   Cucumis sativus [cucumbers]
ref|XP_010675155.1|  PREDICTED: serine/threonine-protein kinase S...    180   8e-50   Beta vulgaris subsp. vulgaris [field beet]
gb|KFK25224.1|  hypothetical protein AALP_AA8G083600                    180   8e-50   Arabis alpina [alpine rockcress]
dbj|BAD81709.1|  serine/threonine protein kinase SAPK4-like protein     174   9e-50   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004952837.1|  PREDICTED: serine/threonine-protein kinase S...    183   1e-49   
gb|KGN54758.1|  hypothetical protein Csa_4G454660                       185   1e-49   Cucumis sativus [cucumbers]
ref|XP_010030125.1|  PREDICTED: serine/threonine-protein kinase S...    179   2e-49   Eucalyptus grandis [rose gum]
gb|ACU17548.1|  unknown                                                 171   4e-49   Glycine max [soybeans]
gb|AIZ68209.1|  serine/threonine-protein kinase SAPK7-like protein      178   5e-49   Ornithogalum longebracteatum [sea-onion]
ref|XP_010912491.1|  PREDICTED: LOW QUALITY PROTEIN: serine/threo...    178   6e-49   
ref|XP_008783425.1|  PREDICTED: serine/threonine-protein kinase S...    178   7e-49   Phoenix dactylifera
ref|XP_009404984.1|  PREDICTED: serine/threonine-protein kinase S...    177   1e-48   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006645084.1|  PREDICTED: serine/threonine-protein kinase S...    176   5e-48   Oryza brachyantha
gb|AGT17340.1|  serine/threonine-protein kinase                         175   9e-48   Saccharum hybrid cultivar R570
ref|XP_006399366.1|  hypothetical protein EUTSA_v10013967mg             174   1e-47   Eutrema salsugineum [saltwater cress]
ref|NP_001044930.1|  Os01g0869900                                       174   2e-47   
gb|ABD72268.1|  serine kinase                                           174   2e-47   Oryza sativa Indica Group [Indian rice]
ref|XP_008657021.1|  PREDICTED: serine/threonine-protein kinase S...    174   2e-47   Zea mays [maize]
ref|XP_010491506.1|  PREDICTED: serine/threonine-protein kinase S...    172   5e-47   Camelina sativa [gold-of-pleasure]
gb|AFW84447.1|  putative snRK/SAPK family protein kinase                174   6e-47   
ref|XP_010423046.1|  PREDICTED: serine/threonine-protein kinase S...    172   6e-47   Camelina sativa [gold-of-pleasure]
ref|XP_010452877.1|  PREDICTED: serine/threonine-protein kinase S...    172   6e-47   Camelina sativa [gold-of-pleasure]
emb|CDX69936.1|  BnaA10g22850D                                          172   7e-47   
ref|XP_009122476.1|  PREDICTED: serine/threonine-protein kinase S...    172   7e-47   Brassica rapa
ref|XP_009131093.1|  PREDICTED: serine/threonine-protein kinase S...    172   9e-47   Brassica rapa
ref|NP_196476.1|  serine/threonine-protein kinase SRK2G                 172   9e-47   Arabidopsis thaliana [mouse-ear cress]
emb|CAA78106.1|  protein kinase                                         172   9e-47   Arabidopsis thaliana [mouse-ear cress]
emb|CDX78346.1|  BnaA03g02580D                                          172   1e-46   
ref|XP_009420573.1|  PREDICTED: serine/threonine-protein kinase S...    172   1e-46   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY21553.1|  BnaC09g47390D                                          172   1e-46   Brassica napus [oilseed rape]
ref|XP_002871349.1|  hypothetical protein ARALYDRAFT_908839             171   1e-46   Arabidopsis lyrata subsp. lyrata
ref|NP_001183943.1|  SnRK2.4                                            171   3e-46   
ref|XP_006288057.1|  hypothetical protein CARUB_v10001287mg             171   4e-46   Capsella rubella
emb|CDX81116.1|  BnaC03g03700D                                          171   4e-46   
ref|XP_009384226.1|  PREDICTED: serine/threonine-protein kinase S...    170   5e-46   Musa acuminata subsp. malaccensis [pisang utan]
tpg|DAA56626.1|  TPA: putative snRK/SAPK family protein kinase          170   7e-46   
ref|NP_001170331.1|  uncharacterized protein LOC100384302               170   7e-46   
ref|XP_008673283.1|  PREDICTED: uncharacterized protein LOC100384...    169   1e-45   Zea mays [maize]
gb|AGT16857.1|  serine kinase                                           169   1e-45   Saccharum hybrid cultivar R570
ref|XP_003564710.2|  PREDICTED: serine/threonine-protein kinase S...    170   1e-45   
gb|ACU65228.1|  SNF1-type serine-threonine protein kinase               168   3e-45   Triticum aestivum [Canadian hard winter wheat]
ref|XP_009399177.1|  PREDICTED: serine/threonine-protein kinase S...    167   9e-45   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDM85167.1|  unnamed protein product                                167   1e-44   Triticum aestivum [Canadian hard winter wheat]
ref|XP_004961968.1|  PREDICTED: serine/threonine-protein kinase S...    166   2e-44   Setaria italica
ref|XP_009403694.1|  PREDICTED: serine/threonine-protein kinase S...    166   2e-44   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009403693.1|  PREDICTED: serine/threonine-protein kinase S...    166   2e-44   Musa acuminata subsp. malaccensis [pisang utan]
gb|AHY82614.1|  SNF1-type serine-threonine protein kinase               166   2e-44   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004959953.1|  PREDICTED: serine/threonine-protein kinase S...    166   3e-44   Setaria italica
ref|XP_010547867.1|  PREDICTED: serine/threonine-protein kinase S...    164   5e-44   Tarenaya hassleriana [spider flower]
ref|XP_004970723.1|  PREDICTED: serine/threonine-protein kinase S...    164   7e-44   Setaria italica
gb|AFW62592.1|  putative snRK/SAPK family protein kinase                163   2e-43   
gb|ACG46236.1|  serine/threonine-protein kinase SAPK4                   163   2e-43   Zea mays [maize]
gb|EPS73443.1|  stress kinase                                           162   3e-43   Genlisea aurea
ref|XP_008647613.1|  PREDICTED: LOC100274512 isoform X1                 162   5e-43   Zea mays [maize]
gb|AIH00110.1|  sucrose nonfermenting 1-related protein kinase 2.7      160   9e-43   Fragaria x ananassa
ref|NP_001142342.1|  LOC100274512                                       161   1e-42   Zea mays [maize]
gb|ACG50014.1|  SnRK2.11                                                160   3e-42   Zea mays [maize]
emb|CAH68097.1|  B0518A01.2                                             160   5e-42   Oryza sativa [red rice]
ref|XP_002441159.1|  hypothetical protein SORBIDRAFT_09g021410          159   5e-42   Sorghum bicolor [broomcorn]
ref|NP_001054356.1|  Os04g0691100                                       159   1e-41   
ref|XP_002447377.1|  hypothetical protein SORBIDRAFT_06g033990          157   5e-41   Sorghum bicolor [broomcorn]
ref|XP_006653076.1|  PREDICTED: serine/threonine-protein kinase S...    157   7e-41   Oryza brachyantha
ref|XP_003580888.1|  PREDICTED: serine/threonine-protein kinase S...    156   2e-40   
ref|XP_008456157.1|  PREDICTED: serine/threonine-protein kinase S...    156   2e-40   Cucumis melo [Oriental melon]
ref|XP_008465554.1|  PREDICTED: serine/threonine-protein kinase S...    150   1e-39   
dbj|BAJ93234.1|  predicted protein                                      153   2e-39   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|ACN25951.1|  unknown                                                 150   4e-39   Zea mays [maize]
ref|XP_002880473.1|  hypothetical protein ARALYDRAFT_481174             150   1e-38   
ref|XP_010472302.1|  PREDICTED: serine/threonine-protein kinase S...    148   2e-38   Camelina sativa [gold-of-pleasure]
ref|NP_001132381.1|  LOC100193827                                       150   2e-38   Zea mays [maize]
gb|ACG50009.1|  SnRK2.5                                                 150   2e-38   Zea mays [maize]
emb|CDY38921.1|  BnaA04g13420D                                          149   2e-38   Brassica napus [oilseed rape]
ref|XP_010417055.1|  PREDICTED: serine/threonine-protein kinase S...    149   2e-38   Camelina sativa [gold-of-pleasure]
ref|XP_008456158.1|  PREDICTED: serine/threonine-protein kinase S...    150   3e-38   Cucumis melo [Oriental melon]
ref|NP_179885.1|  serine/threonine-protein kinase SNRK2.9               149   3e-38   Arabidopsis thaliana [mouse-ear cress]
gb|AAO24574.1|  At2g23030                                               148   5e-38   Arabidopsis thaliana [mouse-ear cress]
emb|CDX89537.1|  BnaC04g35560D                                          148   6e-38   
ref|XP_010429243.1|  PREDICTED: serine/threonine-protein kinase S...    147   1e-37   Camelina sativa [gold-of-pleasure]
ref|XP_009140443.1|  PREDICTED: serine/threonine-protein kinase S...    147   1e-37   Brassica rapa
gb|KFK32775.1|  hypothetical protein AALP_AA6G287000                    147   2e-37   Arabis alpina [alpine rockcress]
ref|XP_012081018.1|  PREDICTED: serine/threonine-protein kinase S...    145   6e-37   Jatropha curcas
gb|EMS68739.1|  Serine/threonine-protein kinase SAPK4                   146   7e-37   Triticum urartu
gb|EMT18947.1|  Serine/threonine-protein kinase SAPK4                   146   8e-37   
ref|XP_006294364.1|  hypothetical protein CARUB_v10023381mg             146   9e-37   
gb|AAK25751.1|AF334831_1  STK1                                          142   9e-37   
gb|AHC00229.1|  SNF1-type serine-threonine protein kinase               144   2e-36   
ref|XP_006385576.1|  hypothetical protein POPTR_0003s08240g             144   3e-36   
gb|ACU21561.1|  unknown                                                 140   5e-36   
gb|ABK25003.1|  unknown                                                 144   6e-36   
ref|XP_002517501.1|  Serine/threonine-protein kinase SAPK3, putative    142   7e-36   
gb|KHN48096.1|  Serine/threonine-protein kinase SAPK7                   142   8e-36   
ref|XP_010110552.1|  hypothetical protein L484_023386                   143   8e-36   
ref|XP_003629963.1|  Serine/threonine protein kinase                    135   2e-35   
ref|XP_004300317.1|  PREDICTED: serine/threonine-protein kinase S...    141   2e-35   
ref|XP_002262726.1|  PREDICTED: serine/threonine-protein kinase S...    141   2e-35   
ref|XP_008813092.1|  PREDICTED: serine/threonine-protein kinase S...    140   3e-35   
gb|KHG15024.1|  Serine/threonine-protein kinase SAPK3                   140   3e-35   
emb|CDP08319.1|  unnamed protein product                                141   3e-35   
gb|KJB25444.1|  hypothetical protein B456_004G191500                    140   4e-35   
ref|XP_001778501.1|  predicted protein                                  140   5e-35   
gb|KJB25443.1|  hypothetical protein B456_004G191500                    140   6e-35   
ref|XP_008813090.1|  PREDICTED: serine/threonine-protein kinase S...    140   7e-35   
ref|XP_008794879.1|  PREDICTED: serine/threonine-protein kinase S...    140   8e-35   
ref|XP_010053546.1|  PREDICTED: serine/threonine-protein kinase S...    140   9e-35   
gb|KCW77859.1|  hypothetical protein EUGRSUZ_D02135                     139   9e-35   
ref|XP_008804779.1|  PREDICTED: serine/threonine-protein kinase S...    139   1e-34   
ref|XP_008448770.1|  PREDICTED: serine/threonine-protein kinase S...    139   1e-34   
ref|XP_008369275.1|  PREDICTED: serine/threonine-protein kinase S...    139   1e-34   
ref|XP_004147241.1|  PREDICTED: serine/threonine-protein kinase S...    139   1e-34   
ref|XP_010926328.1|  PREDICTED: serine/threonine-protein kinase S...    138   1e-34   
ref|XP_008442074.1|  PREDICTED: serine/threonine-protein kinase S...    139   2e-34   
emb|CAN62023.1|  hypothetical protein VITISV_005083                     139   2e-34   
ref|XP_004245833.1|  PREDICTED: serine/threonine-protein kinase S...    139   2e-34   
gb|ACN27013.1|  unknown                                                 133   2e-34   
ref|XP_009346160.1|  PREDICTED: serine/threonine-protein kinase S...    139   2e-34   
ref|XP_006404768.1|  hypothetical protein EUTSA_v10000225mg             139   2e-34   
gb|AEB71561.1|  serine/threonine protein kinase                         139   2e-34   
ref|XP_008804778.1|  PREDICTED: serine/threonine-protein kinase S...    139   2e-34   
ref|XP_008442072.1|  PREDICTED: serine/threonine-protein kinase S...    139   3e-34   
ref|XP_007039658.1|  Serine/threonine-protein kinase SAPK3 isoform 2    138   3e-34   
gb|ERM97331.1|  hypothetical protein AMTR_s00073p00126020               137   3e-34   
ref|XP_010926327.1|  PREDICTED: serine/threonine-protein kinase S...    138   4e-34   
ref|XP_007039657.1|  Serine/threonine-protein kinase SAPK3 isoform 1    138   4e-34   
ref|XP_008244468.1|  PREDICTED: serine/threonine-protein kinase S...    137   6e-34   
gb|KDO57026.1|  hypothetical protein CISIN_1g019433mg                   134   6e-34   
ref|XP_006477070.1|  PREDICTED: serine/threonine-protein kinase S...    137   6e-34   
ref|XP_006829915.2|  PREDICTED: serine/threonine-protein kinase S...    137   8e-34   
ref|XP_001777278.1|  predicted protein                                  137   1e-33   
gb|AFR68939.1|  sucrose non-fermenting 1-related protein kinase 2...    137   1e-33   
ref|XP_007209164.1|  hypothetical protein PRUPE_ppa006108mg             138   1e-33   
gb|KDO57027.1|  hypothetical protein CISIN_1g019433mg                   134   1e-33   
gb|EMS48966.1|  Serine/threonine-protein kinase SAPK5                   137   1e-33   
gb|AHC00228.1|  SNF1-type serine-threonine protein kinase               137   2e-33   
ref|XP_006359207.1|  PREDICTED: serine/threonine-protein kinase S...    136   2e-33   
ref|XP_002465184.1|  hypothetical protein SORBIDRAFT_01g033570          136   2e-33   
ref|NP_001050274.1|  Os03g0390200                                       136   2e-33   
gb|AAC69450.1|  putative serine/threonine protein kinase                136   2e-33   
ref|XP_009792025.1|  PREDICTED: serine/threonine-protein kinase S...    136   2e-33   
ref|XP_008373645.1|  PREDICTED: serine/threonine-protein kinase S...    136   2e-33   
ref|XP_001769579.1|  predicted protein                                  136   2e-33   
ref|XP_007047872.1|  Serine/threonine-protein kinase SRK2E              136   2e-33   
ref|XP_010919796.1|  PREDICTED: serine/threonine-protein kinase S...    135   3e-33   
dbj|BAK01400.1|  predicted protein                                      141   3e-33   
gb|EMT05579.1|  Serine/threonine-protein kinase SAPK5                   136   3e-33   
ref|XP_006650154.1|  PREDICTED: serine/threonine-protein kinase S...    135   3e-33   
ref|XP_001769324.1|  predicted protein                                  135   4e-33   
gb|KHG23487.1|  Serine/threonine-protein kinase SAPK1                   133   4e-33   
dbj|BAG92232.1|  unnamed protein product                                133   5e-33   
ref|XP_006440157.1|  hypothetical protein CICLE_v10020980mg             135   5e-33   
ref|XP_010917301.1|  PREDICTED: serine/threonine-protein kinase S...    135   5e-33   
gb|KDO57024.1|  hypothetical protein CISIN_1g019433mg                   135   5e-33   
dbj|BAK05446.1|  predicted protein                                      135   6e-33   
ref|XP_009607204.1|  PREDICTED: serine/threonine-protein kinase S...    134   7e-33   
gb|AAD00240.1|  PK11-C5                                                 134   7e-33   
ref|XP_002464236.1|  hypothetical protein SORBIDRAFT_01g014720          135   7e-33   
ref|XP_002992280.1|  hypothetical protein SELMODRAFT_162233             134   8e-33   
ref|XP_006852955.1|  PREDICTED: serine/threonine-protein kinase S...    135   9e-33   
ref|XP_004984154.1|  PREDICTED: serine/threonine-protein kinase S...    134   9e-33   
gb|EAY98163.1|  hypothetical protein OsI_20079                          134   9e-33   
ref|XP_006654449.1|  PREDICTED: serine/threonine-protein kinase S...    134   1e-32   
ref|NP_001136496.1|  SnRK2.3                                            134   1e-32   
ref|NP_001168073.1|  uncharacterized protein LOC100381806               134   1e-32   
ref|XP_004983620.1|  PREDICTED: serine/threonine-protein kinase S...    134   1e-32   
ref|XP_006583868.1|  PREDICTED: serine/threonine-protein kinase S...    134   1e-32   
gb|AHC00227.1|  SNF1-type serine-threonine protein kinase               134   1e-32   
ref|XP_006583867.1|  PREDICTED: serine/threonine-protein kinase S...    134   1e-32   
gb|ACG32779.1|  serine/threonine-protein kinase SAPK10                  134   1e-32   
ref|XP_008654908.1|  PREDICTED: uncharacterized LOC100191280 isof...    134   1e-32   
gb|AAW49219.1|  protein kinase 1                                        134   1e-32   
gb|EEC75392.1|  hypothetical protein OsI_11876                          134   1e-32   
ref|NP_001060312.1|  Os07g0622000                                       134   2e-32   
ref|XP_010691013.1|  PREDICTED: serine/threonine-protein kinase S...    134   2e-32   
ref|NP_001130186.1|  uncharacterized LOC100191280                       134   2e-32   
ref|XP_004958353.1|  PREDICTED: serine/threonine-protein kinase S...    133   2e-32   
gb|AEB26578.1|  Snf-related protein kinase 2.6                          133   2e-32   
sp|A2YNT8.2|SAPK2_ORYSI  RecName: Full=Serine/threonine-protein k...    133   2e-32   
gb|AFN22054.1|  putative serine/threonine-protein kinase                133   2e-32   
ref|XP_011088305.1|  PREDICTED: serine/threonine-protein kinase S...    134   2e-32   
gb|AFW88026.1|  putative snRK/SAPK family protein kinase                130   2e-32   
gb|AAO65504.1|  abcisic acid-inducible protein kinanase                 134   2e-32   
ref|XP_006657974.1|  PREDICTED: serine/threonine-protein kinase S...    132   2e-32   
gb|AIK22404.1|  sucrose non-fermenting-1-related protein kinase 2.4     133   2e-32   
ref|XP_009774098.1|  PREDICTED: serine/threonine-protein kinase S...    133   2e-32   
dbj|BAJ94902.1|  predicted protein                                      133   2e-32   
ref|XP_002987826.1|  hypothetical protein SELMODRAFT_158991             133   2e-32   
ref|XP_009591754.1|  PREDICTED: serine/threonine-protein kinase S...    132   2e-32   
ref|XP_011088303.1|  PREDICTED: serine/threonine-protein kinase S...    133   3e-32   
ref|XP_011100039.1|  PREDICTED: serine/threonine-protein kinase S...    133   3e-32   
gb|KGN54765.1|  hypothetical protein Csa_4G457190                       132   3e-32   
gb|AIY30420.1|  SNF1-type serine-threonine protein kinase               133   3e-32   
ref|XP_010255130.1|  PREDICTED: serine/threonine-protein kinase S...    133   3e-32   
gb|EMS56487.1|  Serine/threonine-protein kinase SAPK10                  133   4e-32   
ref|XP_010106278.1|  Serine/threonine-protein kinase SAPK2              131   4e-32   
ref|XP_008792700.1|  PREDICTED: serine/threonine-protein kinase S...    133   4e-32   
ref|XP_006579656.1|  PREDICTED: serine/threonine-protein kinase S...    129   5e-32   
ref|XP_006657973.1|  PREDICTED: serine/threonine-protein kinase S...    132   5e-32   
tpg|DAA50444.1|  TPA: putative snRK/SAPK family protein kinase          127   5e-32   
ref|XP_009591753.1|  PREDICTED: serine/threonine-protein kinase S...    132   5e-32   
gb|KEH31607.1|  sucrose nonfermenting 1(SNF1)-related kinase            132   5e-32   
ref|XP_004982436.1|  PREDICTED: serine/threonine-protein kinase S...    132   6e-32   
ref|XP_008666744.1|  PREDICTED: serine/threonine-protein kinase S...    127   6e-32   
gb|AFK33830.1|  unknown                                                 132   6e-32   
ref|XP_006838505.1|  PREDICTED: serine/threonine-protein kinase S...    132   6e-32   
gb|AFK40249.1|  unknown                                                 132   7e-32   
gb|KDO49175.1|  hypothetical protein CISIN_1g017936mg                   130   8e-32   
gb|AEF00939.1|  serine/threonine-protein kinase                         132   8e-32   
ref|NP_001050653.1|  Os03g0610900                                       132   8e-32   
gb|ACN33954.1|  unknown                                                 130   8e-32   
ref|XP_004508967.1|  PREDICTED: serine/threonine-protein kinase S...    131   9e-32   
gb|KJB44108.1|  hypothetical protein B456_007G234800                    131   9e-32   
ref|XP_004230794.1|  PREDICTED: serine/threonine-protein kinase S...    132   9e-32   
ref|XP_011653874.1|  PREDICTED: LOW QUALITY PROTEIN: serine/threo...    132   9e-32   
gb|ACG50005.1|  SnRK2.1                                                 131   9e-32   
gb|ABM73653.1|  Ser/Thr kinase                                          128   1e-31   
ref|XP_004502408.1|  PREDICTED: serine/threonine-protein kinase S...    131   1e-31   
ref|XP_007159714.1|  hypothetical protein PHAVU_002G261200g             131   1e-31   
ref|NP_001275318.1|  serine/threonine-protein kinase SRK2E-like         132   1e-31   
ref|XP_009786561.1|  PREDICTED: serine/threonine-protein kinase S...    132   1e-31   
ref|XP_006583765.1|  PREDICTED: serine/threonine-protein kinase S...    130   1e-31   
gb|KJB44109.1|  hypothetical protein B456_007G234800                    131   1e-31   
gb|AAT47051.1|  hypothetical protein                                    133   1e-31   
gb|KHN37483.1|  Serine/threonine-protein kinase SRK2E                   129   1e-31   
gb|KJB44110.1|  hypothetical protein B456_007G234800                    131   1e-31   
ref|XP_006579655.1|  PREDICTED: serine/threonine-protein kinase S...    129   1e-31   
ref|XP_007155720.1|  hypothetical protein PHAVU_003G225800g             131   1e-31   
ref|XP_003562284.1|  PREDICTED: serine/threonine-protein kinase S...    131   1e-31   
ref|XP_008664891.1|  PREDICTED: snRK2.3 isoform X1                      132   1e-31   
ref|XP_009601198.1|  PREDICTED: serine/threonine-protein kinase S...    131   1e-31   
ref|XP_009601203.1|  PREDICTED: serine/threonine-protein kinase S...    131   2e-31   
ref|XP_004502407.1|  PREDICTED: serine/threonine-protein kinase S...    131   2e-31   
ref|XP_011001189.1|  PREDICTED: serine/threonine-protein kinase S...    130   2e-31   
ref|XP_010055408.1|  PREDICTED: serine/threonine-protein kinase S...    130   2e-31   
gb|EYU37717.1|  hypothetical protein MIMGU_mgv1a008717mg                131   2e-31   
ref|XP_002964718.1|  hypothetical protein SELMODRAFT_167058             130   2e-31   
gb|ABR16094.1|  unknown                                                 130   2e-31   
dbj|BAJ34451.1|  unnamed protein product                                131   2e-31   
emb|CEO16426.1|  sucrose non-fermenting 1-related protein kinase ...    130   2e-31   
ref|XP_002961653.1|  hypothetical protein SELMODRAFT_164978             130   2e-31   
gb|KEH20795.1|  Serine/Threonine-kinase SAPK1-like protein              129   2e-31   
ref|XP_007018727.1|  Kinase superfamily protein isoform 3               128   2e-31   
ref|XP_008782170.1|  PREDICTED: serine/threonine-protein kinase S...    129   2e-31   
ref|XP_007159580.1|  hypothetical protein PHAVU_002G2493000g            129   2e-31   
gb|KDO49174.1|  hypothetical protein CISIN_1g017936mg                   130   3e-31   
ref|XP_008386119.1|  PREDICTED: serine/threonine-protein kinase S...    129   3e-31   
ref|XP_003529248.1|  PREDICTED: serine/threonine-protein kinase S...    130   3e-31   
gb|KDO49166.1|  hypothetical protein CISIN_1g017936mg                   130   3e-31   
tpg|DAA63653.1|  TPA: putative snRK/SAPK family protein kinase          125   3e-31   
ref|XP_006480145.1|  PREDICTED: serine/threonine-protein kinase S...    130   3e-31   
gb|ACJ85478.1|  unknown                                                 125   3e-31   
ref|NP_001238077.1|  protein kinase 2                                   130   3e-31   
ref|XP_009601520.1|  PREDICTED: serine/threonine-protein kinase S...    130   3e-31   
ref|XP_008386118.1|  PREDICTED: serine/threonine-protein kinase S...    129   4e-31   
ref|XP_003524220.1|  PREDICTED: serine/threonine-protein kinase S...    130   4e-31   
gb|ACF87919.1|  unknown                                                 130   4e-31   
ref|XP_009397730.1|  PREDICTED: serine/threonine-protein kinase S...    130   4e-31   
ref|XP_011001186.1|  PREDICTED: serine/threonine-protein kinase S...    130   4e-31   
emb|CDO97138.1|  unnamed protein product                                130   4e-31   
ref|XP_010934123.1|  PREDICTED: serine/threonine-protein kinase S...    129   4e-31   
ref|XP_008782169.1|  PREDICTED: serine/threonine-protein kinase S...    130   4e-31   
ref|XP_008454909.1|  PREDICTED: serine/threonine-protein kinase S...    130   5e-31   
ref|XP_006662074.1|  PREDICTED: serine/threonine-protein kinase S...    129   5e-31   
gb|AII99812.1|  SNF1-related kinase                                     129   5e-31   
ref|XP_004136995.1|  PREDICTED: serine/threonine-protein kinase S...    130   5e-31   
gb|KDO81024.1|  hypothetical protein CISIN_1g019628mg                   127   5e-31   
ref|XP_006433943.1|  hypothetical protein CICLE_v10001754mg             127   5e-31   
ref|XP_008386117.1|  PREDICTED: serine/threonine-protein kinase S...    129   5e-31   
ref|XP_007146909.1|  hypothetical protein PHAVU_006G080800g             128   5e-31   
ref|XP_002302308.1|  serine/threonine protein kinase                    129   5e-31   
ref|XP_007042346.1|  Kinase superfamily protein isoform 3               128   5e-31   
ref|XP_009802847.1|  PREDICTED: serine/threonine-protein kinase S...    129   6e-31   
ref|XP_008359931.1|  PREDICTED: serine/threonine-protein kinase S...    126   6e-31   
gb|ACF79259.1|  unknown                                                 130   6e-31   
ref|NP_001130882.1|  uncharacterized protein LOC100191986               129   6e-31   
ref|XP_009802846.1|  PREDICTED: serine/threonine-protein kinase S...    129   6e-31   
gb|AAG31326.1|  putative serine/threonine kinase GDBrPK                 129   6e-31   
ref|NP_001288653.1|  serine/threonine-protein kinase SAPK2              129   7e-31   
ref|XP_011654392.1|  PREDICTED: serine/threonine-protein kinase S...    130   7e-31   
ref|XP_010909986.1|  PREDICTED: serine/threonine-protein kinase S...    129   8e-31   
ref|XP_003631616.1|  PREDICTED: serine/threonine-protein kinase S...    129   8e-31   
ref|XP_006423078.1|  hypothetical protein CICLE_v10028703mg             129   8e-31   
gb|KGN54756.1|  hypothetical protein Csa_4G454150                       128   9e-31   
ref|XP_003531338.1|  PREDICTED: serine/threonine-protein kinase S...    129   9e-31   
ref|XP_007156597.1|  hypothetical protein PHAVU_002G002200g             129   9e-31   
ref|NP_001130868.1|  SnRK2.10                                           129   9e-31   
ref|XP_003634478.1|  PREDICTED: serine/threonine-protein kinase S...    129   9e-31   
gb|ACJ84405.1|  unknown                                                 129   9e-31   
ref|NP_001274912.1|  serine/threonine-protein kinase SAPK2-like         129   1e-30   
gb|EAY83693.1|  hypothetical protein OsI_38916                          129   1e-30   
ref|XP_009365827.1|  PREDICTED: serine/threonine-protein kinase S...    129   1e-30   
emb|CAN62745.1|  hypothetical protein VITISV_025025                     129   1e-30   
ref|XP_002284959.1|  PREDICTED: serine/threonine-protein kinase S...    129   1e-30   
ref|XP_003518861.1|  PREDICTED: serine/threonine-protein kinase S...    129   1e-30   
gb|KCW55252.1|  hypothetical protein EUGRSUZ_I01180                     127   1e-30   
ref|XP_006575017.1|  PREDICTED: serine/threonine-protein kinase S...    129   1e-30   
gb|ACF21741.1|  putative serine/threonine protein kinase                128   1e-30   
ref|XP_008235070.1|  PREDICTED: serine/threonine-protein kinase S...    128   1e-30   
ref|XP_007018726.1|  Kinase superfamily protein isoform 2               128   1e-30   
ref|XP_003555707.1|  PREDICTED: serine/threonine-protein kinase S...    129   1e-30   
gb|AFK34893.1|  unknown                                                 128   1e-30   
ref|XP_007018725.1|  Kinase superfamily protein isoform 1               128   1e-30   
ref|XP_002869183.1|  hypothetical protein ARALYDRAFT_491280             129   1e-30   
ref|NP_001147649.1|  LOC100281258                                       129   1e-30   
gb|AGW51610.1|  serine/threonine protein kinase                         128   2e-30   
ref|XP_012067903.1|  PREDICTED: serine/threonine-protein kinase S...    128   2e-30   
ref|XP_009373019.1|  PREDICTED: serine/threonine-protein kinase S...    127   2e-30   



>ref|XP_003540159.1| PREDICTED: serine/threonine-protein kinase SRK2A-like [Glycine 
max]
Length=359

 Score =   224 bits (571),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 104/114 (91%), Positives = 108/114 (95%), Gaps = 0/114 (0%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED DDPKNFRKTI RIM+VQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF
Sbjct  201  EDQDDPKNFRKTINRIMAVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  260

Query  744  LKNLPRELTEVAQAAYYRRENPTFSLQSAEEIMKIVDEAKAPPPASRSMGGFGW  583
            LKNLPRELTEVAQAAYYR+ENPTFSLQS E IM IV+EAK PPPASRS+GGFGW
Sbjct  261  LKNLPRELTEVAQAAYYRKENPTFSLQSIEGIMNIVEEAKTPPPASRSIGGFGW  314



>ref|XP_009776074.1| PREDICTED: serine/threonine-protein kinase SRK2A [Nicotiana sylvestris]
 gb|AAL89456.1| osmotic stress-activated protein kinase [Nicotiana tabacum]
Length=356

 Score =   223 bits (568),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 104/114 (91%), Positives = 108/114 (95%), Gaps = 0/114 (0%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED +DPKNFRKTIQRIM+VQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF
Sbjct  201  EDQEDPKNFRKTIQRIMAVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  260

Query  744  LKNLPRELTEVAQAAYYRRENPTFSLQSAEEIMKIVDEAKAPPPASRSMGGFGW  583
            LKNLPRELTE AQAAYYRRENPTFSLQS EEIMKIV+EAK P PASRS+ GFGW
Sbjct  261  LKNLPRELTEAAQAAYYRRENPTFSLQSVEEIMKIVEEAKTPAPASRSVSGFGW  314



>ref|XP_009621087.1| PREDICTED: serine/threonine-protein kinase SRK2A-like [Nicotiana 
tomentosiformis]
Length=353

 Score =   223 bits (567),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 104/114 (91%), Positives = 107/114 (94%), Gaps = 0/114 (0%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED +DPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIK+HPWF
Sbjct  201  EDQEDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKTHPWF  260

Query  744  LKNLPRELTEVAQAAYYRRENPTFSLQSAEEIMKIVDEAKAPPPASRSMGGFGW  583
            LKNLPRELTE AQ AYYRRENPTFSLQSAE IMKIV+EAK P PASRS GGFGW
Sbjct  261  LKNLPRELTEAAQLAYYRRENPTFSLQSAEMIMKIVEEAKTPAPASRSTGGFGW  314



>ref|XP_002303162.2| hypothetical protein POPTR_0003s01110g [Populus trichocarpa]
 gb|EEE78141.2| hypothetical protein POPTR_0003s01110g [Populus trichocarpa]
Length=357

 Score =   222 bits (565),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 102/114 (89%), Positives = 107/114 (94%), Gaps = 0/114 (0%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            EDH+DPKNFRKTI RIM+VQYKIPDYVHISQDCRHLLS IFVANP+RRITIKEIKSHPWF
Sbjct  201  EDHEDPKNFRKTINRIMAVQYKIPDYVHISQDCRHLLSHIFVANPSRRITIKEIKSHPWF  260

Query  744  LKNLPRELTEVAQAAYYRRENPTFSLQSAEEIMKIVDEAKAPPPASRSMGGFGW  583
            LKNLPRELTE AQA YYRRENPTFSLQS EEIMKIV+EAK PPP SRS+GGFGW
Sbjct  261  LKNLPRELTEAAQAMYYRRENPTFSLQSVEEIMKIVEEAKIPPPVSRSIGGFGW  314



>gb|KDO50087.1| hypothetical protein CISIN_1g0187341mg, partial [Citrus sinensis]
 gb|KDO50088.1| hypothetical protein CISIN_1g0187341mg, partial [Citrus sinensis]
 gb|KDO50089.1| hypothetical protein CISIN_1g0187341mg, partial [Citrus sinensis]
Length=172

 Score =   216 bits (549),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 99/114 (87%), Positives = 106/114 (93%), Gaps = 0/114 (0%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED +DPKNFRKTI RIM+VQYKIPDYVHISQDCR+LLSRIFVANP+RRITIKEIKSHPWF
Sbjct  22   EDQEDPKNFRKTISRIMAVQYKIPDYVHISQDCRNLLSRIFVANPSRRITIKEIKSHPWF  81

Query  744  LKNLPRELTEVAQAAYYRRENPTFSLQSAEEIMKIVDEAKAPPPASRSMGGFGW  583
            LKNLPRELTE AQA YYR+ENPTFSLQS EEI KIV+EAK PPP SRS+GGFGW
Sbjct  82   LKNLPRELTETAQAIYYRKENPTFSLQSVEEITKIVEEAKVPPPVSRSIGGFGW  135



>ref|XP_009602813.1| PREDICTED: serine/threonine-protein kinase SRK2A [Nicotiana tomentosiformis]
Length=355

 Score =   222 bits (565),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 103/114 (90%), Positives = 108/114 (95%), Gaps = 0/114 (0%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED +DPKNFRKTIQRIM+VQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF
Sbjct  201  EDQEDPKNFRKTIQRIMAVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  260

Query  744  LKNLPRELTEVAQAAYYRRENPTFSLQSAEEIMKIVDEAKAPPPASRSMGGFGW  583
            LKNLPRELTE AQAAYYR+ENPTFSLQS EEIMKIV+EAK P PASRS+ GFGW
Sbjct  261  LKNLPRELTEAAQAAYYRKENPTFSLQSVEEIMKIVEEAKTPAPASRSVSGFGW  314



>gb|KHN45467.1| Serine/threonine-protein kinase SRK2B [Glycine soja]
Length=359

 Score =   222 bits (565),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 103/114 (90%), Positives = 107/114 (94%), Gaps = 0/114 (0%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED DDPKNFRKTI RIM+VQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF
Sbjct  201  EDQDDPKNFRKTINRIMAVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  260

Query  744  LKNLPRELTEVAQAAYYRRENPTFSLQSAEEIMKIVDEAKAPPPASRSMGGFGW  583
            LKNLPRELTEVAQAAYYR+ENPTFSLQS E IM IV+EAK PPPASRS+GG GW
Sbjct  261  LKNLPRELTEVAQAAYYRKENPTFSLQSIEGIMNIVEEAKTPPPASRSIGGIGW  314



>ref|XP_009804586.1| PREDICTED: serine/threonine-protein kinase SRK2A-like [Nicotiana 
sylvestris]
 ref|XP_009804587.1| PREDICTED: serine/threonine-protein kinase SRK2A-like [Nicotiana 
sylvestris]
Length=354

 Score =   221 bits (563),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 103/114 (90%), Positives = 107/114 (94%), Gaps = 0/114 (0%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED +DPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIK+HPWF
Sbjct  201  EDQEDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKTHPWF  260

Query  744  LKNLPRELTEVAQAAYYRRENPTFSLQSAEEIMKIVDEAKAPPPASRSMGGFGW  583
            LKNLPRELTE AQ AYYR+ENPTFSLQSAE IMKIV+EAK P PASRS GGFGW
Sbjct  261  LKNLPRELTEAAQLAYYRKENPTFSLQSAEMIMKIVEEAKTPAPASRSTGGFGW  314



>ref|XP_006384980.1| hypothetical protein POPTR_0004s22770g [Populus trichocarpa]
 gb|ERP62777.1| hypothetical protein POPTR_0004s22770g [Populus trichocarpa]
Length=171

 Score =   215 bits (547),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 100/114 (88%), Positives = 105/114 (92%), Gaps = 0/114 (0%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED +DPKNFRKTI RIM+VQYKIPDYVHISQDCRH LSRIFVANP RRITIKEIKSHPWF
Sbjct  9    EDQEDPKNFRKTINRIMAVQYKIPDYVHISQDCRHPLSRIFVANPIRRITIKEIKSHPWF  68

Query  744  LKNLPRELTEVAQAAYYRRENPTFSLQSAEEIMKIVDEAKAPPPASRSMGGFGW  583
            LKNLPRELTE AQA YYR+ENPTFSLQS EEIMKIV+EAK PPP SRS+GGFGW
Sbjct  69   LKNLPRELTEAAQAMYYRKENPTFSLQSVEEIMKIVEEAKIPPPVSRSIGGFGW  122



>ref|XP_009774903.1| PREDICTED: serine/threonine-protein kinase SRK2A-like, partial 
[Nicotiana sylvestris]
Length=213

 Score =   216 bits (550),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 101/114 (89%), Positives = 106/114 (93%), Gaps = 0/114 (0%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED +DPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIK+HPWF
Sbjct  60   EDQEDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKTHPWF  119

Query  744  LKNLPRELTEVAQAAYYRRENPTFSLQSAEEIMKIVDEAKAPPPASRSMGGFGW  583
            LKNLPRELTE AQ AYYR+ENPTFSLQS E IMKIV+E+KA  PASRS GGFGW
Sbjct  120  LKNLPRELTEAAQLAYYRKENPTFSLQSTEMIMKIVEESKALAPASRSTGGFGW  173



>ref|NP_001274892.1| serine/threonine-protein kinase SRK2B-like [Solanum tuberosum]
 ref|XP_006349355.1| PREDICTED: serine/threonine-protein kinase SRK2B-like isoform 
X1 [Solanum tuberosum]
 ref|XP_006349356.1| PREDICTED: serine/threonine-protein kinase SRK2B-like isoform 
X2 [Solanum tuberosum]
 gb|AFR68941.1| sucrose non-fermenting 1-related protein kinase 2 family member 
[Solanum tuberosum]
Length=360

 Score =   221 bits (563),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 102/114 (89%), Positives = 107/114 (94%), Gaps = 0/114 (0%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED +DPKNFRKTIQRIM+VQYKIPDYVHISQDCRHLLSRIFVAN ARRITIKEIKSHPWF
Sbjct  201  EDQEDPKNFRKTIQRIMAVQYKIPDYVHISQDCRHLLSRIFVANSARRITIKEIKSHPWF  260

Query  744  LKNLPRELTEVAQAAYYRRENPTFSLQSAEEIMKIVDEAKAPPPASRSMGGFGW  583
            LKNLPRELTE AQAAYYR+ENPTFSLQS EEIMKIV+EAK PPP SRS+ GFGW
Sbjct  261  LKNLPRELTEAAQAAYYRKENPTFSLQSVEEIMKIVEEAKTPPPVSRSVSGFGW  314



>ref|XP_004230475.1| PREDICTED: serine/threonine-protein kinase SRK2B [Solanum lycopersicum]
 ref|XP_010314655.1| PREDICTED: serine/threonine-protein kinase SRK2B [Solanum lycopersicum]
Length=361

 Score =   221 bits (563),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 102/114 (89%), Positives = 107/114 (94%), Gaps = 0/114 (0%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED +DPKNFRKTIQRIM+VQYKIPDYVHISQDCRHLLSRIFVAN ARRITIKEIKSHPWF
Sbjct  201  EDQEDPKNFRKTIQRIMAVQYKIPDYVHISQDCRHLLSRIFVANSARRITIKEIKSHPWF  260

Query  744  LKNLPRELTEVAQAAYYRRENPTFSLQSAEEIMKIVDEAKAPPPASRSMGGFGW  583
            LKNLPRELTE AQAAYYR+ENPTFSLQS EEIMKIV+EAK PPP SRS+ GFGW
Sbjct  261  LKNLPRELTEAAQAAYYRKENPTFSLQSVEEIMKIVEEAKTPPPVSRSVSGFGW  314



>gb|EYU26515.1| hypothetical protein MIMGU_mgv1a009739mg [Erythranthe guttata]
Length=333

 Score =   220 bits (560),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 101/114 (89%), Positives = 109/114 (96%), Gaps = 0/114 (0%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED +DPKNFRKTIQRIM+VQYKIPDYVHISQDCRHLLSRIFVAN ARRITIK+IKSHPWF
Sbjct  173  EDQEDPKNFRKTIQRIMAVQYKIPDYVHISQDCRHLLSRIFVANAARRITIKDIKSHPWF  232

Query  744  LKNLPRELTEVAQAAYYRRENPTFSLQSAEEIMKIVDEAKAPPPASRSMGGFGW  583
            LKNLPRELT+VAQAAYYRRENPT+SLQ+ EEIMKIV+EAK PPPASRS+ GFGW
Sbjct  233  LKNLPRELTDVAQAAYYRRENPTYSLQTVEEIMKIVEEAKTPPPASRSISGFGW  286



>ref|XP_006384983.1| kinase family protein [Populus trichocarpa]
 gb|ERP62780.1| kinase family protein [Populus trichocarpa]
Length=353

 Score =   219 bits (559),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 101/114 (89%), Positives = 106/114 (93%), Gaps = 0/114 (0%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED +DPKNFRKTI RIM+VQYKIPDYVHISQDCRHLLSRIFVANP RRITIKEIKSHPWF
Sbjct  201  EDQEDPKNFRKTINRIMAVQYKIPDYVHISQDCRHLLSRIFVANPIRRITIKEIKSHPWF  260

Query  744  LKNLPRELTEVAQAAYYRRENPTFSLQSAEEIMKIVDEAKAPPPASRSMGGFGW  583
            LKNLPRELTE AQA YYR+ENPTFSLQS EEIMKIV+EAK PPP SRS+GGFGW
Sbjct  261  LKNLPRELTEAAQAMYYRKENPTFSLQSVEEIMKIVEEAKIPPPVSRSIGGFGW  314



>ref|XP_006384982.1| hypothetical protein POPTR_0004s22790g [Populus trichocarpa]
 gb|ERP62779.1| hypothetical protein POPTR_0004s22790g [Populus trichocarpa]
Length=375

 Score =   220 bits (560),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 101/114 (89%), Positives = 106/114 (93%), Gaps = 0/114 (0%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED +DPKNFRKTI RIM+VQYKIPDYVHISQDCRHLLSRIFVANP RRITIKEIKSHPWF
Sbjct  201  EDQEDPKNFRKTINRIMAVQYKIPDYVHISQDCRHLLSRIFVANPIRRITIKEIKSHPWF  260

Query  744  LKNLPRELTEVAQAAYYRRENPTFSLQSAEEIMKIVDEAKAPPPASRSMGGFGW  583
            LKNLPRELTE AQA YYR+ENPTFSLQS EEIMKIV+EAK PPP SRS+GGFGW
Sbjct  261  LKNLPRELTEAAQAMYYRKENPTFSLQSVEEIMKIVEEAKIPPPVSRSIGGFGW  314



>ref|XP_011028283.1| PREDICTED: serine/threonine-protein kinase SRK2A isoform X2 [Populus 
euphratica]
Length=363

 Score =   218 bits (556),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 101/114 (89%), Positives = 105/114 (92%), Gaps = 0/114 (0%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED +DPKNFRKTI RIM+VQYKIPDYVHISQDCRHLLSRIFVANP RRITIKEIKSHPWF
Sbjct  201  EDQEDPKNFRKTINRIMAVQYKIPDYVHISQDCRHLLSRIFVANPIRRITIKEIKSHPWF  260

Query  744  LKNLPRELTEVAQAAYYRRENPTFSLQSAEEIMKIVDEAKAPPPASRSMGGFGW  583
            LKNLPRELTE AQA YYRRENPTFSLQS EEIMKIV+EAK P P SRS+GGFGW
Sbjct  261  LKNLPRELTEAAQAMYYRRENPTFSLQSVEEIMKIVEEAKIPAPVSRSIGGFGW  314



>emb|CBI29763.3| unnamed protein product [Vitis vinifera]
Length=335

 Score =   217 bits (553),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 98/114 (86%), Positives = 107/114 (94%), Gaps = 0/114 (0%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED +DPKNFRKTI RIM+VQYKIPDYVHISQDCRHLL+RIFVANP+RR+TIK+IK+HPWF
Sbjct  201  EDQEDPKNFRKTISRIMAVQYKIPDYVHISQDCRHLLARIFVANPSRRVTIKDIKNHPWF  260

Query  744  LKNLPRELTEVAQAAYYRRENPTFSLQSAEEIMKIVDEAKAPPPASRSMGGFGW  583
            LKNLPRELTE AQA YYRRENPTFSLQS E+IMKIVDEAK PPP SRS+GGFGW
Sbjct  261  LKNLPRELTEAAQALYYRRENPTFSLQSIEDIMKIVDEAKTPPPVSRSIGGFGW  314



>ref|XP_002269221.1| PREDICTED: serine/threonine-protein kinase SRK2A [Vitis vinifera]
Length=356

 Score =   218 bits (554),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 98/114 (86%), Positives = 107/114 (94%), Gaps = 0/114 (0%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED +DPKNFRKTI RIM+VQYKIPDYVHISQDCRHLL+RIFVANP+RR+TIK+IK+HPWF
Sbjct  201  EDQEDPKNFRKTISRIMAVQYKIPDYVHISQDCRHLLARIFVANPSRRVTIKDIKNHPWF  260

Query  744  LKNLPRELTEVAQAAYYRRENPTFSLQSAEEIMKIVDEAKAPPPASRSMGGFGW  583
            LKNLPRELTE AQA YYRRENPTFSLQS E+IMKIVDEAK PPP SRS+GGFGW
Sbjct  261  LKNLPRELTEAAQALYYRRENPTFSLQSIEDIMKIVDEAKTPPPVSRSIGGFGW  314



>emb|CAN78793.1| hypothetical protein VITISV_028464 [Vitis vinifera]
Length=357

 Score =   218 bits (554),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 98/114 (86%), Positives = 107/114 (94%), Gaps = 0/114 (0%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED +DPKNFRKTI RIM+VQYKIPDYVHISQDCRHLL+RIFVANP+RR+TIK+IK+HPWF
Sbjct  201  EDQEDPKNFRKTISRIMAVQYKIPDYVHISQDCRHLLARIFVANPSRRVTIKDIKNHPWF  260

Query  744  LKNLPRELTEVAQAAYYRRENPTFSLQSAEEIMKIVDEAKAPPPASRSMGGFGW  583
            LKNLPRELTE AQA YYRRENPTFSLQS E+IMKIVDEAK PPP SRS+GGFGW
Sbjct  261  LKNLPRELTEAAQALYYRRENPTFSLQSIEDIMKIVDEAKTPPPVSRSIGGFGW  314



>ref|XP_011028282.1| PREDICTED: serine/threonine-protein kinase SRK2A isoform X1 [Populus 
euphratica]
Length=315

 Score =   216 bits (550),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 99/114 (87%), Positives = 105/114 (92%), Gaps = 0/114 (0%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED +DPKNFRKTI RIM+VQYKIPDYVHISQDCRHLLSRIFVANP RRITIKEIKSHPWF
Sbjct  201  EDQEDPKNFRKTINRIMAVQYKIPDYVHISQDCRHLLSRIFVANPIRRITIKEIKSHPWF  260

Query  744  LKNLPRELTEVAQAAYYRRENPTFSLQSAEEIMKIVDEAKAPPPASRSMGGFGW  583
            LKNLPRELTE AQA YYR+ENPTFSLQ  EEIMKIV+EA+ PPP SRS+GGFGW
Sbjct  261  LKNLPRELTEAAQAIYYRKENPTFSLQGVEEIMKIVEEARIPPPVSRSIGGFGW  314



>ref|XP_007148531.1| hypothetical protein PHAVU_006G216400g [Phaseolus vulgaris]
 gb|ESW20525.1| hypothetical protein PHAVU_006G216400g [Phaseolus vulgaris]
Length=351

 Score =   217 bits (553),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 100/114 (88%), Positives = 105/114 (92%), Gaps = 0/114 (0%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED DDPKNFRKTI RIM+VQYKIPDYVHISQDC+HLLSRIFVAN ARRITIKEIKSHPWF
Sbjct  201  EDQDDPKNFRKTINRIMAVQYKIPDYVHISQDCKHLLSRIFVANAARRITIKEIKSHPWF  260

Query  744  LKNLPRELTEVAQAAYYRRENPTFSLQSAEEIMKIVDEAKAPPPASRSMGGFGW  583
            LKNLPRELTEV QAAYYR+ENP FSLQS E IM IV+EAK PPPASRS+GGFGW
Sbjct  261  LKNLPRELTEVGQAAYYRKENPIFSLQSIEGIMNIVEEAKVPPPASRSIGGFGW  314



>ref|XP_011464827.1| PREDICTED: serine/threonine-protein kinase SRK2A [Fragaria vesca 
subsp. vesca]
 gb|AIH00111.1| sucrose nonfermenting 1-related protein kinase 2.8 [Fragaria 
x ananassa]
Length=352

 Score =   217 bits (553),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 99/114 (87%), Positives = 106/114 (93%), Gaps = 0/114 (0%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED +DPKNFRKTI RIM+VQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIK+HPWF
Sbjct  201  EDQEDPKNFRKTINRIMAVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKNHPWF  260

Query  744  LKNLPRELTEVAQAAYYRRENPTFSLQSAEEIMKIVDEAKAPPPASRSMGGFGW  583
            LKNLPRELTE AQ  YYR+ENPTFSLQS E+IMKIV+EAK PPP SRS+GGFGW
Sbjct  261  LKNLPRELTEAAQTMYYRKENPTFSLQSVEDIMKIVEEAKNPPPVSRSVGGFGW  314



>emb|CDO97575.1| unnamed protein product [Coffea canephora]
Length=358

 Score =   217 bits (552),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 98/114 (86%), Positives = 108/114 (95%), Gaps = 0/114 (0%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED +DPKNFRKTIQRIM+VQYK+PDYVHISQ+CRHLLSRIFVANPARRITIK+IK+HPWF
Sbjct  201  EDQEDPKNFRKTIQRIMAVQYKVPDYVHISQECRHLLSRIFVANPARRITIKDIKTHPWF  260

Query  744  LKNLPRELTEVAQAAYYRRENPTFSLQSAEEIMKIVDEAKAPPPASRSMGGFGW  583
            LKNLPRELT+ AQAAYYR+ENPTFSLQ+ EEI KIV EAK PPPASRS+GGFGW
Sbjct  261  LKNLPRELTDAAQAAYYRKENPTFSLQTVEEITKIVAEAKTPPPASRSIGGFGW  314



>ref|XP_010242684.1| PREDICTED: serine/threonine-protein kinase SRK2A isoform X1 [Nelumbo 
nucifera]
Length=355

 Score =   217 bits (552),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 99/114 (87%), Positives = 106/114 (93%), Gaps = 0/114 (0%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED +DPKNFRKTI RIM+VQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIK+HPWF
Sbjct  201  EDQEDPKNFRKTIGRIMAVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKNHPWF  260

Query  744  LKNLPRELTEVAQAAYYRRENPTFSLQSAEEIMKIVDEAKAPPPASRSMGGFGW  583
            LKNLPRELTE AQA YY+R NPT+SLQS EEIMKIV EA+ PPPASRS+GGFGW
Sbjct  261  LKNLPRELTETAQAVYYQRNNPTYSLQSVEEIMKIVGEARTPPPASRSIGGFGW  314



>ref|XP_008218556.1| PREDICTED: serine/threonine-protein kinase SRK2A [Prunus mume]
Length=350

 Score =   217 bits (552),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 99/114 (87%), Positives = 106/114 (93%), Gaps = 0/114 (0%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED +DPKNFRKTI RIM+VQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIK+HPWF
Sbjct  201  EDQEDPKNFRKTINRIMAVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKNHPWF  260

Query  744  LKNLPRELTEVAQAAYYRRENPTFSLQSAEEIMKIVDEAKAPPPASRSMGGFGW  583
            LKNLPRELTE AQ  YYR+ENPTFSLQS E+IMKIV+EAK PPP SRS+GGFGW
Sbjct  261  LKNLPRELTEAAQTIYYRKENPTFSLQSIEDIMKIVEEAKIPPPVSRSIGGFGW  314



>ref|XP_003592981.1| Serine/threonine protein kinase [Medicago truncatula]
 gb|AES63232.1| sucrose non-fermenting-like kinase 2 family protein [Medicago 
truncatula]
Length=275

 Score =   214 bits (545),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 99/114 (87%), Positives = 108/114 (95%), Gaps = 0/114 (0%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED DDPKNFRKTI RIM+VQYKIPDYVHISQ+CRHLLSRIFVA+PARRITIKEIKSHPWF
Sbjct  125  EDQDDPKNFRKTINRIMAVQYKIPDYVHISQECRHLLSRIFVASPARRITIKEIKSHPWF  184

Query  744  LKNLPRELTEVAQAAYYRRENPTFSLQSAEEIMKIVDEAKAPPPASRSMGGFGW  583
            LKNLPRELTE+AQA YYR+ENPT+SLQS E+IMKIV+EAK PP ASRS+GGFGW
Sbjct  185  LKNLPRELTEMAQAVYYRKENPTYSLQSIEDIMKIVEEAKNPPQASRSVGGFGW  238



>ref|XP_011009382.1| PREDICTED: serine/threonine-protein kinase SRK2A-like [Populus 
euphratica]
Length=357

 Score =   216 bits (551),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 100/113 (88%), Positives = 106/113 (94%), Gaps = 0/113 (0%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            EDH+DPKNFRKTI RIM+VQYKIPDYVHIS+DCRHLLS IFVANP+RRITIKEIKSHPWF
Sbjct  201  EDHEDPKNFRKTINRIMAVQYKIPDYVHISEDCRHLLSHIFVANPSRRITIKEIKSHPWF  260

Query  744  LKNLPRELTEVAQAAYYRRENPTFSLQSAEEIMKIVDEAKAPPPASRSMGGFG  586
            LKNLPRELTE AQA YYRRENPTFSLQS EEIMKIV+EAK PPP SRS+GGFG
Sbjct  261  LKNLPRELTEAAQAMYYRRENPTFSLQSVEEIMKIVEEAKIPPPVSRSIGGFG  313



>ref|XP_006431824.1| hypothetical protein CICLE_v10001672mg [Citrus clementina]
 gb|ESR45064.1| hypothetical protein CICLE_v10001672mg [Citrus clementina]
Length=351

 Score =   216 bits (550),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 99/114 (87%), Positives = 106/114 (93%), Gaps = 0/114 (0%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED +DPKNFRKTI RIM+VQYKIPDYVHISQDCR+LLSRIFVANP+RRITIKEIKSHPWF
Sbjct  201  EDQEDPKNFRKTISRIMAVQYKIPDYVHISQDCRNLLSRIFVANPSRRITIKEIKSHPWF  260

Query  744  LKNLPRELTEVAQAAYYRRENPTFSLQSAEEIMKIVDEAKAPPPASRSMGGFGW  583
            LKNLPRELTE AQA YYR+ENPTFSLQS EEI KIV+EAK PPP SRS+GGFGW
Sbjct  261  LKNLPRELTETAQAIYYRKENPTFSLQSVEEITKIVEEAKVPPPVSRSIGGFGW  314



>ref|XP_009348751.1| PREDICTED: serine/threonine-protein kinase SRK2A [Pyrus x bretschneideri]
Length=351

 Score =   216 bits (549),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 98/114 (86%), Positives = 105/114 (92%), Gaps = 0/114 (0%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED +DPKNFRKTI +IMSVQYKIPDYVHISQDCRHLLSRIFVANP RRITIKEIK+HPWF
Sbjct  201  EDQEDPKNFRKTINKIMSVQYKIPDYVHISQDCRHLLSRIFVANPGRRITIKEIKNHPWF  260

Query  744  LKNLPRELTEVAQAAYYRRENPTFSLQSAEEIMKIVDEAKAPPPASRSMGGFGW  583
            LKNLPRELTE AQ  YYR+ENPTFSLQS E+IMKIV+EAK PPP SRS+GGFGW
Sbjct  261  LKNLPRELTEAAQTVYYRKENPTFSLQSIEDIMKIVEEAKNPPPVSRSIGGFGW  314



>ref|XP_010101152.1| Serine/threonine-protein kinase SAPK7 [Morus notabilis]
 gb|EXB87370.1| Serine/threonine-protein kinase SAPK7 [Morus notabilis]
Length=355

 Score =   216 bits (549),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 97/114 (85%), Positives = 108/114 (95%), Gaps = 0/114 (0%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED +DPKNFRKTI RIMSVQYKIP+YVH+SQDCRHL+SRIFVANPA+RITIKEIK+HPWF
Sbjct  201  EDQEDPKNFRKTINRIMSVQYKIPEYVHVSQDCRHLISRIFVANPAKRITIKEIKNHPWF  260

Query  744  LKNLPRELTEVAQAAYYRRENPTFSLQSAEEIMKIVDEAKAPPPASRSMGGFGW  583
            LKNLPRELTE AQA YYRRENP+FSLQS ++IMKIVD+AK PPPASRS+GGFGW
Sbjct  261  LKNLPRELTEGAQAMYYRRENPSFSLQSVDDIMKIVDDAKTPPPASRSIGGFGW  314



>gb|KJB79237.1| hypothetical protein B456_013G038800 [Gossypium raimondii]
Length=348

 Score =   215 bits (548),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 98/114 (86%), Positives = 107/114 (94%), Gaps = 0/114 (0%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED +DPKNFRKTI RIMSVQYKIPDYVHISQDCRHLLSRIFVA+P+RRI+IK+IKSHPWF
Sbjct  195  EDQEDPKNFRKTISRIMSVQYKIPDYVHISQDCRHLLSRIFVASPSRRISIKDIKSHPWF  254

Query  744  LKNLPRELTEVAQAAYYRRENPTFSLQSAEEIMKIVDEAKAPPPASRSMGGFGW  583
            LKNLPRELTE AQAAYYR+ENPTFSLQS +EIMKIV+EAK  PP SRS+GGFGW
Sbjct  255  LKNLPRELTEAAQAAYYRKENPTFSLQSVDEIMKIVEEAKVAPPVSRSIGGFGW  308



>gb|AFK33547.1| unknown [Medicago truncatula]
Length=351

 Score =   215 bits (547),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 99/114 (87%), Positives = 108/114 (95%), Gaps = 0/114 (0%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED DDPKNFRKTI RIM+VQYKIPDYVHISQ+CRHLLSRIFVA+PARRITIKEIKSHPWF
Sbjct  201  EDQDDPKNFRKTINRIMAVQYKIPDYVHISQECRHLLSRIFVASPARRITIKEIKSHPWF  260

Query  744  LKNLPRELTEVAQAAYYRRENPTFSLQSAEEIMKIVDEAKAPPPASRSMGGFGW  583
            LKNLPRELTE+AQA YYR+ENPT+SLQS E+IMKIV+EAK PP ASRS+GGFGW
Sbjct  261  LKNLPRELTEMAQAVYYRKENPTYSLQSIEDIMKIVEEAKNPPQASRSVGGFGW  314



>ref|XP_003592980.1| Serine/threonine protein kinase [Medicago truncatula]
 gb|AAV41842.1| stress kinase [Medicago truncatula]
 gb|AAV41843.1| stress kinase [Medicago truncatula]
 gb|AES63231.1| sucrose non-fermenting-like kinase 2 family protein [Medicago 
truncatula]
Length=351

 Score =   215 bits (547),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 99/114 (87%), Positives = 108/114 (95%), Gaps = 0/114 (0%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED DDPKNFRKTI RIM+VQYKIPDYVHISQ+CRHLLSRIFVA+PARRITIKEIKSHPWF
Sbjct  201  EDQDDPKNFRKTINRIMAVQYKIPDYVHISQECRHLLSRIFVASPARRITIKEIKSHPWF  260

Query  744  LKNLPRELTEVAQAAYYRRENPTFSLQSAEEIMKIVDEAKAPPPASRSMGGFGW  583
            LKNLPRELTE+AQA YYR+ENPT+SLQS E+IMKIV+EAK PP ASRS+GGFGW
Sbjct  261  LKNLPRELTEMAQAVYYRKENPTYSLQSIEDIMKIVEEAKNPPQASRSVGGFGW  314



>gb|KJB79236.1| hypothetical protein B456_013G038800 [Gossypium raimondii]
Length=354

 Score =   215 bits (547),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 98/114 (86%), Positives = 107/114 (94%), Gaps = 0/114 (0%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED +DPKNFRKTI RIMSVQYKIPDYVHISQDCRHLLSRIFVA+P+RRI+IK+IKSHPWF
Sbjct  201  EDQEDPKNFRKTISRIMSVQYKIPDYVHISQDCRHLLSRIFVASPSRRISIKDIKSHPWF  260

Query  744  LKNLPRELTEVAQAAYYRRENPTFSLQSAEEIMKIVDEAKAPPPASRSMGGFGW  583
            LKNLPRELTE AQAAYYR+ENPTFSLQS +EIMKIV+EAK  PP SRS+GGFGW
Sbjct  261  LKNLPRELTEAAQAAYYRKENPTFSLQSVDEIMKIVEEAKVAPPVSRSIGGFGW  314



>ref|XP_011087723.1| PREDICTED: serine/threonine-protein kinase SRK2A [Sesamum indicum]
Length=352

 Score =   214 bits (546),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 97/114 (85%), Positives = 108/114 (95%), Gaps = 0/114 (0%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED +DPKNFRKTIQRIM+VQY+IPDYVHISQDCRHLLSRIFVA  +RRI+IKEIKSHPWF
Sbjct  201  EDQEDPKNFRKTIQRIMAVQYRIPDYVHISQDCRHLLSRIFVATASRRISIKEIKSHPWF  260

Query  744  LKNLPRELTEVAQAAYYRRENPTFSLQSAEEIMKIVDEAKAPPPASRSMGGFGW  583
            LKNLPRELT+VAQAAYYR+E+PT+ LQS EEIMKIV+EAK PPPASRS+GGFGW
Sbjct  261  LKNLPRELTDVAQAAYYRKEDPTYCLQSVEEIMKIVEEAKTPPPASRSIGGFGW  314



>ref|XP_011092341.1| PREDICTED: serine/threonine-protein kinase SRK2A-like [Sesamum 
indicum]
Length=355

 Score =   215 bits (547),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 96/114 (84%), Positives = 107/114 (94%), Gaps = 0/114 (0%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED +DP+NFR+TIQRIM+VQYKIPDYVHISQDCRHLLSRIFVANPARRITIK+IK+HPWF
Sbjct  201  EDQEDPRNFRRTIQRIMAVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKDIKTHPWF  260

Query  744  LKNLPRELTEVAQAAYYRRENPTFSLQSAEEIMKIVDEAKAPPPASRSMGGFGW  583
            LKNLPRELT+ AQA YYRRENPT+SLQ+ EEIMKIV+EAK P P SRS+GGFGW
Sbjct  261  LKNLPRELTDAAQATYYRRENPTYSLQTVEEIMKIVEEAKTPAPVSRSVGGFGW  314



>ref|XP_006471015.1| PREDICTED: serine/threonine-protein kinase SRK2A-like [Citrus 
sinensis]
Length=351

 Score =   214 bits (545),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 99/114 (87%), Positives = 106/114 (93%), Gaps = 0/114 (0%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED +DPKNFRKTI RIM+VQYKIPDYVHISQDCR+LLSRIFVANP+RRITIKEIKSHPWF
Sbjct  201  EDQEDPKNFRKTISRIMAVQYKIPDYVHISQDCRNLLSRIFVANPSRRITIKEIKSHPWF  260

Query  744  LKNLPRELTEVAQAAYYRRENPTFSLQSAEEIMKIVDEAKAPPPASRSMGGFGW  583
            LKNLPRELTE AQA YYR+ENPTFSLQS EEI KIV+EAK PPP SRS+GGFGW
Sbjct  261  LKNLPRELTEPAQAIYYRKENPTFSLQSVEEITKIVEEAKVPPPVSRSIGGFGW  314



>ref|XP_007222266.1| hypothetical protein PRUPE_ppa007946mg [Prunus persica]
 gb|EMJ23465.1| hypothetical protein PRUPE_ppa007946mg [Prunus persica]
Length=350

 Score =   214 bits (544),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 98/114 (86%), Positives = 105/114 (92%), Gaps = 0/114 (0%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED +DPKNFRKTI RIM+VQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIK+HPWF
Sbjct  201  EDQEDPKNFRKTINRIMAVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKNHPWF  260

Query  744  LKNLPRELTEVAQAAYYRRENPTFSLQSAEEIMKIVDEAKAPPPASRSMGGFGW  583
            LKNLPRELTE AQ  YYR+ENPTFSLQS E+IMKIV+EAK PPP SRS+G FGW
Sbjct  261  LKNLPRELTEAAQTIYYRKENPTFSLQSIEDIMKIVEEAKIPPPVSRSIGSFGW  314



>gb|KHG21689.1| Serine/threonine-protein kinase SRK2B [Gossypium arboreum]
Length=302

 Score =   212 bits (540),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 97/114 (85%), Positives = 106/114 (93%), Gaps = 0/114 (0%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED +DPKNFRKTI RIMSVQYKIPDYVHISQDCRHLLSRIFVA+P+RRI+IK+IKSHPWF
Sbjct  149  EDQEDPKNFRKTISRIMSVQYKIPDYVHISQDCRHLLSRIFVASPSRRISIKDIKSHPWF  208

Query  744  LKNLPRELTEVAQAAYYRRENPTFSLQSAEEIMKIVDEAKAPPPASRSMGGFGW  583
            LKNLPRELTE AQAAYYR+ENPTFSLQS +EIMKIV+EAK   P SRS+GGFGW
Sbjct  209  LKNLPRELTEAAQAAYYRKENPTFSLQSVDEIMKIVEEAKVAAPVSRSIGGFGW  262



>gb|EYU35455.1| hypothetical protein MIMGU_mgv1a008963mg [Erythranthe guttata]
Length=357

 Score =   213 bits (542),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 98/114 (86%), Positives = 105/114 (92%), Gaps = 0/114 (0%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED +DPKNFRKTIQRIM+VQYKIPDYVHISQDCRHLLSRIFVAN +RRI+IK+IKSHPWF
Sbjct  201  EDQEDPKNFRKTIQRIMAVQYKIPDYVHISQDCRHLLSRIFVANSSRRISIKDIKSHPWF  260

Query  744  LKNLPRELTEVAQAAYYRRENPTFSLQSAEEIMKIVDEAKAPPPASRSMGGFGW  583
            LKNLPRELT+ AQ  YYRRENPTFSLQS EEIMKIVDEAK PPPASRS+  FGW
Sbjct  261  LKNLPRELTDAAQTVYYRRENPTFSLQSVEEIMKIVDEAKTPPPASRSVRAFGW  314



>gb|KJB47471.1| hypothetical protein B456_008G027800 [Gossypium raimondii]
Length=280

 Score =   210 bits (535),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 96/114 (84%), Positives = 106/114 (93%), Gaps = 0/114 (0%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED +DPKNFRKTI RIMS+QYKIPDYVHISQDCRHLLSRIFVA+P+RRI+IK+IKSHPWF
Sbjct  125  EDQEDPKNFRKTISRIMSIQYKIPDYVHISQDCRHLLSRIFVASPSRRISIKDIKSHPWF  184

Query  744  LKNLPRELTEVAQAAYYRRENPTFSLQSAEEIMKIVDEAKAPPPASRSMGGFGW  583
            LKNLPRELTE AQAAYYR+ENPTFSLQS +EIMKIV+EAK  P  SRS+GGFGW
Sbjct  185  LKNLPRELTEAAQAAYYRKENPTFSLQSVDEIMKIVEEAKVAPRVSRSIGGFGW  238



>ref|XP_002530676.1| Serine/threonine-protein kinase ASK1, putative [Ricinus communis]
 gb|EEF31707.1| Serine/threonine-protein kinase ASK1, putative [Ricinus communis]
Length=357

 Score =   213 bits (541),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 97/112 (87%), Positives = 106/112 (95%), Gaps = 0/112 (0%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED +DPKNFRKTI RIM+VQYKIPDYVHISQDCRHLLSRIFVANP+RR+TIK+IKSHPWF
Sbjct  201  EDQEDPKNFRKTINRIMAVQYKIPDYVHISQDCRHLLSRIFVANPSRRVTIKDIKSHPWF  260

Query  744  LKNLPRELTEVAQAAYYRRENPTFSLQSAEEIMKIVDEAKAPPPASRSMGGF  589
            LKNLPRELTE AQA YYR+ENPTFSLQ+AEEIMKIV+EAK PPP SRS+GGF
Sbjct  261  LKNLPRELTEAAQAMYYRKENPTFSLQTAEEIMKIVEEAKIPPPVSRSIGGF  312



>ref|XP_008361703.1| PREDICTED: serine/threonine-protein kinase SRK2A [Malus domestica]
 gb|AII82273.1| SnRK2.9 [Malus domestica]
 gb|AIK22398.1| sucrose non-fermenting-1-related protein kinase 2.11 [Malus prunifolia]
Length=352

 Score =   212 bits (540),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 97/114 (85%), Positives = 103/114 (90%), Gaps = 0/114 (0%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED +DPKNFRKTI +IMSVQYKIPDYVHISQDCRHLLSRIFVAN  RRITIKEIK+HPWF
Sbjct  201  EDQEDPKNFRKTINKIMSVQYKIPDYVHISQDCRHLLSRIFVANSGRRITIKEIKNHPWF  260

Query  744  LKNLPRELTEVAQAAYYRRENPTFSLQSAEEIMKIVDEAKAPPPASRSMGGFGW  583
            LKNLPRELTE AQ  YYR+ENPTFSLQS E IMKIV+EAK PPP SRS+GGFGW
Sbjct  261  LKNLPRELTEAAQTVYYRKENPTFSLQSIEAIMKIVEEAKNPPPVSRSIGGFGW  314



>ref|XP_008339496.1| PREDICTED: serine/threonine-protein kinase SRK2A [Malus domestica]
Length=352

 Score =   212 bits (540),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 97/114 (85%), Positives = 103/114 (90%), Gaps = 0/114 (0%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED +DPKNFRKTI +IMSVQYKIPDYVHISQDCRHLLSRIFVAN  RRITIKEIK+HPWF
Sbjct  201  EDQEDPKNFRKTINKIMSVQYKIPDYVHISQDCRHLLSRIFVANSGRRITIKEIKNHPWF  260

Query  744  LKNLPRELTEVAQAAYYRRENPTFSLQSAEEIMKIVDEAKAPPPASRSMGGFGW  583
            LKNLPRELTE AQ  YYR+ENPTFSLQS E IMKIV+EAK PPP SRS+GGFGW
Sbjct  261  LKNLPRELTEAAQTVYYRKENPTFSLQSIEAIMKIVEEAKNPPPVSRSIGGFGW  314



>ref|XP_007042267.1| SNF1-related protein kinase 2.10 isoform 2 [Theobroma cacao]
 gb|EOX98098.1| SNF1-related protein kinase 2.10 isoform 2 [Theobroma cacao]
Length=353

 Score =   212 bits (540),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 96/114 (84%), Positives = 106/114 (93%), Gaps = 0/114 (0%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED +DPKNFRKTI RIMSVQYKIPDYVH+SQDCRHLLSRIFVA+P+RRI+IK+IK+HPWF
Sbjct  201  EDQEDPKNFRKTISRIMSVQYKIPDYVHVSQDCRHLLSRIFVASPSRRISIKDIKNHPWF  260

Query  744  LKNLPRELTEVAQAAYYRRENPTFSLQSAEEIMKIVDEAKAPPPASRSMGGFGW  583
            LKNLPRELTE AQ AYYR+ENPTFSLQS EEIMKIV+EAKA PP  RS+GGFGW
Sbjct  261  LKNLPRELTEAAQTAYYRKENPTFSLQSVEEIMKIVEEAKAAPPVLRSIGGFGW  314



>ref|XP_010547458.1| PREDICTED: serine/threonine-protein kinase SRK2A-like [Tarenaya 
hassleriana]
Length=356

 Score =   212 bits (539),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 96/114 (84%), Positives = 105/114 (92%), Gaps = 0/114 (0%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED +DPKNFRKTIQRIM+VQYKIPDYVH++QDC+HLLSRIFVANPA+RI I EIK HPWF
Sbjct  201  EDQEDPKNFRKTIQRIMAVQYKIPDYVHVTQDCKHLLSRIFVANPAKRIAIAEIKKHPWF  260

Query  744  LKNLPRELTEVAQAAYYRRENPTFSLQSAEEIMKIVDEAKAPPPASRSMGGFGW  583
             KNLPRELTE AQAAYYR+ENPTFSLQS EEIMKIV+EAKAPP  SRS+GGFGW
Sbjct  261  RKNLPRELTETAQAAYYRKENPTFSLQSVEEIMKIVEEAKAPPRVSRSIGGFGW  314



>gb|KJB47472.1| hypothetical protein B456_008G027800 [Gossypium raimondii]
Length=334

 Score =   211 bits (537),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 96/114 (84%), Positives = 106/114 (93%), Gaps = 0/114 (0%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED +DPKNFRKTI RIMS+QYKIPDYVHISQDCRHLLSRIFVA+P+RRI+IK+IKSHPWF
Sbjct  201  EDQEDPKNFRKTISRIMSIQYKIPDYVHISQDCRHLLSRIFVASPSRRISIKDIKSHPWF  260

Query  744  LKNLPRELTEVAQAAYYRRENPTFSLQSAEEIMKIVDEAKAPPPASRSMGGFGW  583
            LKNLPRELTE AQAAYYR+ENPTFSLQS +EIMKIV+EAK  P  SRS+GGFGW
Sbjct  261  LKNLPRELTEAAQAAYYRKENPTFSLQSVDEIMKIVEEAKVAPRVSRSIGGFGW  314



>gb|KHG21217.1| Serine/threonine-protein kinase SRK2B [Gossypium arboreum]
Length=305

 Score =   209 bits (533),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 96/114 (84%), Positives = 106/114 (93%), Gaps = 0/114 (0%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED +DPKNFRKTI RIMSVQYKIPDYVHISQDC+HLLSRIFVA+P+RRI+IK+IKSHPWF
Sbjct  149  EDQEDPKNFRKTISRIMSVQYKIPDYVHISQDCKHLLSRIFVASPSRRISIKDIKSHPWF  208

Query  744  LKNLPRELTEVAQAAYYRRENPTFSLQSAEEIMKIVDEAKAPPPASRSMGGFGW  583
            LKNLPRELTE AQAAYYR+ENPTFSLQS +EIMKIV+EAK  P  SRS+GGFGW
Sbjct  209  LKNLPRELTEAAQAAYYRKENPTFSLQSVDEIMKIVEEAKVAPRVSRSIGGFGW  262



>ref|XP_009104154.1| PREDICTED: serine/threonine-protein kinase SRK2A [Brassica rapa]
 emb|CDY46190.1| BnaA01g23120D [Brassica napus]
Length=352

 Score =   211 bits (537),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 95/114 (83%), Positives = 106/114 (93%), Gaps = 0/114 (0%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED +DPKNFRKT+QRI++VQYKIPDYVHISQDC+H+LSRIFVANP +RITI EIK HPWF
Sbjct  201  EDPEDPKNFRKTMQRILAVQYKIPDYVHISQDCKHILSRIFVANPLKRITIAEIKKHPWF  260

Query  744  LKNLPRELTEVAQAAYYRRENPTFSLQSAEEIMKIVDEAKAPPPASRSMGGFGW  583
            LKNLPRELTE+AQAAYYR+ENPTFSLQS EEIMKIV+EAK PPP SRS+G FGW
Sbjct  261  LKNLPRELTEIAQAAYYRKENPTFSLQSVEEIMKIVEEAKTPPPVSRSIGAFGW  314



>gb|KJB47468.1| hypothetical protein B456_008G027800 [Gossypium raimondii]
Length=356

 Score =   211 bits (537),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 96/114 (84%), Positives = 106/114 (93%), Gaps = 0/114 (0%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED +DPKNFRKTI RIMS+QYKIPDYVHISQDCRHLLSRIFVA+P+RRI+IK+IKSHPWF
Sbjct  201  EDQEDPKNFRKTISRIMSIQYKIPDYVHISQDCRHLLSRIFVASPSRRISIKDIKSHPWF  260

Query  744  LKNLPRELTEVAQAAYYRRENPTFSLQSAEEIMKIVDEAKAPPPASRSMGGFGW  583
            LKNLPRELTE AQAAYYR+ENPTFSLQS +EIMKIV+EAK  P  SRS+GGFGW
Sbjct  261  LKNLPRELTEAAQAAYYRKENPTFSLQSVDEIMKIVEEAKVAPRVSRSIGGFGW  314



>emb|CDY20973.1| BnaA08g25520D [Brassica napus]
Length=354

 Score =   211 bits (537),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 94/114 (82%), Positives = 105/114 (92%), Gaps = 0/114 (0%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED +DPKNFRKTIQ+IM+VQYKIPDYVHISQDC+HLLSRIFVAN  +RITI EIK HPWF
Sbjct  201  EDQEDPKNFRKTIQKIMAVQYKIPDYVHISQDCKHLLSRIFVANSLQRITIAEIKKHPWF  260

Query  744  LKNLPRELTEVAQAAYYRRENPTFSLQSAEEIMKIVDEAKAPPPASRSMGGFGW  583
            +KNLPRELTE AQAAY+R+ENPTFSLQ+ EEIMKIVD+AK PPP SRS+GGFGW
Sbjct  261  MKNLPRELTETAQAAYFRKENPTFSLQTTEEIMKIVDDAKTPPPVSRSIGGFGW  314



>ref|XP_004485476.1| PREDICTED: serine/threonine-protein kinase SRK2A-like [Cicer 
arietinum]
Length=351

 Score =   210 bits (534),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 96/114 (84%), Positives = 106/114 (93%), Gaps = 0/114 (0%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED +DPKNFRKTI RI++VQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF
Sbjct  201  EDQEDPKNFRKTINRIVAVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  260

Query  744  LKNLPRELTEVAQAAYYRRENPTFSLQSAEEIMKIVDEAKAPPPASRSMGGFGW  583
            LKNLPRELTE+AQA YY++ENPT+SLQS E+IM IV+EAK P  ASRS+GGFGW
Sbjct  261  LKNLPRELTEMAQAVYYKKENPTYSLQSIEDIMNIVEEAKIPSQASRSIGGFGW  314



>ref|XP_007042266.1| SNF1-related protein kinase 2.10 isoform 1 [Theobroma cacao]
 gb|EOX98097.1| SNF1-related protein kinase 2.10 isoform 1 [Theobroma cacao]
Length=424

 Score =   211 bits (538),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 96/114 (84%), Positives = 106/114 (93%), Gaps = 0/114 (0%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED +DPKNFRKTI RIMSVQYKIPDYVH+SQDCRHLLSRIFVA+P+RRI+IK+IK+HPWF
Sbjct  272  EDQEDPKNFRKTISRIMSVQYKIPDYVHVSQDCRHLLSRIFVASPSRRISIKDIKNHPWF  331

Query  744  LKNLPRELTEVAQAAYYRRENPTFSLQSAEEIMKIVDEAKAPPPASRSMGGFGW  583
            LKNLPRELTE AQ AYYR+ENPTFSLQS EEIMKIV+EAKA PP  RS+GGFGW
Sbjct  332  LKNLPRELTEAAQTAYYRKENPTFSLQSVEEIMKIVEEAKAAPPVLRSIGGFGW  385



>ref|XP_003531593.1| PREDICTED: serine/threonine-protein kinase SRK2A-like isoform 
X1 [Glycine max]
 ref|XP_006585497.1| PREDICTED: serine/threonine-protein kinase SRK2A-like isoform 
X2 [Glycine max]
 gb|KHN11243.1| Serine/threonine-protein kinase SRK2B [Glycine soja]
Length=352

 Score =   209 bits (533),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 98/109 (90%), Positives = 105/109 (96%), Gaps = 0/109 (0%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED +DPKNFRKTI RIM+VQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF
Sbjct  201  EDQEDPKNFRKTINRIMAVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  260

Query  744  LKNLPRELTEVAQAAYYRRENPTFSLQSAEEIMKIVDEAKAPPPASRSM  598
            +KNLPRELTEVAQAAYYR+ENPTFSLQS E+IM IV+EAKAPPPASRS+
Sbjct  261  VKNLPRELTEVAQAAYYRKENPTFSLQSIEDIMNIVEEAKAPPPASRSI  309



>gb|KFK43389.1| hypothetical protein AALP_AA1G119700 [Arabis alpina]
Length=360

 Score =   209 bits (531),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 93/114 (82%), Positives = 104/114 (91%), Gaps = 0/114 (0%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED +DPKNFRKTIQ+IM+VQYKIPDYVHISQDC+HLLSRIFVAN  +R+TI EIK HPWF
Sbjct  201  EDQEDPKNFRKTIQKIMAVQYKIPDYVHISQDCKHLLSRIFVANSLKRVTIAEIKKHPWF  260

Query  744  LKNLPRELTEVAQAAYYRRENPTFSLQSAEEIMKIVDEAKAPPPASRSMGGFGW  583
            LKNLPRELTE AQAAY+R+ENPTFSLQ+ EEIMKIVD+AK PPP SRS+ GFGW
Sbjct  261  LKNLPRELTETAQAAYFRKENPTFSLQTVEEIMKIVDDAKTPPPVSRSISGFGW  314



>gb|AAO69666.1| protein kinase SPK-3 [Phaseolus acutifolius]
Length=159

 Score =   202 bits (514),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 93/114 (82%), Positives = 103/114 (90%), Gaps = 0/114 (0%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED DDP+NFRKTIQRIM+VQYKIPDYVHISQDCRHLLSRIFVANP RRI++KEIK+HPWF
Sbjct  9    EDQDDPRNFRKTIQRIMAVQYKIPDYVHISQDCRHLLSRIFVANPLRRISLKEIKNHPWF  68

Query  744  LKNLPRELTEVAQAAYYRRENPTFSLQSAEEIMKIVDEAKAPPPASRSMGGFGW  583
            LKNLPRELTE AQA YY+R NP+FS+QS EEIMKIV EA+ PPP SR + GFGW
Sbjct  69   LKNLPRELTESAQALYYQRGNPSFSVQSVEEIMKIVGEARDPPPVSRPVKGFGW  122



>ref|XP_012071302.1| PREDICTED: serine/threonine-protein kinase SRK2A [Jatropha curcas]
 gb|KDP38831.1| hypothetical protein JCGZ_04988 [Jatropha curcas]
Length=354

 Score =   208 bits (530),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 95/112 (85%), Positives = 105/112 (94%), Gaps = 0/112 (0%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED +DPKNFRKTI RIM+VQYKIPDYVHISQDCRHLLSRIFVANP+RRITIKEI+SHPWF
Sbjct  201  EDQEDPKNFRKTINRIMAVQYKIPDYVHISQDCRHLLSRIFVANPSRRITIKEIRSHPWF  260

Query  744  LKNLPRELTEVAQAAYYRRENPTFSLQSAEEIMKIVDEAKAPPPASRSMGGF  589
            LKNLPRELTE AQA YYR+ENP FSLQ+ +EIMKIV+EAK+PPP SRS+GGF
Sbjct  261  LKNLPRELTEAAQAMYYRKENPGFSLQTDQEIMKIVEEAKSPPPVSRSIGGF  312



>ref|XP_009144406.1| PREDICTED: serine/threonine-protein kinase SRK2A-like [Brassica 
rapa]
Length=354

 Score =   208 bits (530),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 93/114 (82%), Positives = 104/114 (91%), Gaps = 0/114 (0%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED +DPKNFRKTIQ+IM+VQYKIPDYVHISQ C+HLLSRIFVAN  +RITI EIK HPWF
Sbjct  201  EDQEDPKNFRKTIQKIMAVQYKIPDYVHISQGCKHLLSRIFVANSLQRITIAEIKKHPWF  260

Query  744  LKNLPRELTEVAQAAYYRRENPTFSLQSAEEIMKIVDEAKAPPPASRSMGGFGW  583
            +KNLPRELTE AQAAY+R+ENPTFSLQ+ EEIMKIVD+AK PPP SRS+GGFGW
Sbjct  261  MKNLPRELTETAQAAYFRKENPTFSLQTTEEIMKIVDDAKTPPPVSRSIGGFGW  314



>ref|XP_006300518.1| hypothetical protein CARUB_v10020517mg [Capsella rubella]
 gb|EOA33416.1| hypothetical protein CARUB_v10020517mg [Capsella rubella]
Length=364

 Score =   207 bits (527),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 94/114 (82%), Positives = 102/114 (89%), Gaps = 0/114 (0%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED  DPKNF+KTIQRIM+VQYKIPDYVHISQDC+HLLSRIFVAN  +RITI EIK HPWF
Sbjct  201  EDQQDPKNFKKTIQRIMAVQYKIPDYVHISQDCKHLLSRIFVANSIKRITIAEIKKHPWF  260

Query  744  LKNLPRELTEVAQAAYYRRENPTFSLQSAEEIMKIVDEAKAPPPASRSMGGFGW  583
            LKNLPRELTE AQAAY+R+ENPTFSLQS EEIMKIV+EAK P P SRS+G FGW
Sbjct  261  LKNLPRELTETAQAAYFRKENPTFSLQSVEEIMKIVEEAKTPAPVSRSIGAFGW  314



>ref|XP_006847010.1| PREDICTED: serine/threonine-protein kinase SRK2A [Amborella trichopoda]
 ref|XP_011624335.1| PREDICTED: serine/threonine-protein kinase SRK2A [Amborella trichopoda]
 gb|ERN08591.1| hypothetical protein AMTR_s00017p00148890 [Amborella trichopoda]
Length=354

 Score =   206 bits (525),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 93/114 (82%), Positives = 103/114 (90%), Gaps = 0/114 (0%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED +DPKNFRKTIQRIM VQYKIPDYVHISQDCRHLLSRIFVAN ++RITIKEIKSHPWF
Sbjct  201  EDQEDPKNFRKTIQRIMGVQYKIPDYVHISQDCRHLLSRIFVANSSKRITIKEIKSHPWF  260

Query  744  LKNLPRELTEVAQAAYYRRENPTFSLQSAEEIMKIVDEAKAPPPASRSMGGFGW  583
            LKNLPRELTE AQA +Y+RENP+   QS E+IMKIV EA+ PPP+SRS+GGFGW
Sbjct  261  LKNLPRELTEAAQATFYQRENPSLFFQSVEDIMKIVGEARTPPPSSRSIGGFGW  314



>gb|AFK42988.1| unknown [Lotus japonicus]
Length=351

 Score =   206 bits (525),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 94/114 (82%), Positives = 104/114 (91%), Gaps = 0/114 (0%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED +DP+NFRKTI RIM+VQYKIPDYVHI+QDCRHLLSRIFVANPA+RITIKEIKSHPWF
Sbjct  201  EDPEDPRNFRKTINRIMAVQYKIPDYVHITQDCRHLLSRIFVANPAKRITIKEIKSHPWF  260

Query  744  LKNLPRELTEVAQAAYYRRENPTFSLQSAEEIMKIVDEAKAPPPASRSMGGFGW  583
            LKNLPRELTEVAQA YYR+ENPTFSLQS E+IM IV+EAK P    RS+GG+GW
Sbjct  261  LKNLPRELTEVAQAVYYRKENPTFSLQSIEDIMNIVEEAKTPAKVPRSIGGYGW  314



>ref|XP_010418041.1| PREDICTED: serine/threonine-protein kinase SRK2B-like [Camelina 
sativa]
Length=362

 Score =   207 bits (526),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 94/114 (82%), Positives = 102/114 (89%), Gaps = 0/114 (0%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED  DPKNF+KTIQRIM+VQYKIPDYVHISQDC+HLLSRIFVAN  +RITI EIK HPWF
Sbjct  201  EDQQDPKNFKKTIQRIMAVQYKIPDYVHISQDCKHLLSRIFVANSIKRITIAEIKKHPWF  260

Query  744  LKNLPRELTEVAQAAYYRRENPTFSLQSAEEIMKIVDEAKAPPPASRSMGGFGW  583
            LKNLPRELTE AQAAY+R+ENPTFSLQS EEIMKIV+EAK P P SRS+G FGW
Sbjct  261  LKNLPRELTETAQAAYFRKENPTFSLQSVEEIMKIVEEAKTPAPVSRSIGAFGW  314



>ref|XP_010430082.1| PREDICTED: serine/threonine-protein kinase SRK2B-like [Camelina 
sativa]
Length=362

 Score =   207 bits (526),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 94/114 (82%), Positives = 102/114 (89%), Gaps = 0/114 (0%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED  DPKNF+KTIQRIM+VQYKIPDYVHISQDC+HLLSRIFVAN  +RITI EIK HPWF
Sbjct  201  EDQQDPKNFKKTIQRIMAVQYKIPDYVHISQDCKHLLSRIFVANSIKRITIAEIKKHPWF  260

Query  744  LKNLPRELTEVAQAAYYRRENPTFSLQSAEEIMKIVDEAKAPPPASRSMGGFGW  583
            LKNLPRELTE AQAAY+R+ENPTFSLQS EEIMKIV+EAK P P SRS+G FGW
Sbjct  261  LKNLPRELTETAQAAYFRKENPTFSLQSVEEIMKIVEEAKTPAPVSRSIGAFGW  314



>gb|AFK42326.1| unknown [Lotus japonicus]
Length=344

 Score =   206 bits (524),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 94/114 (82%), Positives = 104/114 (91%), Gaps = 0/114 (0%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED +DP+NFRKTI RIM+VQYKIPDYVHI+QDCRHLLSRIFVANPA+RITIKEIKSHPWF
Sbjct  201  EDPEDPRNFRKTINRIMAVQYKIPDYVHITQDCRHLLSRIFVANPAKRITIKEIKSHPWF  260

Query  744  LKNLPRELTEVAQAAYYRRENPTFSLQSAEEIMKIVDEAKAPPPASRSMGGFGW  583
            LKNLPRELTEVAQA YYR+ENPTFSLQS E+IM IV+EAK P    RS+GG+GW
Sbjct  261  LKNLPRELTEVAQAVYYRKENPTFSLQSIEDIMNIVEEAKTPAKVPRSIGGYGW  314



>ref|XP_008449831.1| PREDICTED: serine/threonine-protein kinase SRK2H-like [Cucumis 
melo]
Length=355

 Score =   206 bits (525),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 94/114 (82%), Positives = 105/114 (92%), Gaps = 0/114 (0%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED +DPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFV NP+RRIT+ EIK+HPWF
Sbjct  201  EDQEDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVPNPSRRITLMEIKNHPWF  260

Query  744  LKNLPRELTEVAQAAYYRRENPTFSLQSAEEIMKIVDEAKAPPPASRSMGGFGW  583
            LKNLPRELTE AQAAYY+R+NP+FSLQS +EIMKIV EA+ PPP+SR + GFGW
Sbjct  261  LKNLPRELTESAQAAYYKRDNPSFSLQSVDEIMKIVGEARNPPPSSRPVKGFGW  314



>ref|XP_010473290.1| PREDICTED: serine/threonine-protein kinase SRK2B [Camelina sativa]
Length=362

 Score =   206 bits (525),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 94/114 (82%), Positives = 102/114 (89%), Gaps = 0/114 (0%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED  DPKNF+KTIQRIM+VQYKIPDYVHISQDC+HLLSRIFVAN  +RITI EIK HPWF
Sbjct  201  EDQQDPKNFKKTIQRIMAVQYKIPDYVHISQDCKHLLSRIFVANSIKRITIAEIKKHPWF  260

Query  744  LKNLPRELTEVAQAAYYRRENPTFSLQSAEEIMKIVDEAKAPPPASRSMGGFGW  583
            LKNLPRELTE AQAAY+R+ENPTFSLQS EEIMKIV+EAK P P SRS+G FGW
Sbjct  261  LKNLPRELTETAQAAYFRKENPTFSLQSVEEIMKIVEEAKTPAPVSRSIGAFGW  314



>ref|XP_006426422.1| hypothetical protein CICLE_v10025965mg [Citrus clementina]
 gb|ESR39662.1| hypothetical protein CICLE_v10025965mg [Citrus clementina]
Length=353

 Score =   206 bits (524),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 92/114 (81%), Positives = 106/114 (93%), Gaps = 0/114 (0%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED DDPKNFRKTIQ+IM+VQY+IPDYVHISQ+CRHLLSR+FVANP+RRIT+KEIK+HPWF
Sbjct  201  EDQDDPKNFRKTIQKIMAVQYRIPDYVHISQECRHLLSRLFVANPSRRITLKEIKNHPWF  260

Query  744  LKNLPRELTEVAQAAYYRRENPTFSLQSAEEIMKIVDEAKAPPPASRSMGGFGW  583
            LKNLPRELTE AQA YY+RENP+FSLQS EEIMKIV EA+ PPP+SR++  FGW
Sbjct  261  LKNLPRELTESAQAVYYQRENPSFSLQSVEEIMKIVGEARNPPPSSRTVKNFGW  314



>ref|XP_006466196.1| PREDICTED: serine/threonine-protein kinase SRK2A-like [Citrus 
sinensis]
Length=354

 Score =   206 bits (524),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 92/114 (81%), Positives = 106/114 (93%), Gaps = 0/114 (0%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED DDPKNFRKTIQ+IM+VQY+IPDYVHISQ+CRHLLSR+FVANP+RRIT+KEIK+HPWF
Sbjct  201  EDQDDPKNFRKTIQKIMAVQYRIPDYVHISQECRHLLSRLFVANPSRRITLKEIKNHPWF  260

Query  744  LKNLPRELTEVAQAAYYRRENPTFSLQSAEEIMKIVDEAKAPPPASRSMGGFGW  583
            LKNLPRELTE AQA YY+RENP+FSLQS EEIMKIV EA+ PPP+SR++  FGW
Sbjct  261  LKNLPRELTESAQAVYYQRENPSFSLQSVEEIMKIVGEARNPPPSSRTVKNFGW  314



>ref|XP_006392094.1| hypothetical protein EUTSA_v10023544mg [Eutrema salsugineum]
 gb|ESQ29380.1| hypothetical protein EUTSA_v10023544mg [Eutrema salsugineum]
Length=361

 Score =   206 bits (524),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 94/114 (82%), Positives = 102/114 (89%), Gaps = 0/114 (0%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED +DPKNFRKTIQRIM+VQYKIPDYV +SQDC+HLLSRIFVAN  +RITI EIK HPWF
Sbjct  201  EDQEDPKNFRKTIQRIMAVQYKIPDYVRVSQDCKHLLSRIFVANAIKRITIAEIKKHPWF  260

Query  744  LKNLPRELTEVAQAAYYRRENPTFSLQSAEEIMKIVDEAKAPPPASRSMGGFGW  583
            LKNLPRELTE AQAAY+R+ENPTFS QS EEIMKIVDEAK PPP SRS+G FGW
Sbjct  261  LKNLPRELTETAQAAYFRKENPTFSEQSVEEIMKIVDEAKTPPPVSRSIGAFGW  314



>ref|NP_001236743.1| protein kinase 3 [Glycine max]
 gb|AAB68961.1| protein kinase 3 [Glycine max]
 gb|KHN16911.1| Serine/threonine-protein kinase SAPK7 [Glycine soja]
Length=351

 Score =   206 bits (523),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 94/114 (82%), Positives = 103/114 (90%), Gaps = 0/114 (0%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED DDP+NFRKTIQRIM+VQYKIPDYVHISQDCRHLLSRIFVANP RRI++KEIKSHPWF
Sbjct  201  EDQDDPRNFRKTIQRIMAVQYKIPDYVHISQDCRHLLSRIFVANPLRRISLKEIKSHPWF  260

Query  744  LKNLPRELTEVAQAAYYRRENPTFSLQSAEEIMKIVDEAKAPPPASRSMGGFGW  583
            LKNLPRELTE AQA YY+R NP+FS+QS EEIMKIV EA+ PPP SR + GFGW
Sbjct  261  LKNLPRELTESAQAVYYQRGNPSFSIQSVEEIMKIVGEARDPPPVSRPVKGFGW  314



>gb|KEH35656.1| sucrose non-fermenting-like kinase 2 family protein [Medicago 
truncatula]
Length=355

 Score =   206 bits (523),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 93/114 (82%), Positives = 103/114 (90%), Gaps = 0/114 (0%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED DDPKNFRKTIQRIM++QYKIPDYVHISQDCRHL+SRIFVANP RRITIKEIKSHPWF
Sbjct  201  EDQDDPKNFRKTIQRIMAIQYKIPDYVHISQDCRHLISRIFVANPLRRITIKEIKSHPWF  260

Query  744  LKNLPRELTEVAQAAYYRRENPTFSLQSAEEIMKIVDEAKAPPPASRSMGGFGW  583
            LKNLPRELTE AQA YY+RENP+F LQS +++MKIV EA+ PPP SR + GFGW
Sbjct  261  LKNLPRELTESAQAMYYQRENPSFHLQSVDDVMKIVGEARNPPPVSRPVKGFGW  314



>gb|KGN54755.1| hypothetical protein Csa_4G453650 [Cucumis sativus]
Length=347

 Score =   205 bits (522),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 92/114 (81%), Positives = 105/114 (92%), Gaps = 0/114 (0%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED +DPKNFRKTIQRIM+VQYKIPDYVHISQDCRHLLSRIFV NP+RRIT+ EIK+HPWF
Sbjct  193  EDQEDPKNFRKTIQRIMAVQYKIPDYVHISQDCRHLLSRIFVPNPSRRITLMEIKNHPWF  252

Query  744  LKNLPRELTEVAQAAYYRRENPTFSLQSAEEIMKIVDEAKAPPPASRSMGGFGW  583
            LKNLPRELTE AQAAYY+R+NP+FSLQ  +EIMKIV EA+ PPP+SR++ GFGW
Sbjct  253  LKNLPRELTESAQAAYYKRDNPSFSLQGVDEIMKIVGEARNPPPSSRTVKGFGW  306



>ref|XP_007049926.1| Kinase superfamily protein isoform 1 [Theobroma cacao]
 gb|EOX94083.1| Kinase superfamily protein isoform 1 [Theobroma cacao]
Length=357

 Score =   205 bits (522),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 92/114 (81%), Positives = 107/114 (94%), Gaps = 0/114 (0%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED +DP+NFRKTIQRIM+VQYKIPDYVH+SQDCR+LLSRIFVANP+RRITIKEIK+HPWF
Sbjct  206  EDQEDPRNFRKTIQRIMAVQYKIPDYVHVSQDCRNLLSRIFVANPSRRITIKEIKNHPWF  265

Query  744  LKNLPRELTEVAQAAYYRRENPTFSLQSAEEIMKIVDEAKAPPPASRSMGGFGW  583
            LKNLPRELT+ AQA+YYRR+NP FSLQS EEIMKIV+EA++PPP+S  + GFGW
Sbjct  266  LKNLPRELTDTAQASYYRRDNPAFSLQSVEEIMKIVEEARSPPPSSVPVKGFGW  319



>ref|XP_010096415.1| Serine/threonine-protein kinase SRK2A [Morus notabilis]
 gb|EXB64086.1| Serine/threonine-protein kinase SRK2A [Morus notabilis]
Length=346

 Score =   205 bits (521),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 92/114 (81%), Positives = 106/114 (93%), Gaps = 0/114 (0%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED DDPKNFRKTIQRIM+VQYKIPDYVHISQDCRHLLSR+F+A+P+RRI+IKEIK+HPWF
Sbjct  192  EDQDDPKNFRKTIQRIMAVQYKIPDYVHISQDCRHLLSRLFLASPSRRISIKEIKNHPWF  251

Query  744  LKNLPRELTEVAQAAYYRRENPTFSLQSAEEIMKIVDEAKAPPPASRSMGGFGW  583
            LKNLPRELT+ AQA YY+RENP+FSLQS +EIMKIV EA+ PPP S+S+ GFGW
Sbjct  252  LKNLPRELTDSAQAIYYQRENPSFSLQSVDEIMKIVGEARTPPPVSKSVRGFGW  305



>ref|XP_007049927.1| Kinase superfamily protein isoform 2 [Theobroma cacao]
 gb|EOX94084.1| Kinase superfamily protein isoform 2 [Theobroma cacao]
Length=352

 Score =   205 bits (522),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 92/114 (81%), Positives = 107/114 (94%), Gaps = 0/114 (0%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED +DP+NFRKTIQRIM+VQYKIPDYVH+SQDCR+LLSRIFVANP+RRITIKEIK+HPWF
Sbjct  201  EDQEDPRNFRKTIQRIMAVQYKIPDYVHVSQDCRNLLSRIFVANPSRRITIKEIKNHPWF  260

Query  744  LKNLPRELTEVAQAAYYRRENPTFSLQSAEEIMKIVDEAKAPPPASRSMGGFGW  583
            LKNLPRELT+ AQA+YYRR+NP FSLQS EEIMKIV+EA++PPP+S  + GFGW
Sbjct  261  LKNLPRELTDTAQASYYRRDNPAFSLQSVEEIMKIVEEARSPPPSSVPVKGFGW  314



>ref|XP_007049928.1| Kinase superfamily protein isoform 3 [Theobroma cacao]
 gb|EOX94085.1| Kinase superfamily protein isoform 3 [Theobroma cacao]
Length=352

 Score =   205 bits (522),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 92/114 (81%), Positives = 107/114 (94%), Gaps = 0/114 (0%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED +DP+NFRKTIQRIM+VQYKIPDYVH+SQDCR+LLSRIFVANP+RRITIKEIK+HPWF
Sbjct  201  EDQEDPRNFRKTIQRIMAVQYKIPDYVHVSQDCRNLLSRIFVANPSRRITIKEIKNHPWF  260

Query  744  LKNLPRELTEVAQAAYYRRENPTFSLQSAEEIMKIVDEAKAPPPASRSMGGFGW  583
            LKNLPRELT+ AQA+YYRR+NP FSLQS EEIMKIV+EA++PPP+S  + GFGW
Sbjct  261  LKNLPRELTDTAQASYYRRDNPAFSLQSVEEIMKIVEEARSPPPSSVPVKGFGW  314



>ref|XP_004144354.1| PREDICTED: serine/threonine-protein kinase SRK2A-like [Cucumis 
sativus]
Length=355

 Score =   205 bits (522),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 92/114 (81%), Positives = 105/114 (92%), Gaps = 0/114 (0%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED +DPKNFRKTIQRIM+VQYKIPDYVHISQDCRHLLSRIFV NP+RRIT+ EIK+HPWF
Sbjct  201  EDQEDPKNFRKTIQRIMAVQYKIPDYVHISQDCRHLLSRIFVPNPSRRITLMEIKNHPWF  260

Query  744  LKNLPRELTEVAQAAYYRRENPTFSLQSAEEIMKIVDEAKAPPPASRSMGGFGW  583
            LKNLPRELTE AQAAYY+R+NP+FSLQ  +EIMKIV EA+ PPP+SR++ GFGW
Sbjct  261  LKNLPRELTESAQAAYYKRDNPSFSLQGVDEIMKIVGEARNPPPSSRTVKGFGW  314



>gb|KHN17430.1| Serine/threonine-protein kinase SAPK7 [Glycine soja]
Length=351

 Score =   204 bits (520),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 93/114 (82%), Positives = 103/114 (90%), Gaps = 0/114 (0%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED DDP+NFRKTIQRIM+VQYKIPDYVHISQDCRHLLSRIFVANP RRI++KEIK+HPWF
Sbjct  201  EDQDDPRNFRKTIQRIMAVQYKIPDYVHISQDCRHLLSRIFVANPLRRISLKEIKNHPWF  260

Query  744  LKNLPRELTEVAQAAYYRRENPTFSLQSAEEIMKIVDEAKAPPPASRSMGGFGW  583
            LKNLPRELTE AQA YY+R NP+FS+QS EEIMKIV EA+ PPP SR + GFGW
Sbjct  261  LKNLPRELTESAQAVYYQRGNPSFSVQSVEEIMKIVGEARDPPPVSRLVKGFGW  314



>ref|XP_009355252.1| PREDICTED: serine/threonine-protein kinase SRK2A-like [Pyrus 
x bretschneideri]
Length=352

 Score =   204 bits (520),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 91/114 (80%), Positives = 103/114 (90%), Gaps = 0/114 (0%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED +DPKNFRKTI++IM V YKIPD+VH+SQDCRHLLSRIFVANP RRITIK+IK+HPWF
Sbjct  201  EDQEDPKNFRKTIKKIMGVHYKIPDHVHVSQDCRHLLSRIFVANPVRRITIKDIKNHPWF  260

Query  744  LKNLPRELTEVAQAAYYRRENPTFSLQSAEEIMKIVDEAKAPPPASRSMGGFGW  583
            LKNLPRELTE AQ  YYR+ENPTFSLQ+ E+IMKIV+EAK PPP SRS+GGF W
Sbjct  261  LKNLPRELTEAAQTIYYRKENPTFSLQTIEDIMKIVEEAKIPPPVSRSIGGFSW  314



>ref|XP_007159914.1| hypothetical protein PHAVU_002G278200g [Phaseolus vulgaris]
 gb|ESW31908.1| hypothetical protein PHAVU_002G278200g [Phaseolus vulgaris]
Length=356

 Score =   204 bits (519),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 93/114 (82%), Positives = 103/114 (90%), Gaps = 0/114 (0%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED DDP+NFRKTIQRIM+VQYKIPDYVHISQDCRHLLSRIFVANP RRI++KEIK+HPWF
Sbjct  201  EDQDDPRNFRKTIQRIMAVQYKIPDYVHISQDCRHLLSRIFVANPLRRISLKEIKNHPWF  260

Query  744  LKNLPRELTEVAQAAYYRRENPTFSLQSAEEIMKIVDEAKAPPPASRSMGGFGW  583
            LKNLPRELTE AQA YY+R NP+FS+QS EEIMKIV EA+ PPP SR + GFGW
Sbjct  261  LKNLPRELTESAQAVYYQRGNPSFSVQSVEEIMKIVGEARDPPPVSRPVKGFGW  314



>gb|AFK41211.1| unknown [Lotus japonicus]
Length=163

 Score =   198 bits (503),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 93/115 (81%), Positives = 103/115 (90%), Gaps = 1/115 (1%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            EDHDDP+NFRKTIQRIM+VQYKIPDYVHISQDCRHLLSRIFVANP RRI++KEIK+HPWF
Sbjct  9    EDHDDPRNFRKTIQRIMAVQYKIPDYVHISQDCRHLLSRIFVANPLRRISLKEIKNHPWF  68

Query  744  LKNLPRELTEVAQAAYYRR-ENPTFSLQSAEEIMKIVDEAKAPPPASRSMGGFGW  583
            LKNLPRELTE AQA YY+R  N +FS+QS EEIMKIV EA+ PPP SR + GFGW
Sbjct  69   LKNLPRELTESAQAVYYQRGGNLSFSVQSVEEIMKIVGEAREPPPVSRPVKGFGW  123



>gb|AFK47198.1| unknown [Medicago truncatula]
Length=355

 Score =   204 bits (519),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 92/114 (81%), Positives = 104/114 (91%), Gaps = 0/114 (0%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED DDP+NFRKTIQRIM+VQYKIPDYVHISQDC+HLLSRIFVANP RRI++KEIK+HPWF
Sbjct  202  EDQDDPRNFRKTIQRIMAVQYKIPDYVHISQDCKHLLSRIFVANPLRRISLKEIKNHPWF  261

Query  744  LKNLPRELTEVAQAAYYRRENPTFSLQSAEEIMKIVDEAKAPPPASRSMGGFGW  583
            LKNLPRELTE AQAAYY+R NP+FS+QS +EIMKIV EA+ PPP SR + GFGW
Sbjct  262  LKNLPRELTESAQAAYYQRGNPSFSIQSVDEIMKIVGEAREPPPVSRPVKGFGW  315



>gb|AET04893.2| sucrose non-fermenting-like kinase 2 family protein [Medicago 
truncatula]
Length=355

 Score =   204 bits (518),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 92/114 (81%), Positives = 104/114 (91%), Gaps = 0/114 (0%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED DDP+NFRKTIQRIM+VQYKIPDYVHISQDC+HLLSRIFVANP RRI++KEIK+HPWF
Sbjct  202  EDQDDPRNFRKTIQRIMAVQYKIPDYVHISQDCKHLLSRIFVANPLRRISLKEIKNHPWF  261

Query  744  LKNLPRELTEVAQAAYYRRENPTFSLQSAEEIMKIVDEAKAPPPASRSMGGFGW  583
            LKNLPRELTE AQAAYY+R NP+FS+QS +EIMKIV EA+ PPP SR + GFGW
Sbjct  262  LKNLPRELTESAQAAYYQRGNPSFSIQSVDEIMKIVGEAREPPPVSRPVKGFGW  315



>ref|XP_003630417.1| Serine/threonine protein kinase [Medicago truncatula]
Length=354

 Score =   204 bits (518),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 92/114 (81%), Positives = 104/114 (91%), Gaps = 0/114 (0%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED DDP+NFRKTIQRIM+VQYKIPDYVHISQDC+HLLSRIFVANP RRI++KEIK+HPWF
Sbjct  201  EDQDDPRNFRKTIQRIMAVQYKIPDYVHISQDCKHLLSRIFVANPLRRISLKEIKNHPWF  260

Query  744  LKNLPRELTEVAQAAYYRRENPTFSLQSAEEIMKIVDEAKAPPPASRSMGGFGW  583
            LKNLPRELTE AQAAYY+R NP+FS+QS +EIMKIV EA+ PPP SR + GFGW
Sbjct  261  LKNLPRELTESAQAAYYQRGNPSFSIQSVDEIMKIVGEAREPPPVSRPVKGFGW  314



>gb|KHG01745.1| Serine/threonine-protein kinase SAPK7 [Gossypium arboreum]
Length=277

 Score =   201 bits (512),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 92/114 (81%), Positives = 105/114 (92%), Gaps = 0/114 (0%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED  DP+NFRKTIQRIM+VQYKIPDYVHISQDC++LLSRIFVANP+RRIT+KEIK+HPWF
Sbjct  124  EDQADPRNFRKTIQRIMAVQYKIPDYVHISQDCKNLLSRIFVANPSRRITLKEIKNHPWF  183

Query  744  LKNLPRELTEVAQAAYYRRENPTFSLQSAEEIMKIVDEAKAPPPASRSMGGFGW  583
            LKNLPRELT+ AQAAYYR +NPTFSLQS +EIMKIV+EA+ PPPAS  + GFGW
Sbjct  184  LKNLPRELTDTAQAAYYRSDNPTFSLQSIDEIMKIVEEARIPPPASVPVKGFGW  237



>ref|NP_001238298.1| protein kinase [Glycine max]
 gb|AAB68962.1| protein kinase [Glycine max]
Length=349

 Score =   203 bits (517),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 92/114 (81%), Positives = 103/114 (90%), Gaps = 0/114 (0%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED DDP+NFRKTIQRIM+VQYKIPDYVHISQDCRHLLSRIFVANP RRITIKEIK+HPWF
Sbjct  201  EDQDDPRNFRKTIQRIMAVQYKIPDYVHISQDCRHLLSRIFVANPLRRITIKEIKNHPWF  260

Query  744  LKNLPRELTEVAQAAYYRRENPTFSLQSAEEIMKIVDEAKAPPPASRSMGGFGW  583
            L+NLPRELTE AQA YY+R++P F LQS +EIMKIV EA+ PPP SR++ GFGW
Sbjct  261  LRNLPRELTESAQAIYYQRDSPNFHLQSVDEIMKIVGEARNPPPVSRALKGFGW  314



>ref|XP_003526896.1| PREDICTED: serine/threonine-protein kinase SRK2A-like [Glycine 
max]
Length=346

 Score =   203 bits (516),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 92/114 (81%), Positives = 103/114 (90%), Gaps = 0/114 (0%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED DDP+NFRKTIQRIM+VQYKIPDYVHISQDCRHLLSRIFVANP RRITIKEIK+HPWF
Sbjct  201  EDQDDPRNFRKTIQRIMAVQYKIPDYVHISQDCRHLLSRIFVANPLRRITIKEIKNHPWF  260

Query  744  LKNLPRELTEVAQAAYYRRENPTFSLQSAEEIMKIVDEAKAPPPASRSMGGFGW  583
            L+NLPRELTE AQA YY+R++P F LQS +EIMKIV EA+ PPP SR++ GFGW
Sbjct  261  LRNLPRELTESAQAIYYQRDSPNFHLQSVDEIMKIVGEARNPPPVSRAVKGFGW  314



>gb|KHN09673.1| Serine/threonine-protein kinase SRK2A [Glycine soja]
Length=350

 Score =   203 bits (516),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 92/114 (81%), Positives = 103/114 (90%), Gaps = 0/114 (0%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED DDP+NFRKTIQRIM+VQYKIPDYVHISQDCRHLLSRIFVANP RRITIKEIK+HPWF
Sbjct  201  EDQDDPRNFRKTIQRIMAVQYKIPDYVHISQDCRHLLSRIFVANPLRRITIKEIKNHPWF  260

Query  744  LKNLPRELTEVAQAAYYRRENPTFSLQSAEEIMKIVDEAKAPPPASRSMGGFGW  583
            L+NLPRELTE AQA YY+R++P F LQS +EIMKIV EA+ PPP SR++ GFGW
Sbjct  261  LRNLPRELTESAQAIYYQRDSPNFHLQSVDEIMKIVGEARNPPPVSRAVKGFGW  314



>gb|AFK36100.1| unknown [Medicago truncatula]
Length=313

 Score =   202 bits (513),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 92/113 (81%), Positives = 102/113 (90%), Gaps = 0/113 (0%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED DDPKNFRKTIQRIM++QYKIPDYVHISQDCRHL+SRIFVANP RRITIKEIKSHPWF
Sbjct  201  EDQDDPKNFRKTIQRIMAIQYKIPDYVHISQDCRHLISRIFVANPLRRITIKEIKSHPWF  260

Query  744  LKNLPRELTEVAQAAYYRRENPTFSLQSAEEIMKIVDEAKAPPPASRSMGGFG  586
            LKNLPRELTE AQA YY+RENP+F LQS +++MKIV EA+ PPP SR + GFG
Sbjct  261  LKNLPRELTESAQAMYYQRENPSFHLQSVDDVMKIVGEARNPPPVSRPVKGFG  313



>emb|CDY03768.1| BnaC01g28850D [Brassica napus]
Length=589

 Score =   208 bits (530),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 94/114 (82%), Positives = 105/114 (92%), Gaps = 0/114 (0%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED +DPKNFRKT+QRI++VQYKIPDYVHISQDC+H+LS IFVANP +RITI EIK HPWF
Sbjct  201  EDPEDPKNFRKTMQRILAVQYKIPDYVHISQDCKHILSHIFVANPLKRITIAEIKKHPWF  260

Query  744  LKNLPRELTEVAQAAYYRRENPTFSLQSAEEIMKIVDEAKAPPPASRSMGGFGW  583
            LKNLPRELTE+AQAAYYR+ENPTFSLQS EEIMKIV+EAK PPP SRS+G FGW
Sbjct  261  LKNLPRELTEIAQAAYYRKENPTFSLQSVEEIMKIVEEAKTPPPVSRSIGAFGW  314



>ref|XP_004503013.1| PREDICTED: serine/threonine-protein kinase SRK2A-like [Cicer 
arietinum]
Length=357

 Score =   202 bits (515),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 91/114 (80%), Positives = 102/114 (89%), Gaps = 0/114 (0%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED DDPKNFRKTIQRIM++QYKIPDYVHISQDCRHL+SRIFVANP RR TIKEIK+HPWF
Sbjct  201  EDQDDPKNFRKTIQRIMAIQYKIPDYVHISQDCRHLISRIFVANPLRRTTIKEIKNHPWF  260

Query  744  LKNLPRELTEVAQAAYYRRENPTFSLQSAEEIMKIVDEAKAPPPASRSMGGFGW  583
            LKNLPRELTE AQA YY+RENP+F LQS +++MKIV EA+ PPP SR + GFGW
Sbjct  261  LKNLPRELTEAAQAMYYQRENPSFHLQSVDDVMKIVGEARNPPPVSRPVRGFGW  314



>gb|KJB71410.1| hypothetical protein B456_011G121900 [Gossypium raimondii]
 gb|KJB71411.1| hypothetical protein B456_011G121900 [Gossypium raimondii]
Length=353

 Score =   201 bits (512),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 92/114 (81%), Positives = 105/114 (92%), Gaps = 0/114 (0%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED  DP+NFRKTIQRIM+VQYKIPDYVHISQDC++LLSRIFVANP+RRIT+KEIK+HPWF
Sbjct  201  EDQADPRNFRKTIQRIMAVQYKIPDYVHISQDCKNLLSRIFVANPSRRITLKEIKNHPWF  260

Query  744  LKNLPRELTEVAQAAYYRRENPTFSLQSAEEIMKIVDEAKAPPPASRSMGGFGW  583
            LKNLPRELT+ AQAAYYR +NPTFSLQS +EIMKIV+EA+ PPPAS  + GFGW
Sbjct  261  LKNLPRELTDTAQAAYYRSDNPTFSLQSIDEIMKIVEEARIPPPASVPVKGFGW  314



>gb|AID23890.1| sucrose non-fermenting 1-related protein kinase 2 [Gossypium 
hirsutum]
Length=354

 Score =   201 bits (512),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 92/114 (81%), Positives = 105/114 (92%), Gaps = 0/114 (0%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED  DP+NFRKTIQRIM+VQYKIPDYVHISQDC++LLSRIFVANP+RRIT+KEIK+HPWF
Sbjct  201  EDQADPRNFRKTIQRIMAVQYKIPDYVHISQDCKNLLSRIFVANPSRRITLKEIKNHPWF  260

Query  744  LKNLPRELTEVAQAAYYRRENPTFSLQSAEEIMKIVDEAKAPPPASRSMGGFGW  583
            LKNLPRELT+ AQAAYYR +NPTFSLQS +EIMKIV+EA+ PPPAS  + GFGW
Sbjct  261  LKNLPRELTDTAQAAYYRSDNPTFSLQSIDEIMKIVEEARIPPPASVPVKGFGW  314



>gb|AFP49839.1| SNF1-related kinase, partial [Cucumis sativus]
Length=218

 Score =   197 bits (501),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 89/114 (78%), Positives = 103/114 (90%), Gaps = 0/114 (0%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED DDP+NFRKTIQRIM+VQYKIPDYVHISQDCR LLSRIFV+NP+RRI++KEIKSHPWF
Sbjct  64   EDQDDPRNFRKTIQRIMAVQYKIPDYVHISQDCRDLLSRIFVSNPSRRISLKEIKSHPWF  123

Query  744  LKNLPRELTEVAQAAYYRRENPTFSLQSAEEIMKIVDEAKAPPPASRSMGGFGW  583
            LKNLPRELTE AQ  YY+R+NP+FS+QS EEIMKIV EA+ PPP+S ++ GF W
Sbjct  124  LKNLPRELTESAQTIYYQRDNPSFSVQSVEEIMKIVGEARNPPPSSTTVKGFKW  177



>gb|AIO02852.1| phloem small RNA-binding protein kinase 1 [Cucurbita maxima]
Length=359

 Score =   201 bits (512),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 90/114 (79%), Positives = 105/114 (92%), Gaps = 0/114 (0%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED +DPKNFRKTIQRIM+VQYKIPDYVHISQDCRHLLSRIFV NP+RRI++ EIK+HPWF
Sbjct  201  EDQEDPKNFRKTIQRIMAVQYKIPDYVHISQDCRHLLSRIFVPNPSRRISLMEIKNHPWF  260

Query  744  LKNLPRELTEVAQAAYYRRENPTFSLQSAEEIMKIVDEAKAPPPASRSMGGFGW  583
            LKNLPRELTE AQAAYY+R+NP+FSLQ+ +EIMKIV EA+ PPP+S+ + GFGW
Sbjct  261  LKNLPRELTESAQAAYYKRDNPSFSLQTVDEIMKIVGEARNPPPSSKPVKGFGW  314



>gb|KHN31217.1| Serine/threonine-protein kinase SRK2A [Glycine soja]
Length=349

 Score =   201 bits (512),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 92/114 (81%), Positives = 102/114 (89%), Gaps = 0/114 (0%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED DDP+NFRKTIQRIM+VQYKIPDYVHISQDCRHLLSRIFVANP RRITIKEIK+HPWF
Sbjct  201  EDQDDPRNFRKTIQRIMAVQYKIPDYVHISQDCRHLLSRIFVANPLRRITIKEIKNHPWF  260

Query  744  LKNLPRELTEVAQAAYYRRENPTFSLQSAEEIMKIVDEAKAPPPASRSMGGFGW  583
            L+NLPRELTE AQA YY+R++P F LQS +EIMKIV EA+ PPP SR + GFGW
Sbjct  261  LRNLPRELTESAQAIYYQRDSPNFHLQSVDEIMKIVGEARNPPPVSRPVKGFGW  314



>ref|XP_002886574.1| hypothetical protein ARALYDRAFT_475237 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH62833.1| hypothetical protein ARALYDRAFT_475237 [Arabidopsis lyrata subsp. 
lyrata]
Length=352

 Score =   201 bits (512),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 91/114 (80%), Positives = 101/114 (89%), Gaps = 0/114 (0%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED +DPKNF+KTIQRIM+V+YKIPDYVHISQDC+HLLSRIFVAN  +RI I EIK HPWF
Sbjct  201  EDQEDPKNFKKTIQRIMAVKYKIPDYVHISQDCKHLLSRIFVANSNKRIKIAEIKKHPWF  260

Query  744  LKNLPRELTEVAQAAYYRRENPTFSLQSAEEIMKIVDEAKAPPPASRSMGGFGW  583
            LKNLPRELTE AQAAY+ +ENPTFSLQS EEIMKIV+EAK P P SRS+G FGW
Sbjct  261  LKNLPRELTETAQAAYFSKENPTFSLQSVEEIMKIVEEAKTPAPVSRSIGAFGW  314



>dbj|BAN15745.1| subfamily 2 of SNF1-related protein kinase [Dianthus caryophyllus]
Length=361

 Score =   201 bits (512),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 88/114 (77%), Positives = 104/114 (91%), Gaps = 0/114 (0%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED +DPKNFRKTI RI++VQYKIPDYVH+SQ+C+ LL+RIFVANP+RRI+I+EIK+HPWF
Sbjct  201  EDQEDPKNFRKTINRILAVQYKIPDYVHVSQECKQLLARIFVANPSRRISIREIKNHPWF  260

Query  744  LKNLPRELTEVAQAAYYRRENPTFSLQSAEEIMKIVDEAKAPPPASRSMGGFGW  583
            LKNLPRELTE  QA YYRRENPTFS+Q+ EEIMKIV++AK PPP SRS+G FGW
Sbjct  261  LKNLPRELTEAHQATYYRRENPTFSIQTVEEIMKIVEQAKNPPPVSRSLGSFGW  314



>ref|XP_008442077.1| PREDICTED: serine/threonine-protein kinase SRK2H-like [Cucumis 
melo]
 ref|XP_008442078.1| PREDICTED: serine/threonine-protein kinase SRK2H-like [Cucumis 
melo]
 ref|XP_008442079.1| PREDICTED: serine/threonine-protein kinase SRK2H-like [Cucumis 
melo]
Length=357

 Score =   201 bits (511),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 91/114 (80%), Positives = 104/114 (91%), Gaps = 0/114 (0%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED DDP+NFRKTIQRIM+VQYKIPDYVHISQDCR LLSRIFV+NP+RRI++KEIKSHPWF
Sbjct  201  EDQDDPRNFRKTIQRIMAVQYKIPDYVHISQDCRDLLSRIFVSNPSRRISLKEIKSHPWF  260

Query  744  LKNLPRELTEVAQAAYYRRENPTFSLQSAEEIMKIVDEAKAPPPASRSMGGFGW  583
            LKNLPRELTE AQA YY+R+NP+FSLQS EEIMKIV EA+ PPP+S ++ GF W
Sbjct  261  LKNLPRELTEAAQAIYYQRDNPSFSLQSVEEIMKIVGEARNPPPSSTTVKGFKW  314



>ref|XP_004503865.1| PREDICTED: serine/threonine-protein kinase SRK2A-like [Cicer 
arietinum]
Length=354

 Score =   201 bits (511),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 91/114 (80%), Positives = 103/114 (90%), Gaps = 0/114 (0%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED DDP+NFRKTIQRIM+VQYKIPDYVHISQDC+HLLSRIFVANP RRI++KEIK+HPWF
Sbjct  201  EDQDDPRNFRKTIQRIMAVQYKIPDYVHISQDCKHLLSRIFVANPLRRISLKEIKNHPWF  260

Query  744  LKNLPRELTEVAQAAYYRRENPTFSLQSAEEIMKIVDEAKAPPPASRSMGGFGW  583
            LKNLPREL E AQAAYY+R NP+FS+QS +EIMKIV EA+ PPP SR + GFGW
Sbjct  261  LKNLPRELIESAQAAYYQRGNPSFSIQSVDEIMKIVGEAREPPPISRPVKGFGW  314



>ref|NP_001242600.1| uncharacterized protein LOC100804018 [Glycine max]
 gb|ACU19874.1| unknown [Glycine max]
Length=351

 Score =   201 bits (510),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 91/114 (80%), Positives = 103/114 (90%), Gaps = 0/114 (0%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED DDP+NFRKTIQRIM+VQYKIPDYVHISQDCRHLLSRIFVANP RRI++KEIK+HPWF
Sbjct  201  EDQDDPRNFRKTIQRIMAVQYKIPDYVHISQDCRHLLSRIFVANPLRRISLKEIKNHPWF  260

Query  744  LKNLPRELTEVAQAAYYRRENPTFSLQSAEEIMKIVDEAKAPPPASRSMGGFGW  583
            LKNLPRELTE AQA YY+R +P+FS++S EEIMKIV EA+ PPP SR + GFGW
Sbjct  261  LKNLPRELTESAQAVYYQRGSPSFSVRSVEEIMKIVGEARDPPPVSRLVKGFGW  314



>ref|NP_176290.1| SNF1-related protein kinase 2.10 [Arabidopsis thaliana]
 ref|NP_849834.1| SNF1-related protein kinase 2.10 [Arabidopsis thaliana]
 sp|Q9C958.1|SRK2B_ARATH RecName: Full=Serine/threonine-protein kinase SRK2B; AltName: 
Full=OST1-kinase-like 6; AltName: Full=SNF1-related kinase 
2.10; Short=SnRK2.10 [Arabidopsis thaliana]
 gb|AAG51649.1|AC018908_15 putative serine/threonine-protein kinase; 36981-34483 [Arabidopsis 
thaliana]
 gb|AAL61947.1| putative serine/threonine-protein kinase [Arabidopsis thaliana]
 gb|AAO00906.1| putative serine/threonine-protein kinase [Arabidopsis thaliana]
 gb|AEE33750.1| SNF1-related protein kinase 2.10 [Arabidopsis thaliana]
 gb|AEE33751.1| SNF1-related protein kinase 2.10 [Arabidopsis thaliana]
Length=361

 Score =   201 bits (510),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 90/114 (79%), Positives = 102/114 (89%), Gaps = 0/114 (0%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED +DPKNF+KTIQRIM+V+YKIPDYVHISQDC+HLLSRIFV N  +RITI +IK HPWF
Sbjct  201  EDQEDPKNFKKTIQRIMAVKYKIPDYVHISQDCKHLLSRIFVTNSNKRITIGDIKKHPWF  260

Query  744  LKNLPRELTEVAQAAYYRRENPTFSLQSAEEIMKIVDEAKAPPPASRSMGGFGW  583
            LKNLPRELTE+AQAAY+R+ENPTFSLQS EEIMKIV+EAK P   SRS+G FGW
Sbjct  261  LKNLPRELTEIAQAAYFRKENPTFSLQSVEEIMKIVEEAKTPARVSRSIGAFGW  314



>gb|AAM67112.1| putative serine/threonine-protein kinase [Arabidopsis thaliana]
Length=361

 Score =   201 bits (510),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 90/114 (79%), Positives = 102/114 (89%), Gaps = 0/114 (0%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED +DPKNF+KTIQRIM+V+YKIPDYVHISQDC+HLLSRIFV N  +RITI +IK HPWF
Sbjct  201  EDQEDPKNFKKTIQRIMAVKYKIPDYVHISQDCKHLLSRIFVTNSNKRITIADIKKHPWF  260

Query  744  LKNLPRELTEVAQAAYYRRENPTFSLQSAEEIMKIVDEAKAPPPASRSMGGFGW  583
            LKNLPRELTE+AQAAY+R+ENPTFSLQS EEIMKIV+EAK P   SRS+G FGW
Sbjct  261  LKNLPRELTEIAQAAYFRKENPTFSLQSVEEIMKIVEEAKTPARVSRSIGAFGW  314



>ref|XP_008347910.1| PREDICTED: serine/threonine-protein kinase SRK2A-like [Malus 
domestica]
 gb|AGC31662.1| SnRK2.4 [Malus domestica]
 gb|AIK22399.1| sucrose non-fermenting-1-related protein kinase 2.5 [Malus prunifolia]
Length=352

 Score =   199 bits (505),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 89/114 (78%), Positives = 103/114 (90%), Gaps = 0/114 (0%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED +DPKNFRKT+++IM V YKIPD+VH+SQ+CRHLLSRIFVANPARRITIK+IK+HPWF
Sbjct  201  EDQEDPKNFRKTMKKIMGVHYKIPDHVHMSQECRHLLSRIFVANPARRITIKDIKNHPWF  260

Query  744  LKNLPRELTEVAQAAYYRRENPTFSLQSAEEIMKIVDEAKAPPPASRSMGGFGW  583
            LKNLPRELTE AQ  YYR+ENPTFS Q+ E+IMKIV+EAK PPP SRS+GGF W
Sbjct  261  LKNLPRELTEAAQIIYYRKENPTFSPQTVEDIMKIVEEAKIPPPVSRSIGGFSW  314



>ref|XP_002513284.1| Serine/threonine-protein kinase SAPK7, putative [Ricinus communis]
 gb|EEF49152.1| Serine/threonine-protein kinase SAPK7, putative [Ricinus communis]
Length=161

 Score =   192 bits (489),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 87/114 (76%), Positives = 100/114 (88%), Gaps = 0/114 (0%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED DDPKNFRKTIQRIM+VQYKIPDYVH+SQDCRHLLSRIFVANP+RRIT+KEIKSHPWF
Sbjct  9    EDQDDPKNFRKTIQRIMAVQYKIPDYVHVSQDCRHLLSRIFVANPSRRITLKEIKSHPWF  68

Query  744  LKNLPRELTEVAQAAYYRRENPTFSLQSAEEIMKIVDEAKAPPPASRSMGGFGW  583
            LKNLP+EL E  QA YY+ +NP+FS QS EEIMKIV EA+  P ++ ++ GFGW
Sbjct  69   LKNLPKELKETGQANYYQIDNPSFSAQSVEEIMKIVSEARNRPSSTVTVKGFGW  122



>ref|XP_010930862.1| PREDICTED: serine/threonine-protein kinase SAPK7 [Elaeis guineensis]
Length=356

 Score =   199 bits (505),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 93/116 (80%), Positives = 104/116 (90%), Gaps = 2/116 (2%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED DDPKNFRKTIQRIMSVQYKIP+YVHISQDCR LLSRIFVAN ARRITI+EI++HPWF
Sbjct  201  EDPDDPKNFRKTIQRIMSVQYKIPEYVHISQDCRQLLSRIFVANSARRITIREIRNHPWF  260

Query  744  LKNLPRELTEVAQAAYYRREN--PTFSLQSAEEIMKIVDEAKAPPPASRSMGGFGW  583
            LKNLPRELTE AQA YYRR+N  PT+SLQS EEIM+IV EA+ PPP+S ++ GFGW
Sbjct  261  LKNLPRELTEAAQAVYYRRDNNAPTYSLQSVEEIMRIVREARTPPPSSTNIAGFGW  316



>emb|CAA06503.1| protein kinase [Craterostigma plantagineum]
Length=355

 Score =   199 bits (505),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 95/114 (83%), Positives = 102/114 (89%), Gaps = 0/114 (0%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED +DP  FRKTI  IM+VQYKIPDYV ISQ CRHLLSRIFVANP RRITIKEIKSH WF
Sbjct  201  EDQEDPFFFRKTILWIMAVQYKIPDYVRISQSCRHLLSRIFVANPLRRITIKEIKSHLWF  260

Query  744  LKNLPRELTEVAQAAYYRRENPTFSLQSAEEIMKIVDEAKAPPPASRSMGGFGW  583
            LKNLPRELTEVAQAAY+RR+NPT+SLQS EEIMKIV+EAK PP ASRS+GGFGW
Sbjct  261  LKNLPRELTEVAQAAYFRRDNPTYSLQSEEEIMKIVEEAKVPPQASRSIGGFGW  314



>ref|XP_007137814.1| hypothetical protein PHAVU_009G157800g [Phaseolus vulgaris]
 gb|ESW09808.1| hypothetical protein PHAVU_009G157800g [Phaseolus vulgaris]
Length=351

 Score =   198 bits (504),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 91/114 (80%), Positives = 100/114 (88%), Gaps = 0/114 (0%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED +DP+NFRK IQRIM+VQYKIPDYVHISQDC+ LLSRIFVANP RRITIKEIKSHPWF
Sbjct  201  EDQNDPRNFRKAIQRIMAVQYKIPDYVHISQDCKQLLSRIFVANPLRRITIKEIKSHPWF  260

Query  744  LKNLPRELTEVAQAAYYRRENPTFSLQSAEEIMKIVDEAKAPPPASRSMGGFGW  583
            LKNLPRELTE AQA YY+R+NP F LQS +EIMKIV EA+ PPP SR + GFGW
Sbjct  261  LKNLPRELTESAQAMYYQRDNPNFHLQSVDEIMKIVGEARNPPPVSRPVKGFGW  314



>ref|XP_010025673.1| PREDICTED: serine/threonine-protein kinase SRK2A-like [Eucalyptus 
grandis]
Length=360

 Score =   198 bits (504),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 90/114 (79%), Positives = 102/114 (89%), Gaps = 0/114 (0%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED  DPKNFRKTIQRIM+VQYKIPDYVH+SQDC+HLLSRIFVANP RRITIKEIK+HPWF
Sbjct  201  EDQQDPKNFRKTIQRIMAVQYKIPDYVHVSQDCKHLLSRIFVANPTRRITIKEIKNHPWF  260

Query  744  LKNLPRELTEVAQAAYYRRENPTFSLQSAEEIMKIVDEAKAPPPASRSMGGFGW  583
            LKNLPRELTE AQAAYY+R+N +FS+QS +EIMKIV EA+ PPP ++   GFGW
Sbjct  261  LKNLPRELTETAQAAYYQRDNQSFSVQSVQEIMKIVGEARNPPPLAKPPKGFGW  314



>ref|XP_009780712.1| PREDICTED: serine/threonine-protein kinase SAPK7-like [Nicotiana 
sylvestris]
Length=362

 Score =   198 bits (503),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 89/114 (78%), Positives = 104/114 (91%), Gaps = 0/114 (0%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED DDPKNFRKTI +IM+ QYKIPDYVH+SQDC+HLLSRIFVA+P RRIT+KEIK+HPWF
Sbjct  201  EDPDDPKNFRKTISKIMAGQYKIPDYVHVSQDCKHLLSRIFVASPIRRITLKEIKNHPWF  260

Query  744  LKNLPRELTEVAQAAYYRRENPTFSLQSAEEIMKIVDEAKAPPPASRSMGGFGW  583
            LK+LP+ELTE AQA YY+R+NPTFSLQ+ EEIMKIV EA+ PPP+SRS+ GFGW
Sbjct  261  LKSLPKELTEPAQAVYYKRDNPTFSLQTIEEIMKIVSEARNPPPSSRSVTGFGW  314



>ref|XP_004146378.1| PREDICTED: serine/threonine-protein kinase SRK2H [Cucumis sativus]
 ref|XP_011653912.1| PREDICTED: serine/threonine-protein kinase SRK2H [Cucumis sativus]
 ref|XP_011653913.1| PREDICTED: serine/threonine-protein kinase SRK2H [Cucumis sativus]
Length=355

 Score =   197 bits (502),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 89/114 (78%), Positives = 103/114 (90%), Gaps = 0/114 (0%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED DDP+NFRKTIQRIM+VQYKIPDYVHISQDCR LLSRIFV+NP+RRI++KEIKSHPWF
Sbjct  201  EDQDDPRNFRKTIQRIMAVQYKIPDYVHISQDCRDLLSRIFVSNPSRRISLKEIKSHPWF  260

Query  744  LKNLPRELTEVAQAAYYRRENPTFSLQSAEEIMKIVDEAKAPPPASRSMGGFGW  583
            LKNLPRELTE AQ  YY+R+NP+FS+QS EEIMKIV EA+ PPP+S ++ GF W
Sbjct  261  LKNLPRELTESAQTIYYQRDNPSFSVQSVEEIMKIVGEARNPPPSSTTVKGFKW  314



>gb|KGN54829.1| hypothetical protein Csa_4G515040 [Cucumis sativus]
Length=357

 Score =   197 bits (502),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 89/114 (78%), Positives = 103/114 (90%), Gaps = 0/114 (0%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED DDP+NFRKTIQRIM+VQYKIPDYVHISQDCR LLSRIFV+NP+RRI++KEIKSHPWF
Sbjct  201  EDQDDPRNFRKTIQRIMAVQYKIPDYVHISQDCRDLLSRIFVSNPSRRISLKEIKSHPWF  260

Query  744  LKNLPRELTEVAQAAYYRRENPTFSLQSAEEIMKIVDEAKAPPPASRSMGGFGW  583
            LKNLPRELTE AQ  YY+R+NP+FS+QS EEIMKIV EA+ PPP+S ++ GF W
Sbjct  261  LKNLPRELTESAQTIYYQRDNPSFSVQSVEEIMKIVGEARNPPPSSTTVKGFKW  314



>ref|XP_006417402.1| hypothetical protein EUTSA_v10007985mg [Eutrema salsugineum]
 gb|ESQ35755.1| hypothetical protein EUTSA_v10007985mg [Eutrema salsugineum]
Length=366

 Score =   197 bits (502),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 90/109 (83%), Positives = 100/109 (92%), Gaps = 0/109 (0%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED +DPKNFRKTIQ+IM+VQYKIPDYVHISQDC+HLLSRIFVAN  +RITI EIK HPWF
Sbjct  201  EDQEDPKNFRKTIQKIMAVQYKIPDYVHISQDCKHLLSRIFVANSLKRITIAEIKKHPWF  260

Query  744  LKNLPRELTEVAQAAYYRRENPTFSLQSAEEIMKIVDEAKAPPPASRSM  598
            LKNLPRELTE AQAAY+R+ENPTFSLQ+ EEIMKIVD+AK PPP SRS+
Sbjct  261  LKNLPRELTETAQAAYFRKENPTFSLQTVEEIMKIVDDAKTPPPVSRSI  309



>ref|XP_009602316.1| PREDICTED: serine/threonine-protein kinase SAPK7-like [Nicotiana 
tomentosiformis]
Length=362

 Score =   197 bits (501),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 90/114 (79%), Positives = 104/114 (91%), Gaps = 0/114 (0%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED DDPKNFRKTI +IM+ QYKIPDYVHISQDC+HLLSRIFVA+P RRIT+KEIK+HPWF
Sbjct  201  EDPDDPKNFRKTISKIMAGQYKIPDYVHISQDCKHLLSRIFVASPIRRITLKEIKNHPWF  260

Query  744  LKNLPRELTEVAQAAYYRRENPTFSLQSAEEIMKIVDEAKAPPPASRSMGGFGW  583
            LK+LP+ELTE AQA YY+R+NPTFSLQ+ EEIMKIV EA+ PPP+SRS+ GFGW
Sbjct  261  LKSLPKELTEPAQAVYYKRDNPTFSLQTIEEIMKIVSEARNPPPSSRSVPGFGW  314



>emb|CAE54589.1| serine/threonine protein kinase [Fagus sylvatica]
Length=245

 Score =   194 bits (492),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 88/114 (77%), Positives = 101/114 (89%), Gaps = 0/114 (0%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED +DPKNFRKTI RIM+VQYKIPDYVHISQ+C+HLLSRIFVANP++RITIKEIK+HPWF
Sbjct  93   EDPEDPKNFRKTINRIMAVQYKIPDYVHISQECKHLLSRIFVANPSKRITIKEIKNHPWF  152

Query  744  LKNLPRELTEVAQAAYYRRENPTFSLQSAEEIMKIVDEAKAPPPASRSMGGFGW  583
            LKNLPRELTE AQ  YY++ENP+FSLQS  EI KIV++AK PP  SRS+GG  W
Sbjct  153  LKNLPRELTEAAQIMYYKKENPSFSLQSDREITKIVEDAKIPPTTSRSIGGLAW  206



>emb|CAE54075.1| serine/threonine-protein kinase [Fagus sylvatica]
Length=359

 Score =   197 bits (500),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 86/114 (75%), Positives = 104/114 (91%), Gaps = 0/114 (0%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED DDP+NFRKTIQ+IM+VQYK+PDYVHISQDC+HL SR+FVANP+RRIT+KEIK+HPWF
Sbjct  201  EDQDDPRNFRKTIQKIMAVQYKVPDYVHISQDCKHLFSRLFVANPSRRITLKEIKNHPWF  260

Query  744  LKNLPRELTEVAQAAYYRRENPTFSLQSAEEIMKIVDEAKAPPPASRSMGGFGW  583
            LKNLPRELTE +QA YY+R+NP+FSLQS +EIMKIV EA+ PPP+S+ + GF W
Sbjct  261  LKNLPRELTESSQAIYYQRDNPSFSLQSVDEIMKIVGEARNPPPSSKIVRGFSW  314



>ref|XP_010533957.1| PREDICTED: serine/threonine-protein kinase SRK2A [Tarenaya hassleriana]
Length=357

 Score =   196 bits (499),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 89/109 (82%), Positives = 98/109 (90%), Gaps = 0/109 (0%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED +DPKNFRKTIQRIM+VQYKIPDYVH++QDC+HLLSRIFVANP +RI I EIK HPWF
Sbjct  201  EDQEDPKNFRKTIQRIMAVQYKIPDYVHVTQDCKHLLSRIFVANPTKRIAIAEIKKHPWF  260

Query  744  LKNLPRELTEVAQAAYYRRENPTFSLQSAEEIMKIVDEAKAPPPASRSM  598
            LKNLPREL E AQAAYY +ENPTFSLQS EEIMKIV+EAK PPP SRS+
Sbjct  261  LKNLPRELAETAQAAYYSKENPTFSLQSVEEIMKIVEEAKVPPPVSRSI  309



>gb|ACU23651.1| unknown [Glycine max]
Length=349

 Score =   195 bits (495),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 89/114 (78%), Positives = 99/114 (87%), Gaps = 0/114 (0%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED DDP+NFRKTIQRIM+VQYKIPDYVHISQDCRHLL RIFVANP RRITIKEIK+HPWF
Sbjct  201  EDQDDPRNFRKTIQRIMAVQYKIPDYVHISQDCRHLLFRIFVANPLRRITIKEIKNHPWF  260

Query  744  LKNLPRELTEVAQAAYYRRENPTFSLQSAEEIMKIVDEAKAPPPASRSMGGFGW  583
            L+N PRELTE AQA YY+R++P F LQS +EIMKIV EA+ PPP  R + GFGW
Sbjct  261  LRNFPRELTESAQAIYYQRDSPNFHLQSVDEIMKIVGEARNPPPVFRPVKGFGW  314



>gb|ABG81507.1| serine/threonine protein kinase [Camellia sinensis]
Length=358

 Score =   195 bits (495),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 91/109 (83%), Positives = 99/109 (91%), Gaps = 0/109 (0%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED +DPKNFRKTI RIM+V YKIPDYVHISQDCRHLLSRIFVAN ARRITIKEIK+HPWF
Sbjct  201  EDQEDPKNFRKTIHRIMAVNYKIPDYVHISQDCRHLLSRIFVANSARRITIKEIKNHPWF  260

Query  744  LKNLPRELTEVAQAAYYRRENPTFSLQSAEEIMKIVDEAKAPPPASRSM  598
            LKNLPRELTE AQA YYRRENP+FS Q+ EEIMKIV+EA+ PPP SRS+
Sbjct  261  LKNLPRELTEAAQAMYYRRENPSFSPQTVEEIMKIVEEARTPPPVSRSI  309



>gb|EPS60016.1| hypothetical protein M569_14789 [Genlisea aurea]
Length=360

 Score =   195 bits (495),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 94/115 (82%), Positives = 103/115 (90%), Gaps = 1/115 (1%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED +DPKNFRKTIQRIM+VQYKIPDYVHISQDCRHL+SRIFVA P+RRITIKEIKSHPWF
Sbjct  201  EDQEDPKNFRKTIQRIMAVQYKIPDYVHISQDCRHLISRIFVATPSRRITIKEIKSHPWF  260

Query  744  LKNLPRELTEVAQAAYYRRENPTFS-LQSAEEIMKIVDEAKAPPPASRSMGGFGW  583
            LKNLPREL E AQAAYYR+E+PT S LQS +EIM IV+EAK  P ASRS+G FGW
Sbjct  261  LKNLPRELREPAQAAYYRKEDPTNSLLQSVKEIMAIVEEAKTLPAASRSIGRFGW  315



>emb|CDP20535.1| unnamed protein product [Coffea canephora]
Length=349

 Score =   194 bits (494),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 89/114 (78%), Positives = 101/114 (89%), Gaps = 0/114 (0%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED DDPKNFRKTI RI++VQYKIPDYVHISQDC+HLLSRIF  NP RRITIKEIKSHPWF
Sbjct  201  EDPDDPKNFRKTISRIVAVQYKIPDYVHISQDCKHLLSRIFTPNPLRRITIKEIKSHPWF  260

Query  744  LKNLPRELTEVAQAAYYRRENPTFSLQSAEEIMKIVDEAKAPPPASRSMGGFGW  583
            LKNLPREL E AQA YY+++NP+FSLQS +EIMKIV EA+ PPP+S+ + GFGW
Sbjct  261  LKNLPRELIESAQATYYQKDNPSFSLQSIDEIMKIVGEARNPPPSSKPVEGFGW  314



>ref|XP_010492159.1| PREDICTED: serine/threonine-protein kinase SRK2A [Camelina sativa]
Length=360

 Score =   194 bits (494),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 89/109 (82%), Positives = 99/109 (91%), Gaps = 0/109 (0%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED +DPKNFRKTIQ+IM+VQYKIPDYVHISQDC+HLLSRIFVAN  +RITI EIK HPWF
Sbjct  201  EDQEDPKNFRKTIQKIMAVQYKIPDYVHISQDCKHLLSRIFVANSLKRITIAEIKKHPWF  260

Query  744  LKNLPRELTEVAQAAYYRRENPTFSLQSAEEIMKIVDEAKAPPPASRSM  598
            LKNLPRELTE AQA Y+R+ENPTFSLQ+AEEIMKIV +AK PPP SRS+
Sbjct  261  LKNLPRELTETAQATYFRKENPTFSLQTAEEIMKIVADAKTPPPVSRSI  309



>gb|AAA33004.1| serine/threonine protein kinase [Brassica napus]
 prf||2113401B protein kinase
Length=354

 Score =   194 bits (493),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 89/109 (82%), Positives = 100/109 (92%), Gaps = 0/109 (0%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED +DPKNFRKTIQ+IM+VQYKIPDYVHISQDC+HLLSRIFVAN  +RITI EIK HPWF
Sbjct  201  EDQEDPKNFRKTIQKIMAVQYKIPDYVHISQDCKHLLSRIFVANSLKRITIAEIKKHPWF  260

Query  744  LKNLPRELTEVAQAAYYRRENPTFSLQSAEEIMKIVDEAKAPPPASRSM  598
            LKNLPRELTE AQAAY+++ENPTFS Q+AEEIMKIVD+AK PPP SRS+
Sbjct  261  LKNLPRELTETAQAAYFKKENPTFSPQTAEEIMKIVDDAKTPPPVSRSI  309



>gb|ADP24128.1| serine/threonine protein kinase [Brassica napus]
Length=354

 Score =   194 bits (493),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 89/109 (82%), Positives = 100/109 (92%), Gaps = 0/109 (0%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED +DPKNFRKTIQ+IM+VQYKIPDYVHISQDC+HLLSRIFVAN  +RITI EIK HPWF
Sbjct  201  EDQEDPKNFRKTIQKIMAVQYKIPDYVHISQDCKHLLSRIFVANSLKRITIAEIKKHPWF  260

Query  744  LKNLPRELTEVAQAAYYRRENPTFSLQSAEEIMKIVDEAKAPPPASRSM  598
            LKNLPRELTE AQAAY+++ENPTFS Q+AEEIMKIVD+AK PPP SRS+
Sbjct  261  LKNLPRELTETAQAAYFKKENPTFSPQTAEEIMKIVDDAKTPPPVSRSI  309



>ref|XP_006305166.1| hypothetical protein CARUB_v10009533mg [Capsella rubella]
 gb|EOA38064.1| hypothetical protein CARUB_v10009533mg [Capsella rubella]
Length=362

 Score =   194 bits (494),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 89/109 (82%), Positives = 99/109 (91%), Gaps = 0/109 (0%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED +DPKNFRKTIQ+IM+VQYKIPDYVHISQDC+HLLSRIFVAN  +RITI EIK HPWF
Sbjct  201  EDQEDPKNFRKTIQKIMAVQYKIPDYVHISQDCKHLLSRIFVANSLKRITIAEIKKHPWF  260

Query  744  LKNLPRELTEVAQAAYYRRENPTFSLQSAEEIMKIVDEAKAPPPASRSM  598
            LKNLPRELTE AQAAY+R+ENPTFSLQ+ EEIMKIV +AK PPP SRS+
Sbjct  261  LKNLPRELTETAQAAYFRKENPTFSLQTVEEIMKIVADAKTPPPVSRSI  309



>emb|CDY34860.1| BnaA09g47860D [Brassica napus]
Length=357

 Score =   194 bits (493),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 89/109 (82%), Positives = 100/109 (92%), Gaps = 0/109 (0%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED +DPKNFRKTIQ+IM+VQYKIPDYVHISQDC+HLLSRIFVAN  +RITI EIK HPWF
Sbjct  201  EDQEDPKNFRKTIQKIMAVQYKIPDYVHISQDCKHLLSRIFVANSLKRITIAEIKKHPWF  260

Query  744  LKNLPRELTEVAQAAYYRRENPTFSLQSAEEIMKIVDEAKAPPPASRSM  598
            LKNLPRELTE AQAAY+++ENPTFS Q+AEEIMKIVD+AK PPP SRS+
Sbjct  261  LKNLPRELTETAQAAYFKKENPTFSPQTAEEIMKIVDDAKTPPPVSRSI  309



>ref|XP_012087257.1| PREDICTED: serine/threonine-protein kinase SAPK7-like [Jatropha 
curcas]
 gb|KDP25157.1| hypothetical protein JCGZ_24259 [Jatropha curcas]
Length=355

 Score =   194 bits (493),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 88/114 (77%), Positives = 101/114 (89%), Gaps = 0/114 (0%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED +DP+NFRKTIQRIM+VQYKIPDYVH+SQ+CRHLLSRIFVANP+RRITIKEIKSHPWF
Sbjct  201  EDQNDPRNFRKTIQRIMAVQYKIPDYVHVSQECRHLLSRIFVANPSRRITIKEIKSHPWF  260

Query  744  LKNLPRELTEVAQAAYYRRENPTFSLQSAEEIMKIVDEAKAPPPASRSMGGFGW  583
            LKN P+ELTE +QA YYR+ NP+FS QS EEIMKIV EA+  PP+S  + GFGW
Sbjct  261  LKNFPKELTESSQAVYYRKGNPSFSGQSEEEIMKIVAEARTRPPSSVPIKGFGW  314



>emb|CDX97923.1| BnaA06g06740D [Brassica napus]
Length=362

 Score =   194 bits (492),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 88/109 (81%), Positives = 99/109 (91%), Gaps = 0/109 (0%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED +DPKNFRKTIQ+IM+VQYKIPDYVHISQDC+HLLSRIFVAN  +RITI EIK HPWF
Sbjct  209  EDQEDPKNFRKTIQKIMAVQYKIPDYVHISQDCKHLLSRIFVANSVKRITIAEIKKHPWF  268

Query  744  LKNLPRELTEVAQAAYYRRENPTFSLQSAEEIMKIVDEAKAPPPASRSM  598
             KNLPRELTE AQAAY+++ENPTFS Q+AEEIMKIVD+AK PPP SRS+
Sbjct  269  TKNLPRELTETAQAAYFKKENPTFSAQTAEEIMKIVDDAKTPPPVSRSI  317



>ref|XP_002267922.1| PREDICTED: serine/threonine-protein kinase SRK2A [Vitis vinifera]
 emb|CBI21667.3| unnamed protein product [Vitis vinifera]
Length=355

 Score =   194 bits (492),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 90/114 (79%), Positives = 101/114 (89%), Gaps = 0/114 (0%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED DDPKNFRKTI RIM+VQYKIP+YVHISQDC+ LLSRIFVAN +RRITIKEIK+HPWF
Sbjct  201  EDPDDPKNFRKTIGRIMAVQYKIPEYVHISQDCKQLLSRIFVANSSRRITIKEIKNHPWF  260

Query  744  LKNLPRELTEVAQAAYYRRENPTFSLQSAEEIMKIVDEAKAPPPASRSMGGFGW  583
            LKNLPRELTE  QA YY+R+N +FSLQS EEIMKIV EA+   P+SRS+GGFGW
Sbjct  261  LKNLPRELTESTQANYYQRDNLSFSLQSVEEIMKIVGEARIRCPSSRSIGGFGW  314



>gb|AAA33003.1| serine/threonine protein kinase [Brassica napus]
 prf||2113401A protein kinase
Length=359

 Score =   193 bits (491),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 88/109 (81%), Positives = 99/109 (91%), Gaps = 0/109 (0%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED +DPKNFRKTIQ+IM+VQYKIPDYVHISQDC+HLLSRIFVAN  +RITI EIK HPWF
Sbjct  201  EDQEDPKNFRKTIQKIMAVQYKIPDYVHISQDCKHLLSRIFVANSLKRITIAEIKKHPWF  260

Query  744  LKNLPRELTEVAQAAYYRRENPTFSLQSAEEIMKIVDEAKAPPPASRSM  598
             KNLPRELTE AQAAY+++ENPTFS Q+AEEIMKIVD+AK PPP SRS+
Sbjct  261  TKNLPRELTETAQAAYFKKENPTFSAQTAEEIMKIVDDAKTPPPVSRSI  309



>ref|XP_010475982.1| PREDICTED: serine/threonine-protein kinase SRK2A-like [Camelina 
sativa]
Length=363

 Score =   193 bits (490),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 88/109 (81%), Positives = 98/109 (90%), Gaps = 0/109 (0%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED +DPKNFRKTIQ+IM+VQYKIPDYVHISQDC+HLLSRIFVAN  +RITI EIK HPWF
Sbjct  201  EDQEDPKNFRKTIQKIMAVQYKIPDYVHISQDCKHLLSRIFVANSLKRITIAEIKKHPWF  260

Query  744  LKNLPRELTEVAQAAYYRRENPTFSLQSAEEIMKIVDEAKAPPPASRSM  598
            LKNLPRELTE AQA Y+R+ENPTFSLQ+ EEIMKIV +AK PPP SRS+
Sbjct  261  LKNLPRELTETAQATYFRKENPTFSLQTVEEIMKIVADAKTPPPVSRSI  309



>emb|CDY34668.1| BnaC08g42270D [Brassica napus]
Length=361

 Score =   193 bits (490),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 88/109 (81%), Positives = 100/109 (92%), Gaps = 0/109 (0%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED +DPKNFRKTIQ+IM+VQYKIPDYVHISQDC+HLLSRIFVAN  +RITI EI+ HPWF
Sbjct  208  EDQEDPKNFRKTIQKIMAVQYKIPDYVHISQDCKHLLSRIFVANSLKRITIAEIRKHPWF  267

Query  744  LKNLPRELTEVAQAAYYRRENPTFSLQSAEEIMKIVDEAKAPPPASRSM  598
            LKNLPRELTE AQAAY+++ENPTFS Q+AEEIMKIVD+AK PPP SRS+
Sbjct  268  LKNLPRELTETAQAAYFKKENPTFSPQTAEEIMKIVDDAKTPPPVSRSI  316



>ref|XP_010458473.1| PREDICTED: serine/threonine-protein kinase SRK2A-like [Camelina 
sativa]
Length=361

 Score =   193 bits (490),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 88/109 (81%), Positives = 98/109 (90%), Gaps = 0/109 (0%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED +DPKNFRKTIQ+IM+VQYKIPDYVHISQDC+HLLSRIFVAN  +RITI EIK HPWF
Sbjct  201  EDQEDPKNFRKTIQKIMAVQYKIPDYVHISQDCKHLLSRIFVANSLKRITIAEIKKHPWF  260

Query  744  LKNLPRELTEVAQAAYYRRENPTFSLQSAEEIMKIVDEAKAPPPASRSM  598
            LKNLPRELTE AQA Y+R+ENPTFS Q+AEEIMKIV +AK PPP SRS+
Sbjct  261  LKNLPRELTETAQATYFRKENPTFSFQTAEEIMKIVADAKTPPPVSRSI  309



>ref|XP_004239628.1| PREDICTED: serine/threonine-protein kinase SAPK7-like [Solanum 
lycopersicum]
Length=356

 Score =   192 bits (488),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 89/114 (78%), Positives = 100/114 (88%), Gaps = 0/114 (0%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED DDPKNFRKTI RIM VQYKIPDYVHIS DC+HLLSRIFVA+PARRIT+KEIK+HPWF
Sbjct  201  EDVDDPKNFRKTISRIMGVQYKIPDYVHISHDCKHLLSRIFVASPARRITLKEIKNHPWF  260

Query  744  LKNLPRELTEVAQAAYYRRENPTFSLQSAEEIMKIVDEAKAPPPASRSMGGFGW  583
            LK+LP+ELTE AQA YY+R+NPTFS+QS EEIMKIV EA+ P P SR +  FGW
Sbjct  261  LKSLPKELTETAQAVYYKRDNPTFSIQSIEEIMKIVSEARNPAPPSRPVPHFGW  314



>ref|XP_010065455.1| PREDICTED: serine/threonine-protein kinase SAPK7-like [Eucalyptus 
grandis]
 gb|KCW62959.1| hypothetical protein EUGRSUZ_G00557 [Eucalyptus grandis]
 gb|KCW62960.1| hypothetical protein EUGRSUZ_G00557 [Eucalyptus grandis]
Length=362

 Score =   192 bits (488),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 88/114 (77%), Positives = 98/114 (86%), Gaps = 0/114 (0%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED  DPKNFRKT+ RIM+VQY IPDYVHISQDC+HLLSRIFVA+P+RR TIKEIK HPWF
Sbjct  201  EDPQDPKNFRKTMNRIMAVQYNIPDYVHISQDCKHLLSRIFVASPSRRTTIKEIKCHPWF  260

Query  744  LKNLPRELTEVAQAAYYRRENPTFSLQSAEEIMKIVDEAKAPPPASRSMGGFGW  583
            LKNLPRELTE AQA  YR+ NP   LQS EEIMKIV+EA+ PPPASR++ GFGW
Sbjct  261  LKNLPRELTEAAQAIEYRKGNPGVCLQSDEEIMKIVEEARVPPPASRTVSGFGW  314



>ref|XP_006652300.1| PREDICTED: serine/threonine-protein kinase SAPK7-like [Oryza 
brachyantha]
Length=358

 Score =   192 bits (488),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 88/116 (76%), Positives = 103/116 (89%), Gaps = 2/116 (2%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED DDPKNFRKTI RIMS+QYKIP+YVH+SQDCR LLSRIFVANPA+RITI+EI++HPWF
Sbjct  201  EDPDDPKNFRKTIGRIMSIQYKIPEYVHVSQDCRQLLSRIFVANPAKRITIREIRNHPWF  260

Query  744  LKNLPRELTEVAQAAYYRREN--PTFSLQSAEEIMKIVDEAKAPPPASRSMGGFGW  583
            LKNLPRELTE AQA YY+++N  PTFS+QS EEIMKIV+EA+ PP +S  + GFGW
Sbjct  261  LKNLPRELTEAAQAMYYKKDNSAPTFSVQSVEEIMKIVEEARTPPRSSTPVAGFGW  316



>gb|AIZ68211.1| serine/threonine-protein kinase SAPK7 [Ornithogalum saundersiae]
Length=363

 Score =   192 bits (487),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 89/116 (77%), Positives = 103/116 (89%), Gaps = 2/116 (2%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED DDPKNFRKTIQRIMSVQYKIPDYVHISQDC+ LLSRIFVA+PARRI+I+EIK+HPWF
Sbjct  201  EDQDDPKNFRKTIQRIMSVQYKIPDYVHISQDCKQLLSRIFVASPARRISIREIKNHPWF  260

Query  744  LKNLPRELTEVAQAAYYRREN--PTFSLQSAEEIMKIVDEAKAPPPASRSMGGFGW  583
            LKNLPRELTE AQA YY+R++  PTFSLQS E+IMKIV EA+  P  S+++ G+GW
Sbjct  261  LKNLPRELTEAAQAVYYKRDHNAPTFSLQSIEDIMKIVGEARTRPQLSKTVSGYGW  316



>emb|CDY19332.1| BnaC05g08410D [Brassica napus]
Length=415

 Score =   193 bits (491),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 88/109 (81%), Positives = 99/109 (91%), Gaps = 0/109 (0%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED +DPKNFRKTIQ+IM+VQYKIPDYVHISQDC+HLLSRIFVAN  +RITI EIK HPWF
Sbjct  201  EDQEDPKNFRKTIQKIMAVQYKIPDYVHISQDCKHLLSRIFVANSLKRITIAEIKKHPWF  260

Query  744  LKNLPRELTEVAQAAYYRRENPTFSLQSAEEIMKIVDEAKAPPPASRSM  598
             KNLPRELTE AQAAY+++ENPTFS Q+AEEIMKIVD+AK PPP SRS+
Sbjct  261  TKNLPRELTETAQAAYFKKENPTFSAQTAEEIMKIVDDAKTPPPVSRSI  309


 Score = 83.2 bits (204),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 38/62 (61%), Positives = 48/62 (77%), Gaps = 7/62 (11%)
 Frame = -1

Query  777  TIKEI-------KSHPWFLKNLPRELTEVAQAAYYRRENPTFSLQSAEEIMKIVDEAKAP  619
            T+KE+       + HPWFLKNLP +LTE AQAAY+ + N +FSLQ+AEEIMK+VD+AK P
Sbjct  346  TVKEVHASGEISRKHPWFLKNLPSDLTETAQAAYFSKGNQSFSLQTAEEIMKLVDDAKTP  405

Query  618  PP  613
            PP
Sbjct  406  PP  407



>ref|XP_003579766.1| PREDICTED: serine/threonine-protein kinase SAPK7 [Brachypodium 
distachyon]
Length=357

 Score =   191 bits (486),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 88/116 (76%), Positives = 103/116 (89%), Gaps = 2/116 (2%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED DDPKNFRKTI RIMS+QYKIP+YVH+SQDC+ LL+RIFVANPA+RIT++EI+SHPWF
Sbjct  201  EDPDDPKNFRKTIGRIMSIQYKIPEYVHVSQDCKQLLARIFVANPAKRITMREIRSHPWF  260

Query  744  LKNLPRELTEVAQAAYYRREN--PTFSLQSAEEIMKIVDEAKAPPPASRSMGGFGW  583
            LKNLPRELTE AQA YY+R+N  PT+SLQS EEIMKIV EA+ PPP+S  + GFGW
Sbjct  261  LKNLPRELTEPAQAMYYKRDNSAPTYSLQSVEEIMKIVQEAQKPPPSSTPVAGFGW  316



>gb|EYU20561.1| hypothetical protein MIMGU_mgv1a009810mg [Erythranthe guttata]
Length=331

 Score =   190 bits (483),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 85/114 (75%), Positives = 99/114 (87%), Gaps = 0/114 (0%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED  DPKNFRKTI RIM +QYKIPDYVHISQ+C+HLLSRIFV NP+RRI IKEIKSH WF
Sbjct  178  EDPTDPKNFRKTISRIMGIQYKIPDYVHISQECKHLLSRIFVTNPSRRINIKEIKSHAWF  237

Query  744  LKNLPRELTEVAQAAYYRRENPTFSLQSAEEIMKIVDEAKAPPPASRSMGGFGW  583
            +KNLPREL E  QA YY+++NP+FSLQS +EIMKIV EA+ PPP+SR++ GFGW
Sbjct  238  MKNLPRELAETNQALYYKKDNPSFSLQSVDEIMKIVSEARKPPPSSRNVPGFGW  291



>emb|CDX84430.1| BnaC03g50700D [Brassica napus]
Length=352

 Score =   191 bits (485),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 86/112 (77%), Positives = 102/112 (91%), Gaps = 0/112 (0%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED DDP+NFRKTIQRIM+VQYKIPDYVHISQ+C+HLLSRIFV NPA+RIT+KEIK HPWF
Sbjct  201  EDPDDPRNFRKTIQRIMAVQYKIPDYVHISQECKHLLSRIFVTNPAKRITLKEIKKHPWF  260

Query  744  LKNLPRELTEVAQAAYYRRENPTFSLQSAEEIMKIVDEAKAPPPASRSMGGF  589
            LKNLP+ELT+ AQAAYY+R+NP+FSLQS E+IMKIV EA+ P P+S ++ GF
Sbjct  261  LKNLPKELTDSAQAAYYKRDNPSFSLQSVEDIMKIVGEARNPAPSSSAVKGF  312



>ref|XP_006384384.1| kinase SPK-3 family protein [Populus trichocarpa]
 gb|ERP62181.1| kinase SPK-3 family protein [Populus trichocarpa]
Length=360

 Score =   191 bits (485),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 85/114 (75%), Positives = 102/114 (89%), Gaps = 0/114 (0%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED DDPKNFRKTIQ+IM+VQYKIPDYVH+SQ CRHLLSRIFVANP+RRI++ EIKSH WF
Sbjct  207  EDQDDPKNFRKTIQKIMAVQYKIPDYVHVSQACRHLLSRIFVANPSRRISLSEIKSHSWF  266

Query  744  LKNLPRELTEVAQAAYYRRENPTFSLQSAEEIMKIVDEAKAPPPASRSMGGFGW  583
            LKNLP+EL+E +QA YY+R+NP+FS+QS EEIMKIV EA+ PPP+S+ +  FGW
Sbjct  267  LKNLPKELSESSQAIYYQRDNPSFSVQSVEEIMKIVAEARQPPPSSKPVRSFGW  320



>ref|XP_006394252.1| hypothetical protein EUTSA_v10004481mg [Eutrema salsugineum]
 gb|ESQ31538.1| hypothetical protein EUTSA_v10004481mg [Eutrema salsugineum]
Length=356

 Score =   191 bits (485),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 86/112 (77%), Positives = 102/112 (91%), Gaps = 0/112 (0%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED DDP+NFRKTIQRIM+VQYKIPDYVHISQ+CRHLLSRIFV NPA+RIT+KEIK HPW+
Sbjct  201  EDPDDPRNFRKTIQRIMAVQYKIPDYVHISQECRHLLSRIFVTNPAKRITLKEIKKHPWY  260

Query  744  LKNLPRELTEVAQAAYYRRENPTFSLQSAEEIMKIVDEAKAPPPASRSMGGF  589
            LKNLP+ELT+ AQAAYY+R+NP+FSLQS E+IMKIV EA+ P P+S ++ GF
Sbjct  261  LKNLPKELTDSAQAAYYKRDNPSFSLQSVEDIMKIVGEARTPAPSSSAVKGF  312



>ref|XP_009150418.1| PREDICTED: serine/threonine-protein kinase SRK2H [Brassica rapa]
 emb|CDY41527.1| BnaA06g22800D [Brassica napus]
Length=357

 Score =   191 bits (485),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 86/112 (77%), Positives = 102/112 (91%), Gaps = 0/112 (0%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED DDP+NFRKTIQRIM+VQYKIPDYVHISQ+C+HLLSRIFV NPA+RIT+KEIK HPWF
Sbjct  201  EDPDDPRNFRKTIQRIMAVQYKIPDYVHISQECKHLLSRIFVTNPAKRITLKEIKKHPWF  260

Query  744  LKNLPRELTEVAQAAYYRRENPTFSLQSAEEIMKIVDEAKAPPPASRSMGGF  589
            LKNLP+ELT+ AQAAYY+R+NP+FSLQS E+IMKIV EA+ P P+S ++ GF
Sbjct  261  LKNLPKELTDSAQAAYYKRDNPSFSLQSVEDIMKIVGEARNPAPSSSAVKGF  312



>ref|XP_009406104.1| PREDICTED: serine/threonine-protein kinase SAPK7 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009406105.1| PREDICTED: serine/threonine-protein kinase SAPK7 [Musa acuminata 
subsp. malaccensis]
Length=359

 Score =   191 bits (484),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 86/114 (75%), Positives = 100/114 (88%), Gaps = 0/114 (0%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED  DPKNFRKTI RI+SVQYKIP+YVHISQDCR L+SRIFVANPARRITI+EI++HPWF
Sbjct  201  EDPADPKNFRKTIGRIVSVQYKIPEYVHISQDCRQLISRIFVANPARRITIREIRNHPWF  260

Query  744  LKNLPRELTEVAQAAYYRRENPTFSLQSAEEIMKIVDEAKAPPPASRSMGGFGW  583
            LKNLPRELTE  QA YY+R+ PT+SLQS EEIM+IV EA+ PPP++  + GFGW
Sbjct  261  LKNLPRELTEAQQAQYYKRDTPTYSLQSVEEIMRIVGEARTPPPSTTPVAGFGW  314



>ref|XP_009118223.1| PREDICTED: serine/threonine-protein kinase SRK2A-like [Brassica 
rapa]
Length=357

 Score =   191 bits (484),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 88/109 (81%), Positives = 99/109 (91%), Gaps = 0/109 (0%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED +DPKNFRKTIQ+IM+VQYKIPDYVHISQ C+HLLSRIFVAN  +RITI EIK HPWF
Sbjct  201  EDQEDPKNFRKTIQKIMAVQYKIPDYVHISQYCKHLLSRIFVANSLKRITIAEIKKHPWF  260

Query  744  LKNLPRELTEVAQAAYYRRENPTFSLQSAEEIMKIVDEAKAPPPASRSM  598
            LKNLPRELTE AQAAY+++ENPTFS Q+AEEIMKIVD+AK PPP SRS+
Sbjct  261  LKNLPRELTETAQAAYFKKENPTFSPQTAEEIMKIVDDAKTPPPVSRSI  309



>ref|XP_002325309.2| hypothetical protein POPTR_0019s00790g [Populus trichocarpa]
 gb|EEE99690.2| hypothetical protein POPTR_0019s00790g [Populus trichocarpa]
Length=353

 Score =   190 bits (483),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 86/114 (75%), Positives = 102/114 (89%), Gaps = 0/114 (0%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED DDP+NFRKTIQRIM+VQYKIPDYVH+SQ CR+LLSRIFVAN +RRI++ EIKSHPWF
Sbjct  201  EDQDDPRNFRKTIQRIMAVQYKIPDYVHVSQACRNLLSRIFVANSSRRISLSEIKSHPWF  260

Query  744  LKNLPRELTEVAQAAYYRRENPTFSLQSAEEIMKIVDEAKAPPPASRSMGGFGW  583
            LKNLP+ELTE AQA YY+R+NP+FSLQS +EIMKIV EA+  PP+S+ + GFGW
Sbjct  261  LKNLPKELTEPAQAIYYQRDNPSFSLQSVDEIMKIVAEARQQPPSSKPVKGFGW  314



>ref|NP_001052827.1| Os04g0432000 [Oryza sativa Japonica Group]
 sp|Q7XQP4.2|SAPK7_ORYSJ RecName: Full=Serine/threonine-protein kinase SAPK7; AltName: 
Full=Osmotic stress/abscisic acid-activated protein kinase 
7 [Oryza sativa Japonica Group]
 dbj|BAD18003.1| serine/threonine protein kinase SAPK7 [Oryza sativa Japonica 
Group]
 dbj|BAF14741.1| Os04g0432000 [Oryza sativa Japonica Group]
 emb|CAH66441.1| B0308C03.1 [Oryza sativa Indica Group]
 gb|EEE61026.1| hypothetical protein OsJ_14855 [Oryza sativa Japonica Group]
 gb|AEF00936.1| serine/threonine-protein kinase [Oryza sativa Japonica Group]
Length=359

 Score =   190 bits (483),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 87/116 (75%), Positives = 103/116 (89%), Gaps = 2/116 (2%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED DDPKNFRKTI RIMS+QYKIP+YVH+SQDCR LLSRIFVANPA+RITI+EI++HPWF
Sbjct  201  EDPDDPKNFRKTIGRIMSIQYKIPEYVHVSQDCRQLLSRIFVANPAKRITIREIRNHPWF  260

Query  744  LKNLPRELTEVAQAAYYRREN--PTFSLQSAEEIMKIVDEAKAPPPASRSMGGFGW  583
            LKNLPRELTE AQA YY+++N  PT+S+QS EEIMKIV+EA+ PP +S  + GFGW
Sbjct  261  LKNLPRELTEAAQAMYYKKDNSAPTYSVQSVEEIMKIVEEARTPPRSSTPVAGFGW  316



>emb|CAE54588.1| serin/threonine protein kinase [Fagus sylvatica]
Length=353

 Score =   190 bits (483),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 87/112 (78%), Positives = 100/112 (89%), Gaps = 0/112 (0%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED +DPKNFRK I RIM+VQYKIPDYVHISQ+C+HLLSRIF ANP++RITIKEIK+HPWF
Sbjct  201  EDPEDPKNFRKPINRIMAVQYKIPDYVHISQECKHLLSRIFAANPSKRITIKEIKNHPWF  260

Query  744  LKNLPRELTEVAQAAYYRRENPTFSLQSAEEIMKIVDEAKAPPPASRSMGGF  589
            LKNLPRELTE AQ  YY++ENP+FSLQS  EI KIV++AK PPP SRS+GGF
Sbjct  261  LKNLPRELTEAAQIMYYKKENPSFSLQSDREITKIVEDAKIPPPTSRSIGGF  312



>gb|AFW71756.1| putative snRK/SAPK family protein kinase [Zea mays]
Length=185

 Score =   185 bits (469),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 85/116 (73%), Positives = 102/116 (88%), Gaps = 2/116 (2%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED DDPKNFRKTI RI+S+QY+IP+YVHISQDCR LL+RIFVANPA+RITI+EI++HPWF
Sbjct  22   EDPDDPKNFRKTIGRIVSIQYQIPEYVHISQDCRQLLARIFVANPAKRITIREIRNHPWF  81

Query  744  LKNLPRELTEVAQAAYYRREN--PTFSLQSAEEIMKIVDEAKAPPPASRSMGGFGW  583
            LKNLPRELTE AQA YY+++N  PTFS Q+ EEIMKIV+EA+ PP +S  + GFGW
Sbjct  82   LKNLPRELTEAAQAKYYKKDNSAPTFSDQTVEEIMKIVEEARTPPQSSTPVAGFGW  137



>ref|XP_002892611.1| hypothetical protein ARALYDRAFT_888390 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68870.1| hypothetical protein ARALYDRAFT_888390 [Arabidopsis lyrata subsp. 
lyrata]
Length=364

 Score =   190 bits (483),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 87/109 (80%), Positives = 99/109 (91%), Gaps = 0/109 (0%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED +DPKNFRKTIQ+IM+VQYKIPDYVHISQDC++LLSRIFVAN  +RITI EIK HPWF
Sbjct  201  EDQEDPKNFRKTIQKIMAVQYKIPDYVHISQDCKNLLSRIFVANSLKRITIAEIKKHPWF  260

Query  744  LKNLPRELTEVAQAAYYRRENPTFSLQSAEEIMKIVDEAKAPPPASRSM  598
            LKNLPRELTE AQAAY+++ENPTFSLQ+ EEIMKIV +AK PPP SRS+
Sbjct  261  LKNLPRELTETAQAAYFKKENPTFSLQTVEEIMKIVADAKTPPPISRSI  309



>ref|XP_010065453.1| PREDICTED: serine/threonine-protein kinase SAPK7-like [Eucalyptus 
grandis]
 ref|XP_010065454.1| PREDICTED: serine/threonine-protein kinase SAPK7-like [Eucalyptus 
grandis]
 gb|KCW62961.1| hypothetical protein EUGRSUZ_G00558 [Eucalyptus grandis]
Length=356

 Score =   190 bits (482),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 88/113 (78%), Positives = 98/113 (87%), Gaps = 0/113 (0%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED  DPKNFRKT+ RIM+VQY IPDYVHISQDC+HLLSRIFVA+P+RR TIKEIKSHPWF
Sbjct  201  EDPQDPKNFRKTMNRIMAVQYNIPDYVHISQDCKHLLSRIFVASPSRRTTIKEIKSHPWF  260

Query  744  LKNLPRELTEVAQAAYYRRENPTFSLQSAEEIMKIVDEAKAPPPASRSMGGFG  586
            LKNLPRELTE AQA  YR+ NP   LQS EEIMKIV+EA+ PPPASR++ GFG
Sbjct  261  LKNLPRELTEAAQAIEYRKGNPGVCLQSDEEIMKIVEEARVPPPASRTVSGFG  313



>ref|XP_011097123.1| PREDICTED: serine/threonine-protein kinase SAPK7 [Sesamum indicum]
Length=354

 Score =   189 bits (481),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 87/107 (81%), Positives = 98/107 (92%), Gaps = 0/107 (0%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED DDPKNFRKTI RIM+VQYKIPDYVHISQDCRHLLSRIFVANP+RRI IKEIKSHPWF
Sbjct  201  EDPDDPKNFRKTISRIMAVQYKIPDYVHISQDCRHLLSRIFVANPSRRINIKEIKSHPWF  260

Query  744  LKNLPRELTEVAQAAYYRRENPTFSLQSAEEIMKIVDEAKAPPPASR  604
            LKNLP+EL+E  QA YY+++NP+FSLQS +EIMKIV EA+ PPP+SR
Sbjct  261  LKNLPKELSEANQAMYYKKDNPSFSLQSIDEIMKIVSEARNPPPSSR  307



>ref|XP_008781505.1| PREDICTED: serine/threonine-protein kinase SAPK7 [Phoenix dactylifera]
Length=356

 Score =   189 bits (480),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 87/116 (75%), Positives = 103/116 (89%), Gaps = 2/116 (2%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED +DPKNFR+TIQRIMSVQYKIP+YVHISQDCR LL+RIFVAN ARRITI+EI++HPWF
Sbjct  201  EDPNDPKNFRRTIQRIMSVQYKIPEYVHISQDCRQLLARIFVANSARRITIREIRNHPWF  260

Query  744  LKNLPRELTEVAQAAYYRRE--NPTFSLQSAEEIMKIVDEAKAPPPASRSMGGFGW  583
            LKNLPRELTE AQA YY+R+   PT+SLQS +EIM+IV EA+ PPP+S ++ GFGW
Sbjct  261  LKNLPRELTETAQAVYYKRDINAPTYSLQSVDEIMRIVREARTPPPSSTNVAGFGW  316



>gb|EEC73377.1| hypothetical protein OsI_07615 [Oryza sativa Indica Group]
Length=365

 Score =   189 bits (480),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 87/116 (75%), Positives = 102/116 (88%), Gaps = 2/116 (2%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED DDPKNFRKTI RI+S+QYKIP+YVHISQDCR LLSRIFVANPA+RITI+EI++HPWF
Sbjct  201  EDPDDPKNFRKTIGRIVSIQYKIPEYVHISQDCRQLLSRIFVANPAKRITIREIRNHPWF  260

Query  744  LKNLPRELTEVAQAAYYRREN--PTFSLQSAEEIMKIVDEAKAPPPASRSMGGFGW  583
            +KNLPRELTE AQA YY+++N  PTFS Q+ +EIMKIV EAK PPP+S  + GFGW
Sbjct  261  MKNLPRELTEAAQAKYYKKDNSAPTFSDQTVDEIMKIVQEAKTPPPSSTPVAGFGW  316



>ref|XP_011001254.1| PREDICTED: serine/threonine-protein kinase SRK2A [Populus euphratica]
 ref|XP_011015060.1| PREDICTED: serine/threonine-protein kinase SRK2A-like [Populus 
euphratica]
Length=353

 Score =   189 bits (479),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 85/114 (75%), Positives = 102/114 (89%), Gaps = 0/114 (0%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED DDP+NFRKTI+RIM+VQYKIPDYVH+SQ CR+LLSRIFVAN +RRI++ EIKSHPWF
Sbjct  201  EDQDDPRNFRKTIERIMAVQYKIPDYVHVSQACRNLLSRIFVANSSRRISLSEIKSHPWF  260

Query  744  LKNLPRELTEVAQAAYYRRENPTFSLQSAEEIMKIVDEAKAPPPASRSMGGFGW  583
            LKNLP+ELTE AQA YY+R+NP+FSLQS +EIMKIV EA+  PP+S+ + GFGW
Sbjct  261  LKNLPKELTEPAQAIYYQRDNPSFSLQSVDEIMKIVAEARQQPPSSKPVKGFGW  314



>ref|XP_008784212.1| PREDICTED: serine/threonine-protein kinase SAPK7-like [Phoenix 
dactylifera]
Length=356

 Score =   189 bits (479),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 87/116 (75%), Positives = 100/116 (86%), Gaps = 2/116 (2%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED DDPKNF+KT QRI+SVQYKIP++VHISQDCR LL+RIFVANPARRITI+EI++HPWF
Sbjct  201  EDPDDPKNFKKTFQRIVSVQYKIPEFVHISQDCRQLLARIFVANPARRITIREIRNHPWF  260

Query  744  LKNLPRELTEVAQAAYYRREN--PTFSLQSAEEIMKIVDEAKAPPPASRSMGGFGW  583
            LKNLPRELTE  Q AYY+R+N  PT+SLQ  EEIMKIVDEA+  PP S  + GFGW
Sbjct  261  LKNLPRELTEAGQTAYYKRDNDAPTYSLQKIEEIMKIVDEARTAPPTSTPVAGFGW  316



>emb|CAE03037.3| OSJNBa0084A10.12 [Oryza sativa Japonica Group]
Length=407

 Score =   190 bits (482),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 87/116 (75%), Positives = 103/116 (89%), Gaps = 2/116 (2%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED DDPKNFRKTI RIMS+QYKIP+YVH+SQDCR LLSRIFVANPA+RITI+EI++HPWF
Sbjct  226  EDPDDPKNFRKTIGRIMSIQYKIPEYVHVSQDCRQLLSRIFVANPAKRITIREIRNHPWF  285

Query  744  LKNLPRELTEVAQAAYYRREN--PTFSLQSAEEIMKIVDEAKAPPPASRSMGGFGW  583
            LKNLPRELTE AQA YY+++N  PT+S+QS EEIMKIV+EA+ PP +S  + GFGW
Sbjct  286  LKNLPRELTEAAQAMYYKKDNSAPTYSVQSVEEIMKIVEEARTPPRSSTPVAGFGW  341



>ref|XP_010444281.1| PREDICTED: serine/threonine-protein kinase SRK2H-like [Camelina 
sativa]
Length=356

 Score =   188 bits (478),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 85/112 (76%), Positives = 101/112 (90%), Gaps = 0/112 (0%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED DDP+NFRKTIQRIM+VQYKIPDYVHISQ+C+HLLSRIFV N A+RIT+KEIK HPW+
Sbjct  201  EDPDDPRNFRKTIQRIMAVQYKIPDYVHISQECKHLLSRIFVTNSAKRITLKEIKKHPWY  260

Query  744  LKNLPRELTEVAQAAYYRRENPTFSLQSAEEIMKIVDEAKAPPPASRSMGGF  589
            LKNLP+ELTE AQAAYY+RE P+FSLQS E+IMKIV EA++P P+S ++ GF
Sbjct  261  LKNLPKELTESAQAAYYKRETPSFSLQSVEDIMKIVGEARSPAPSSNAVNGF  312



>gb|ACN33610.1| unknown [Zea mays]
 tpg|DAA37760.1| TPA: putative snRK/SAPK family protein kinase [Zea mays]
Length=356

 Score =   188 bits (478),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 85/116 (73%), Positives = 103/116 (89%), Gaps = 2/116 (2%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED DDPKNFRKTI RIMS+QYKIP+YVH+SQDC+ LLSRIFVAN A+RITI+EI++HPWF
Sbjct  201  EDPDDPKNFRKTIGRIMSIQYKIPEYVHVSQDCKELLSRIFVANSAKRITIREIRNHPWF  260

Query  744  LKNLPRELTEVAQAAYYRREN--PTFSLQSAEEIMKIVDEAKAPPPASRSMGGFGW  583
            LKNLPRELTE AQA YY+++N  PT+S+QS EEIMKIV++A+ PPP+S  + GFGW
Sbjct  261  LKNLPRELTEAAQAMYYKKDNSAPTYSVQSVEEIMKIVEKARTPPPSSTPVAGFGW  316



>ref|NP_001149107.1| LOC100282729 [Zea mays]
 gb|ACG34231.1| serine/threonine-protein kinase SAPK7 [Zea mays]
Length=356

 Score =   188 bits (478),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 85/116 (73%), Positives = 103/116 (89%), Gaps = 2/116 (2%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED DDPKNFRKTI RIMS+QYKIP+YVH+SQDC+ LLSRIFVAN A+RITI+EI++HPWF
Sbjct  201  EDPDDPKNFRKTIGRIMSIQYKIPEYVHVSQDCKELLSRIFVANSAKRITIREIRNHPWF  260

Query  744  LKNLPRELTEVAQAAYYRREN--PTFSLQSAEEIMKIVDEAKAPPPASRSMGGFGW  583
            LKNLPRELTE AQA YY+++N  PT+S+QS EEIMKIV++A+ PPP+S  + GFGW
Sbjct  261  LKNLPRELTEAAQAMYYKKDNSAPTYSVQSVEEIMKIVEKARTPPPSSTPVAGFGW  316



>ref|XP_010547692.1| PREDICTED: serine/threonine-protein kinase SRK2G [Tarenaya hassleriana]
Length=356

 Score =   188 bits (478),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 85/113 (75%), Positives = 101/113 (89%), Gaps = 0/113 (0%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED DDP+NFRKTIQRIM+VQYKIPDYVHISQDC+HLLSRIFV NP +RIT+KEIK+HPW+
Sbjct  201  EDPDDPRNFRKTIQRIMAVQYKIPDYVHISQDCKHLLSRIFVTNPLKRITLKEIKNHPWY  260

Query  744  LKNLPRELTEVAQAAYYRRENPTFSLQSAEEIMKIVDEAKAPPPASRSMGGFG  586
            LKNLP+ELTE AQA YY+R+NP++SLQS E+IMKIV EA+ P P+S  + GFG
Sbjct  261  LKNLPKELTESAQANYYKRDNPSYSLQSIEDIMKIVGEARNPAPSSTPVKGFG  313



>gb|ACG50011.1| SnRK2.7 [Zea mays]
Length=356

 Score =   188 bits (478),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 85/116 (73%), Positives = 103/116 (89%), Gaps = 2/116 (2%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED DDPKNFRKTI RIMS+QYKIP+YVH+SQDC+ LLSRIFVAN A+RITI+EI++HPWF
Sbjct  201  EDPDDPKNFRKTIGRIMSIQYKIPEYVHVSQDCKELLSRIFVANSAKRITIREIRNHPWF  260

Query  744  LKNLPRELTEVAQAAYYRREN--PTFSLQSAEEIMKIVDEAKAPPPASRSMGGFGW  583
            LKNLPRELTE AQA YY+++N  PT+S+QS EEIMKIV++A+ PPP+S  + GFGW
Sbjct  261  LKNLPRELTEAAQAMYYKKDNSAPTYSVQSVEEIMKIVEKARTPPPSSTPVAGFGW  316



>ref|NP_172563.1| serine/threonine-protein kinase SRK2A [Arabidopsis thaliana]
 sp|P43291.1|SRK2A_ARATH RecName: Full=Serine/threonine-protein kinase SRK2A; AltName: 
Full=Arabidopsis protein SK1; AltName: Full=OST1-kinase-like 
7; AltName: Full=SNF1-related kinase 2.4; Short=SnRK2.4 [Arabidopsis 
thaliana]
 gb|AAA02840.1| serine/threonine kinase [Arabidopsis thaliana]
 gb|AAB65483.1| Ser/Thr kinase; 69816-71936 [Arabidopsis thaliana]
 gb|AAM13129.1| Ser/Thr kinase [Arabidopsis thaliana]
 gb|AAM60822.1| Ser/Thr kinase [Arabidopsis thaliana]
 gb|AAP68289.1| At1g10940 [Arabidopsis thaliana]
 gb|AEE28666.1| serine/threonine-protein kinase SRK2A [Arabidopsis thaliana]
Length=363

 Score =   188 bits (477),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 86/109 (79%), Positives = 98/109 (90%), Gaps = 0/109 (0%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED +DPKNFRKTIQ+IM+VQYKIPDYVHISQDC++LLSRIFVAN  +RITI EIK H WF
Sbjct  201  EDQEDPKNFRKTIQKIMAVQYKIPDYVHISQDCKNLLSRIFVANSLKRITIAEIKKHSWF  260

Query  744  LKNLPRELTEVAQAAYYRRENPTFSLQSAEEIMKIVDEAKAPPPASRSM  598
            LKNLPRELTE AQAAY+++ENPTFSLQ+ EEIMKIV +AK PPP SRS+
Sbjct  261  LKNLPRELTETAQAAYFKKENPTFSLQTVEEIMKIVADAKTPPPVSRSI  309



>gb|AGT16423.1| hypothetical protein SHCRBa_145_O09_R_60 [Saccharum hybrid cultivar 
R570]
Length=359

 Score =   188 bits (477),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 85/116 (73%), Positives = 103/116 (89%), Gaps = 2/116 (2%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED DDPKNFRKTI RIMS+QYKIP+YVH+SQDC+ LLSRIFVAN A+RITI+EI++HPWF
Sbjct  201  EDPDDPKNFRKTIGRIMSIQYKIPEYVHVSQDCKELLSRIFVANSAKRITIREIRNHPWF  260

Query  744  LKNLPRELTEVAQAAYYRREN--PTFSLQSAEEIMKIVDEAKAPPPASRSMGGFGW  583
            LKNLPRELTE AQA YY+++N  PT+S+QS EEIMKIV++A+ PPP+S  + GFGW
Sbjct  261  LKNLPRELTEAAQAMYYKKDNSAPTYSVQSVEEIMKIVEKARTPPPSSTPVAGFGW  316



>gb|EMT04089.1| Serine/threonine-protein kinase SAPK7 [Aegilops tauschii]
Length=357

 Score =   188 bits (477),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 84/116 (72%), Positives = 103/116 (89%), Gaps = 2/116 (2%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED DDPKNFRKTI RIMS+QYKIP+YVH+SQDC+ LL+ IFVANPA+RIT++EI++HPWF
Sbjct  201  EDPDDPKNFRKTIGRIMSIQYKIPEYVHVSQDCKQLLASIFVANPAKRITMREIRNHPWF  260

Query  744  LKNLPRELTEVAQAAYYRREN--PTFSLQSAEEIMKIVDEAKAPPPASRSMGGFGW  583
            LKNLPRELTE AQA YY+R+N  PT+S+QS EEIMKIV+EA+ PPP++  + GFGW
Sbjct  261  LKNLPRELTEAAQAMYYKRDNSAPTYSVQSVEEIMKIVEEAQKPPPSTTPVAGFGW  316



>dbj|BAH56941.1| AT5G63650 [Arabidopsis thaliana]
Length=346

 Score =   187 bits (476),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 86/112 (77%), Positives = 100/112 (89%), Gaps = 0/112 (0%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED DDP+NFRKTIQRIM+VQYKIPDYVHISQ+CRHLLSRIFV N A+RIT+KEIK HPW+
Sbjct  201  EDPDDPRNFRKTIQRIMAVQYKIPDYVHISQECRHLLSRIFVTNSAKRITLKEIKKHPWY  260

Query  744  LKNLPRELTEVAQAAYYRRENPTFSLQSAEEIMKIVDEAKAPPPASRSMGGF  589
            LKNLP+ELTE AQAAYY+RE P+FSLQS E+IMKIV EA+ P P+S ++ GF
Sbjct  261  LKNLPKELTEPAQAAYYKRETPSFSLQSVEDIMKIVGEARNPAPSSNAVKGF  312



>ref|NP_001031021.2| serine/threonine-protein kinase SRK2A [Arabidopsis thaliana]
 gb|AEE28667.1| serine/threonine-protein kinase SRK2A [Arabidopsis thaliana]
Length=371

 Score =   188 bits (477),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 86/109 (79%), Positives = 98/109 (90%), Gaps = 0/109 (0%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED +DPKNFRKTIQ+IM+VQYKIPDYVHISQDC++LLSRIFVAN  +RITI EIK H WF
Sbjct  209  EDQEDPKNFRKTIQKIMAVQYKIPDYVHISQDCKNLLSRIFVANSLKRITIAEIKKHSWF  268

Query  744  LKNLPRELTEVAQAAYYRRENPTFSLQSAEEIMKIVDEAKAPPPASRSM  598
            LKNLPRELTE AQAAY+++ENPTFSLQ+ EEIMKIV +AK PPP SRS+
Sbjct  269  LKNLPRELTETAQAAYFKKENPTFSLQTVEEIMKIVADAKTPPPVSRSI  317



>gb|EMS63561.1| Serine/threonine-protein kinase SAPK7 [Triticum urartu]
Length=383

 Score =   188 bits (478),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 84/116 (72%), Positives = 103/116 (89%), Gaps = 2/116 (2%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED DDPKNFRKTI RIMS+QYKIP+YVH+SQDC+ LL+ IFVANPA+RIT++EI++HPWF
Sbjct  201  EDPDDPKNFRKTIGRIMSIQYKIPEYVHVSQDCKQLLASIFVANPAKRITMREIRNHPWF  260

Query  744  LKNLPRELTEVAQAAYYRREN--PTFSLQSAEEIMKIVDEAKAPPPASRSMGGFGW  583
            LKNLPRELTE AQA YY+R+N  PT+S+QS EEIMKIV+EA+ PPP++  + GFGW
Sbjct  261  LKNLPRELTEAAQAMYYKRDNSAPTYSVQSVEEIMKIVEEAQKPPPSTTPVAGFGW  316



>gb|AFW62591.1| putative snRK/SAPK family protein kinase [Zea mays]
Length=185

 Score =   182 bits (462),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 84/116 (72%), Positives = 101/116 (87%), Gaps = 2/116 (2%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED DDPKNFRKTI RI+S+QY+IP+YVHISQDCR LL+RIFVANPA+RITI+EI++HPWF
Sbjct  22   EDPDDPKNFRKTIGRIVSIQYQIPEYVHISQDCRQLLARIFVANPAKRITIREIRNHPWF  81

Query  744  LKNLPRELTEVAQAAYYRREN--PTFSLQSAEEIMKIVDEAKAPPPASRSMGGFGW  583
            LKNLPRELTE AQA YY+++N  PTFS Q+ EEIMKIV+EA+ PP +   + GFGW
Sbjct  82   LKNLPRELTEAAQAKYYKKDNGAPTFSDQTVEEIMKIVEEARTPPQSPAPVAGFGW  137



>dbj|BAE99712.1| serine/threonine-protein kinase [Arabidopsis thaliana]
Length=360

 Score =   187 bits (476),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 86/112 (77%), Positives = 100/112 (89%), Gaps = 0/112 (0%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED DDP+NFRKTIQRIM+VQYKIPDYVHISQ+CRHLLSRIFV N A+RIT+KEIK HPW+
Sbjct  201  EDPDDPRNFRKTIQRIMAVQYKIPDYVHISQECRHLLSRIFVTNSAKRITLKEIKKHPWY  260

Query  744  LKNLPRELTEVAQAAYYRRENPTFSLQSAEEIMKIVDEAKAPPPASRSMGGF  589
            LKNLP+ELTE AQAAYY+RE P+FSLQS E+IMKIV EA+ P P+S ++ GF
Sbjct  261  LKNLPKELTEPAQAAYYKRETPSFSLQSVEDIMKIVGEARNPAPSSNAVKGF  312



>gb|AAM65503.1| serine/threonine-protein kinase [Arabidopsis thaliana]
Length=358

 Score =   187 bits (475),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 86/112 (77%), Positives = 100/112 (89%), Gaps = 0/112 (0%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED DDP+NFRKTIQRIM+VQYKIPDYVHISQ+CRHLLSRIFV N A+RIT+KEIK HPW+
Sbjct  201  EDPDDPRNFRKTIQRIMAVQYKIPDYVHISQECRHLLSRIFVTNSAKRITLKEIKKHPWY  260

Query  744  LKNLPRELTEVAQAAYYRRENPTFSLQSAEEIMKIVDEAKAPPPASRSMGGF  589
            LKNLP+ELTE AQAAYY+RE P+FSLQS E+IMKIV EA+ P P+S ++ GF
Sbjct  261  LKNLPKELTEPAQAAYYKRETPSFSLQSVEDIMKIVGEARNPAPSSNAVKGF  312



>ref|NP_201170.1| serine/threonine-protein kinase SRK2H [Arabidopsis thaliana]
 sp|Q9FFP9.1|SRK2H_ARATH RecName: Full=Serine/threonine-protein kinase SRK2H; AltName: 
Full=OST1-kinase-like 9; AltName: Full=SNF1-related kinase 
2.5; Short=SnRK2.5 [Arabidopsis thaliana]
 dbj|BAB10458.1| serine/threonine-protein kinase [Arabidopsis thaliana]
 gb|AED97781.1| serine/threonine-protein kinase SRK2H [Arabidopsis thaliana]
Length=360

 Score =   187 bits (475),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 86/112 (77%), Positives = 100/112 (89%), Gaps = 0/112 (0%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED DDP+NFRKTIQRIM+VQYKIPDYVHISQ+CRHLLSRIFV N A+RIT+KEIK HPW+
Sbjct  201  EDPDDPRNFRKTIQRIMAVQYKIPDYVHISQECRHLLSRIFVTNSAKRITLKEIKKHPWY  260

Query  744  LKNLPRELTEVAQAAYYRRENPTFSLQSAEEIMKIVDEAKAPPPASRSMGGF  589
            LKNLP+ELTE AQAAYY+RE P+FSLQS E+IMKIV EA+ P P+S ++ GF
Sbjct  261  LKNLPKELTEPAQAAYYKRETPSFSLQSVEDIMKIVGEARNPAPSSNAVKGF  312



>ref|XP_010484120.1| PREDICTED: serine/threonine-protein kinase SRK2H-like [Camelina 
sativa]
Length=357

 Score =   187 bits (475),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 84/112 (75%), Positives = 100/112 (89%), Gaps = 0/112 (0%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED DDP+NFRKTIQRIM+VQYKIPDYVHISQ+C+HLLSRIFV N A+RIT+KEIK HPW+
Sbjct  201  EDPDDPRNFRKTIQRIMAVQYKIPDYVHISQECKHLLSRIFVTNSAKRITLKEIKKHPWY  260

Query  744  LKNLPRELTEVAQAAYYRRENPTFSLQSAEEIMKIVDEAKAPPPASRSMGGF  589
            LKNLP+ELTE AQA YY+RE P+FSLQS E+IMKIV EA++P P+S ++ GF
Sbjct  261  LKNLPKELTESAQATYYKRETPSFSLQSVEDIMKIVGEARSPAPSSNAVNGF  312



>ref|XP_010911872.1| PREDICTED: serine/threonine-protein kinase SAPK7-like [Elaeis 
guineensis]
Length=358

 Score =   187 bits (474),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 86/116 (74%), Positives = 100/116 (86%), Gaps = 2/116 (2%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED +DP+N RKTIQ++M VQYKIP+YVHIS+DCR L+SR+FVANPARRITIKEIK+HPWF
Sbjct  201  EDQNDPRNLRKTIQKVMQVQYKIPEYVHISRDCRQLISRLFVANPARRITIKEIKNHPWF  260

Query  744  LKNLPRELTEVAQAAYYRREN--PTFSLQSAEEIMKIVDEAKAPPPASRSMGGFGW  583
            L+NLPRELTE AQA YYRR+   PTFSLQS E+IMKI  EA+ P  ASRS+ GFGW
Sbjct  261  LRNLPRELTESAQAVYYRRDRNAPTFSLQSVEDIMKIAGEARTPAQASRSIPGFGW  316



>ref|XP_009148434.1| PREDICTED: serine/threonine-protein kinase SRK2A [Brassica rapa]
Length=359

 Score =   186 bits (473),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 85/109 (78%), Positives = 96/109 (88%), Gaps = 0/109 (0%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED +DPKNFRKTIQ+IM+VQYK P  VHISQDC+HLLSRIFVAN  +RITI EIK HPWF
Sbjct  201  EDQEDPKNFRKTIQKIMAVQYKFPGSVHISQDCKHLLSRIFVANSVKRITIAEIKKHPWF  260

Query  744  LKNLPRELTEVAQAAYYRRENPTFSLQSAEEIMKIVDEAKAPPPASRSM  598
             KNLPRELTE AQAAY+++ENPTFS Q+AEEIMKIVD+AK PPP SRS+
Sbjct  261  TKNLPRELTETAQAAYFKKENPTFSAQTAEEIMKIVDDAKTPPPVSRSI  309



>ref|NP_001047099.1| Os02g0551100 [Oryza sativa Japonica Group]
 sp|Q6ZI44.1|SAPK6_ORYSJ RecName: Full=Serine/threonine-protein kinase SAPK6; AltName: 
Full=Osmotic stress/abscisic acid-activated protein kinase 
6 [Oryza sativa Japonica Group]
 dbj|BAD15474.1| putative osmotic stress-activated protein kinase [Oryza sativa 
Japonica Group]
 dbj|BAD18002.1| serine/threonine protein kinase SAPK6 [Oryza sativa Japonica 
Group]
 dbj|BAD33270.1| putative osmotic stress-activated protein kinase [Oryza sativa 
Japonica Group]
 gb|ABB89146.1| serine-threonine protein kinase [Oryza sativa Japonica Group]
 dbj|BAF09013.1| Os02g0551100 [Oryza sativa Japonica Group]
 dbj|BAG90400.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE57169.1| hypothetical protein OsJ_07099 [Oryza sativa Japonica Group]
 gb|AEF00935.1| serine/threonine-protein kinase [Oryza sativa Japonica Group]
Length=365

 Score =   186 bits (473),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 86/116 (74%), Positives = 101/116 (87%), Gaps = 2/116 (2%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED DDPKNFRKTI RI+S+QYKIP+YVHISQDCR LLSRIFVANPA+RITI+EI++HPWF
Sbjct  201  EDPDDPKNFRKTIGRIVSIQYKIPEYVHISQDCRQLLSRIFVANPAKRITIREIRNHPWF  260

Query  744  LKNLPRELTEVAQAAYYRRENP--TFSLQSAEEIMKIVDEAKAPPPASRSMGGFGW  583
            +KNLPRELTE AQA YY+++N   TFS Q+ +EIMKIV EAK PPP+S  + GFGW
Sbjct  261  MKNLPRELTEAAQAKYYKKDNSARTFSDQTVDEIMKIVQEAKTPPPSSTPVAGFGW  316



>ref|XP_010460858.1| PREDICTED: serine/threonine-protein kinase SRK2H [Camelina sativa]
Length=357

 Score =   186 bits (471),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 84/112 (75%), Positives = 99/112 (88%), Gaps = 0/112 (0%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED DDP+NFRKTIQRIM+VQYKIPDYVHISQ+C+HLLSRIFV N A+RIT+KEIK HPW+
Sbjct  201  EDPDDPRNFRKTIQRIMAVQYKIPDYVHISQECKHLLSRIFVTNSAKRITLKEIKKHPWY  260

Query  744  LKNLPRELTEVAQAAYYRRENPTFSLQSAEEIMKIVDEAKAPPPASRSMGGF  589
            LKNLP+ELTE AQA YY+RE P+FSLQS E+IMKIV EA+ P P+S ++ GF
Sbjct  261  LKNLPKELTESAQATYYKRETPSFSLQSVEDIMKIVGEARNPAPSSNAVNGF  312



>ref|XP_009383517.1| PREDICTED: serine/threonine-protein kinase SAPK7-like [Musa acuminata 
subsp. malaccensis]
Length=355

 Score =   186 bits (471),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 85/116 (73%), Positives = 100/116 (86%), Gaps = 2/116 (2%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED DDP+NFRKTI RI++ QYKIP+YVH SQDCR +LSRIFVANP RRITI+EI++HPWF
Sbjct  201  EDPDDPRNFRKTIGRIVAAQYKIPEYVHTSQDCRQILSRIFVANPERRITIREIRNHPWF  260

Query  744  LKNLPRELTEVAQAAYYRREN--PTFSLQSAEEIMKIVDEAKAPPPASRSMGGFGW  583
            LKNLPRELTE AQA YY+R+N  PT+SLQS EEIM+IV EA+ PPP+S  + GFGW
Sbjct  261  LKNLPRELTEAAQAQYYKRDNDAPTYSLQSIEEIMRIVGEARTPPPSSTPVAGFGW  316



>ref|XP_006280694.1| hypothetical protein CARUB_v10026657mg [Capsella rubella]
 gb|EOA13592.1| hypothetical protein CARUB_v10026657mg [Capsella rubella]
Length=359

 Score =   186 bits (471),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 84/112 (75%), Positives = 100/112 (89%), Gaps = 0/112 (0%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED DDP+NFRKTIQRIM+VQYKIPDYVHISQ+C+HLLSRIFV N A+RIT+KEIK HPW+
Sbjct  201  EDPDDPRNFRKTIQRIMAVQYKIPDYVHISQECKHLLSRIFVTNSAKRITLKEIKKHPWY  260

Query  744  LKNLPRELTEVAQAAYYRRENPTFSLQSAEEIMKIVDEAKAPPPASRSMGGF  589
            LKNLP+ELTE +QAAYY+RE P+FSLQS E+IMKIV EA+ P P+S ++ GF
Sbjct  261  LKNLPKELTESSQAAYYKRETPSFSLQSVEDIMKIVGEARNPAPSSNAVKGF  312



>ref|XP_004975639.1| PREDICTED: serine/threonine-protein kinase SAPK7-like [Setaria 
italica]
Length=358

 Score =   185 bits (470),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 84/116 (72%), Positives = 102/116 (88%), Gaps = 2/116 (2%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED DDPKNFRKTI RIMS QYKIP+YVH+SQDC+ LLSRIFVAN A+RITI+EI++HPWF
Sbjct  201  EDPDDPKNFRKTIGRIMSTQYKIPEYVHVSQDCKELLSRIFVANSAKRITIREIRNHPWF  260

Query  744  LKNLPRELTEVAQAAYYRREN--PTFSLQSAEEIMKIVDEAKAPPPASRSMGGFGW  583
            LKNLPRELTE AQA YY+++N  PT+S+QS E+IMKIV++A+ PPP+S  + GFGW
Sbjct  261  LKNLPRELTEAAQAMYYKKDNSAPTYSVQSVEDIMKIVEKARTPPPSSTPVAGFGW  316



>ref|XP_002866567.1| serine/threonine-protein kinase [Arabidopsis lyrata subsp. lyrata]
 gb|EFH42826.1| serine/threonine-protein kinase [Arabidopsis lyrata subsp. lyrata]
Length=356

 Score =   185 bits (470),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 84/112 (75%), Positives = 100/112 (89%), Gaps = 0/112 (0%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED DDP+NFRKTIQRIM+VQYKIPDYVHIS +C+HLLSRIFV N A+RIT+KEIK HPW+
Sbjct  201  EDPDDPRNFRKTIQRIMAVQYKIPDYVHISLECKHLLSRIFVTNSAKRITLKEIKKHPWY  260

Query  744  LKNLPRELTEVAQAAYYRRENPTFSLQSAEEIMKIVDEAKAPPPASRSMGGF  589
            LKNLP+ELTE AQAAYY+RE P+FSLQS E+IMKIV EA++P P+S ++ GF
Sbjct  261  LKNLPKELTESAQAAYYKRETPSFSLQSVEDIMKIVGEARSPAPSSNAVKGF  312



>ref|XP_003575110.1| PREDICTED: serine/threonine-protein kinase SAPK7-like [Brachypodium 
distachyon]
Length=362

 Score =   185 bits (470),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 85/116 (73%), Positives = 102/116 (88%), Gaps = 2/116 (2%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED DDPKNFRKTI RI+S+QYKIP+YVHISQDCR LLS+IFVANPA+RITI+EI++HPWF
Sbjct  201  EDPDDPKNFRKTIGRIVSIQYKIPEYVHISQDCRQLLSKIFVANPAKRITIREIRNHPWF  260

Query  744  LKNLPRELTEVAQAAYYRREN--PTFSLQSAEEIMKIVDEAKAPPPASRSMGGFGW  583
            LKNLPRELTE  Q  YY+++N  PTFS Q+ EEIMKIV++A+APPP+S  + GFGW
Sbjct  261  LKNLPRELTETVQEKYYKKDNSAPTFSDQTVEEIMKIVEDARAPPPSSTPVTGFGW  316



>gb|ACN35772.1| unknown [Zea mays]
 gb|ACR38484.1| unknown [Zea mays]
 gb|AFW71757.1| putative snRK/SAPK family protein kinase isoform 1 [Zea mays]
 gb|AFW71758.1| putative snRK/SAPK family protein kinase isoform 2 [Zea mays]
Length=364

 Score =   185 bits (470),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 85/116 (73%), Positives = 102/116 (88%), Gaps = 2/116 (2%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED DDPKNFRKTI RI+S+QY+IP+YVHISQDCR LL+RIFVANPA+RITI+EI++HPWF
Sbjct  201  EDPDDPKNFRKTIGRIVSIQYQIPEYVHISQDCRQLLARIFVANPAKRITIREIRNHPWF  260

Query  744  LKNLPRELTEVAQAAYYRREN--PTFSLQSAEEIMKIVDEAKAPPPASRSMGGFGW  583
            LKNLPRELTE AQA YY+++N  PTFS Q+ EEIMKIV+EA+ PP +S  + GFGW
Sbjct  261  LKNLPRELTEAAQAKYYKKDNSAPTFSDQTVEEIMKIVEEARTPPQSSTPVAGFGW  316



>ref|XP_002453967.1| hypothetical protein SORBIDRAFT_04g022410 [Sorghum bicolor]
 gb|EES06943.1| hypothetical protein SORBIDRAFT_04g022410 [Sorghum bicolor]
Length=364

 Score =   185 bits (469),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 85/116 (73%), Positives = 102/116 (88%), Gaps = 2/116 (2%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED DDPKNFRKTI RI+S+QY+IP+YVHISQDCR LL+RIFVANPA+RITI+EI++HPWF
Sbjct  201  EDPDDPKNFRKTIGRIVSIQYQIPEYVHISQDCRQLLARIFVANPAKRITIREIRNHPWF  260

Query  744  LKNLPRELTEVAQAAYYRREN--PTFSLQSAEEIMKIVDEAKAPPPASRSMGGFGW  583
            LKNLPRELTE AQA YY+++N  PTFS Q+ EEIMKIV+EA+ PP +S  + GFGW
Sbjct  261  LKNLPRELTEAAQAKYYKKDNSAPTFSDQTVEEIMKIVEEARMPPESSTPVAGFGW  316



>gb|AFW71759.1| putative snRK/SAPK family protein kinase [Zea mays]
Length=377

 Score =   185 bits (470),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 85/116 (73%), Positives = 102/116 (88%), Gaps = 2/116 (2%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED DDPKNFRKTI RI+S+QY+IP+YVHISQDCR LL+RIFVANPA+RITI+EI++HPWF
Sbjct  214  EDPDDPKNFRKTIGRIVSIQYQIPEYVHISQDCRQLLARIFVANPAKRITIREIRNHPWF  273

Query  744  LKNLPRELTEVAQAAYYRREN--PTFSLQSAEEIMKIVDEAKAPPPASRSMGGFGW  583
            LKNLPRELTE AQA YY+++N  PTFS Q+ EEIMKIV+EA+ PP +S  + GFGW
Sbjct  274  LKNLPRELTEAAQAKYYKKDNSAPTFSDQTVEEIMKIVEEARTPPQSSTPVAGFGW  329



>ref|NP_001105274.1| uncharacterized protein LOC542190 [Zea mays]
 gb|AAU43772.1| putative salt-inducible protein kinase [Zea mays]
Length=364

 Score =   184 bits (467),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 84/116 (72%), Positives = 102/116 (88%), Gaps = 2/116 (2%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED DDPKNFRKTI RI+S+QY+IP+YVHISQDCR LL+RIFVANPA+RITI+EI++HPWF
Sbjct  201  EDPDDPKNFRKTIGRIVSIQYQIPEYVHISQDCRQLLARIFVANPAKRITIREIRNHPWF  260

Query  744  LKNLPRELTEVAQAAYYRREN--PTFSLQSAEEIMKIVDEAKAPPPASRSMGGFGW  583
            L+NLPRELTE AQA YY+++N  PTFS Q+ EEIMKIV+EA+ PP +S  + GFGW
Sbjct  261  LRNLPRELTEAAQAKYYKKDNSAPTFSDQTVEEIMKIVEEARTPPQSSTPVAGFGW  316



>ref|NP_001274891.1| serine/threonine-protein kinase SAPK7-like [Solanum tuberosum]
 gb|AFR68943.1| sucrose non-fermenting 1-related protein kinase 2 family member 
[Solanum tuberosum]
Length=358

 Score =   184 bits (466),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 91/114 (80%), Positives = 101/114 (89%), Gaps = 0/114 (0%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED DDPKNFRKTI RIM VQYKIPDYVHIS DC+HLLSRIFVA+PARRIT+KEIK+HPWF
Sbjct  201  EDVDDPKNFRKTISRIMGVQYKIPDYVHISHDCKHLLSRIFVASPARRITLKEIKNHPWF  260

Query  744  LKNLPRELTEVAQAAYYRRENPTFSLQSAEEIMKIVDEAKAPPPASRSMGGFGW  583
            LK+LP+ELTE AQA YY+R+NPTFSLQS EEIMKIV EA+ PPP SR +  FGW
Sbjct  261  LKSLPKELTESAQAVYYKRDNPTFSLQSIEEIMKIVSEARNPPPPSRPVPHFGW  314



>emb|CDY20594.1| BnaC08g14640D [Brassica napus]
Length=307

 Score =   181 bits (458),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 87/119 (73%), Positives = 99/119 (83%), Gaps = 10/119 (8%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQ----RIMSVQYKIPDYVHISQDCRHLLSRIFVANPAR-RITIKEIK  760
            ED +DPKNFRKTIQ    +IM+VQYKIP+YVHISQDC+HLLSR     P   RI I EIK
Sbjct  154  EDQEDPKNFRKTIQLGLFKIMAVQYKIPNYVHISQDCKHLLSR-----PTHSRINIAEIK  208

Query  759  SHPWFLKNLPRELTEVAQAAYYRRENPTFSLQSAEEIMKIVDEAKAPPPASRSMGGFGW  583
             HPWF+KNLPRELTE AQAAY+R+ENPTFSLQ+AEEIMKI+D+AK PP  SRS+GGFGW
Sbjct  209  KHPWFVKNLPRELTETAQAAYFRKENPTFSLQTAEEIMKILDDAKTPPHVSRSIGGFGW  267



>ref|NP_001136796.1| uncharacterized LOC100216941 [Zea mays]
 gb|ACF82654.1| unknown [Zea mays]
 gb|AFW62593.1| putative snRK/SAPK family protein kinase [Zea mays]
Length=364

 Score =   182 bits (462),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 84/116 (72%), Positives = 101/116 (87%), Gaps = 2/116 (2%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED DDPKNFRKTI RI+S+QY+IP+YVHISQDCR LL+RIFVANPA+RITI+EI++HPWF
Sbjct  201  EDPDDPKNFRKTIGRIVSIQYQIPEYVHISQDCRQLLARIFVANPAKRITIREIRNHPWF  260

Query  744  LKNLPRELTEVAQAAYYRREN--PTFSLQSAEEIMKIVDEAKAPPPASRSMGGFGW  583
            LKNLPRELTE AQA YY+++N  PTFS Q+ EEIMKIV+EA+ PP +   + GFGW
Sbjct  261  LKNLPRELTEAAQAKYYKKDNGAPTFSDQTVEEIMKIVEEARTPPQSPAPVAGFGW  316



>ref|XP_004952838.1| PREDICTED: serine/threonine-protein kinase SAPK6-like isoform 
X2 [Setaria italica]
Length=454

 Score =   184 bits (466),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 84/116 (72%), Positives = 101/116 (87%), Gaps = 2/116 (2%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED DDPKNFRKTI RI+S+QY+IP+YVHISQDCR LLSRIFVANPA+RITI+EI++HPWF
Sbjct  291  EDPDDPKNFRKTIGRIVSIQYQIPEYVHISQDCRQLLSRIFVANPAKRITIREIRNHPWF  350

Query  744  LKNLPRELTEVAQAAYYRREN--PTFSLQSAEEIMKIVDEAKAPPPASRSMGGFGW  583
            LKNLPRELTE  QA YY+++N  PTFS Q+ E+IMKIV+EA+ PP +S  + GFGW
Sbjct  351  LKNLPRELTEAVQAKYYKKDNSAPTFSDQTVEDIMKIVEEARTPPQSSTPVAGFGW  406



>gb|ACG33803.1| serine/threonine-protein kinase SAPK6 [Zea mays]
Length=364

 Score =   181 bits (460),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 83/116 (72%), Positives = 101/116 (87%), Gaps = 2/116 (2%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED DDPKNFRKTI RI+S+QY+IP+YVH+SQDCR LL+RIFVANPA+RITI+EI++HPWF
Sbjct  201  EDPDDPKNFRKTIGRIVSIQYQIPEYVHLSQDCRQLLARIFVANPAKRITIREIRNHPWF  260

Query  744  LKNLPRELTEVAQAAYYRREN--PTFSLQSAEEIMKIVDEAKAPPPASRSMGGFGW  583
            LKNLPRELTE AQA YY+++N  PTFS Q+ EEIMKIV+EA+ PP +   + GFGW
Sbjct  261  LKNLPRELTEAAQAKYYKKDNGAPTFSDQTVEEIMKIVEEARTPPQSPAPVAGFGW  316



>ref|XP_010546285.1| PREDICTED: serine/threonine-protein kinase SRK2G-like [Tarenaya 
hassleriana]
 ref|XP_010546286.1| PREDICTED: serine/threonine-protein kinase SRK2G-like [Tarenaya 
hassleriana]
Length=345

 Score =   181 bits (458),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 85/113 (75%), Positives = 97/113 (86%), Gaps = 5/113 (4%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED  D +NFRKTIQRIM+VQYKIPDYVH+SQDCRHLLSRIFVANP +RIT+KEIK+HPW+
Sbjct  201  EDPKDSRNFRKTIQRIMAVQYKIPDYVHVSQDCRHLLSRIFVANPLKRITLKEIKNHPWY  260

Query  744  LKNLPRELTEVAQAAYYRRENPTFSLQSAEEIMKIVDEAKAPPPASRSMGGFG  586
            LKNLPRELTE AQAAYYRR+N ++SLQS E+IMKIV EA+ P P      GFG
Sbjct  261  LKNLPRELTESAQAAYYRRDNSSYSLQSIEDIMKIVGEARNPAPT-----GFG  308



>ref|XP_006647363.1| PREDICTED: serine/threonine-protein kinase SAPK6-like [Oryza 
brachyantha]
Length=371

 Score =   181 bits (459),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 85/117 (73%), Positives = 100/117 (85%), Gaps = 3/117 (3%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED DDPKNFRKTI RIMS+QYKIP+YVHISQDCR LLSRIFVANP++RITI+EI++HPWF
Sbjct  201  EDPDDPKNFRKTIGRIMSIQYKIPEYVHISQDCRQLLSRIFVANPSKRITIREIRNHPWF  260

Query  744  LKNLPRELTEVAQAAYYRREN--PTFSLQSAEEIMKIVDEAKAPPPASRS-MGGFGW  583
            LKNLPRELTE  QA YY+++   PTFS Q+ EEIM  V+EAKA PP+S + + GFGW
Sbjct  261  LKNLPRELTEAVQAKYYKKDTSAPTFSDQTVEEIMTFVEEAKAAPPSSSTPVAGFGW  317



>gb|ACG50010.1| SnRK2.6 [Zea mays]
Length=364

 Score =   181 bits (458),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 83/116 (72%), Positives = 100/116 (86%), Gaps = 2/116 (2%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED DDPKNFRK I RI+S+QY+IP+YVHISQDCR LL+RIFVANPA+RITI+EI++HPWF
Sbjct  201  EDPDDPKNFRKAIGRIVSIQYQIPEYVHISQDCRQLLARIFVANPAKRITIREIRNHPWF  260

Query  744  LKNLPRELTEVAQAAYYRREN--PTFSLQSAEEIMKIVDEAKAPPPASRSMGGFGW  583
            LKNLPRELTE AQA YY+++N  PTFS Q+ EEIMKIV+EA+ PP +   + GFGW
Sbjct  261  LKNLPRELTEAAQAKYYKKDNGAPTFSDQTVEEIMKIVEEARTPPQSPAPVAGFGW  316



>ref|XP_004144372.2| PREDICTED: serine/threonine-protein kinase SRK2A-like [Cucumis 
sativus]
Length=557

 Score =   184 bits (468),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 84/114 (74%), Positives = 98/114 (86%), Gaps = 0/114 (0%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED +DP+N+RK IQRIMSVQYKIPDYV++SQDCRHLLSRIFV NP+RRI++KEIKSHPWF
Sbjct  401  EDQNDPRNYRKLIQRIMSVQYKIPDYVYVSQDCRHLLSRIFVQNPSRRISVKEIKSHPWF  460

Query  744  LKNLPRELTEVAQAAYYRRENPTFSLQSAEEIMKIVDEAKAPPPASRSMGGFGW  583
            LKNLPRELTE AQA YY  +NP+FS+QS +EIMKI+ EAK P P S +  GF W
Sbjct  461  LKNLPRELTESAQAIYYNSDNPSFSVQSFDEIMKILGEAKTPLPPSTTAKGFRW  514


 Score =   152 bits (384),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 74/113 (65%), Positives = 89/113 (79%), Gaps = 1/113 (1%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED D P+NF+K IQRI + QYKIP  V ISQ+C HLLSRIFV NP++RI++KEI SHPWF
Sbjct  77   EDQDGPRNFQKIIQRIKAAQYKIPVNVRISQECGHLLSRIFVRNPSKRISLKEILSHPWF  136

Query  744  LKNLPRELTEVAQAAYYRREN-PTFSLQSAEEIMKIVDEAKAPPPASRSMGGF  589
            LKNLPRELT+ AQA Y +R N P F+LQS EEIMKIV EA+ P P+S ++  F
Sbjct  137  LKNLPRELTQSAQAIYCQRNNTPAFTLQSIEEIMKIVGEARNPLPSSSTINSF  189



>ref|XP_010675155.1| PREDICTED: serine/threonine-protein kinase SRK2H-like [Beta vulgaris 
subsp. vulgaris]
Length=355

 Score =   180 bits (457),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 85/110 (77%), Positives = 97/110 (88%), Gaps = 1/110 (1%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED  DPKNFRKTI RIM+VQYKIP+YVHISQDC+HLLSRIF  NP RRI+IKEIKSHPWF
Sbjct  201  EDPQDPKNFRKTITRIMAVQYKIPEYVHISQDCKHLLSRIFTTNPTRRISIKEIKSHPWF  260

Query  744  LKNLPRELTEVAQAAYYRRENPTF-SLQSAEEIMKIVDEAKAPPPASRSM  598
            LKNLP+ELTE AQAAYY+R+NP+F SLQS EEIMKIV EA+ P P +R++
Sbjct  261  LKNLPKELTEPAQAAYYQRDNPSFASLQSVEEIMKIVGEARNPAPVARTV  310



>gb|KFK25224.1| hypothetical protein AALP_AA8G083600 [Arabis alpina]
Length=354

 Score =   180 bits (456),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 81/106 (76%), Positives = 97/106 (92%), Gaps = 0/106 (0%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED +DPKNFRKTIQRIM++QYKIPDYVHISQ+C+HLLSRIFV NPA+RIT+KEIK+HPW+
Sbjct  201  EDPNDPKNFRKTIQRIMAIQYKIPDYVHISQECKHLLSRIFVTNPAKRITLKEIKNHPWY  260

Query  744  LKNLPRELTEVAQAAYYRRENPTFSLQSAEEIMKIVDEAKAPPPAS  607
            LKNLP+EL E AQA YY+R+NP+FSLQS E+IMKIV+EA+ P P S
Sbjct  261  LKNLPKELLESAQAMYYKRDNPSFSLQSVEDIMKIVEEARNPAPPS  306



>dbj|BAD81709.1| serine/threonine protein kinase SAPK4-like protein [Oryza sativa 
Japonica Group]
 dbj|BAD82014.1| serine/threonine protein kinase SAPK4-like protein [Oryza sativa 
Japonica Group]
 gb|AEF00933.1| serine/threonine-protein kinase [Oryza sativa Japonica Group]
Length=168

 Score =   174 bits (442),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 83/110 (75%), Positives = 95/110 (86%), Gaps = 2/110 (2%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED DDPKN RKTIQRIMSVQYKIPDYVHIS +C+ L++RIFV NP RRIT+KEIKSHPWF
Sbjct  9    EDQDDPKNIRKTIQRIMSVQYKIPDYVHISAECKQLIARIFVNNPLRRITMKEIKSHPWF  68

Query  744  LKNLPRELTEVAQAAYYRREN--PTFSLQSAEEIMKIVDEAKAPPPASRS  601
            LKNLPRELTE AQA YYRR+N  P+FS Q++EEIMKIV EA+  P +SR+
Sbjct  69   LKNLPRELTETAQAMYYRRDNSVPSFSDQTSEEIMKIVQEARTMPKSSRT  118



>ref|XP_004952837.1| PREDICTED: serine/threonine-protein kinase SAPK6-like isoform 
X1 [Setaria italica]
Length=500

 Score =   183 bits (465),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 84/116 (72%), Positives = 101/116 (87%), Gaps = 2/116 (2%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED DDPKNFRKTI RI+S+QY+IP+YVHISQDCR LLSRIFVANPA+RITI+EI++HPWF
Sbjct  337  EDPDDPKNFRKTIGRIVSIQYQIPEYVHISQDCRQLLSRIFVANPAKRITIREIRNHPWF  396

Query  744  LKNLPRELTEVAQAAYYRREN--PTFSLQSAEEIMKIVDEAKAPPPASRSMGGFGW  583
            LKNLPRELTE  QA YY+++N  PTFS Q+ E+IMKIV+EA+ PP +S  + GFGW
Sbjct  397  LKNLPRELTEAVQAKYYKKDNSAPTFSDQTVEDIMKIVEEARTPPQSSTPVAGFGW  452



>gb|KGN54758.1| hypothetical protein Csa_4G454660 [Cucumis sativus]
Length=608

 Score =   185 bits (469),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 84/114 (74%), Positives = 98/114 (86%), Gaps = 0/114 (0%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED +DP+N+RK IQRIMSVQYKIPDYV++SQDCRHLLSRIFV NP+RRI++KEIKSHPWF
Sbjct  452  EDQNDPRNYRKLIQRIMSVQYKIPDYVYVSQDCRHLLSRIFVQNPSRRISVKEIKSHPWF  511

Query  744  LKNLPRELTEVAQAAYYRRENPTFSLQSAEEIMKIVDEAKAPPPASRSMGGFGW  583
            LKNLPRELTE AQA YY  +NP+FS+QS +EIMKI+ EAK P P S +  GF W
Sbjct  512  LKNLPRELTESAQAIYYNSDNPSFSVQSFDEIMKILGEAKTPLPPSTTAKGFRW  565


 Score =   146 bits (369),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 74/118 (63%), Positives = 89/118 (75%), Gaps = 6/118 (5%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQ-----RIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIK  760
            ED D P+NF+K IQ     RI + QYKIP  V ISQ+C HLLSRIFV NP++RI++KEI 
Sbjct  123  EDQDGPRNFQKIIQVQYSTRIKAAQYKIPVNVRISQECGHLLSRIFVRNPSKRISLKEIL  182

Query  759  SHPWFLKNLPRELTEVAQAAYYRREN-PTFSLQSAEEIMKIVDEAKAPPPASRSMGGF  589
            SHPWFLKNLPRELT+ AQA Y +R N P F+LQS EEIMKIV EA+ P P+S ++  F
Sbjct  183  SHPWFLKNLPRELTQSAQAIYCQRNNTPAFTLQSIEEIMKIVGEARNPLPSSSTINSF  240



>ref|XP_010030125.1| PREDICTED: serine/threonine-protein kinase SRK2A-like [Eucalyptus 
grandis]
 gb|KCW57091.1| hypothetical protein EUGRSUZ_I02742 [Eucalyptus grandis]
Length=373

 Score =   179 bits (455),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 92/135 (68%), Positives = 102/135 (76%), Gaps = 23/135 (17%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED +DPKNFRKTI RIM+VQYKIPDYVHISQDCRHLLSRIFVANP+RR+TI+EIKSHPWF
Sbjct  201  EDPEDPKNFRKTINRIMAVQYKIPDYVHISQDCRHLLSRIFVANPSRRVTIREIKSHPWF  260

Query  744  LKNLPRELTEVAQAAYY-------------------RRENPTFSLQSAEEIMKIVDEAK-  625
            +KNLPRELTE AQA YY                   R+ENP+FS QS  EIM+IV+EAK 
Sbjct  261  VKNLPRELTEAAQAKYYRKENISLPRESTEAAPAKLRKENPSFSSQSVGEIMRIVEEAKR  320

Query  624  -APPPASRSMGGFGW  583
             APPP SR    FGW
Sbjct  321  QAPPPHSRR--SFGW  333



>gb|ACU17548.1| unknown [Glycine max]
Length=135

 Score =   171 bits (434),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 79/98 (81%), Positives = 87/98 (89%), Gaps = 0/98 (0%)
 Frame = -1

Query  876  MSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWFLKNLPRELTEVAQAAY  697
            M+VQYKIPDYVHISQDCRHLLSRIFVANP RRI++KEIKS PWFLKNLPRELTE AQA Y
Sbjct  1    MAVQYKIPDYVHISQDCRHLLSRIFVANPLRRISLKEIKSRPWFLKNLPRELTESAQAVY  60

Query  696  YRRENPTFSLQSAEEIMKIVDEAKAPPPASRSMGGFGW  583
            Y+R NP+FS+QS EEIMKIV EA+ PPP SR + GFGW
Sbjct  61   YQRGNPSFSIQSVEEIMKIVGEARDPPPVSRPVKGFGW  98



>gb|AIZ68209.1| serine/threonine-protein kinase SAPK7-like protein [Ornithogalum 
saundersiae]
Length=358

 Score =   178 bits (452),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 83/116 (72%), Positives = 98/116 (84%), Gaps = 2/116 (2%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED DDPKNFRKTI RIMS+QYKIPD+VH+S DCR LL+RIFVANPA+RI+I+EIKSHPWF
Sbjct  201  EDPDDPKNFRKTISRIMSIQYKIPDHVHLSVDCRQLLARIFVANPAKRISIREIKSHPWF  260

Query  744  LKNLPRELTEVAQAAYYRREN--PTFSLQSAEEIMKIVDEAKAPPPASRSMGGFGW  583
            LKNLPRE+TE AQA YY R+N  PT+SLQS ++IMKIV E + P P+   + GFGW
Sbjct  261  LKNLPREMTEEAQAIYYNRDNSAPTYSLQSIDDIMKIVKEGRTPAPSITPVPGFGW  316



>ref|XP_010912491.1| PREDICTED: LOW QUALITY PROTEIN: serine/threonine-protein kinase 
SAPK7-like [Elaeis guineensis]
Length=356

 Score =   178 bits (451),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 83/112 (74%), Positives = 97/112 (87%), Gaps = 2/112 (2%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED DDPKNF+KT QRI+SVQY IP++VHISQDCR LLSRIFVANPARRITI+EI++HPWF
Sbjct  201  EDPDDPKNFKKTFQRIVSVQYTIPEFVHISQDCRQLLSRIFVANPARRITIREIRNHPWF  260

Query  744  LKNLPRELTEVAQAAYYRREN--PTFSLQSAEEIMKIVDEAKAPPPASRSMG  595
            L+NLPRELTE  QA YY+R+N  PT+SLQS EEIMKIV EA+ PPP+   +G
Sbjct  261  LRNLPRELTEAGQAVYYKRDNNAPTYSLQSVEEIMKIVKEARTPPPSFTPVG  312



>ref|XP_008783425.1| PREDICTED: serine/threonine-protein kinase SAPK7-like isoform 
X1 [Phoenix dactylifera]
Length=364

 Score =   178 bits (451),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 83/114 (73%), Positives = 99/114 (87%), Gaps = 2/114 (2%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED +DP+N RKTIQ++MSVQYKIPDYVHIS+DCR L++R+FVANPARRI I+EIK+HPWF
Sbjct  201  EDQNDPRNLRKTIQKVMSVQYKIPDYVHISRDCRQLIARLFVANPARRIPIREIKNHPWF  260

Query  744  LKNLPRELTEVAQAAYYRREN--PTFSLQSAEEIMKIVDEAKAPPPASRSMGGF  589
            LKNLPRELTE AQAAYYRR+   PT+S+QS E+IM IV EA+ P  ASRS+ GF
Sbjct  261  LKNLPRELTESAQAAYYRRDRNAPTYSIQSIEDIMNIVGEARTPAQASRSIPGF  314



>ref|XP_009404984.1| PREDICTED: serine/threonine-protein kinase SAPK7-like [Musa acuminata 
subsp. malaccensis]
Length=358

 Score =   177 bits (449),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 84/116 (72%), Positives = 96/116 (83%), Gaps = 2/116 (2%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED +DPKN RKTI+RIMSVQYKIPDYVHISQDCR L+SRIF ANP RRI ++EI++HPWF
Sbjct  201  EDQNDPKNIRKTIRRIMSVQYKIPDYVHISQDCRQLISRIFDANPMRRIKMREIRTHPWF  260

Query  744  LKNLPRELTEVAQAAYYRREN--PTFSLQSAEEIMKIVDEAKAPPPASRSMGGFGW  583
            LKNLPRELTE AQA YYRR+N  P FS QS +EI KI+ EA+  P  SRS+ GFGW
Sbjct  261  LKNLPRELTEAAQAVYYRRDNSIPPFSTQSIDEIRKILTEARTLPKPSRSISGFGW  316



>ref|XP_006645084.1| PREDICTED: serine/threonine-protein kinase SAPK4-like [Oryza 
brachyantha]
Length=360

 Score =   176 bits (445),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 84/110 (76%), Positives = 95/110 (86%), Gaps = 2/110 (2%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED DDPKN RKTIQRIMSVQYKIPDYVHIS +CR L++RIFV NP RRIT+KEIKSHPWF
Sbjct  201  EDQDDPKNIRKTIQRIMSVQYKIPDYVHISAECRQLIARIFVNNPLRRITMKEIKSHPWF  260

Query  744  LKNLPRELTEVAQAAYYRREN--PTFSLQSAEEIMKIVDEAKAPPPASRS  601
            LKNLPRELTE AQA YYRR+N  P+FS Q++EEIMKIV EA+  P +SR+
Sbjct  261  LKNLPRELTETAQAMYYRRDNSVPSFSDQTSEEIMKIVQEARTMPKSSRT  310



>gb|AGT17340.1| serine/threonine-protein kinase [Saccharum hybrid cultivar R570]
Length=361

 Score =   175 bits (443),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 84/116 (72%), Positives = 98/116 (84%), Gaps = 4/116 (3%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED DDPKN RKTIQ+IM VQYKIPDYVHIS +C+ LL+RIFVANP RRIT+KEIKSHPWF
Sbjct  201  EDPDDPKNIRKTIQQIMQVQYKIPDYVHISTECQQLLARIFVANPMRRITMKEIKSHPWF  260

Query  744  LKNLPRELTEVAQAAYYRREN--PTFSLQSAEEIMKIVDEAKAPPPASRSMGGFGW  583
            LKNLPRELTE AQ  YYRR+N  P++S Q++EEIMKIV +A+  P +SRS  G+GW
Sbjct  261  LKNLPRELTETAQGMYYRRDNRVPSYSDQTSEEIMKIVQDARTMPKSSRS--GYGW  314



>ref|XP_006399366.1| hypothetical protein EUTSA_v10013967mg [Eutrema salsugineum]
 gb|ESQ40819.1| hypothetical protein EUTSA_v10013967mg [Eutrema salsugineum]
Length=353

 Score =   174 bits (442),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 78/104 (75%), Positives = 94/104 (90%), Gaps = 0/104 (0%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED +DPKNFRKTIQRIM++QYKIPDYVHISQ+C+HLLSRIFV NPA+RIT+KEIK+HPW+
Sbjct  201  EDPNDPKNFRKTIQRIMAIQYKIPDYVHISQECKHLLSRIFVTNPAKRITLKEIKNHPWY  260

Query  744  LKNLPRELTEVAQAAYYRRENPTFSLQSAEEIMKIVDEAKAPPP  613
            LKNLP+EL E AQA YY+R+N ++SLQS E+IMKIV EA+ P P
Sbjct  261  LKNLPKELIESAQAVYYKRDNTSYSLQSIEDIMKIVGEARNPAP  304



>ref|NP_001044930.1| Os01g0869900 [Oryza sativa Japonica Group]
 sp|Q5N942.2|SAPK4_ORYSJ RecName: Full=Serine/threonine-protein kinase SAPK4; AltName: 
Full=Osmotic stress/abscisic acid-activated protein kinase 
4 [Oryza sativa Japonica Group]
 dbj|BAB64101.1| serine/threonine protein kinase SAPK4 [Oryza sativa Japonica 
Group]
 dbj|BAB89813.1| serine/threonine protein kinase SAPK4 [Oryza sativa Japonica 
Group]
 dbj|BAD18000.1| serine/threonine protein kinase SAPK4 [Oryza sativa Japonica 
Group]
 dbj|BAF06844.1| Os01g0869900 [Oryza sativa Japonica Group]
 gb|EAY76636.1| hypothetical protein OsI_04590 [Oryza sativa Indica Group]
 gb|EAZ14302.1| hypothetical protein OsJ_04228 [Oryza sativa Japonica Group]
Length=360

 Score =   174 bits (441),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 83/110 (75%), Positives = 95/110 (86%), Gaps = 2/110 (2%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED DDPKN RKTIQRIMSVQYKIPDYVHIS +C+ L++RIFV NP RRIT+KEIKSHPWF
Sbjct  201  EDQDDPKNIRKTIQRIMSVQYKIPDYVHISAECKQLIARIFVNNPLRRITMKEIKSHPWF  260

Query  744  LKNLPRELTEVAQAAYYRREN--PTFSLQSAEEIMKIVDEAKAPPPASRS  601
            LKNLPRELTE AQA YYRR+N  P+FS Q++EEIMKIV EA+  P +SR+
Sbjct  261  LKNLPRELTETAQAMYYRRDNSVPSFSDQTSEEIMKIVQEARTMPKSSRT  310



>gb|ABD72268.1| serine kinase [Oryza sativa Indica Group]
Length=360

 Score =   174 bits (441),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 83/110 (75%), Positives = 95/110 (86%), Gaps = 2/110 (2%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED DDPKN RKTIQRIMSVQYKIPDYVHIS +C+ L++RIFV NP RRIT+KEIKSHPWF
Sbjct  201  EDQDDPKNIRKTIQRIMSVQYKIPDYVHISAECKQLIARIFVNNPLRRITMKEIKSHPWF  260

Query  744  LKNLPRELTEVAQAAYYRREN--PTFSLQSAEEIMKIVDEAKAPPPASRS  601
            LKNLPRELTE AQA YYRR+N  P+FS Q++EEIMKIV EA+  P +SR+
Sbjct  261  LKNLPRELTETAQAMYYRRDNSVPSFSDQTSEEIMKIVQEARTMPKSSRT  310



>ref|XP_008657021.1| PREDICTED: serine/threonine-protein kinase SAPK4-like [Zea mays]
 gb|AFW84448.1| putative snRK/SAPK family protein kinase [Zea mays]
Length=355

 Score =   174 bits (440),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 83/116 (72%), Positives = 98/116 (84%), Gaps = 4/116 (3%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED DDPKN RKTIQ+IM VQYKIPDYVHIS +C+ L++RIFVANP RRIT+KEIKSHPWF
Sbjct  201  EDPDDPKNIRKTIQQIMQVQYKIPDYVHISTECQQLIARIFVANPVRRITMKEIKSHPWF  260

Query  744  LKNLPRELTEVAQAAYYRREN--PTFSLQSAEEIMKIVDEAKAPPPASRSMGGFGW  583
            LKNLPRELTE AQ  YYRR+N  P++S Q++EEIMKIV +A+  P +SRS  G+GW
Sbjct  261  LKNLPRELTETAQGMYYRRDNKVPSYSDQTSEEIMKIVRDARTMPKSSRS--GYGW  314



>ref|XP_010491506.1| PREDICTED: serine/threonine-protein kinase SRK2G-like [Camelina 
sativa]
Length=354

 Score =   172 bits (437),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 82/113 (73%), Positives = 96/113 (85%), Gaps = 1/113 (1%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED +DPKNFRKTIQRIM+VQYKIPDYVHISQ+C+HLLSRIFV N A+RIT+KEIK+HPW+
Sbjct  201  EDPNDPKNFRKTIQRIMAVQYKIPDYVHISQECKHLLSRIFVTNSAKRITLKEIKNHPWY  260

Query  744  LKNLPRELTEVAQAAYYRRENPTFSLQSAEEIMKIVDEAKAPPPASRSMGGFG  586
            LKNLP+EL E AQAAYY+R+  +FSLQS E+IMKIV EA+ P P S    G G
Sbjct  261  LKNLPKELLESAQAAYYKRDT-SFSLQSVEDIMKIVGEARNPAPPSVKSSGSG  312



>gb|AFW84447.1| putative snRK/SAPK family protein kinase [Zea mays]
Length=421

 Score =   174 bits (441),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 83/116 (72%), Positives = 98/116 (84%), Gaps = 4/116 (3%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED DDPKN RKTIQ+IM VQYKIPDYVHIS +C+ L++RIFVANP RRIT+KEIKSHPWF
Sbjct  170  EDPDDPKNIRKTIQQIMQVQYKIPDYVHISTECQQLIARIFVANPVRRITMKEIKSHPWF  229

Query  744  LKNLPRELTEVAQAAYYRREN--PTFSLQSAEEIMKIVDEAKAPPPASRSMGGFGW  583
            LKNLPRELTE AQ  YYRR+N  P++S Q++EEIMKIV +A+  P +SRS  G+GW
Sbjct  230  LKNLPRELTETAQGMYYRRDNKVPSYSDQTSEEIMKIVRDARTMPKSSRS--GYGW  283



>ref|XP_010423046.1| PREDICTED: serine/threonine-protein kinase SRK2G [Camelina sativa]
Length=354

 Score =   172 bits (437),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 82/113 (73%), Positives = 96/113 (85%), Gaps = 1/113 (1%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED +DPKNFRKTIQRIM+VQYKIPDYVHISQ+C+HLLSRIFV N A+RIT+KEIK+HPW+
Sbjct  201  EDPNDPKNFRKTIQRIMAVQYKIPDYVHISQECKHLLSRIFVTNSAKRITLKEIKNHPWY  260

Query  744  LKNLPRELTEVAQAAYYRRENPTFSLQSAEEIMKIVDEAKAPPPASRSMGGFG  586
            LKNLP+EL E AQAAYY+R+  +FSLQS E+IMKIV EA+ P P S    G G
Sbjct  261  LKNLPKELLESAQAAYYKRDT-SFSLQSVEDIMKIVGEARNPAPPSVKSSGSG  312



>ref|XP_010452877.1| PREDICTED: serine/threonine-protein kinase SRK2G-like [Camelina 
sativa]
Length=356

 Score =   172 bits (437),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 82/113 (73%), Positives = 96/113 (85%), Gaps = 1/113 (1%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED +DPKNFRKTIQRIM+VQYKIPDYVHISQ+C+HLLSRIFV N A+RIT+KEIK+HPW+
Sbjct  201  EDPNDPKNFRKTIQRIMAVQYKIPDYVHISQECKHLLSRIFVTNSAKRITLKEIKNHPWY  260

Query  744  LKNLPRELTEVAQAAYYRRENPTFSLQSAEEIMKIVDEAKAPPPASRSMGGFG  586
            LKNLP+EL E AQAAYY+R+  +FSLQS E+IMKIV EA+ P P S    G G
Sbjct  261  LKNLPKELLESAQAAYYKRDT-SFSLQSVEDIMKIVGEARNPAPPSVKSSGSG  312



>emb|CDX69936.1| BnaA10g22850D [Brassica napus]
Length=367

 Score =   172 bits (437),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 77/102 (75%), Positives = 93/102 (91%), Gaps = 0/102 (0%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED +DPKNFRKTIQRIM++QYKIPDYVHISQ+C+HLLSRIFV NPA+RIT+KEIK+HPW+
Sbjct  204  EDPNDPKNFRKTIQRIMAIQYKIPDYVHISQECKHLLSRIFVTNPAKRITLKEIKNHPWY  263

Query  744  LKNLPRELTEVAQAAYYRRENPTFSLQSAEEIMKIVDEAKAP  619
            LKNLP+EL E AQA YY+R+N ++SLQS E+IMKIV EA+ P
Sbjct  264  LKNLPKELLESAQAVYYKRDNTSYSLQSVEDIMKIVGEARNP  305



>ref|XP_009122476.1| PREDICTED: serine/threonine-protein kinase SRK2G [Brassica rapa]
Length=364

 Score =   172 bits (437),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 77/102 (75%), Positives = 93/102 (91%), Gaps = 0/102 (0%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED +DPKNFRKTIQRIM++QYKIPDYVHISQ+C+HLLSRIFV NPA+RIT+KEIK+HPW+
Sbjct  201  EDPNDPKNFRKTIQRIMAIQYKIPDYVHISQECKHLLSRIFVTNPAKRITLKEIKNHPWY  260

Query  744  LKNLPRELTEVAQAAYYRRENPTFSLQSAEEIMKIVDEAKAP  619
            LKNLP+EL E AQA YY+R+N ++SLQS E+IMKIV EA+ P
Sbjct  261  LKNLPKELLESAQAVYYKRDNTSYSLQSVEDIMKIVGEARNP  302



>ref|XP_009131093.1| PREDICTED: serine/threonine-protein kinase SRK2G [Brassica rapa]
Length=360

 Score =   172 bits (436),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 77/102 (75%), Positives = 93/102 (91%), Gaps = 0/102 (0%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED +DPKNFRKTIQRIM++QYKIPDYVHISQ+C+HLLSRIFV NPA+RIT+KEIK+HPW+
Sbjct  201  EDPNDPKNFRKTIQRIMAIQYKIPDYVHISQECKHLLSRIFVTNPAKRITLKEIKNHPWY  260

Query  744  LKNLPRELTEVAQAAYYRRENPTFSLQSAEEIMKIVDEAKAP  619
            LKNLP+EL E AQA YY+R+N ++SLQS E+IMKIV EA+ P
Sbjct  261  LKNLPKELVESAQAVYYKRDNTSYSLQSIEDIMKIVGEARNP  302



>ref|NP_196476.1| serine/threonine-protein kinase SRK2G [Arabidopsis thaliana]
 sp|P43292.2|SRK2G_ARATH RecName: Full=Serine/threonine-protein kinase SRK2G; AltName: 
Full=Arabidopsis protein SK1; AltName: Full=OST1-kinase-like 
8; AltName: Full=SNF1-related kinase 2.1; Short=SnRK2.1 [Arabidopsis 
thaliana]
 dbj|BAB10008.1| serine/threonine-protein kinase [Arabidopsis thaliana]
 gb|ABD85157.1| At5g08590 [Arabidopsis thaliana]
 gb|AED91326.1| serine/threonine-protein kinase SRK2G [Arabidopsis thaliana]
Length=353

 Score =   172 bits (436),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 80/113 (71%), Positives = 98/113 (87%), Gaps = 1/113 (1%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED +DPKNFRKTIQRIM+VQYKIPDYVHISQ+C+HLLSRIFV N A+RIT+KEIK+HPW+
Sbjct  201  EDPNDPKNFRKTIQRIMAVQYKIPDYVHISQECKHLLSRIFVTNSAKRITLKEIKNHPWY  260

Query  744  LKNLPRELTEVAQAAYYRRENPTFSLQSAEEIMKIVDEAKAPPPASRSMGGFG  586
            LKNLP+EL E AQAAYY+R+  +FSLQS E+IMKIV EA+ P P++ ++   G
Sbjct  261  LKNLPKELLESAQAAYYKRDT-SFSLQSVEDIMKIVGEARNPAPSTSAVKSSG  312



>emb|CAA78106.1| protein kinase [Arabidopsis thaliana]
Length=353

 Score =   172 bits (436),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 80/113 (71%), Positives = 98/113 (87%), Gaps = 1/113 (1%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED +DPKNFRKTIQRIM+VQYKIPDYVHISQ+C+HLLSRIFV N A+RIT+KEIK+HPW+
Sbjct  201  EDPNDPKNFRKTIQRIMAVQYKIPDYVHISQECKHLLSRIFVTNSAKRITLKEIKNHPWY  260

Query  744  LKNLPRELTEVAQAAYYRRENPTFSLQSAEEIMKIVDEAKAPPPASRSMGGFG  586
            LKNLP+EL E AQAAYY+R+  +FSLQS E+IMKIV EA+ P P++ ++   G
Sbjct  261  LKNLPKELLESAQAAYYKRDT-SFSLQSVEDIMKIVGEARNPAPSTSAVKSSG  312



>emb|CDX78346.1| BnaA03g02580D [Brassica napus]
Length=370

 Score =   172 bits (436),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 77/102 (75%), Positives = 93/102 (91%), Gaps = 0/102 (0%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED +DPKNFRKTIQRIM++QYKIPDYVHISQ+C+HLLSRIFV NPA+RIT+KEIK+HPW+
Sbjct  211  EDPNDPKNFRKTIQRIMAIQYKIPDYVHISQECKHLLSRIFVTNPAKRITLKEIKNHPWY  270

Query  744  LKNLPRELTEVAQAAYYRRENPTFSLQSAEEIMKIVDEAKAP  619
            LKNLP+EL E AQA YY+R+N ++SLQS E+IMKIV EA+ P
Sbjct  271  LKNLPKELVESAQAVYYKRDNTSYSLQSIEDIMKIVGEARNP  312



>ref|XP_009420573.1| PREDICTED: serine/threonine-protein kinase SAPK7-like [Musa acuminata 
subsp. malaccensis]
Length=371

 Score =   172 bits (436),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 82/117 (70%), Positives = 99/117 (85%), Gaps = 3/117 (3%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED DDPKNFRKT+ RI+SVQY+IP+YVHISQDCR L+SRIFVA+P++RIT++EI++HPWF
Sbjct  201  EDPDDPKNFRKTMARIVSVQYRIPEYVHISQDCRQLISRIFVADPSKRITVREIRNHPWF  260

Query  744  LKNLPRELTEVAQAAYYRRE--NPTFSLQSAEEIMKIVDEAKAPPPASR-SMGGFGW  583
            LKNLPR LTEVAQA YY+R+     +SLQS EEIMKIV+EA+ PP AS  S  G GW
Sbjct  261  LKNLPRGLTEVAQAMYYKRDASGLAYSLQSEEEIMKIVEEARIPPAASTPSTAGSGW  317



>emb|CDY21553.1| BnaC09g47390D [Brassica napus]
Length=377

 Score =   172 bits (436),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 77/102 (75%), Positives = 93/102 (91%), Gaps = 0/102 (0%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED +DPKNFRKTIQRIM++QYKIPDYVHISQ+C+HLLSRIFV NPA+RIT+KEIK+HPW+
Sbjct  214  EDPNDPKNFRKTIQRIMAIQYKIPDYVHISQECKHLLSRIFVTNPAKRITLKEIKNHPWY  273

Query  744  LKNLPRELTEVAQAAYYRRENPTFSLQSAEEIMKIVDEAKAP  619
            LKNLP+EL E AQA YY+R+N ++SLQS E+IMKIV EA+ P
Sbjct  274  LKNLPKELLESAQAVYYKRDNTSYSLQSVEDIMKIVGEARNP  315



>ref|XP_002871349.1| hypothetical protein ARALYDRAFT_908839 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47608.1| hypothetical protein ARALYDRAFT_908839 [Arabidopsis lyrata subsp. 
lyrata]
Length=351

 Score =   171 bits (434),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 80/113 (71%), Positives = 98/113 (87%), Gaps = 1/113 (1%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED +DPKNFRKTIQRIM+VQYKIPDYVHISQ+C+HLLSRIFV N A+RIT+KEIK+HPW+
Sbjct  201  EDPNDPKNFRKTIQRIMAVQYKIPDYVHISQECKHLLSRIFVTNSAKRITLKEIKNHPWY  260

Query  744  LKNLPRELTEVAQAAYYRRENPTFSLQSAEEIMKIVDEAKAPPPASRSMGGFG  586
            LKNLP+EL E AQAAYY+R+  +FSLQS E+IMKIV EA+ P P++ ++   G
Sbjct  261  LKNLPKELLESAQAAYYKRDT-SFSLQSVEDIMKIVGEARNPAPSTSAVKSSG  312



>ref|NP_001183943.1| SnRK2.4 [Zea mays]
 gb|ACG50008.1| SnRK2.4 [Zea mays]
Length=361

 Score =   171 bits (433),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 81/116 (70%), Positives = 98/116 (84%), Gaps = 4/116 (3%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED DDPKN RKTIQ+IM VQYKIPD+VHIS +C+ L++RIFVANP RRIT+KEIKSHPWF
Sbjct  201  EDPDDPKNIRKTIQQIMQVQYKIPDHVHISTECQQLIARIFVANPMRRITMKEIKSHPWF  260

Query  744  LKNLPRELTEVAQAAYYRREN--PTFSLQSAEEIMKIVDEAKAPPPASRSMGGFGW  583
            LKNLPRELTE AQ  YYRR+N  P++S Q++EE+MKIV +A+  P +SRS  G+GW
Sbjct  261  LKNLPRELTETAQGMYYRRDNRVPSYSDQTSEEVMKIVQDARTMPKSSRS--GYGW  314



>ref|XP_006288057.1| hypothetical protein CARUB_v10001287mg [Capsella rubella]
 gb|EOA20955.1| hypothetical protein CARUB_v10001287mg [Capsella rubella]
Length=354

 Score =   171 bits (432),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 80/113 (71%), Positives = 97/113 (86%), Gaps = 1/113 (1%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED +DPKNFRKTIQRIM+VQYKIPDYVHISQ+C+HLLSRIFV N A+RIT+KEIK+HPW+
Sbjct  201  EDPNDPKNFRKTIQRIMAVQYKIPDYVHISQECKHLLSRIFVTNSAKRITLKEIKNHPWY  260

Query  744  LKNLPRELTEVAQAAYYRRENPTFSLQSAEEIMKIVDEAKAPPPASRSMGGFG  586
            LKNLP+EL E AQAAYY+R+  +FSLQS E+IMKIV EA+ P P + ++   G
Sbjct  261  LKNLPKELLESAQAAYYKRDT-SFSLQSVEDIMKIVGEARNPAPPTSAVKSSG  312



>emb|CDX81116.1| BnaC03g03700D [Brassica napus]
Length=370

 Score =   171 bits (432),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 76/102 (75%), Positives = 92/102 (90%), Gaps = 0/102 (0%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED +DPKNFRKTIQRIM++QYKIPDYVHISQ+C+HLLSRIFV NPA+RIT+KEIK+HPW+
Sbjct  209  EDPNDPKNFRKTIQRIMAIQYKIPDYVHISQECKHLLSRIFVTNPAKRITLKEIKNHPWY  268

Query  744  LKNLPRELTEVAQAAYYRRENPTFSLQSAEEIMKIVDEAKAP  619
            LKNLP+EL E AQA YY+R+N ++SLQS E+IMK V EA+ P
Sbjct  269  LKNLPKELVESAQAVYYKRDNTSYSLQSIEDIMKTVGEARNP  310



>ref|XP_009384226.1| PREDICTED: serine/threonine-protein kinase SAPK7-like [Musa acuminata 
subsp. malaccensis]
Length=357

 Score =   170 bits (431),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 81/113 (72%), Positives = 94/113 (83%), Gaps = 2/113 (2%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED  DPKNFRKTI RIMSVQYKIPDYVHISQDC+ L+SRIFVANP +RITI+EIKSHPWF
Sbjct  201  EDQKDPKNFRKTIGRIMSVQYKIPDYVHISQDCKQLISRIFVANPMKRITIREIKSHPWF  260

Query  744  LKNLPRELTEVAQAAYYRREN--PTFSLQSAEEIMKIVDEAKAPPPASRSMGG  592
            LKNLPRELTE AQA +YR++N  PT+S Q  +EIMKI+ EA+ P   S+ + G
Sbjct  261  LKNLPRELTEAAQAVFYRKDNNTPTYSTQKVDEIMKILTEARTPRKPSQPVPG  313



>tpg|DAA56626.1| TPA: putative snRK/SAPK family protein kinase [Zea mays]
Length=361

 Score =   170 bits (430),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 81/116 (70%), Positives = 97/116 (84%), Gaps = 4/116 (3%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED DDPKN R TIQ+IM VQYKIPD+VHIS +C+ L++RIFVANP RRIT+KEIKSHPWF
Sbjct  201  EDPDDPKNIRNTIQQIMQVQYKIPDHVHISTECQQLIARIFVANPMRRITMKEIKSHPWF  260

Query  744  LKNLPRELTEVAQAAYYRREN--PTFSLQSAEEIMKIVDEAKAPPPASRSMGGFGW  583
            LKNLPRELTE AQ  YYRR+N  P++S Q++EEIMKIV +A+  P +SRS  G+GW
Sbjct  261  LKNLPRELTETAQGMYYRRDNRVPSYSDQTSEEIMKIVQDARTMPKSSRS--GYGW  314



>ref|NP_001170331.1| uncharacterized protein LOC100384302 [Zea mays]
 gb|ACN36644.1| unknown [Zea mays]
Length=361

 Score =   170 bits (430),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 81/116 (70%), Positives = 97/116 (84%), Gaps = 4/116 (3%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED DDPKN R TIQ+IM VQYKIPD+VHIS +C+ L++RIFVANP RRIT+KEIKSHPWF
Sbjct  201  EDPDDPKNIRNTIQQIMQVQYKIPDHVHISTECQQLIARIFVANPMRRITMKEIKSHPWF  260

Query  744  LKNLPRELTEVAQAAYYRREN--PTFSLQSAEEIMKIVDEAKAPPPASRSMGGFGW  583
            LKNLPRELTE AQ  YYRR+N  P++S Q++EEIMKIV +A+  P +SRS  G+GW
Sbjct  261  LKNLPRELTETAQGMYYRRDNRVPSYSDQTSEEIMKIVQDARTMPKSSRS--GYGW  314



>ref|XP_008673283.1| PREDICTED: uncharacterized protein LOC100384302 isoform X1 [Zea 
mays]
 tpg|DAA56627.1| TPA: putative snRK/SAPK family protein kinase [Zea mays]
Length=367

 Score =   169 bits (429),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 81/116 (70%), Positives = 97/116 (84%), Gaps = 4/116 (3%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED DDPKN R TIQ+IM VQYKIPD+VHIS +C+ L++RIFVANP RRIT+KEIKSHPWF
Sbjct  207  EDPDDPKNIRNTIQQIMQVQYKIPDHVHISTECQQLIARIFVANPMRRITMKEIKSHPWF  266

Query  744  LKNLPRELTEVAQAAYYRREN--PTFSLQSAEEIMKIVDEAKAPPPASRSMGGFGW  583
            LKNLPRELTE AQ  YYRR+N  P++S Q++EEIMKIV +A+  P +SRS  G+GW
Sbjct  267  LKNLPRELTETAQGMYYRRDNRVPSYSDQTSEEIMKIVQDARTMPKSSRS--GYGW  320



>gb|AGT16857.1| serine kinase [Saccharum hybrid cultivar R570]
 gb|AGT17369.1| SNF1-type serine-threonine protein kinase [Saccharum hybrid cultivar 
R570]
Length=361

 Score =   169 bits (429),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 82/116 (71%), Positives = 96/116 (83%), Gaps = 4/116 (3%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED DDPKN RKTIQ+IM VQYKIPDYVHIS +C+ LL+RIFVANP RRI +KEIKSHPWF
Sbjct  201  EDPDDPKNIRKTIQQIMQVQYKIPDYVHISTECQQLLARIFVANPMRRIIMKEIKSHPWF  260

Query  744  LKNLPRELTEVAQAAYYRREN--PTFSLQSAEEIMKIVDEAKAPPPASRSMGGFGW  583
            LKNLPRELTE AQ  YYRR+N  P++S Q++EEIMKIV +A+    +SRS  G+GW
Sbjct  261  LKNLPRELTETAQGMYYRRDNRVPSYSDQTSEEIMKIVQDARTMLKSSRS--GYGW  314



>ref|XP_003564710.2| PREDICTED: serine/threonine-protein kinase SAPK4 [Brachypodium 
distachyon]
Length=391

 Score =   170 bits (430),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 81/116 (70%), Positives = 95/116 (82%), Gaps = 4/116 (3%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED DDPKN RKTIQRIMSVQY IPD+VHIS +CR L++RIFV +P RRIT+KEIKSHPWF
Sbjct  231  EDQDDPKNIRKTIQRIMSVQYNIPDHVHISTECRQLMARIFVNSPGRRITMKEIKSHPWF  290

Query  744  LKNLPRELTEVAQAAYYRREN--PTFSLQSAEEIMKIVDEAKAPPPASRSMGGFGW  583
            L+NLPRELTE  QA YYRR+N  P+FS Q++EEIMKIV EA+  P +SR    +GW
Sbjct  291  LRNLPRELTEAMQAMYYRRDNTVPSFSEQTSEEIMKIVQEARTMPKSSRP--SYGW  344



>gb|ACU65228.1| SNF1-type serine-threonine protein kinase [Triticum aestivum]
Length=363

 Score =   168 bits (425),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 80/115 (70%), Positives = 96/115 (83%), Gaps = 2/115 (2%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED DDPKN RKTIQRIMSVQY IPD+VHIS +CR L++RIFV  P++RIT++EIKSHPWF
Sbjct  201  EDQDDPKNIRKTIQRIMSVQYTIPDHVHISMECRQLMARIFVNVPSKRITMREIKSHPWF  260

Query  744  LKNLPRELTEVAQAAYYRREN--PTFSLQSAEEIMKIVDEAKAPPPASRSMGGFG  586
            LKNLPRELTE AQA Y+RR+N  P+FS Q++EEIMKIV EA+  P +SR   G+G
Sbjct  261  LKNLPRELTETAQAMYFRRDNAVPSFSEQTSEEIMKIVQEARTMPKSSRPSYGWG  315



>ref|XP_009399177.1| PREDICTED: serine/threonine-protein kinase SAPK7-like [Musa acuminata 
subsp. malaccensis]
Length=348

 Score =   167 bits (422),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 81/114 (71%), Positives = 93/114 (82%), Gaps = 3/114 (3%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED  DPKNFRK I RIMSVQYKIPD+VHISQDC+ L+SRIFVANP +R+TI+EIKSHPWF
Sbjct  201  EDQRDPKNFRKAIGRIMSVQYKIPDHVHISQDCKQLISRIFVANPMKRLTIREIKSHPWF  260

Query  744  LKNLPRELTEVAQAAYYRREN---PTFSLQSAEEIMKIVDEAKAPPPASRSMGG  592
            LKNLPRELTE AQA YYRR+N   PT+S QS +EIM I+ EA+A    SR + G
Sbjct  261  LKNLPRELTETAQALYYRRDNNAPPTYSTQSVDEIMNILTEARAHRKLSRPILG  314



>emb|CDM85167.1| unnamed protein product [Triticum aestivum]
Length=363

 Score =   167 bits (422),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 79/115 (69%), Positives = 96/115 (83%), Gaps = 2/115 (2%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED DDPKN RKTIQRIMSVQY IPD+VHIS +CR L++RIFV  P++RIT++EIK+HPWF
Sbjct  201  EDQDDPKNIRKTIQRIMSVQYTIPDHVHISMECRQLMARIFVNVPSKRITMREIKNHPWF  260

Query  744  LKNLPRELTEVAQAAYYRREN--PTFSLQSAEEIMKIVDEAKAPPPASRSMGGFG  586
            LKNLPRELTE AQA Y+RR+N  P+FS Q++EEIMKIV EA+  P +SR   G+G
Sbjct  261  LKNLPRELTETAQAMYFRRDNAVPSFSEQTSEEIMKIVQEARTMPKSSRPSYGWG  315



>ref|XP_004961968.1| PREDICTED: serine/threonine-protein kinase SAPK4-like [Setaria 
italica]
Length=360

 Score =   166 bits (421),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 79/116 (68%), Positives = 95/116 (82%), Gaps = 4/116 (3%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED DDPKN RKTIQRI ++QYKIPD +HIS +CR L+SRIFV+NP RRIT++EIKSHPWF
Sbjct  201  EDQDDPKNIRKTIQRIAAIQYKIPDNIHISDECRELISRIFVSNPLRRITMREIKSHPWF  260

Query  744  LKNLPRELTEVAQAAYYRREN--PTFSLQSAEEIMKIVDEAKAPPPASRSMGGFGW  583
            LKNLPRELTE  Q +Y+RR+N  P FS Q+ EEIMKIV EA+  P +SRS  G+G+
Sbjct  261  LKNLPRELTEAVQLSYFRRDNTVPAFSDQTTEEIMKIVKEARTMPKSSRS--GYGY  314



>ref|XP_009403694.1| PREDICTED: serine/threonine-protein kinase SAPK7-like isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=360

 Score =   166 bits (420),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 78/116 (67%), Positives = 94/116 (81%), Gaps = 2/116 (2%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED +D KNFRKT+ RIMSVQY IP+YVHIS+DCR LLS IF+A+P++RITI+EI+ HPWF
Sbjct  202  EDPEDTKNFRKTMTRIMSVQYTIPEYVHISKDCRQLLSGIFMADPSKRITIREIRHHPWF  261

Query  744  LKNLPRELTEVAQAAYYRREN--PTFSLQSAEEIMKIVDEAKAPPPASRSMGGFGW  583
            LKNLPR LTE AQA YY+R+N  PTFSLQS +EIMKIV+EA+  P +     GF W
Sbjct  262  LKNLPRSLTEAAQAIYYKRDNTAPTFSLQSVDEIMKIVEEARITPGSPAPAAGFAW  317



>ref|XP_009403693.1| PREDICTED: serine/threonine-protein kinase SAPK7-like isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=365

 Score =   166 bits (420),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 78/116 (67%), Positives = 94/116 (81%), Gaps = 2/116 (2%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED +D KNFRKT+ RIMSVQY IP+YVHIS+DCR LLS IF+A+P++RITI+EI+ HPWF
Sbjct  207  EDPEDTKNFRKTMTRIMSVQYTIPEYVHISKDCRQLLSGIFMADPSKRITIREIRHHPWF  266

Query  744  LKNLPRELTEVAQAAYYRREN--PTFSLQSAEEIMKIVDEAKAPPPASRSMGGFGW  583
            LKNLPR LTE AQA YY+R+N  PTFSLQS +EIMKIV+EA+  P +     GF W
Sbjct  267  LKNLPRSLTEAAQAIYYKRDNTAPTFSLQSVDEIMKIVEEARITPGSPAPAAGFAW  322



>gb|AHY82614.1| SNF1-type serine-threonine protein kinase [Hordeum vulgare subsp. 
vulgare]
Length=362

 Score =   166 bits (420),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 79/115 (69%), Positives = 94/115 (82%), Gaps = 2/115 (2%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED DDPKN RKTIQRIMSVQY IPD+VHIS +CR L++ IFV  P++RIT++EIKSHPWF
Sbjct  201  EDQDDPKNIRKTIQRIMSVQYTIPDHVHISTECRQLMASIFVNVPSKRITMREIKSHPWF  260

Query  744  LKNLPRELTEVAQAAYYRREN--PTFSLQSAEEIMKIVDEAKAPPPASRSMGGFG  586
            LKNLPRELTE AQ  YYRR+N  P+FS Q++EEIMKIV EA+  P +SR   G+G
Sbjct  261  LKNLPRELTETAQGMYYRRDNAVPSFSEQTSEEIMKIVQEARTMPKSSRPSYGWG  315



>ref|XP_004959953.1| PREDICTED: serine/threonine-protein kinase SAPK5-like isoform 
X2 [Setaria italica]
Length=380

 Score =   166 bits (420),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 83/133 (62%), Positives = 94/133 (71%), Gaps = 19/133 (14%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED  DPKNFRKTI RIMSVQYKIP+YVH+SQ+CRHLLSRIFVANP +RIT+ EIKSHPWF
Sbjct  201  EDPKDPKNFRKTISRIMSVQYKIPEYVHVSQNCRHLLSRIFVANPYKRITMSEIKSHPWF  260

Query  744  LKNLPRELTEVAQAAYYRREN-------------------PTFSLQSAEEIMKIVDEAKA  622
            LKNLPREL E AQAAYY R                      TFS QS E+IM+IV EA+ 
Sbjct  261  LKNLPRELKEEAQAAYYSRRGGGDASAGAGGSATSNNAPAATFSAQSVEDIMRIVQEAQT  320

Query  621  PPPASRSMGGFGW  583
             P  +R + G+GW
Sbjct  321  VPRPARPVAGYGW  333



>ref|XP_010547867.1| PREDICTED: serine/threonine-protein kinase SRK2J [Tarenaya hassleriana]
Length=335

 Score =   164 bits (416),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 75/111 (68%), Positives = 93/111 (84%), Gaps = 0/111 (0%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            +D  DP+NFRKT+Q+IM+V+YKIP +VHISQDCR++L+RIFVANP +RIT++E+K+HPWF
Sbjct  201  DDPKDPRNFRKTVQKIMAVKYKIPTHVHISQDCRNILTRIFVANPLKRITLREVKNHPWF  260

Query  744  LKNLPRELTEVAQAAYYRRENPTFSLQSAEEIMKIVDEAKAPPPASRSMGG  592
            LKNLPRELTE AQA YY+R N +FS QS EEIMKIV EA+  P  S   GG
Sbjct  261  LKNLPRELTESAQAVYYQRNNQSFSPQSVEEIMKIVGEARTVPKPSGHAGG  311



>ref|XP_004970723.1| PREDICTED: serine/threonine-protein kinase SAPK4-like [Setaria 
italica]
Length=362

 Score =   164 bits (416),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 79/110 (72%), Positives = 93/110 (85%), Gaps = 2/110 (2%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED DDPKN RKTIQ+IM VQY IPDYVHIS +C+ L++RIFVANP RRIT+KEIKSHPWF
Sbjct  201  EDPDDPKNIRKTIQQIMQVQYDIPDYVHISTECKQLIARIFVANPMRRITMKEIKSHPWF  260

Query  744  LKNLPRELTEVAQAAYYRREN--PTFSLQSAEEIMKIVDEAKAPPPASRS  601
            LKNLPRELTE AQA YYRR+N  P++S Q++EEIMKIV +A+    +SRS
Sbjct  261  LKNLPRELTETAQAMYYRRDNRVPSYSDQTSEEIMKIVQDARTMLKSSRS  310



>gb|AFW62592.1| putative snRK/SAPK family protein kinase [Zea mays]
Length=356

 Score =   163 bits (413),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 79/116 (68%), Positives = 93/116 (80%), Gaps = 10/116 (9%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED DDPKNFRKTI         IP+YVHISQDCR LL+RIFVANPA+RITI+EI++HPWF
Sbjct  201  EDPDDPKNFRKTI--------GIPEYVHISQDCRQLLARIFVANPAKRITIREIRNHPWF  252

Query  744  LKNLPRELTEVAQAAYYRREN--PTFSLQSAEEIMKIVDEAKAPPPASRSMGGFGW  583
            LKNLPRELTE AQA YY+++N  PTFS Q+ EEIMKIV+EA+ PP +   + GFGW
Sbjct  253  LKNLPRELTEAAQAKYYKKDNGAPTFSDQTVEEIMKIVEEARTPPQSPAPVAGFGW  308



>gb|ACG46236.1| serine/threonine-protein kinase SAPK4 [Zea mays]
Length=359

 Score =   163 bits (413),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 78/116 (67%), Positives = 93/116 (80%), Gaps = 4/116 (3%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED DDPKN RKTIQRI ++QY IPD + IS DCR L+SRIFV+NP RRIT++EIKSHPWF
Sbjct  201  EDQDDPKNIRKTIQRIAAIQYNIPDNIRISDDCRQLISRIFVSNPLRRITMREIKSHPWF  260

Query  744  LKNLPRELTEVAQAAYYRREN--PTFSLQSAEEIMKIVDEAKAPPPASRSMGGFGW  583
            LKNLPRELTE  Q +Y+RR+N   TFS Q+ EEIMKIV EA+  P +SRS  G+G+
Sbjct  261  LKNLPRELTEAVQLSYFRRDNSVSTFSDQTTEEIMKIVKEARTLPKSSRS--GYGY  314



>gb|EPS73443.1| stress kinase, partial [Genlisea aurea]
Length=340

 Score =   162 bits (410),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 74/113 (65%), Positives = 89/113 (79%), Gaps = 0/113 (0%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED DDPKN RK+I +I++ QY +PDYVH SQDC+ LLS+IF ANP+ RITI EIK HPWF
Sbjct  201  EDRDDPKNLRKSITKIVAAQYHVPDYVHFSQDCKDLLSQIFKANPSERITINEIKKHPWF  260

Query  744  LKNLPRELTEVAQAAYYRRENPTFSLQSAEEIMKIVDEAKAPPPASRSMGGFG  586
            LKNLP ELT   QA YY+++NP +SLQS EEIM IV EA+ PP +SR + GFG
Sbjct  261  LKNLPEELTPENQAVYYKKDNPCYSLQSGEEIMSIVIEARKPPLSSRPVPGFG  313



>ref|XP_008647613.1| PREDICTED: LOC100274512 isoform X1 [Zea mays]
 gb|ACF86929.2| unknown [Zea mays]
Length=334

 Score =   162 bits (409),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 77/116 (66%), Positives = 92/116 (79%), Gaps = 4/116 (3%)
 Frame = -1

Query  924  EDHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWF  745
            ED DDPKN RKTIQRI ++QY IPD + IS DCR L+SRIFV+NP RRIT++EIKSHPWF
Sbjct  176  EDQDDPKNIRKTIQRIAAIQYNIPDNIRISDDCRQLISRIFVSNPLRRITMREIKSHPWF  235

Query  744  LKNLPRELTEVAQAAYYRRENPT--FSLQSAEEIMKIVDEAKAPPPASRSMGGFGW  583
            LKNLPRELTE  Q +Y+RR+N    FS Q+ EEIMKIV EA+  P +SRS  G+G+
Sbjct  236  LKNLPRELTEAVQLSYFRRDNSVSAFSDQTTEEIMKIVKEARTLPKSSRS--GYGY  289



>gb|AIH00110.1| sucrose nonfermenting 1-related protein kinase 2.7 [Fragaria 
x ananassa]
Length=311

 Score =   160 bits (405),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 79/111 (71%), Positives = 93/111 (84%), Gaps = 4/111 (4%)
 Frame = -1

Query  921  DHDDPKNFRKTIQRIMSVQYKIPDYVHISQDCRHLLSRIFVANPARRITIKEIKSHPWFL  742
            D +D  N R+ ++RIMSV+Y IP YV+IS+DCRHLLSRIFVA+PARRITI+EIK+HPWFL
Sbjct  203  DENDQTNIREIVKRIMSVRYVIPGYVYISEDCRHLLSRIFVADPARRITIQEIKNHPWFL  262

Query  741  KNLPRELTEVAQAAYYRRENPTFSLQSAEEIMKIVDEAK-APPPASRSMGG  592
            KNLPRELTE AQ    R+EN T SLQS E+IMKIV+EAK  PPP SRS+GG
Sbjct  263  KNLPRELTEEAQT---RKENSTCSLQSVEDIMKIVEEAKNIPPPVSRSVGG  310



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2172931915458