BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig372

Length=841
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_010656174.1|  PREDICTED: uncharacterized protein LOC100266...    198   7e-57   
ref|XP_010656172.1|  PREDICTED: uncharacterized protein LOC100266...    198   7e-57   Vitis vinifera
emb|CAN72196.1|  hypothetical protein VITISV_014980                     184   6e-51   Vitis vinifera
ref|XP_002514886.1|  conserved hypothetical protein                     183   6e-51   
gb|KJB30854.1|  hypothetical protein B456_005G164100                    179   3e-50   Gossypium raimondii
gb|KJB60935.1|  hypothetical protein B456_009G332000                    179   1e-49   Gossypium raimondii
gb|KJB30852.1|  hypothetical protein B456_005G164100                    178   5e-49   Gossypium raimondii
ref|XP_007043918.1|  Uncharacterized protein TCM_008615                 177   8e-48   
ref|XP_011086830.1|  PREDICTED: uncharacterized protein LOC105168442    172   9e-47   Sesamum indicum [beniseed]
gb|KJB30853.1|  hypothetical protein B456_005G164100                    166   4e-45   Gossypium raimondii
ref|XP_009591285.1|  PREDICTED: uncharacterized protein LOC104088330    166   9e-45   Nicotiana tomentosiformis
ref|XP_009771615.1|  PREDICTED: uncharacterized protein LOC104222123    161   1e-42   Nicotiana sylvestris
ref|XP_002299323.2|  hypothetical protein POPTR_0001s13570g             159   5e-42   Populus trichocarpa [western balsam poplar]
ref|XP_010250652.1|  PREDICTED: uncharacterized protein LOC104592840    157   4e-41   Nelumbo nucifera [Indian lotus]
ref|XP_006437983.1|  hypothetical protein CICLE_v10031707mg             157   5e-41   
gb|KDO81827.1|  hypothetical protein CISIN_1g015546mg                   157   5e-41   Citrus sinensis [apfelsine]
ref|XP_011036107.1|  PREDICTED: uncharacterized protein LOC105133719    155   2e-40   Populus euphratica
ref|XP_012085721.1|  PREDICTED: uncharacterized protein LOC105644842    154   5e-40   Jatropha curcas
ref|XP_004239242.1|  PREDICTED: uncharacterized protein LOC101252392    147   2e-37   Solanum lycopersicum
ref|XP_008389910.1|  PREDICTED: uncharacterized protein LOC103452...    144   3e-36   Malus domestica [apple tree]
ref|XP_008389909.1|  PREDICTED: uncharacterized protein LOC103452...    143   4e-36   
ref|XP_008389908.1|  PREDICTED: uncharacterized protein LOC103452...    143   5e-36   Malus domestica [apple tree]
ref|XP_008389907.1|  PREDICTED: uncharacterized protein LOC103452...    143   6e-36   
ref|XP_009343132.1|  PREDICTED: uncharacterized protein LOC103935107    142   9e-36   
ref|XP_011020800.1|  PREDICTED: uncharacterized protein LOC105123041    141   2e-35   Populus euphratica
ref|XP_004310225.1|  PREDICTED: uncharacterized protein LOC101307...    139   1e-34   Fragaria vesca subsp. vesca
ref|XP_011457500.1|  PREDICTED: uncharacterized protein LOC101307...    139   1e-34   Fragaria vesca subsp. vesca
emb|CDP13369.1|  unnamed protein product                                138   6e-34   Coffea canephora [robusta coffee]
ref|XP_010027268.1|  PREDICTED: uncharacterized protein LOC104417743    135   4e-33   
ref|XP_010556118.1|  PREDICTED: uncharacterized protein LOC104825488    134   1e-32   Tarenaya hassleriana [spider flower]
ref|XP_008222202.1|  PREDICTED: uncharacterized protein LOC103322...    132   5e-32   Prunus mume [ume]
ref|XP_008222201.1|  PREDICTED: uncharacterized protein LOC103322...    132   8e-32   Prunus mume [ume]
ref|XP_008340399.1|  PREDICTED: uncharacterized protein LOC103403371    127   6e-30   
ref|XP_009372251.1|  PREDICTED: uncharacterized protein LOC103961...    125   2e-29   Pyrus x bretschneideri [bai li]
gb|KCW61917.1|  hypothetical protein EUGRSUZ_H04615                     122   1e-28   Eucalyptus grandis [rose gum]
ref|XP_007223089.1|  hypothetical protein PRUPE_ppa007017mg             119   2e-27   
ref|XP_010249078.1|  PREDICTED: uncharacterized protein LOC104591...    119   3e-27   Nelumbo nucifera [Indian lotus]
ref|XP_010249079.1|  PREDICTED: uncharacterized protein LOC104591...    119   3e-27   Nelumbo nucifera [Indian lotus]
ref|XP_003551814.1|  PREDICTED: uncharacterized protein LOC100795...    117   6e-27   Glycine max [soybeans]
ref|XP_006603013.1|  PREDICTED: uncharacterized protein LOC100795...    117   1e-26   Glycine max [soybeans]
ref|XP_006575827.1|  PREDICTED: uncharacterized protein LOC102660341    116   2e-26   Glycine max [soybeans]
ref|XP_010543088.1|  PREDICTED: uncharacterized protein LOC104816114    116   3e-26   Tarenaya hassleriana [spider flower]
ref|XP_009372252.1|  PREDICTED: uncharacterized protein LOC103961...    115   4e-26   Pyrus x bretschneideri [bai li]
gb|KHN13847.1|  hypothetical protein glysoja_016131                     115   4e-26   Glycine soja [wild soybean]
ref|XP_007139293.1|  hypothetical protein PHAVU_008G017100g             114   9e-26   Phaseolus vulgaris [French bean]
ref|XP_010682717.1|  PREDICTED: uncharacterized protein LOC104897530    114   1e-25   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007142600.1|  hypothetical protein PHAVU_007G001200g             113   3e-25   Phaseolus vulgaris [French bean]
ref|XP_010090655.1|  hypothetical protein L484_017461                   113   3e-25   
ref|XP_006589802.1|  PREDICTED: uncharacterized protein LOC102661485    111   1e-24   Glycine max [soybeans]
ref|XP_008459858.1|  PREDICTED: uncharacterized protein LOC103498856    110   4e-24   Cucumis melo [Oriental melon]
ref|XP_003621746.1|  hypothetical protein MTR_7g022360                  104   2e-22   
gb|AES77964.2|  WRKY transcription factor-like protein                  104   2e-22   Medicago truncatula
gb|KHN27188.1|  hypothetical protein glysoja_025472                     103   9e-22   Glycine soja [wild soybean]
gb|KDP41789.1|  hypothetical protein JCGZ_26807                         101   3e-21   Jatropha curcas
gb|KHN37253.1|  hypothetical protein glysoja_013468                     101   5e-21   Glycine soja [wild soybean]
ref|XP_010913028.1|  PREDICTED: uncharacterized protein LOC105038820    100   5e-21   Elaeis guineensis
ref|XP_012067555.1|  PREDICTED: uncharacterized protein LOC105630360    100   1e-20   
ref|XP_006606602.1|  PREDICTED: uncharacterized protein LOC102663986  95.5    3e-19   Glycine max [soybeans]
ref|XP_011656805.1|  PREDICTED: uncharacterized protein LOC105435773  95.1    5e-19   Cucumis sativus [cucumbers]
gb|AES72068.2|  WRKY transcription factor-like protein                93.6    1e-18   Medicago truncatula
ref|XP_003601817.1|  hypothetical protein MTR_3g085710                93.6    2e-18   
ref|XP_008808109.1|  PREDICTED: uncharacterized protein LOC103720272  91.7    7e-18   Phoenix dactylifera
ref|XP_004492060.1|  PREDICTED: uncharacterized protein LOC101497033  91.3    1e-17   Cicer arietinum [garbanzo]
ref|XP_008231191.1|  PREDICTED: uncharacterized protein LOC103330395  90.9    1e-17   
ref|XP_002512909.1|  conserved hypothetical protein                   89.7    3e-17   Ricinus communis
gb|EYU37396.1|  hypothetical protein MIMGU_mgv1a011034mg              88.2    6e-17   Erythranthe guttata [common monkey flower]
ref|XP_010917537.1|  PREDICTED: uncharacterized protein LOC105042...  88.2    1e-16   Elaeis guineensis
ref|XP_006447030.1|  hypothetical protein CICLE_v10018081mg           87.8    2e-16   
ref|XP_010044846.1|  PREDICTED: uncharacterized protein LOC104433701  87.0    3e-16   Eucalyptus grandis [rose gum]
ref|XP_008454016.1|  PREDICTED: uncharacterized protein LOC103494565  85.9    9e-16   
gb|KHN27151.1|  hypothetical protein glysoja_032919                   83.2    6e-15   Glycine soja [wild soybean]
gb|KJB70677.1|  hypothetical protein B456_011G086600                  82.0    2e-14   Gossypium raimondii
ref|XP_010917536.1|  PREDICTED: uncharacterized protein LOC105042...  81.6    3e-14   Elaeis guineensis
ref|XP_009405509.1|  PREDICTED: uncharacterized protein LOC103988641  81.3    4e-14   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008805338.1|  PREDICTED: uncharacterized protein LOC103718341  80.9    4e-14   Phoenix dactylifera
gb|AFK45721.1|  unknown                                               79.3    1e-13   Medicago truncatula
ref|XP_011000964.1|  PREDICTED: uncharacterized protein LOC105108...  79.3    2e-13   Populus euphratica
ref|XP_010112393.1|  hypothetical protein L484_010798                 78.6    5e-13   
ref|XP_011653042.1|  PREDICTED: uncharacterized protein LOC105435167  77.8    6e-13   Cucumis sativus [cucumbers]
ref|XP_007217685.1|  hypothetical protein PRUPE_ppa019356mg           76.6    1e-12   
ref|XP_004148010.2|  PREDICTED: uncharacterized protein LOC101218873  76.3    2e-12   Cucumis sativus [cucumbers]
gb|KJB70678.1|  hypothetical protein B456_011G086600                  76.3    2e-12   Gossypium raimondii
ref|XP_006385888.1|  hypothetical protein POPTR_0003s16715g           70.5    4e-12   
ref|XP_003622164.1|  hypothetical protein MTR_7g028590                75.5    4e-12   
gb|KDO63890.1|  hypothetical protein CISIN_1g047473mg                 74.7    7e-12   Citrus sinensis [apfelsine]
ref|XP_008450129.1|  PREDICTED: uncharacterized protein LOC103491...  73.6    2e-11   Cucumis melo [Oriental melon]
ref|XP_008450122.1|  PREDICTED: uncharacterized protein LOC103491...  73.6    2e-11   
ref|XP_006470092.1|  PREDICTED: uncharacterized protein LOC102616547  68.6    2e-11   
ref|XP_007161667.1|  hypothetical protein PHAVU_001G088600g           72.8    3e-11   Phaseolus vulgaris [French bean]
ref|XP_006599015.1|  PREDICTED: uncharacterized protein LOC102666543  72.4    4e-11   
ref|XP_011468707.1|  PREDICTED: uncharacterized protein LOC105352761  72.4    4e-11   Fragaria vesca subsp. vesca
gb|KHN28283.1|  hypothetical protein glysoja_040163                   72.4    5e-11   Glycine soja [wild soybean]
ref|XP_009344241.1|  PREDICTED: uncharacterized protein LOC103936127  71.6    7e-11   
ref|XP_008362102.1|  PREDICTED: uncharacterized protein LOC103425...  71.6    9e-11   
ref|XP_004516561.1|  PREDICTED: uncharacterized protein LOC101513155  71.2    9e-11   
ref|XP_008362103.1|  PREDICTED: uncharacterized protein LOC103425...  71.2    1e-10   
ref|XP_009415896.1|  PREDICTED: uncharacterized protein LOC103996661  70.1    2e-10   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007031921.1|  Regulator of nonsense transcripts 3A, putative   70.1    3e-10   
gb|KEH21973.1|  WRKY transcription factor-like protein                68.2    4e-10   Medicago truncatula
ref|XP_002300122.1|  hypothetical protein POPTR_0001s33510g           68.6    9e-10   
ref|XP_006604154.1|  PREDICTED: uncharacterized protein LOC102665678  68.2    1e-09   Glycine max [soybeans]
ref|XP_010550214.1|  PREDICTED: uncharacterized protein LOC104821...  67.4    2e-09   Tarenaya hassleriana [spider flower]
ref|XP_009597113.1|  PREDICTED: uncharacterized protein LOC104093106  67.0    2e-09   Nicotiana tomentosiformis
gb|KCW55813.1|  hypothetical protein EUGRSUZ_I01630                   66.6    3e-09   Eucalyptus grandis [rose gum]
ref|XP_011000963.1|  PREDICTED: uncharacterized protein LOC105108...  66.6    4e-09   Populus euphratica
ref|XP_010028982.1|  PREDICTED: uncharacterized protein LOC104419127  66.6    4e-09   Eucalyptus grandis [rose gum]
ref|XP_009757313.1|  PREDICTED: uncharacterized protein LOC104210...  64.3    2e-08   Nicotiana sylvestris
ref|XP_009757314.1|  PREDICTED: uncharacterized protein LOC104210...  64.3    2e-08   Nicotiana sylvestris
ref|XP_004979290.1|  PREDICTED: uncharacterized protein LOC101784407  63.9    4e-08   Setaria italica
emb|CDP20015.1|  unnamed protein product                              63.2    5e-08   Coffea canephora [robusta coffee]
ref|XP_009771786.1|  PREDICTED: uncharacterized protein LOC104222...  62.4    9e-08   Nicotiana sylvestris
ref|XP_009771785.1|  PREDICTED: uncharacterized protein LOC104222...  62.0    1e-07   Nicotiana sylvestris
ref|XP_010556290.1|  PREDICTED: uncharacterized protein LOC104825...  61.6    2e-07   Tarenaya hassleriana [spider flower]
ref|NP_001067926.1|  Os11g0490600                                     61.2    3e-07   
ref|XP_006848334.2|  PREDICTED: uncharacterized protein LOC18438079   61.2    3e-07   
gb|KJB76371.1|  hypothetical protein B456_012G084800                  60.5    4e-07   Gossypium raimondii
ref|XP_002303775.1|  hypothetical protein POPTR_0003s16710g           60.1    5e-07   
ref|XP_010237715.1|  PREDICTED: uncharacterized protein LOC100820935  60.1    7e-07   Brachypodium distachyon [annual false brome]
ref|XP_006663458.1|  PREDICTED: uncharacterized protein LOC102717475  59.7    9e-07   
gb|EAZ18396.1|  hypothetical protein OsJ_33928                        55.8    2e-06   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006399919.1|  hypothetical protein EUTSA_v10013936mg           58.9    2e-06   Eutrema salsugineum [saltwater cress]
ref|NP_001232845.1|  uncharacterized protein LOC100384392             57.8    2e-06   
ref|NP_001143888.1|  uncharacterized protein LOC100276689             57.8    4e-06   
ref|NP_001132334.1|  hypothetical protein                             57.8    4e-06   Zea mays [maize]
gb|KHG01154.1|  ethylene insensitive 3 -like protein                  57.4    5e-06   Gossypium arboreum [tree cotton]
emb|CDY58415.1|  BnaC09g54600D                                        57.0    6e-06   Brassica napus [oilseed rape]
gb|AEM59513.1|  controlling leaf angle                                56.6    1e-05   Zea mays [maize]
ref|XP_010550213.1|  PREDICTED: uncharacterized protein LOC104821...  55.5    2e-05   Tarenaya hassleriana [spider flower]
ref|XP_010543095.1|  PREDICTED: uncharacterized protein LOC104816121  54.3    3e-05   Tarenaya hassleriana [spider flower]
ref|XP_010543090.1|  PREDICTED: uncharacterized protein LOC104816116  54.3    4e-05   Tarenaya hassleriana [spider flower]
ref|XP_006338807.1|  PREDICTED: uncharacterized protein LOC102585754  52.8    1e-04   Solanum tuberosum [potatoes]
gb|EAY80969.1|  hypothetical protein OsI_36150                        51.2    6e-04   Oryza sativa Indica Group [Indian rice]
ref|XP_002449512.1|  hypothetical protein SORBIDRAFT_05g017110        50.8    7e-04   Sorghum bicolor [broomcorn]



>ref|XP_010656174.1| PREDICTED: uncharacterized protein LOC100266157 isoform X2 [Vitis 
vinifera]
Length=381

 Score =   198 bits (504),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 111/174 (64%), Positives = 138/174 (79%), Gaps = 8/174 (5%)
 Frame = -2

Query  840  GELFQKTKLADENSGGAKYDRGEKRMDKEHDKSAVHLVKKILKKGMPHASSKSSTAASGC  661
            GELFQ++K  +ENSG AK +RGEKR DKE DKSAVH++KK+LKK M HASS++STAA G 
Sbjct  212  GELFQRSK--EENSG-AKCERGEKRTDKEADKSAVHIMKKMLKKKMLHASSRNSTAAGG-  267

Query  660  TIDSAAADSKLHKILNMFHRKVHPESTTTAEKLDKPSKNEIRNNLMYDGAYNLGGA----  493
            T+DSA+A++KLHKIL+MFHRKVHPES+T  EK ++P KNEI+N + YDG  N G      
Sbjct  268  TVDSASAETKLHKILHMFHRKVHPESSTATEKPNRPHKNEIKNGIFYDGGCNNGDRMLPD  327

Query  492  ENVALMPKQRMSKESIRRLKSQSNMHQFTISDPDCNGNRECWIKSDADYLVLEL  331
            E++ + P++ +SKESIRR KSQSN  QFT+   D NGNRE WIK+DADYLVLEL
Sbjct  328  EDIMIFPQRTLSKESIRRYKSQSNPPQFTLCGNDSNGNREYWIKTDADYLVLEL  381



>ref|XP_010656172.1| PREDICTED: uncharacterized protein LOC100266157 isoform X1 [Vitis 
vinifera]
 emb|CBI27683.3| unnamed protein product [Vitis vinifera]
Length=381

 Score =   198 bits (504),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 111/174 (64%), Positives = 138/174 (79%), Gaps = 8/174 (5%)
 Frame = -2

Query  840  GELFQKTKLADENSGGAKYDRGEKRMDKEHDKSAVHLVKKILKKGMPHASSKSSTAASGC  661
            GELFQ++K  +ENSG AK +RGEKR DKE DKSAVH++KK+LKK M HASS++STAA G 
Sbjct  212  GELFQRSK--EENSG-AKCERGEKRTDKEADKSAVHIMKKMLKKKMLHASSRNSTAAGG-  267

Query  660  TIDSAAADSKLHKILNMFHRKVHPESTTTAEKLDKPSKNEIRNNLMYDGAYNLGGA----  493
            T+DSA+A++KLHKIL+MFHRKVHPES+T  EK ++P KNEI+N + YDG  N G      
Sbjct  268  TVDSASAETKLHKILHMFHRKVHPESSTATEKPNRPHKNEIKNGIFYDGGCNNGDRMLPD  327

Query  492  ENVALMPKQRMSKESIRRLKSQSNMHQFTISDPDCNGNRECWIKSDADYLVLEL  331
            E++ + P++ +SKESIRR KSQSN  QFT+   D NGNRE WIK+DADYLVLEL
Sbjct  328  EDIMIFPQRTLSKESIRRYKSQSNPPQFTLCGNDSNGNREYWIKTDADYLVLEL  381



>emb|CAN72196.1| hypothetical protein VITISV_014980 [Vitis vinifera]
Length=458

 Score =   184 bits (468),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 105/168 (63%), Positives = 132/168 (79%), Gaps = 8/168 (5%)
 Frame = -2

Query  840  GELFQKTKLADENSGGAKYDRGEKRMDKEHDKSAVHLVKKILKKGMPHASSKSSTAASGC  661
            GELFQ++K  +ENSG AK +RGEKR DKE DKSAVH++KK+LKK M HASS++STAA G 
Sbjct  278  GELFQRSK--EENSG-AKCERGEKRTDKEADKSAVHIMKKMLKKKMLHASSRNSTAAGG-  333

Query  660  TIDSAAADSKLHKILNMFHRKVHPESTTTAEKLDKPSKNEIRNNLMYDGAYNLGGA----  493
            T+DSA+A++KLHKIL+MFHRKVHPES+T  EK ++P KNEI+N + YDG  N G      
Sbjct  334  TVDSASAETKLHKILHMFHRKVHPESSTATEKPNRPHKNEIKNGIFYDGGCNNGDRMLPD  393

Query  492  ENVALMPKQRMSKESIRRLKSQSNMHQFTISDPDCNGNRECWIKSDAD  349
            E++ + P++ +SKESIRR KSQSN  QFT+   D NGNRE WIK+DAD
Sbjct  394  EDIMIFPQRTLSKESIRRYKSQSNPPQFTLCGNDSNGNREYWIKTDAD  441



>ref|XP_002514886.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF47440.1| conserved hypothetical protein [Ricinus communis]
Length=388

 Score =   183 bits (464),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 102/173 (59%), Positives = 135/173 (78%), Gaps = 4/173 (2%)
 Frame = -2

Query  840  GELFQKTKLADENSGGAKYDRGEKRMDKEHDKSAVHLVKKILKKGMPHASSKSSTAASGC  661
            GELFQ++K+A+EN GG KY+R EKRM+KE DKSAVHL+KK+LKK M HASS++ST + G 
Sbjct  217  GELFQRSKIAEENFGG-KYERDEKRMEKEADKSAVHLMKKMLKKKMLHASSRNSTGSGGG  275

Query  660  TIDSAAADSKLHKILNMFHRKVHPESTTTAEKLDKP---SKNEIRNNLMYDGAYNLGGAE  490
            T+DSA+A++KLHKIL+MFHRKVHPES+T+ +K DKP      +  NN  ++    +   E
Sbjct  276  TVDSASAETKLHKILHMFHRKVHPESSTSTQKADKPQKNDNKKNANNAGHNNGGQMLPDE  335

Query  489  NVALMPKQRMSKESIRRLKSQSNMHQFTISDPDCNGNRECWIKSDADYLVLEL  331
             + ++P++ +SK SIRR KSQSN  QFT+S  + NG+RECWIK+DADYLVLEL
Sbjct  336  EITVLPQRALSKRSIRRYKSQSNPPQFTLSSSESNGSRECWIKTDADYLVLEL  388



>gb|KJB30854.1| hypothetical protein B456_005G164100 [Gossypium raimondii]
Length=313

 Score =   179 bits (454),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 102/174 (59%), Positives = 133/174 (76%), Gaps = 7/174 (4%)
 Frame = -2

Query  840  GELFQKTKLADENSGGAKYDRGEKRMDKEHDKSAVHLVKKILKKGMPHASSKSSTAASGC  661
            GELFQ+TK+ +EN GG KYD+ EKR +KE DKSAVH++KK+LKK M +AS +SSTAA+  
Sbjct  143  GELFQRTKITEENVGG-KYDKEEKRTEKEGDKSAVHIMKKMLKKKMLNAS-RSSTAATEG  200

Query  660  TIDSAAADSKLHKILNMFHRKVHPESTTTAEKLDKPSKNEIRNNLMYDGAYNLGGA----  493
             IDSA+A++KLHKIL+MFHRKVHPES+T   K  KP K E + N+ YDG +  GG     
Sbjct  201  NIDSASAETKLHKILHMFHRKVHPESSTATYKHGKPQKKENKENIFYDGGHEDGGHMLTD  260

Query  492  ENVALMPKQRMSKESIRRLKSQSNMHQFTISDPDCNGNRECWIKSDADYLVLEL  331
            +++ + P++ +SK+ +RR KSQS   QFT++  D NGNRECWIK+DADYLVLEL
Sbjct  261  DDIMIFPQRALSKK-MRRYKSQSIPPQFTLNCNDSNGNRECWIKTDADYLVLEL  313



>gb|KJB60935.1| hypothetical protein B456_009G332000 [Gossypium raimondii]
Length=391

 Score =   179 bits (455),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 105/174 (60%), Positives = 132/174 (76%), Gaps = 7/174 (4%)
 Frame = -2

Query  840  GELFQKTKLADENSGGAKYDRGEKRMDKEHDKSAVHLVKKILKKGMPHASSKSSTAASGC  661
            GELFQ+TK+ +E S G+KYD+ EKRM+KE DKSAVH++KKILKK M  AS KSSTAA+G 
Sbjct  221  GELFQRTKITEE-SFGSKYDKEEKRMEKEGDKSAVHIMKKILKKKMLSAS-KSSTAATGG  278

Query  660  TIDSAAADSKLHKILNMFHRKVHPESTTTAEKLDKPSKNEIRNNLMYDGAYNLGGA----  493
             IDSA+A++KLHKIL+ FHRKVHPES+T   K DKP KNE +  + Y+G    GG     
Sbjct  279  NIDSASAETKLHKILHKFHRKVHPESSTATYKHDKPQKNENKKGIGYNGGQENGGPILAE  338

Query  492  ENVALMPKQRMSKESIRRLKSQSNMHQFTISDPDCNGNRECWIKSDADYLVLEL  331
            E++ + P++  SK+ +RR  SQ+N  QFT+S  D NGNRECWIK+DADYLVLEL
Sbjct  339  EDIVIFPQRAHSKD-MRRYNSQANPSQFTLSCNDSNGNRECWIKTDADYLVLEL  391



>gb|KJB30852.1| hypothetical protein B456_005G164100 [Gossypium raimondii]
Length=398

 Score =   178 bits (452),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 102/174 (59%), Positives = 133/174 (76%), Gaps = 7/174 (4%)
 Frame = -2

Query  840  GELFQKTKLADENSGGAKYDRGEKRMDKEHDKSAVHLVKKILKKGMPHASSKSSTAASGC  661
            GELFQ+TK+ +EN GG KYD+ EKR +KE DKSAVH++KK+LKK M +AS +SSTAA+  
Sbjct  228  GELFQRTKITEENVGG-KYDKEEKRTEKEGDKSAVHIMKKMLKKKMLNAS-RSSTAATEG  285

Query  660  TIDSAAADSKLHKILNMFHRKVHPESTTTAEKLDKPSKNEIRNNLMYDGAYNLGGA----  493
             IDSA+A++KLHKIL+MFHRKVHPES+T   K  KP K E + N+ YDG +  GG     
Sbjct  286  NIDSASAETKLHKILHMFHRKVHPESSTATYKHGKPQKKENKENIFYDGGHEDGGHMLTD  345

Query  492  ENVALMPKQRMSKESIRRLKSQSNMHQFTISDPDCNGNRECWIKSDADYLVLEL  331
            +++ + P++ +SK+ +RR KSQS   QFT++  D NGNRECWIK+DADYLVLEL
Sbjct  346  DDIMIFPQRALSKK-MRRYKSQSIPPQFTLNCNDSNGNRECWIKTDADYLVLEL  398



>ref|XP_007043918.1| Uncharacterized protein TCM_008615 [Theobroma cacao]
 gb|EOX99749.1| Uncharacterized protein TCM_008615 [Theobroma cacao]
Length=499

 Score =   177 bits (449),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 102/168 (61%), Positives = 131/168 (78%), Gaps = 7/168 (4%)
 Frame = -2

Query  840  GELFQKTKLADENSGGAKYDRGEKRMDKEHDKSAVHLVKKILKKGMPHASSKSSTAASGC  661
            GELFQ+TK+ +EN G +KYD+ EKR +KE DKSAVH++KK+LKK M +AS +SSTAA+G 
Sbjct  287  GELFQRTKITEENFG-SKYDKEEKRPEKEGDKSAVHIMKKMLKKKMLNAS-RSSTAATGG  344

Query  660  TIDSAAADSKLHKILNMFHRKVHPESTTTAEKLDKPSKNEIRNNLMYDGAYNLGGA----  493
             IDSA+A++KLHKIL+MFHRKVHPES+T   K DKP KNE +  ++YDG +  GG     
Sbjct  345  NIDSASAETKLHKILHMFHRKVHPESSTATYKHDKPQKNENKKGILYDGGHENGGHTLED  404

Query  492  ENVALMPKQRMSKESIRRLKSQSNMHQFTISDPDCNGNRECWIKSDAD  349
            E++ L P++ +SK ++RR KSQSN  QFTIS  D NGNRECWIK+DAD
Sbjct  405  EDIMLFPQRALSK-NMRRYKSQSNPPQFTISCNDSNGNRECWIKTDAD  451



>ref|XP_011086830.1| PREDICTED: uncharacterized protein LOC105168442 [Sesamum indicum]
Length=388

 Score =   172 bits (435),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 95/173 (55%), Positives = 125/173 (72%), Gaps = 5/173 (3%)
 Frame = -2

Query  840  GELFQKTKLADENSGGAKYDRGEKRMDKEHDKSAVHLVKKILKKGMPHASSKSSTAASGC  661
            GELFQKTK A+E   G K DR EKR +KE DKSAVHL+KK+LK+   HASS+SSTAA G 
Sbjct  218  GELFQKTKQAEE-CYGTKSDRVEKRTEKETDKSAVHLMKKMLKRRTIHASSRSSTAAQGA  276

Query  660  TIDSAAADSKLHKILNMFHRKVHPESTTTAEKLDKPSKNEIRNNLMYDGAYNLG---GAE  490
            TIDS  A++KLHKIL++F+RKVHPE++T+  +  KP+KNEI  N     + ++G    AE
Sbjct  277  TIDSTTAETKLHKILHIFNRKVHPENSTSCHQSHKPTKNEINYNTQLTASNSVGLRPSAE  336

Query  489  NVALMPKQRMSKESIRRLKSQSNMHQFTISDPDCNGNRECWIKSDADYLVLEL  331
            ++ + P+Q +SKE+    K+QS++ Q T S  D  GN E W+K+DADYLVLEL
Sbjct  337  DIIIYPQQAISKENTWSHKNQSHLPQLTKSSSDIAGN-EFWVKTDADYLVLEL  388



>gb|KJB30853.1| hypothetical protein B456_005G164100 [Gossypium raimondii]
Length=313

 Score =   166 bits (419),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 96/168 (57%), Positives = 127/168 (76%), Gaps = 7/168 (4%)
 Frame = -2

Query  840  GELFQKTKLADENSGGAKYDRGEKRMDKEHDKSAVHLVKKILKKGMPHASSKSSTAASGC  661
            GELFQ+TK+ +EN GG KYD+ EKR +KE DKSAVH++KK+LKK M +AS +SSTAA+  
Sbjct  143  GELFQRTKITEENVGG-KYDKEEKRTEKEGDKSAVHIMKKMLKKKMLNAS-RSSTAATEG  200

Query  660  TIDSAAADSKLHKILNMFHRKVHPESTTTAEKLDKPSKNEIRNNLMYDGAYNLGGA----  493
             IDSA+A++KLHKIL+MFHRKVHPES+T   K  KP K E + N+ YDG +  GG     
Sbjct  201  NIDSASAETKLHKILHMFHRKVHPESSTATYKHGKPQKKENKENIFYDGGHEDGGHMLTD  260

Query  492  ENVALMPKQRMSKESIRRLKSQSNMHQFTISDPDCNGNRECWIKSDAD  349
            +++ + P++ +SK+ +RR KSQS   QFT++  D NGNRECWIK+DAD
Sbjct  261  DDIMIFPQRALSKK-MRRYKSQSIPPQFTLNCNDSNGNRECWIKTDAD  307



>ref|XP_009591285.1| PREDICTED: uncharacterized protein LOC104088330 [Nicotiana tomentosiformis]
Length=381

 Score =   166 bits (421),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 107/170 (63%), Positives = 131/170 (77%), Gaps = 13/170 (8%)
 Frame = -2

Query  840  GELFQKTKLADENSGGAKYDRGEKRMDKEHDKSAVHLVKKILKKGMPHASSKSSTAASGC  661
            GELFQKTKLA+EN G AK DRGEKR D   DKSAV+L+KKILKK M HASS++S  ASG 
Sbjct  225  GELFQKTKLAEENYG-AKSDRGEKRTD---DKSAVNLMKKILKKKMLHASSRNS-VASGG  279

Query  660  TIDSAAADSKLHKILNMFHRKVHPESTTTAEKLDKPSKNEIRNNLMYDGAYNLGGAENVA  481
            T+DS +A+ KL+KIL+MFHRKVHPES+T A+K DK SKNE  ++    G  +L   E++ 
Sbjct  280  TVDSVSAERKLNKILHMFHRKVHPESSTAAQKSDKSSKNERAHD---RGRLSL-AREDIT  335

Query  480  LMPKQRMSKESIRRLKSQSNMHQFTISDPDCNGNRECWIKSDADYLVLEL  331
            ++P  R+SK+SI   K QSNM QFT+ D D NGNRECWIK+DA+YLVLEL
Sbjct  336  IIPHHRLSKDSI---KGQSNMQQFTL-DGDSNGNRECWIKTDAEYLVLEL  381



>ref|XP_009771615.1| PREDICTED: uncharacterized protein LOC104222123 [Nicotiana sylvestris]
Length=381

 Score =   161 bits (407),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 104/170 (61%), Positives = 129/170 (76%), Gaps = 10/170 (6%)
 Frame = -2

Query  840  GELFQKTKLADENSGGAKYDRGEKRMDKEHDKSAVHLVKKILKKGMPHASSKSSTAASGC  661
            GELFQKTKLA+EN G AK DRGEKR DK+ DKSAVHL+KKILKK M HASS++S  ASG 
Sbjct  222  GELFQKTKLAEENYG-AKSDRGEKRTDKDSDKSAVHLMKKILKKKMLHASSRNS-VASGG  279

Query  660  TIDSAAADSKLHKILNMFHRKVHPESTTTAEKLDKPSKNEIRNNLMYDGAYNLGGAENVA  481
            T+DS +A+ KL+KIL+MFHRKVHPES+T  +K  K SKNE  ++    G  +L   E++ 
Sbjct  280  TVDSVSAERKLNKILHMFHRKVHPESSTGGQKPYKSSKNERAHD---RGRLSL-AREDIT  335

Query  480  LMPKQRMSKESIRRLKSQSNMHQFTISDPDCNGNRECWIKSDADYLVLEL  331
            ++P  R+SK+SI   K QSNM Q T+ D + + NRECWIK+DADYLVLEL
Sbjct  336  IIPHHRLSKDSI---KGQSNMQQCTL-DGELDENRECWIKTDADYLVLEL  381



>ref|XP_002299323.2| hypothetical protein POPTR_0001s13570g [Populus trichocarpa]
 gb|EEE84128.2| hypothetical protein POPTR_0001s13570g [Populus trichocarpa]
Length=390

 Score =   159 bits (403),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 104/173 (60%), Positives = 132/173 (76%), Gaps = 5/173 (3%)
 Frame = -2

Query  840  GELFQKTKLADENSGGAKYDRGEKRMDKEHDKSAVHLVKKILKKGMPHASSKSSTAASGC  661
            GELFQKTK+A+EN G  K++R EKR++KE DKSAV+L+KKILKK M HASS+SST+A G 
Sbjct  220  GELFQKTKIAEENYG-VKFEREEKRVEKEADKSAVNLMKKILKKKMLHASSRSSTSAGGA  278

Query  660  TIDSAAADSKLHKILNMFHRKVHPESTTTAEKLDKPSKNEIRNNLMYDGAYNLGGA---E  490
            T+DSA+A++KLHKIL+MFHRKVHPES+T+  K DKP K E + +    G  N G     E
Sbjct  279  TVDSASAETKLHKILHMFHRKVHPESSTSTRKADKPPKTENKKSNNNGGNNNGGQMLLDE  338

Query  489  NVALMPKQRMSKESIRRLKSQSNMHQFTISDPDCNGNRECWIKSDADYLVLEL  331
            ++ ++P+  +SK SIRR KSQSN   F  +  D NG+RECWIK+DADYLVLEL
Sbjct  339  DITIVPRT-LSKRSIRRFKSQSNPPHFMFTGCDSNGSRECWIKTDADYLVLEL  390



>ref|XP_010250652.1| PREDICTED: uncharacterized protein LOC104592840 [Nelumbo nucifera]
Length=383

 Score =   157 bits (396),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 93/174 (53%), Positives = 123/174 (71%), Gaps = 6/174 (3%)
 Frame = -2

Query  840  GELFQKTKLADENSGGAKYDRGEKRMDKEHDKSAVHLVKKILKKGMPHASSKSSTAASGC  661
            GELF K+K+AD+NS G K D+ EKR +K+ +KS VHL+KK+LK+ +P++++  S+AA+  
Sbjct  212  GELFLKSKMADDNSAG-KCDKDEKRAEKDAEKSGVHLMKKMLKRRVPNSTTSRSSAAAA-  269

Query  660  TIDSAAADSKLHKILNMFHRKVHPESTTTAEKLDKPSKNEIRNNLMYDGAYNLGGA----  493
              D  +A+ K HKIL MFHRKVHPEST  A+K  K  K EI++N + DG  N G      
Sbjct  270  PADPVSAEKKTHKILQMFHRKVHPESTLPAKKPSKSHKTEIKSNGLNDGGCNNGDHTLPD  329

Query  492  ENVALMPKQRMSKESIRRLKSQSNMHQFTISDPDCNGNRECWIKSDADYLVLEL  331
            E + + P++ +SKE IRR KSQSN  QF +S  D NGNRE WIK+DADYLVLEL
Sbjct  330  EYIMIFPQRTISKERIRRYKSQSNPPQFALSGSDSNGNREYWIKTDADYLVLEL  383



>ref|XP_006437983.1| hypothetical protein CICLE_v10031707mg [Citrus clementina]
 ref|XP_006484156.1| PREDICTED: uncharacterized protein LOC102622478 [Citrus sinensis]
 gb|ESR51223.1| hypothetical protein CICLE_v10031707mg [Citrus clementina]
Length=405

 Score =   157 bits (397),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 99/174 (57%), Positives = 127/174 (73%), Gaps = 5/174 (3%)
 Frame = -2

Query  840  GELFQKTKLADENSGGAKYDRG-EKRMDKEHDKSAVHLVKKILKKGMPHASSKSSTAASG  664
            GELFQ+TKL+D+ + G+K +R  EKR+DKE DKS++H++KKILKK M HAS +SS A +G
Sbjct  233  GELFQRTKLSDQENPGSKCERDQEKRIDKEADKSSLHIMKKILKKKMLHAS-RSSNATAG  291

Query  663  CTIDSAAADSKLHKILNMFHRKVHPESTTTAEKLDKPSKNEIRNNLMYDGAYNLGGAENV  484
             T+DS++A++KLHKIL+MFHRKVHPES+   +K  KP K E R +  +  A    G + +
Sbjct  292  GTVDSSSAETKLHKILHMFHRKVHPESSAATKKNGKPMKRENRKSSSHHEAVQDNGGQIL  351

Query  483  ALM---PKQRMSKESIRRLKSQSNMHQFTISDPDCNGNRECWIKSDADYLVLEL  331
                  P+  +SKE IRR KSQSN  QFTIS  D NGNRE WIK+DADYLVLEL
Sbjct  352  VPADEDPQTNLSKEKIRRYKSQSNPPQFTISGSDSNGNREFWIKTDADYLVLEL  405



>gb|KDO81827.1| hypothetical protein CISIN_1g015546mg [Citrus sinensis]
Length=405

 Score =   157 bits (396),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 99/174 (57%), Positives = 127/174 (73%), Gaps = 5/174 (3%)
 Frame = -2

Query  840  GELFQKTKLADENSGGAKYDRG-EKRMDKEHDKSAVHLVKKILKKGMPHASSKSSTAASG  664
            GELFQ+TKL+D+ + G+K +R  EKR+DKE DKS++H++KKILKK M HAS +SS A +G
Sbjct  233  GELFQRTKLSDQENPGSKCERDQEKRIDKEADKSSLHIMKKILKKKMLHAS-RSSNATAG  291

Query  663  CTIDSAAADSKLHKILNMFHRKVHPESTTTAEKLDKPSKNEIRNNLMYDGAYNLGGAENV  484
             T+DS++A++KLHKIL+MFHRKVHPES+   +K  KP K E R +  +  A    G + +
Sbjct  292  GTVDSSSAETKLHKILHMFHRKVHPESSAATKKNGKPMKRENRKSSSHHEAVQDNGGQIL  351

Query  483  ALM---PKQRMSKESIRRLKSQSNMHQFTISDPDCNGNRECWIKSDADYLVLEL  331
                  P+  +SKE IRR KSQSN  QFTIS  D NGNRE WIK+DADYLVLEL
Sbjct  352  VPADEDPQTNLSKEKIRRYKSQSNPPQFTISGSDSNGNREFWIKTDADYLVLEL  405



>ref|XP_011036107.1| PREDICTED: uncharacterized protein LOC105133719 [Populus euphratica]
Length=390

 Score =   155 bits (392),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 103/173 (60%), Positives = 130/173 (75%), Gaps = 5/173 (3%)
 Frame = -2

Query  840  GELFQKTKLADENSGGAKYDRGEKRMDKEHDKSAVHLVKKILKKGMPHASSKSSTAASGC  661
            GELFQKTK+A+EN G  K +R EKR++KE DKSAV+L+KKILKK M HASS+SST+A G 
Sbjct  220  GELFQKTKIAEENYG-VKLEREEKRVEKEADKSAVNLMKKILKKKMLHASSRSSTSAGGA  278

Query  660  TIDSAAADSKLHKILNMFHRKVHPESTTTAEKLDKPSKNEIRNNLMYDGAYNLGGA---E  490
            T+D+A+A++KLHKIL+MFHRKVHPES+T+  K DKP K E + +    G  N G     E
Sbjct  279  TVDTASAETKLHKILHMFHRKVHPESSTSTRKADKPPKTENKKSNNNGGNNNGGQMLLDE  338

Query  489  NVALMPKQRMSKESIRRLKSQSNMHQFTISDPDCNGNRECWIKSDADYLVLEL  331
            ++ ++P Q + K SIRR KSQSN   F  +  D NG+RECWIK+DADYLVLEL
Sbjct  339  DITIVP-QTLPKMSIRRFKSQSNPPHFMFTGCDSNGSRECWIKTDADYLVLEL  390



>ref|XP_012085721.1| PREDICTED: uncharacterized protein LOC105644842 [Jatropha curcas]
 gb|KDP26836.1| hypothetical protein JCGZ_17994 [Jatropha curcas]
Length=390

 Score =   154 bits (389),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 101/170 (59%), Positives = 129/170 (76%), Gaps = 4/170 (2%)
 Frame = -2

Query  840  GELFQKTKLADENSGGAKYDRGEKRMDKEHDKSAVHLVKKILKKGMPHASSKSSTAASGC  661
            GELFQ+TK+A+ENSG +K +R EKRM+KE DKS+V L+KK+LKK M HASS+SS AA G 
Sbjct  225  GELFQRTKMAEENSG-SKCERDEKRMEKEADKSSVPLMKKMLKKKMLHASSRSS-AAGGG  282

Query  660  TIDSAAADSKLHKILNMFHRKVHPESTTTAEKLDKPSKNEIRNNLMYDGAYNLGGAENVA  481
            T+DSA+ ++KL KIL+MFHRKVHPES+T   K DKP KNE + N       ++   E + 
Sbjct  283  TVDSASTETKLQKILHMFHRKVHPESSTAPRKADKPPKNENKKNGNN--GGHMVPDEEIT  340

Query  480  LMPKQRMSKESIRRLKSQSNMHQFTISDPDCNGNRECWIKSDADYLVLEL  331
            ++P + +SK SIRR KSQSN  QFT+S  D +G+RE WIK+DADYLVLEL
Sbjct  341  IIPPKALSKRSIRRYKSQSNPPQFTLSSSDSSGSREYWIKTDADYLVLEL  390



>ref|XP_004239242.1| PREDICTED: uncharacterized protein LOC101252392 [Solanum lycopersicum]
Length=380

 Score =   147 bits (371),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 96/171 (56%), Positives = 120/171 (70%), Gaps = 16/171 (9%)
 Frame = -2

Query  840  GELFQKTKLADENSGGAKYDRGEKRMDKEHDKSAVHLVKKILKKGMPHASSKSSTAASGC  661
            GELFQKTKLA+EN G  KY   EKR DK+ DKSAVHL+KKILKK M HASS++S +ASG 
Sbjct  225  GELFQKTKLAEENYG-PKYH--EKRTDKDSDKSAVHLMKKILKKKMLHASSRNSVSASGG  281

Query  660  TIDSAAADSKLHKILNMFHRKVHPESTTTAEKLDKPSKNEIRNNLMYD-GAYNLGGAENV  484
            T+DS +A+SK HKIL MFHRKVHPES+   +K        ++N   +D G  +L   +++
Sbjct  282  TVDSVSAESKPHKILQMFHRKVHPESSMKPDKF-------LKNERAHDRGGLSL-ARDDI  333

Query  483  ALMPKQRMSKESIRRLKSQSNMHQFTISDPDCNGNRECWIKSDADYLVLEL  331
             ++P  R+SK+SI   K Q  M Q T+ D D N NRECWIK+DADY VLEL
Sbjct  334  TIIPHHRLSKDSI---KGQPIMQQSTV-DGDSNENRECWIKTDADYFVLEL  380



>ref|XP_008389910.1| PREDICTED: uncharacterized protein LOC103452173 isoform X4 [Malus 
domestica]
Length=384

 Score =   144 bits (362),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 92/172 (53%), Positives = 119/172 (69%), Gaps = 7/172 (4%)
 Frame = -2

Query  840  GELFQKTKLADENSGGAKYDRGEKRMDKEHDKSAVHLVKKILKKGMPHASSKSSTAASGC  661
            GELFQ+TKLA+E SG AK  + EKR +KE DKSA+HL+KK+LKK M HASS+     SG 
Sbjct  218  GELFQRTKLAEEISG-AKLSKEEKRAEKEADKSAMHLMKKMLKKKMIHASSR----GSGG  272

Query  660  TIDSAAADSKLHKILNMFHRKVHPESTTTAEKLDKPSKNEIRNNLMYDGAYNLGGAE-NV  484
              D A+A++KL+KIL+MFHRKVHPE++   +K  K  +N+ +     +G Y+ G  E ++
Sbjct  273  AADHASAETKLNKILHMFHRKVHPETSAAQQKPGKYERNQTKKKTSSEGTYSNGDQEDDI  332

Query  483  ALMPKQRMSKE-SIRRLKSQSNMHQFTISDPDCNGNRECWIKSDADYLVLEL  331
             L P+Q  S   S+RR KSQSN  Q  +S  D N NRE WIK+DADYLVLEL
Sbjct  333  ILYPQQGFSSNPSMRRYKSQSNPPQIALSGMDSNDNREHWIKTDADYLVLEL  384



>ref|XP_008389909.1| PREDICTED: uncharacterized protein LOC103452173 isoform X3 [Malus 
domestica]
Length=387

 Score =   143 bits (361),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 92/172 (53%), Positives = 119/172 (69%), Gaps = 7/172 (4%)
 Frame = -2

Query  840  GELFQKTKLADENSGGAKYDRGEKRMDKEHDKSAVHLVKKILKKGMPHASSKSSTAASGC  661
            GELFQ+TKLA+E SG AK  + EKR +KE DKSA+HL+KK+LKK M HASS+     SG 
Sbjct  221  GELFQRTKLAEEISG-AKLSKEEKRAEKEADKSAMHLMKKMLKKKMIHASSR----GSGG  275

Query  660  TIDSAAADSKLHKILNMFHRKVHPESTTTAEKLDKPSKNEIRNNLMYDGAYNLGGAE-NV  484
              D A+A++KL+KIL+MFHRKVHPE++   +K  K  +N+ +     +G Y+ G  E ++
Sbjct  276  AADHASAETKLNKILHMFHRKVHPETSAAQQKPGKYERNQTKKKTSSEGTYSNGDQEDDI  335

Query  483  ALMPKQRMSKE-SIRRLKSQSNMHQFTISDPDCNGNRECWIKSDADYLVLEL  331
             L P+Q  S   S+RR KSQSN  Q  +S  D N NRE WIK+DADYLVLEL
Sbjct  336  ILYPQQGFSSNPSMRRYKSQSNPPQIALSGMDSNDNREHWIKTDADYLVLEL  387



>ref|XP_008389908.1| PREDICTED: uncharacterized protein LOC103452173 isoform X2 [Malus 
domestica]
Length=392

 Score =   143 bits (361),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 92/172 (53%), Positives = 119/172 (69%), Gaps = 7/172 (4%)
 Frame = -2

Query  840  GELFQKTKLADENSGGAKYDRGEKRMDKEHDKSAVHLVKKILKKGMPHASSKSSTAASGC  661
            GELFQ+TKLA+E SG AK  + EKR +KE DKSA+HL+KK+LKK M HASS+     SG 
Sbjct  226  GELFQRTKLAEEISG-AKLSKEEKRAEKEADKSAMHLMKKMLKKKMIHASSR----GSGG  280

Query  660  TIDSAAADSKLHKILNMFHRKVHPESTTTAEKLDKPSKNEIRNNLMYDGAYNLGGAE-NV  484
              D A+A++KL+KIL+MFHRKVHPE++   +K  K  +N+ +     +G Y+ G  E ++
Sbjct  281  AADHASAETKLNKILHMFHRKVHPETSAAQQKPGKYERNQTKKKTSSEGTYSNGDQEDDI  340

Query  483  ALMPKQRMSKE-SIRRLKSQSNMHQFTISDPDCNGNRECWIKSDADYLVLEL  331
             L P+Q  S   S+RR KSQSN  Q  +S  D N NRE WIK+DADYLVLEL
Sbjct  341  ILYPQQGFSSNPSMRRYKSQSNPPQIALSGMDSNDNREHWIKTDADYLVLEL  392



>ref|XP_008389907.1| PREDICTED: uncharacterized protein LOC103452173 isoform X1 [Malus 
domestica]
Length=395

 Score =   143 bits (360),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 92/172 (53%), Positives = 119/172 (69%), Gaps = 7/172 (4%)
 Frame = -2

Query  840  GELFQKTKLADENSGGAKYDRGEKRMDKEHDKSAVHLVKKILKKGMPHASSKSSTAASGC  661
            GELFQ+TKLA+E SG AK  + EKR +KE DKSA+HL+KK+LKK M HASS+     SG 
Sbjct  229  GELFQRTKLAEEISG-AKLSKEEKRAEKEADKSAMHLMKKMLKKKMIHASSR----GSGG  283

Query  660  TIDSAAADSKLHKILNMFHRKVHPESTTTAEKLDKPSKNEIRNNLMYDGAYNLGGAE-NV  484
              D A+A++KL+KIL+MFHRKVHPE++   +K  K  +N+ +     +G Y+ G  E ++
Sbjct  284  AADHASAETKLNKILHMFHRKVHPETSAAQQKPGKYERNQTKKKTSSEGTYSNGDQEDDI  343

Query  483  ALMPKQRMSKE-SIRRLKSQSNMHQFTISDPDCNGNRECWIKSDADYLVLEL  331
             L P+Q  S   S+RR KSQSN  Q  +S  D N NRE WIK+DADYLVLEL
Sbjct  344  ILYPQQGFSSNPSMRRYKSQSNPPQIALSGMDSNDNREHWIKTDADYLVLEL  395



>ref|XP_009343132.1| PREDICTED: uncharacterized protein LOC103935107 [Pyrus x bretschneideri]
Length=384

 Score =   142 bits (359),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 91/172 (53%), Positives = 118/172 (69%), Gaps = 7/172 (4%)
 Frame = -2

Query  840  GELFQKTKLADENSGGAKYDRGEKRMDKEHDKSAVHLVKKILKKGMPHASSKSSTAASGC  661
            GELFQ+TKLA+E SG AK  + EKR +KE DKSA+HL+KK+LKK M HASS+     SG 
Sbjct  218  GELFQRTKLAEEISG-AKLSKEEKRAEKEADKSAMHLMKKMLKKKMIHASSR----GSGG  272

Query  660  TIDSAAADSKLHKILNMFHRKVHPESTTTAEKLDKPSKNEIRNNLMYDGAYNLGGAE-NV  484
              D A+A++KL+ IL+MFHRKVHPE++   +K  K  +N+ +     +G Y+ G  E ++
Sbjct  273  AADPASAETKLNNILHMFHRKVHPETSAAEQKPGKYERNQTKKKTSSEGTYSNGDQEDDI  332

Query  483  ALMPKQRMSKE-SIRRLKSQSNMHQFTISDPDCNGNRECWIKSDADYLVLEL  331
             L P+Q  S   S+RR KSQSN  Q  +S  D N NRE WIK+DADYLVLEL
Sbjct  333  ILYPQQGFSSNPSMRRYKSQSNPPQIALSGMDSNDNREQWIKTDADYLVLEL  384



>ref|XP_011020800.1| PREDICTED: uncharacterized protein LOC105123041 [Populus euphratica]
Length=384

 Score =   141 bits (356),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 99/174 (57%), Positives = 127/174 (73%), Gaps = 13/174 (7%)
 Frame = -2

Query  840  GELFQKTKLADENSGGAKYDRGEKRMDKEHDKSAVHLVKKILKKGMPHASSKSSTAASGC  661
            GELFQKTK+A+ENSG  K++R EKRM+KE DKSAV+L+KK LKK M HASS+SSTA  G 
Sbjct  220  GELFQKTKIAEENSG-IKFEREEKRMEKEADKSAVNLMKKTLKKKMLHASSRSSTATGGG  278

Query  660  TIDSAAADSKLHKILNMFHRKVHPESTTTAEKLDKPSKNEIRNNLMYDGAYNLGGA----  493
            T+DSA+A++KL KIL+MFHRKVHPES+T+  K  KP KNE + +       N GG     
Sbjct  279  TLDSASAETKLRKILHMFHRKVHPESSTSTRKAGKPQKNENKKS-------NKGGQVLPN  331

Query  492  ENVALMPKQRMSKESIRRLKSQSNMHQFTISDPDCNGNRECWIKSDADYLVLEL  331
            E++ ++P+    + + RR KSQSN   FT +  + N +RECWIK+DADYLVLEL
Sbjct  332  EDITIVPRTLSRRST-RRFKSQSNPPHFTFTGCESNESRECWIKTDADYLVLEL  384



>ref|XP_004310225.1| PREDICTED: uncharacterized protein LOC101307273 isoform X2 [Fragaria 
vesca subsp. vesca]
Length=389

 Score =   139 bits (351),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 92/179 (51%), Positives = 116/179 (65%), Gaps = 13/179 (7%)
 Frame = -2

Query  840  GELFQKTKLADENSGGAKYDRGEKRMD-KEHDKSAVHLVKKILKKGMPH--ASSKSSTAA  670
            GELFQK+KL +EN  GAK  + EKR D KE DKS++HL+KK L K + H  ASS+SSTAA
Sbjct  215  GELFQKSKLTEENYSGAKLSKEEKRADQKEADKSSIHLMKKKLMKKVLHMNASSRSSTAA  274

Query  669  SGCTIDSAAADSKLHKILNMFHRKVHPESTTTAEKLDKPSKNEIRNNLMYDGAYN-----  505
                 +  +A++KL+KIL MFHRKVHPE++T  EK  K  K+E +     DG  N     
Sbjct  275  G----EPGSAETKLNKILQMFHRKVHPENSTAGEKSGKYQKSENKKRRSSDGISNHRDQV  330

Query  504  LGGAENVALMPKQRMSKESI-RRLKSQSNMHQFTISDPDCNGNRECWIKSDADYLVLEL  331
                +++ L P+Q  S   I RR KSQSN  QF +   D NGN+E WIK+DADYLVLEL
Sbjct  331  FPDDQDIMLYPEQVSSSNQIMRRYKSQSNPPQFALGALDSNGNKEHWIKTDADYLVLEL  389



>ref|XP_011457500.1| PREDICTED: uncharacterized protein LOC101307273 isoform X1 [Fragaria 
vesca subsp. vesca]
Length=397

 Score =   139 bits (351),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 92/179 (51%), Positives = 116/179 (65%), Gaps = 13/179 (7%)
 Frame = -2

Query  840  GELFQKTKLADENSGGAKYDRGEKRMD-KEHDKSAVHLVKKILKKGMPH--ASSKSSTAA  670
            GELFQK+KL +EN  GAK  + EKR D KE DKS++HL+KK L K + H  ASS+SSTAA
Sbjct  223  GELFQKSKLTEENYSGAKLSKEEKRADQKEADKSSIHLMKKKLMKKVLHMNASSRSSTAA  282

Query  669  SGCTIDSAAADSKLHKILNMFHRKVHPESTTTAEKLDKPSKNEIRNNLMYDGAYN-----  505
                 +  +A++KL+KIL MFHRKVHPE++T  EK  K  K+E +     DG  N     
Sbjct  283  G----EPGSAETKLNKILQMFHRKVHPENSTAGEKSGKYQKSENKKRRSSDGISNHRDQV  338

Query  504  LGGAENVALMPKQRMSKESI-RRLKSQSNMHQFTISDPDCNGNRECWIKSDADYLVLEL  331
                +++ L P+Q  S   I RR KSQSN  QF +   D NGN+E WIK+DADYLVLEL
Sbjct  339  FPDDQDIMLYPEQVSSSNQIMRRYKSQSNPPQFALGALDSNGNKEHWIKTDADYLVLEL  397



>emb|CDP13369.1| unnamed protein product [Coffea canephora]
Length=412

 Score =   138 bits (347),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 87/175 (50%), Positives = 116/175 (66%), Gaps = 6/175 (3%)
 Frame = -2

Query  840  GELFQKTKLADENSGGAKYDRGEKRMDKEHDKSAVHLVKKILKKGMPHASSKSSTAASGC  661
            GELF KTK A++ SG       EK+ DKE DKSAV LVKK+LK+ + H + ++  AASG 
Sbjct  239  GELFLKTKQAEDISGAKPERAAEKKPDKESDKSAVLLVKKMLKRKILHPN-RNCIAASGG  297

Query  660  TIDSAAADSKLHKILNMFHRKVHPESTTTAEKLDKPSKN-EIRNNLMYDGAYNLGGA---  493
            T DSA+A++KLHKIL++FHRKVHPES+  A+K  KP      R+   Y   Y +GG    
Sbjct  298  TTDSASAETKLHKILHLFHRKVHPESSAAAKKSKKPPSQVGERSGGSYKRPYIIGGPEDT  357

Query  492  -ENVALMPKQRMSKESIRRLKSQSNMHQFTISDPDCNGNRECWIKSDADYLVLEL  331
             E++ + P Q +SKE +RR KSQSN  Q +++  +  G  E WIK+D+DYLVLEL
Sbjct  358  DEDIIITPYQPLSKERLRRFKSQSNPPQLSLNGGNPLGTGEHWIKTDSDYLVLEL  412



>ref|XP_010027268.1| PREDICTED: uncharacterized protein LOC104417743 [Eucalyptus grandis]
Length=395

 Score =   135 bits (340),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 79/176 (45%), Positives = 115/176 (65%), Gaps = 15/176 (9%)
 Frame = -2

Query  840  GELFQKTKLADENSGGAKYDRGEKRMDKEHDKSAVHLVKKILKKGMPHA--SSKSSTAAS  667
            GELFQKTK+ +E  G  K         K+ D S VH VKK LKK    A  +++SS+  +
Sbjct  229  GELFQKTKMTEEEFGYGK---------KDWDSSMVHFVKKKLKKKALQANPAARSSSFDA  279

Query  666  GCTIDSAAADSKLHKILNMFHRKVHPESTTTAEKLDKPSKNEIRNNLMYDGAYNLGGA--  493
            G + DS +A++KLHKIL+MFH+KVHPE+++ A+K  +  K E++        +N+G    
Sbjct  280  GTSSDSGSAETKLHKILHMFHKKVHPENSSAAKKSYEQQKIEVKKKATRGHGHNVGNQVL  339

Query  492  --ENVALMPKQRMSKESIRRLKSQSNMHQFTISDPDCNGNRECWIKSDADYLVLEL  331
              E++ ++P++ + KE IRRL+SQSN  +  ++  + NGNRECWIK+DADYLVLEL
Sbjct  340  PEEDIVIVPEKILLKEKIRRLRSQSNRARILVTGDESNGNRECWIKTDADYLVLEL  395



>ref|XP_010556118.1| PREDICTED: uncharacterized protein LOC104825488 [Tarenaya hassleriana]
Length=385

 Score =   134 bits (336),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 85/175 (49%), Positives = 116/175 (66%), Gaps = 10/175 (6%)
 Frame = -2

Query  837  ELFQKTKLADENSGGAKYDRGEKRMDKEHDKSAVHLVKKILKKGMPHASSKSSTAASGCT  658
            ELFQKTK+ DE  GG + +R EKR +K+ DKSAV+++K++LKK +PH S +SSTAA G  
Sbjct  215  ELFQKTKITDE-YGGGRCERDEKRTEKDADKSAVNMMKRMLKKRVPHLS-RSSTAAYGRP  272

Query  657  IDSAAADSKLHKILNMFHRKVHPESTTTAEK-LDKPSKNEIRNNLMYDGAYN-----LGG  496
             +S+ A++KL+KIL++FHRKVHPES+T+++  +  P + +   ++  DGA N        
Sbjct  273  ANSSPAETKLNKILHIFHRKVHPESSTSSKTHMKLPKEKKKHRSISSDGASNYQCRTFPK  332

Query  495  AENVALMPKQRMSKESIRRLKSQSNMHQFTISDPDCNGNRECWIKSDADYLVLEL  331
             E +AL       K +    KSQ N  QF +   D NGNRE WIKSDADYLVLEL
Sbjct  333  GETMALSQGVIPHKGTRNCYKSQFNP-QFALKS-DSNGNREFWIKSDADYLVLEL  385



>ref|XP_008222202.1| PREDICTED: uncharacterized protein LOC103322099 isoform X2 [Prunus 
mume]
Length=386

 Score =   132 bits (332),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 95/175 (54%), Positives = 123/175 (70%), Gaps = 10/175 (6%)
 Frame = -2

Query  840  GELFQKTKLADENSGGAKYDRGEKRMDKEHDKSAVHLVKKILKKGMPHASSKSSTAASGC  661
            GELFQ+TKLA+E SG  K  + EKR +KE +KSA+HL+KK LKK M +ASS+SS    G 
Sbjct  217  GELFQRTKLAEEISG-PKSAKEEKRAEKEAEKSAMHLMKKKLKKKMLYASSRSS----GG  271

Query  660  TIDSAAADSKLHKILNMFHRKVHPESTTTAEKLDKPSKNEIRNNLMYDGAYNLGGA----  493
              D ++A++KL+KIL+MFHRKVHPE+++  +K  K  KNE +     DGAYN G      
Sbjct  272  PADPSSAETKLNKILHMFHRKVHPETSSAEQKTGKYHKNENKKKTSNDGAYNSGDQVLPD  331

Query  492  ENVALMPKQRMS-KESIRRLKSQSNMHQFTISDPDCNGNRECWIKSDADYLVLEL  331
            E++ L P++  S K+S+RR KSQSN  QF +S  D N NRE WIK+DADYLVLEL
Sbjct  332  EDIMLYPERGFSLKQSMRRYKSQSNPPQFALSSIDSNENREHWIKTDADYLVLEL  386



>ref|XP_008222201.1| PREDICTED: uncharacterized protein LOC103322099 isoform X1 [Prunus 
mume]
Length=394

 Score =   132 bits (331),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 95/175 (54%), Positives = 123/175 (70%), Gaps = 10/175 (6%)
 Frame = -2

Query  840  GELFQKTKLADENSGGAKYDRGEKRMDKEHDKSAVHLVKKILKKGMPHASSKSSTAASGC  661
            GELFQ+TKLA+E SG  K  + EKR +KE +KSA+HL+KK LKK M +ASS+SS    G 
Sbjct  225  GELFQRTKLAEEISG-PKSAKEEKRAEKEAEKSAMHLMKKKLKKKMLYASSRSS----GG  279

Query  660  TIDSAAADSKLHKILNMFHRKVHPESTTTAEKLDKPSKNEIRNNLMYDGAYNLGGA----  493
              D ++A++KL+KIL+MFHRKVHPE+++  +K  K  KNE +     DGAYN G      
Sbjct  280  PADPSSAETKLNKILHMFHRKVHPETSSAEQKTGKYHKNENKKKTSNDGAYNSGDQVLPD  339

Query  492  ENVALMPKQRMS-KESIRRLKSQSNMHQFTISDPDCNGNRECWIKSDADYLVLEL  331
            E++ L P++  S K+S+RR KSQSN  QF +S  D N NRE WIK+DADYLVLEL
Sbjct  340  EDIMLYPERGFSLKQSMRRYKSQSNPPQFALSSIDSNENREHWIKTDADYLVLEL  394



>ref|XP_008340399.1| PREDICTED: uncharacterized protein LOC103403371 [Malus domestica]
Length=436

 Score =   127 bits (318),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 87/172 (51%), Positives = 112/172 (65%), Gaps = 11/172 (6%)
 Frame = -2

Query  840  GELFQKTKLADENSGGAKYDRGEKRMDKEHDKSAVHLVKKILKKGMPHASSKSSTAASGC  661
            GELFQ+TKLA+E SG A+  + EKR DK    SA+HL+KK+LKK M HASS+     SG 
Sbjct  274  GELFQRTKLAEEISG-AELIKEEKRADK----SAMHLIKKMLKKKMLHASSR----GSGR  324

Query  660  TIDSAAADSKLHKILNMFHRKVHPESTTTAEKLDKPSKNEIRNNLMYDGAYNLGGA-ENV  484
              D A+A++KL+KIL+MF RKVHPE++    K  K   N+ +     +G YN GG  E++
Sbjct  325  AADHASAETKLNKILHMFRRKVHPETSAAERKPGKYKGNQSKKKPSSEGTYNNGGQDEDI  384

Query  483  ALMPKQRMSK-ESIRRLKSQSNMHQFTISDPDCNGNRECWIKSDADYLVLEL  331
             L P+Q  S  +S+   KSQSN  QF +S  D   NRE WIK+ ADYLVLEL
Sbjct  385  LLYPQQGFSSMQSMWHYKSQSNPLQFVLSGMDSXENREHWIKTGADYLVLEL  436



>ref|XP_009372251.1| PREDICTED: uncharacterized protein LOC103961434 isoform X1 [Pyrus 
x bretschneideri]
Length=418

 Score =   125 bits (315),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 83/172 (48%), Positives = 110/172 (64%), Gaps = 11/172 (6%)
 Frame = -2

Query  840  GELFQKTKLADENSGGAKYDRGEKRMDKEHDKSAVHLVKKILKKGMPHASSKSSTAASGC  661
            GELFQ+TKLA+E SG         + +K+ DKSA+HL+KK+LKK M HASS+     SG 
Sbjct  256  GELFQRTKLAEEISGAELI-----KEEKQADKSAMHLIKKMLKKKMLHASSR----GSGI  306

Query  660  TIDSAAADSKLHKILNMFHRKVHPESTTTAEKLDKPSKNEIRNNLMYDGAYNLGGA-ENV  484
              D A+A++KL+KIL+MF RKVHPE++    K  K   N+ R     +G YN G   E++
Sbjct  307  AADHASAETKLNKILHMFRRKVHPETSAAERKPGKYKGNQSRKKPSSEGTYNNGDQDEDI  366

Query  483  ALMPKQRM-SKESIRRLKSQSNMHQFTISDPDCNGNRECWIKSDADYLVLEL  331
             L P+Q   S +S+R  KSQSN  QF +S  + N NR  WIK+ ADYL+LEL
Sbjct  367  LLYPQQGFSSNQSMRLYKSQSNPPQFVLSGMNSNENRGHWIKTGADYLILEL  418



>gb|KCW61917.1| hypothetical protein EUGRSUZ_H04615, partial [Eucalyptus grandis]
Length=380

 Score =   122 bits (307),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 73/170 (43%), Positives = 109/170 (64%), Gaps = 15/170 (9%)
 Frame = -2

Query  840  GELFQKTKLADENSGGAKYDRGEKRMDKEHDKSAVHLVKKILKKGMPHA--SSKSSTAAS  667
            GELFQKTK+ +E  G  K         K+ D S VH VKK LKK    A  +++SS+  +
Sbjct  220  GELFQKTKMTEEEFGYGK---------KDWDSSMVHFVKKKLKKKALQANPAARSSSFDA  270

Query  666  GCTIDSAAADSKLHKILNMFHRKVHPESTTTAEKLDKPSKNEIRNNLMYDGAYNLGGA--  493
            G + DS +A++KLHKIL+MFH+KVHPE+++ A+K  +  K E++        +N+G    
Sbjct  271  GTSSDSGSAETKLHKILHMFHKKVHPENSSAAKKSYEQQKIEVKKKATRGHGHNVGNQVL  330

Query  492  --ENVALMPKQRMSKESIRRLKSQSNMHQFTISDPDCNGNRECWIKSDAD  349
              E++ ++P++ + KE IRRL+SQSN  +  ++  + NGNRECWIK+DAD
Sbjct  331  PEEDIVIVPEKILLKEKIRRLRSQSNRARILVTGDESNGNRECWIKTDAD  380



>ref|XP_007223089.1| hypothetical protein PRUPE_ppa007017mg [Prunus persica]
 gb|EMJ24288.1| hypothetical protein PRUPE_ppa007017mg [Prunus persica]
Length=386

 Score =   119 bits (298),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 89/169 (53%), Positives = 117/169 (69%), Gaps = 10/169 (6%)
 Frame = -2

Query  840  GELFQKTKLADENSGGAKYDRGEKRMDKEHDKSAVHLVKKILKKGMPHASSKSSTAASGC  661
            GELFQ+TKLA+E SG  K  + EKR +KE +KSA+HL+KK LKK M +ASS+SS    G 
Sbjct  217  GELFQRTKLAEEISG-PKSAKEEKRAEKEAEKSAMHLMKKKLKKKMLYASSRSS----GG  271

Query  660  TIDSAAADSKLHKILNMFHRKVHPESTTTAEKLDKPSKNEIRNNLMYDGAYNLGGA----  493
              D ++A++KL+KIL+MFHRKVHPE+++  +K  K  KNE +     DGAYN G      
Sbjct  272  PADPSSAETKLNKILHMFHRKVHPETSSAEQKTGKYHKNENKKKTSNDGAYNSGDQVLPD  331

Query  492  ENVALMPKQRMS-KESIRRLKSQSNMHQFTISDPDCNGNRECWIKSDAD  349
            E++ L P++  S K+S+RR KSQSN  QF +S  D N NRE WIK+DAD
Sbjct  332  EDIMLYPERGFSLKQSMRRYKSQSNPPQFALSSIDSNENREHWIKTDAD  380



>ref|XP_010249078.1| PREDICTED: uncharacterized protein LOC104591766 isoform X1 [Nelumbo 
nucifera]
Length=396

 Score =   119 bits (298),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 74/185 (40%), Positives = 108/185 (58%), Gaps = 16/185 (9%)
 Frame = -2

Query  837  ELFQKTKLADENSGGAKYDRGEKRMDKEH------DKSAVHLVKKILKKGMPHASSKSST  676
            ELF ++K    ++  AK +R  KR +KE         S+ HL+ KILK+   +  S++  
Sbjct  212  ELFHRSKTTGNSASDAKCERKAKRAEKEAIAEKCGSTSSHHLMTKILKRRTSNTCSRNPA  271

Query  675  AASGCTIDSAAADSKLHKILNMFHRKVHPESTTTAEKLDKPSKNEIRNNLMYD--GAYNL  502
             A     D  +A+ K HKIL MFHR+VHPES+TT++K  K  KNE+++++  D  G+Y+ 
Sbjct  272  TAVAAASDPVSAEKKTHKILQMFHRRVHPESSTTSKKPGKLYKNEMKSDIPDDKGGSYDY  331

Query  501  GGA------ENVALMPKQRMSKES-IRRLKSQSN-MHQFTISDPDCNGNRECWIKSDADY  346
                     E++ + P+  +SKE  +R  +S SN   Q  +   D NGNRE WIK+DADY
Sbjct  332  NNGDQMPLEEDIMIFPQSAISKEGFLRHCESPSNPPPQLPLGGRDSNGNREYWIKTDADY  391

Query  345  LVLEL  331
            LVLEL
Sbjct  392  LVLEL  396



>ref|XP_010249079.1| PREDICTED: uncharacterized protein LOC104591766 isoform X2 [Nelumbo 
nucifera]
Length=388

 Score =   119 bits (297),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 74/185 (40%), Positives = 108/185 (58%), Gaps = 16/185 (9%)
 Frame = -2

Query  837  ELFQKTKLADENSGGAKYDRGEKRMDKEH------DKSAVHLVKKILKKGMPHASSKSST  676
            ELF ++K    ++  AK +R  KR +KE         S+ HL+ KILK+   +  S++  
Sbjct  204  ELFHRSKTTGNSASDAKCERKAKRAEKEAIAEKCGSTSSHHLMTKILKRRTSNTCSRNPA  263

Query  675  AASGCTIDSAAADSKLHKILNMFHRKVHPESTTTAEKLDKPSKNEIRNNLMYD--GAYNL  502
             A     D  +A+ K HKIL MFHR+VHPES+TT++K  K  KNE+++++  D  G+Y+ 
Sbjct  264  TAVAAASDPVSAEKKTHKILQMFHRRVHPESSTTSKKPGKLYKNEMKSDIPDDKGGSYDY  323

Query  501  GGA------ENVALMPKQRMSKES-IRRLKSQSN-MHQFTISDPDCNGNRECWIKSDADY  346
                     E++ + P+  +SKE  +R  +S SN   Q  +   D NGNRE WIK+DADY
Sbjct  324  NNGDQMPLEEDIMIFPQSAISKEGFLRHCESPSNPPPQLPLGGRDSNGNREYWIKTDADY  383

Query  345  LVLEL  331
            LVLEL
Sbjct  384  LVLEL  388



>ref|XP_003551814.1| PREDICTED: uncharacterized protein LOC100795458 isoform X1 [Glycine 
max]
Length=357

 Score =   117 bits (294),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 77/170 (45%), Positives = 109/170 (64%), Gaps = 29/170 (17%)
 Frame = -2

Query  840  GELFQKTKLADENSGGAKYDRGEKRMDKEHDKSAVHLVKKILKKGMPHASSKSSTAASGC  661
            GELFQ++K A+EN   AK ++ +KR +KE DKSA++L+K+ LKK M HA SK+ST+ +G 
Sbjct  217  GELFQRSKSAEENFS-AKCEKEDKRAEKEVDKSAMNLMKEKLKKRMLHAYSKNSTSINGG  275

Query  660  TIDSAAADSKLHKILNMFHRKVHPESTTTAEKLDKPSKNEIRNNLMYDGAYNLGGAENVA  481
             IDSA+A++KL+KIL+MF +KVHPES+T A+K  K  KN+ +   + DG YN    ++  
Sbjct  276  PIDSASAETKLNKILHMFRKKVHPESSTAAQKSAKHHKNQKKKKTINDGGYN----KSDL  331

Query  480  LMPKQRMSKESIRRLKSQSNMHQFTISDPDCNGNRECWIKSDADYLVLEL  331
            + P++                        D + NRE WIK+DADYLVLEL
Sbjct  332  VHPEE------------------------DSSVNREYWIKTDADYLVLEL  357



>ref|XP_006603013.1| PREDICTED: uncharacterized protein LOC100795458 isoform X2 [Glycine 
max]
Length=365

 Score =   117 bits (293),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 77/170 (45%), Positives = 109/170 (64%), Gaps = 29/170 (17%)
 Frame = -2

Query  840  GELFQKTKLADENSGGAKYDRGEKRMDKEHDKSAVHLVKKILKKGMPHASSKSSTAASGC  661
            GELFQ++K A+EN   AK ++ +KR +KE DKSA++L+K+ LKK M HA SK+ST+ +G 
Sbjct  225  GELFQRSKSAEENFS-AKCEKEDKRAEKEVDKSAMNLMKEKLKKRMLHAYSKNSTSINGG  283

Query  660  TIDSAAADSKLHKILNMFHRKVHPESTTTAEKLDKPSKNEIRNNLMYDGAYNLGGAENVA  481
             IDSA+A++KL+KIL+MF +KVHPES+T A+K  K  KN+ +   + DG YN    ++  
Sbjct  284  PIDSASAETKLNKILHMFRKKVHPESSTAAQKSAKHHKNQKKKKTINDGGYN----KSDL  339

Query  480  LMPKQRMSKESIRRLKSQSNMHQFTISDPDCNGNRECWIKSDADYLVLEL  331
            + P++                        D + NRE WIK+DADYLVLEL
Sbjct  340  VHPEE------------------------DSSVNREYWIKTDADYLVLEL  365



>ref|XP_006575827.1| PREDICTED: uncharacterized protein LOC102660341 [Glycine max]
Length=358

 Score =   116 bits (290),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 75/170 (44%), Positives = 110/170 (65%), Gaps = 29/170 (17%)
 Frame = -2

Query  840  GELFQKTKLADENSGGAKYDRGEKRMDKEHDKSAVHLVKKILKKGMPHASSKSSTAASGC  661
            GELFQ++K ++EN G AK ++ +KR +KE DKS+++L+K+ LKK M HA SK+ST+ +G 
Sbjct  218  GELFQRSKSSEENFG-AKCEKEDKRAEKEVDKSSMNLMKEKLKKRMLHAYSKNSTSINGG  276

Query  660  TIDSAAADSKLHKILNMFHRKVHPESTTTAEKLDKPSKNEIRNNLMYDGAYNLGGAENVA  481
             IDSA+A++KL+KIL+MF +KVHPES+T A+K  K  KN+ +   + +G YN    ++  
Sbjct  277  PIDSASAETKLNKILHMFRKKVHPESSTAAQKSGKHHKNQKKKKTINNGGYN----KSDL  332

Query  480  LMPKQRMSKESIRRLKSQSNMHQFTISDPDCNGNRECWIKSDADYLVLEL  331
            + P++                        D + NRE WIK+DADYLVLEL
Sbjct  333  VHPEE------------------------DSSVNREYWIKTDADYLVLEL  358



>ref|XP_010543088.1| PREDICTED: uncharacterized protein LOC104816114 [Tarenaya hassleriana]
 ref|XP_010523253.1| PREDICTED: uncharacterized protein LOC104801635 [Tarenaya hassleriana]
 ref|XP_010523256.1| PREDICTED: uncharacterized protein LOC104801639 [Tarenaya hassleriana]
 ref|XP_010527358.1| PREDICTED: uncharacterized protein LOC104804714 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010527359.1| PREDICTED: uncharacterized protein LOC104804714 isoform X2 [Tarenaya 
hassleriana]
Length=393

 Score =   116 bits (290),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 85/176 (48%), Positives = 116/176 (66%), Gaps = 11/176 (6%)
 Frame = -2

Query  837  ELFQKTKLADENSGGAKYDRGEKRMDKEHDKSAVHLVKKILKKGMPHASSKSSTAASGCT  658
            ELFQKTK+ DE SGG + +R EKR +K+  KSAV+++KK+LKK +P  S +SSTAA    
Sbjct  222  ELFQKTKITDEYSGG-RCERDEKRTEKDAHKSAVNMMKKMLKKKVPQVS-RSSTAAYARE  279

Query  657  IDSAAADSKLHKILNMFHRKVHPESTTTAE-KLDKPSKNEIRNNLMYDGAYNLGG-----  496
             +S++A++KL+KIL++FHRKVHPES+T ++  +  P   +   ++  DGA N  G     
Sbjct  280  ANSSSAETKLNKILHIFHRKVHPESSTASKMPMKLPKDKKKHRSISSDGASNDEGWTFPK  339

Query  495  AENVALMPKQRMSKESIRR-LKSQSNMHQFTISDPDCNGNRECWIKSDADYLVLEL  331
            ++ +AL        +  R   KSQ N  QFT+   D NGNRE WIKSDADYLVLEL
Sbjct  340  SDTMALAQGAIPDDKGTRNCYKSQFNT-QFTLKS-DSNGNREFWIKSDADYLVLEL  393



>ref|XP_009372252.1| PREDICTED: uncharacterized protein LOC103961434 isoform X2 [Pyrus 
x bretschneideri]
Length=415

 Score =   115 bits (289),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 81/172 (47%), Positives = 108/172 (63%), Gaps = 14/172 (8%)
 Frame = -2

Query  840  GELFQKTKLADENSGGAKYDRGEKRMDKEHDKSAVHLVKKILKKGMPHASSKSSTAASGC  661
            GELFQ+TKLA+E SG         + +K+ DKSA+HL+KK+LKK M HASS+     SG 
Sbjct  256  GELFQRTKLAEEISGAELI-----KEEKQADKSAMHLIKKMLKKKMLHASSR----GSGI  306

Query  660  TIDSAAADSKLHKILNMFHRKVHPESTTTAEKLDKPSKNEIRNNLMYDGAYNLGGA-ENV  484
              D A+A++KL+KIL+MF RKVHPE++    K  K   N+ R     +G YN G   E++
Sbjct  307  AADHASAETKLNKILHMFRRKVHPETSAAERKPGKYKGNQSRKKPSSEGTYNNGDQDEDI  366

Query  483  ALMPKQRM-SKESIRRLKSQSNMHQFTISDPDCNGNRECWIKSDADYLVLEL  331
             L P+Q   S +S+R  KSQSN  QF +S  + N NR  WIK+D   L+LEL
Sbjct  367  LLYPQQGFSSNQSMRLYKSQSNPPQFVLSGMNSNENRGHWIKTD---LILEL  415



>gb|KHN13847.1| hypothetical protein glysoja_016131 [Glycine soja]
Length=365

 Score =   115 bits (288),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 76/170 (45%), Positives = 109/170 (64%), Gaps = 29/170 (17%)
 Frame = -2

Query  840  GELFQKTKLADENSGGAKYDRGEKRMDKEHDKSAVHLVKKILKKGMPHASSKSSTAASGC  661
            GELFQ++K A+EN   AK ++ +KR +KE DKSA++L+K+ LKK M HA SK+ST+ +G 
Sbjct  225  GELFQRSKSAEENFS-AKCEKEDKRAEKEVDKSAMNLMKEKLKKRMLHAYSKNSTSINGG  283

Query  660  TIDSAAADSKLHKILNMFHRKVHPESTTTAEKLDKPSKNEIRNNLMYDGAYNLGGAENVA  481
             IDSA+A++KL+KIL+MF +KVHPES+T A+K  K  KN+ +   + +G YN    ++  
Sbjct  284  PIDSASAETKLNKILHMFRKKVHPESSTAAQKSAKHHKNQKKKKTINEGGYN----KSDL  339

Query  480  LMPKQRMSKESIRRLKSQSNMHQFTISDPDCNGNRECWIKSDADYLVLEL  331
            + P++                        D + NRE WIK+DADYLVLEL
Sbjct  340  VHPEE------------------------DSSVNREYWIKTDADYLVLEL  365



>ref|XP_007139293.1| hypothetical protein PHAVU_008G017100g [Phaseolus vulgaris]
 gb|ESW11287.1| hypothetical protein PHAVU_008G017100g [Phaseolus vulgaris]
Length=361

 Score =   114 bits (285),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 75/170 (44%), Positives = 104/170 (61%), Gaps = 30/170 (18%)
 Frame = -2

Query  840  GELFQKTKLADENSGGAKYDRGEKRMDKEHDKSAVHLVKKILKKGMPHASSKSSTAASGC  661
            GELFQ++K A+EN   AK ++ +KR +KE DKSA++L+K+ LKK M HA SK+S++ +G 
Sbjct  222  GELFQRSKSAEENFS-AKCEKEDKRTEKELDKSAMNLMKEKLKKRMLHAYSKNSSSINGG  280

Query  660  TIDSAAADSKLHKILNMFHRKVHPESTTTAEKLDKPSKNEIRNNLMYDGAYNLGGAENVA  481
             IDSA+A++KL+KIL+MF +KVHPES+T A+K  K  KN  +  ++ DG Y         
Sbjct  281  PIDSASAETKLNKILHMFRKKVHPESSTAAQKSAKHHKNMKKKKILNDGGY---------  331

Query  480  LMPKQRMSKESIRRLKSQSNMHQFTISDPDCNGNRECWIKSDADYLVLEL  331
                               N H     + D +  RE WIK+DADYLVLEL
Sbjct  332  -------------------NKHDLVHPEEDSSA-REYWIKTDADYLVLEL  361



>ref|XP_010682717.1| PREDICTED: uncharacterized protein LOC104897530 [Beta vulgaris 
subsp. vulgaris]
Length=376

 Score =   114 bits (286),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 81/178 (46%), Positives = 103/178 (58%), Gaps = 14/178 (8%)
 Frame = -2

Query  840  GELFQKTKLADENSGGAKYDRGEKRMDKEHDKSA-VHLVKKIL--KKGMPHASSKSSTAA  670
            GELF+K K   E S   K  RGEKR DK+ DK+A ++L+KKIL  KK   HA+S++ST  
Sbjct  205  GELFEKHKA--EESSEVKCKRGEKREDKDGDKTASMNLMKKILTKKKNALHAASRNSTRG  262

Query  669  SGCTIDSAAADSKLHKILNMFHRKVHPESTTTAEKLDKPSKNEIRNNLMYDGAY-----N  505
               T +SA+A+ KL KIL  FH+KVHPE   + EK +K     I+N + +D  Y      
Sbjct  263  ---TAESASAEPKLCKILQKFHKKVHPECLISTEKSNKMHNAGIKNMVPWDAGYYKDEHA  319

Query  504  LGGAENVALMPKQRMSKESIRRLKSQSNMHQFTISDPDCNGNRECWIKSDADYLVLEL  331
                       K   S   + R KS SN  QF+    D NG+RECWIK+DADYLVLEL
Sbjct  320  FRDESTTTFSQKPGQSGYMLCR-KSISNPTQFSEDGSDSNGSRECWIKTDADYLVLEL  376



>ref|XP_007142600.1| hypothetical protein PHAVU_007G001200g [Phaseolus vulgaris]
 gb|ESW14594.1| hypothetical protein PHAVU_007G001200g [Phaseolus vulgaris]
Length=370

 Score =   113 bits (282),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 83/172 (48%), Positives = 118/172 (69%), Gaps = 13/172 (8%)
 Frame = -2

Query  840  GELFQKTKLADENSGGAKYDRGEKRMDKEHDKSAVHLVKKILKKGMPHASSKSSTAASGC  661
            GELFQ++KLA+E+ GG K D   KR ++E +KSA++L+KK LKK M H SS+SS++A+  
Sbjct  210  GELFQRSKLAEESIGGNKDDN--KRSEREAEKSAMNLMKKKLKKRMLHTSSRSSSSATAS  267

Query  660  T--IDSAAADSKLHKILNMFHRKVHPESTTTAEKLDKPSKNEIRNNLMYDGAYNLGGAEN  487
               +DSA+A+ KLHKIL+MFHRKVHPE+ T A+K DK  KNE +  +       + G E+
Sbjct  268  AQSVDSASAERKLHKILHMFHRKVHPENWTGAQKCDKYQKNENKKTM----NEVVHGEED  323

Query  486  VALMPKQRMSKESIRRLKSQSNMHQFTISDPDCNGNRECWIKSDADYLVLEL  331
            + + PK+ +SKE+I R       ++  +   D + N+E WIK+DADYLVLEL
Sbjct  324  IMIHPKRAVSKENIMR-----QYYKIALGCEDSSDNKEHWIKTDADYLVLEL  370



>ref|XP_010090655.1| hypothetical protein L484_017461 [Morus notabilis]
 gb|EXB40319.1| hypothetical protein L484_017461 [Morus notabilis]
Length=445

 Score =   113 bits (283),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 84/183 (46%), Positives = 111/183 (61%), Gaps = 19/183 (10%)
 Frame = -2

Query  840  GELFQKTKLADE-NSGGAKYDRG----EKRM--DKEHDKSAVHLVKKILKKGMPHASSKS  682
            GELFQ++K+ +E N GG K D+     EK M  +KE DKSA++++KK LKK M HASS++
Sbjct  260  GELFQRSKVVEESNGGGGKNDKDMIHQEKMMRSEKEGDKSAMNMMKKKLKKKMLHASSRT  319

Query  681  STAASGCTIDSAAA----DSKLHKILNMFHRKVHPESTTTAEKLDKPSKNEIRNNLM--Y  520
                +             ++KLHKIL+MFHRKVHPE++ T  K  K  KNE +      Y
Sbjct  320  GGTTTTAGGGGPGDPAPTETKLHKILHMFHRKVHPETSATVLKSSKRQKNEQKKKTTHEY  379

Query  519  DGAYNLGGA-----ENVALMPKQRMS-KESIRRLKSQSNMHQFTISDPDCNGNRECWIKS  358
             GA N GG      E++ L P++ +  K+ IRR +SQSN  QFT    D NGNRE WIK+
Sbjct  380  GGAGNNGGQVHPDHEDIILCPQRALFLKQKIRRYRSQSNPPQFTFGSIDSNGNREQWIKT  439

Query  357  DAD  349
            DAD
Sbjct  440  DAD  442



>ref|XP_006589802.1| PREDICTED: uncharacterized protein LOC102661485 [Glycine max]
Length=355

 Score =   111 bits (277),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 83/175 (47%), Positives = 109/175 (62%), Gaps = 31/175 (18%)
 Frame = -2

Query  840  GELFQKTKLADENSGGAKYDRGEKRMDKEHDKSAVHLVKKILKKGMPHASSKSSTAASGC  661
            GELFQ+TKLA+EN+             KE DKSA+HL+KK LK        +SST+    
Sbjct  207  GELFQRTKLAEENNNFGP---------KEADKSAMHLMKKKLK-----KKMRSSTST---  249

Query  660  TIDSAAADSKLHKILNMFHRKVHPE-STTTAEKLDKPSKNEIRNNLMYDGAYNLGGAENV  484
            T+DSA+AD KLHKIL+MFHRKVHPE ST+ A+K DK  K +  N          G  E++
Sbjct  250  TVDSASADRKLHKILHMFHRKVHPENSTSGAQKCDKYQKKKTMNE---------GSEEDI  300

Query  483  ALMPKQR--MSKES-IRRLKSQSNMHQFTIS-DPDCNGNRECWIKSDADYLVLEL  331
             ++  +R  +SKE+  R+ K Q N  QFT+  + D + N+E WIK+DADYLVLEL
Sbjct  301  LMIQPKRAELSKENYTRQYKIQPNPFQFTLGCEEDSSENKEHWIKTDADYLVLEL  355



>ref|XP_008459858.1| PREDICTED: uncharacterized protein LOC103498856 [Cucumis melo]
Length=385

 Score =   110 bits (274),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 84/175 (48%), Positives = 120/175 (69%), Gaps = 7/175 (4%)
 Frame = -2

Query  840  GELFQKTKLADENSGGAKYDRGEKRMDKEHDKSAVHLVKKILKKGMPHASSKSSTAASGC  661
            GELFQ++K+A+EN+G AK+D+ +KR +++ +KSA+HL+KK LKK M  ASS+SS  A   
Sbjct  213  GELFQRSKIAEENAG-AKFDKEDKRAEEDIEKSAMHLMKKKLKKRMLSASSRSSATAVEG  271

Query  660  TIDSAAADSKLHKILNMFHRKVHPESTTTAEKLDKPSKNEIRN--NLMYDGAYNLG---G  496
              DSA+A++KLHKI +MFHRKVHPES+   +K DK  K + +   N  +DG  N G    
Sbjct  272  LNDSASAETKLHKIFHMFHRKVHPESSAIIQKSDKHPKVQKKKKANHNHDGCCNNGEQTS  331

Query  495  AENVALMPKQRMSKESIRRLKSQSNMHQFTISDPDCNGNRECWIKSDADYLVLEL  331
             E++ + P++  SK S +R+K+Q   H + ++  D N N+E WI SD DYLVLEL
Sbjct  332  DEDIMIYPQRTQSKPSFQRVKNQFPPH-YGLNSSDPNDNKERWINSDEDYLVLEL  385



>ref|XP_003621746.1| hypothetical protein MTR_7g022360 [Medicago truncatula]
Length=384

 Score =   104 bits (260),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 73/176 (41%), Positives = 103/176 (59%), Gaps = 37/176 (21%)
 Frame = -2

Query  840  GELFQKTKLADENSGGAKYDRGEKRMDKEHDK------SAVHLVKKILKKGMPHASSKSS  679
            GELFQ++KLADE S G K+   EK  DK +++      SA+++VK+ LKK M H+ SK+S
Sbjct  240  GELFQRSKLADEISFGMKF---EKEFDKRNERDAEKYSSALNMVKEKLKKRMFHSCSKNS  296

Query  678  TAASGCTIDSAAADSKLHKILNMFHRKVHPESTTTAEKLDKPSKNEIRNNLMYDGAYNLG  499
            ++ +G  +DSA+A++KL+KIL+MF +KVHPE++T   K  K  KNE +   M DG  N G
Sbjct  297  SSTNGANVDSASAETKLNKILHMFRKKVHPENSTVGHKSGKHRKNENKKKNMNDGGPNKG  356

Query  498  GAENVALMPKQRMSKESIRRLKSQSNMHQFTISDPDCNGNRECWIKSDADYLVLEL  331
                  + P++                        D +  RE WIK+DADYLVLEL
Sbjct  357  ----YLVHPEE------------------------DPSSYREHWIKTDADYLVLEL  384



>gb|AES77964.2| WRKY transcription factor-like protein [Medicago truncatula]
Length=383

 Score =   104 bits (260),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 73/176 (41%), Positives = 103/176 (59%), Gaps = 37/176 (21%)
 Frame = -2

Query  840  GELFQKTKLADENSGGAKYDRGEKRMDKEHDK------SAVHLVKKILKKGMPHASSKSS  679
            GELFQ++KLADE S G K+   EK  DK +++      SA+++VK+ LKK M H+ SK+S
Sbjct  239  GELFQRSKLADEISFGMKF---EKEFDKRNERDAEKYSSALNMVKEKLKKRMFHSCSKNS  295

Query  678  TAASGCTIDSAAADSKLHKILNMFHRKVHPESTTTAEKLDKPSKNEIRNNLMYDGAYNLG  499
            ++ +G  +DSA+A++KL+KIL+MF +KVHPE++T   K  K  KNE +   M DG  N G
Sbjct  296  SSTNGANVDSASAETKLNKILHMFRKKVHPENSTVGHKSGKHRKNENKKKNMNDGGPNKG  355

Query  498  GAENVALMPKQRMSKESIRRLKSQSNMHQFTISDPDCNGNRECWIKSDADYLVLEL  331
                  + P++                        D +  RE WIK+DADYLVLEL
Sbjct  356  ----YLVHPEE------------------------DPSSYREHWIKTDADYLVLEL  383



>gb|KHN27188.1| hypothetical protein glysoja_025472, partial [Glycine soja]
Length=384

 Score =   103 bits (256),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 69/164 (42%), Positives = 104/164 (63%), Gaps = 29/164 (18%)
 Frame = -2

Query  840  GELFQKTKLADENSGGAKYDRGEKRMDKEHDKSAVHLVKKILKKGMPHASSKSSTAASGC  661
            GELFQ++K ++EN G AK ++ +KR +KE DKS+++L+K+ LKK M HA SK+ST+ +G 
Sbjct  226  GELFQRSKSSEENFG-AKCEKEDKRAEKEVDKSSMNLMKEKLKKRMLHAYSKNSTSINGG  284

Query  660  TIDSAAADSKLHKILNMFHRKVHPESTTTAEKLDKPSKNEIRNNLMYDGAYNLGGAENVA  481
             IDSA+A++KL+KIL+MF +KVHPES+T A+K  K  KN+ +   + +G YN    ++  
Sbjct  285  PIDSASAETKLNKILHMFRKKVHPESSTAAQKSGKHHKNQKKKKTINNGGYN----KSDL  340

Query  480  LMPKQRMSKESIRRLKSQSNMHQFTISDPDCNGNRECWIKSDAD  349
            + P++                        D + NRE WIK+DAD
Sbjct  341  VHPEE------------------------DSSVNREYWIKTDAD  360



>gb|KDP41789.1| hypothetical protein JCGZ_26807 [Jatropha curcas]
Length=364

 Score =   101 bits (251),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 66/170 (39%), Positives = 96/170 (56%), Gaps = 5/170 (3%)
 Frame = -2

Query  840  GELFQKTKLADENSGGAKYDRGEKRMDKEHDKSAVHLVKKILKKGMPHASSKSSTAASGC  661
            GE+F+KTK+ DE S  A+ +   K   +E  KSA HL+KKIL+K   HAS      +S  
Sbjct  200  GEMFRKTKITDEIS--AETEGKGKTHTREAHKSAKHLIKKILRKF--HASRNPVPPSSEG  255

Query  660  TIDSAAADSKLHKILNMFHRKVHPESTTTAEKLDKPSKNEIRNNLMYDGAYNLGGAENVA  481
              +S     KL+K+L M HRKVHPE+ T  ++     K +I+ +L +         +N  
Sbjct  256  ASNSVPTKKKLNKVLRMLHRKVHPENPTAEKEFTTSRKEKIKMDLHHKADLVHQDEDNRK  315

Query  480  LMPKQRMSKESIRRLKSQSNMHQFTISDPDCNGNRECWIKSDADYLVLEL  331
             +P  + S E I+  K+   + Q+ +   + +GNRE WIK+DADYLVLEL
Sbjct  316  FLPGFK-SVEGIKWYKNNLKLSQYALGGCNSSGNREHWIKTDADYLVLEL  364



>gb|KHN37253.1| hypothetical protein glysoja_013468 [Glycine soja]
Length=417

 Score =   101 bits (251),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 78/170 (46%), Positives = 104/170 (61%), Gaps = 31/170 (18%)
 Frame = -2

Query  840  GELFQKTKLADENSGGAKYDRGEKRMDKEHDKSAVHLVKKILKKGMPHASSKSSTAASGC  661
            GELFQ+TKLA+EN+             KE DKSA+HL+KK LK        +SST+    
Sbjct  207  GELFQRTKLAEENNNFGP---------KEADKSAMHLMKKKLK-----KKMRSSTST---  249

Query  660  TIDSAAADSKLHKILNMFHRKVHPE-STTTAEKLDKPSKNEIRNNLMYDGAYNLGGAENV  484
            T+DSA+AD KLHKIL+MFHRKVHPE ST+ A+K DK  K +  N          G  E++
Sbjct  250  TVDSASADRKLHKILHMFHRKVHPENSTSGAQKCDKYQKKKTMNE---------GSEEDI  300

Query  483  ALMPKQR--MSKES-IRRLKSQSNMHQFTIS-DPDCNGNRECWIKSDADY  346
             ++  +R  +SKE+  R+ K Q N  QFT+  + D + N+E WIK+DADY
Sbjct  301  LMIQPKRAELSKENYTRQYKIQPNPFQFTLGCEEDSSENKEHWIKTDADY  350



>ref|XP_010913028.1| PREDICTED: uncharacterized protein LOC105038820 [Elaeis guineensis]
Length=377

 Score =   100 bits (250),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 68/180 (38%), Positives = 94/180 (52%), Gaps = 25/180 (14%)
 Frame = -2

Query  840  GELFQKTKLADEN---------SGGAKYDRGEKRMDKEHDKSAVHLVKKILKKGMPHASS  688
            GELF ++++A+E          +GGA  D GE R       + +HL+KK+ ++G     S
Sbjct  213  GELFMRSRIAEEGGGKREEATVAGGAACD-GEGR-----STAGMHLMKKLKRRG-----S  261

Query  687  KSSTAASGCTIDSAAADSKLHKILNMFHRKVHPESTTTAEKLDKPSKNEIRNNLMYDGAY  508
            + S    G T    +A++K  KIL +FHRKVHPE+T  A+K   P K    + +   G  
Sbjct  262  RVSGGGPGET----SAETKFQKILQIFHRKVHPENTAAAKKPAWPGKKNGSDCMHRGGGN  317

Query  507  NLGGAENVALMP-KQRMSKESIRRLKSQSNMHQFTISDPDCNGNRECWIKSDADYLVLEL  331
            +  G    A+   K    KE I + K  SN     +   D NGNRE WIK+DADYLVLEL
Sbjct  318  DFNGTRGAAMTAAKGACRKEGIPKSKFCSNSSSLVLCGSDSNGNREHWIKTDADYLVLEL  377



>ref|XP_012067555.1| PREDICTED: uncharacterized protein LOC105630360 [Jatropha curcas]
Length=479

 Score =   100 bits (250),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 66/170 (39%), Positives = 96/170 (56%), Gaps = 5/170 (3%)
 Frame = -2

Query  840  GELFQKTKLADENSGGAKYDRGEKRMDKEHDKSAVHLVKKILKKGMPHASSKSSTAASGC  661
            GE+F+KTK+ DE S  A+ +   K   +E  KSA HL+KKIL+K   HAS      +S  
Sbjct  315  GEMFRKTKITDEIS--AETEGKGKTHTREAHKSAKHLIKKILRKF--HASRNPVPPSSEG  370

Query  660  TIDSAAADSKLHKILNMFHRKVHPESTTTAEKLDKPSKNEIRNNLMYDGAYNLGGAENVA  481
              +S     KL+K+L M HRKVHPE+ T  ++     K +I+ +L +         +N  
Sbjct  371  ASNSVPTKKKLNKVLRMLHRKVHPENPTAEKEFTTSRKEKIKMDLHHKADLVHQDEDNRK  430

Query  480  LMPKQRMSKESIRRLKSQSNMHQFTISDPDCNGNRECWIKSDADYLVLEL  331
             +P  + S E I+  K+   + Q+ +   + +GNRE WIK+DADYLVLEL
Sbjct  431  FLPGFK-SVEGIKWYKNNLKLSQYALGGCNSSGNREHWIKTDADYLVLEL  479



>ref|XP_006606602.1| PREDICTED: uncharacterized protein LOC102663986 [Glycine max]
Length=359

 Score = 95.5 bits (236),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 77/181 (43%), Positives = 106/181 (59%), Gaps = 39/181 (22%)
 Frame = -2

Query  840  GELFQKTKLADE--NSGGAKYDRGEKRMDKEHDKSAVHLVKKILKKGMPHASSKSSTAAS  667
            GELFQ+TKLAD+  N+ G   D+         DKSA+HL+KK LK        +SST+  
Sbjct  207  GELFQRTKLADQENNNFGPPKDQA--------DKSAMHLMKKKLK-----KKMRSSTST-  252

Query  666  GCTIDSA-AADSKLHKILNMFHRKVHPESTTTAEKLDKPSKNEIRNNLMYDGAYNLGGAE  490
              T+DSA AAD KLHKIL+MFHRKVHPE++T A+K DK  K +  N    +G  ++    
Sbjct  253  --TVDSASAADRKLHKILHMFHRKVHPENSTGAQKCDKYQKKKTMNEGEGEGEEDI----  306

Query  489  NVALMPKQRMSKESIRRLKSQSNMHQFTIS--------DPDCNGNRECWIKSDADYLVLE  334
             + + PK+ +       L +++ M Q+ I         + D + N+E WIK+DADYLVLE
Sbjct  307  -LMMQPKRAV-------LSTENYMRQYKIQPNPLLGSCEEDSSENKEHWIKTDADYLVLE  358

Query  333  L  331
            L
Sbjct  359  L  359



>ref|XP_011656805.1| PREDICTED: uncharacterized protein LOC105435773 [Cucumis sativus]
 gb|KGN46453.1| hypothetical protein Csa_6G094710 [Cucumis sativus]
Length=378

 Score = 95.1 bits (235),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 71/175 (41%), Positives = 110/175 (63%), Gaps = 14/175 (8%)
 Frame = -2

Query  840  GELFQKTKLADENSGGAKYDRGEKRMDKEHDKSAVHLVKKILKKGMPHASSKSSTAASGC  661
            GELFQ++K+A+EN+G AK+D+ +KR +++ +KSA+HL+KK           +  +A+S  
Sbjct  213  GELFQRSKIAEENAG-AKFDKEDKRAEEDIEKSAMHLMKK-------KLKKRMLSASSRS  264

Query  660  TIDSAAADSKLHKILNMFHRKVHPESTTTAEKLDKPSKNEIRN--NLMYDGAYNLG---G  496
            +  +  + +KLHKI +MFHRKVHPES+   +K DK  K + +   N  +DG  N G    
Sbjct  265  SATAVESGTKLHKIFHMFHRKVHPESSAIIQKSDKHPKVQKKKKANHNHDGCCNNGEQTS  324

Query  495  AENVALMPKQRMSKESIRRLKSQSNMHQFTISDPDCNGNRECWIKSDADYLVLEL  331
             E++ + P++  SK S + +K+Q   H + ++  D N N+E WI SD DYLVLEL
Sbjct  325  DEDIMIYPQRTRSKPSFQCVKNQFPPH-YGLNSSDPNDNKERWINSDEDYLVLEL  378



>gb|AES72068.2| WRKY transcription factor-like protein [Medicago truncatula]
Length=371

 Score = 93.6 bits (231),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 76/175 (43%), Positives = 106/175 (61%), Gaps = 21/175 (12%)
 Frame = -2

Query  840  GELFQKTKLADE-NSGGAKYDRGEKRMDKEHDKSAVHLVKKILKKGMPHASSKSSTAASG  664
             ELFQ++K AD+ N  GAK D  +++  +E +KSA+HL++K LKK   HASS++S     
Sbjct  213  AELFQRSKQADQDNLVGAKDDTDKEK--EEANKSAMHLMRKKLKKKRAHASSQTS-----  265

Query  663  CTIDSAAADSKLH-KILNMFHRKVHPESTTTAEKLDKPSKNEIRNNLMYDGAYNLGG---  496
              +DS +AD KLH KIL MFHRKVHPE+ T AEK +K         +M +G +N      
Sbjct  266  --VDSTSADRKLHNKILQMFHRKVHPENPTCAEKYEK-------KKIMNEGGHNKSNKVE  316

Query  495  AENVALMPKQRMSKESIRRLKSQSNMHQFTISDPDCNGNRECWIKSDADYLVLEL  331
             E++ + PK+ + KE+I + K +           D + N E WIK+DADYLVLEL
Sbjct  317  EESIMIQPKRAVGKENIGQCKKRQLQITLGSGSEDSSENMEQWIKTDADYLVLEL  371



>ref|XP_003601817.1| hypothetical protein MTR_3g085710 [Medicago truncatula]
Length=407

 Score = 93.6 bits (231),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 76/175 (43%), Positives = 106/175 (61%), Gaps = 21/175 (12%)
 Frame = -2

Query  840  GELFQKTKLADE-NSGGAKYDRGEKRMDKEHDKSAVHLVKKILKKGMPHASSKSSTAASG  664
             ELFQ++K AD+ N  GAK D  +++  +E +KSA+HL++K LKK   HASS++S     
Sbjct  249  AELFQRSKQADQDNLVGAKDDTDKEK--EEANKSAMHLMRKKLKKKRAHASSQTS-----  301

Query  663  CTIDSAAADSKLH-KILNMFHRKVHPESTTTAEKLDKPSKNEIRNNLMYDGAYNLGG---  496
              +DS +AD KLH KIL MFHRKVHPE+ T AEK +K         +M +G +N      
Sbjct  302  --VDSTSADRKLHNKILQMFHRKVHPENPTCAEKYEK-------KKIMNEGGHNKSNKVE  352

Query  495  AENVALMPKQRMSKESIRRLKSQSNMHQFTISDPDCNGNRECWIKSDADYLVLEL  331
             E++ + PK+ + KE+I + K +           D + N E WIK+DADYLVLEL
Sbjct  353  EESIMIQPKRAVGKENIGQCKKRQLQITLGSGSEDSSENMEQWIKTDADYLVLEL  407



>ref|XP_008808109.1| PREDICTED: uncharacterized protein LOC103720272 [Phoenix dactylifera]
Length=380

 Score = 91.7 bits (226),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 66/178 (37%), Positives = 92/178 (52%), Gaps = 18/178 (10%)
 Frame = -2

Query  840  GELFQKTKLADENSGG------AKYDRGEKRMDKEHDKSAVHLVKKILKKGMPHASSKSS  679
            GELF K+++A+E SG       A          +    + +HL+KK+ ++G     S+ S
Sbjct  213  GELFMKSRMAEEGSGKREEATVAGGAASAAGDGEGRSTAGMHLMKKLKRRG-----SRVS  267

Query  678  TAASGCTIDSAAADSKLHKILNMFHRKVHPESTTTAEKLDKPSKNEIRNNLMYDGAYN--  505
                G T    +A++K  KIL +FHRKVHPE+T  A+K    S N+  ++ M  G  N  
Sbjct  268  GGGPGET----SAETKFQKILQIFHRKVHPENTAAAKK-TAGSGNKNGSDCMRRGGGNDC  322

Query  504  LGGAENVALMPKQRMSKESIRRLKSQSNMHQFTISDPDCNGNRECWIKSDADYLVLEL  331
             G   ++    K    KE+I   K   N     +S  D NGNRE WIK+DADYLVLEL
Sbjct  323  NGSRGSLVTGSKSTCRKEAIPNFKFCPNASSLALSGSDSNGNREHWIKTDADYLVLEL  380



>ref|XP_004492060.1| PREDICTED: uncharacterized protein LOC101497033 [Cicer arietinum]
Length=382

 Score = 91.3 bits (225),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 71/173 (41%), Positives = 98/173 (57%), Gaps = 39/173 (23%)
 Frame = -2

Query  840  GELFQKTKLA-DENSGGAKYDRGEKRMDKEH-DK-SAVHLVKKILKKGMPHASSKSSTAA  670
            GELFQ++KL  D+N     YD   KR +++H DK SA++LVK+ LK+ M H+ SK+S++ 
Sbjct  246  GELFQRSKLVGDDNFVAKDYD---KRSERDHADKFSAMNLVKEKLKRRMFHSCSKNSSSI  302

Query  669  SGCTIDSAAADSKLHKILNMFHRKVHPESTTTAEKLDKPSKNEIRNNLMYDGAYNLGGAE  490
                  SA+AD+KL+KIL+MF +KVHPE++T  +K  +  KNE +  +M DG YN G   
Sbjct  303  D-----SASADTKLNKILHMFRKKVHPENSTIGQKSGRNRKNENKKKIMNDGGYNKGYIV  357

Query  489  NVALMPKQRMSKESIRRLKSQSNMHQFTISDPDCNGNRECWIKSDADYLVLEL  331
            N                             + D    RE WIK+DADYLVLEL
Sbjct  358  N----------------------------QEEDSASYREHWIKTDADYLVLEL  382



>ref|XP_008231191.1| PREDICTED: uncharacterized protein LOC103330395 [Prunus mume]
Length=381

 Score = 90.9 bits (224),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 68/178 (38%), Positives = 91/178 (51%), Gaps = 18/178 (10%)
 Frame = -2

Query  837  ELFQKTKLADENSGGAKYDRGEKRMDKEHD-KSAVHLVKKILKKGMPHASSKSSTAASGC  661
            ELF +TK+  EN    K       +  EH   SA+  +KKI+KK   HASSKSS   +G 
Sbjct  213  ELFDRTKMTTEN---CKQTSESVDIKSEHKHTSAMQFMKKIIKK--LHASSKSSAPCTGG  267

Query  660  TI-DSAAADSKLHKILNMFHRKVHPESTTTAEKLDKPSKNEIRNNLMYDGAYNLGGAENV  484
             + D  +   K  +IL MFHR++HPES+T A +     K + +NN    G    G  EN+
Sbjct  268  DVTDPVSTRKKFGEILRMFHRRIHPESSTAAREFVDAEKYKDKNNSSAHG----GCRENM  323

Query  483  ALM-------PKQRMSKESIRRLKSQSNMHQFTISDPDCNGNRECWIKSDADYLVLEL  331
             LM       P+  M K      K   N+ Q+ +S  +     E WIK+DADYLVLEL
Sbjct  324  MLMGRDNRRFPQGAMIKGGTEHCKKYMNLPQYRLSGSNFRRKGEHWIKTDADYLVLEL  381



>ref|XP_002512909.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF49412.1| conserved hypothetical protein [Ricinus communis]
Length=364

 Score = 89.7 bits (221),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 63/171 (37%), Positives = 99/171 (58%), Gaps = 14/171 (8%)
 Frame = -2

Query  840  GELFQKTKLADENSGGAKYDRGEKRMDKEHDKSAVHLVKKILKKGMPHASSKSSTAASGC  661
             E+F +TK+ +E S   + ++GE    + H K   HL+KKIL+K   +ASSK+   +S  
Sbjct  207  AEMFHRTKITEEISLEVE-EKGEMHAKQAH-KPVRHLIKKILQKF--YASSKNPILSSSH  262

Query  660  TIDSAAADSK-LHKILNMFHRKVHPESTTTAEKLDKPSKNEIRNNLMYDGAYNLGGAENV  484
              D++ +  K L+K+L MFHRKVHPE+   AEK+   S  +I+ NL ++        +++
Sbjct  263  DADTSVSTKKRLNKVLRMFHRKVHPENPI-AEKVFAESNAKIKKNLHHNVDMVYQDQDSI  321

Query  483  ALMPKQRMSKESIRRLKSQSNMHQFTISDPDCNGNRECWIKSDADYLVLEL  331
              +P  +    S+ R++   N     +S  + + NRE WIK+DADYLVLEL
Sbjct  322  RFLPGSK----SMERVRCYKN----NLSGSNSSRNREYWIKTDADYLVLEL  364



>gb|EYU37396.1| hypothetical protein MIMGU_mgv1a011034mg [Erythranthe guttata]
Length=294

 Score = 88.2 bits (217),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 69/173 (40%), Positives = 93/173 (54%), Gaps = 33/173 (19%)
 Frame = -2

Query  840  GELFQKTKLADENSGGAKYDRGEKRMDKEHDKSAVHLVKKILKKGMPHASSKSSTAASGC  661
            GELFQKTK A+E + G K +R         DKSAV LVKK+LKK + HA           
Sbjct  152  GELFQKTKQAEEMNSGVKSER---------DKSAVRLVKKMLKKKIVHA-----------  191

Query  660  TIDSAAADSKLHKILNMFHRKVHPESTTTAEK-LDKPSKNEIRNNLMYDGAYNLGGAENV  484
             IDS   ++KL KIL +F+RKVHPE+ T  E   +K  K  I ++ M      +  +E+V
Sbjct  192  -IDS---ETKLTKILQIFNRKVHPENYTAEESACNKKEKKNINDDEM------MKNSESV  241

Query  483  ALMP-KQRMSKESIRRLKSQSNMHQFTISDPDCNGN-RECWIKSDADYLVLEL  331
             L+      S  +IRR  S  ++  +    P  N N  E W+ +D+DYLVLEL
Sbjct  242  PLVGCNNNYSGGTIRRSSSAEDIIIYPDQHPIINKNANEFWVNTDSDYLVLEL  294



>ref|XP_010917537.1| PREDICTED: uncharacterized protein LOC105042134 isoform X2 [Elaeis 
guineensis]
Length=381

 Score = 88.2 bits (217),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 59/182 (32%), Positives = 88/182 (48%), Gaps = 25/182 (14%)
 Frame = -2

Query  840  GELFQKTKLADENSGG-----------AKYDRGEKRMDKEHDKSAVHLVKKILKKGMPHA  694
            GELF K+++A+E  G            A    GE R       + +HL+KK+        
Sbjct  213  GELFMKSRMAEEGGGKREEATAAGGGVAVLGEGEGR-----STAGMHLMKKL--------  259

Query  693  SSKSSTAASGCTIDSAAADSKLHKILNMFHRKVHPESTTTAEKLDKPSKNEIRNNLMYDG  514
              + S  + G  +++ AA++   KIL +FHRKVHPE++  A+K  +  K    + + + G
Sbjct  260  KRRGSRGSGGGPVEATAAETTFQKILQIFHRKVHPENSVAAKKTARSGKKNGSDCMPHGG  319

Query  513  AYNLGGAENVALMPKQRMS-KESIRRLKSQSNMHQFTISDPDCNGNRECWIKSDADYLVL  337
              +  G+    +   + +  KE     K   N     I   D NGNRE WIK+DADYLVL
Sbjct  320  GNDFNGSGGAVITASKSICRKEGTPNFKFCLNAPSLAIGGSDSNGNREHWIKTDADYLVL  379

Query  336  EL  331
            EL
Sbjct  380  EL  381



>ref|XP_006447030.1| hypothetical protein CICLE_v10018081mg [Citrus clementina]
 gb|ESR60270.1| hypothetical protein CICLE_v10018081mg [Citrus clementina]
Length=380

 Score = 87.8 bits (216),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 67/170 (39%), Positives = 97/170 (57%), Gaps = 8/170 (5%)
 Frame = -2

Query  837  ELFQKTKLADENSGGAKYDRGEKRMDKEHDKSAVHLVKKILKKGMPHASSKSSTAASGCT  658
            ELF + +  D++S   K  + E    ++H KS  +L+KK+ KK    ASSKS T +   T
Sbjct  218  ELFHRRETTDKSSM-EKSSKVEMPAKQKH-KSVKNLIKKMFKKF--RASSKSPTPSDSDT  273

Query  657  IDSAAADSKLHKILNMFHRKVHPESTTTAEKLDKPSKNEIRNNLMYDGAYNLGGAEN-VA  481
                +   KLHK++ MFHRK+HPE +  AEK  K   N+I+++  Y+G +  GG +N   
Sbjct  274  A-FVSTKKKLHKVIQMFHRKIHPEKSI-AEKELKSRTNKIKSS-PYEGVHTDGGLDNDNK  330

Query  480  LMPKQRMSKESIRRLKSQSNMHQFTISDPDCNGNRECWIKSDADYLVLEL  331
              P    SK+ I   K +  + Q+ +     +GNRE WIK+DADYLVLEL
Sbjct  331  SSPPGCESKDQIEYHKIEKMLSQYGLRGSTSSGNREHWIKTDADYLVLEL  380



>ref|XP_010044846.1| PREDICTED: uncharacterized protein LOC104433701 [Eucalyptus grandis]
Length=367

 Score = 87.0 bits (214),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 68/174 (39%), Positives = 97/174 (56%), Gaps = 36/174 (21%)
 Frame = -2

Query  840  GELFQKTKLADENSGGAKYDRGEKRMDKEHDKSAVHLVKKILKKGMPHASSKSSTAASGC  661
            GELFQ++KL +        D  E + ++E   +A++L+KK LKK M    S+SSTA  G 
Sbjct  226  GELFQRSKLTE--------DVHELKPEREERHTAMNLMKKKLKKKM-LLPSRSSTATVGM  276

Query  660  TIDSAAADSKLHKILNMFHRKVHPESTTTAEKLDKPSKNEIRNNLMYDGAYNLGGAENVA  481
             +DS +A++KL KIL MFHRKVHPES+                      A      +   
Sbjct  277  NVDSTSAETKLQKILQMFHRKVHPESS----------------------ASTKKTQKKQQ  314

Query  480  LMPKQRMSKESIRRLKSQSNMH----QFTISDPDCNGNRECWIKSDADYLVLEL  331
               K++ ++ES ++ + Q  +H    QF ++  + NGNRECWIK+DADYLVLEL
Sbjct  315  KESKKKTNQESKKKNRDQE-LHNKPPQFKLAGSESNGNRECWIKTDADYLVLEL  367



>ref|XP_008454016.1| PREDICTED: uncharacterized protein LOC103494565 [Cucumis melo]
Length=381

 Score = 85.9 bits (211),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 73/198 (37%), Positives = 115/198 (58%), Gaps = 31/198 (16%)
 Frame = -2

Query  840  GELFQKTKLADENSGGAKYDRGE-KRMDKEHDKSAVHLVKKILKKGMPHASSKS---STA  673
            GELFQ++K+ +E  GG    + E K+++KE DK  + L+KK LKK M  A+SKS   S  
Sbjct  187  GELFQRSKVVEEGGGGRCDQKDEQKKVEKEGDKYGMQLLKKKLKKKMFCAASKSTLSSNN  246

Query  672  ASGCTIDSAAADSKLHKILNMFHRKVHPESTTTAEKLDKPSKNEIRNNLMYDGAY-----  508
            ASG  +D + A +KLHKIL++F+RKV+P  +    K  K   ++ + N  YD        
Sbjct  247  ASGEVLDVSTA-TKLHKILHLFNRKVYPAESIAMGKDQKGDHHKAQKN--YDKKKKTTTS  303

Query  507  -NLGGA--------------ENVALMPKQRMSKESIRRLKSQSNMHQFT-ISDPDCN---  385
             ++G +              E++ + PKQ + K++++ ++++S   +F+ I D D +   
Sbjct  304  TDIGRSSVNKNNNEETTSTDEDIMIFPKQLILKQTLQSIQTRSGPPRFSDIIDDDVDFNY  363

Query  384  GNRECWIKSDADYLVLEL  331
             N+E WIKSD+DYLVLEL
Sbjct  364  WNKEQWIKSDSDYLVLEL  381



>gb|KHN27151.1| hypothetical protein glysoja_032919 [Glycine soja]
Length=352

 Score = 83.2 bits (204),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 71/175 (41%), Positives = 100/175 (57%), Gaps = 39/175 (22%)
 Frame = -2

Query  840  GELFQKTKLADE--NSGGAKYDRGEKRMDKEHDKSAVHLVKKILKKGMPHASSKSSTAAS  667
            GELFQ+TKLAD+  N+ G   D+         DKSA+HL+KK LK        +SST+  
Sbjct  197  GELFQRTKLADQENNNFGPPKDQA--------DKSAMHLMKKKLK-----KKMRSSTST-  242

Query  666  GCTIDSA-AADSKLHKILNMFHRKVHPESTTTAEKLDKPSKNEIRNNLMYDGAYNLGGAE  490
              T+DSA AAD KLHKIL+MFHRKVHPE++T A+K DK  K +  N    +G  ++    
Sbjct  243  --TVDSASAADRKLHKILHMFHRKVHPENSTGAQKCDKYQKKKTMNEGEGEGEEDI----  296

Query  489  NVALMPKQRMSKESIRRLKSQSNMHQFTIS--------DPDCNGNRECWIKSDAD  349
             + + PK+ +       L +++ M Q+ I         + D + N+E WIK+DAD
Sbjct  297  -LMMQPKRAV-------LSTENYMRQYKIQPNPLLGSCEEDSSENKEHWIKTDAD  343



>gb|KJB70677.1| hypothetical protein B456_011G086600 [Gossypium raimondii]
Length=378

 Score = 82.0 bits (201),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 63/178 (35%), Positives = 93/178 (52%), Gaps = 16/178 (9%)
 Frame = -2

Query  837  ELFQKTKLADENSGGAKYDRGEKRMDKEHDKSAVHLVKKILKKGMPHASSKSSTAASGCT  658
            ELF  TK+A+E++   +    E+   K+  K   H +KKILK  M HASS+SS + +  T
Sbjct  208  ELFYGTKIAEEST--MEKCGKEEMQTKQTIKPLKHFIKKILK--MVHASSRSSISFTKET  263

Query  657  IDSAAADSKLHKILNMFHRKVHPESTTTAEKLDKPSKNEIRNNLMYDGAYNLGGAENVAL  478
             +  +   KL K+  +FHRK+HPES+    +L    KNE+ NN  Y+   +  G +   +
Sbjct  264  -NPVSTKKKLQKVTRLFHRKIHPESSIAERELKAQHKNEM-NNTPYNDGDSTDGEQMHQV  321

Query  477  MPKQRMSKESIRRLKSQSNMHQFTISDPDCNGNREC---------WIKSDADYLVLEL  331
              K   S+ S  R  +Q N   F++     +G   C         WIK++ADYLVLEL
Sbjct  322  EVKNWFSQGSTSRAGTQ-NYKSFSVMPQPQHGVTGCTAASSNGAHWIKTEADYLVLEL  378



>ref|XP_010917536.1| PREDICTED: uncharacterized protein LOC105042134 isoform X1 [Elaeis 
guineensis]
Length=386

 Score = 81.6 bits (200),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 59/187 (32%), Positives = 88/187 (47%), Gaps = 30/187 (16%)
 Frame = -2

Query  840  GELFQKTKLADENSGG-----------AKYDRGEKRMDKEHDKSAVHLVKKILKKGMPHA  694
            GELF K+++A+E  G            A    GE R       + +HL+KK+        
Sbjct  213  GELFMKSRMAEEGGGKREEATAAGGGVAVLGEGEGR-----STAGMHLMKKL--------  259

Query  693  SSKSSTAASGCTIDSAAADSKLHK-----ILNMFHRKVHPESTTTAEKLDKPSKNEIRNN  529
              + S  + G  +++ AA++   K     IL +FHRKVHPE++  A+K  +  K    + 
Sbjct  260  KRRGSRGSGGGPVEATAAETTFQKLFMPQILQIFHRKVHPENSVAAKKTARSGKKNGSDC  319

Query  528  LMYDGAYNLGGAENVALMPKQRMS-KESIRRLKSQSNMHQFTISDPDCNGNRECWIKSDA  352
            + + G  +  G+    +   + +  KE     K   N     I   D NGNRE WIK+DA
Sbjct  320  MPHGGGNDFNGSGGAVITASKSICRKEGTPNFKFCLNAPSLAIGGSDSNGNREHWIKTDA  379

Query  351  DYLVLEL  331
            DYLVLEL
Sbjct  380  DYLVLEL  386



>ref|XP_009405509.1| PREDICTED: uncharacterized protein LOC103988641 [Musa acuminata 
subsp. malaccensis]
Length=377

 Score = 81.3 bits (199),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 58/177 (33%), Positives = 89/177 (50%), Gaps = 19/177 (11%)
 Frame = -2

Query  840  GELFQKTKLADENSGGAKYDRGEKRMDKEHDKSA-----VHLVKKILKKGMPHASSKSST  676
            GELF  +++ +E SGG K + G+   D   D+       + L++K + K      S   +
Sbjct  213  GELFMMSRIVEEGSGGGKAEEGKLAGDVSDDRERKPTVDICLMRKKMTKRRGGMGSDGGS  272

Query  675  AASGCTIDSAAADSKLHKILNMFHRKVHPESTTTAEKLDKPSKNEIRNNLMYDGAYNLGG  496
             ++  T++      K  KIL +FHRKVHPES+  A+K  K  K E  + +   G  +  G
Sbjct  273  PSNVSTVEK-----KFQKILQIFHRKVHPESSLMAKKASKTGKFEKNDYVSLAGGIDPTG  327

Query  495  AENVALMPKQRMS--KESIRRLKSQSNMHQFTISDPDCNGNRECWIKSDADYLVLEL  331
                     +RM+  K + R+ ++  N   + +   D N  RE WIK+DADYLVLEL
Sbjct  328  TGG------RRMTTVKGACRK-ENIPNPPSYALGGSDSNSGREHWIKTDADYLVLEL  377



>ref|XP_008805338.1| PREDICTED: uncharacterized protein LOC103718341 [Phoenix dactylifera]
Length=375

 Score = 80.9 bits (198),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 63/178 (35%), Positives = 88/178 (49%), Gaps = 24/178 (13%)
 Frame = -2

Query  840  GELFQKTKLADENSGGAKYDR------GEKRMDKEHDKS--AVHLVKKILKKGMPHASSK  685
            GELF ++++A+E  GG K +       G   +     +S   +HL+KK+          +
Sbjct  214  GELFMRSRMAEE--GGGKREETSAAGGGVTAIGDGDGRSTAGMHLMKKL--------KRR  263

Query  684  SSTAASGCTIDSAAADSKLHKILNMFHRKVHPESTTTAEKLDKPSKNEIRNNLMYDGAYN  505
             S  + G   +++AA++   KIL +FHRKVHPE++  A+K  +  K     N  +     
Sbjct  264  GSRGSGGGPGEASAAETPFQKILQIFHRKVHPENSVAAKKTARSGKKNGGGNDFH----G  319

Query  504  LGGAENVALMPKQRMSKESIRRLKSQSNMHQFTISDPDCNGNRECWIKSDADYLVLEL  331
             GGA   A   K    KE     KS SN     IS    N NRE WIK+DADYLVLEL
Sbjct  320  CGGAAIAA--SKSICRKEGTPNFKSCSNAPPLAISGSGSNANREHWIKTDADYLVLEL  375



>gb|AFK45721.1| unknown [Medicago truncatula]
 gb|AES78382.2| WRKY transcription factor-like protein [Medicago truncatula]
Length=342

 Score = 79.3 bits (194),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 61/171 (36%), Positives = 86/171 (50%), Gaps = 30/171 (18%)
 Frame = -2

Query  840  GELFQKTKLADENSGGAKYDRGEKRMD-KEHDKSAVHLVKKILKKGMPHASSKSSTAASG  664
             ELFQ+TK A+E+      + G K    K+  KS +H++KK+LK  M H SSKS   +  
Sbjct  201  AELFQRTKTANEDC----IETGVKDTQVKQAHKSPMHIMKKMLK--MVHISSKSCNTSEN  254

Query  663  CTIDSAAADSKLHKILNMFHRKVHPESTTTAEKLDKPSKNEIRNNLMYDGAYNLGGAENV  484
               DS   + KL K+L  FHRKVHPE T  A+ + K  K++I+N                
Sbjct  255  -IADSTTTNKKLSKVLRKFHRKVHPEDTLNAKSVTKSHKDKIKN----------------  297

Query  483  ALMPKQRMSKESIRRLKSQSNMHQFTISDPDCNGNRECWIKSDADYLVLEL  331
              +P++   +      +   N  Q  +      GN E WIK+DA+YLVLEL
Sbjct  298  --LPRECFDE----HCEINWNPPQDDLCCSGSTGNNEHWIKTDAEYLVLEL  342



>ref|XP_011000964.1| PREDICTED: uncharacterized protein LOC105108372 isoform X2 [Populus 
euphratica]
Length=386

 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 63/179 (35%), Positives = 92/179 (51%), Gaps = 19/179 (11%)
 Frame = -2

Query  840  GELFQKTKLADENSGGAKYDRGEKRMDKEHDKSAVHLVKKILK-----KGMPHASSKSST  676
            GE+F+ TK+ DE     K  +GE +  K H KSA +L+KKILK      G P  S++   
Sbjct  218  GEMFRMTKVTDEIPS-EKEVKGEMQAKKAH-KSAKYLIKKILKMFRTTSGNPTPSTRDEA  275

Query  675  AASGCTIDSAAADSKLHKILNMFHRKVHPESTTTAEKLDKPSKNEIRNNLMYDGAYNLGG  496
            +      +S +    L+K+L +FHRKVHPE+     +  K  K++    L  DG YN   
Sbjct  276  S------NSVSTKKTLNKVLKVFHRKVHPENPLAEREFTKSHKDKTMTTLN-DGGYNAEL  328

Query  495  AENV----ALMPKQRMSKESIRRLKSQSNMHQFTISDPDCNGNRECWIKSDADYLVLEL  331
               V      +P  + S+E ++  K+   + Q      + + N E WIK+DADYLVLEL
Sbjct  329  THQVKEKRKFLPGYK-SREGVQCHKNSLKVPQHDHICSNSSANGEYWIKTDADYLVLEL  386



>ref|XP_010112393.1| hypothetical protein L484_010798 [Morus notabilis]
 gb|EXC33388.1| hypothetical protein L484_010798 [Morus notabilis]
Length=479

 Score = 78.6 bits (192),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 70/194 (36%), Positives = 97/194 (50%), Gaps = 29/194 (15%)
 Frame = -2

Query  840  GELFQKTKLADENSGGAKYDRGEKRMDKEHDKSAVHLVKKILKKGMPHASSKSSTAASGC  661
            GELF +TK+A EN    +    E+  +K+  KSA+  VKK++KK  P  SSKSS  + G 
Sbjct  292  GELFHRTKIAAENCTEKR--PIEEIPEKQKHKSAMRFVKKMIKKVNP--SSKSSYHSYGE  347

Query  660  T-------------IDSAAADSKLHKILNMFHRKVHPESTTTAEKLDKPSKNEIRNNLMY  520
            T             IDS +   KL K++ MFHRK+HPES+    +  +  K + +N    
Sbjct  348  TPDSVSTKKELGDAIDSVSNMKKLQKVMRMFHRKIHPESSMAEREFVRSKKCKSKNTPKE  407

Query  519  DGA-----YNLGGAENVALMPKQRMSKESIRRLKSQSNMHQFTISDPDCN---GNRECWI  364
             G       +L G  +    P+  MS E +    S+ N++    S  +CN   G  E WI
Sbjct  408  VGCASGNLIHLSG--DNKRFPQGSMSMEGVHC--SKKNVNSPQESSLNCNNLRGKGEHWI  463

Query  363  KSDADYLVLEL*DQ  322
            K D DYLVLEL  Q
Sbjct  464  KIDDDYLVLELQQQ  477



>ref|XP_011653042.1| PREDICTED: uncharacterized protein LOC105435167 [Cucumis sativus]
 gb|KGN53042.1| hypothetical protein Csa_4G012380 [Cucumis sativus]
Length=385

 Score = 77.8 bits (190),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 70/197 (36%), Positives = 113/197 (57%), Gaps = 28/197 (14%)
 Frame = -2

Query  840  GELFQKTKLADENSGGAKYDRGE-KRMDKEHD-KSAVHLVKKILKKGMPHASSKS--STA  673
            GELFQ++K+ +E  GG   ++ E K+++KE D +  + L+KK LKK M  A+SKS  S+ 
Sbjct  190  GELFQRSKVVEEGGGGRCDEKDEQKKVEKEGDNRYGMQLLKKKLKKKMFCAASKSTLSSN  249

Query  672  ASGCTIDSAAADSKLHKILNMFHRKVHPESTTTA---EKLDKPSKNE--------IRNNL  526
            ASG  +D ++A +KLHKIL++F+RKV+P  + T    +K+  P K +             
Sbjct  250  ASGEVLDVSSA-TKLHKILHLFNRKVYPAESITMGKDQKVGDPHKVQKSYDKKKKTTITT  308

Query  525  MYDG------AYNLGGAENVALMPKQRMSKESIRRLKSQSNMHQFTISDPDCNG------  382
              DG             E++ + PKQ + K++++ ++++S   +F+    D +       
Sbjct  309  TVDGRSSNNNEETTSTDEDIMIFPKQLILKQTLQSIQTRSGPPRFSDISDDDDDVDFNYW  368

Query  381  NRECWIKSDADYLVLEL  331
            N+E WIKSD+DYLVLEL
Sbjct  369  NKEQWIKSDSDYLVLEL  385



>ref|XP_007217685.1| hypothetical protein PRUPE_ppa019356mg, partial [Prunus persica]
 gb|EMJ18884.1| hypothetical protein PRUPE_ppa019356mg, partial [Prunus persica]
Length=357

 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 61/172 (35%), Positives = 85/172 (49%), Gaps = 18/172 (10%)
 Frame = -2

Query  837  ELFQKTKLADENSGGAKYDRGEKRMDKEHD-KSAVHLVKKILKKGMPHASSKSSTAASGC  661
            ELF +TK+  EN    K       +  EH   SA+  +KKI+KK   HASSKSS   +G 
Sbjct  180  ELFDRTKMTTEN---CKETSESVDIKSEHKHTSAMQFMKKIIKK--LHASSKSSAPCTGG  234

Query  660  TI-DSAAADSKLHKILNMFHRKVHPESTTTAEKLDKPSKNEIRNNLMYDGAYNLGGAENV  484
             + D  +      +IL MFHR++HPES+T A +  +  K + +NN    G       EN+
Sbjct  235  DVTDPVSTRKTFGEILRMFHRRIHPESSTAAREFVEAEKYKDKNNYSAHGRCR----ENM  290

Query  483  ALM-------PKQRMSKESIRRLKSQSNMHQFTISDPDCNGNRECWIKSDAD  349
             LM       P+  M KE     K   N+ Q+ +S  +     E WIK+DAD
Sbjct  291  MLMGRDNRRFPQGAMIKEGTEHGKKYMNLPQYRLSGSNFRRKGEHWIKTDAD  342



>ref|XP_004148010.2| PREDICTED: uncharacterized protein LOC101218873 [Cucumis sativus]
 gb|KGN58162.1| hypothetical protein Csa_3G565330 [Cucumis sativus]
Length=369

 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 61/172 (35%), Positives = 95/172 (55%), Gaps = 10/172 (6%)
 Frame = -2

Query  837  ELFQKTKLADENSGGAKYDRGEKRMDKEHDKSAVHLVKKILKKGMPHASSKSSTAASGCT  658
            ELFQ T +A+  S     ++ +K + K  +KSA+  VKK+LKK +  +S  SST  SG  
Sbjct  205  ELFQDT-IAENESFKLNIEK-KKALVKHSNKSALTFVKKMLKK-LCTSSHGSSTYDSG--  259

Query  657  IDSAAADSKLHKILNMFHRKVHPESTTTAEKLDKPSKNEIRNNLMYDGAYN---LGGAEN  487
             DS +   KL K+L   +RK+HPE++T  ++  K S+  I  N+ +D   N   +   E+
Sbjct  260  -DSHSTKKKLQKVLRKLNRKIHPETSTAMDECQK-SQKYIFENVSFDNFNNDSVMNRVED  317

Query  486  VALMPKQRMSKESIRRLKSQSNMHQFTISDPDCNGNRECWIKSDADYLVLEL  331
                 ++ +SKE +   K+   +  + I     + NR  WIK+DA+YLVLEL
Sbjct  318  GITYCQEFISKEEMCYWKTNLGLPLYGIDTNVSSANRGHWIKTDAEYLVLEL  369



>gb|KJB70678.1| hypothetical protein B456_011G086600 [Gossypium raimondii]
Length=382

 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 63/182 (35%), Positives = 93/182 (51%), Gaps = 20/182 (11%)
 Frame = -2

Query  837  ELFQKTKLADENSGGAKYDRGEKRMDKEHDKSAVHLVKKILKKGMPHASSKSSTAASGCT  658
            ELF  TK+A+E++   +    E+   K+  K   H +KKILK  M HASS+SS + +  T
Sbjct  208  ELFYGTKIAEEST--MEKCGKEEMQTKQTIKPLKHFIKKILK--MVHASSRSSISFTKET  263

Query  657  IDSAAADSKLHK----ILNMFHRKVHPESTTTAEKLDKPSKNEIRNNLMYDGAYNLGGAE  490
             +  +   KL K    +  +FHRK+HPES+    +L    KNE+ NN  Y+   +  G +
Sbjct  264  -NPVSTKKKLQKCGLQVTRLFHRKIHPESSIAERELKAQHKNEM-NNTPYNDGDSTDGEQ  321

Query  489  NVALMPKQRMSKESIRRLKSQSNMHQFTISDPDCNGNREC---------WIKSDADYLVL  337
               +  K   S+ S  R  +Q N   F++     +G   C         WIK++ADYLVL
Sbjct  322  MHQVEVKNWFSQGSTSRAGTQ-NYKSFSVMPQPQHGVTGCTAASSNGAHWIKTEADYLVL  380

Query  336  EL  331
            EL
Sbjct  381  EL  382



>ref|XP_006385888.1| hypothetical protein POPTR_0003s16715g [Populus trichocarpa]
 gb|ERP63685.1| hypothetical protein POPTR_0003s16715g [Populus trichocarpa]
Length=91

 Score = 70.5 bits (171),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 45/94 (48%), Positives = 61/94 (65%), Gaps = 3/94 (3%)
 Frame = -2

Query  612  MFHRKVHPESTTTAEKLDKPSKNEIRNNLMYDGAYNLGGAENVALMPKQRMSKESIRRLK  433
            MFHRKVHPES+T+  K  KP KNE + +    G   +   E++ ++P+    + + RR K
Sbjct  1    MFHRKVHPESSTSTRKAGKPQKNENKKSNNNGG--QVLPNEDITIVPRTLSRRST-RRFK  57

Query  432  SQSNMHQFTISDPDCNGNRECWIKSDADYLVLEL  331
            SQSN   FT +  + N +RECWIK+DADYLVLEL
Sbjct  58   SQSNPPHFTFTGCESNESRECWIKTDADYLVLEL  91



>ref|XP_003622164.1| hypothetical protein MTR_7g028590 [Medicago truncatula]
Length=405

 Score = 75.5 bits (184),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 59/170 (35%), Positives = 85/170 (50%), Gaps = 30/170 (18%)
 Frame = -2

Query  840  GELFQKTKLADENSGGAKYDRGEKRMD-KEHDKSAVHLVKKILKKGMPHASSKSSTAASG  664
             ELFQ+TK A+E+      + G K    K+  KS +H++KK+LK  M H SSKS   +  
Sbjct  201  AELFQRTKTANEDC----IETGVKDTQVKQAHKSPMHIMKKMLK--MVHISSKSCNTSEN  254

Query  663  CTIDSAAADSKLHKILNMFHRKVHPESTTTAEKLDKPSKNEIRNNLMYDGAYNLGGAENV  484
               DS   + KL K+L  FHRKVHPE T  A+ + K  K++I+N                
Sbjct  255  -IADSTTTNKKLSKVLRKFHRKVHPEDTLNAKSVTKSHKDKIKN----------------  297

Query  483  ALMPKQRMSKESIRRLKSQSNMHQFTISDPDCNGNRECWIKSDADYLVLE  334
              +P++   +      +   N  Q  +      GN E WIK+DA+YLVL+
Sbjct  298  --LPRECFDE----HCEINWNPPQDDLCCSGSTGNNEHWIKTDAEYLVLD  341



>gb|KDO63890.1| hypothetical protein CISIN_1g047473mg, partial [Citrus sinensis]
Length=373

 Score = 74.7 bits (182),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 61/164 (37%), Positives = 91/164 (55%), Gaps = 8/164 (5%)
 Frame = -2

Query  837  ELFQKTKLADENSGGAKYDRGEKRMDKEHDKSAVHLVKKILKKGMPHASSKSSTAASGCT  658
            ELF + +  D++S   K  + E    ++H KS  +L+KK+ KK    ASSKS T +   T
Sbjct  217  ELFHRRETTDKSSM-EKSSKVEMPAKQKH-KSVKNLIKKMFKKF--RASSKSPTPSDSDT  272

Query  657  IDSAAADSKLHKILNMFHRKVHPESTTTAEKLDKPSKNEIRNNLMYDGAYNLGGAEN-VA  481
                +   KLHK++ MFHRK+HPE  + AEK  K   N+I+++  Y+G +  GG +N   
Sbjct  273  A-FVSTKKKLHKVIQMFHRKIHPEK-SIAEKELKSRTNKIKSS-PYEGVHTDGGLDNDNK  329

Query  480  LMPKQRMSKESIRRLKSQSNMHQFTISDPDCNGNRECWIKSDAD  349
              P    SK+ I   K +  + Q+ +     +GNRE WIK+DAD
Sbjct  330  SSPPGCESKDQIEYHKIEKMLSQYGLRGSTSSGNREHWIKTDAD  373



>ref|XP_008450129.1| PREDICTED: uncharacterized protein LOC103491804 isoform X2 [Cucumis 
melo]
 ref|XP_008450130.1| PREDICTED: uncharacterized protein LOC103491804 isoform X2 [Cucumis 
melo]
 ref|XP_008450131.1| PREDICTED: uncharacterized protein LOC103491804 isoform X2 [Cucumis 
melo]
Length=370

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 61/173 (35%), Positives = 94/173 (54%), Gaps = 12/173 (7%)
 Frame = -2

Query  837  ELFQKTKLADENSGGAKYDRGEKRMDKEHDKSAVHLVKKILKKGMPHASSKSSTAASGCT  658
            ELFQ T +A+  S     ++ E  + K  +KSA+  VKK+LKK +  +S  SST  SG  
Sbjct  206  ELFQGT-IAENESFKLNIEKKEALV-KHSNKSALSFVKKMLKK-LCTSSHGSSTYDSG--  260

Query  657  IDSAAADSKLHKILNMFHRKVHPESTTTAEKLDKPSKNEIRNNLMYDGAYNLG----GAE  490
             DS +   KL K+L   +RK+HPE++T  +   K S+  I  N+ +D  +N G      E
Sbjct  261  -DSYSTKKKLQKVLRKLNRKIHPETSTATDDCQK-SQKYIFENVSFDN-FNDGRVMNRVE  317

Query  489  NVALMPKQRMSKESIRRLKSQSNMHQFTISDPDCNGNRECWIKSDADYLVLEL  331
            +     ++ +SKE +   K+   +  + +     + NR  WIK+DA+YLVLEL
Sbjct  318  DGITYCQEFISKEEMCYWKTNLGLPLYGVDTNVSSANRGHWIKTDAEYLVLEL  370



>ref|XP_008450122.1| PREDICTED: uncharacterized protein LOC103491804 isoform X1 [Cucumis 
melo]
 ref|XP_008450123.1| PREDICTED: uncharacterized protein LOC103491804 isoform X1 [Cucumis 
melo]
 ref|XP_008450124.1| PREDICTED: uncharacterized protein LOC103491804 isoform X1 [Cucumis 
melo]
 ref|XP_008450125.1| PREDICTED: uncharacterized protein LOC103491804 isoform X1 [Cucumis 
melo]
 ref|XP_008450126.1| PREDICTED: uncharacterized protein LOC103491804 isoform X1 [Cucumis 
melo]
 ref|XP_008450127.1| PREDICTED: uncharacterized protein LOC103491804 isoform X1 [Cucumis 
melo]
 ref|XP_008450128.1| PREDICTED: uncharacterized protein LOC103491804 isoform X1 [Cucumis 
melo]
Length=386

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 61/173 (35%), Positives = 94/173 (54%), Gaps = 12/173 (7%)
 Frame = -2

Query  837  ELFQKTKLADENSGGAKYDRGEKRMDKEHDKSAVHLVKKILKKGMPHASSKSSTAASGCT  658
            ELFQ T +A+  S     ++ E  + K  +KSA+  VKK+LKK +  +S  SST  SG  
Sbjct  222  ELFQGT-IAENESFKLNIEKKEALV-KHSNKSALSFVKKMLKK-LCTSSHGSSTYDSG--  276

Query  657  IDSAAADSKLHKILNMFHRKVHPESTTTAEKLDKPSKNEIRNNLMYDGAYNLG----GAE  490
             DS +   KL K+L   +RK+HPE++T  +   K S+  I  N+ +D  +N G      E
Sbjct  277  -DSYSTKKKLQKVLRKLNRKIHPETSTATDDCQK-SQKYIFENVSFDN-FNDGRVMNRVE  333

Query  489  NVALMPKQRMSKESIRRLKSQSNMHQFTISDPDCNGNRECWIKSDADYLVLEL  331
            +     ++ +SKE +   K+   +  + +     + NR  WIK+DA+YLVLEL
Sbjct  334  DGITYCQEFISKEEMCYWKTNLGLPLYGVDTNVSSANRGHWIKTDAEYLVLEL  386



>ref|XP_006470092.1| PREDICTED: uncharacterized protein LOC102616547 [Citrus sinensis]
Length=98

 Score = 68.6 bits (166),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 41/99 (41%), Positives = 60/99 (61%), Gaps = 3/99 (3%)
 Frame = -2

Query  624  KILNMFHRKVHPESTTTAEKLDKPSKNEIRNNLMYDGAYNLGGAEN-VALMPKQRMSKES  448
            +++ MFHRK+HPE +  AEK  K   N+I+++  Y+G +  GG +N     P    SK+ 
Sbjct  2    QVIQMFHRKIHPEKSI-AEKELKSRTNKIKSS-PYEGVHTDGGLDNDNKSSPPGCESKDQ  59

Query  447  IRRLKSQSNMHQFTISDPDCNGNRECWIKSDADYLVLEL  331
            I   K +  + Q+ +     +GNRE WIK+DADYLVLEL
Sbjct  60   IEYHKIEKMLSQYGLRGSTSSGNREHWIKTDADYLVLEL  98



>ref|XP_007161667.1| hypothetical protein PHAVU_001G088600g [Phaseolus vulgaris]
 gb|ESW33661.1| hypothetical protein PHAVU_001G088600g [Phaseolus vulgaris]
Length=380

 Score = 72.8 bits (177),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 60/175 (34%), Positives = 86/175 (49%), Gaps = 10/175 (6%)
 Frame = -2

Query  840  GELFQKTKLADENSGGAKYDRGEKRMDKEHDKSAVHLVKKILKKGMPHASSKSSTAASGC  661
             EL  +TK   ++       R E ++ K    +A H+++KILKK     SS  S   S  
Sbjct  211  AELLDRTKATSQDCTETGI-RSETQVKKTLKSAARHIMRKILKKV---CSSSKSCNTSKN  266

Query  660  TIDSAAADSKLHKILNMFHRKVHPESTTTAEKLDKPSKNEIRN-NLMYDGAYNLGGAENV  484
              DSA+ +  LHK+L +FHRKV+PES    +   K  K+EI+N +  +   Y+ G   N 
Sbjct  267  DADSASTNKNLHKVLCLFHRKVYPESPINGKDGIKSHKDEIQNVSHEFFHEYDNGKPTNP  326

Query  483  ----ALMPKQRMSKESIRRLKSQSNMHQFTISDPDCNGNRECWIKSDADYLVLEL  331
                   P  R S+E  +   +  N  Q         GN E WI++DA+YLVLEL
Sbjct  327  DKGKRFHPDTR-SREWSQHCMTNWNPPQLGQICSSSTGNNEHWIRTDAEYLVLEL  380



>ref|XP_006599015.1| PREDICTED: uncharacterized protein LOC102666543 [Glycine max]
Length=382

 Score = 72.4 bits (176),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 54/155 (35%), Positives = 81/155 (52%), Gaps = 9/155 (6%)
 Frame = -2

Query  780  RGEKRMDKEHDKSAVHLVKKILKKGMPHASSKSSTAASGCTIDSAAADSKLHKILNMFHR  601
            +GE ++ +    SA+H+++KILK+   H+SSKS   +     DSA+ + KLHK+L MFHR
Sbjct  232  QGETQVKRTTKSSAMHIMRKILKRV--HSSSKSCNTSRD-DADSASTNKKLHKVLRMFHR  288

Query  600  KVHPESTTTAEKLDKPSKNEIRNNLMYDGAYNLGGAENVALMPKQRMSKESIRRLKSQS-  424
            KV+PES        +  K +I+ N+ ++        +       +R   ++  R  SQ  
Sbjct  289  KVYPESPVDGNDCIQSHKGKIK-NVPHECLQEYDDGKFTNPDKGKRFYSDTKSRKWSQHC  347

Query  423  ----NMHQFTISDPDCNGNRECWIKSDADYLVLEL  331
                N  Q  +      GN E WIK+DA YLVLEL
Sbjct  348  MTNWNPPQHGLICSSSTGNNEHWIKTDAKYLVLEL  382



>ref|XP_011468707.1| PREDICTED: uncharacterized protein LOC105352761 [Fragaria vesca 
subsp. vesca]
Length=431

 Score = 72.4 bits (176),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 67/184 (36%), Positives = 95/184 (52%), Gaps = 28/184 (15%)
 Frame = -2

Query  837  ELFQKTKLADENSGGAKYDRGEKRMDKEHDKSAVHLVKKILKKGMPHASSKSSTAASGCT  658
            ELF +TK+  EN   ++ D       K+  KSA   +KKI+KK   +ASSKS T+ SG  
Sbjct  204  ELFDRTKMT-ENFEKSEID------PKQKSKSATASMKKIIKKL--YASSKSPTSTSGHP  254

Query  657  IDSA-------AADS-----KLHKILNMFHRKVHPESTTTAEKLDKPSKNEIRNNLMYDG  514
             D A       A+DS     K HK+L MF RKVHPE +   +++ K  K + ++N    G
Sbjct  255  TDPAILEKLGEASDSVSTKKKPHKVLRMFQRKVHPEGSIAEKEIIKSKKYKDKSNSSDIG  314

Query  513  AYN----LGGAENVALMPKQRMSKESIRRLKSQSNMHQFTISDPDCNGNRECWIKSDAD-  349
              N    L G EN  L P++   KE  +      +M Q+ ++  D   N E WIK+DA+ 
Sbjct  315  GCNRNLKLMGEENRRL-PQESKLKEGTKNCNKYMDMPQYRLNGNDLKRNEEHWIKTDANC  373

Query  348  -YLV  340
             YL+
Sbjct  374  KYLL  377



>gb|KHN28283.1| hypothetical protein glysoja_040163, partial [Glycine soja]
Length=382

 Score = 72.4 bits (176),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 54/155 (35%), Positives = 81/155 (52%), Gaps = 9/155 (6%)
 Frame = -2

Query  780  RGEKRMDKEHDKSAVHLVKKILKKGMPHASSKSSTAASGCTIDSAAADSKLHKILNMFHR  601
            +GE ++ +    SA+H+++KILK+   H+SSKS   +     DSA+ + KLHK+L MFHR
Sbjct  232  QGETQVKRTTKSSAMHIMRKILKRV--HSSSKSCNTSRD-DADSASTNKKLHKVLRMFHR  288

Query  600  KVHPESTTTAEKLDKPSKNEIRNNLMYDGAYNLGGAENVALMPKQRMSKESIRRLKSQS-  424
            KV+PES        +  K +I+ N+ ++        +       +R   ++  R  SQ  
Sbjct  289  KVYPESPVDGNDCIQSHKGKIK-NVPHECLQEYDDGKFTNPDKGKRFYSDTKSRKWSQHC  347

Query  423  ----NMHQFTISDPDCNGNRECWIKSDADYLVLEL  331
                N  Q  +      GN E WIK+DA YLVLEL
Sbjct  348  MTNWNPPQHGLICSSSTGNNEHWIKTDAKYLVLEL  382



>ref|XP_009344241.1| PREDICTED: uncharacterized protein LOC103936127 [Pyrus x bretschneideri]
Length=386

 Score = 71.6 bits (174),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 56/153 (37%), Positives = 75/153 (49%), Gaps = 17/153 (11%)
 Frame = -2

Query  747  KSAVHLVKKILKKGMPHASSKSS--TAASGCTI--------DSAAADSKLHKILNMFHRK  598
            KSA+  +KK++KK   HASSKSS   A    +I        DS +   K HK+L MFHR 
Sbjct  237  KSAMRFMKKMIKKF--HASSKSSGGDATDSVSIKKKCDEASDSLSTKKKPHKVLRMFHRT  294

Query  597  VHPESTTTAEKLDKPSKNEIRNNLMYDGAYN----LGGAENVALMPKQRMSKESIRRLKS  430
            +HPES+  A +  K  K + +     D   N    L G +N    P+  +  E     K 
Sbjct  295  IHPESSIAAREFVKSEKYKKKKIFSADSGCNENMMLKGGDNRRF-PEGPLVNEGTENCKK  353

Query  429  QSNMHQFTISDPDCNGNRECWIKSDADYLVLEL  331
              N  Q+ +S        E WIK+DA+YLVLEL
Sbjct  354  YMNFPQYRLSGSTYGKREEHWIKTDAEYLVLEL  386



>ref|XP_008362102.1| PREDICTED: uncharacterized protein LOC103425780 isoform X1 [Malus 
domestica]
Length=379

 Score = 71.6 bits (174),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 55/153 (36%), Positives = 76/153 (50%), Gaps = 17/153 (11%)
 Frame = -2

Query  747  KSAVHLVKKILKKGMPHASSKSSTAAS----------GCTIDSAAADSKLHKILNMFHRK  598
            KSA+  +KK++KK   HASSKSS   +          G   DS +   K HK+L MFHR 
Sbjct  230  KSAMGFMKKMIKKF--HASSKSSGGDATDSVSIKKKCGEASDSLSTKKKPHKVLRMFHRT  287

Query  597  VHPESTTTAEKLDKPSKNEIRNNLMYDGAYN----LGGAENVALMPKQRMSKESIRRLKS  430
            +HPES+  A ++ K  K + +     D   N    L G +N    P+  + KE     K 
Sbjct  288  IHPESSIAAREVVKSEKYKKKKIFSADSGCNENMMLKGGDNRRF-PEGPLVKEGTENCKK  346

Query  429  QSNMHQFTISDPDCNGNRECWIKSDADYLVLEL  331
              N  Q+ ++        E WIK+DA+YLVLEL
Sbjct  347  YMNFPQYRLNGSTYGTRAEHWIKTDAEYLVLEL  379



>ref|XP_004516561.1| PREDICTED: uncharacterized protein LOC101513155 [Cicer arietinum]
Length=343

 Score = 71.2 bits (173),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 59/170 (35%), Positives = 87/170 (51%), Gaps = 29/170 (17%)
 Frame = -2

Query  840  GELFQKTKLADENSGGAKYDRGEKRMDKEHDKSAVHLVKKILKKGMPHASSKSSTAASGC  661
             ELF +T+  +E+   A+    E ++ + H KSA+H++KK+ K  M H+SSK     SG 
Sbjct  203  AELFHRTESTNEDC--AETGVEETQVKQAH-KSAMHIMKKMFK--MVHSSSKGCNT-SGN  256

Query  660  TIDSAAADSKLHKILNMFHRKVHPESTTTAEKLDKPSKNEIRNNLMYDGAYNLGGAENVA  481
              DS + ++KL K+L+ FHRKV+PE    A+   K  K +I  NL +D  ++        
Sbjct  257  DADSTSTNTKLSKVLHKFHRKVYPEDIINAKCFSKSHKGKI--NLPHD-CFD--------  305

Query  480  LMPKQRMSKESIRRLKSQSNMHQFTISDPDCNGNRECWIKSDADYLVLEL  331
                           K+     Q  +S     GN E WIK+DA+YLVLEL
Sbjct  306  ------------EYCKTNWKPPQDGLSSSGSTGNNEHWIKTDAEYLVLEL  343



>ref|XP_008362103.1| PREDICTED: uncharacterized protein LOC103425780 isoform X2 [Malus 
domestica]
Length=387

 Score = 71.2 bits (173),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 55/153 (36%), Positives = 76/153 (50%), Gaps = 17/153 (11%)
 Frame = -2

Query  747  KSAVHLVKKILKKGMPHASSKSSTAAS----------GCTIDSAAADSKLHKILNMFHRK  598
            KSA+  +KK++KK   HASSKSS   +          G   DS +   K HK+L MFHR 
Sbjct  238  KSAMGFMKKMIKKF--HASSKSSGGDATDSVSIKKKCGEASDSLSTKKKPHKVLRMFHRT  295

Query  597  VHPESTTTAEKLDKPSKNEIRNNLMYDGAYN----LGGAENVALMPKQRMSKESIRRLKS  430
            +HPES+  A ++ K  K + +     D   N    L G +N    P+  + KE     K 
Sbjct  296  IHPESSIAAREVVKSEKYKKKKIFSADSGCNENMMLKGGDNRRF-PEGPLVKEGTENCKK  354

Query  429  QSNMHQFTISDPDCNGNRECWIKSDADYLVLEL  331
              N  Q+ ++        E WIK+DA+YLVLEL
Sbjct  355  YMNFPQYRLNGSTYGTRAEHWIKTDAEYLVLEL  387



>ref|XP_009415896.1| PREDICTED: uncharacterized protein LOC103996661 [Musa acuminata 
subsp. malaccensis]
Length=391

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 60/182 (33%), Positives = 86/182 (47%), Gaps = 22/182 (12%)
 Frame = -2

Query  840  GELFQKTKLADENSGGAKYDRGEKRMDKEHDK-----SAVHLVKKILKKGMPHASSKSST  676
            GELF  +++ +E  GG      + +    HD+     + + L+KK + K      S    
Sbjct  220  GELFMISRITEEEGGGGSGTAEQVKFAGGHDEDGKSTAEICLMKKKMTKRRGGKGSDGGG  279

Query  675  AASGCTIDSAAADSKLHKILNMFHRKVHPESTTTAEKLDKPSKNEIRNNLMYDGAYNLGG  496
             ++G T+++     K  KIL  FH+KVHPES+  ++K  K  KNE +       A+ +GG
Sbjct  280  PSNGSTVET-----KFQKILQFFHKKVHPESSIMSKKPSKTGKNEKKEY-----AHPVGG  329

Query  495  AE-------NVALMPKQRMSKESIRRLKSQSNMHQFTISDPDCNGNRECWIKSDADYLVL  337
            +E         A        KE I  L    N         D NG+RE WIK+DADYLVL
Sbjct  330  SEPAGTDGCTAASAKVGPCRKEHIPDLNFCYNPPAHAFGGDDSNGSREHWIKTDADYLVL  389

Query  336  EL  331
            EL
Sbjct  390  EL  391



>ref|XP_007031921.1| Regulator of nonsense transcripts 3A, putative [Theobroma cacao]
 gb|EOY02847.1| Regulator of nonsense transcripts 3A, putative [Theobroma cacao]
Length=513

 Score = 70.1 bits (170),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 43/113 (38%), Positives = 61/113 (54%), Gaps = 6/113 (5%)
 Frame = -2

Query  654  DSAAADSKLHKILNMFHRKVHPESTTTAEKLDKPSKNEIRNNLMY-DGAYN----LGGAE  490
            +S +   KLHK++ +FHRK+HPES + AE+  K    +  NN  Y DG Y         +
Sbjct  402  NSISTKKKLHKVIKLFHRKIHPES-SIAERESKNLHTDKMNNAPYDDGEYTDVQQTHQGK  460

Query  489  NVALMPKQRMSKESIRRLKSQSNMHQFTISDPDCNGNRECWIKSDADYLVLEL  331
                 P+   SKE  +  K+ S + Q+ ++      N E WIK+DADYLVLEL
Sbjct  461  GNRRFPQGSWSKEGTQNYKTISKLPQYGLTGFTAGANGEHWIKTDADYLVLEL  513



>gb|KEH21973.1| WRKY transcription factor-like protein [Medicago truncatula]
Length=243

 Score = 68.2 bits (165),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 58/173 (34%), Positives = 84/173 (49%), Gaps = 33/173 (19%)
 Frame = -2

Query  840  GELFQKTKLADENSGGAKYDRGEKRMD-KEHDKSAVHLVKKILKKGMPHASSKSSTAASG  664
             ELFQ+TK A+E+      + G K    K+  KS +H++KK+LK  M H SSKS   +  
Sbjct  92   AELFQRTKTANEDC----IETGVKDTQVKQAHKSPMHIMKKMLK--MVHISSKSCNTSEN  145

Query  663  CTIDSAAADSKLHKILNMFHRKVHPESTTTAEKLDKPSKNEIRNNLMYDGAYNLGGAENV  484
               DS   + KL K+L  FHRKVHPE T  A+ + K  K++I+N                
Sbjct  146  -IADSTTTNKKLSKVLRKFHRKVHPEDTLNAKSVTKSHKDKIKN----------------  188

Query  483  ALMPKQRMSKESIRRLKSQSNMHQFTISDPDCNGNRECWIKSDAD---YLVLE  334
              +P++   +      +   N  Q  +      GN E WIK+DA+   Y+ LE
Sbjct  189  --LPRECFDE----HCEINWNPPQDDLCCSGSTGNNEHWIKTDAECKYYISLE  235



>ref|XP_002300122.1| hypothetical protein POPTR_0001s33510g [Populus trichocarpa]
 gb|EEE84927.1| hypothetical protein POPTR_0001s33510g [Populus trichocarpa]
Length=430

 Score = 68.6 bits (166),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 59/169 (35%), Positives = 88/169 (52%), Gaps = 11/169 (7%)
 Frame = -2

Query  840  GELFQKTKLADENSGGAKYDRGEKRMDKEHDKSAVHLVKKILKKGMPHASSKSST-AASG  664
            GE+F+ TK+ DE     K  +GE +  K H KSA +L+KKIL  GM   +S + T + S 
Sbjct  265  GEMFRMTKVTDEIPS-EKEVKGEMQAKKAH-KSAKYLIKKIL--GMFCTTSGNPTPSTSD  320

Query  663  CTIDSAAADSKLHKILNMFHRKVHPESTTTAEKLDKPSKNEIRNNLMYDGAYNLGGAENV  484
               +S +    L+K+L +FHRKVHPE+     +  K  K++  N L  DG YN      V
Sbjct  321  EASNSVSTKKTLNKVLKVFHRKVHPENPLAEREFTKSHKDKTMNTL-NDGGYNAELTNQV  379

Query  483  ----ALMPKQRMSKESIRRLKSQSNMHQFTISDPDCNGNRECWIKSDAD  349
                  +P  + S+E ++  K+   + Q      + + N E WIK+DAD
Sbjct  380  KEKRKFLPGYK-SREGVQCHKNSLKLPQHDHICSNSSANGEYWIKTDAD  427



>ref|XP_006604154.1| PREDICTED: uncharacterized protein LOC102665678 [Glycine max]
Length=382

 Score = 68.2 bits (165),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 59/176 (34%), Positives = 88/176 (50%), Gaps = 12/176 (7%)
 Frame = -2

Query  840  GELFQKTKLADENSGGAKYDRGEKRMDKEHDKSAVHLVKKILKKGMPHASSKSSTAASGC  661
             EL  KTK   ++       +GE ++ +    +A+H+++KILK+   H+SSKS   +   
Sbjct  213  AELLYKTKSTSQDCIDTGI-QGETQVKRTPKSAAMHIMRKILKRV--HSSSKSCNTSRN-  268

Query  660  TIDSAAADSKLHKILNMFHRKVHPESTTTAEKLDKPSKNEIRNNLM-YDGAYNLGGAENV  484
              DSA+ + KL K+  MFH+KV+PES    +   +  K +I+N    Y   Y  G   N 
Sbjct  269  DADSASTNKKLQKVQRMFHKKVYPESPVDGKDCIQSHKGKIKNVPHEYFQEYENGKFTNP  328

Query  483  ALMPKQRMSKESIRRLKSQS-----NMHQFTISDPDCNGNRECWIKSDADYLVLEL  331
                 +R   ++  R  SQ      N  Q  +      GN E WIK+DA+YLVLEL
Sbjct  329  D--KGKRFHSDTKSRKWSQHCMTNWNPPQHGLICSSSTGNNEHWIKTDAEYLVLEL  382



>ref|XP_010550214.1| PREDICTED: uncharacterized protein LOC104821129 isoform X2 [Tarenaya 
hassleriana]
Length=351

 Score = 67.4 bits (163),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 62/171 (36%), Positives = 85/171 (50%), Gaps = 26/171 (15%)
 Frame = -2

Query  840  GELFQKTKLADENSGGAKYDRGEKRMDKEHDKSAVHLVKKILKKGMPHASSKSSTAASGC  661
            GELFQ+T +  ENS   K +    + +  H +SA + +KK+LK    H+SS+ ST   G 
Sbjct  206  GELFQRTNI-QENSE-FKCENKLMQTNPAH-RSAKNPMKKLLK--TIHSSSRFST---GG  257

Query  660  TIDSAAADSKLHKILNMFHRKVHPESTTTAEKLDKPSKNEIRNNLMYDGAYN-LGGAENV  484
              DS +   K  KI+ +FHRKVHPE++ T  +++   K        Y G  +  G + NV
Sbjct  258  KTDSPSTKKKFQKIIQIFHRKVHPENSITEREINGKMKTAESTEPDYLGLISEKGNSSNV  317

Query  483  ALMPKQRMSKESIRRLKSQSNMHQFTISDPDCNGNRECWIKSDADYLVLEL  331
                   MSK  I          Q  I   D   N E WIK+DA+Y VLEL
Sbjct  318  -------MSKRQI----------QCEIKGSDSARNGEHWIKTDAEYFVLEL  351



>ref|XP_009597113.1| PREDICTED: uncharacterized protein LOC104093106 [Nicotiana tomentosiformis]
Length=355

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 59/170 (35%), Positives = 85/170 (50%), Gaps = 16/170 (9%)
 Frame = -2

Query  834  LFQKTKLADENSGGAKYDRGEKRMDKEHDKSAVHLVKKILKKGMPHASSKSST-AASGCT  658
            L ++  +A E+  G   D  EK+  K   + A+H +KK+LK    H+ SKS T  +SG  
Sbjct  200  LIKRNNIAGEHHIGK--DGKEKKQTK--GRHAMHFMKKMLKN--LHSKSKSCTDPSSGDV  253

Query  657  IDSAAADSKLHKILNMFHRKVHPESTTTAEKLDKPSKNEIRNNLMYDGAYNLGGAENVAL  478
             +  ++  KL ++L M  RKVHP    T +  +KP K+EIRN     G     G      
Sbjct  254  NEPVSSKRKLPQVLKMLKRKVHPAEGLTDK--NKPLKDEIRNIFCEAGKLGANGE-----  306

Query  477  MPKQRMSKESI-RRLKSQSNMHQFTISDPDCNGNRECWIKSDADYLVLEL  331
             P    S  S+  ++   S ++   +       NRE WIK+DADYLVLEL
Sbjct  307  -PNNMFSNASVPTKILHASEVYPSDMEYDVSAVNREHWIKTDADYLVLEL  355



>gb|KCW55813.1| hypothetical protein EUGRSUZ_I01630 [Eucalyptus grandis]
Length=324

 Score = 66.6 bits (161),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 60/182 (33%), Positives = 89/182 (49%), Gaps = 29/182 (16%)
 Frame = -2

Query  837  ELFQKTKLADENSGG---AKYDRGEKRMDKEHDKSAVHLVKKILKKGMPHASSKSSTAAS  667
            +LFQ+T+     +GG    K + G K ++  H KS+ H++KK LKK +  +S   S +  
Sbjct  159  QLFQETR----KTGGDCSKKSEMGAKLVEPIH-KSSKHIMKKFLKK-LCASSRPPSHSTG  212

Query  666  GCTIDSAAADSKLHKILNMFHRKVHPESTTTAEKLDK----PSKNEIRNN------LMYD  517
            G   +S+    K HK+L MF RK+HPE+     +++K     SK    +N      L+  
Sbjct  213  GDATESSLPKKKFHKVLQMFRRKIHPENAMDTAEMNKCKAYKSKKAFNDNSCSHKDLIDQ  272

Query  516  GAYNLGGAENVALMPKQRMSKESIRRLKSQSNMHQFTISDPDCNGNRECWIKSDADYLVL  337
               N+  A+ +       MS E  +           T +  DC   RE WIK+DADYLVL
Sbjct  273  DKANISSAQGL-------MSTEGEKASLKLRPPEIATATSDDC---REHWIKTDADYLVL  322

Query  336  EL  331
            EL
Sbjct  323  EL  324



>ref|XP_011000963.1| PREDICTED: uncharacterized protein LOC105108372 isoform X1 [Populus 
euphratica]
Length=395

 Score = 66.6 bits (161),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 57/173 (33%), Positives = 86/173 (50%), Gaps = 19/173 (11%)
 Frame = -2

Query  840  GELFQKTKLADENSGGAKYDRGEKRMDKEHDKSAVHLVKKILK-----KGMPHASSKSST  676
            GE+F+ TK+ DE     K  +GE +  K H KSA +L+KKILK      G P  S++   
Sbjct  218  GEMFRMTKVTDEIPS-EKEVKGEMQAKKAH-KSAKYLIKKILKMFRTTSGNPTPSTRDEA  275

Query  675  AASGCTIDSAAADSKLHKILNMFHRKVHPESTTTAEKLDKPSKNEIRNNLMYDGAYNLGG  496
            +      +S +    L+K+L +FHRKVHPE+     +  K  K++    L  DG YN   
Sbjct  276  S------NSVSTKKTLNKVLKVFHRKVHPENPLAEREFTKSHKDKTMTTLN-DGGYNAEL  328

Query  495  AENV----ALMPKQRMSKESIRRLKSQSNMHQFTISDPDCNGNRECWIKSDAD  349
               V      +P  + S+E ++  K+   + Q      + + N E WIK+DAD
Sbjct  329  THQVKEKRKFLPGYK-SREGVQCHKNSLKVPQHDHICSNSSANGEYWIKTDAD  380



>ref|XP_010028982.1| PREDICTED: uncharacterized protein LOC104419127 [Eucalyptus grandis]
Length=368

 Score = 66.6 bits (161),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 60/182 (33%), Positives = 89/182 (49%), Gaps = 29/182 (16%)
 Frame = -2

Query  837  ELFQKTKLADENSGG---AKYDRGEKRMDKEHDKSAVHLVKKILKKGMPHASSKSSTAAS  667
            +LFQ+T+     +GG    K + G K ++  H KS+ H++KK LKK +  +S   S +  
Sbjct  203  QLFQETR----KTGGDCSKKSEMGAKLVEPIH-KSSKHIMKKFLKK-LCASSRPPSHSTG  256

Query  666  GCTIDSAAADSKLHKILNMFHRKVHPESTTTAEKLDK----PSKNEIRNN------LMYD  517
            G   +S+    K HK+L MF RK+HPE+     +++K     SK    +N      L+  
Sbjct  257  GDATESSLPKKKFHKVLQMFRRKIHPENAMDTAEMNKCKAYKSKKAFNDNSCSHKDLIDQ  316

Query  516  GAYNLGGAENVALMPKQRMSKESIRRLKSQSNMHQFTISDPDCNGNRECWIKSDADYLVL  337
               N+  A+ +       MS E  +           T +  DC   RE WIK+DADYLVL
Sbjct  317  DKANISSAQGL-------MSTEGEKASLKLRPPEIATATSDDC---REHWIKTDADYLVL  366

Query  336  EL  331
            EL
Sbjct  367  EL  368



>ref|XP_009757313.1| PREDICTED: uncharacterized protein LOC104210188 isoform X1 [Nicotiana 
sylvestris]
Length=347

 Score = 64.3 bits (155),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 55/171 (32%), Positives = 84/171 (49%), Gaps = 27/171 (16%)
 Frame = -2

Query  837  ELFQKTKLADENSGGAKYDRGEKRMDKEHDKSAVHLVKKILKKGMPHASSKSSTAA--SG  664
            ELF++T +  E+  G  +D  EK+  K   K AV  +KK+L+    H  SKSST A   G
Sbjct  202  ELFKRTNIVQESHVGT-HDGKEKKQAKR--KHAVDFMKKMLQN--LHYKSKSSTTAHSKG  256

Query  663  CTIDSAAADSKLHKILNMFHRKVHPESTTTAEKLDKPSKNEIRNNLMYDGAYNLGGAENV  484
                S ++  KL ++L MF RKVHPE               +  N++ D   +    +  
Sbjct  257  NVNGSVSSKRKLPQVLKMFKRKVHPEGL-------------MNENILQDNETSNISCKTN  303

Query  483  ALMPKQRMSKESIRRLKSQSNMHQFTISDPDCNGNRECWIKSDADYLVLEL  331
             L     ++K++     ++  ++  T+       NRE WIK+D+DYLVLEL
Sbjct  304  NLRANSEVNKKNSPAATTKKELNALTV-------NREHWIKTDSDYLVLEL  347



>ref|XP_009757314.1| PREDICTED: uncharacterized protein LOC104210188 isoform X2 [Nicotiana 
sylvestris]
Length=339

 Score = 64.3 bits (155),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 55/171 (32%), Positives = 84/171 (49%), Gaps = 27/171 (16%)
 Frame = -2

Query  837  ELFQKTKLADENSGGAKYDRGEKRMDKEHDKSAVHLVKKILKKGMPHASSKSSTAA--SG  664
            ELF++T +  E+  G  +D  EK+  K   K AV  +KK+L+    H  SKSST A   G
Sbjct  194  ELFKRTNIVQESHVGT-HDGKEKKQAKR--KHAVDFMKKMLQN--LHYKSKSSTTAHSKG  248

Query  663  CTIDSAAADSKLHKILNMFHRKVHPESTTTAEKLDKPSKNEIRNNLMYDGAYNLGGAENV  484
                S ++  KL ++L MF RKVHPE               +  N++ D   +    +  
Sbjct  249  NVNGSVSSKRKLPQVLKMFKRKVHPEGL-------------MNENILQDNETSNISCKTN  295

Query  483  ALMPKQRMSKESIRRLKSQSNMHQFTISDPDCNGNRECWIKSDADYLVLEL  331
             L     ++K++     ++  ++  T+       NRE WIK+D+DYLVLEL
Sbjct  296  NLRANSEVNKKNSPAATTKKELNALTV-------NREHWIKTDSDYLVLEL  339



>ref|XP_004979290.1| PREDICTED: uncharacterized protein LOC101784407 [Setaria italica]
Length=411

 Score = 63.9 bits (154),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 58/183 (32%), Positives = 79/183 (43%), Gaps = 23/183 (13%)
 Frame = -2

Query  840  GELFQKTKLADENSGGAKYDRGEKRM----DKEHDKSAVHLVKKILKKGMPHASSKSSTA  673
            GELF +T+ ADE       + GE        ++  +      +K +KK     +      
Sbjct  239  GELFMRTRFADEKVALVAVEEGEDGAAGGETEDGKEGKGGDGRKTVKK--RRVNDGKGAG  296

Query  672  ASGCTIDSAAADSKLHKILNMFHRKVHPESTTTAEKLDKPSKNEIRNNLMYDGAYNLGGA  493
              G    +A   SK  KIL +FHRKV+PEST  A  L K S+          G+ +    
Sbjct  297  GEGAPASAAVTKSKFQKILQIFHRKVYPESTALARSLTKKSRKR--------GSSSASAD  348

Query  492  ENVALMPKQRMSKES-IRRLKSQSNMHQF-----TISDPD--CNGNREC-WIKSDADYLV  340
            E    +PK R  KE         +N   F      I D D   NG++   WIK+DA+YLV
Sbjct  349  EPELALPKLRCRKEQRAPGFGCCANRASFGGAATPIDDDDDELNGSKSGHWIKTDAEYLV  408

Query  339  LEL  331
            LEL
Sbjct  409  LEL  411



>emb|CDP20015.1| unnamed protein product, partial [Coffea canephora]
Length=394

 Score = 63.2 bits (152),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 57/163 (35%), Positives = 86/163 (53%), Gaps = 10/163 (6%)
 Frame = -2

Query  837  ELFQKTKLADENSGGAKYDRGEKRMDKEHDKSAVHLVKKILKKGMPHASSKSSTAASGCT  658
            ELF++T  + E S   KYD  + +  K H   A H +KKILKK    ASS  +TA++  T
Sbjct  231  ELFRRTDTSCEKSTN-KYDCTDYQPKKRH---ASHFIKKILKKLQSTASS-CTTASAEKT  285

Query  657  IDSAAADSKLHKILNMFHRKVHPESTTTAEKLDKPSKNEIRNNLMYDGAYNLGGAENVAL  478
             +S A   KL K++ +FHRKVHPE  TT ++  K  +++ + N      +    AE+   
Sbjct  286  TESEAIKRKLPKVMKIFHRKVHPEGFTTKKQFIKADEDKSKKNSSKSNNHY---AEDTG-  341

Query  477  MPKQRMSKESIRRLKSQSNMHQFTISDPDCNGNRECWIKSDAD  349
              K+  +K  +++  S+S +            NRE WIK+DAD
Sbjct  342  -KKRSHNKSDLKKEISKSVLSFKRADSGRVMVNREHWIKTDAD  383



>ref|XP_009771786.1| PREDICTED: uncharacterized protein LOC104222269 isoform X2 [Nicotiana 
sylvestris]
Length=354

 Score = 62.4 bits (150),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 59/170 (35%), Positives = 85/170 (50%), Gaps = 16/170 (9%)
 Frame = -2

Query  834  LFQKTKLADENSGGAKYDRGEKRMDKEHDKSAVHLVKKILKKGMPHASSKSST-AASGCT  658
            L ++  +A E+  G   D  EK+  K   + A+H +KK+LK    H+ SKSST  +SG  
Sbjct  199  LIKRNNIAGEHHIGK--DGKEKKQTK--GRRAMHFMKKMLKN--LHSKSKSSTDPSSGDV  252

Query  657  IDSAAADSKLHKILNMFHRKVHPESTTTAEKLDKPSKNEIRNNLMYDGAYNLGGAENVAL  478
             +  +   KL ++L M  RKVHP    T +  +KP K+EIR      G     G  N   
Sbjct  253  NEYVSRKRKLPQVLKMLKRKVHPAEGLTDK--NKPLKDEIRKISCEAGKLGANGELN---  307

Query  477  MPKQRMSKESI-RRLKSQSNMHQFTISDPDCNGNRECWIKSDADYLVLEL  331
               +  S  S+  ++   S ++   +       NRE WIK+DADYLVLEL
Sbjct  308  ---KMFSNTSVPTKILHASEVYPSDMEYDVSAVNREHWIKTDADYLVLEL  354



>ref|XP_009771785.1| PREDICTED: uncharacterized protein LOC104222269 isoform X1 [Nicotiana 
sylvestris]
Length=355

 Score = 62.0 bits (149),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 59/170 (35%), Positives = 85/170 (50%), Gaps = 16/170 (9%)
 Frame = -2

Query  834  LFQKTKLADENSGGAKYDRGEKRMDKEHDKSAVHLVKKILKKGMPHASSKSST-AASGCT  658
            L ++  +A E+  G   D  EK+  K   + A+H +KK+LK    H+ SKSST  +SG  
Sbjct  200  LIKRNNIAGEHHIGK--DGKEKKQTK--GRRAMHFMKKMLKN--LHSKSKSSTDPSSGDV  253

Query  657  IDSAAADSKLHKILNMFHRKVHPESTTTAEKLDKPSKNEIRNNLMYDGAYNLGGAENVAL  478
             +  +   KL ++L M  RKVHP    T +  +KP K+EIR      G     G  N   
Sbjct  254  NEYVSRKRKLPQVLKMLKRKVHPAEGLTDK--NKPLKDEIRKISCEAGKLGANGELN---  308

Query  477  MPKQRMSKESI-RRLKSQSNMHQFTISDPDCNGNRECWIKSDADYLVLEL  331
               +  S  S+  ++   S ++   +       NRE WIK+DADYLVLEL
Sbjct  309  ---KMFSNTSVPTKILHASEVYPSDMEYDVSAVNREHWIKTDADYLVLEL  355



>ref|XP_010556290.1| PREDICTED: uncharacterized protein LOC104825628 isoform X2 [Tarenaya 
hassleriana]
Length=363

 Score = 61.6 bits (148),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 45/135 (33%), Positives = 65/135 (48%), Gaps = 16/135 (12%)
 Frame = -2

Query  699  HASSKSSTAASG---CTIDSAAADSKLHKILNMFHRKVHPESTTTAEKLDKPSKNE----  541
            H ++K S    G      DS     KL KI  +F RK+HP   T+  + +KP+K++    
Sbjct  233  HGTAKKSFTHCGKDDDDDDSVPQKKKLRKIGQLFRRKIHPVICTSETEGNKPNKDQKIDD  292

Query  540  -IRNNLMY----DGAYNLGGAENVALMPKQRMSKESIRRLKSQSNMHQFTISDPDCNGNR  376
              RN   Y    D  Y  GG +N         S+E     ++ S+M Q+ +     NG R
Sbjct  293  MFRNRRSYINGDDLIYRHGGGDNQV----SSSSEEGFLSSETSSDMTQYEVVGKSPNGKR  348

Query  375  ECWIKSDADYLVLEL  331
            E WI +D++YLVLEL
Sbjct  349  EKWINTDSEYLVLEL  363



>ref|NP_001067926.1| Os11g0490600 [Oryza sativa Japonica Group]
 gb|ABA93814.2| expressed protein [Oryza sativa Japonica Group]
 gb|ABI34464.1| LA [Oryza sativa Japonica Group]
 dbj|BAF28289.1| Os11g0490600 [Oryza sativa Japonica Group]
Length=416

 Score = 61.2 bits (147),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 42/107 (39%), Positives = 52/107 (49%), Gaps = 6/107 (6%)
 Frame = -2

Query  636  SKLHKILNMFHRKVHPESTTTAEKLDKPSKNEIRNNLMYDGAYNLGGAENVALMPKQRMS  457
            SK  KIL +FHRKV+PE+T     L K S+N    +    GA   G  +     P  R  
Sbjct  311  SKFQKILQIFHRKVYPENTLLTRNLTKKSRNRGATD-NGGGAVATGDPDGPLASPVLRCR  369

Query  456  KESIRRLKSQSNMHQFTISDP----DCNGNREC-WIKSDADYLVLEL  331
            K+   R         F  S P    + NGN+   WIK+DADYLVLEL
Sbjct  370  KDHPMRGFGCCTNGAFGASSPGGNAEMNGNKSGHWIKTDADYLVLEL  416



>ref|XP_006848334.2| PREDICTED: uncharacterized protein LOC18438079 [Amborella trichopoda]
Length=375

 Score = 61.2 bits (147),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 66/197 (34%), Positives = 92/197 (47%), Gaps = 41/197 (21%)
 Frame = -2

Query  840  GELFQKTKLAD--ENSGGAKYDRGEKRMDKEHDKSAVHLVKKILKKGMPHASSKSSTAAS  667
            GELF ++K  D        +  +     D  + K   HLV+KIL +   H ++ SS A +
Sbjct  193  GELFMRSKAEDVMREKEEREEKKEGNSNDNNNTKVGAHLVRKILGRKSAHRNT-SSNANA  251

Query  666  GCTIDSAAADSKLHKI--------------LNMF-----HR---KVHPESTTTAEKLDKP  553
              +ID AA  +KLHK+                MF     HR   K+HPES+  A      
Sbjct  252  DSSIDPAA--NKLHKVRIMSYMNVQTPNNSQQMFDQMTQHRITWKIHPESSDAA------  303

Query  552  SKNEIRNNLMY---DGAYNLGGAENVALMPKQRMSKESIRRLKSQSNMHQFTISDPDCNG  382
             KNE + +L      GAY+    E   LM ++R S  + RR K+     +   S  + NG
Sbjct  304  -KNETKAHLKGYKGGGAYDGDVDEGKDLMGRERESART-RRYKAH---RETPFSGINSNG  358

Query  381  NRECWIKSDADYLVLEL  331
            N   WIK+DA+YLVLEL
Sbjct  359  NTGYWIKTDANYLVLEL  375



>gb|KJB76371.1| hypothetical protein B456_012G084800 [Gossypium raimondii]
 gb|KJB76372.1| hypothetical protein B456_012G084800 [Gossypium raimondii]
Length=366

 Score = 60.5 bits (145),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 65/176 (37%), Positives = 92/176 (52%), Gaps = 27/176 (15%)
 Frame = -2

Query  837  ELFQKTKLADENSGGAKYDRG-EKRMDKEHDKSAVHLVKKILKKGMPHASSKSSTAASGC  661
            ELF +TK+A+E +       G E    K+  K A HL+KKI+KK   HASS         
Sbjct  211  ELFYRTKVAEEYNNNPMEKSGKEDTQTKQTTKPAKHLIKKIIKKF--HASSGKEET----  264

Query  660  TIDSAAADSKLHKILNMFHRKVHPESTTTAEKLDKPSKNEIRNNLMY-DGAYNLGGAENV  484
              +S +   KL K++ +FHRK+HPE+ + AE+  K       NN  Y D  Y   G +N+
Sbjct  265  --NSFSTKKKLQKVIKLFHRKIHPEN-SIAERESK------MNNAPYSDNDYT--GGDNM  313

Query  483  ALMPKQRMSKESI--RRLKSQSNMHQFTISDPDCNG---NRECWIKSDADYLVLEL  331
               P+   SK  +   + K+ S + Q+ ++   C     N E WIK+DADYLVLEL
Sbjct  314  RF-PQGSRSKAGLGNNKKKTISKLPQYGLT--GCTAATENGEHWIKTDADYLVLEL  366



>ref|XP_002303775.1| hypothetical protein POPTR_0003s16710g [Populus trichocarpa]
 gb|EEE78754.1| hypothetical protein POPTR_0003s16710g [Populus trichocarpa]
Length=297

 Score = 60.1 bits (144),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 49/75 (65%), Positives = 64/75 (85%), Gaps = 1/75 (1%)
 Frame = -2

Query  840  GELFQKTKLADENSGGAKYDRGEKRMDKEHDKSAVHLVKKILKKGMPHASSKSSTAASGC  661
            GELFQKTK+A+ENSG  K++R EKRM+KE DKSAV+L+KK LKK M +ASS+SST+A G 
Sbjct  220  GELFQKTKIAEENSG-IKFEREEKRMEKEADKSAVNLMKKTLKKKMLNASSRSSTSAGGG  278

Query  660  TIDSAAADSKLHKIL  616
            T+DSA+A++KL K+ 
Sbjct  279  TLDSASAETKLSKVC  293



>ref|XP_010237715.1| PREDICTED: uncharacterized protein LOC100820935 [Brachypodium 
distachyon]
Length=393

 Score = 60.1 bits (144),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 58/187 (31%), Positives = 79/187 (42%), Gaps = 32/187 (17%)
 Frame = -2

Query  840  GELFQKTKLADEN----------SGGAKYDRGEKRMDKEHDKSAVHLVKKILKKGMPHAS  691
            GELF +T+ A+EN            G + D+ E +              K+         
Sbjct  222  GELFLRTRFAEENKVALVTVAEGEDGGEGDKAEGKGGGGGGGRKRMKKWKV--------K  273

Query  690  SKSSTAASGCTIDSAAADSKLHKILNMFHRKVHPESTTT-AEKLDKPSKNEIRNNLMYDG  514
             +    A G  +D     SK  KIL +FHRKV+PE T   A  L K  KN  R     D 
Sbjct  274  DEKGAGADGSRVDPKVTKSKFQKILQIFHRKVYPEGTAILARNLTK--KNRKRG--APDN  329

Query  513  AYNLGGAENVALMPKQRMSKESIRRLKSQSNMHQFTISDPD-----CNGNREC-WIKSDA  352
                 G +   + PK+   +  +  L   +N   F+ S PD      NG++   WIK+DA
Sbjct  330  GDGGPGTDEPVVPPKRTGPR--MPSLGCCANRASFSAS-PDHRGELLNGSKSGHWIKTDA  386

Query  351  DYLVLEL  331
            DYLVLEL
Sbjct  387  DYLVLEL  393



>ref|XP_006663458.1| PREDICTED: uncharacterized protein LOC102717475 [Oryza brachyantha]
Length=468

 Score = 59.7 bits (143),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 59/196 (30%), Positives = 77/196 (39%), Gaps = 35/196 (18%)
 Frame = -2

Query  840  GELFQKTKLADENSGGAKYDRGEK-----------RMDKEHDKSAVHLVKKILKKGMPHA  694
            GELF +T+ A+E       + GE            R +    K       K++KK     
Sbjct  282  GELFMRTRFAEEKVALVAVEEGEDGFGDGAAAGADREEGRAGKGDGGGGHKMMKKRRVKD  341

Query  693  SSKSSTAASGCTIDSAAADSKLHKILNMFHRKVHPESTTTAEKLDKPSKNEIRNNLMYDG  514
                    +  T+      SK  KIL +FHRKV+PE+T     L K S  +       D 
Sbjct  342  EKGGGGGGTPATV----TKSKFQKILQIFHRKVYPENTLLTRNLTKKSHRK-----RGDS  392

Query  513  AYNLGGA--------ENVALMPKQRMSKES-IRRLKSQSNMHQFTISDPDCNGNREC---  370
            + N GGA        E     P  R  K+  + R      +  F  S P CNG       
Sbjct  393  SDNGGGAAATGYPADEPALGSPVLRCRKDVHLMRGFGCCTIGAFGASSPSCNGGEMNGSR  452

Query  369  ---WIKSDADYLVLEL  331
               WIK+DADYLVLEL
Sbjct  453  SGHWIKTDADYLVLEL  468



>gb|EAZ18396.1| hypothetical protein OsJ_33928 [Oryza sativa Japonica Group]
Length=112

 Score = 55.8 bits (133),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 40/105 (38%), Positives = 50/105 (48%), Gaps = 6/105 (6%)
 Frame = -2

Query  630  LHKILNMFHRKVHPESTTTAEKLDKPSKNEIRNNLMYDGAYNLGGAENVALMPKQRMSKE  451
            L  IL +FHRKV+PE+T     L K S+N    +    GA   G  +     P  R  K+
Sbjct  9    LGAILQIFHRKVYPENTLLTRNLTKKSRNRGATD-NGGGAVATGDPDGPLASPVLRCRKD  67

Query  450  SIRRLKSQSNMHQFTISDP----DCNGNREC-WIKSDADYLVLEL  331
               R         F  S P    + NGN+   WIK+DADYLVLEL
Sbjct  68   HPMRGFGCCTNGAFGASSPGGNAEMNGNKSGHWIKTDADYLVLEL  112



>ref|XP_006399919.1| hypothetical protein EUTSA_v10013936mg [Eutrema salsugineum]
 gb|ESQ41372.1| hypothetical protein EUTSA_v10013936mg [Eutrema salsugineum]
Length=357

 Score = 58.9 bits (141),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 66/174 (38%), Positives = 88/174 (51%), Gaps = 31/174 (18%)
 Frame = -2

Query  840  GELFQKTKLAD---ENSGGAKYDRGEKRMDKEHDKSAVHLVKKILKKGMPHASSKSSTAA  670
            GELFQ T++ D   EN  G K     K+      KSA HLVKK+LKK  P     S   A
Sbjct  211  GELFQVTEMQDKHPENKCGEK-----KKQTSSTHKSAKHLVKKVLKKLHP----TSRIPA  261

Query  669  SGCTIDSAAADSKLHKILNMFHRKVHPESTTTAEKLDKPSKNEIRNNLMYDGAYNLGGAE  490
            +G T + A+   K HK+  +FHRKVHPE        D   ++EI N+ M D  ++   A 
Sbjct  262  NGKT-EVASTKKKFHKMAQVFHRKVHPE--------DSIMESEIYNS-MADPKHSR--AS  309

Query  489  NVALMP-KQRMSKESIRRLKSQSNMHQFTISDPDCNGNRECWIKSDADYLVLEL  331
            ++ L+P K     E+ +R        Q+ +      GN E WIK+D DY VLEL
Sbjct  310  SIGLVPAKMNPCHETSKRWI------QYELKSSPSAGNGEHWIKTDEDYFVLEL  357



>ref|NP_001232845.1| uncharacterized protein LOC100384392 [Zea mays]
 gb|ACN36910.1| unknown [Zea mays]
Length=243

 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 53/181 (29%), Positives = 75/181 (41%), Gaps = 17/181 (9%)
 Frame = -2

Query  840  GELFQKTKLADENSGGAKYDRGEKRMD-----KEHDKSAVHLVKKILKKGMPHASSKSST  676
            GELF +T+ A+E       + GE   D     +  D+ A              A  +   
Sbjct  69   GELFMRTRFAEEKVALVAVEEGEDGGDIGAGGERDDRKAGKGGGGHKTTKKRSAKDEKVP  128

Query  675  AASGCTIDSAAADSKLHKILNMFHRKVHPESTTTAEKLDKPSKNEIRNNLMYDGAYNL--  502
               G    +    SK HKIL +FHRKV+PES   A  L K S+          GAY+   
Sbjct  129  RGDGAQASATVTKSKFHKILQIFHRKVYPESAALARNLTKKSRKR------GSGAYHKPE  182

Query  501  GGAENVALMPKQRMSKESIRRLKSQSNMHQFTI---SDPDCNGNREC-WIKSDADYLVLE  334
              A  +  + +QR         ++        I    D + NG++   WIK+DA+YLVLE
Sbjct  183  PAASKLRCLKEQRAPGFGCCASRASFGGAASPIDGDDDDELNGSKSGHWIKTDAEYLVLE  242

Query  333  L  331
            L
Sbjct  243  L  243



>ref|NP_001143888.1| uncharacterized protein LOC100276689 [Zea mays]
 gb|ACG36238.1| hypothetical protein [Zea mays]
Length=413

 Score = 57.8 bits (138),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 53/181 (29%), Positives = 75/181 (41%), Gaps = 17/181 (9%)
 Frame = -2

Query  840  GELFQKTKLADENSGGAKYDRGEKRMD-----KEHDKSAVHLVKKILKKGMPHASSKSST  676
            GELF +T+ A+E       + GE   D     +  D+ A              A  +   
Sbjct  239  GELFMRTRFAEEKVALVAVEEGEDGGDIGAGGERDDRKAGKGGGGHKTTKKRSAKDEKVP  298

Query  675  AASGCTIDSAAADSKLHKILNMFHRKVHPESTTTAEKLDKPSKNEIRNNLMYDGAYNL--  502
               G    +    SK HKIL +FHRKV+PES   A  L K S+          GAY+   
Sbjct  299  RGDGAQASATVTKSKFHKILQIFHRKVYPESVALARNLTKKSRKR------GSGAYHKPE  352

Query  501  GGAENVALMPKQRMSKESIRRLKSQSNMHQFTI---SDPDCNGNREC-WIKSDADYLVLE  334
              A  +  + +QR         ++        I    D + NG++   WIK+DA+YLVLE
Sbjct  353  PAASKLRCLKEQRAPGFGCCASRASFGGAASPIDGDDDDELNGSKSGHWIKTDAEYLVLE  412

Query  333  L  331
            L
Sbjct  413  L  413



>ref|NP_001132334.1| hypothetical protein [Zea mays]
 gb|ACF81139.1| unknown [Zea mays]
 gb|ACL54300.1| unknown [Zea mays]
 gb|AFW60749.1| hypothetical protein ZEAMMB73_681845 [Zea mays]
Length=413

 Score = 57.8 bits (138),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 53/181 (29%), Positives = 75/181 (41%), Gaps = 17/181 (9%)
 Frame = -2

Query  840  GELFQKTKLADENSGGAKYDRGEKRMD-----KEHDKSAVHLVKKILKKGMPHASSKSST  676
            GELF +T+ A+E       + GE   D     +  D+ A              A  +   
Sbjct  239  GELFMRTRFAEEKVALVAVEEGEDGGDIGAGGERDDRKAGKGGGGHKTTKKRSAKDEKVP  298

Query  675  AASGCTIDSAAADSKLHKILNMFHRKVHPESTTTAEKLDKPSKNEIRNNLMYDGAYN--L  502
               G    +    SK HKIL +FHRKV+PES   A  L K S+          GAY+   
Sbjct  299  RGDGAQASATVTKSKFHKILQIFHRKVYPESAALARNLTKKSRKR------GSGAYHKPE  352

Query  501  GGAENVALMPKQRMSKESIRRLKSQSNMHQFTI---SDPDCNGNREC-WIKSDADYLVLE  334
              A  +  + +QR         ++        I    D + NG++   WIK+DA+YLVLE
Sbjct  353  PAASKLRCLKEQRAPGFGCCASRASFGGAASPIDGDDDDELNGSKSGHWIKTDAEYLVLE  412

Query  333  L  331
            L
Sbjct  413  L  413



>gb|KHG01154.1| ethylene insensitive 3 -like protein [Gossypium arboreum]
Length=365

 Score = 57.4 bits (137),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 56/174 (32%), Positives = 85/174 (49%), Gaps = 24/174 (14%)
 Frame = -2

Query  837  ELFQKTKLADENSGGAKYDRGEKRMDKEHDKSAVHLVKKILKKGMPHASSKSSTAASGCT  658
            ELF +TK+A+E +       G++    +     V  + K + K    +S K  T      
Sbjct  211  ELFYRTKVAEEYNNNPMEKSGKEDTQTKQTTKPVKHLIKKILKKFHASSGKEET------  264

Query  657  IDSAAADSKLHKILNMFHRKVHPESTTTAEKLDKPSKNEIRNNLMY-DGAYNLGGAENVA  481
             +S +   KL K++ +FHRK+HPE+ + AE+  K       NN  Y D  Y   G +N+ 
Sbjct  265  -NSFSTKKKLQKVIKLFHRKIHPEN-SIAERESK------MNNAPYSDNDYT--GGDNMR  314

Query  480  LMPKQRMSKESI-RRLKSQSNMHQFTISDPDCNG---NRECWIKSDADYLVLEL  331
              P+   SK  +    K+ S + Q+ ++   C     N E WIK+DADYLVLEL
Sbjct  315  F-PQGSRSKAGLGNNKKTISKLPQYGLT--GCTAATENGEHWIKTDADYLVLEL  365



>emb|CDY58415.1| BnaC09g54600D [Brassica napus]
Length=357

 Score = 57.0 bits (136),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 56/165 (34%), Positives = 80/165 (48%), Gaps = 23/165 (14%)
 Frame = -2

Query  840  GELFQKTKLADENSGGAKYDRGEKRMDKEHDKSAVHLVKKILKKGMPHASSKSSTAASGC  661
            GELFQ T++ D++S     +  +K       KSA H VKK+LKK   H SS+S    SG 
Sbjct  182  GELFQATEVQDKHSENKYEEEKKKASSTH--KSAKHFVKKVLKK--LHLSSRSPD--SGK  235

Query  660  TIDSAAADSKLHKILNMFHRKVHPESTTTAEKLDKPSKNEIRNNLMYDGAYNLGGAENVA  481
            T + A+   K  KI  +FHRKV+PE +    K+   S  E +N+       N  G  +  
Sbjct  236  T-EVASTKKKFQKIAQVFHRKVYPEDSIMESKI-YSSMTEPKNS-----KANSTGLMSEK  288

Query  480  LMPKQRMSKESIRRLKSQSNMHQFTISDPDCNGNRECWIKSDADY  346
            + P  + SK  I          Q+ + +   +G  E WIK+D DY
Sbjct  289  VRPCHKTSKRWI----------QYELRNSHSSGKGEHWIKTDEDY  323



>gb|AEM59513.1| controlling leaf angle [Zea mays]
Length=414

 Score = 56.6 bits (135),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 55/182 (30%), Positives = 75/182 (41%), Gaps = 18/182 (10%)
 Frame = -2

Query  840  GELFQKTKLADENSGGAKYDRGEKRMD----KEHDKSAVHLVKKILKKGMPHASSKSSTA  673
            GELF +T+ A+E       + GE   D     E D            K     S+K    
Sbjct  239  GELFMRTRFAEEKVALVAVEEGEDGGDIGAGGERDDRKAGKGGGGGHKTTKKRSAKDEKV  298

Query  672  --ASGCTIDSAAADSKLHKILNMFHRKVHPESTTTAEKLDKPSKNEIRNNLMYDGAYN--  505
                G    +    SK HKIL +FHRKV+PES   A  L K S+          GAY+  
Sbjct  299  PRGDGAQASATVTKSKFHKILQIFHRKVYPESAALARNLTKKSRKR------GSGAYHKP  352

Query  504  LGGAENVALMPKQRMSKESIRRLKSQSNMHQFTI---SDPDCNGNREC-WIKSDADYLVL  337
               A  +  + +QR         ++        I    D + NG++   WIK+DA+YLVL
Sbjct  353  EPAASKLRCLKEQRAPGFGCCASRASFGGAASPIDGDDDDELNGSKSGHWIKTDAEYLVL  412

Query  336  EL  331
            EL
Sbjct  413  EL  414



>ref|XP_010550213.1| PREDICTED: uncharacterized protein LOC104821129 isoform X1 [Tarenaya 
hassleriana]
Length=357

 Score = 55.5 bits (132),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 57/165 (35%), Positives = 80/165 (48%), Gaps = 26/165 (16%)
 Frame = -2

Query  840  GELFQKTKLADENSGGAKYDRGEKRMDKEHDKSAVHLVKKILKKGMPHASSKSSTAASGC  661
            GELFQ+T +  ENS   K +    + +  H +SA + +KK+LK    H+SS+ ST   G 
Sbjct  206  GELFQRTNI-QENSE-FKCENKLMQTNPAH-RSAKNPMKKLLK--TIHSSSRFST---GG  257

Query  660  TIDSAAADSKLHKILNMFHRKVHPESTTTAEKLDKPSKNEIRNNLMYDGAYNL-GGAENV  484
              DS +   K  KI+ +FHRKVHPE++ T  +++   K        Y G  +  G + NV
Sbjct  258  KTDSPSTKKKFQKIIQIFHRKVHPENSITEREINGKMKTAESTEPDYLGLISEKGNSSNV  317

Query  483  ALMPKQRMSKESIRRLKSQSNMHQFTISDPDCNGNRECWIKSDAD  349
                   MSK  I          Q  I   D   N E WIK+DA+
Sbjct  318  -------MSKRQI----------QCEIKGSDSARNGEHWIKTDAE  345



>ref|XP_010543095.1| PREDICTED: uncharacterized protein LOC104816121 [Tarenaya hassleriana]
Length=278

 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 38/73 (52%), Positives = 56/73 (77%), Gaps = 2/73 (3%)
 Frame = -2

Query  837  ELFQKTKLADENSGGAKYDRGEKRMDKEHDKSAVHLVKKILKKGMPHASSKSSTAASGCT  658
            ELFQKTK+ DE SGG + +R EKR +K+  KSAV+++KK+LKK +P   S+SSTAA    
Sbjct  191  ELFQKTKITDEYSGG-RCERDEKRTEKDAHKSAVNMMKKMLKKKVPQV-SRSSTAAYARE  248

Query  657  IDSAAADSKLHKI  619
             +S++A++KL+K+
Sbjct  249  ANSSSAETKLNKV  261



>ref|XP_010543090.1| PREDICTED: uncharacterized protein LOC104816116 [Tarenaya hassleriana]
 ref|XP_010523254.1| PREDICTED: uncharacterized protein LOC104801637 [Tarenaya hassleriana]
Length=309

 Score = 54.3 bits (129),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 38/73 (52%), Positives = 56/73 (77%), Gaps = 2/73 (3%)
 Frame = -2

Query  837  ELFQKTKLADENSGGAKYDRGEKRMDKEHDKSAVHLVKKILKKGMPHASSKSSTAASGCT  658
            ELFQKTK+ DE SGG + +R EKR +K+  KSAV+++KK+LKK +P   S+SSTAA    
Sbjct  222  ELFQKTKITDEYSGG-RCERDEKRTEKDAHKSAVNMMKKMLKKKVPQV-SRSSTAAYARE  279

Query  657  IDSAAADSKLHKI  619
             +S++A++KL+K+
Sbjct  280  ANSSSAETKLNKV  292



>ref|XP_006338807.1| PREDICTED: uncharacterized protein LOC102585754 [Solanum tuberosum]
Length=258

 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 43/141 (30%), Positives = 61/141 (43%), Gaps = 47/141 (33%)
 Frame = -2

Query  741  AVHLVKKILKKGMPHASSKSSTAASGCTIDSAAADSKLHKILNMFHRKVHPESTTTAEKL  562
            AVH +KK+L+  +P + S + TA       S ++  KL ++L MF+RKVHP +       
Sbjct  159  AVHFMKKVLQNLLPKSKSSNVTA-------SVSSRKKLPQVLKMFYRKVHPVN-------  204

Query  561  DKPSKNEIRNNLMYD----GAYNLGGAENVALMPKQRMSKESIRRLKSQSNMHQFTISDP  394
                     NN++ D       N+  +   A +      KE I                 
Sbjct  205  --------ENNILEDNHEISNMNINVSCKTANLTNSSPKKEVI-----------------  239

Query  393  DCNGNRECWIKSDADYLVLEL  331
                NRE WIK+D DYLVLEL
Sbjct  240  ----NREHWIKTDRDYLVLEL  256



>gb|EAY80969.1| hypothetical protein OsI_36150 [Oryza sativa Indica Group]
Length=439

 Score = 51.2 bits (121),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 38/102 (37%), Positives = 45/102 (44%), Gaps = 14/102 (14%)
 Frame = -2

Query  621  ILNMFHRKVHPESTTTAEKLDKPSKNEIRNNLMYDGAYNLGGAENVALMPKQRMSKESIR  442
            IL +FHRKV+PE+T     L K S+N         GA   G  +     P  R  K+   
Sbjct  347  ILQIFHRKVYPENTLLTRNLTKKSRNR--------GAAT-GDPDEPLASPVLRCRKDHPM  397

Query  441  RLKSQSNMHQFTISDPDCNGNREC-----WIKSDADYLVLEL  331
            R         F  S P  NG         WIK+DADYLVLEL
Sbjct  398  RGFGCCTNGAFGASSPGGNGEMNGSKSGHWIKTDADYLVLEL  439



>ref|XP_002449512.1| hypothetical protein SORBIDRAFT_05g017110 [Sorghum bicolor]
 gb|EES08500.1| hypothetical protein SORBIDRAFT_05g017110 [Sorghum bicolor]
Length=419

 Score = 50.8 bits (120),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 43/130 (33%), Positives = 57/130 (44%), Gaps = 33/130 (25%)
 Frame = -2

Query  666  GCTIDSAAADSKLHKILNMFHRKVHPESTTTAEKLDKPSKNEIRNNLMYDGAYNLGGAEN  487
            G    +A   SK  KIL +FHRKV+PES   A  L K S+               GGA+ 
Sbjct  305  GTPASAAVTKSKFQKILQIFHRKVYPESAALARNLTKKSRKR-----------GSGGADE  353

Query  486  VALMPKQRMSKESIRRLKSQ--------SNMHQF-TISDP--------DCNGNREC-WIK  361
                P +  S   +R  K Q        +N   F   + P        + NG++   WIK
Sbjct  354  ----PAEPASSNKLRCRKEQRAPGFGCCANRASFGGAASPIHDDDDDDELNGSKSGHWIK  409

Query  360  SDADYLVLEL  331
            +DA+YLVLEL
Sbjct  410  TDAEYLVLEL  419



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1812563152356