BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig411

Length=818
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009776515.1|  PREDICTED: regulatory protein NPR3-like isof...  92.4    1e-17   Nicotiana sylvestris
ref|XP_009776511.1|  PREDICTED: regulatory protein NPR3-like isof...  92.4    1e-17   Nicotiana sylvestris
gb|AAT57641.1|  NIM1-like protein 1                                   92.4    1e-17   Nicotiana tabacum [American tobacco]
gb|AEE81755.1|  regulatory protein NPR2                               92.0    2e-17   Populus deltoides
ref|XP_002322351.2|  ankyrin repeat family protein                    92.0    2e-17   Populus trichocarpa [western balsam poplar]
ref|XP_011040366.1|  PREDICTED: regulatory protein NPR3-like isof...  92.0    2e-17   Populus euphratica
ref|XP_011040365.1|  PREDICTED: regulatory protein NPR3-like isof...  92.0    2e-17   Populus euphratica
gb|ABN45747.1|  nonexpressor of pathogenesis-related genes 3          91.7    3e-17   Nicotiana glutinosa
gb|ABF48718.1|  ankyrin repeat BTB/POZ domain-containing protein      91.7    3e-17   Populus trichocarpa [western balsam poplar]
ref|XP_009602190.1|  PREDICTED: regulatory protein NPR3-like          91.3    3e-17   Nicotiana tomentosiformis
ref|XP_006376994.1|  hypothetical protein POPTR_0012s11900g           88.2    3e-16   
ref|XP_011001309.1|  PREDICTED: regulatory protein NPR3-like          88.2    4e-16   Populus euphratica
ref|NP_001234562.1|  NIM1-like protein 1                              87.8    4e-16   Solanum lycopersicum
ref|XP_006353069.1|  PREDICTED: regulatory protein NPR3-like          86.7    1e-15   Solanum tuberosum [potatoes]
ref|XP_002520549.1|  Regulatory protein NPR1, putative                85.9    2e-15   
ref|XP_002274045.1|  PREDICTED: regulatory protein NPR3 isoform X1    85.1    4e-15   Vitis vinifera
ref|XP_006280229.1|  hypothetical protein CARUB_v10026146mg           85.1    4e-15   Capsella rubella
emb|CAN67078.1|  hypothetical protein VITISV_004499                   85.1    4e-15   Vitis vinifera
ref|XP_002307566.2|  hypothetical protein POPTR_0005s22770g           84.3    6e-15   Populus trichocarpa [western balsam poplar]
ref|XP_012089954.1|  PREDICTED: regulatory protein NPR3-like          84.3    6e-15   Jatropha curcas
ref|XP_010272312.1|  PREDICTED: regulatory protein NPR3 isoform X2    84.3    7e-15   Nelumbo nucifera [Indian lotus]
ref|XP_010481651.1|  PREDICTED: regulatory protein NPR3-like          84.3    7e-15   Camelina sativa [gold-of-pleasure]
ref|XP_010272311.1|  PREDICTED: regulatory protein NPR3 isoform X1    84.3    7e-15   Nelumbo nucifera [Indian lotus]
ref|XP_010441782.1|  PREDICTED: regulatory protein NPR3               84.3    7e-15   Camelina sativa [gold-of-pleasure]
ref|XP_007024872.1|  NPR1-like protein 4                              84.0    8e-15   Theobroma cacao [chocolate]
gb|AGC39275.1|  NPR1-like3 protein                                    84.0    8e-15   Theobroma cacao [chocolate]
gb|KDO77445.1|  hypothetical protein CISIN_1g007849mg                 83.2    1e-14   Citrus sinensis [apfelsine]
ref|XP_010494583.1|  PREDICTED: regulatory protein NPR3               83.6    1e-14   Camelina sativa [gold-of-pleasure]
ref|XP_006448743.1|  hypothetical protein CICLE_v10017873mg           83.2    1e-14   
gb|KDO77446.1|  hypothetical protein CISIN_1g007849mg                 83.2    1e-14   Citrus sinensis [apfelsine]
ref|XP_010942675.1|  PREDICTED: regulatory protein NPR3-like          83.2    2e-14   Elaeis guineensis
ref|XP_006468441.1|  PREDICTED: regulatory protein NPR3-like          83.2    2e-14   Citrus sinensis [apfelsine]
gb|KDO77444.1|  hypothetical protein CISIN_1g007849mg                 83.2    2e-14   Citrus sinensis [apfelsine]
ref|XP_002865280.1|  hypothetical protein ARALYDRAFT_494469           82.8    2e-14   
ref|XP_009128768.1|  PREDICTED: LOW QUALITY PROTEIN: regulatory p...  82.8    2e-14   
gb|ACJ45012.1|  NPR1-1 protein                                        82.4    3e-14   Glycine max [soybeans]
ref|XP_004497710.1|  PREDICTED: regulatory protein NPR3-like          82.4    3e-14   Cicer arietinum [garbanzo]
ref|NP_001238658.1|  NPR1-1 protein                                   82.4    3e-14   Glycine max [soybeans]
emb|CDP17457.1|  unnamed protein product                              82.4    3e-14   Coffea canephora [robusta coffee]
gb|ACJ45014.1|  NPR1-2 protein                                        82.0    3e-14   Glycine max [soybeans]
gb|KHN14362.1|  Regulatory protein NPR3                               82.0    3e-14   Glycine soja [wild soybean]
ref|NP_001238674.1|  NPR1-2 protein                                   82.0    3e-14   Glycine max [soybeans]
ref|XP_007147518.1|  hypothetical protein PHAVU_006G131400g           82.0    4e-14   Phaseolus vulgaris [French bean]
emb|CDY26398.1|  BnaA02g23720D                                        81.3    7e-14   Brassica napus [oilseed rape]
ref|XP_011032773.1|  PREDICTED: regulatory protein NPR3-like          81.3    7e-14   Populus euphratica
ref|XP_010092646.1|  Regulatory protein                               80.9    1e-13   Morus notabilis
ref|XP_007214668.1|  hypothetical protein PRUPE_ppa003290mg           80.5    1e-13   Prunus persica
ref|XP_002300863.2|  hypothetical protein POPTR_0002s05740g           79.7    1e-13   
ref|XP_009397343.1|  PREDICTED: regulatory protein NPR3-like          80.5    1e-13   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011026213.1|  PREDICTED: regulatory protein NPR3-like          80.1    2e-13   Populus euphratica
gb|AGL61506.1|  NPR1                                                  80.1    2e-13   Morus alba var. multicaulis
ref|XP_004486434.1|  PREDICTED: regulatory protein NPR3-like isof...  79.3    3e-13   Cicer arietinum [garbanzo]
ref|XP_008225741.1|  PREDICTED: regulatory protein NPR3-like          79.0    3e-13   Prunus mume [ume]
ref|XP_004486433.1|  PREDICTED: regulatory protein NPR3-like isof...  79.0    3e-13   Cicer arietinum [garbanzo]
ref|XP_006398160.1|  hypothetical protein EUTSA_v10000824mg           79.0    3e-13   Eutrema salsugineum [saltwater cress]
ref|XP_008787319.1|  PREDICTED: regulatory protein NPR3-like          79.0    4e-13   
ref|XP_007141442.1|  hypothetical protein PHAVU_008G195900g           79.0    4e-13   Phaseolus vulgaris [French bean]
ref|XP_008806697.1|  PREDICTED: regulatory protein NPR3-like          79.0    4e-13   
ref|XP_010908601.1|  PREDICTED: regulatory protein NPR3-like          78.2    7e-13   Elaeis guineensis
ref|XP_011096773.1|  PREDICTED: regulatory protein NPR3-like          77.8    1e-12   Sesamum indicum [beniseed]
ref|XP_004303898.1|  PREDICTED: regulatory protein NPR3-like          77.4    1e-12   Fragaria vesca subsp. vesca
ref|XP_008459083.1|  PREDICTED: regulatory protein NPR3-like          77.0    2e-12   
dbj|BAB09496.1|  regulatory protein NPR1-like; transcription fact...  77.0    2e-12   Arabidopsis thaliana [mouse-ear cress]
ref|NP_199324.2|  NPR1-like protein 3                                 77.0    2e-12   Arabidopsis thaliana [mouse-ear cress]
emb|CDP17620.1|  unnamed protein product                              76.6    2e-12   Coffea canephora [robusta coffee]
ref|XP_003519533.1|  PREDICTED: regulatory protein NPR3-like isof...  76.6    2e-12   Glycine max [soybeans]
ref|XP_010536418.1|  PREDICTED: regulatory protein NPR3-like isof...  76.6    2e-12   Tarenaya hassleriana [spider flower]
emb|CDY36698.1|  BnaC02g31190D                                        76.3    3e-12   Brassica napus [oilseed rape]
emb|CDX82577.1|  BnaC07g02890D                                        76.3    3e-12   
emb|CDY39410.1|  BnaAnng05410D                                        76.3    3e-12   Brassica napus [oilseed rape]
ref|XP_009101624.1|  PREDICTED: LOW QUALITY PROTEIN: regulatory p...  75.9    3e-12   Brassica rapa
gb|KFK41854.1|  hypothetical protein AALP_AA2G179400                  75.5    5e-12   Arabis alpina [alpine rockcress]
ref|XP_003594464.1|  NPR1-1 protein                                   75.5    5e-12   Medicago truncatula
gb|KEH37013.1|  regulatory protein NPR1                               75.1    5e-12   Medicago truncatula
ref|XP_010538609.1|  PREDICTED: regulatory protein NPR3-like          75.1    6e-12   Tarenaya hassleriana [spider flower]
gb|KEH28396.1|  NPR1/NIM1-like regulatory protein, putative           74.7    7e-12   Medicago truncatula
gb|KHN11992.1|  Regulatory protein NPR3                               75.1    7e-12   Glycine soja [wild soybean]
ref|XP_003545296.1|  PREDICTED: regulatory protein NPR3-like          75.1    7e-12   
ref|XP_003617362.1|  NPR1-1 protein                                   74.7    8e-12   Medicago truncatula
ref|XP_008229582.1|  PREDICTED: regulatory protein NPR3-like          72.4    5e-11   Prunus mume [ume]
ref|XP_007214958.1|  hypothetical protein PRUPE_ppa003232mg           72.4    5e-11   Prunus persica
ref|XP_007213800.1|  hypothetical protein PRUPE_ppa003221mg           72.4    5e-11   Prunus persica
ref|XP_008348376.1|  PREDICTED: LOW QUALITY PROTEIN: regulatory p...  72.4    5e-11   
ref|XP_009356589.1|  PREDICTED: regulatory protein NPR3-like          72.4    6e-11   Pyrus x bretschneideri [bai li]
ref|XP_008451832.1|  PREDICTED: LOW QUALITY PROTEIN: regulatory p...  71.2    1e-10   
ref|XP_008342334.1|  PREDICTED: regulatory protein NPR3-like          68.2    2e-10   
gb|KGN53513.1|  hypothetical protein Csa_4G063470                     70.5    2e-10   Cucumis sativus [cucumbers]
ref|XP_009377037.1|  PREDICTED: regulatory protein NPR3-like          70.9    2e-10   Pyrus x bretschneideri [bai li]
ref|XP_009786055.1|  PREDICTED: regulatory protein NPR3-like isof...  70.9    2e-10   Nicotiana sylvestris
ref|XP_009786050.1|  PREDICTED: regulatory protein NPR3-like isof...  70.9    2e-10   Nicotiana sylvestris
ref|XP_004147747.2|  PREDICTED: LOW QUALITY PROTEIN: regulatory p...  70.5    3e-10   Cucumis sativus [cucumbers]
ref|XP_004491374.1|  PREDICTED: regulatory protein NPR3-like          69.3    5e-10   
ref|XP_009629505.1|  PREDICTED: regulatory protein NPR3-like          69.3    6e-10   
gb|KCW89778.1|  hypothetical protein EUGRSUZ_A02033                   68.9    6e-10   Eucalyptus grandis [rose gum]
gb|KCW89777.1|  hypothetical protein EUGRSUZ_A02033                   68.9    6e-10   Eucalyptus grandis [rose gum]
ref|XP_010054033.1|  PREDICTED: regulatory protein NPR3-like          68.9    8e-10   Eucalyptus grandis [rose gum]
ref|XP_008342333.1|  PREDICTED: regulatory protein NPR3-like          68.6    9e-10   
emb|CDX99350.1|  BnaC01g12020D                                        67.8    2e-09   
ref|XP_009399065.1|  PREDICTED: regulatory protein NPR3-like isof...  67.8    2e-09   Musa acuminata subsp. malaccensis [pisang utan]
gb|AHF20181.1|  ankyrin-repeat protein                                67.4    2e-09   Musa acuminata AAA Group [Cavendish banana]
ref|XP_009399066.1|  PREDICTED: regulatory protein NPR3-like isof...  67.4    2e-09   Musa acuminata subsp. malaccensis [pisang utan]
gb|ACJ04030.1|  NPR1-like protein                                     67.0    3e-09   Musa ABB Group [cooking banana]
ref|NP_001233844.1|  NIM1-like protein 2                              67.0    4e-09   Solanum lycopersicum
ref|XP_006413943.1|  hypothetical protein EUTSA_v10024752mg           66.6    4e-09   
emb|CDX78955.1|  BnaA01g10220D                                        66.6    4e-09   
ref|XP_006413942.1|  hypothetical protein EUTSA_v10024752mg           66.2    4e-09   
gb|AHF20180.1|  ankyrin-repeat protein                                65.5    9e-09   Musa acuminata AAA Group [Cavendish banana]
ref|XP_006366625.1|  PREDICTED: regulatory protein NPR3-like          65.5    1e-08   Solanum tuberosum [potatoes]
gb|AAT57642.1|  NIM1-like protein 1                                   64.7    2e-08   Helianthus annuus
gb|KDO44757.1|  hypothetical protein CISIN_1g007550mg                 64.7    2e-08   Citrus sinensis [apfelsine]
gb|KDO44756.1|  hypothetical protein CISIN_1g007550mg                 64.7    2e-08   Citrus sinensis [apfelsine]
gb|AIM54370.1|  nonexpressor of pathogenesis-related protein 1        64.7    2e-08   Gladiolus hybrid cultivar
ref|XP_009133120.1|  PREDICTED: regulatory protein NPR4               64.7    2e-08   Brassica rapa
gb|KDO44755.1|  hypothetical protein CISIN_1g007550mg                 64.7    2e-08   Citrus sinensis [apfelsine]
ref|XP_007048936.1|  NPR1-like protein 3, putative                    64.3    2e-08   
gb|KHG00475.1|  Regulatory NPR3 -like protein                         64.3    3e-08   Gossypium arboreum [tree cotton]
gb|KJB69919.1|  hypothetical protein B456_011G050200                  64.3    3e-08   Gossypium raimondii
gb|KJB69920.1|  hypothetical protein B456_011G050200                  64.3    3e-08   Gossypium raimondii
gb|KJB69918.1|  hypothetical protein B456_011G050200                  64.3    3e-08   Gossypium raimondii
gb|KJB34938.1|  hypothetical protein B456_006G091900                  63.9    3e-08   Gossypium raimondii
gb|KJB69916.1|  hypothetical protein B456_011G050200                  63.9    3e-08   Gossypium raimondii
gb|KHG09335.1|  Regulatory NPR3 -like protein                         63.5    4e-08   Gossypium arboreum [tree cotton]
gb|KJB34937.1|  hypothetical protein B456_006G091900                  63.5    5e-08   Gossypium raimondii
emb|CDM84353.1|  unnamed protein product                              63.5    5e-08   Triticum aestivum [Canadian hard winter wheat]
ref|XP_008383328.1|  PREDICTED: regulatory protein NPR3-like          63.5    5e-08   Malus domestica [apple tree]
ref|XP_010449314.1|  PREDICTED: regulatory protein NPR4-like          63.5    5e-08   Camelina sativa [gold-of-pleasure]
ref|XP_010439666.1|  PREDICTED: regulatory protein NPR4-like          63.2    6e-08   
ref|XP_010056640.1|  PREDICTED: regulatory protein NPR3-like          62.8    1e-07   Eucalyptus grandis [rose gum]
ref|XP_006285143.1|  hypothetical protein CARUB_v10006486mg           62.4    1e-07   Capsella rubella
ref|XP_003569900.1|  PREDICTED: regulatory protein NPR3-like          62.4    1e-07   Brachypodium distachyon [annual false brome]
ref|XP_006853358.1|  PREDICTED: regulatory protein NPR3               62.4    1e-07   
ref|XP_009341187.1|  PREDICTED: regulatory protein NPR3-like isof...  62.0    1e-07   Pyrus x bretschneideri [bai li]
ref|XP_009341186.1|  PREDICTED: regulatory protein NPR3-like isof...  62.0    2e-07   Pyrus x bretschneideri [bai li]
ref|XP_009357280.1|  PREDICTED: regulatory protein NPR3-like isof...  62.0    2e-07   Pyrus x bretschneideri [bai li]
ref|XP_009357282.1|  PREDICTED: regulatory protein NPR3-like isof...  62.0    2e-07   Pyrus x bretschneideri [bai li]
ref|XP_008371836.1|  PREDICTED: regulatory protein NPR3 isoform X2    62.0    2e-07   
ref|XP_008371834.1|  PREDICTED: regulatory protein NPR3 isoform X1    62.0    2e-07   
ref|XP_010434372.1|  PREDICTED: regulatory protein NPR4               62.0    2e-07   Camelina sativa [gold-of-pleasure]
ref|XP_006437091.1|  hypothetical protein CICLE_v10031020mg           61.6    2e-07   Citrus clementina [clementine]
ref|NP_001147587.1|  regulatory protein NPR1                          61.2    3e-07   
gb|AFW84951.1|  regulatory protein NPR1                               61.2    3e-07   
gb|AHA43769.1|  NPR3                                                  60.8    4e-07   Morus alba var. multicaulis
ref|XP_010093184.1|  Regulatory protein                               60.8    4e-07   Morus notabilis
ref|XP_004303897.1|  PREDICTED: regulatory protein NPR3-like          60.5    6e-07   Fragaria vesca subsp. vesca
gb|ACE86413.1|  NPR1-like protein                                     60.1    6e-07   Musa ABB Group [cooking banana]
ref|XP_004293734.1|  PREDICTED: regulatory protein NPR3-like          59.7    9e-07   Fragaria vesca subsp. vesca
ref|XP_009357279.1|  PREDICTED: regulatory protein NPR3-like          59.3    1e-06   Pyrus x bretschneideri [bai li]
ref|XP_009777160.1|  PREDICTED: regulatory protein NPR3-like isof...  58.5    2e-06   Nicotiana sylvestris
ref|XP_009621669.1|  PREDICTED: regulatory protein NPR3-like          58.5    2e-06   
ref|NP_001280793.1|  regulatory protein NPR3-like                     58.5    2e-06   Malus domestica [apple tree]
ref|XP_009777172.1|  PREDICTED: regulatory protein NPR3-like isof...  58.5    2e-06   Nicotiana sylvestris
ref|NP_001289241.1|  uncharacterized protein LOC103945128             58.5    2e-06   Pyrus x bretschneideri [bai li]
gb|ABK62792.1|  NPR-1                                                 58.5    2e-06   Pyrus pyrifolia [sha li]
gb|ACC77697.1|  NPR1-like protein                                     58.2    3e-06   Malus domestica [apple tree]
gb|ACU78081.1|  NPR1-like protein                                     58.2    3e-06   Malus hupehensis
gb|ADP95762.1|  npr1 protein                                          58.2    3e-06   Malus hupehensis
ref|NP_193701.2|  NPR1-like protein 4                                 58.2    3e-06   Arabidopsis thaliana [mouse-ear cress]
emb|CAA19683.1|  putative protein                                     58.2    3e-06   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004970097.1|  PREDICTED: regulatory protein NPR3-like          57.8    4e-06   Setaria italica
gb|EYU43699.1|  hypothetical protein MIMGU_mgv1a003483mg              57.0    8e-06   Erythranthe guttata [common monkey flower]
ref|XP_002867926.1|  predicted protein                                56.6    9e-06   Arabidopsis lyrata subsp. lyrata
ref|XP_008225738.1|  PREDICTED: regulatory protein NPR3-like          56.6    9e-06   Prunus mume [ume]
ref|XP_011085427.1|  PREDICTED: regulatory protein NPR3-like          56.6    9e-06   
dbj|BAD53355.1|  putative NPR1                                        55.8    2e-05   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001044363.1|  Os01g0767900                                     55.8    2e-05   
gb|ABA38903.1|  NPR1-like protein                                     53.5    7e-05   Pyrus communis
gb|EYU42809.1|  hypothetical protein MIMGU_mgv1a003347mg              53.1    1e-04   Erythranthe guttata [common monkey flower]
dbj|BAJ91588.1|  predicted protein                                    52.0    3e-04   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ90272.1|  predicted protein                                    52.0    3e-04   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002456404.1|  hypothetical protein SORBIDRAFT_03g035720        52.0    3e-04   Sorghum bicolor [broomcorn]



>ref|XP_009776515.1| PREDICTED: regulatory protein NPR3-like isoform X2 [Nicotiana 
sylvestris]
Length=558

 Score = 92.4 bits (228),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 45/60 (75%), Positives = 52/60 (87%), Gaps = 0/60 (0%)
 Frame = +1

Query  637  SSGGSSLEIFSLSKLSNSLEQLLSDTTSDFSDADIVVEGTTVGVHRCILAARSNFFHVLF  816
            S  GSS EI SLSKLSN+LEQLLSD++SDF+DA+IVVEG ++GVHRCILAARS FF  LF
Sbjct  36   SETGSSYEIISLSKLSNNLEQLLSDSSSDFTDAEIVVEGVSLGVHRCILAARSKFFQDLF  95



>ref|XP_009776511.1| PREDICTED: regulatory protein NPR3-like isoform X1 [Nicotiana 
sylvestris]
Length=588

 Score = 92.4 bits (228),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 45/60 (75%), Positives = 52/60 (87%), Gaps = 0/60 (0%)
 Frame = +1

Query  637  SSGGSSLEIFSLSKLSNSLEQLLSDTTSDFSDADIVVEGTTVGVHRCILAARSNFFHVLF  816
            S  GSS EI SLSKLSN+LEQLLSD++SDF+DA+IVVEG ++GVHRCILAARS FF  LF
Sbjct  36   SETGSSYEIISLSKLSNNLEQLLSDSSSDFTDAEIVVEGVSLGVHRCILAARSKFFQDLF  95



>gb|AAT57641.1| NIM1-like protein 1 [Nicotiana tabacum]
Length=588

 Score = 92.4 bits (228),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 45/60 (75%), Positives = 52/60 (87%), Gaps = 0/60 (0%)
 Frame = +1

Query  637  SSGGSSLEIFSLSKLSNSLEQLLSDTTSDFSDADIVVEGTTVGVHRCILAARSNFFHVLF  816
            S  GSS EI SLSKLSN+LEQLLSD++SDF+DA+IVVEG ++GVHRCILAARS FF  LF
Sbjct  36   SETGSSYEIISLSKLSNNLEQLLSDSSSDFTDAEIVVEGVSLGVHRCILAARSKFFQDLF  95



>gb|AEE81755.1| regulatory protein NPR2 [Populus deltoides]
Length=587

 Score = 92.0 bits (227),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 42/60 (70%), Positives = 51/60 (85%), Gaps = 0/60 (0%)
 Frame = +1

Query  637  SSGGSSLEIFSLSKLSNSLEQLLSDTTSDFSDADIVVEGTTVGVHRCILAARSNFFHVLF  816
            +  G+SLE+ SL+KLS++LEQLL D+T D+SDADIVVEGT +GVHRCIL ARS FFH LF
Sbjct  34   AEAGTSLEVISLNKLSSNLEQLLIDSTCDYSDADIVVEGTAIGVHRCILGARSKFFHELF  93



>ref|XP_002322351.2| ankyrin repeat family protein [Populus trichocarpa]
 gb|EEF06478.2| ankyrin repeat family protein [Populus trichocarpa]
Length=587

 Score = 92.0 bits (227),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 42/60 (70%), Positives = 51/60 (85%), Gaps = 0/60 (0%)
 Frame = +1

Query  637  SSGGSSLEIFSLSKLSNSLEQLLSDTTSDFSDADIVVEGTTVGVHRCILAARSNFFHVLF  816
            +  G+SLE+ SL+KLS++LEQLL D+T D+SDADIVVEGT +GVHRCIL ARS FFH LF
Sbjct  34   AEAGTSLEVISLNKLSSNLEQLLIDSTCDYSDADIVVEGTAIGVHRCILGARSKFFHELF  93



>ref|XP_011040366.1| PREDICTED: regulatory protein NPR3-like isoform X2 [Populus euphratica]
Length=587

 Score = 92.0 bits (227),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 42/60 (70%), Positives = 51/60 (85%), Gaps = 0/60 (0%)
 Frame = +1

Query  637  SSGGSSLEIFSLSKLSNSLEQLLSDTTSDFSDADIVVEGTTVGVHRCILAARSNFFHVLF  816
            +  G+SLE+ SL+KLS++LEQLL D+T D+SDADIVVEGT +GVHRCIL ARS FFH LF
Sbjct  34   AEAGTSLEVISLNKLSSNLEQLLIDSTCDYSDADIVVEGTAIGVHRCILGARSRFFHELF  93



>ref|XP_011040365.1| PREDICTED: regulatory protein NPR3-like isoform X1 [Populus euphratica]
Length=589

 Score = 92.0 bits (227),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 42/60 (70%), Positives = 51/60 (85%), Gaps = 0/60 (0%)
 Frame = +1

Query  637  SSGGSSLEIFSLSKLSNSLEQLLSDTTSDFSDADIVVEGTTVGVHRCILAARSNFFHVLF  816
            +  G+SLE+ SL+KLS++LEQLL D+T D+SDADIVVEGT +GVHRCIL ARS FFH LF
Sbjct  34   AEAGTSLEVISLNKLSSNLEQLLIDSTCDYSDADIVVEGTAIGVHRCILGARSRFFHELF  93



>gb|ABN45747.1| nonexpressor of pathogenesis-related genes 3 [Nicotiana glutinosa]
 gb|ADI52630.1| nonexpressor of pathogenesis-like protein 3 [Nicotiana glutinosa]
Length=588

 Score = 91.7 bits (226),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 45/60 (75%), Positives = 51/60 (85%), Gaps = 0/60 (0%)
 Frame = +1

Query  637  SSGGSSLEIFSLSKLSNSLEQLLSDTTSDFSDADIVVEGTTVGVHRCILAARSNFFHVLF  816
            S  G+S EI SLSKLSNSLEQLLSD+ +DFSDA+IVVEG ++GVHRCILAARS FF  LF
Sbjct  36   SETGTSYEIISLSKLSNSLEQLLSDSITDFSDAEIVVEGVSLGVHRCILAARSKFFQDLF  95



>gb|ABF48718.1| ankyrin repeat BTB/POZ domain-containing protein [Populus trichocarpa]
Length=679

 Score = 91.7 bits (226),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 42/60 (70%), Positives = 51/60 (85%), Gaps = 0/60 (0%)
 Frame = +1

Query  637  SSGGSSLEIFSLSKLSNSLEQLLSDTTSDFSDADIVVEGTTVGVHRCILAARSNFFHVLF  816
            +  G+SLE+ SL+KLS++LEQLL D+T D+SDADIVVEGT +GVHRCIL ARS FFH LF
Sbjct  34   AEAGTSLEVISLNKLSSNLEQLLIDSTCDYSDADIVVEGTAIGVHRCILGARSKFFHELF  93



>ref|XP_009602190.1| PREDICTED: regulatory protein NPR3-like [Nicotiana tomentosiformis]
Length=580

 Score = 91.3 bits (225),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 44/60 (73%), Positives = 52/60 (87%), Gaps = 0/60 (0%)
 Frame = +1

Query  637  SSGGSSLEIFSLSKLSNSLEQLLSDTTSDFSDADIVVEGTTVGVHRCILAARSNFFHVLF  816
            S  G+S EI SLSKLSN+LEQLLSD+++DFSDA+IVVEG ++GVHRCILAARS FF  LF
Sbjct  36   SETGTSYEIISLSKLSNNLEQLLSDSSTDFSDAEIVVEGVSLGVHRCILAARSKFFQDLF  95



>ref|XP_006376994.1| hypothetical protein POPTR_0012s11900g [Populus trichocarpa]
 gb|ERP54791.1| hypothetical protein POPTR_0012s11900g [Populus trichocarpa]
Length=587

 Score = 88.2 bits (217),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 41/60 (68%), Positives = 51/60 (85%), Gaps = 0/60 (0%)
 Frame = +1

Query  637  SSGGSSLEIFSLSKLSNSLEQLLSDTTSDFSDADIVVEGTTVGVHRCILAARSNFFHVLF  816
            +  G+SLE+ SL+KLS+SLEQLL ++T ++SDADIVVEG  VGVHRCILA+RS FFH LF
Sbjct  34   AEAGTSLEVISLNKLSSSLEQLLIESTCEYSDADIVVEGIAVGVHRCILASRSKFFHELF  93



>ref|XP_011001309.1| PREDICTED: regulatory protein NPR3-like [Populus euphratica]
Length=587

 Score = 88.2 bits (217),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 41/60 (68%), Positives = 51/60 (85%), Gaps = 0/60 (0%)
 Frame = +1

Query  637  SSGGSSLEIFSLSKLSNSLEQLLSDTTSDFSDADIVVEGTTVGVHRCILAARSNFFHVLF  816
            +  G+SLE+ SL+KLS+SLEQLL ++T ++SDADIVVEG  VGVHRCILA+RS FFH LF
Sbjct  34   AEAGTSLEVISLNKLSSSLEQLLIESTCEYSDADIVVEGIAVGVHRCILASRSKFFHELF  93



>ref|NP_001234562.1| NIM1-like protein 1 [Solanum lycopersicum]
 gb|AAT57638.1| NIM1-like protein 1 [Solanum lycopersicum]
Length=581

 Score = 87.8 bits (216),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 44/60 (73%), Positives = 52/60 (87%), Gaps = 0/60 (0%)
 Frame = +1

Query  637  SSGGSSLEIFSLSKLSNSLEQLLSDTTSDFSDADIVVEGTTVGVHRCILAARSNFFHVLF  816
            S  GSS EI SLSKLSN+LEQLL D++S+FSDA+IVVEG ++GVHRCILAARS+FF  LF
Sbjct  36   SETGSSYEIISLSKLSNNLEQLLLDSSSEFSDAEIVVEGVSLGVHRCILAARSSFFRDLF  95



>ref|XP_006353069.1| PREDICTED: regulatory protein NPR3-like [Solanum tuberosum]
Length=581

 Score = 86.7 bits (213),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 44/60 (73%), Positives = 52/60 (87%), Gaps = 0/60 (0%)
 Frame = +1

Query  637  SSGGSSLEIFSLSKLSNSLEQLLSDTTSDFSDADIVVEGTTVGVHRCILAARSNFFHVLF  816
            S  GSS EI SLSKLSN+LEQLL D++S+FSDA+IVVEG ++GVHRCILAARS+FF  LF
Sbjct  36   SETGSSNEIISLSKLSNNLEQLLLDSSSEFSDAEIVVEGDSLGVHRCILAARSSFFRDLF  95



>ref|XP_002520549.1| Regulatory protein NPR1, putative [Ricinus communis]
 gb|EEF41835.1| Regulatory protein NPR1, putative [Ricinus communis]
Length=590

 Score = 85.9 bits (211),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 40/56 (71%), Positives = 49/56 (88%), Gaps = 0/56 (0%)
 Frame = +1

Query  649  SSLEIFSLSKLSNSLEQLLSDTTSDFSDADIVVEGTTVGVHRCILAARSNFFHVLF  816
            SSLE+ SL+KLS++LE+LL D++ D+SDADIVVEG  VG+HRCILAARS FFH LF
Sbjct  38   SSLEVISLTKLSSNLEKLLIDSSCDYSDADIVVEGKPVGIHRCILAARSRFFHDLF  93



>ref|XP_002274045.1| PREDICTED: regulatory protein NPR3 isoform X1 [Vitis vinifera]
Length=587

 Score = 85.1 bits (209),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 41/57 (72%), Positives = 48/57 (84%), Gaps = 0/57 (0%)
 Frame = +1

Query  646  GSSLEIFSLSKLSNSLEQLLSDTTSDFSDADIVVEGTTVGVHRCILAARSNFFHVLF  816
            G SLEI SLSKLS++LEQLL D+  D+SDA+I+VEG  VGVHRCILAARS FF+ LF
Sbjct  37   GPSLEIISLSKLSSNLEQLLVDSGCDYSDAEIIVEGIPVGVHRCILAARSRFFYDLF  93



>ref|XP_006280229.1| hypothetical protein CARUB_v10026146mg [Capsella rubella]
 gb|EOA13127.1| hypothetical protein CARUB_v10026146mg [Capsella rubella]
Length=579

 Score = 85.1 bits (209),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 40/61 (66%), Positives = 49/61 (80%), Gaps = 0/61 (0%)
 Frame = +1

Query  634  PSSGGSSLEIFSLSKLSNSLEQLLSDTTSDFSDADIVVEGTTVGVHRCILAARSNFFHVL  813
            PSS  S+ E+ SLSKLS++LEQLLS+   D+SDA+I+V+G  VGVHRCILAARS FF  L
Sbjct  29   PSSSASNPEVVSLSKLSSNLEQLLSNPDCDYSDAEIIVDGVPVGVHRCILAARSKFFQEL  88

Query  814  F  816
            F
Sbjct  89   F  89



>emb|CAN67078.1| hypothetical protein VITISV_004499 [Vitis vinifera]
Length=628

 Score = 85.1 bits (209),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 41/57 (72%), Positives = 48/57 (84%), Gaps = 0/57 (0%)
 Frame = +1

Query  646  GSSLEIFSLSKLSNSLEQLLSDTTSDFSDADIVVEGTTVGVHRCILAARSNFFHVLF  816
            G SLEI SLSKLS++LEQLL D+  D+SDA+I+VEG  VGVHRCILAARS FF+ LF
Sbjct  37   GPSLEIISLSKLSSNLEQLLVDSGCDYSDAEIIVEGIPVGVHRCILAARSRFFYDLF  93



>ref|XP_002307566.2| hypothetical protein POPTR_0005s22770g [Populus trichocarpa]
 gb|EEE94562.2| hypothetical protein POPTR_0005s22770g [Populus trichocarpa]
Length=586

 Score = 84.3 bits (207),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 44/62 (71%), Positives = 48/62 (77%), Gaps = 1/62 (2%)
 Frame = +1

Query  631  VPSSGGSSLEIFSLSKLSNSLEQLLSDTTSDFSDADIVVEGTTVGVHRCILAARSNFFHV  810
            VP  G  SLE FSLSKLS +LE+LL D   D+SDA+IVVEG  VGVHRCILAARS FFH 
Sbjct  33   VPEPG-VSLENFSLSKLSGNLERLLLDGEYDYSDAEIVVEGIPVGVHRCILAARSQFFHE  91

Query  811  LF  816
            LF
Sbjct  92   LF  93



>ref|XP_012089954.1| PREDICTED: regulatory protein NPR3-like [Jatropha curcas]
 gb|KDP22628.1| hypothetical protein JCGZ_02854 [Jatropha curcas]
Length=587

 Score = 84.3 bits (207),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 39/55 (71%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = +1

Query  652  SLEIFSLSKLSNSLEQLLSDTTSDFSDADIVVEGTTVGVHRCILAARSNFFHVLF  816
            SL++ SL+KLS+SLEQLL D + D+SDA+I+VEG  VGVHRCILAARS FFH LF
Sbjct  42   SLDVISLTKLSSSLEQLLIDPSCDYSDAEIIVEGKPVGVHRCILAARSKFFHELF  96



>ref|XP_010272312.1| PREDICTED: regulatory protein NPR3 isoform X2 [Nelumbo nucifera]
Length=570

 Score = 84.3 bits (207),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 39/57 (68%), Positives = 48/57 (84%), Gaps = 0/57 (0%)
 Frame = +1

Query  646  GSSLEIFSLSKLSNSLEQLLSDTTSDFSDADIVVEGTTVGVHRCILAARSNFFHVLF  816
            G +L+I SL KLS+++EQLL DT  D+SDA+++VEG TVGVHRCILAARS FFH LF
Sbjct  37   GVNLDIISLGKLSSNMEQLLIDTGLDYSDAEVIVEGNTVGVHRCILAARSRFFHELF  93



>ref|XP_010481651.1| PREDICTED: regulatory protein NPR3-like [Camelina sativa]
Length=579

 Score = 84.3 bits (207),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 39/61 (64%), Positives = 49/61 (80%), Gaps = 0/61 (0%)
 Frame = +1

Query  634  PSSGGSSLEIFSLSKLSNSLEQLLSDTTSDFSDADIVVEGTTVGVHRCILAARSNFFHVL  813
            PSS  S+ E+ SLSKLS++LEQLLS+   D+SDA+++V+G  VGVHRCILAARS FF  L
Sbjct  29   PSSSASNPEVVSLSKLSSNLEQLLSNPDCDYSDAEVIVDGVPVGVHRCILAARSKFFQEL  88

Query  814  F  816
            F
Sbjct  89   F  89



>ref|XP_010272311.1| PREDICTED: regulatory protein NPR3 isoform X1 [Nelumbo nucifera]
Length=571

 Score = 84.3 bits (207),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 39/57 (68%), Positives = 48/57 (84%), Gaps = 0/57 (0%)
 Frame = +1

Query  646  GSSLEIFSLSKLSNSLEQLLSDTTSDFSDADIVVEGTTVGVHRCILAARSNFFHVLF  816
            G +L+I SL KLS+++EQLL DT  D+SDA+++VEG TVGVHRCILAARS FFH LF
Sbjct  37   GVNLDIISLGKLSSNMEQLLIDTGLDYSDAEVIVEGNTVGVHRCILAARSRFFHELF  93



>ref|XP_010441782.1| PREDICTED: regulatory protein NPR3 [Camelina sativa]
Length=579

 Score = 84.3 bits (207),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 39/61 (64%), Positives = 49/61 (80%), Gaps = 0/61 (0%)
 Frame = +1

Query  634  PSSGGSSLEIFSLSKLSNSLEQLLSDTTSDFSDADIVVEGTTVGVHRCILAARSNFFHVL  813
            PSS  S+ E+ SLSKLS++LEQLLS+   D+SDA+++V+G  VGVHRCILAARS FF  L
Sbjct  29   PSSSASNPEVVSLSKLSSNLEQLLSNPDCDYSDAEVIVDGVPVGVHRCILAARSKFFQEL  88

Query  814  F  816
            F
Sbjct  89   F  89



>ref|XP_007024872.1| NPR1-like protein 4 [Theobroma cacao]
 gb|EOY27494.1| NPR1-like protein 4 [Theobroma cacao]
Length=587

 Score = 84.0 bits (206),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 42/62 (68%), Positives = 49/62 (79%), Gaps = 1/62 (2%)
 Frame = +1

Query  631  VPSSGGSSLEIFSLSKLSNSLEQLLSDTTSDFSDADIVVEGTTVGVHRCILAARSNFFHV  810
            VP +G +SLE+ SL+KLS SLEQL++D   DFSDADIVVE   VGVHRCILA RS FF+ 
Sbjct  33   VPETG-ASLEVISLTKLSTSLEQLVNDNGPDFSDADIVVEDVPVGVHRCILAVRSKFFNE  91

Query  811  LF  816
            LF
Sbjct  92   LF  93



>gb|AGC39275.1| NPR1-like3 protein [Theobroma cacao]
Length=587

 Score = 84.0 bits (206),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 42/62 (68%), Positives = 49/62 (79%), Gaps = 1/62 (2%)
 Frame = +1

Query  631  VPSSGGSSLEIFSLSKLSNSLEQLLSDTTSDFSDADIVVEGTTVGVHRCILAARSNFFHV  810
            VP +G +SLE+ SL+KLS SLEQL++D   DFSDADIVVE   VGVHRCILA RS FF+ 
Sbjct  33   VPETG-ASLEVISLTKLSTSLEQLVNDNGPDFSDADIVVEDVPVGVHRCILAVRSKFFNE  91

Query  811  LF  816
            LF
Sbjct  92   LF  93



>gb|KDO77445.1| hypothetical protein CISIN_1g007849mg [Citrus sinensis]
Length=501

 Score = 83.2 bits (204),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 39/57 (68%), Positives = 49/57 (86%), Gaps = 0/57 (0%)
 Frame = +1

Query  646  GSSLEIFSLSKLSNSLEQLLSDTTSDFSDADIVVEGTTVGVHRCILAARSNFFHVLF  816
            G +LE+FSL+KLS+SLEQLL D+T ++SDA+I+VEG  V VHRCILAARS FF+ LF
Sbjct  37   GVNLEVFSLNKLSSSLEQLLIDSTCEYSDAEIIVEGIPVCVHRCILAARSKFFYELF  93



>ref|XP_010494583.1| PREDICTED: regulatory protein NPR3 [Camelina sativa]
Length=579

 Score = 83.6 bits (205),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 38/61 (62%), Positives = 49/61 (80%), Gaps = 0/61 (0%)
 Frame = +1

Query  634  PSSGGSSLEIFSLSKLSNSLEQLLSDTTSDFSDADIVVEGTTVGVHRCILAARSNFFHVL  813
            PSS  S+ E+ SLSKLS++LEQLLS+   D+SDA+++V+G  VGVHRCILAARS FF  +
Sbjct  29   PSSSASNPEVVSLSKLSSNLEQLLSNPDCDYSDAEVIVDGVPVGVHRCILAARSKFFQEM  88

Query  814  F  816
            F
Sbjct  89   F  89



>ref|XP_006448743.1| hypothetical protein CICLE_v10017873mg [Citrus clementina]
 gb|ESR61983.1| hypothetical protein CICLE_v10017873mg [Citrus clementina]
Length=539

 Score = 83.2 bits (204),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 39/57 (68%), Positives = 49/57 (86%), Gaps = 0/57 (0%)
 Frame = +1

Query  646  GSSLEIFSLSKLSNSLEQLLSDTTSDFSDADIVVEGTTVGVHRCILAARSNFFHVLF  816
            G +LE+FSL+KLS+SLEQLL D+T ++SDA+I+VEG  V VHRCILAARS FF+ LF
Sbjct  37   GVNLEVFSLNKLSSSLEQLLIDSTCEYSDAEIIVEGIPVCVHRCILAARSKFFYELF  93



>gb|KDO77446.1| hypothetical protein CISIN_1g007849mg [Citrus sinensis]
Length=532

 Score = 83.2 bits (204),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 39/57 (68%), Positives = 49/57 (86%), Gaps = 0/57 (0%)
 Frame = +1

Query  646  GSSLEIFSLSKLSNSLEQLLSDTTSDFSDADIVVEGTTVGVHRCILAARSNFFHVLF  816
            G +LE+FSL+KLS+SLEQLL D+T ++SDA+I+VEG  V VHRCILAARS FF+ LF
Sbjct  37   GVNLEVFSLNKLSSSLEQLLIDSTCEYSDAEIIVEGIPVCVHRCILAARSKFFYELF  93



>ref|XP_010942675.1| PREDICTED: regulatory protein NPR3-like [Elaeis guineensis]
Length=604

 Score = 83.2 bits (204),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 41/60 (68%), Positives = 48/60 (80%), Gaps = 0/60 (0%)
 Frame = +1

Query  637  SSGGSSLEIFSLSKLSNSLEQLLSDTTSDFSDADIVVEGTTVGVHRCILAARSNFFHVLF  816
            +  G SLE+ SLSKLS++LE+LL D+  D SDA+IVVEG  VGVHRCILAARS FFH LF
Sbjct  45   NEAGGSLEVVSLSKLSSNLERLLLDSEFDCSDAEIVVEGVPVGVHRCILAARSRFFHDLF  104



>ref|XP_006468441.1| PREDICTED: regulatory protein NPR3-like [Citrus sinensis]
Length=587

 Score = 83.2 bits (204),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 39/57 (68%), Positives = 49/57 (86%), Gaps = 0/57 (0%)
 Frame = +1

Query  646  GSSLEIFSLSKLSNSLEQLLSDTTSDFSDADIVVEGTTVGVHRCILAARSNFFHVLF  816
            G +LE+FSL+KLS+SLEQLL D+T ++SDA+I+VEG  V VHRCILAARS FF+ LF
Sbjct  37   GVNLEVFSLNKLSSSLEQLLIDSTCEYSDAEIIVEGIPVCVHRCILAARSKFFYELF  93



>gb|KDO77444.1| hypothetical protein CISIN_1g007849mg [Citrus sinensis]
Length=587

 Score = 83.2 bits (204),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 39/57 (68%), Positives = 49/57 (86%), Gaps = 0/57 (0%)
 Frame = +1

Query  646  GSSLEIFSLSKLSNSLEQLLSDTTSDFSDADIVVEGTTVGVHRCILAARSNFFHVLF  816
            G +LE+FSL+KLS+SLEQLL D+T ++SDA+I+VEG  V VHRCILAARS FF+ LF
Sbjct  37   GVNLEVFSLNKLSSSLEQLLIDSTCEYSDAEIIVEGIPVCVHRCILAARSKFFYELF  93



>ref|XP_002865280.1| hypothetical protein ARALYDRAFT_494469 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH41539.1| hypothetical protein ARALYDRAFT_494469 [Arabidopsis lyrata subsp. 
lyrata]
Length=586

 Score = 82.8 bits (203),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 39/61 (64%), Positives = 49/61 (80%), Gaps = 0/61 (0%)
 Frame = +1

Query  634  PSSGGSSLEIFSLSKLSNSLEQLLSDTTSDFSDADIVVEGTTVGVHRCILAARSNFFHVL  813
            PSS  S+ E+ SLSKLS++LEQLL++   D+SDA+I+V+G  VGVHRCILAARS FF  L
Sbjct  29   PSSTASNPEVVSLSKLSSNLEQLLNNPDFDYSDAEIIVDGVPVGVHRCILAARSKFFQEL  88

Query  814  F  816
            F
Sbjct  89   F  89



>ref|XP_009128768.1| PREDICTED: LOW QUALITY PROTEIN: regulatory protein NPR3-like 
[Brassica rapa]
Length=597

 Score = 82.8 bits (203),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 41/63 (65%), Positives = 50/63 (79%), Gaps = 1/63 (2%)
 Frame = +1

Query  628  IVPSSGGSSLEIFSLSKLSNSLEQLLSDTTSDFSDADIVVEGTTVGVHRCILAARSNFFH  807
            I PSS  S+LE+ SL+KLS++LEQLLS    D++DA+I+VEG  VGVHRCILAARS FF 
Sbjct  40   ISPSSA-SNLEVISLTKLSSNLEQLLSSPDCDYTDAEIIVEGVPVGVHRCILAARSKFFE  98

Query  808  VLF  816
             LF
Sbjct  99   QLF  101



>gb|ACJ45012.1| NPR1-1 protein [Glycine max]
Length=495

 Score = 82.4 bits (202),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 42/66 (64%), Positives = 49/66 (74%), Gaps = 3/66 (5%)
 Frame = +1

Query  628  IVPSSG---GSSLEIFSLSKLSNSLEQLLSDTTSDFSDADIVVEGTTVGVHRCILAARSN  798
            I PS G   G +LE  SLSKLS++LEQLL +   D+SDAD+VVEG  V VHRCILA+RS 
Sbjct  28   ICPSYGSDPGPNLEAISLSKLSSNLEQLLIEPDCDYSDADLVVEGIPVSVHRCILASRSK  87

Query  799  FFHVLF  816
            FFH LF
Sbjct  88   FFHELF  93



>ref|XP_004497710.1| PREDICTED: regulatory protein NPR3-like [Cicer arietinum]
Length=595

 Score = 82.4 bits (202),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 39/60 (65%), Positives = 49/60 (82%), Gaps = 0/60 (0%)
 Frame = +1

Query  637  SSGGSSLEIFSLSKLSNSLEQLLSDTTSDFSDADIVVEGTTVGVHRCILAARSNFFHVLF  816
            S  G +LE+ SLSKLS++LEQLL D+ +D+SDA+IVVEG  V VHRC+LA+RS FFH LF
Sbjct  35   SDHGRNLEVISLSKLSSNLEQLLIDSDNDYSDAEIVVEGIPVRVHRCVLASRSKFFHELF  94



>ref|NP_001238658.1| NPR1-1 protein [Glycine max]
 gb|ACJ45013.1| NPR1-1 protein [Glycine max]
 gb|KHN22972.1| Regulatory protein NPR3 [Glycine soja]
Length=590

 Score = 82.4 bits (202),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 42/66 (64%), Positives = 49/66 (74%), Gaps = 3/66 (5%)
 Frame = +1

Query  628  IVPSSG---GSSLEIFSLSKLSNSLEQLLSDTTSDFSDADIVVEGTTVGVHRCILAARSN  798
            I PS G   G +LE  SLSKLS++LEQLL +   D+SDAD+VVEG  V VHRCILA+RS 
Sbjct  28   ICPSYGSDPGPNLEAISLSKLSSNLEQLLIEPDCDYSDADLVVEGIPVSVHRCILASRSK  87

Query  799  FFHVLF  816
            FFH LF
Sbjct  88   FFHELF  93



>emb|CDP17457.1| unnamed protein product [Coffea canephora]
Length=590

 Score = 82.4 bits (202),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 41/65 (63%), Positives = 54/65 (83%), Gaps = 3/65 (5%)
 Frame = +1

Query  631  VPSSG---GSSLEIFSLSKLSNSLEQLLSDTTSDFSDADIVVEGTTVGVHRCILAARSNF  801
            +PS+G   G+SL++ +L+KLS SLE+LL D   D+SDA+IVVEGT+VGV+RCILA+RS F
Sbjct  28   MPSAGHEPGASLDLLTLTKLSGSLEKLLLDAEFDYSDAEIVVEGTSVGVNRCILASRSPF  87

Query  802  FHVLF  816
            FH LF
Sbjct  88   FHDLF  92



>gb|ACJ45014.1| NPR1-2 protein [Glycine max]
Length=502

 Score = 82.0 bits (201),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 40/60 (67%), Positives = 47/60 (78%), Gaps = 0/60 (0%)
 Frame = +1

Query  637  SSGGSSLEIFSLSKLSNSLEQLLSDTTSDFSDADIVVEGTTVGVHRCILAARSNFFHVLF  816
            S  G +LE  SLSKLS++ EQLL +T  D+SDADIVVEG +V VHRCILA+RS FFH LF
Sbjct  34   SDPGPNLEALSLSKLSSNFEQLLIETDCDYSDADIVVEGISVSVHRCILASRSKFFHELF  93



>gb|KHN14362.1| Regulatory protein NPR3 [Glycine soja]
Length=590

 Score = 82.0 bits (201),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 40/60 (67%), Positives = 47/60 (78%), Gaps = 0/60 (0%)
 Frame = +1

Query  637  SSGGSSLEIFSLSKLSNSLEQLLSDTTSDFSDADIVVEGTTVGVHRCILAARSNFFHVLF  816
            S  G +LE  SLSKLS++ EQLL +T  D+SDADIVVEG +V VHRCILA+RS FFH LF
Sbjct  34   SDPGPNLEALSLSKLSSNFEQLLIETDCDYSDADIVVEGISVSVHRCILASRSKFFHELF  93



>ref|NP_001238674.1| NPR1-2 protein [Glycine max]
 gb|ACJ45015.1| NPR1-2 protein [Glycine max]
Length=590

 Score = 82.0 bits (201),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 40/60 (67%), Positives = 47/60 (78%), Gaps = 0/60 (0%)
 Frame = +1

Query  637  SSGGSSLEIFSLSKLSNSLEQLLSDTTSDFSDADIVVEGTTVGVHRCILAARSNFFHVLF  816
            S  G +LE  SLSKLS++ EQLL +T  D+SDADIVVEG +V VHRCILA+RS FFH LF
Sbjct  34   SDPGPNLEALSLSKLSSNFEQLLIETDCDYSDADIVVEGISVSVHRCILASRSKFFHELF  93



>ref|XP_007147518.1| hypothetical protein PHAVU_006G131400g [Phaseolus vulgaris]
 gb|ESW19512.1| hypothetical protein PHAVU_006G131400g [Phaseolus vulgaris]
Length=590

 Score = 82.0 bits (201),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 38/60 (63%), Positives = 48/60 (80%), Gaps = 0/60 (0%)
 Frame = +1

Query  637  SSGGSSLEIFSLSKLSNSLEQLLSDTTSDFSDADIVVEGTTVGVHRCILAARSNFFHVLF  816
            S  G +LE+ SLSKLS++LEQLL ++  D+SDADI+VEG  V VHRC+LA+RS FFH LF
Sbjct  34   SDPGPNLEVVSLSKLSSNLEQLLIESDCDYSDADIIVEGIPVSVHRCVLASRSKFFHELF  93



>emb|CDY26398.1| BnaA02g23720D [Brassica napus]
Length=562

 Score = 81.3 bits (199),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 38/62 (61%), Positives = 48/62 (77%), Gaps = 0/62 (0%)
 Frame = +1

Query  631  VPSSGGSSLEIFSLSKLSNSLEQLLSDTTSDFSDADIVVEGTTVGVHRCILAARSNFFHV  810
            + +S  S+LE+ SL+KLS++LEQLLS    D++DA+I VEG  VGVHRCILAARS FF  
Sbjct  28   ISASSASNLEVISLNKLSSNLEQLLSSPDCDYTDAEITVEGVPVGVHRCILAARSKFFEQ  87

Query  811  LF  816
            LF
Sbjct  88   LF  89



>ref|XP_011032773.1| PREDICTED: regulatory protein NPR3-like [Populus euphratica]
Length=586

 Score = 81.3 bits (199),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 42/62 (68%), Positives = 47/62 (76%), Gaps = 1/62 (2%)
 Frame = +1

Query  631  VPSSGGSSLEIFSLSKLSNSLEQLLSDTTSDFSDADIVVEGTTVGVHRCILAARSNFFHV  810
            VP  G  +LE  SLSKLS +LE+LL D   D+SDA+IVVEG  VGVHRCILAARS FFH 
Sbjct  33   VPEPG-VNLENLSLSKLSGNLERLLLDGEYDYSDAEIVVEGIPVGVHRCILAARSQFFHE  91

Query  811  LF  816
            LF
Sbjct  92   LF  93



>ref|XP_010092646.1| Regulatory protein [Morus notabilis]
 gb|EXB51897.1| Regulatory protein [Morus notabilis]
Length=582

 Score = 80.9 bits (198),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 38/55 (69%), Positives = 46/55 (84%), Gaps = 0/55 (0%)
 Frame = +1

Query  652  SLEIFSLSKLSNSLEQLLSDTTSDFSDADIVVEGTTVGVHRCILAARSNFFHVLF  816
            SLE  SL+KLS +L+QLL  ++ D+SDAD++VEGT VGVHRCILAARS FFH LF
Sbjct  32   SLEAMSLNKLSANLDQLLVGSSCDYSDADVIVEGTRVGVHRCILAARSGFFHDLF  86



>ref|XP_007214668.1| hypothetical protein PRUPE_ppa003290mg [Prunus persica]
 gb|EMJ15867.1| hypothetical protein PRUPE_ppa003290mg [Prunus persica]
Length=587

 Score = 80.5 bits (197),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 38/54 (70%), Positives = 47/54 (87%), Gaps = 0/54 (0%)
 Frame = +1

Query  655  LEIFSLSKLSNSLEQLLSDTTSDFSDADIVVEGTTVGVHRCILAARSNFFHVLF  816
            LE+ SLSKLS++LEQLL D+  D+SDADI+VEG +VGVHRCILA+RS+FF  LF
Sbjct  39   LEVISLSKLSSNLEQLLVDSGCDYSDADIIVEGISVGVHRCILASRSSFFRDLF  92



>ref|XP_002300863.2| hypothetical protein POPTR_0002s05740g, partial [Populus trichocarpa]
 gb|EEE80136.2| hypothetical protein POPTR_0002s05740g, partial [Populus trichocarpa]
Length=435

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 47/62 (76%), Gaps = 1/62 (2%)
 Frame = +1

Query  631  VPSSGGSSLEIFSLSKLSNSLEQLLSDTTSDFSDADIVVEGTTVGVHRCILAARSNFFHV  810
            VP  G  +LE  SL+KLS +LE+LL D   D+SDA+I VEGT VGVHRC+LAARS FFH 
Sbjct  33   VPEPG-VNLENLSLNKLSGNLERLLLDKEYDYSDAEIFVEGTPVGVHRCVLAARSQFFHE  91

Query  811  LF  816
            LF
Sbjct  92   LF  93



>ref|XP_009397343.1| PREDICTED: regulatory protein NPR3-like [Musa acuminata subsp. 
malaccensis]
Length=595

 Score = 80.5 bits (197),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 38/59 (64%), Positives = 46/59 (78%), Gaps = 0/59 (0%)
 Frame = +1

Query  640  SGGSSLEIFSLSKLSNSLEQLLSDTTSDFSDADIVVEGTTVGVHRCILAARSNFFHVLF  816
             GG++LE+ SLSKLS +LE+LL DT  D +DA+I VEG  VG+HRCILAARS FF  LF
Sbjct  44   EGGTNLEVLSLSKLSTNLERLLLDTEFDCTDAEIAVEGAPVGIHRCILAARSRFFRDLF  102



>ref|XP_011026213.1| PREDICTED: regulatory protein NPR3-like [Populus euphratica]
 ref|XP_011026214.1| PREDICTED: regulatory protein NPR3-like [Populus euphratica]
Length=591

 Score = 80.1 bits (196),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 47/62 (76%), Gaps = 1/62 (2%)
 Frame = +1

Query  631  VPSSGGSSLEIFSLSKLSNSLEQLLSDTTSDFSDADIVVEGTTVGVHRCILAARSNFFHV  810
            VP  G  +LE  SL+KLS +LE+LL D   D+SDA+I VEGT VGVHRC+LAARS FFH 
Sbjct  33   VPEPG-VNLENLSLNKLSGNLERLLLDKEYDYSDAEIFVEGTPVGVHRCVLAARSQFFHE  91

Query  811  LF  816
            LF
Sbjct  92   LF  93



>gb|AGL61506.1| NPR1 [Morus alba var. multicaulis]
Length=581

 Score = 80.1 bits (196),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 38/55 (69%), Positives = 45/55 (82%), Gaps = 0/55 (0%)
 Frame = +1

Query  652  SLEIFSLSKLSNSLEQLLSDTTSDFSDADIVVEGTTVGVHRCILAARSNFFHVLF  816
            S E  SL+KLS +LEQLL  ++ D+SDAD++VEGT VGVHRCILAARS FFH LF
Sbjct  32   SFEAMSLNKLSANLEQLLVGSSCDYSDADVIVEGTHVGVHRCILAARSGFFHDLF  86



>ref|XP_004486434.1| PREDICTED: regulatory protein NPR3-like isoform X2 [Cicer arietinum]
Length=591

 Score = 79.3 bits (194),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 37/55 (67%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = +1

Query  652  SLEIFSLSKLSNSLEQLLSDTTSDFSDADIVVEGTTVGVHRCILAARSNFFHVLF  816
            +LE+ SLSKLS++LEQLL D+ +D+SDA+IVVEG  V VHRC+LA+RS FFH LF
Sbjct  40   NLEVISLSKLSSNLEQLLIDSDNDYSDAEIVVEGILVRVHRCVLASRSKFFHELF  94



>ref|XP_008225741.1| PREDICTED: regulatory protein NPR3-like [Prunus mume]
Length=587

 Score = 79.0 bits (193),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 38/54 (70%), Positives = 47/54 (87%), Gaps = 0/54 (0%)
 Frame = +1

Query  655  LEIFSLSKLSNSLEQLLSDTTSDFSDADIVVEGTTVGVHRCILAARSNFFHVLF  816
            LE+ SLSKLS++LEQLL D+  D+SDADI+VEG +VGVHRCILA+RS+FF  LF
Sbjct  39   LEVISLSKLSSNLEQLLVDSGCDYSDADIIVEGISVGVHRCILASRSSFFCDLF  92



>ref|XP_004486433.1| PREDICTED: regulatory protein NPR3-like isoform X1 [Cicer arietinum]
Length=595

 Score = 79.0 bits (193),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 37/55 (67%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = +1

Query  652  SLEIFSLSKLSNSLEQLLSDTTSDFSDADIVVEGTTVGVHRCILAARSNFFHVLF  816
            +LE+ SLSKLS++LEQLL D+ +D+SDA+IVVEG  V VHRC+LA+RS FFH LF
Sbjct  40   NLEVISLSKLSSNLEQLLIDSDNDYSDAEIVVEGILVRVHRCVLASRSKFFHELF  94



>ref|XP_006398160.1| hypothetical protein EUTSA_v10000824mg [Eutrema salsugineum]
 gb|ESQ39613.1| hypothetical protein EUTSA_v10000824mg [Eutrema salsugineum]
Length=588

 Score = 79.0 bits (193),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 39/61 (64%), Positives = 49/61 (80%), Gaps = 1/61 (2%)
 Frame = +1

Query  634  PSSGGSSLEIFSLSKLSNSLEQLLSDTTSDFSDADIVVEGTTVGVHRCILAARSNFFHVL  813
            PSS  S+LE+ SL+KLS +LEQLLS+   D++DA+I+V+G  VGVHRCILAARS FF  L
Sbjct  30   PSSA-SNLEVVSLTKLSTNLEQLLSNPDCDYTDAEIIVDGVPVGVHRCILAARSKFFLEL  88

Query  814  F  816
            F
Sbjct  89   F  89



>ref|XP_008787319.1| PREDICTED: regulatory protein NPR3-like [Phoenix dactylifera]
Length=585

 Score = 79.0 bits (193),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 38/55 (69%), Positives = 46/55 (84%), Gaps = 0/55 (0%)
 Frame = +1

Query  652  SLEIFSLSKLSNSLEQLLSDTTSDFSDADIVVEGTTVGVHRCILAARSNFFHVLF  816
            SLE+ SLSKLS++LE+LL D+  D SDA++VVEG  VG+HRCILAARS FFH LF
Sbjct  38   SLEVVSLSKLSSNLERLLVDSEFDCSDAEVVVEGAPVGIHRCILAARSRFFHDLF  92



>ref|XP_007141442.1| hypothetical protein PHAVU_008G195900g [Phaseolus vulgaris]
 gb|ESW13436.1| hypothetical protein PHAVU_008G195900g [Phaseolus vulgaris]
Length=588

 Score = 79.0 bits (193),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 37/57 (65%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = +1

Query  646  GSSLEIFSLSKLSNSLEQLLSDTTSDFSDADIVVEGTTVGVHRCILAARSNFFHVLF  816
            G+++EI +L+KLS SLE+LL D   D+SDA+IVVE  +VGVHRCILA+RS FFH LF
Sbjct  36   GANIEILTLNKLSGSLEKLLIDAEYDYSDAEIVVEDISVGVHRCILASRSPFFHELF  92



>ref|XP_008806697.1| PREDICTED: regulatory protein NPR3-like [Phoenix dactylifera]
 ref|XP_008806698.1| PREDICTED: regulatory protein NPR3-like [Phoenix dactylifera]
 ref|XP_008806699.1| PREDICTED: regulatory protein NPR3-like [Phoenix dactylifera]
Length=591

 Score = 79.0 bits (193),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = +1

Query  655  LEIFSLSKLSNSLEQLLSDTTSDFSDADIVVEGTTVGVHRCILAARSNFFHVLF  816
            LE+ SLSKLS++LE+LL D+  D SDA+IVVEG  VGVHRCILAARS FFH LF
Sbjct  44   LEVVSLSKLSSNLERLLLDSEFDCSDAEIVVEGAPVGVHRCILAARSRFFHDLF  97



>ref|XP_010908601.1| PREDICTED: regulatory protein NPR3-like [Elaeis guineensis]
 ref|XP_010908602.1| PREDICTED: regulatory protein NPR3-like [Elaeis guineensis]
Length=587

 Score = 78.2 bits (191),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 38/55 (69%), Positives = 46/55 (84%), Gaps = 0/55 (0%)
 Frame = +1

Query  652  SLEIFSLSKLSNSLEQLLSDTTSDFSDADIVVEGTTVGVHRCILAARSNFFHVLF  816
            SLE+ SL KLS++LE+LL+D+  D+SDA+IVVEG  VGVHRCILAARS FF  LF
Sbjct  40   SLEVVSLGKLSSNLERLLADSEFDYSDAEIVVEGAPVGVHRCILAARSRFFLDLF  94



>ref|XP_011096773.1| PREDICTED: regulatory protein NPR3-like [Sesamum indicum]
Length=563

 Score = 77.8 bits (190),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 39/59 (66%), Positives = 46/59 (78%), Gaps = 0/59 (0%)
 Frame = +1

Query  640  SGGSSLEIFSLSKLSNSLEQLLSDTTSDFSDADIVVEGTTVGVHRCILAARSNFFHVLF  816
              G +LEI SLSKLS +L QLL ++ +DFSDADIVVE  +VG+HRCILAARS FF  LF
Sbjct  12   EAGLNLEIISLSKLSCNLGQLLCESGADFSDADIVVEDNSVGIHRCILAARSKFFFDLF  70



>ref|XP_004303898.1| PREDICTED: regulatory protein NPR3-like [Fragaria vesca subsp. 
vesca]
 ref|XP_011467613.1| PREDICTED: regulatory protein NPR3-like [Fragaria vesca subsp. 
vesca]
 ref|XP_011467614.1| PREDICTED: regulatory protein NPR3-like [Fragaria vesca subsp. 
vesca]
 ref|XP_011467615.1| PREDICTED: regulatory protein NPR3-like [Fragaria vesca subsp. 
vesca]
 ref|XP_011467616.1| PREDICTED: regulatory protein NPR3-like [Fragaria vesca subsp. 
vesca]
Length=591

 Score = 77.4 bits (189),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 38/60 (63%), Positives = 46/60 (77%), Gaps = 0/60 (0%)
 Frame = +1

Query  637  SSGGSSLEIFSLSKLSNSLEQLLSDTTSDFSDADIVVEGTTVGVHRCILAARSNFFHVLF  816
            S+   S E  SLS+LS++LE+LL D+  D+SDADIVVEG  VGV+RCILAARS FFH  F
Sbjct  30   SANSQSTEHLSLSRLSDNLERLLLDSQYDYSDADIVVEGVPVGVNRCILAARSQFFHEHF  89



>ref|XP_008459083.1| PREDICTED: regulatory protein NPR3-like [Cucumis melo]
Length=586

 Score = 77.0 bits (188),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 37/60 (62%), Positives = 44/60 (73%), Gaps = 0/60 (0%)
 Frame = +1

Query  637  SSGGSSLEIFSLSKLSNSLEQLLSDTTSDFSDADIVVEGTTVGVHRCILAARSNFFHVLF  816
            S    SLE+ SL+KLS++L QLL     D++DADIVVEG  VG+HRCILA RS FFH LF
Sbjct  33   SDPMPSLEVISLNKLSSNLAQLLIHDGCDYTDADIVVEGVPVGIHRCILAVRSRFFHYLF  92



>dbj|BAB09496.1| regulatory protein NPR1-like; transcription factor inhibitor 
I kappa B-like [Arabidopsis thaliana]
Length=593

 Score = 77.0 bits (188),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 35/53 (66%), Positives = 45/53 (85%), Gaps = 0/53 (0%)
 Frame = +1

Query  658  EIFSLSKLSNSLEQLLSDTTSDFSDADIVVEGTTVGVHRCILAARSNFFHVLF  816
            E+ SL+KLS++LEQLLS++  D+SDA+I+V+G  VGVHRCILAARS FF  LF
Sbjct  37   EVVSLTKLSSNLEQLLSNSDCDYSDAEIIVDGVPVGVHRCILAARSKFFQDLF  89



>ref|NP_199324.2| NPR1-like protein 3 [Arabidopsis thaliana]
 sp|Q8L746.1|NPR3_ARATH RecName: Full=Regulatory protein NPR3; AltName: Full=BTB/POZ 
domain-containing protein NPR3 [Arabidopsis thaliana]
 gb|AAM98084.1| AT5g45110/K17O22_11 [Arabidopsis thaliana]
 gb|AAO42783.1| AT5g45110/K17O22_11 [Arabidopsis thaliana]
 gb|AED95205.1| NPR1-like protein 3 [Arabidopsis thaliana]
Length=586

 Score = 77.0 bits (188),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 35/53 (66%), Positives = 45/53 (85%), Gaps = 0/53 (0%)
 Frame = +1

Query  658  EIFSLSKLSNSLEQLLSDTTSDFSDADIVVEGTTVGVHRCILAARSNFFHVLF  816
            E+ SL+KLS++LEQLLS++  D+SDA+I+V+G  VGVHRCILAARS FF  LF
Sbjct  37   EVVSLTKLSSNLEQLLSNSDCDYSDAEIIVDGVPVGVHRCILAARSKFFQDLF  89



>emb|CDP17620.1| unnamed protein product [Coffea canephora]
Length=588

 Score = 76.6 bits (187),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 35/60 (58%), Positives = 47/60 (78%), Gaps = 0/60 (0%)
 Frame = +1

Query  637  SSGGSSLEIFSLSKLSNSLEQLLSDTTSDFSDADIVVEGTTVGVHRCILAARSNFFHVLF  816
            S   S+L++ SLSKLS++LEQLL +   D+SDA+I VE  ++G+HRCI+AARS FFH LF
Sbjct  35   SEARSALQMISLSKLSSNLEQLLPEAGCDYSDAEIEVEAISIGIHRCIVAARSKFFHDLF  94



>ref|XP_003519533.1| PREDICTED: regulatory protein NPR3-like isoform X1 [Glycine max]
 ref|XP_006575639.1| PREDICTED: regulatory protein NPR3-like isoform X2 [Glycine max]
 ref|XP_006575640.1| PREDICTED: regulatory protein NPR3-like isoform X3 [Glycine max]
Length=590

 Score = 76.6 bits (187),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 36/57 (63%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = +1

Query  646  GSSLEIFSLSKLSNSLEQLLSDTTSDFSDADIVVEGTTVGVHRCILAARSNFFHVLF  816
            G+++EI SL+KLS SLE+LL +T  D+SDA+I+VE   VG+HRCILA+RS FFH LF
Sbjct  36   GANIEILSLNKLSGSLEKLLIETEYDYSDAEILVEDIPVGIHRCILASRSLFFHELF  92



>ref|XP_010536418.1| PREDICTED: regulatory protein NPR3-like isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010536426.1| PREDICTED: regulatory protein NPR3-like isoform X1 [Tarenaya 
hassleriana]
Length=587

 Score = 76.6 bits (187),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 37/60 (62%), Positives = 49/60 (82%), Gaps = 0/60 (0%)
 Frame = +1

Query  637  SSGGSSLEIFSLSKLSNSLEQLLSDTTSDFSDADIVVEGTTVGVHRCILAARSNFFHVLF  816
            SS  ++LE+ +LSKLS++LEQLL +  SD+SDA+I ++G +VGVHRCILAARS FF  LF
Sbjct  33   SSSATNLEVVALSKLSSNLEQLLFELDSDYSDAEIFIDGVSVGVHRCILAARSKFFVELF  92



>emb|CDY36698.1| BnaC02g31190D [Brassica napus]
Length=509

 Score = 76.3 bits (186),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 38/63 (60%), Positives = 47/63 (75%), Gaps = 1/63 (2%)
 Frame = +1

Query  628  IVPSSGGSSLEIFSLSKLSNSLEQLLSDTTSDFSDADIVVEGTTVGVHRCILAARSNFFH  807
            I PSS  S+L++ SL+KLS++LEQL S    D++DA I+VEG  VGVHRCILA RS FF 
Sbjct  94   ISPSSA-SNLQVISLTKLSSNLEQLPSSPDCDYTDAKIIVEGVPVGVHRCILAERSKFFE  152

Query  808  VLF  816
             LF
Sbjct  153  ELF  155



>emb|CDX82577.1| BnaC07g02890D [Brassica napus]
Length=542

 Score = 76.3 bits (186),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 37/60 (62%), Positives = 48/60 (80%), Gaps = 1/60 (2%)
 Frame = +1

Query  640  SGGSSLEIFSLSKLSNSLEQLLS-DTTSDFSDADIVVEGTTVGVHRCILAARSNFFHVLF  816
            S  S+LE+ SLSKLS++LEQLLS +   D++DA+I+V+G  VGVHRCIL+ARS FF  LF
Sbjct  31   SSASNLEVVSLSKLSSNLEQLLSSNPDCDYTDAEIIVDGVPVGVHRCILSARSKFFQELF  90



>emb|CDY39410.1| BnaAnng05410D [Brassica napus]
Length=546

 Score = 76.3 bits (186),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 37/60 (62%), Positives = 48/60 (80%), Gaps = 1/60 (2%)
 Frame = +1

Query  640  SGGSSLEIFSLSKLSNSLEQLLS-DTTSDFSDADIVVEGTTVGVHRCILAARSNFFHVLF  816
            S  S+LE+ SLSKLS++LEQLLS +   D++DA+I+V+G  VGVHRCIL+ARS FF  LF
Sbjct  31   SSASNLEVVSLSKLSSNLEQLLSSNPDCDYTDAEIIVDGVPVGVHRCILSARSKFFQELF  90



>ref|XP_009101624.1| PREDICTED: LOW QUALITY PROTEIN: regulatory protein NPR3 [Brassica 
rapa]
Length=583

 Score = 75.9 bits (185),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 37/60 (62%), Positives = 48/60 (80%), Gaps = 1/60 (2%)
 Frame = +1

Query  640  SGGSSLEIFSLSKLSNSLEQLLS-DTTSDFSDADIVVEGTTVGVHRCILAARSNFFHVLF  816
            S  S+LE+ SLSKLS++LEQLLS +   D++DA+I+V+G  VGVHRCIL+ARS FF  LF
Sbjct  31   SSASNLEVVSLSKLSSNLEQLLSSNPDCDYTDAEIIVDGVPVGVHRCILSARSKFFQELF  90



>gb|KFK41854.1| hypothetical protein AALP_AA2G179400 [Arabis alpina]
Length=587

 Score = 75.5 bits (184),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 36/54 (67%), Positives = 44/54 (81%), Gaps = 0/54 (0%)
 Frame = +1

Query  655  LEIFSLSKLSNSLEQLLSDTTSDFSDADIVVEGTTVGVHRCILAARSNFFHVLF  816
            LE+ SLSKLS++LEQLLS+   D+SDA+I+V G +V VHRCILAARS FF  LF
Sbjct  36   LEVVSLSKLSSNLEQLLSNPDCDYSDAEIIVGGVSVSVHRCILAARSKFFQELF  89



>ref|XP_003594464.1| NPR1-1 protein [Medicago truncatula]
 gb|AES64715.1| regulatory protein NPR1 [Medicago truncatula]
Length=589

 Score = 75.5 bits (184),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 34/60 (57%), Positives = 45/60 (75%), Gaps = 0/60 (0%)
 Frame = +1

Query  637  SSGGSSLEIFSLSKLSNSLEQLLSDTTSDFSDADIVVEGTTVGVHRCILAARSNFFHVLF  816
            S    +LE+ SL+KLS++LEQLL D+  D+ DADI+VEG  V +HRCIL +RS FFH +F
Sbjct  34   SDHARNLEVISLNKLSSNLEQLLIDSDYDYGDADIIVEGIPVRIHRCILGSRSKFFHEIF  93



>gb|KEH37013.1| regulatory protein NPR1 [Medicago truncatula]
Length=509

 Score = 75.1 bits (183),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 34/60 (57%), Positives = 45/60 (75%), Gaps = 0/60 (0%)
 Frame = +1

Query  637  SSGGSSLEIFSLSKLSNSLEQLLSDTTSDFSDADIVVEGTTVGVHRCILAARSNFFHVLF  816
            S    +LE+ SL+KLS++LEQLL D+  D+ DADI+VEG  V +HRCIL +RS FFH +F
Sbjct  34   SDHARNLEVISLNKLSSNLEQLLIDSDYDYGDADIIVEGIPVRIHRCILGSRSKFFHEIF  93



>ref|XP_010538609.1| PREDICTED: regulatory protein NPR3-like [Tarenaya hassleriana]
Length=588

 Score = 75.1 bits (183),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 36/60 (60%), Positives = 48/60 (80%), Gaps = 0/60 (0%)
 Frame = +1

Query  637  SSGGSSLEIFSLSKLSNSLEQLLSDTTSDFSDADIVVEGTTVGVHRCILAARSNFFHVLF  816
            +S  ++LE+ SLSKLS++LEQLL D+   +SDA+I++ G +VGVHRCILAARS FF  LF
Sbjct  33   NSSAANLEVASLSKLSSNLEQLLIDSDCGYSDAEIIINGVSVGVHRCILAARSKFFLELF  92



>gb|KEH28396.1| NPR1/NIM1-like regulatory protein, putative [Medicago truncatula]
Length=456

 Score = 74.7 bits (182),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 35/53 (66%), Positives = 42/53 (79%), Gaps = 0/53 (0%)
 Frame = +1

Query  658  EIFSLSKLSNSLEQLLSDTTSDFSDADIVVEGTTVGVHRCILAARSNFFHVLF  816
            EI SL+KLS SLE+LLSD   D+ DA+I+VE   VG+HRCILA+RS FFH LF
Sbjct  44   EIVSLNKLSGSLEKLLSDVDYDYCDAEILVEEIPVGIHRCILASRSQFFHELF  96



>gb|KHN11992.1| Regulatory protein NPR3 [Glycine soja]
Length=590

 Score = 75.1 bits (183),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 34/57 (60%), Positives = 45/57 (79%), Gaps = 0/57 (0%)
 Frame = +1

Query  646  GSSLEIFSLSKLSNSLEQLLSDTTSDFSDADIVVEGTTVGVHRCILAARSNFFHVLF  816
            G ++EI SL+KLS SLE+LL +   D+SDA+I++E   VG+HRCILA+RS FFH LF
Sbjct  36   GENIEILSLNKLSGSLEKLLIEVEYDYSDAEILIEDIPVGIHRCILASRSPFFHELF  92



>ref|XP_003545296.1| PREDICTED: regulatory protein NPR3-like [Glycine max]
Length=590

 Score = 75.1 bits (183),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 34/57 (60%), Positives = 45/57 (79%), Gaps = 0/57 (0%)
 Frame = +1

Query  646  GSSLEIFSLSKLSNSLEQLLSDTTSDFSDADIVVEGTTVGVHRCILAARSNFFHVLF  816
            G ++EI SL+KLS SLE+LL +   D+SDA+I++E   VG+HRCILA+RS FFH LF
Sbjct  36   GENIEILSLNKLSGSLEKLLIEVEYDYSDAEILIEDIPVGIHRCILASRSPFFHELF  92



>ref|XP_003617362.1| NPR1-1 protein [Medicago truncatula]
 gb|AET00321.1| NPR1/NIM1-like regulatory protein, putative [Medicago truncatula]
Length=594

 Score = 74.7 bits (182),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 35/56 (63%), Positives = 44/56 (79%), Gaps = 0/56 (0%)
 Frame = +1

Query  649  SSLEIFSLSKLSNSLEQLLSDTTSDFSDADIVVEGTTVGVHRCILAARSNFFHVLF  816
            ++ EI SL+KLS SLE+LLSD   D+ DA+I+VE   VG+HRCILA+RS FFH LF
Sbjct  41   ANTEIVSLNKLSGSLEKLLSDVDYDYCDAEILVEEIPVGIHRCILASRSQFFHELF  96



>ref|XP_008229582.1| PREDICTED: regulatory protein NPR3-like [Prunus mume]
Length=589

 Score = 72.4 bits (176),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 36/56 (64%), Positives = 46/56 (82%), Gaps = 1/56 (2%)
 Frame = +1

Query  652  SLEIF-SLSKLSNSLEQLLSDTTSDFSDADIVVEGTTVGVHRCILAARSNFFHVLF  816
            S+EI+ SL+KLS SLE+LL +   D++DA+I+VEG TVGV+RCILAARS FF  LF
Sbjct  39   SIEIYLSLNKLSGSLERLLLEPEYDYNDAEIIVEGNTVGVNRCILAARSQFFQDLF  94



>ref|XP_007214958.1| hypothetical protein PRUPE_ppa003232mg [Prunus persica]
 gb|EMJ16157.1| hypothetical protein PRUPE_ppa003232mg [Prunus persica]
Length=590

 Score = 72.4 bits (176),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 36/56 (64%), Positives = 46/56 (82%), Gaps = 1/56 (2%)
 Frame = +1

Query  652  SLEIF-SLSKLSNSLEQLLSDTTSDFSDADIVVEGTTVGVHRCILAARSNFFHVLF  816
            S+EI+ SL+KLS SLE+LL +   D++DA+I+VEG TVGV+RCILAARS FF  LF
Sbjct  39   SIEIYLSLNKLSGSLERLLLEPEYDYNDAEIIVEGNTVGVNRCILAARSEFFQDLF  94



>ref|XP_007213800.1| hypothetical protein PRUPE_ppa003221mg [Prunus persica]
 gb|EMJ14999.1| hypothetical protein PRUPE_ppa003221mg [Prunus persica]
Length=591

 Score = 72.4 bits (176),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 37/56 (66%), Positives = 49/56 (88%), Gaps = 1/56 (2%)
 Frame = +1

Query  652  SLEIFSLSKLSNSLEQLL-SDTTSDFSDADIVVEGTTVGVHRCILAARSNFFHVLF  816
            SLE+ SL+KLS++LEQLL  D++SD+SDA I+VEG +VGV+RCILA+RS+FF  LF
Sbjct  41   SLEVISLTKLSSNLEQLLLVDSSSDYSDAVIIVEGKSVGVYRCILASRSSFFGELF  96



>ref|XP_008348376.1| PREDICTED: LOW QUALITY PROTEIN: regulatory protein NPR3-like, 
partial [Malus domestica]
Length=586

 Score = 72.4 bits (176),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 35/51 (69%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = +1

Query  664  FSLSKLSNSLEQLLSDTTSDFSDADIVVEGTTVGVHRCILAARSNFFHVLF  816
             SLSKLS++LE+LL D   D+SDA+IVVEG TVGV+RCILA+RS FF  LF
Sbjct  39   LSLSKLSDNLERLLLDPEFDYSDAEIVVEGNTVGVNRCILASRSQFFQELF  89



>ref|XP_009356589.1| PREDICTED: regulatory protein NPR3-like [Pyrus x bretschneideri]
 ref|XP_009356590.1| PREDICTED: regulatory protein NPR3-like [Pyrus x bretschneideri]
Length=591

 Score = 72.4 bits (176),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 35/51 (69%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = +1

Query  664  FSLSKLSNSLEQLLSDTTSDFSDADIVVEGTTVGVHRCILAARSNFFHVLF  816
             SLSKLS++LE+LL D   D+SDA+IVVEG TVGV+RCILA+RS FF  LF
Sbjct  44   LSLSKLSDNLERLLLDPEFDYSDAEIVVEGNTVGVNRCILASRSQFFQELF  94



>ref|XP_008451832.1| PREDICTED: LOW QUALITY PROTEIN: regulatory protein NPR3-like 
[Cucumis melo]
Length=586

 Score = 71.2 bits (173),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 34/49 (69%), Positives = 40/49 (82%), Gaps = 0/49 (0%)
 Frame = +1

Query  670  LSKLSNSLEQLLSDTTSDFSDADIVVEGTTVGVHRCILAARSNFFHVLF  816
            LSKLS +LE+L+ D+  D++DA IVVEG  VGVHRCILAARS FFH LF
Sbjct  45   LSKLSANLEKLMVDSDFDYTDAVIVVEGIEVGVHRCILAARSQFFHELF  93



>ref|XP_008342334.1| PREDICTED: regulatory protein NPR3-like [Malus domestica]
Length=188

 Score = 68.2 bits (165),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 33/51 (65%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = +1

Query  664  FSLSKLSNSLEQLLSDTTSDFSDADIVVEGTTVGVHRCILAARSNFFHVLF  816
             SLSKLS++LE+LL D   D+ DA+IVVE  TVGV+RCILA+RS FF  LF
Sbjct  44   LSLSKLSDNLERLLLDHEYDYXDAEIVVERNTVGVNRCILASRSQFFQYLF  94



>gb|KGN53513.1| hypothetical protein Csa_4G063470 [Cucumis sativus]
Length=358

 Score = 70.5 bits (171),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 36/61 (59%), Positives = 44/61 (72%), Gaps = 3/61 (5%)
 Frame = +1

Query  634  PSSGGSSLEIFSLSKLSNSLEQLLSDTTSDFSDADIVVEGTTVGVHRCILAARSNFFHVL  813
            PS+    +    LSKLS +LE+L+ D+  D++DA IVVEG  VGVHRCILAARS FFH L
Sbjct  36   PSANSDHM---CLSKLSANLEKLVVDSDFDYTDAVIVVEGIEVGVHRCILAARSQFFHEL  92

Query  814  F  816
            F
Sbjct  93   F  93



>ref|XP_009377037.1| PREDICTED: regulatory protein NPR3-like [Pyrus x bretschneideri]
Length=583

 Score = 70.9 bits (172),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 34/51 (67%), Positives = 41/51 (80%), Gaps = 0/51 (0%)
 Frame = +1

Query  664  FSLSKLSNSLEQLLSDTTSDFSDADIVVEGTTVGVHRCILAARSNFFHVLF  816
             SL KLS++LE+LL D   D+SDA+IVVEG TVGV+RCILA+RS FF  LF
Sbjct  44   LSLRKLSDNLERLLLDHEYDYSDAEIVVEGNTVGVNRCILASRSQFFQDLF  94



>ref|XP_009786055.1| PREDICTED: regulatory protein NPR3-like isoform X2 [Nicotiana 
sylvestris]
Length=579

 Score = 70.9 bits (172),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 35/61 (57%), Positives = 45/61 (74%), Gaps = 2/61 (3%)
 Frame = +1

Query  634  PSSGGSSLEIFSLSKLSNSLEQLLSDTTSDFSDADIVVEGTTVGVHRCILAARSNFFHVL  813
            P   G +L++  LS LS SLE+LL +   D+SDA++VVEG +VGV+RCILAARS FFH  
Sbjct  26   PQEPGPNLDL--LSNLSGSLEKLLLNPEYDYSDAEVVVEGISVGVNRCILAARSQFFHEK  83

Query  814  F  816
            F
Sbjct  84   F  84



>ref|XP_009786050.1| PREDICTED: regulatory protein NPR3-like isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009786051.1| PREDICTED: regulatory protein NPR3-like isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009786052.1| PREDICTED: regulatory protein NPR3-like isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009786054.1| PREDICTED: regulatory protein NPR3-like isoform X1 [Nicotiana 
sylvestris]
Length=587

 Score = 70.9 bits (172),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 35/61 (57%), Positives = 45/61 (74%), Gaps = 2/61 (3%)
 Frame = +1

Query  634  PSSGGSSLEIFSLSKLSNSLEQLLSDTTSDFSDADIVVEGTTVGVHRCILAARSNFFHVL  813
            P   G +L++  LS LS SLE+LL +   D+SDA++VVEG +VGV+RCILAARS FFH  
Sbjct  26   PQEPGPNLDL--LSNLSGSLEKLLLNPEYDYSDAEVVVEGISVGVNRCILAARSQFFHEK  83

Query  814  F  816
            F
Sbjct  84   F  84



>ref|XP_004147747.2| PREDICTED: LOW QUALITY PROTEIN: regulatory protein NPR3-like 
[Cucumis sativus]
Length=580

 Score = 70.5 bits (171),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 34/49 (69%), Positives = 40/49 (82%), Gaps = 0/49 (0%)
 Frame = +1

Query  670  LSKLSNSLEQLLSDTTSDFSDADIVVEGTTVGVHRCILAARSNFFHVLF  816
            LSKLS +LE+L+ D+  D++DA IVVEG  VGVHRCILAARS FFH LF
Sbjct  45   LSKLSANLEKLVVDSDFDYTDAVIVVEGIEVGVHRCILAARSQFFHELF  93



>ref|XP_004491374.1| PREDICTED: regulatory protein NPR3-like [Cicer arietinum]
Length=571

 Score = 69.3 bits (168),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 34/61 (56%), Positives = 45/61 (74%), Gaps = 1/61 (2%)
 Frame = +1

Query  637  SSGGSSLEIFSLSKLSNSLEQL-LSDTTSDFSDADIVVEGTTVGVHRCILAARSNFFHVL  813
            +  G+++EI SL+KLS SLE+L L D   D+ DA+I+VE   VG+HRCILA+RS FFH  
Sbjct  36   NDNGANIEIVSLNKLSGSLEKLILGDIDYDYCDAEILVEEIPVGIHRCILASRSQFFHEH  95

Query  814  F  816
            F
Sbjct  96   F  96



>ref|XP_009629505.1| PREDICTED: regulatory protein NPR3-like [Nicotiana tomentosiformis]
 ref|XP_009629506.1| PREDICTED: regulatory protein NPR3-like [Nicotiana tomentosiformis]
 ref|XP_009629507.1| PREDICTED: regulatory protein NPR3-like [Nicotiana tomentosiformis]
 ref|XP_009629508.1| PREDICTED: regulatory protein NPR3-like [Nicotiana tomentosiformis]
 ref|XP_009629509.1| PREDICTED: regulatory protein NPR3-like [Nicotiana tomentosiformis]
Length=579

 Score = 69.3 bits (168),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 34/61 (56%), Positives = 45/61 (74%), Gaps = 2/61 (3%)
 Frame = +1

Query  634  PSSGGSSLEIFSLSKLSNSLEQLLSDTTSDFSDADIVVEGTTVGVHRCILAARSNFFHVL  813
            P   G +L++  L+ LS +LE+LL +   D+SDA+IVVEG +VGV+RCILAARS FFH  
Sbjct  26   PQEPGPNLDL--LTNLSGNLEKLLLNPEYDYSDAEIVVEGISVGVNRCILAARSQFFHEK  83

Query  814  F  816
            F
Sbjct  84   F  84



>gb|KCW89778.1| hypothetical protein EUGRSUZ_A02033 [Eucalyptus grandis]
Length=432

 Score = 68.9 bits (167),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 34/61 (56%), Positives = 44/61 (72%), Gaps = 1/61 (2%)
 Frame = +1

Query  634  PSSGGSSLEIFSLSKLSNSLEQLLSDTTSDFSDADIVVEGTTVGVHRCILAARSNFFHVL  813
            P SG +  ++ SL+KLS+SL++LL D    ++DA IVVEG  VGVHRC+LAARS F H  
Sbjct  30   PESGYNP-DLLSLTKLSDSLDKLLCDDDYGYTDAVIVVEGVPVGVHRCLLAARSQFLHEF  88

Query  814  F  816
            F
Sbjct  89   F  89



>gb|KCW89777.1| hypothetical protein EUGRSUZ_A02033 [Eucalyptus grandis]
Length=482

 Score = 68.9 bits (167),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 34/61 (56%), Positives = 44/61 (72%), Gaps = 1/61 (2%)
 Frame = +1

Query  634  PSSGGSSLEIFSLSKLSNSLEQLLSDTTSDFSDADIVVEGTTVGVHRCILAARSNFFHVL  813
            P SG +  ++ SL+KLS+SL++LL D    ++DA IVVEG  VGVHRC+LAARS F H  
Sbjct  30   PESGYNP-DLLSLTKLSDSLDKLLCDDDYGYTDAVIVVEGVPVGVHRCLLAARSQFLHEF  88

Query  814  F  816
            F
Sbjct  89   F  89



>ref|XP_010054033.1| PREDICTED: regulatory protein NPR3-like [Eucalyptus grandis]
 gb|KCW89776.1| hypothetical protein EUGRSUZ_A02033 [Eucalyptus grandis]
Length=574

 Score = 68.9 bits (167),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 34/61 (56%), Positives = 44/61 (72%), Gaps = 1/61 (2%)
 Frame = +1

Query  634  PSSGGSSLEIFSLSKLSNSLEQLLSDTTSDFSDADIVVEGTTVGVHRCILAARSNFFHVL  813
            P SG +  ++ SL+KLS+SL++LL D    ++DA IVVEG  VGVHRC+LAARS F H  
Sbjct  30   PESGYNP-DLLSLTKLSDSLDKLLCDDDYGYTDAVIVVEGVPVGVHRCLLAARSQFLHEF  88

Query  814  F  816
            F
Sbjct  89   F  89



>ref|XP_008342333.1| PREDICTED: regulatory protein NPR3-like [Malus domestica]
Length=585

 Score = 68.6 bits (166),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 34/51 (67%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = +1

Query  664  FSLSKLSNSLEQLLSDTTSDFSDADIVVEGTTVGVHRCILAARSNFFHVLF  816
             SLSKLS++LE LL D   D+SDA+IVVE  TVGV+RCILA+RS FF  LF
Sbjct  46   LSLSKLSDNLEXLLLDHEYDYSDAEIVVEXBTVGVNRCILASRSQFFQXLF  96



>emb|CDX99350.1| BnaC01g12020D [Brassica napus]
Length=588

 Score = 67.8 bits (164),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 35/62 (56%), Positives = 43/62 (69%), Gaps = 2/62 (3%)
 Frame = +1

Query  637  SSGGSSLEIFSLSKLSNSLEQLLSDTTSDFSDADIVVEGTT--VGVHRCILAARSNFFHV  810
             S   +LE  SL+KLS  LEQLL+ +  D++DA+I  EG T  VGVHRC+LAARS FF  
Sbjct  30   QSSSPNLEAASLAKLSTDLEQLLTSSDCDYTDAEITFEGETHAVGVHRCVLAARSKFFFD  89

Query  811  LF  816
            LF
Sbjct  90   LF  91



>ref|XP_009399065.1| PREDICTED: regulatory protein NPR3-like isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=599

 Score = 67.8 bits (164),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 39/58 (67%), Positives = 48/58 (83%), Gaps = 0/58 (0%)
 Frame = +1

Query  643  GGSSLEIFSLSKLSNSLEQLLSDTTSDFSDADIVVEGTTVGVHRCILAARSNFFHVLF  816
            GG++LE+ SLSKLS++LE+LL DT  D +DA+I+VEG  VGVHRCILAARS FF  LF
Sbjct  44   GGTNLEVLSLSKLSSNLERLLVDTEFDCTDAEIMVEGAPVGVHRCILAARSRFFRELF  101



>gb|AHF20181.1| ankyrin-repeat protein, partial [Musa acuminata AAA Group]
Length=584

 Score = 67.4 bits (163),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 39/58 (67%), Positives = 48/58 (83%), Gaps = 0/58 (0%)
 Frame = +1

Query  643  GGSSLEIFSLSKLSNSLEQLLSDTTSDFSDADIVVEGTTVGVHRCILAARSNFFHVLF  816
            GG++LE+ SLSKLS++LE+LL DT  D +DA+I+VEG  VGVHRCILAARS FF  LF
Sbjct  44   GGTNLEVLSLSKLSSNLERLLVDTEFDCTDAEIMVEGAPVGVHRCILAARSRFFRELF  101



>ref|XP_009399066.1| PREDICTED: regulatory protein NPR3-like isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=584

 Score = 67.4 bits (163),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 39/58 (67%), Positives = 48/58 (83%), Gaps = 0/58 (0%)
 Frame = +1

Query  643  GGSSLEIFSLSKLSNSLEQLLSDTTSDFSDADIVVEGTTVGVHRCILAARSNFFHVLF  816
            GG++LE+ SLSKLS++LE+LL DT  D +DA+I+VEG  VGVHRCILAARS FF  LF
Sbjct  44   GGTNLEVLSLSKLSSNLERLLVDTEFDCTDAEIMVEGAPVGVHRCILAARSRFFRELF  101



>gb|ACJ04030.1| NPR1-like protein [Musa ABB Group]
 gb|ACJ04031.1| NPR1-like protein [Musa ABB Group]
Length=595

 Score = 67.0 bits (162),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 39/59 (66%), Positives = 47/59 (80%), Gaps = 0/59 (0%)
 Frame = +1

Query  640  SGGSSLEIFSLSKLSNSLEQLLSDTTSDFSDADIVVEGTTVGVHRCILAARSNFFHVLF  816
             GG++LE+ SLSKLS++LE LL DT  D +DA+I VEGT VG+HRCILAARS FF  LF
Sbjct  44   EGGTNLEVLSLSKLSSNLEHLLLDTEFDCTDAEIAVEGTPVGIHRCILAARSRFFRDLF  102



>ref|NP_001233844.1| NIM1-like protein 2 [Solanum lycopersicum]
 ref|XP_010323612.1| PREDICTED: NIM1-like protein 2 isoform X1 [Solanum lycopersicum]
 ref|XP_010323613.1| PREDICTED: NIM1-like protein 2 isoform X1 [Solanum lycopersicum]
 gb|AAT57639.1| NIM1-like protein 2 [Solanum lycopersicum]
Length=573

 Score = 67.0 bits (162),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 34/61 (56%), Positives = 42/61 (69%), Gaps = 2/61 (3%)
 Frame = +1

Query  634  PSSGGSSLEIFSLSKLSNSLEQLLSDTTSDFSDADIVVEGTTVGVHRCILAARSNFFHVL  813
            P   G +++   LS L  SLE+LL +   D+SDA+IVVEG  VGV+RCILAARS FFH  
Sbjct  21   PQEPGPNVD--HLSNLCGSLEKLLLNPEYDYSDAEIVVEGINVGVNRCILAARSQFFHEK  78

Query  814  F  816
            F
Sbjct  79   F  79



>ref|XP_006413943.1| hypothetical protein EUTSA_v10024752mg [Eutrema salsugineum]
 dbj|BAJ34281.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ55396.1| hypothetical protein EUTSA_v10024752mg [Eutrema salsugineum]
Length=588

 Score = 66.6 bits (161),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 32/59 (54%), Positives = 46/59 (78%), Gaps = 2/59 (3%)
 Frame = +1

Query  646  GSSLEIFSLSKLSNSLEQLLSDTTSDFSDADIVVEGTT--VGVHRCILAARSNFFHVLF  816
             ++LE  SL KLS+ LEQLL+++  D++DA+I++EG +  VGVHRC+LA+RS FF  LF
Sbjct  33   AANLEAVSLIKLSSDLEQLLTNSDCDYTDAEIIIEGESHAVGVHRCVLASRSTFFLELF  91



>emb|CDX78955.1| BnaA01g10220D [Brassica napus]
Length=588

 Score = 66.6 bits (161),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 35/62 (56%), Positives = 43/62 (69%), Gaps = 2/62 (3%)
 Frame = +1

Query  637  SSGGSSLEIFSLSKLSNSLEQLLSDTTSDFSDADIVVEGTT--VGVHRCILAARSNFFHV  810
             S   +LE  SL+KLS  LEQLL+ +  D++DA+I  EG T  VGVHRC+LAARS FF  
Sbjct  30   QSPSPNLEAASLAKLSTDLEQLLTSSDCDYTDAEITFEGETRAVGVHRCLLAARSKFFLD  89

Query  811  LF  816
            LF
Sbjct  90   LF  91



>ref|XP_006413942.1| hypothetical protein EUTSA_v10024752mg [Eutrema salsugineum]
 gb|ESQ55395.1| hypothetical protein EUTSA_v10024752mg [Eutrema salsugineum]
Length=441

 Score = 66.2 bits (160),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 32/59 (54%), Positives = 46/59 (78%), Gaps = 2/59 (3%)
 Frame = +1

Query  646  GSSLEIFSLSKLSNSLEQLLSDTTSDFSDADIVVEGTT--VGVHRCILAARSNFFHVLF  816
             ++LE  SL KLS+ LEQLL+++  D++DA+I++EG +  VGVHRC+LA+RS FF  LF
Sbjct  33   AANLEAVSLIKLSSDLEQLLTNSDCDYTDAEIIIEGESHAVGVHRCVLASRSTFFLELF  91



>gb|AHF20180.1| ankyrin-repeat protein [Musa acuminata AAA Group]
Length=595

 Score = 65.5 bits (158),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 38/59 (64%), Positives = 47/59 (80%), Gaps = 0/59 (0%)
 Frame = +1

Query  640  SGGSSLEIFSLSKLSNSLEQLLSDTTSDFSDADIVVEGTTVGVHRCILAARSNFFHVLF  816
             GG++LE+ SLSKLS++LE+LL DT  D +DA+I VEG  VG+HRCILAARS FF  LF
Sbjct  44   EGGTNLEVLSLSKLSSNLERLLLDTEFDCTDAEIAVEGAPVGIHRCILAARSRFFRDLF  102



>ref|XP_006366625.1| PREDICTED: regulatory protein NPR3-like [Solanum tuberosum]
Length=575

 Score = 65.5 bits (158),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 34/61 (56%), Positives = 42/61 (69%), Gaps = 2/61 (3%)
 Frame = +1

Query  634  PSSGGSSLEIFSLSKLSNSLEQLLSDTTSDFSDADIVVEGTTVGVHRCILAARSNFFHVL  813
            P   G S++   LS L  SLE+LL +   ++SDA+IVVEG  VGV+RCILAARS FFH  
Sbjct  21   PQEPGPSVD--HLSNLCGSLEKLLLNPEYNYSDAEIVVEGIDVGVNRCILAARSQFFHEK  78

Query  814  F  816
            F
Sbjct  79   F  79



>gb|AAT57642.1| NIM1-like protein 1 [Helianthus annuus]
Length=591

 Score = 64.7 bits (156),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 32/60 (53%), Positives = 46/60 (77%), Gaps = 4/60 (7%)
 Frame = +1

Query  649  SSLEIFSLSKLSNSLEQLLSDTTSD----FSDADIVVEGTTVGVHRCILAARSNFFHVLF  816
            S++EI  L++LS +LE+L+ D+ S+    +SDA++VVEG +VG+HRCILA RS FF  LF
Sbjct  38   SNIEIIGLNRLSTNLEKLVFDSGSESDCNYSDAEVVVEGISVGIHRCILATRSTFFSDLF  97



>gb|KDO44757.1| hypothetical protein CISIN_1g007550mg [Citrus sinensis]
Length=513

 Score = 64.7 bits (156),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = +1

Query  694  EQLLSDTTSDFSDADIVVEGTTVGVHRCILAARSNFFHVLF  816
            E+LL D   D++DADIVVEG +V VHRCIL+ARS FFH LF
Sbjct  55   EKLLLDAEHDYTDADIVVEGKSVAVHRCILSARSQFFHELF  95



>gb|KDO44756.1| hypothetical protein CISIN_1g007550mg [Citrus sinensis]
Length=595

 Score = 64.7 bits (156),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = +1

Query  694  EQLLSDTTSDFSDADIVVEGTTVGVHRCILAARSNFFHVLF  816
            E+LL D   D++DADIVVEG +V VHRCIL+ARS FFH LF
Sbjct  55   EKLLLDAEHDYTDADIVVEGKSVAVHRCILSARSQFFHELF  95



>gb|AIM54370.1| nonexpressor of pathogenesis-related protein 1 [Gladiolus hybrid 
cultivar]
Length=588

 Score = 64.7 bits (156),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 38/62 (61%), Positives = 45/62 (73%), Gaps = 2/62 (3%)
 Frame = +1

Query  637  SSGGSSLEIFSLSKLSNSLEQLLSD-TTSDFSDADIVVEG-TTVGVHRCILAARSNFFHV  810
            SS  ++LEI SLSKLS+ LE+LL D T S F DAD+ ++G   VGVHRCILAARS  F  
Sbjct  27   SSPPTNLEIVSLSKLSSHLERLLLDPTNSGFIDADVALDGGADVGVHRCILAARSRVFRD  86

Query  811  LF  816
            LF
Sbjct  87   LF  88



>ref|XP_009133120.1| PREDICTED: regulatory protein NPR4 [Brassica rapa]
Length=588

 Score = 64.7 bits (156),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 34/62 (55%), Positives = 42/62 (68%), Gaps = 2/62 (3%)
 Frame = +1

Query  637  SSGGSSLEIFSLSKLSNSLEQLLSDTTSDFSDADIVVEGTT--VGVHRCILAARSNFFHV  810
             S   +LE  SL+KLS  LE LL+ +  D++DADI  EG +  VGVHRC+LAARS FF  
Sbjct  30   QSSSPNLEAASLAKLSTDLENLLTSSDCDYTDADITFEGESRAVGVHRCLLAARSKFFLD  89

Query  811  LF  816
            LF
Sbjct  90   LF  91



>gb|KDO44755.1| hypothetical protein CISIN_1g007550mg [Citrus sinensis]
Length=599

 Score = 64.7 bits (156),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = +1

Query  694  EQLLSDTTSDFSDADIVVEGTTVGVHRCILAARSNFFHVLF  816
            E+LL D   D++DADIVVEG +V VHRCIL+ARS FFH LF
Sbjct  55   EKLLLDAEHDYTDADIVVEGKSVAVHRCILSARSQFFHELF  95



>ref|XP_007048936.1| NPR1-like protein 3, putative [Theobroma cacao]
 gb|EOX93093.1| NPR1-like protein 3, putative [Theobroma cacao]
Length=583

 Score = 64.3 bits (155),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 39/58 (67%), Positives = 47/58 (81%), Gaps = 1/58 (2%)
 Frame = +1

Query  646  GSSLEIFSLSKLSNSLEQLLSDTTSDFSDADIVVEGT-TVGVHRCILAARSNFFHVLF  816
            G++LEI SLS+LS SLE+LL D   D+SDA+IVVEG   VGV+RCILAARS +FH LF
Sbjct  38   GANLEILSLSRLSCSLEKLLVDQEYDYSDAEIVVEGNIAVGVNRCILAARSQYFHELF  95



>gb|KHG00475.1| Regulatory NPR3 -like protein [Gossypium arboreum]
Length=587

 Score = 64.3 bits (155),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 48/62 (77%), Gaps = 1/62 (2%)
 Frame = +1

Query  631  VPSSGGSSLEIFSLSKLSNSLEQLLSDTTSDFSDADIVVEGTTVGVHRCILAARSNFFHV  810
            VP +G ++LE  SL+KLS+SLEQL+ D    FSDADIVVEG  VGVHRCILA RS FF+ 
Sbjct  33   VPETG-ANLEALSLTKLSSSLEQLIVDNCPVFSDADIVVEGVAVGVHRCILAVRSKFFNE  91

Query  811  LF  816
            +F
Sbjct  92   VF  93



>gb|KJB69919.1| hypothetical protein B456_011G050200 [Gossypium raimondii]
Length=541

 Score = 64.3 bits (155),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 48/62 (77%), Gaps = 1/62 (2%)
 Frame = +1

Query  631  VPSSGGSSLEIFSLSKLSNSLEQLLSDTTSDFSDADIVVEGTTVGVHRCILAARSNFFHV  810
            VP +G ++LE  SL+KLS+SLEQL+ D    FSDADIVVEG  VGVHRCILA RS FF+ 
Sbjct  33   VPETG-ANLEALSLTKLSSSLEQLIVDNCPVFSDADIVVEGVAVGVHRCILAVRSKFFNE  91

Query  811  LF  816
            +F
Sbjct  92   VF  93



>gb|KJB69920.1| hypothetical protein B456_011G050200 [Gossypium raimondii]
Length=587

 Score = 64.3 bits (155),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 48/62 (77%), Gaps = 1/62 (2%)
 Frame = +1

Query  631  VPSSGGSSLEIFSLSKLSNSLEQLLSDTTSDFSDADIVVEGTTVGVHRCILAARSNFFHV  810
            VP +G ++LE  SL+KLS+SLEQL+ D    FSDADIVVEG  VGVHRCILA RS FF+ 
Sbjct  33   VPETG-ANLEALSLTKLSSSLEQLIVDNCPVFSDADIVVEGVAVGVHRCILAVRSKFFNE  91

Query  811  LF  816
            +F
Sbjct  92   VF  93



>gb|KJB69918.1| hypothetical protein B456_011G050200 [Gossypium raimondii]
Length=521

 Score = 64.3 bits (155),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 48/62 (77%), Gaps = 1/62 (2%)
 Frame = +1

Query  631  VPSSGGSSLEIFSLSKLSNSLEQLLSDTTSDFSDADIVVEGTTVGVHRCILAARSNFFHV  810
            VP +G ++LE  SL+KLS+SLEQL+ D    FSDADIVVEG  VGVHRCILA RS FF+ 
Sbjct  33   VPETG-ANLEALSLTKLSSSLEQLIVDNCPVFSDADIVVEGVAVGVHRCILAVRSKFFNE  91

Query  811  LF  816
            +F
Sbjct  92   VF  93



>gb|KJB34938.1| hypothetical protein B456_006G091900 [Gossypium raimondii]
Length=459

 Score = 63.9 bits (154),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 38/60 (63%), Positives = 48/60 (80%), Gaps = 0/60 (0%)
 Frame = +1

Query  637  SSGGSSLEIFSLSKLSNSLEQLLSDTTSDFSDADIVVEGTTVGVHRCILAARSNFFHVLF  816
            S+  ++LE+ SL+KLS+SLE L+SD +  FSDAD+VVEG +VGVHRCILA RS FF  LF
Sbjct  29   SAAAATLEVISLTKLSSSLEHLVSDNSPPFSDADVVVEGVSVGVHRCILAVRSKFFKELF  88



>gb|KJB69916.1| hypothetical protein B456_011G050200 [Gossypium raimondii]
 gb|KJB69917.1| hypothetical protein B456_011G050200 [Gossypium raimondii]
Length=465

 Score = 63.9 bits (154),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 48/62 (77%), Gaps = 1/62 (2%)
 Frame = +1

Query  631  VPSSGGSSLEIFSLSKLSNSLEQLLSDTTSDFSDADIVVEGTTVGVHRCILAARSNFFHV  810
            VP +G ++LE  SL+KLS+SLEQL+ D    FSDADIVVEG  VGVHRCILA RS FF+ 
Sbjct  33   VPETG-ANLEALSLTKLSSSLEQLIVDNCPVFSDADIVVEGVAVGVHRCILAVRSKFFNE  91

Query  811  LF  816
            +F
Sbjct  92   VF  93



>gb|KHG09335.1| Regulatory NPR3 -like protein [Gossypium arboreum]
Length=583

 Score = 63.5 bits (153),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 38/60 (63%), Positives = 48/60 (80%), Gaps = 0/60 (0%)
 Frame = +1

Query  637  SSGGSSLEIFSLSKLSNSLEQLLSDTTSDFSDADIVVEGTTVGVHRCILAARSNFFHVLF  816
            S+  ++LE+ SL+KLS+SLE L+SD +  FSDAD+VVEG +VGVHRCILA RS FF  LF
Sbjct  29   SAAAATLEVISLTKLSSSLEHLVSDNSPPFSDADVVVEGVSVGVHRCILAVRSKFFKELF  88



>gb|KJB34937.1| hypothetical protein B456_006G091900 [Gossypium raimondii]
Length=583

 Score = 63.5 bits (153),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 38/60 (63%), Positives = 48/60 (80%), Gaps = 0/60 (0%)
 Frame = +1

Query  637  SSGGSSLEIFSLSKLSNSLEQLLSDTTSDFSDADIVVEGTTVGVHRCILAARSNFFHVLF  816
            S+  ++LE+ SL+KLS+SLE L+SD +  FSDAD+VVEG +VGVHRCILA RS FF  LF
Sbjct  29   SAAAATLEVISLTKLSSSLEHLVSDNSPPFSDADVVVEGVSVGVHRCILAVRSKFFKELF  88



>emb|CDM84353.1| unnamed protein product [Triticum aestivum]
Length=609

 Score = 63.5 bits (153),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 33/56 (59%), Positives = 41/56 (73%), Gaps = 2/56 (4%)
 Frame = +1

Query  655  LEIFSLSKLSNSLEQLLSDTTSDFSDADIVVE--GTTVGVHRCILAARSNFFHVLF  816
            +E  SL++LSN+LE+LL D+  D SDAD+ V   G  + VHRCILAARS FFH LF
Sbjct  49   VEAVSLNRLSNNLERLLLDSELDCSDADVDVADGGPPIPVHRCILAARSPFFHDLF  104



>ref|XP_008383328.1| PREDICTED: regulatory protein NPR3-like [Malus domestica]
Length=584

 Score = 63.5 bits (153),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/53 (57%), Positives = 41/53 (77%), Gaps = 0/53 (0%)
 Frame = +1

Query  658  EIFSLSKLSNSLEQLLSDTTSDFSDADIVVEGTTVGVHRCILAARSNFFHVLF  816
            ++ SL+ LS+SL +LL+D+  D+SDA+I VEG  V VHRCILA+RS FF  +F
Sbjct  38   DLTSLTNLSSSLGRLLADSGGDYSDAEITVEGVPVAVHRCILASRSEFFAKVF  90



>ref|XP_010449314.1| PREDICTED: regulatory protein NPR4-like [Camelina sativa]
Length=583

 Score = 63.5 bits (153),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 31/60 (52%), Positives = 43/60 (72%), Gaps = 2/60 (3%)
 Frame = +1

Query  643  GGSSLEIFSLSKLSNSLEQLLSDTTSDFSDADIVV--EGTTVGVHRCILAARSNFFHVLF  816
              ++LE  SL KLS++LEQLL++   D++DA+I++  E   V VHRC+LAARS FF  LF
Sbjct  32   AATNLEAVSLIKLSSNLEQLLTNPDCDYTDAEIIIEEEANPVSVHRCLLAARSKFFLDLF  91



>ref|XP_010439666.1| PREDICTED: regulatory protein NPR4-like [Camelina sativa]
 ref|XP_010439667.1| PREDICTED: regulatory protein NPR4-like [Camelina sativa]
Length=583

 Score = 63.2 bits (152),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 31/60 (52%), Positives = 43/60 (72%), Gaps = 2/60 (3%)
 Frame = +1

Query  643  GGSSLEIFSLSKLSNSLEQLLSDTTSDFSDADIVV--EGTTVGVHRCILAARSNFFHVLF  816
              ++LE  SL KLS++LEQLL++   D++DA+I++  E   V VHRC+LAARS FF  LF
Sbjct  32   AAANLEAVSLIKLSSNLEQLLTNPDCDYTDAEIIIEEEANPVSVHRCLLAARSKFFLDLF  91



>ref|XP_010056640.1| PREDICTED: regulatory protein NPR3-like [Eucalyptus grandis]
 gb|KCW73444.1| hypothetical protein EUGRSUZ_E01922 [Eucalyptus grandis]
Length=585

 Score = 62.8 bits (151),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 41/60 (68%), Positives = 49/60 (82%), Gaps = 0/60 (0%)
 Frame = +1

Query  637  SSGGSSLEIFSLSKLSNSLEQLLSDTTSDFSDADIVVEGTTVGVHRCILAARSNFFHVLF  816
            S  G S +  SL KLS+SLE+LLSD+T D+SDADIVVE  +VGVHRCILAARS+FF+ LF
Sbjct  34   SETGHSPDAISLGKLSSSLERLLSDSTPDYSDADIVVENISVGVHRCILAARSDFFNNLF  93



>ref|XP_006285143.1| hypothetical protein CARUB_v10006486mg [Capsella rubella]
 gb|EOA18041.1| hypothetical protein CARUB_v10006486mg [Capsella rubella]
Length=585

 Score = 62.4 bits (150),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 31/58 (53%), Positives = 43/58 (74%), Gaps = 2/58 (3%)
 Frame = +1

Query  649  SSLEIFSLSKLSNSLEQLLSDTTSDFSDADIVV--EGTTVGVHRCILAARSNFFHVLF  816
            ++LE  SL KLS++LEQLL++   D++DA+I++  E   V VHRC+LAARS FF  LF
Sbjct  33   ANLEAESLIKLSSNLEQLLTNPDCDYTDAEIIIVDEAQPVSVHRCVLAARSKFFLDLF  90



>ref|XP_003569900.1| PREDICTED: regulatory protein NPR3-like [Brachypodium distachyon]
Length=622

 Score = 62.4 bits (150),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/56 (57%), Positives = 41/56 (73%), Gaps = 2/56 (4%)
 Frame = +1

Query  655  LEIFSLSKLSNSLEQLLSDTTSDFSDADIVVE--GTTVGVHRCILAARSNFFHVLF  816
            LE+ SL++LSN+LE+LL ++  D SDAD+ +   G  V VHRCILAARS FFH  F
Sbjct  56   LEVVSLNRLSNNLERLLLESDLDCSDADVDMADGGPLVPVHRCILAARSPFFHEFF  111



>ref|XP_006853358.1| PREDICTED: regulatory protein NPR3 [Amborella trichopoda]
 gb|ERN14825.1| hypothetical protein AMTR_s00032p00112510 [Amborella trichopoda]
Length=595

 Score = 62.4 bits (150),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 30/53 (57%), Positives = 38/53 (72%), Gaps = 0/53 (0%)
 Frame = +1

Query  658  EIFSLSKLSNSLEQLLSDTTSDFSDADIVVEGTTVGVHRCILAARSNFFHVLF  816
            EI  L +LS +LE LL +  + FSDA+I VEG  +GVHRCILAARS+ F  +F
Sbjct  52   EINGLMRLSTNLENLLHEPYNGFSDAEIEVEGVPIGVHRCILAARSSVFREVF  104



>ref|XP_009341187.1| PREDICTED: regulatory protein NPR3-like isoform X2 [Pyrus x bretschneideri]
Length=578

 Score = 62.0 bits (149),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 29/49 (59%), Positives = 38/49 (78%), Gaps = 0/49 (0%)
 Frame = +1

Query  670  LSKLSNSLEQLLSDTTSDFSDADIVVEGTTVGVHRCILAARSNFFHVLF  816
            L+ LS++L +LL+D+  D+SDA+I VEG  V VHRCILA+RS FF  LF
Sbjct  40   LANLSSNLGRLLADSGGDYSDAEITVEGVPVAVHRCILASRSEFFAELF  88



>ref|XP_009341186.1| PREDICTED: regulatory protein NPR3-like isoform X1 [Pyrus x bretschneideri]
Length=580

 Score = 62.0 bits (149),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/49 (59%), Positives = 38/49 (78%), Gaps = 0/49 (0%)
 Frame = +1

Query  670  LSKLSNSLEQLLSDTTSDFSDADIVVEGTTVGVHRCILAARSNFFHVLF  816
            L+ LS++L +LL+D+  D+SDA+I VEG  V VHRCILA+RS FF  LF
Sbjct  40   LANLSSNLGRLLADSGGDYSDAEITVEGVPVAVHRCILASRSEFFAELF  88



>ref|XP_009357280.1| PREDICTED: regulatory protein NPR3-like isoform X1 [Pyrus x bretschneideri]
Length=580

 Score = 62.0 bits (149),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/49 (59%), Positives = 38/49 (78%), Gaps = 0/49 (0%)
 Frame = +1

Query  670  LSKLSNSLEQLLSDTTSDFSDADIVVEGTTVGVHRCILAARSNFFHVLF  816
            L+ LS++L +LL+D+  D+SDA+I VEG  V VHRCILA+RS FF  LF
Sbjct  40   LTNLSSNLGRLLADSGGDYSDAEITVEGVPVAVHRCILASRSEFFAELF  88



>ref|XP_009357282.1| PREDICTED: regulatory protein NPR3-like isoform X2 [Pyrus x bretschneideri]
Length=578

 Score = 62.0 bits (149),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/49 (59%), Positives = 38/49 (78%), Gaps = 0/49 (0%)
 Frame = +1

Query  670  LSKLSNSLEQLLSDTTSDFSDADIVVEGTTVGVHRCILAARSNFFHVLF  816
            L+ LS++L +LL+D+  D+SDA+I VEG  V VHRCILA+RS FF  LF
Sbjct  40   LTNLSSNLGRLLADSGGDYSDAEITVEGVPVAVHRCILASRSEFFAELF  88



>ref|XP_008371836.1| PREDICTED: regulatory protein NPR3 isoform X2 [Malus domestica]
Length=578

 Score = 62.0 bits (149),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/49 (59%), Positives = 38/49 (78%), Gaps = 0/49 (0%)
 Frame = +1

Query  670  LSKLSNSLEQLLSDTTSDFSDADIVVEGTTVGVHRCILAARSNFFHVLF  816
            L+ LS++L +LL+D+  D+SDA+I VEG  V VHRCILA+RS FF  LF
Sbjct  40   LTNLSSNLGRLLADSGGDYSDAEITVEGVPVAVHRCILASRSEFFAELF  88



>ref|XP_008371834.1| PREDICTED: regulatory protein NPR3 isoform X1 [Malus domestica]
Length=580

 Score = 62.0 bits (149),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/49 (59%), Positives = 38/49 (78%), Gaps = 0/49 (0%)
 Frame = +1

Query  670  LSKLSNSLEQLLSDTTSDFSDADIVVEGTTVGVHRCILAARSNFFHVLF  816
            L+ LS++L +LL+D+  D+SDA+I VEG  V VHRCILA+RS FF  LF
Sbjct  40   LTNLSSNLGRLLADSGGDYSDAEITVEGVPVAVHRCILASRSEFFAELF  88



>ref|XP_010434372.1| PREDICTED: regulatory protein NPR4 [Camelina sativa]
Length=583

 Score = 62.0 bits (149),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 30/60 (50%), Positives = 43/60 (72%), Gaps = 2/60 (3%)
 Frame = +1

Query  643  GGSSLEIFSLSKLSNSLEQLLSDTTSDFSDADIVV--EGTTVGVHRCILAARSNFFHVLF  816
              ++LE  SL KLS++L+QLL++   D++DA+I++  E   V VHRC+LAARS FF  LF
Sbjct  32   AAANLEAVSLIKLSSNLDQLLTNPDCDYTDAEIIIEEEANPVSVHRCLLAARSKFFLDLF  91



>ref|XP_006437091.1| hypothetical protein CICLE_v10031020mg [Citrus clementina]
 gb|ESR50331.1| hypothetical protein CICLE_v10031020mg [Citrus clementina]
Length=595

 Score = 61.6 bits (148),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 26/41 (63%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = +1

Query  694  EQLLSDTTSDFSDADIVVEGTTVGVHRCILAARSNFFHVLF  816
            E+LL D   D++DA+IVVEG +V +HRCIL+ARS FFH LF
Sbjct  55   EKLLLDAEYDYTDAEIVVEGKSVALHRCILSARSQFFHELF  95



>ref|NP_001147587.1| regulatory protein NPR1 [Zea mays]
 gb|ACG28002.1| regulatory protein NPR1 [Zea mays]
Length=621

 Score = 61.2 bits (147),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 32/57 (56%), Positives = 41/57 (72%), Gaps = 2/57 (4%)
 Frame = +1

Query  652  SLEIFSLSKLSNSLEQLLSDTTSDFSDADIVVE--GTTVGVHRCILAARSNFFHVLF  816
            S+E  SL++LS +LE+LL D   D SDAD+ V   G  V +HRCILAARS+FF+ LF
Sbjct  56   SVEAVSLNRLSKNLERLLLDPDLDCSDADVDVPDGGPPVPIHRCILAARSDFFYDLF  112



>gb|AFW84951.1| regulatory protein NPR1 [Zea mays]
Length=621

 Score = 61.2 bits (147),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 32/57 (56%), Positives = 41/57 (72%), Gaps = 2/57 (4%)
 Frame = +1

Query  652  SLEIFSLSKLSNSLEQLLSDTTSDFSDADIVVE--GTTVGVHRCILAARSNFFHVLF  816
            S+E  SL++LS +LE+LL D   D SDAD+ V   G  V +HRCILAARS+FF+ LF
Sbjct  56   SVEAVSLNRLSKNLERLLLDPDLDCSDADVDVPDGGPPVPIHRCILAARSDFFYDLF  112



>gb|AHA43769.1| NPR3 [Morus alba var. multicaulis]
Length=594

 Score = 60.8 bits (146),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 28/42 (67%), Positives = 34/42 (81%), Gaps = 1/42 (2%)
 Frame = +1

Query  694  EQLLSDTT-SDFSDADIVVEGTTVGVHRCILAARSNFFHVLF  816
            E+LL D   +D++DA+IVVEG  VGVHRCILA+RS FFH LF
Sbjct  49   EKLLIDAEFADYTDAEIVVEGVPVGVHRCILASRSQFFHELF  90



>ref|XP_010093184.1| Regulatory protein [Morus notabilis]
 gb|EXB53672.1| Regulatory protein [Morus notabilis]
Length=598

 Score = 60.8 bits (146),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 37/61 (61%), Positives = 47/61 (77%), Gaps = 1/61 (2%)
 Frame = +1

Query  637  SSGGSSLEIFSLSKLSNSLEQLLSDTT-SDFSDADIVVEGTTVGVHRCILAARSNFFHVL  813
            S  G +L+  SLSKLS++LE+LL D   +D++DA+IVVEG  VGVHRCILA+RS FFH L
Sbjct  34   SEPGQNLDNLSLSKLSSNLEKLLIDAEFADYTDAEIVVEGVPVGVHRCILASRSQFFHEL  93

Query  814  F  816
             
Sbjct  94   L  94



>ref|XP_004303897.1| PREDICTED: regulatory protein NPR3-like [Fragaria vesca subsp. 
vesca]
Length=578

 Score = 60.5 bits (145),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 27/41 (66%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +1

Query  694  EQLLSDTTSDFSDADIVVEGTTVGVHRCILAARSNFFHVLF  816
            E+LL D   D+SDA+IVVEGT V V+RCILAAR  FFH +F
Sbjct  54   EKLLVDPQYDYSDAEIVVEGTPVSVNRCILAARGQFFHEVF  94



>gb|ACE86413.1| NPR1-like protein [Musa ABB Group]
Length=574

 Score = 60.1 bits (144),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +1

Query  694  EQLLSDTTSDFSDADIVVEGTTVGVHRCILAARSNFFHVLF  816
            E LL DT  D +DA+I VEGT VG+HRCILAARS FF  LF
Sbjct  41   EHLLLDTEFDCTDAEIAVEGTPVGIHRCILAARSRFFRDLF  81



>ref|XP_004293734.1| PREDICTED: regulatory protein NPR3-like [Fragaria vesca subsp. 
vesca]
 ref|XP_011460459.1| PREDICTED: regulatory protein NPR3-like [Fragaria vesca subsp. 
vesca]
Length=587

 Score = 59.7 bits (143),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 39/60 (65%), Positives = 47/60 (78%), Gaps = 0/60 (0%)
 Frame = +1

Query  637  SSGGSSLEIFSLSKLSNSLEQLLSDTTSDFSDADIVVEGTTVGVHRCILAARSNFFHVLF  816
            S    SLE+ SL+KLS+SLEQLL D+  D+SDA+I+VEG  VGVHRCILA+RS FF  LF
Sbjct  31   SEALPSLEVISLTKLSSSLEQLLLDSGCDYSDAEIIVEGDPVGVHRCILASRSKFFCELF  90



>ref|XP_009357279.1| PREDICTED: regulatory protein NPR3-like [Pyrus x bretschneideri]
Length=586

 Score = 59.3 bits (142),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 27/36 (75%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +1

Query  709  DTTSDFSDADIVVEGTTVGVHRCILAARSNFFHVLF  816
            D   DFSDADIVVEG  VGVHRCILA+RS FF  LF
Sbjct  57   DPGCDFSDADIVVEGIPVGVHRCILASRSRFFRELF  92



>ref|XP_009777160.1| PREDICTED: regulatory protein NPR3-like isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009777161.1| PREDICTED: regulatory protein NPR3-like isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009777162.1| PREDICTED: regulatory protein NPR3-like isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009777163.1| PREDICTED: regulatory protein NPR3-like isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009777164.1| PREDICTED: regulatory protein NPR3-like isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009777165.1| PREDICTED: regulatory protein NPR3-like isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009777166.1| PREDICTED: regulatory protein NPR3-like isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009777167.1| PREDICTED: regulatory protein NPR3-like isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009777168.1| PREDICTED: regulatory protein NPR3-like isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009777170.1| PREDICTED: regulatory protein NPR3-like isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009777171.1| PREDICTED: regulatory protein NPR3-like isoform X1 [Nicotiana 
sylvestris]
Length=574

 Score = 58.5 bits (140),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/41 (63%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = +1

Query  694  EQLLSDTTSDFSDADIVVEGTTVGVHRCILAARSNFFHVLF  816
            E+L+ +   D+SDA+IVV+G TVGV+RCILAARS FFH  F
Sbjct  46   EKLVLNAEYDYSDAEIVVDGITVGVNRCILAARSQFFHKKF  86



>ref|XP_009621669.1| PREDICTED: regulatory protein NPR3-like [Nicotiana tomentosiformis]
 ref|XP_009621670.1| PREDICTED: regulatory protein NPR3-like [Nicotiana tomentosiformis]
 ref|XP_009621671.1| PREDICTED: regulatory protein NPR3-like [Nicotiana tomentosiformis]
Length=571

 Score = 58.5 bits (140),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/41 (63%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = +1

Query  694  EQLLSDTTSDFSDADIVVEGTTVGVHRCILAARSNFFHVLF  816
            E+L+ +   D+SDA+IVV+G TVGV+RCILAARS FFH  F
Sbjct  46   EKLVLNAEYDYSDAEIVVDGITVGVNRCILAARSQFFHKKF  86



>ref|NP_001280793.1| regulatory protein NPR3-like [Malus domestica]
 gb|AGK30592.1| NPR1-like protein [Malus domestica]
Length=586

 Score = 58.5 bits (140),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 41/56 (73%), Positives = 45/56 (80%), Gaps = 0/56 (0%)
 Frame = +1

Query  649  SSLEIFSLSKLSNSLEQLLSDTTSDFSDADIVVEGTTVGVHRCILAARSNFFHVLF  816
             SLE+ SLSKLS+SLEQLL D   D+SDADIVVEG  VGVHRCILA+RS FF  LF
Sbjct  37   PSLEVMSLSKLSSSLEQLLIDPGCDYSDADIVVEGIPVGVHRCILASRSGFFRELF  92



>ref|XP_009777172.1| PREDICTED: regulatory protein NPR3-like isoform X2 [Nicotiana 
sylvestris]
Length=503

 Score = 58.5 bits (140),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/41 (63%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = +1

Query  694  EQLLSDTTSDFSDADIVVEGTTVGVHRCILAARSNFFHVLF  816
            E+L+ +   D+SDA+IVV+G TVGV+RCILAARS FFH  F
Sbjct  46   EKLVLNAEYDYSDAEIVVDGITVGVNRCILAARSQFFHKKF  86



>ref|NP_001289241.1| uncharacterized protein LOC103945128 [Pyrus x bretschneideri]
 gb|ACN87218.1| NPR-1 [Pyrus x bretschneideri]
Length=586

 Score = 58.5 bits (140),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 41/56 (73%), Positives = 45/56 (80%), Gaps = 0/56 (0%)
 Frame = +1

Query  649  SSLEIFSLSKLSNSLEQLLSDTTSDFSDADIVVEGTTVGVHRCILAARSNFFHVLF  816
             SLE+ SLSKLS+SLEQLL D   D+SDADIVVEG  VGVHRCILA+RS FF  LF
Sbjct  37   PSLEVISLSKLSSSLEQLLIDPGCDYSDADIVVEGIPVGVHRCILASRSGFFRELF  92



>gb|ABK62792.1| NPR-1 [Pyrus pyrifolia]
Length=586

 Score = 58.5 bits (140),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 41/56 (73%), Positives = 45/56 (80%), Gaps = 0/56 (0%)
 Frame = +1

Query  649  SSLEIFSLSKLSNSLEQLLSDTTSDFSDADIVVEGTTVGVHRCILAARSNFFHVLF  816
             SLE+ SLSKLS+SLEQLL D   D+SDADIVVEG  VGVHRCILA+RS FF  LF
Sbjct  37   PSLEVISLSKLSSSLEQLLIDPGCDYSDADIVVEGIPVGVHRCILASRSGFFRELF  92



>gb|ACC77697.1| NPR1-like protein [Malus domestica]
Length=586

 Score = 58.2 bits (139),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 41/56 (73%), Positives = 45/56 (80%), Gaps = 0/56 (0%)
 Frame = +1

Query  649  SSLEIFSLSKLSNSLEQLLSDTTSDFSDADIVVEGTTVGVHRCILAARSNFFHVLF  816
             SLE+ SLSKLS+SLEQLL D   D+SDADIVVEG  VGVHRCILA+RS FF  LF
Sbjct  37   PSLEVISLSKLSSSLEQLLIDPGCDYSDADIVVEGIPVGVHRCILASRSGFFRELF  92



>gb|ACU78081.1| NPR1-like protein [Malus hupehensis]
Length=586

 Score = 58.2 bits (139),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 26/36 (72%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +1

Query  709  DTTSDFSDADIVVEGTTVGVHRCILAARSNFFHVLF  816
            D   D+SDADIVVEG  VGVHRCILA+RS FF  LF
Sbjct  57   DPGCDYSDADIVVEGIPVGVHRCILASRSGFFRELF  92



>gb|ADP95762.1| npr1 protein [Malus hupehensis]
Length=586

 Score = 58.2 bits (139),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 26/36 (72%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +1

Query  709  DTTSDFSDADIVVEGTTVGVHRCILAARSNFFHVLF  816
            D   D+SDADIVVEG  VGVHRCILA+RS FF  LF
Sbjct  57   DPGCDYSDADIVVEGIPVGVHRCILASRSGFFRELF  92



>ref|NP_193701.2| NPR1-like protein 4 [Arabidopsis thaliana]
 sp|Q5ICL9.1|NPR4_ARATH RecName: Full=Regulatory protein NPR4; AltName: Full=BTB/POZ 
domain-containing protein NPR4 [Arabidopsis thaliana]
 gb|AAW31628.1| ankyrin repeat BTB/POZ domain-containing protein [Arabidopsis 
thaliana]
 gb|AEE84211.1| NPR1-like protein 4 [Arabidopsis thaliana]
Length=574

 Score = 58.2 bits (139),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 27/52 (52%), Positives = 39/52 (75%), Gaps = 2/52 (4%)
 Frame = +1

Query  667  SLSKLSNSLEQLLSDTTSDFSDADIVV--EGTTVGVHRCILAARSNFFHVLF  816
            +L +LS++LEQLL++   D++DA+I++  E   V VHRC+LAARS FF  LF
Sbjct  34   NLEELSSNLEQLLTNPDCDYTDAEIIIEEEANPVSVHRCVLAARSKFFLDLF  85



>emb|CAA19683.1| putative protein [Arabidopsis thaliana]
 emb|CAB78968.1| putative protein [Arabidopsis thaliana]
Length=601

 Score = 58.2 bits (139),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 27/52 (52%), Positives = 39/52 (75%), Gaps = 2/52 (4%)
 Frame = +1

Query  667  SLSKLSNSLEQLLSDTTSDFSDADIVV--EGTTVGVHRCILAARSNFFHVLF  816
            +L +LS++LEQLL++   D++DA+I++  E   V VHRC+LAARS FF  LF
Sbjct  34   NLEELSSNLEQLLTNPDCDYTDAEIIIEEEANPVSVHRCVLAARSKFFLDLF  85



>ref|XP_004970097.1| PREDICTED: regulatory protein NPR3-like [Setaria italica]
Length=629

 Score = 57.8 bits (138),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 31/57 (54%), Positives = 39/57 (68%), Gaps = 2/57 (4%)
 Frame = +1

Query  652  SLEIFSLSKLSNSLEQLLSDTTSDFSDADIVVE--GTTVGVHRCILAARSNFFHVLF  816
            ++E  SL++LS +LE+LL D   D SDADI V   G  V VHRCILA RS FF+ +F
Sbjct  56   NVEAVSLNRLSKNLERLLIDEDLDCSDADIEVPDGGPPVPVHRCILAVRSPFFYDIF  112



>gb|EYU43699.1| hypothetical protein MIMGU_mgv1a003483mg [Erythranthe guttata]
Length=582

 Score = 57.0 bits (136),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 26/36 (72%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +1

Query  709  DTTSDFSDADIVVEGTTVGVHRCILAARSNFFHVLF  816
            ++ SDF+DADIVVE T+VGVHRCILAARS FF  L 
Sbjct  58   ESGSDFTDADIVVEETSVGVHRCILAARSKFFDELL  93



>ref|XP_002867926.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH44185.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=580

 Score = 56.6 bits (135),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 27/51 (53%), Positives = 38/51 (75%), Gaps = 2/51 (4%)
 Frame = +1

Query  670  LSKLSNSLEQLLSDTTSDFSDADIVV--EGTTVGVHRCILAARSNFFHVLF  816
            L +LS++LEQLL++   D++DA+I++  E   V VHRC+LAARS FF  LF
Sbjct  35   LEELSSNLEQLLTNPDCDYTDAEIIIEDEAHPVSVHRCVLAARSKFFLDLF  85



>ref|XP_008225738.1| PREDICTED: regulatory protein NPR3-like [Prunus mume]
Length=591

 Score = 56.6 bits (135),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 38/57 (67%), Positives = 51/57 (89%), Gaps = 1/57 (2%)
 Frame = +1

Query  649  SSLEIFSLSKLSNSLEQLL-SDTTSDFSDADIVVEGTTVGVHRCILAARSNFFHVLF  816
            +SLE+ SL+KLS++LEQLL  D++SD+SDADI+VEG +VGV+RCILA+RS+FF  LF
Sbjct  40   TSLEVISLTKLSSNLEQLLLVDSSSDYSDADIIVEGKSVGVYRCILASRSSFFGELF  96



>ref|XP_011085427.1| PREDICTED: regulatory protein NPR3-like [Sesamum indicum]
 ref|XP_011085428.1| PREDICTED: regulatory protein NPR3-like [Sesamum indicum]
Length=587

 Score = 56.6 bits (135),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 24/31 (77%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = +1

Query  724  FSDADIVVEGTTVGVHRCILAARSNFFHVLF  816
            +SDA+I VEG TVGVHRCILAARS FFH +F
Sbjct  62   YSDAEIEVEGITVGVHRCILAARSQFFHEIF  92



>dbj|BAD53355.1| putative NPR1 [Oryza sativa Japonica Group]
 dbj|BAD53329.1| putative NPR1 [Oryza sativa Japonica Group]
Length=624

 Score = 55.8 bits (133),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 30/51 (59%), Positives = 37/51 (73%), Gaps = 2/51 (4%)
 Frame = +1

Query  670  LSKLSNSLEQLLSDTTSDFSDADIVVE--GTTVGVHRCILAARSNFFHVLF  816
            L++LS +LE+LL D+  D SDAD+ V   G  V VHRCILAARS FF+ LF
Sbjct  67   LNRLSANLERLLLDSDLDCSDADVDVADGGPPVPVHRCILAARSTFFYNLF  117



>ref|NP_001044363.1| Os01g0767900 [Oryza sativa Japonica Group]
 gb|ABE11615.1| ankyrin-repeat protein [Oryza sativa Japonica Group]
 gb|ABE11616.1| ankyrin-repeat protein [Oryza sativa Japonica Group]
 dbj|BAF06277.1| Os01g0767900 [Oryza sativa Japonica Group]
 dbj|BAG90312.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|AEF30409.1| putative NPR1-like protein 1 [Oryza sativa Japonica Group]
Length=635

 Score = 55.8 bits (133),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 30/51 (59%), Positives = 37/51 (73%), Gaps = 2/51 (4%)
 Frame = +1

Query  670  LSKLSNSLEQLLSDTTSDFSDADIVVE--GTTVGVHRCILAARSNFFHVLF  816
            L++LS +LE+LL D+  D SDAD+ V   G  V VHRCILAARS FF+ LF
Sbjct  78   LNRLSANLERLLLDSDLDCSDADVDVADGGPPVPVHRCILAARSTFFYNLF  128



>gb|ABA38903.1| NPR1-like protein, partial [Pyrus communis]
Length=353

 Score = 53.5 bits (127),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 25/43 (58%), Positives = 32/43 (74%), Gaps = 0/43 (0%)
 Frame = +1

Query  688  SLEQLLSDTTSDFSDADIVVEGTTVGVHRCILAARSNFFHVLF  816
            SL +LL+D+  D+SDA+I VEG  V VHRCILA+RS  F  +F
Sbjct  1    SLGRLLADSGGDYSDAEITVEGVPVPVHRCILASRSEVFAKVF  43



>gb|EYU42809.1| hypothetical protein MIMGU_mgv1a003347mg [Erythranthe guttata]
Length=591

 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/32 (72%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = +1

Query  721  DFSDADIVVEGTTVGVHRCILAARSNFFHVLF  816
            D+SDA+I VEG  VGV RCILAARS+FFH +F
Sbjct  63   DYSDAEIEVEGIAVGVSRCILAARSHFFHEIF  94



>dbj|BAJ91588.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=589

 Score = 52.0 bits (123),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 37/58 (64%), Gaps = 2/58 (3%)
 Frame = +1

Query  637  SSGGSSLEIFSLSKLSNSLEQLLSDTTSDFSDADIVVEG--TTVGVHRCILAARSNFF  804
            +   + L+  SL +LS +LE+LL       +DAD+V+      VGVHRCILAARSNFF
Sbjct  24   AEQAADLDAVSLGRLSANLERLLDPAFLGCADADVVLAAGDAVVGVHRCILAARSNFF  81



>dbj|BAJ90272.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ97850.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=589

 Score = 52.0 bits (123),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 37/58 (64%), Gaps = 2/58 (3%)
 Frame = +1

Query  637  SSGGSSLEIFSLSKLSNSLEQLLSDTTSDFSDADIVVEG--TTVGVHRCILAARSNFF  804
            +   + L+  SL +LS +LE+LL       +DAD+V+      VGVHRCILAARSNFF
Sbjct  24   AEQAADLDAVSLGRLSANLERLLDPAFLGCADADVVLAAGDAVVGVHRCILAARSNFF  81



>ref|XP_002456404.1| hypothetical protein SORBIDRAFT_03g035720 [Sorghum bicolor]
 gb|EES01524.1| hypothetical protein SORBIDRAFT_03g035720 [Sorghum bicolor]
Length=621

 Score = 52.0 bits (123),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 34/59 (58%), Positives = 43/59 (73%), Gaps = 2/59 (3%)
 Frame = +1

Query  646  GSSLEIFSLSKLSNSLEQLLSDTTSDFSDADIVVE--GTTVGVHRCILAARSNFFHVLF  816
            GSS+E  SL++LS +LE+LL D   D SDAD+ V   G  V +HRCILAARS+FF+ LF
Sbjct  54   GSSVEAVSLNRLSKNLERLLLDRDLDCSDADVEVPDGGPPVPIHRCILAARSDFFYDLF  112



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1724604950500