BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig300

Length=1057
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009794650.1|  PREDICTED: floral homeotic protein PMADS 1         377   3e-127   Nicotiana sylvestris
ref|XP_009619475.1|  PREDICTED: floral homeotic protein PMADS 1         375   1e-126   Nicotiana tomentosiformis
sp|Q07472.1|MADS1_PETHY  RecName: Full=Floral homeotic protein PM...    367   1e-123   Petunia x hybrida [garden petunia]
gb|ADI58370.1|  PAP3                                                    364   3e-122   Capsicum annuum
gb|ABG20626.1|  DEF                                                     360   4e-121   Solandra maxima
emb|CAJ53871.1|  floral homeotic protein DEFICIENS                      358   5e-120   Solanum lycopersicum
emb|CAA47846.1|  deficiens analogue                                     357   1e-119   Solanum tuberosum [potatoes]
ref|NP_001234077.1|  TAP3                                               357   2e-119   
sp|P23706.1|DEFA_ANTMA  RecName: Full=Floral homeotic protein DEF...    356   3e-119   Antirrhinum majus [garden snapdragon]
gb|ABG20624.1|  DEF                                                     354   1e-118   Mandragora autumnalis
gb|AGN54423.1|  PFDEF                                                   354   3e-118   Physalis pubescens [capuli]
ref|NP_001275326.1|  floral homeotic protein PMADS 1-like               353   4e-118   Solanum tuberosum [potatoes]
gb|ABG20629.1|  DEF                                                     353   4e-118   Cestrum elegans
emb|CAJ44129.1|  deficiens protein                                      353   6e-118   Misopates orontium
dbj|BAI68389.1|  DEFICIENS protein                                      352   7e-118   Antirrhinum majus [garden snapdragon]
gb|ABG20625.1|  DEF                                                     351   3e-117   Juanulloa mexicana
gb|AEM60197.1|  MADS box transcription factor                           347   8e-116   Iochroma cyaneum
ref|XP_011074633.1|  PREDICTED: floral homeotic protein DEFICIENS       345   8e-115   
gb|AAS45984.1|  deficiens                                               344   2e-114   Erythranthe guttata [common monkey flower]
gb|AAS45992.1|  deficiens                                               341   4e-113   Erythranthe guttata [common monkey flower]
gb|AEM60198.1|  MADS box transcription factor                           339   1e-112   Solanum pennellii
gb|AEM60199.1|  MADS box transcription factor                           338   2e-112   Solanum nigrum
gb|AEM60180.1|  MADS box transcription factor                           337   4e-112   Sesamum indicum [beniseed]
gb|ABG20622.1|  DEF                                                     337   7e-112   Brunfelsia uniflora
gb|AAS45985.1|  deficiens                                               337   2e-111   Erythranthe lewisii
gb|ABG20627.1|  DEF1                                                    336   2e-111   Scopolia carniolica
gb|ABG20628.1|  DEF2                                                    335   3e-111   Scopolia carniolica
gb|AAS45990.1|  deficiens                                               335   3e-111   Paulownia tomentosa
gb|AEM60183.1|  MADS box transcription factor                           335   3e-111   Halleria lucida
gb|AEM60188.1|  MADS box transcription factor                           334   5e-111   Eustoma sp. VFI-2011
gb|ADU56837.1|  MADS-box protein DEF subfamily                          335   8e-111   Coffea arabica [arabica coffee]
gb|AAS45979.1|  deficiens                                               334   1e-110   Syringa vulgaris
gb|AGA61764.1|  apetala 3                                               334   1e-110   Cornus florida [flowering dogwood]
gb|AAS45969.1|  deficiens                                               333   2e-110   Diplacus kelloggii [Kellog's monkeyflower]
gb|ADU15474.1|  AP3                                                     332   1e-109   Actinidia eriantha
gb|AAS45982.1|  deficiens                                               331   1e-109   Pedicularis groenlandica [elephant's head]
gb|AEM60182.1|  MADS box transcription factor                           330   3e-109   Antirrhinum sp. VFI-2011
gb|AAS45972.1|  deficiens                                               330   3e-109   Leucocarpus perfoliatus
gb|AAS45967.1|  deficiens                                               331   4e-109   Mimulus ringens
gb|AAS45981.1|  deficiens                                               330   4e-109   Verbena officinalis [common verbena]
gb|AEM60172.1|  MADS box transcription factor                           329   8e-109   Betonica officinalis [betony]
gb|AEM60174.1|  MADS box transcription factor                           329   9e-109   Sesamum indicum [beniseed]
gb|AEM60195.1|  MADS box transcription factor                           328   2e-108   Ligustrum vulgare [prim]
ref|XP_011083640.1|  PREDICTED: floral homeotic protein DEFICIENS...    328   2e-108   Sesamum indicum [beniseed]
gb|AEM60186.1|  MADS box transcription factor                           327   3e-108   Streptocarpus x hybridus [Cape primrose]
gb|AEM60193.1|  MADS box transcription factor                           327   3e-108   Jasminum humile [Italian yellow jasmine]
gb|AEM60190.1|  MADS box transcription factor                           327   4e-108   Pentas lanceolata
gb|AAS45973.1|  deficiens                                               327   5e-108   Diplacus kelloggii [Kellog's monkeyflower]
gb|AEM60192.1|  MADS box transcription factor                           327   6e-108   Jasminum mesnyi [Japanese jasmine]
gb|AGA61754.1|  apetala 3                                               327   7e-108   Cornus kousa [kousa dogwood]
gb|AAS45986.1|  deficiens                                               326   2e-107   Verbena officinalis [common verbena]
dbj|BAG24492.1|  DEFICIENS-like MADS-box protein                        326   3e-107   Torenia fournieri [bluewings]
gb|AEM60169.1|  MADS box transcription factor                           324   6e-107   Buddleja davidii [butterfly bush]
gb|AAS45971.1|  deficiens                                               325   6e-107   Mimulus ringens
gb|AEM60167.1|  MADS box transcription factor                           324   8e-107   Lantana camara
gb|AEM60200.1|  MADS box transcription factor                           324   1e-106   Solanum pyracanthum
gb|AEM60168.1|  MADS box transcription factor                           323   2e-106   Lantana camara
gb|AEM60187.1|  MADS box transcription factor                           323   2e-106   Gardenia jasminoides
gb|ACK43086.1|  deficiens 2 protein                                     323   2e-106   Eustoma exaltatum subsp. russellianum [bluebells]
gb|AEM60170.1|  MADS box transcription factor                           322   3e-106   Clerodendrum infortunatum
gb|AAS45968.1|  deficiens                                               323   4e-106   Leucocarpus perfoliatus
gb|AAS45989.1|  deficiens                                               322   4e-106   Pedicularis groenlandica [elephant's head]
gb|AEM60166.1|  MADS box transcription factor                           322   6e-106   Justicia brandegeeana
gb|AAS45988.1|  deficiens                                               322   1e-105   Salvia coccinea [blood sage]
gb|AAS45966.1|  deficiens                                               322   1e-105   Mazus reptans
gb|AJN00603.1|  MADS domain transcription factor AP3-like protein       321   2e-105   Camellia oleifera [abura-tsubaki]
ref|XP_007017681.1|  Floral homeotic protein DEFICIENS isoform 1        321   2e-105   
gb|AAS45970.1|  deficiens                                               321   2e-105   Mazus reptans
gb|ADL57412.1|  MADS domain transcription factor                        321   2e-105   Camellia japonica [common camellia]
gb|AEM60194.1|  MADS box transcription factor                           320   2e-105   Polypremum procumbens
gb|AEM60176.1|  MADS box transcription factor                           320   3e-105   Lantana camara
gb|ABG20623.1|  DEF                                                     320   3e-105   Solanum pseudolulo
gb|ABQ59274.4|  deficiens 1 protein                                     320   4e-105   Eustoma exaltatum subsp. russellianum [bluebells]
gb|AEM60191.1|  MADS box transcription factor                           319   6e-105   Forsythia x intermedia [cultivated forsythia]
gb|AAS45980.1|  deficiens                                               318   1e-104   Chelone glabra [snakehead]
gb|AEM60185.1|  MADS box transcription factor                           318   1e-104   Digitalis purpurea
gb|AEM60178.1|  MADS box transcription factor                           318   2e-104   Utricularia sp. VFI-2011
gb|AAS45983.1|  deficiens                                               318   2e-104   Paulownia tomentosa
gb|AEJ76847.1|  MADS24                                                  318   2e-104   Gossypium hirsutum [American cotton]
gb|KHG05937.1|  Floral homeotic DEFICIENS                               317   7e-104   Gossypium arboreum [tree cotton]
gb|AEX10627.1|  DEFICIENS                                               314   5e-103   Rhodochiton atrosanguineum
gb|AEM60161.1|  MADS box transcription factor                           311   1e-101   Salvia greggii [autumn sage]
gb|AAC42583.1|  APETALA3 homolog LeAP3                                  310   2e-101   Solanum lycopersicum
gb|AEM60177.1|  MADS box transcription factor                           310   4e-101   Torenia fournieri [bluewings]
gb|AEM60181.1|  MADS box transcription factor                           309   4e-101   Torenia fournieri [bluewings]
gb|AEM60163.1|  MADS box transcription factor                           309   8e-101   Salvia greggii [autumn sage]
ref|NP_001267960.1|  flowering-related B-class MADS-box protein A...    308   1e-100   Vitis vinifera
gb|ABN46893.1|  AP3-like MADS-box protein                               308   1e-100   Vitis labrusca x Vitis vinifera [Labruscan grape]
gb|AEM60189.1|  MADS box transcription factor                           307   3e-100   Allamanda cathartica [copa de oro]
gb|AEM60162.1|  MADS box transcription factor                           307   5e-100   Salvia coccinea [blood sage]
gb|ACY08914.1|  MADS-domain transcription factor                        306   6e-100   Halesia diptera
gb|AEG19541.1|  apetala3-like protein                                   306   6e-100   Vitis labrusca x Vitis vinifera [Labruscan grape]
gb|ACY08901.1|  MADS-domain transcription factor                        306   8e-100   Napoleonaea vogelii
ref|XP_006581063.1|  PREDICTED: MADS-box protein GmNMH7 isoform X1      304   6e-99    Glycine max [soybeans]
ref|NP_001236857.1|  MADS-box protein GmNMH7                            304   1e-98    Glycine max [soybeans]
gb|ACY08903.1|  MADS-domain transcription factor                        303   2e-98    Diospyros digyna [black persimmon]
gb|AAS45991.1|  deficiens                                               303   2e-98    Erythranthe lewisii
gb|AAS45987.1|  deficiens                                               303   2e-98    Salvia coccinea [blood sage]
gb|ACU13442.1|  unknown                                                 302   3e-98    Glycine max [soybeans]
ref|XP_003603721.1|  Apetala3-like protein                              302   5e-98    Medicago truncatula
gb|AAC42584.1|  APETALA3 homolog SvAP3                                  300   9e-98    Syringa vulgaris
gb|AEM60173.1|  MADS box transcription factor                           300   1e-97    Buddleja davidii [butterfly bush]
gb|AAX13301.1|  MADS box protein AP3                                    297   3e-96    Lotus japonicus
gb|AAC15419.1|  MADS-box protein NMH 7                                  296   6e-96    Medicago sativa [alfalfa]
gb|KHN45898.1|  Floral homeotic protein DEFICIENS                       295   4e-95    Glycine soja [wild soybean]
ref|XP_008466510.1|  PREDICTED: floral homeotic protein DEFICIENS       295   7e-95    Cucumis melo [Oriental melon]
gb|AAB48660.1|  MADS-box protein                                        294   1e-94    Medicago sativa [alfalfa]
gb|AEA76416.1|  putative DEF1                                           290   3e-94    Catharanthus roseus [chatas]
dbj|BAK20024.1|  PgMADS protein9                                        292   7e-94    Panax ginseng [Asiatic ginseng]
ref|XP_012071964.1|  PREDICTED: floral homeotic protein DEFICIENS...    291   8e-94    Jatropha curcas
gb|AEM60196.1|  MADS box transcription factor                           288   3e-93    Osmanthus fragrans [sweet osmanthus]
gb|AEM60179.1|  MADS box transcription factor                           288   4e-93    Utricularia sp. VFI-2011
gb|AAX37273.1|  MADS box protein                                        290   5e-93    Cucumis sativus [cucumbers]
gb|ABD78317.1|  Def-like protein                                        288   2e-92    Primula vulgaris
gb|AEM60165.1|  MADS box transcription factor                           286   1e-91    Nepeta grandiflora
ref|XP_004500961.1|  PREDICTED: floral homeotic protein PMADS 1-like    285   2e-91    Cicer arietinum [garbanzo]
gb|AEM60175.1|  MADS box transcription factor                           284   4e-91    Justicia brandegeeana
gb|AEM60171.1|  MADS box transcription factor                           283   8e-91    Clerodendrum infortunatum
gb|AEW43604.1|  MADS-box transcription factor NMH7                      284   8e-91    Pisum sativum [garden pea]
gb|AEM60164.1|  MADS box transcription factor                           283   9e-91    Salvia coccinea [blood sage]
gb|ACY08917.1|  MADS-domain transcription factor                        282   1e-90    Galax urceolata
ref|XP_011652440.1|  PREDICTED: floral homeotic protein DEFICIENS       285   1e-90    Cucumis sativus [cucumbers]
gb|ABF56131.1|  APETALA3-like protein                                   281   4e-90    Ilex aquifolium [English holly]
gb|ACY08913.1|  MADS-domain transcription factor                        281   4e-90    Sarracenia drummondii
gb|AEM60184.1|  MADS box transcription factor                           280   6e-90    Plantago lanceolata [ribgrass]
gb|ACY08899.1|  MADS-domain transcription factor                        280   7e-90    Alangium platanifolium
dbj|BAK09615.1|  MADS-box transcription factor                          280   2e-89    Cyclamen persicum
gb|ADO16135.1|  MADS                                                    276   2e-89    Ipomoea aquatica [Chinese water-spinach]
gb|ADO16143.1|  MADS                                                    275   8e-89    Ipomoea ochracea
gb|ACY08910.1|  MADS-domain transcription factor                        278   8e-89    Clethra tomentosa
gb|ADO16150.1|  MADS                                                    274   2e-88    Ipomoea quamoclit [bejuco de cipres]
gb|ACY08915.1|  MADS-domain transcription factor                        275   4e-88    Styrax japonicus [Japanese snowbell]
ref|NP_001267937.1|  flowering-related B-class MADS-box protein         276   5e-88    Vitis vinifera
gb|ACV53813.1|  MADS-box protein                                        276   5e-88    Gerbera hybrid cultivar
gb|ABE11601.1|  MADS-box transcription factor AP3                       276   7e-88    Trochodendron aralioides
gb|ADO16147.1|  MADS                                                    273   7e-88    Ipomoea plebeia [campainha]
emb|CAA08803.1|  MADS-box protein, GDEF2                                275   2e-87    Gerbera hybrid cultivar
gb|ADO16133.1|  MADS                                                    271   2e-87    Ipomoea alba [moonflower]
gb|ADO16136.1|  MADS                                                    271   2e-87    Ipomoea argillicola
gb|ABR18734.1|  MADS-box transcription factor HAM2                      275   3e-87    Helianthus annuus
gb|ADO16137.1|  MADS                                                    271   3e-87    Ipomoea cordatotriloba
gb|ADO16139.1|  MADS                                                    271   3e-87    Ipomoea eriocarpa
gb|AAD53326.1|AF180365_1  DEFICIENS homolog DEF2                        274   5e-87    Hieracium piloselloides
ref|XP_012071963.1|  PREDICTED: floral homeotic protein DEFICIENS...    275   6e-87    Jatropha curcas
gb|ABR18735.1|  MADS-box transcription factor HAM63                     273   7e-87    Helianthus annuus
gb|ADO16151.1|  MADS                                                    270   7e-87    Ipomoea saintronanensis
ref|XP_010061014.1|  PREDICTED: floral homeotic protein DEFICIENS       273   1e-86    Eucalyptus grandis [rose gum]
gb|ABR68543.1|  APETALA3-like                                           272   1e-86    Dillenia indica
gb|ADO16148.1|  MADS                                                    269   1e-86    Ipomoea plebeia [campainha]
gb|AAD53325.1|AF180364_1  DEFICIENS homolog DEF1                        272   1e-86    Hieracium piloselloides
gb|ADO16134.1|  MADS                                                    269   2e-86    Ipomoea amnicola
gb|ADU15473.1|  AP3                                                     272   2e-86    Actinidia chinensis
gb|ADO16145.1|  MADS                                                    268   2e-86    Ipomoea pes-tigridis
ref|XP_006425563.1|  hypothetical protein CICLE_v10026433mg             271   3e-86    Citrus clementina [clementine]
gb|ADO16153.1|  MADS                                                    268   3e-86    Ipomoea wrightii
gb|ACY08912.1|  MADS-domain transcription factor                        270   4e-86    Stewartia pseudocamellia [Japanese stewartia]
gb|AIC33047.1|  flower development transporter AP3                      271   6e-86    Chrysanthemum lavandulifolium
gb|KDO71079.1|  hypothetical protein CISIN_1g027470mg                   271   6e-86    Citrus sinensis [apfelsine]
gb|ACY08909.1|  MADS-domain transcription factor                        269   7e-86    Synsepalum dulcificum [miracle fruit]
ref|XP_011028945.1|  PREDICTED: floral homeotic protein DEFICIENS...    270   7e-86    Populus euphratica
gb|ADO16152.1|  MADS                                                    267   7e-86    Ipomoea umbraticola
gb|AAO22988.1|  MADS-box transcription factor CDM19                     271   9e-86    Chrysanthemum x morifolium [florist's chrysanthemum]
gb|ADO16140.1|  MADS                                                    267   1e-85    Ipomoea lobata [cresta de gallo]
gb|AGH39936.1|  MADS domain protein                                     270   2e-85    Actaea vaginata
gb|ADO16142.1|  MADS                                                    266   2e-85    Ipomoea obscura
gb|ADO16144.1|  MADS                                                    266   2e-85    Ipomoea ochracea
gb|AAO22985.1|  MADS-box transcription factor CDM115                    270   3e-85    Chrysanthemum x morifolium [florist's chrysanthemum]
ref|XP_006386194.1|  MADS-box protein GmNMH7                            267   5e-85    Populus trichocarpa [western balsam poplar]
gb|ACY08902.1|  MADS-domain transcription factor                        267   1e-84    Phlox paniculata
gb|AAF73931.1|AF230702_1  MADS box transcription factor AP3             267   1e-84    Hydrangea macrophylla
gb|AHH28294.1|  MADS-box transcription factor                           267   1e-84    Clutia sp. DAV B80.252/F1980.8371
ref|XP_006435093.1|  hypothetical protein CICLE_v10002410mg             268   1e-84    
gb|AGH39930.1|  truncated MADS domain protein                           267   1e-84    Leptopyrum fumarioides
ref|XP_008221326.1|  PREDICTED: LOW QUALITY PROTEIN: floral homeo...    267   2e-84    
gb|ABF67489.1|  MADS-domain protein                                     268   3e-84    Impatiens hawkeri
gb|AHY19023.1|  AP3 MADS box protein                                    267   3e-84    Ribes diacanthum
gb|KDO84726.1|  hypothetical protein CISIN_1g040046mg                   266   4e-84    Citrus sinensis [apfelsine]
gb|AHH28320.1|  MADS-box transcription factor                           265   5e-84    Garcia nutans
gb|AIU94279.1|  APETALA3-like protein transcript variant 1              265   8e-84    Prunus pseudocerasus [Chinese sour cherry]
gb|ABF67492.1|  MADS-domain transcription factor                        265   1e-83    Marcgravia umbellata
ref|XP_006473587.1|  PREDICTED: floral homeotic protein DEFICIENS...    265   1e-83    Citrus sinensis [apfelsine]
ref|XP_006340689.1|  PREDICTED: floral homeotic protein DEFICIENS...    264   2e-83    Solanum tuberosum [potatoes]
gb|ACY08898.1|  MADS-domain transcription factor                        264   3e-83    Jacquinia aurantiaca
ref|XP_012078388.1|  PREDICTED: floral homeotic protein DEFICIENS...    264   3e-83    Jatropha curcas
dbj|BAN13567.1|  apetala3/pistillata-like protein                       263   6e-83    Chrysanthemum seticuspe f. boreale
emb|CDP01943.1|  unnamed protein product                                262   1e-82    Coffea canephora [robusta coffee]
ref|XP_006403587.1|  hypothetical protein EUTSA_v10010683mg             262   2e-82    Eutrema salsugineum [saltwater cress]
gb|AHH28321.1|  MADS-box transcription factor                           261   2e-82    Garcia nutans
ref|XP_009116122.1|  PREDICTED: floral homeotic protein APETALA 3       262   2e-82    Brassica rapa
gb|ABD24434.1|  APETALA3-3                                              262   2e-82    Brassica napus [oilseed rape]
gb|AGS42079.2|  AP3a                                                    262   2e-82    Brassica oleracea var. viridis [collards]
gb|ACY08911.1|  MADS-domain transcription factor                        260   3e-82    Camellia japonica [common camellia]
gb|AGH39927.1|  MADS domain protein                                     261   4e-82    Isopyrum manshuricum
gb|ADU56836.1|  MADS-box protein DEF subfamily                          261   5e-82    Coffea arabica [arabica coffee]
gb|AGA61783.1|  apetala 3                                               260   5e-82    Cornus officinalis [Japanese cornel]
gb|ABP01802.1|  MADS transcription factor AP3-3                         260   7e-82    Aquilegia vulgaris
gb|ADC79696.1|  APETALA3-like protein                                   260   7e-82    Euptelea pleiosperma
gb|ACY08907.1|  MADS-domain transcription factor                        260   7e-82    Primula denticulata
ref|XP_010271509.1|  PREDICTED: floral homeotic protein DEFICIENS...    259   2e-81    Nelumbo nucifera [Indian lotus]
ref|XP_010504236.1|  PREDICTED: floral homeotic protein APETALA 3...    259   2e-81    Camelina sativa [gold-of-pleasure]
gb|AGH39924.1|  MADS domain protein                                     259   2e-81    Enemion raddeanum
ref|XP_011028630.1|  PREDICTED: floral homeotic protein DEFICIENS...    259   4e-81    Populus euphratica
ref|XP_009605879.1|  PREDICTED: floral homeotic protein DEFICIENS...    258   5e-81    Nicotiana tomentosiformis
dbj|BAG68950.1|  APETALA3 like protein                                  258   5e-81    Hydrangea macrophylla
gb|AGH39926.1|  MADS domain protein                                     258   5e-81    Isopyrum manshuricum
gb|AAM64919.1|  floral homeotic protein APETALA3 (AP3)                  258   5e-81    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002533305.1|  Floral homeotic protein DEFICIENS, putative        258   6e-81    Ricinus communis
ref|XP_004232453.1|  PREDICTED: floral homeotic protein DEFICIENS...    258   8e-81    
ref|XP_008241774.1|  PREDICTED: floral homeotic protein DEFICIENS...    258   9e-81    Prunus mume [ume]
ref|XP_002877970.1|  APETALA3                                           258   9e-81    
gb|AAD51901.1|  floral homeotic protein AP3                             258   1e-80    Arabidopsis thaliana [mouse-ear cress]
gb|EPS57782.1|  hypothetical protein M569_17035                         255   1e-80    Genlisea aurea
ref|XP_010263856.1|  PREDICTED: floral homeotic protein DEFICIENS...    258   1e-80    Nelumbo nucifera [Indian lotus]
ref|NP_191002.1|  Floral homeotic protein APETALA 3                     257   1e-80    Arabidopsis thaliana [mouse-ear cress]
gb|AAD51895.1|  floral homeotic protein AP3                             257   2e-80    Arabidopsis thaliana [mouse-ear cress]
dbj|BAC79180.1|  MADS-box protein                                       257   2e-80    Rosa rugosa [Japanese rose]
ref|XP_006292594.1|  hypothetical protein CARUB_v10018833mg             257   2e-80    Capsella rubella
ref|XP_010515958.1|  PREDICTED: floral homeotic protein APETALA 3       256   3e-80    Camelina sativa [gold-of-pleasure]
gb|AAD51887.1|  floral homeotic protein AP3                             256   3e-80    Arabidopsis thaliana [mouse-ear cress]
gb|KFK34668.1|  hypothetical protein AALP_AA5G175900                    256   3e-80    Arabis alpina [alpine rockcress]
gb|AGS42080.1|  AP3.b                                                   256   3e-80    Brassica oleracea var. viridis [collards]
ref|XP_010427128.1|  PREDICTED: floral homeotic protein APETALA 3...    256   4e-80    Camelina sativa [gold-of-pleasure]
gb|ADD14338.1|  APETALA3                                                256   4e-80    Spinacia oleracea
gb|AAD51897.1|  floral homeotic protein AP3                             256   4e-80    Arabidopsis thaliana [mouse-ear cress]
dbj|BAA04665.1|  APETALA3                                               256   5e-80    Arabidopsis thaliana [mouse-ear cress]
gb|AGH39931.1|  MADS domain protein                                     256   5e-80    Nigella damascena [jack-in-the-green]
gb|AAD51902.1|  floral homeotic protein AP3                             256   5e-80    Arabidopsis thaliana [mouse-ear cress]
gb|AAD51899.1|  floral homeotic protein AP3                             256   6e-80    Arabidopsis thaliana [mouse-ear cress]
gb|ABE11655.1|  DEFICIENS                                               253   7e-80    Nicotiana benthamiana
ref|XP_007046776.1|  Floral homeotic protein DEFICIENS, putative ...    255   7e-80    Theobroma cacao [chocolate]
gb|AAF28894.1|AF124814_1  APETALA3                                      255   8e-80    Brassica napus [oilseed rape]
gb|ABF67488.1|  MADS-domain protein                                     254   8e-80    Impatiens hawkeri
ref|XP_009798453.1|  PREDICTED: floral homeotic protein DEFICIENS...    255   9e-80    Nicotiana sylvestris
gb|ABF56128.1|  APETALA3-like protein                                   254   1e-79    Corylopsis pauciflora [buttercup winter-hazel]
gb|AGH39923.1|  MADS domain protein                                     255   1e-79    Enemion raddeanum
gb|ABQ51322.1|  B-class MADS-box protein TM6-2                          255   1e-79    Carica papaya [mamon]
gb|AAD51896.1|  floral homeotic protein AP3                             255   1e-79    Arabidopsis thaliana [mouse-ear cress]
gb|AAD51890.1|  floral homeotic protein AP3                             254   2e-79    Arabidopsis thaliana [mouse-ear cress]
ref|XP_008241773.1|  PREDICTED: floral homeotic protein DEFICIENS...    255   2e-79    Prunus mume [ume]
gb|AAP93899.1|  APETALA3                                                254   2e-79    Brassica napus [oilseed rape]
emb|CAC81070.1|  MADS box transcription factor                          254   3e-79    Daucus carota subsp. sativus
gb|AAD51898.1|  floral homeotic protein AP3                             254   3e-79    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009139246.1|  PREDICTED: floral homeotic protein APETALA 3...    253   4e-79    Brassica rapa
gb|AAD51894.1|  floral homeotic protein AP3                             253   5e-79    Arabidopsis thaliana [mouse-ear cress]
gb|AAY63866.1|  APETALA3                                                253   6e-79    Brassica juncea [brown mustard]
gb|KGN60009.1|  hypothetical protein Csa_3G865440                       252   7e-79    Cucumis sativus [cucumbers]
ref|XP_010672335.1|  PREDICTED: floral homeotic protein DEFICIENS...    253   9e-79    Beta vulgaris subsp. vulgaris [field beet]
gb|AAT46097.1|  APETALA3-like protein                                   252   1e-78    Akebia trifoliata
gb|AAF73933.1|AF230704_1  MADS box transcription factor TM6             252   1e-78    Petunia x hybrida [garden petunia]
gb|KJB17703.1|  hypothetical protein B456_003G011500                    252   1e-78    Gossypium raimondii
gb|AAP93898.1|  APETALA3-2                                              252   2e-78    Brassica napus [oilseed rape]
gb|ACY08885.1|  MADS-domain transcription factor                        251   3e-78    Nyssa sylvatica
ref|XP_007046775.1|  Floral homeotic protein DEFICIENS, putative ...    251   3e-78    Theobroma cacao [chocolate]
gb|AEK33828.1|  apetala 3                                               251   3e-78    Paeonia suffruticosa [moutan peony]
emb|CAA56657.1|  SLM3                                                   251   5e-78    Silene latifolia subsp. alba [white campion]
ref|XP_010530322.1|  PREDICTED: floral homeotic protein APETALA 3...    250   8e-78    Tarenaya hassleriana [spider flower]
gb|AAF25590.1|  apetala3                                                250   9e-78    Arabidopsis lyrata [lyrate rockcress]
gb|ABO93622.2|  APETALA3                                                250   9e-78    Platanus x hispanica [London plane tree]
gb|AGN54424.1|  PFTM6                                                   250   1e-77    Physalis pubescens [capuli]
gb|AEG25797.1|  APETALA3-like protein                                   249   1e-77    Cocculus trilobus
ref|XP_010240899.1|  PREDICTED: floral homeotic protein DEFICIENS...    249   1e-77    Nelumbo nucifera [Indian lotus]
gb|AAB17139.1|  homeotic protein bobap3                                 249   2e-77    Brassica oleracea var. botrytis [cauliflower]
ref|XP_007202502.1|  hypothetical protein PRUPE_ppa010727mg             249   2e-77    Prunus persica
gb|AGH39915.1|  MADS domain protein                                     249   2e-77    Beesia calthifolia
gb|ADX60056.1|  transcription factor TM6                                249   2e-77    Gossypium hirsutum [American cotton]
gb|AEM60229.1|  MADS box transcription factor                           248   2e-77    Solanum pennellii
ref|XP_010530324.1|  PREDICTED: floral homeotic protein APETALA 3...    249   3e-77    Tarenaya hassleriana [spider flower]
gb|AGW23353.1|  MADS box protein MADS51                                 248   4e-77    Gossypium hirsutum [American cotton]
gb|ADZ53034.1|  MADS9                                                   248   4e-77    Paeonia suffruticosa [moutan peony]
gb|AHH28279.1|  MADS-box transcription factor                           248   4e-77    Rafflesia tuan-mudae
emb|CAA43171.1|  TDR6                                                   248   4e-77    Solanum lycopersicum
gb|AEE73593.1|  APETALA3-like protein                                   248   4e-77    Prunus serrulata var. lannesiana [Japanese flowering cherry]
ref|XP_012078387.1|  PREDICTED: floral homeotic protein DEFICIENS...    248   5e-77    Jatropha curcas
gb|AAM33100.2|  TDR6 transcription factor                               248   5e-77    Solanum lycopersicum
gb|ABQ51321.1|  B-class MADS-box protein TM6-1                          248   5e-77    Carica papaya [mamon]
gb|AGW23361.1|  MADS box protein MADS59                                 248   5e-77    Gossypium hirsutum [American cotton]
gb|AIU94285.1|  APETALA3-like protein transcript variant 2              248   6e-77    Prunus pseudocerasus [Chinese sour cherry]
gb|ACY08893.1|  MADS-domain transcription factor                        247   8e-77    Styrax japonicus [Japanese snowbell]
ref|XP_007046774.1|  K-box region and MADS-box transcription fact...    248   1e-76    
gb|KJB48361.1|  hypothetical protein B456_008G064900                    247   1e-76    
gb|AFV74879.1|  TM6-like protein                                        246   1e-76    
gb|KHG11328.1|  Floral homeotic PMADS 1                                 247   1e-76    
gb|ACY08916.1|  MADS-domain transcription factor                        246   1e-76    
gb|ACY08882.1|  MADS-domain transcription factor                        246   1e-76    
gb|AFN68920.1|  APETALA3-like protein                                   246   2e-76    
dbj|BAG68949.1|  APETALA3 like protein                                  245   2e-76    
gb|AFN68944.1|  APETALA3-like protein                                   246   2e-76    
gb|AEG25816.1|  APETALA3-like protein                                   246   2e-76    
gb|AHH28259.1|  MADS-box transcription factor                           246   3e-76    
gb|AFN68945.1|  APETALA3-like protein                                   245   4e-76    
gb|KJB17702.1|  hypothetical protein B456_003G011500                    246   4e-76    
gb|AEM60224.1|  MADS box transcription factor                           245   4e-76    
gb|AHH28319.1|  MADS-box transcription factor                           245   4e-76    
ref|XP_007202503.1|  hypothetical protein PRUPE_ppa010727mg             246   4e-76    
gb|AGH39935.1|  MADS domain protein                                     246   4e-76    
gb|ABG20636.1|  TM6                                                     245   6e-76    
gb|AAB08879.1|  homeotic protein boi2AP3                                245   7e-76    
gb|ABP01803.1|  MADS transcription factor AP3-2                         245   7e-76    
gb|AAP93897.1|  APETALA3-1                                              245   7e-76    
gb|AGW23354.1|  MADS box protein MADS52                                 245   8e-76    
gb|ABG20630.1|  TM6                                                     244   1e-75    
gb|ACY08883.1|  MADS-domain transcription factor                        244   1e-75    
gb|AAT46098.1|  APETALA3-like protein                                   244   1e-75    
ref|XP_011025894.1|  PREDICTED: floral homeotic protein DEFICIENS...    244   1e-75    
gb|AAC13695.2|  PTD protein                                             244   1e-75    
gb|ACY08894.1|  MADS-domain transcription factor                        243   2e-75    
emb|CAC38765.1|  putative apetala 3 protein                             243   2e-75    
gb|ACY08897.1|  MADS-domain transcription factor                        243   2e-75    
gb|AGZ63860.1|  APETALA3-like protein                                   243   2e-75    
gb|AFO83618.1|  APETALA3-like protein                                   243   3e-75    
gb|AEM60228.1|  MADS box transcription factor                           243   4e-75    
emb|CAA08802.1|  MADs-box protein, GDEF1                                243   4e-75    
gb|AFO83616.1|  APETALA3-like protein                                   243   6e-75    
gb|AEM60230.1|  MADS box transcription factor                           242   6e-75    
gb|ABG20635.1|  TM6                                                     242   7e-75    
gb|AFN68925.1|  APETALA3-like protein                                   242   7e-75    
gb|AFN68953.1|  APETALA3-like protein                                   242   7e-75    
gb|KJB48363.1|  hypothetical protein B456_008G064900                    242   8e-75    
gb|AFN68928.1|  APETALA3-like protein                                   242   8e-75    
gb|AFN68917.1|  APETALA3-like protein                                   242   9e-75    
gb|AFN68933.1|  APETALA3-like protein                                   242   1e-74    
ref|XP_004291814.1|  PREDICTED: floral homeotic protein PMADS 1         241   2e-74    
gb|ACR16055.1|  DEFICIENS-like MADS-box transcription factor            241   2e-74    
gb|AEG25799.1|  APETALA3-like protein                                   241   3e-74    
ref|XP_007227134.1|  hypothetical protein PRUPE_ppa026083mg             239   3e-74    
gb|AAT69984.1|  APETALA3                                                240   3e-74    
gb|AGH61292.1|  apetala 3                                               241   3e-74    
gb|AFN68918.1|  APETALA3-like protein                                   240   4e-74    
ref|XP_006453002.1|  hypothetical protein CICLE_v10009338mg             240   4e-74    
gb|AGH39929.1|  MADS domain protein                                     240   4e-74    
gb|AIE44760.1|  putative MADS-domain transcription factor AP3           240   5e-74    
gb|ADC79708.1|  APETALA3-like protein                                   240   6e-74    
dbj|BAF34915.1|  MADS-box protein                                       239   6e-74    
dbj|BAL04871.1|  AP3/DEF-like protein                                   238   9e-74    
ref|XP_008781489.1|  PREDICTED: MADS-box transcription factor 16 ...    239   1e-73    
gb|ACY08896.1|  MADS-domain transcription factor                        239   1e-73    
gb|ABG20632.1|  TM6                                                     239   1e-73    
gb|ACD76820.1|  APETALA3-like protein                                   239   2e-73    
dbj|BAK09616.1|  MADS-box transcription factor                          239   2e-73    
gb|AEM60231.1|  MADS box transcription factor                           238   2e-73    
gb|AGH39914.1|  MADS domain protein                                     239   2e-73    
gb|AGH61291.1|  apetala 3                                               238   3e-73    
gb|AAR88330.1|  AP3                                                     238   4e-73    
gb|ABG20634.1|  TM6                                                     238   4e-73    
gb|ADJ96374.1|  MADS protein                                            238   4e-73    
gb|ABC02398.1|  APETALA3-like protein                                   238   4e-73    
dbj|BAD80745.1|  MADS-box transcription factor                          238   5e-73    
ref|XP_006474489.1|  PREDICTED: floral homeotic protein PMADS 1-like    237   5e-73    
ref|XP_010029721.1|  PREDICTED: floral homeotic protein DEFICIENS...    238   6e-73    
gb|AFV74877.1|  TM6-like protein                                        237   7e-73    
emb|CAA61484.1|  MADS box regulatory protein                            237   1e-72    
ref|XP_009418316.1|  PREDICTED: MADS-box transcription factor 16-...    237   1e-72    
gb|ABG20633.1|  TM6                                                     236   1e-72    
gb|AHH28338.1|  MADS-box transcription factor                           235   2e-72    
gb|AAR06664.1|  transcription factor AP3                                236   2e-72    
dbj|BAB63261.1|  MADS-box protein                                       237   3e-72    
gb|AGH39938.1|  MADS domain protein                                     236   3e-72    
gb|AFV74876.1|  TM6-like protein                                        235   3e-72    
gb|AAO49713.1|  APETALA3                                                236   5e-72    
gb|AGA61760.1|  TM6                                                     234   5e-72    
gb|ACY08888.1|  MADS-domain transcription factor                        234   5e-72    
gb|AAO26542.1|  AP3-3 type 1                                            234   7e-72    
gb|AHH28313.1|  MADS-box transcription factor                           234   8e-72    
gb|ACR16041.1|  DEFICIENS-like MADS-box transcription factor            234   8e-72    
ref|XP_003612101.1|  MADS box transcription factor TM6                  235   8e-72    
gb|AFN68946.1|  APETALA3-like protein                                   234   9e-72    
gb|AGH39937.1|  MADS domain protein                                     234   1e-71    
gb|AAQ83493.1|  APETALA3                                                234   1e-71    
dbj|BAE48147.1|  MADS-box transcription factor                          234   1e-71    
gb|ACX50635.1|  MADS-box2 transcription factor                          234   1e-71    
gb|AJN00604.1|  MADS domain transcription factor TM6-like protein       233   1e-71    
gb|ACA47117.1|  MADS box transcription factor TM6                       233   2e-71    
gb|AEG25803.1|  APETALA3-like protein                                   233   2e-71    
gb|AEW43605.1|  MADS-box transcription factor TM6                       234   2e-71    
gb|AGA61779.1|  apetala 3                                               232   2e-71    
gb|AGA61771.1|  TM6                                                     232   2e-71    
gb|ABG20631.1|  TM6                                                     233   2e-71    
gb|AHH28312.1|  MADS-box transcription factor                           233   2e-71    
gb|ABF56132.1|  TM6-like protein                                        232   3e-71    
gb|AEX92972.1|  MADS box protein 6                                      233   4e-71    
gb|ABN55895.1|  DEFICIENS                                               233   4e-71    
gb|AEW43603.1|  MADS-box transcription factor TM6                       233   4e-71    
gb|AAW78035.1|  APETALA3-like protein                                   233   6e-71    
gb|AFL03387.1|  MADS box transcription factor AP3-3                     232   6e-71    
gb|AEG25808.1|  APETALA3-like protein                                   232   6e-71    
gb|AFM75880.1|  APETALA3-like protein                                   232   7e-71    
gb|AGH39933.1|  MADS domain protein                                     232   7e-71    
gb|ACY08895.1|  MADS-domain transcription factor                        231   7e-71    
gb|ACY08887.1|  MADS-domain transcription factor                        231   8e-71    
gb|AFN68921.1|  APETALA3-like protein                                   231   1e-70    
gb|AGO59776.1|  AP3-like MADS-box protein                               231   2e-70    
gb|ACD85120.1|  B-class MADS-box protein AP3-3                          231   2e-70    
dbj|BAE06050.1|  MADS-box transcription factor                          231   2e-70    
gb|KJB48362.1|  hypothetical protein B456_008G064900                    232   2e-70    
gb|AFX61404.1|  deficiens                                               231   2e-70    
gb|AFN68947.1|  APETALA3-like protein                                   231   2e-70    
dbj|BAC75969.1|  MADS-box transcription factor                          231   2e-70    
gb|ADL36746.1|  MADS domain class transcription factor                  231   2e-70    
gb|ACD85095.1|  B-class MADS-box protein AP3-3                          231   2e-70    
gb|ADM08179.1|  MADS-domain transcription factor TM6                    230   3e-70    
gb|KEH27574.1|  MADS-box transcription factor                           231   3e-70    
gb|AFN68914.1|  APETALA3-like protein                                   230   3e-70    
gb|ABP01804.1|  MADS transcription factor AP3-1                         230   3e-70    
ref|XP_008346633.1|  PREDICTED: floral homeotic protein DEFICIENS...    231   4e-70    
ref|XP_009346296.1|  PREDICTED: floral homeotic protein DEFICIENS...    230   5e-70    
gb|ACA62949.1|  MADS-box protein                                        230   6e-70    
gb|AGH39934.1|  MADS domain protein                                     229   8e-70    
gb|AFN68922.1|  APETALA3-like protein                                   229   9e-70    
gb|AFN68916.1|  APETALA3-like protein                                   229   1e-69    
dbj|BAC11907.1|  MADS-box protein                                       229   1e-69    
ref|XP_006590707.1|  PREDICTED: floral homeotic protein PMADS 1-l...    229   1e-69    
gb|AFN68931.1|  APETALA3-like protein                                   228   1e-69    
ref|XP_007157955.1|  hypothetical protein PHAVU_002G112200g             229   1e-69    
gb|AGA61765.1|  apetala 3                                               226   2e-69    
gb|AGA61770.1|  TM6                                                     228   2e-69    
dbj|BAG50400.1|  MADS-box transcription factor                          228   2e-69    
gb|AAR26626.1|  MADS box transcription factor                           228   2e-69    
gb|ACR16047.1|  DEFICIENS-like MADS-box transcription factor            228   2e-69    
gb|AFX61406.1|  APETALA3-like MADS-box transcription factor             229   2e-69    
emb|CAC80856.1|  B-type MADS box protein                                228   3e-69    
ref|XP_009378223.1|  PREDICTED: floral homeotic protein DEFICIENS...    228   3e-69    
gb|KJB17700.1|  hypothetical protein B456_003G011500                    228   3e-69    
gb|ADD25194.1|  AP3-2                                                   227   3e-69    
gb|AGH39921.1|  MADS domain protein                                     228   3e-69    
gb|AFV74874.1|  TM6-like protein                                        228   3e-69    
ref|XP_008344258.1|  PREDICTED: floral homeotic protein DEFICIENS...    228   3e-69    
gb|AAW78034.1|  APETALA3-like protein                                   227   4e-69    
gb|ACD85115.1|  B-class MADS-box protein AP3-2                          228   4e-69    
gb|AAM27456.1|AF503913_1  MADS box protein                              228   4e-69    
gb|AIR76783.1|  APETALA3                                                226   6e-69    
dbj|BAF46353.1|  MADS-box transcription factor                          227   7e-69    
ref|XP_009346295.1|  PREDICTED: floral homeotic protein DEFICIENS...    227   9e-69    
ref|XP_008346632.1|  PREDICTED: floral homeotic protein DEFICIENS...    227   9e-69    
gb|AFP17801.1|  transcription factor AP3                                227   9e-69    
ref|XP_009412806.1|  PREDICTED: MADS-box transcription factor 16-...    226   1e-68    
gb|AAX13302.1|  MADS box protein AP3-like                               226   1e-68    
gb|ADD60473.1|  AP3-related protein 4                                   226   1e-68    
gb|AFN68939.1|  APETALA3-like protein                                   225   2e-68    
gb|ADC79700.1|  APETALA3-like protein                                   226   2e-68    
ref|XP_006453003.1|  hypothetical protein CICLE_v10009338mg             226   3e-68    
dbj|BAD80747.1|  MADS-box transcription factor                          226   3e-68    
dbj|BAB91550.1|  MADS-box transcription factor                          226   3e-68    
gb|AAO26512.1|  AP3-3                                                   224   4e-68    
gb|ACD85098.1|  B-class MADS-box protein AP3-2                          225   4e-68    
ref|XP_007157954.1|  hypothetical protein PHAVU_002G112200g             225   4e-68    
gb|ADI58466.1|  DEFICIENS                                               225   5e-68    
gb|AGH39918.1|  MADS domain protein                                     225   5e-68    
gb|ADI58459.1|  DEFICIENS                                               225   5e-68    
gb|ACD85099.1|  B-class MADS-box protein AP3-3                          225   5e-68    
ref|XP_006590706.1|  PREDICTED: floral homeotic protein PMADS 1-l...    225   5e-68    
gb|AAC42590.1|  APETALA3 homolog DeAP3-1                                224   6e-68    
gb|ACR16040.1|  DEFICIENS-like MADS-box transcription factor            224   6e-68    
ref|XP_009378222.1|  PREDICTED: floral homeotic protein DEFICIENS...    225   6e-68    
gb|AFN68926.1|  APETALA3-like protein                                   224   7e-68    
gb|ACY08906.1|  MADS-domain transcription factor                        223   7e-68    
gb|AAF73932.1|AF230703_1  MADS box transcription factor TM6             223   8e-68    
gb|ACR16056.1|  DEFICIENS-like MADS-box transcription factor            224   1e-67    
gb|ACY08900.1|  MADS-domain transcription factor                        222   1e-67    
gb|AFV74869.1|  AP3-like protein                                        225   1e-67    
ref|XP_004287844.1|  PREDICTED: floral homeotic protein DEFICIENS...    225   1e-67    
gb|AIR76784.1|  APETALA3                                                224   1e-67    
gb|AAO26529.1|  AP3-1                                                   223   1e-67    
dbj|BAF46354.1|  MADS-box transcription factor                          223   2e-67    
dbj|BAF44100.1|  transcription factor MADS                              222   2e-67    
gb|ACR16038.1|  DEFICIENS-like MADS-box transcription factor            223   2e-67    
gb|ACR16049.1|  DEFICIENS-like MADS-box transcription factor            223   2e-67    
gb|ADJ67235.1|  MADS box transcription factor 9                         223   2e-67    
ref|XP_007136051.1|  hypothetical protein PHAVU_009G0139001g            220   2e-67    
gb|AAR06684.1|  APETALA3-like protein AP3-1                             223   2e-67    
gb|AHM92089.1|  MADS-box protein 13                                     223   3e-67    
gb|AGH39917.1|  MADS domain protein                                     223   3e-67    
gb|AEQ75405.1|  APETALA3-like protein 4                                 223   3e-67    
gb|AEG25798.1|  APETALA3-like protein                                   223   3e-67    
gb|ACJ66727.1|  MADS box AP3-like protein 1                             223   3e-67    
gb|ACD85119.1|  B-class MADS-box protein AP3-2                          223   3e-67    
gb|AFH66787.1|  AP3-like MADS-box 3 protein                             223   4e-67    
gb|AFL03391.1|  MADS box transcription factor AP3-1                     222   4e-67    
gb|ABF56129.1|  TM6-like protein                                        221   4e-67    
gb|AEM60225.1|  MADS box transcription factor                           221   5e-67    
gb|AEQ75406.1|  APETALA3-like protein 3                                 222   6e-67    
gb|AFV74870.1|  TM6-like protein                                        222   7e-67    
ref|XP_010105274.1|  Floral homeotic protein DEFICIENS                  222   7e-67    
gb|ACD85094.1|  B-class MADS-box protein AP3-2                          222   8e-67    
gb|ABK34952.1|  APETALA-3-like protein                                  221   8e-67    
gb|KJB17701.1|  hypothetical protein B456_003G011500                    221   8e-67    
gb|ACY08889.1|  MADS-domain transcription factor                        221   9e-67    
gb|ABW96393.1|  AP3-related protein B                                   221   1e-66    
gb|AIR76787.1|  APETALA3                                                221   1e-66    
ref|XP_006572851.1|  PREDICTED: uncharacterized protein LOC100784...    222   1e-66    
gb|AAR06685.1|  APETALA3-like protein AP3-2                             221   1e-66    
ref|XP_004512095.1|  PREDICTED: floral homeotic protein DEFICIENS...    220   1e-66    
emb|CDY69833.1|  BnaAnng31650D                                          219   1e-66    
gb|ACY08904.1|  MADS-domain transcription factor                        219   2e-66    
dbj|BAO00918.1|  DEF-like protein                                       221   2e-66    
gb|KCW56676.1|  hypothetical protein EUGRSUZ_I02376                     220   2e-66    
gb|AAD31696.1|  APETALA3 homolog ScAP3                                  219   2e-66    
gb|ABF56142.1|  APETALA3-like protein                                   220   2e-66    
ref|XP_004512093.1|  PREDICTED: floral homeotic protein DEFICIENS...    221   3e-66    
gb|ACS74865.1|  APETALA3                                                219   3e-66    
gb|AHH28316.1|  MADS-box transcription factor                           220   3e-66    



>ref|XP_009794650.1| PREDICTED: floral homeotic protein PMADS 1 [Nicotiana sylvestris]
 emb|CAA65288.1| MADS-box protein [Nicotiana tabacum]
Length=227

 Score =   377 bits (967),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 181/206 (88%), Positives = 198/206 (96%), Gaps = 0/206 (0%)
 Frame = +1

Query  85   MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMISTSGKLHEYISP  264
            MARGKIQIKRIENQTNRQVTYSKRRNGLFKKA+ELTVLCDAKVSIIMIS++GKLHE+ISP
Sbjct  1    MARGKIQIKRIENQTNRQVTYSKRRNGLFKKANELTVLCDAKVSIIMISSTGKLHEFISP  60

Query  265  STSTKQLFDQYQKTVGVDLWNSHFEKMQEQLKKLRDVNRALRREIRQRMGEGLNDLSFEQ  444
            S +TKQLFD YQKTVGVDLWNSH+EKMQEQL+KL+DVNR LRREIRQRMGE LNDL++EQ
Sbjct  61   SVTTKQLFDLYQKTVGVDLWNSHYEKMQEQLRKLKDVNRNLRREIRQRMGESLNDLNYEQ  120

Query  445  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDPYGLVD  624
            L EL E+VDNS+KLIRERKYKVIGNQI+T+KKKVRNVEEIHRNLLLE +ARQEDPYGLV+
Sbjct  121  LEELNENVDNSLKLIRERKYKVIGNQIDTYKKKVRNVEEIHRNLLLEFDARQEDPYGLVE  180

Query  625  HEGDYNSVLGFPNGGPRILALRLQPD  702
             EGDYNSVLGFPNGGPRILALRLQP+
Sbjct  181  QEGDYNSVLGFPNGGPRILALRLQPN  206



>ref|XP_009619475.1| PREDICTED: floral homeotic protein PMADS 1 [Nicotiana tomentosiformis]
Length=227

 Score =   375 bits (963),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 181/206 (88%), Positives = 197/206 (96%), Gaps = 0/206 (0%)
 Frame = +1

Query  85   MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMISTSGKLHEYISP  264
            MARGKIQIKRIENQTNRQVTYSKRRNGLFKKA+ELTVLCDAKVSIIMIS++GKLHE+ISP
Sbjct  1    MARGKIQIKRIENQTNRQVTYSKRRNGLFKKANELTVLCDAKVSIIMISSTGKLHEFISP  60

Query  265  STSTKQLFDQYQKTVGVDLWNSHFEKMQEQLKKLRDVNRALRREIRQRMGEGLNDLSFEQ  444
            S +TKQLFD YQKTVGVDLWN H+EKMQEQL+KL+DVNR LRREIRQRMGE LNDL++EQ
Sbjct  61   SITTKQLFDLYQKTVGVDLWNFHYEKMQEQLRKLKDVNRNLRREIRQRMGESLNDLNYEQ  120

Query  445  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDPYGLVD  624
            L EL E+VDNS+KLIRERKYKVIGNQIET+KKKVRNVEEIHRNLLLE +ARQEDPYGLV+
Sbjct  121  LEELNENVDNSLKLIRERKYKVIGNQIETYKKKVRNVEEIHRNLLLEFDARQEDPYGLVE  180

Query  625  HEGDYNSVLGFPNGGPRILALRLQPD  702
             EGDYNSVLGFPNGGPRILALRLQP+
Sbjct  181  QEGDYNSVLGFPNGGPRILALRLQPN  206



>sp|Q07472.1|MADS1_PETHY RecName: Full=Floral homeotic protein PMADS 1; AltName: Full=Green 
petal homeotic protein [Petunia x hybrida]
 emb|CAA49567.1| GP (green petal) [Petunia x hybrida]
 gb|AAQ72510.2| DEF [Petunia x hybrida]
Length=231

 Score =   367 bits (943),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 177/203 (87%), Positives = 194/203 (96%), Gaps = 0/203 (0%)
 Frame = +1

Query  85   MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMISTSGKLHEYISP  264
            MARGKIQIKRIENQTNRQVTYSKRRNGLFKKA+ELTVLCDAKVSIIMIS++GKLHE+ISP
Sbjct  1    MARGKIQIKRIENQTNRQVTYSKRRNGLFKKANELTVLCDAKVSIIMISSTGKLHEFISP  60

Query  265  STSTKQLFDQYQKTVGVDLWNSHFEKMQEQLKKLRDVNRALRREIRQRMGEGLNDLSFEQ  444
            S +TKQLFD YQKTVGVDLWNSH+EKMQEQL+KL++VNR LR+EIRQRMGE LNDL++EQ
Sbjct  61   SITTKQLFDLYQKTVGVDLWNSHYEKMQEQLRKLKEVNRNLRKEIRQRMGESLNDLNYEQ  120

Query  445  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDPYGLVD  624
            L EL+E+VDNS+KLIRERKYKVIGNQIET KKKVRNVEEIHRNLLLE +ARQEDPYGLV+
Sbjct  121  LEELMENVDNSLKLIRERKYKVIGNQIETFKKKVRNVEEIHRNLLLEFDARQEDPYGLVE  180

Query  625  HEGDYNSVLGFPNGGPRILALRL  693
             EGDYNSVLGFPNGG RILALRL
Sbjct  181  QEGDYNSVLGFPNGGHRILALRL  203



>gb|ADI58370.1| PAP3 [Capsicum annuum]
Length=226

 Score =   364 bits (934),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 178/208 (86%), Positives = 198/208 (95%), Gaps = 2/208 (1%)
 Frame = +1

Query  85   MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMISTSGKLHEYISP  264
            MARGKIQIK+IENQTNRQVTYSKRRNGLFKKA+ELTVLCDAKVSI+MIS++GKLHE+ISP
Sbjct  1    MARGKIQIKKIENQTNRQVTYSKRRNGLFKKANELTVLCDAKVSIVMISSTGKLHEFISP  60

Query  265  STSTKQLFDQYQKTVGVDLWNSHFEKMQEQLKKLRDVNRALRREIRQRMGEGLNDLSFEQ  444
            S +TKQLFD YQKTVGVDLWNSH+EKMQEQL+KL+DVNR LR+EIRQRMGE LNDL++EQ
Sbjct  61   SITTKQLFDLYQKTVGVDLWNSHYEKMQEQLRKLKDVNRNLRKEIRQRMGESLNDLNYEQ  120

Query  445  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDPY-GLV  621
            L EL+E+VDNS+KLIRERKYKVIGNQIET+KKKVRNVEEIHRNLLLE +ARQEDPY GLV
Sbjct  121  LEELMENVDNSLKLIRERKYKVIGNQIETYKKKVRNVEEIHRNLLLEFDARQEDPYGGLV  180

Query  622  DHEGDYNSVLGFPN-GGPRILALRLQPD  702
            + EGDYNSVLGFPN GG RILALRLQP+
Sbjct  181  EQEGDYNSVLGFPNGGGARILALRLQPN  208



>gb|ABG20626.1| DEF [Solandra maxima]
Length=220

 Score =   360 bits (925),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 172/197 (87%), Positives = 190/197 (96%), Gaps = 0/197 (0%)
 Frame = +1

Query  112  RIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMISTSGKLHEYISPSTSTKQLFD  291
            RIENQTNRQVTYSKRRNGLFKKA+ELTVLCDAKVSIIMIS++GKLHE+ISPS +TKQLFD
Sbjct  1    RIENQTNRQVTYSKRRNGLFKKANELTVLCDAKVSIIMISSTGKLHEFISPSITTKQLFD  60

Query  292  QYQKTVGVDLWNSHFEKMQEQLKKLRDVNRALRREIRQRMGEGLNDLSFEQLTELIEDVD  471
            QYQKTVGVDLWNSH+EKMQEQL+KL+DVNR LRREIRQRMGE LNDL++EQL EL+E+VD
Sbjct  61   QYQKTVGVDLWNSHYEKMQEQLRKLKDVNRNLRREIRQRMGESLNDLNYEQLEELMENVD  120

Query  472  NSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDPYGLVDHEGDYNSVL  651
            +S+KLIRERKYKVIGNQIET+KKKVRNVEEIHRNLLLE +ARQEDPYGLV+ EGDYNSVL
Sbjct  121  SSLKLIRERKYKVIGNQIETYKKKVRNVEEIHRNLLLEFDARQEDPYGLVEQEGDYNSVL  180

Query  652  GFPNGGPRILALRLQPD  702
            GFPNG PRILALRLQP+
Sbjct  181  GFPNGVPRILALRLQPN  197



>emb|CAJ53871.1| floral homeotic protein DEFICIENS [Solanum lycopersicum]
Length=228

 Score =   358 bits (918),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 170/207 (82%), Positives = 197/207 (95%), Gaps = 1/207 (0%)
 Frame = +1

Query  85   MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMISTSGKLHEYISP  264
            MARGKIQIK+IENQTNRQVTYSKRRNGLFKKA+ELTVLCDAKVSI+MIS++GKLHE+ISP
Sbjct  1    MARGKIQIKKIENQTNRQVTYSKRRNGLFKKANELTVLCDAKVSIVMISSTGKLHEFISP  60

Query  265  STSTKQLFDQYQKTVGVDLWNSHFEKMQEQLKKLRDVNRALRREIRQRMGEGLNDLSFEQ  444
            S +TKQLFD YQKT+GVD+W +H+EKMQEQL+KL+DVNR LR+EIRQRMGE LNDL++EQ
Sbjct  61   SITTKQLFDLYQKTIGVDIWTTHYEKMQEQLRKLKDVNRNLRKEIRQRMGESLNDLNYEQ  120

Query  445  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDPY-GLV  621
            L EL+E+VDNS+KLIRERK+KVIGNQIET++KKVRNVEEI+RNLLLE +ARQEDPY GLV
Sbjct  121  LEELMENVDNSLKLIRERKFKVIGNQIETYRKKVRNVEEINRNLLLEFDARQEDPYGGLV  180

Query  622  DHEGDYNSVLGFPNGGPRILALRLQPD  702
            +H+GDYNSVLGFP GGPRIL LRLQP+
Sbjct  181  EHDGDYNSVLGFPTGGPRILDLRLQPN  207



>emb|CAA47846.1| deficiens analogue [Solanum tuberosum]
Length=228

 Score =   357 bits (916),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 172/206 (83%), Positives = 193/206 (94%), Gaps = 1/206 (0%)
 Frame = +1

Query  85   MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMISTSGKLHEYISP  264
            MARGKIQIK+IENQTNRQVTYSKRRNGLFKKA+ELTVLCDAKVSI+MIS++GKLHE+ISP
Sbjct  1    MARGKIQIKKIENQTNRQVTYSKRRNGLFKKANELTVLCDAKVSIVMISSTGKLHEFISP  60

Query  265  STSTKQLFDQYQKTVGVDLWNSHFEKMQEQLKKLRDVNRALRREIRQRMGEGLNDLSFEQ  444
            S +TKQLFD YQKT+GVD+W SH+EKMQEQL+KL+DVNR LR+EIRQRMGE LNDL+FEQ
Sbjct  61   SITTKQLFDLYQKTIGVDIWTSHYEKMQEQLRKLKDVNRNLRKEIRQRMGESLNDLNFEQ  120

Query  445  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDPY-GLV  621
            L EL+E+VDNS+KLIRERKYKVIGNQIET++KKVRNVEEIHRNLLLE +ARQEDPY GLV
Sbjct  121  LEELMENVDNSLKLIRERKYKVIGNQIETYRKKVRNVEEIHRNLLLEFDARQEDPYGGLV  180

Query  622  DHEGDYNSVLGFPNGGPRILALRLQP  699
            + EGDYNSVLGFP GG  ILAL LQP
Sbjct  181  EQEGDYNSVLGFPTGGHHILALGLQP  206



>ref|NP_001234077.1| TAP3 [Solanum lycopersicum]
 gb|ABG73412.1| TAP3 [Solanum lycopersicum]
Length=228

 Score =   357 bits (915),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 169/207 (82%), Positives = 197/207 (95%), Gaps = 1/207 (0%)
 Frame = +1

Query  85   MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMISTSGKLHEYISP  264
            MARGKIQIK+IENQTNRQVTYSKRRNGLFKKA+ELTVLCDAKVSI+MIS++GKLHE+ISP
Sbjct  1    MARGKIQIKKIENQTNRQVTYSKRRNGLFKKANELTVLCDAKVSIVMISSTGKLHEFISP  60

Query  265  STSTKQLFDQYQKTVGVDLWNSHFEKMQEQLKKLRDVNRALRREIRQRMGEGLNDLSFEQ  444
            S +TKQLFD YQKT+GVD+W +H+EKMQEQL+KL+DVNR LR+EIRQRMGE LNDL++EQ
Sbjct  61   SITTKQLFDLYQKTIGVDIWTTHYEKMQEQLRKLKDVNRNLRKEIRQRMGESLNDLNYEQ  120

Query  445  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDPY-GLV  621
            L EL+E+VDNS+KLIRERK+KVIGNQIET++KKVRNVEEI+RNLLLE +ARQEDPY GLV
Sbjct  121  LEELMENVDNSLKLIRERKFKVIGNQIETYRKKVRNVEEINRNLLLEFDARQEDPYGGLV  180

Query  622  DHEGDYNSVLGFPNGGPRILALRLQPD  702
            +H+GDYNS+LGFP GGPRIL LRLQP+
Sbjct  181  EHDGDYNSMLGFPTGGPRILDLRLQPN  207



>sp|P23706.1|DEFA_ANTMA RecName: Full=Floral homeotic protein DEFICIENS [Antirrhinum 
majus]
 emb|CAA44629.1| DEF A protein [Antirrhinum majus]
 emb|CAA36268.1| deficiens [Antirrhinum majus]
Length=227

 Score =   356 bits (914),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 172/204 (84%), Positives = 191/204 (94%), Gaps = 1/204 (0%)
 Frame = +1

Query  85   MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMISTSGKLHEYISP  264
            MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHEL+VLCDAKVSIIMIS++ KLHEYISP
Sbjct  1    MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELSVLCDAKVSIIMISSTQKLHEYISP  60

Query  265  STSTKQLFDQYQKTVGVDLWNSHFEKMQEQLKKLRDVNRALRREIRQRMGEGLNDLSFEQ  444
            +T+TKQLFDQYQK VGVDLW+SH+EKMQE LKKL +VNR LRREIRQRMGE LNDL +EQ
Sbjct  61   TTATKQLFDQYQKAVGVDLWSSHYEKMQEHLKKLNEVNRNLRREIRQRMGESLNDLGYEQ  120

Query  445  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLV  621
            +  LIED+DNS+KLIRERKYKVI NQI+T KKKVRNVEEIHRNL+LE +AR+EDP +GLV
Sbjct  121  IVNLIEDMDNSLKLIRERKYKVISNQIDTSKKKVRNVEEIHRNLVLEFDARREDPHFGLV  180

Query  622  DHEGDYNSVLGFPNGGPRILALRL  693
            D+EGDYNSVLGFPNGGPRI+ALRL
Sbjct  181  DNEGDYNSVLGFPNGGPRIIALRL  204



>gb|ABG20624.1| DEF [Mandragora autumnalis]
Length=214

 Score =   354 bits (908),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 169/197 (86%), Positives = 188/197 (95%), Gaps = 0/197 (0%)
 Frame = +1

Query  112  RIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMISTSGKLHEYISPSTSTKQLFD  291
            RIENQTNRQVTYSKRRNGLFKKA+ELTVLCDAKVSIIMIST+GKLHE+ISPS +TKQ+FD
Sbjct  1    RIENQTNRQVTYSKRRNGLFKKANELTVLCDAKVSIIMISTTGKLHEFISPSITTKQVFD  60

Query  292  QYQKTVGVDLWNSHFEKMQEQLKKLRDVNRALRREIRQRMGEGLNDLSFEQLTELIEDVD  471
             YQKTVGVDLWNSH+EKMQEQL+KL+DVNR LRREIRQRMGE LNDL++EQL EL+E+VD
Sbjct  61   LYQKTVGVDLWNSHYEKMQEQLRKLKDVNRNLRREIRQRMGESLNDLNYEQLEELMENVD  120

Query  472  NSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDPYGLVDHEGDYNSVL  651
            NS+KLIRERK+KVIGNQIET+KKKVRNVEEIHRNLLLE +ARQEDPYGLV+ EGDY SVL
Sbjct  121  NSLKLIRERKFKVIGNQIETYKKKVRNVEEIHRNLLLEFDARQEDPYGLVEQEGDYTSVL  180

Query  652  GFPNGGPRILALRLQPD  702
            GF NGGPRILALR+QP+
Sbjct  181  GFQNGGPRILALRIQPN  197



>gb|AGN54423.1| PFDEF [Physalis pubescens]
Length=235

 Score =   354 bits (908),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 175/210 (83%), Positives = 196/210 (93%), Gaps = 4/210 (2%)
 Frame = +1

Query  85   MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMISTSGKLHEYISP  264
            MARGKIQIK+IENQTNRQVTYSKRRNGLFKKA+ELTVLCDAKVSI+MIS++GKLHEYISP
Sbjct  1    MARGKIQIKKIENQTNRQVTYSKRRNGLFKKANELTVLCDAKVSIVMISSTGKLHEYISP  60

Query  265  STSTKQLFDQYQKTVGVDLWNSHFEKMQEQLKKLRDVNRALRREIRQRMGEGLNDLSFEQ  444
            S STKQLFD YQKTVG DLWNSH+EKMQEQL+KL+DVNR L++EIRQRMGE LNDL++EQ
Sbjct  61   SISTKQLFDLYQKTVGADLWNSHYEKMQEQLRKLKDVNRNLQKEIRQRMGESLNDLNYEQ  120

Query  445  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDPY-GLV  621
            L EL+E+VD+S+KLIRERKYKVIGNQIET+KKKVRNVEEIHRNLLLE +ARQ+DPY GLV
Sbjct  121  LGELMENVDDSLKLIRERKYKVIGNQIETYKKKVRNVEEIHRNLLLEFDARQDDPYGGLV  180

Query  622  DHEG--DYNSVLGFPNG-GPRILALRLQPD  702
            + EG   YNSVLGFPNG G RILALRLQP+
Sbjct  181  EQEGADHYNSVLGFPNGAGARILALRLQPN  210



>ref|NP_001275326.1| floral homeotic protein PMADS 1-like [Solanum tuberosum]
 emb|CAA47845.1| deficiens analogue [Solanum tuberosum]
Length=228

 Score =   353 bits (906),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 170/206 (83%), Positives = 191/206 (93%), Gaps = 1/206 (0%)
 Frame = +1

Query  85   MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMISTSGKLHEYISP  264
            MARGKIQIK+IENQTNRQVTYSKRRNGLFKKA+ELTVLCDAKVSI+MIS++GKLHE+ISP
Sbjct  1    MARGKIQIKKIENQTNRQVTYSKRRNGLFKKANELTVLCDAKVSIVMISSTGKLHEFISP  60

Query  265  STSTKQLFDQYQKTVGVDLWNSHFEKMQEQLKKLRDVNRALRREIRQRMGEGLNDLSFEQ  444
            S +T  LFD YQKT+GVD+W SH+EKMQEQL+KL+DVNR LR+EIRQRMGE LNDL+FEQ
Sbjct  61   SITTNNLFDLYQKTIGVDIWTSHYEKMQEQLRKLKDVNRNLRKEIRQRMGESLNDLNFEQ  120

Query  445  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDPY-GLV  621
            L EL+E+VDNS+KLIRERKYKVIGNQIET++KKVRNVEEIHRNLLLE +ARQEDPY GLV
Sbjct  121  LEELMENVDNSLKLIRERKYKVIGNQIETYRKKVRNVEEIHRNLLLEFDARQEDPYGGLV  180

Query  622  DHEGDYNSVLGFPNGGPRILALRLQP  699
            + EGDYNSVLGFP GG  ILAL LQP
Sbjct  181  EQEGDYNSVLGFPTGGHHILALGLQP  206



>gb|ABG20629.1| DEF [Cestrum elegans]
Length=215

 Score =   353 bits (905),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 170/197 (86%), Positives = 187/197 (95%), Gaps = 0/197 (0%)
 Frame = +1

Query  112  RIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMISTSGKLHEYISPSTSTKQLFD  291
            RIENQTNRQVTYSKRRNGLFKKA+ELTVLCDAKVSIIMIS++GKLHE+ISP  +TKQLFD
Sbjct  1    RIENQTNRQVTYSKRRNGLFKKANELTVLCDAKVSIIMISSTGKLHEFISPQITTKQLFD  60

Query  292  QYQKTVGVDLWNSHFEKMQEQLKKLRDVNRALRREIRQRMGEGLNDLSFEQLTELIEDVD  471
             YQKTVGVDLWNSH+EKMQEQL+KL+DVNR LRREIRQRMGE LNDL++EQL EL+E+VD
Sbjct  61   LYQKTVGVDLWNSHYEKMQEQLRKLKDVNRNLRREIRQRMGESLNDLNYEQLEELMENVD  120

Query  472  NSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDPYGLVDHEGDYNSVL  651
            NS+KLIRERKYKVIGNQIET+KKKVRNVEEIHRNLLLE +ARQEDPYGLV+ EGDYNSVL
Sbjct  121  NSLKLIRERKYKVIGNQIETYKKKVRNVEEIHRNLLLEFDARQEDPYGLVEQEGDYNSVL  180

Query  652  GFPNGGPRILALRLQPD  702
            GF NGG RILALRLQP+
Sbjct  181  GFQNGGHRILALRLQPN  197



>emb|CAJ44129.1| deficiens protein [Misopates orontium]
Length=228

 Score =   353 bits (905),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 170/207 (82%), Positives = 192/207 (93%), Gaps = 1/207 (0%)
 Frame = +1

Query  85   MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMISTSGKLHEYISP  264
            MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHEL+VLCDAKVSIIMIS++ KLHEYISP
Sbjct  1    MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELSVLCDAKVSIIMISSTQKLHEYISP  60

Query  265  STSTKQLFDQYQKTVGVDLWNSHFEKMQEQLKKLRDVNRALRREIRQRMGEGLNDLSFEQ  444
            +T+TKQLFDQYQK VGVDLW+SH+EKMQE LKKL +VNR LRREIRQRMGE LNDL +EQ
Sbjct  61   TTATKQLFDQYQKAVGVDLWSSHYEKMQEHLKKLNEVNRNLRREIRQRMGESLNDLGYEQ  120

Query  445  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLV  621
            +  LIED+DNS+KLIRERKYKVI NQI+T KKKVRNVEEIHRNL+LE +AR+EDP +GLV
Sbjct  121  IVNLIEDMDNSLKLIRERKYKVISNQIDTSKKKVRNVEEIHRNLVLEFDARREDPHFGLV  180

Query  622  DHEGDYNSVLGFPNGGPRILALRLQPD  702
            ++EGDYNSVLGFPNGGPRI+AL+  P+
Sbjct  181  ENEGDYNSVLGFPNGGPRIIALQRLPN  207



>dbj|BAI68389.1| DEFICIENS protein [Antirrhinum majus]
Length=227

 Score =   352 bits (904),  Expect = 7e-118, Method: Compositional matrix adjust.
 Identities = 171/204 (84%), Positives = 190/204 (93%), Gaps = 1/204 (0%)
 Frame = +1

Query  85   MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMISTSGKLHEYISP  264
            MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHEL+VLCDAKVSIIMIS++ KLHEYISP
Sbjct  1    MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELSVLCDAKVSIIMISSTQKLHEYISP  60

Query  265  STSTKQLFDQYQKTVGVDLWNSHFEKMQEQLKKLRDVNRALRREIRQRMGEGLNDLSFEQ  444
            +T+TKQLFDQYQK VGVDLW+SH+EKMQE LKKL +VNR LRREIRQRMGE LNDL +EQ
Sbjct  61   TTATKQLFDQYQKAVGVDLWSSHYEKMQEHLKKLNEVNRNLRREIRQRMGESLNDLGYEQ  120

Query  445  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLV  621
            +  LIED+DNS+KLIRERKYKVI NQI+T KKKVRNVEEI RNL+LE +AR+EDP +GLV
Sbjct  121  IVNLIEDMDNSLKLIRERKYKVISNQIDTSKKKVRNVEEIPRNLVLEFDARREDPHFGLV  180

Query  622  DHEGDYNSVLGFPNGGPRILALRL  693
            D+EGDYNSVLGFPNGGPRI+ALRL
Sbjct  181  DNEGDYNSVLGFPNGGPRIIALRL  204



>gb|ABG20625.1| DEF [Juanulloa mexicana]
Length=218

 Score =   351 bits (900),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 169/196 (86%), Positives = 185/196 (94%), Gaps = 0/196 (0%)
 Frame = +1

Query  112  RIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMISTSGKLHEYISPSTSTKQLFD  291
            RIENQTNRQVTYSKRRNGLFKKA+ELTVLCDAKVSIIMIS++GKLHE+ISPS +TKQLFD
Sbjct  1    RIENQTNRQVTYSKRRNGLFKKANELTVLCDAKVSIIMISSTGKLHEFISPSITTKQLFD  60

Query  292  QYQKTVGVDLWNSHFEKMQEQLKKLRDVNRALRREIRQRMGEGLNDLSFEQLTELIEDVD  471
             YQKTVGVD+W SH+EKMQEQL+KL+DVNR LRREIRQRMGE LNDL+ EQL EL+E+VD
Sbjct  61   LYQKTVGVDIWYSHYEKMQEQLRKLKDVNRNLRREIRQRMGESLNDLNCEQLQELMENVD  120

Query  472  NSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDPYGLVDHEGDYNSVL  651
            NS+KLIRERKYKVIGNQIET+KKKVRNVEEIHRNLLLE +ARQEDPYGLV+ EGDYNSVL
Sbjct  121  NSLKLIRERKYKVIGNQIETYKKKVRNVEEIHRNLLLEFDARQEDPYGLVEQEGDYNSVL  180

Query  652  GFPNGGPRILALRLQP  699
            GFPNGG  ILALRLQP
Sbjct  181  GFPNGGSHILALRLQP  196



>gb|AEM60197.1| MADS box transcription factor, partial [Iochroma cyaneum]
Length=212

 Score =   347 bits (889),  Expect = 8e-116, Method: Compositional matrix adjust.
 Identities = 167/198 (84%), Positives = 186/198 (94%), Gaps = 1/198 (1%)
 Frame = +1

Query  112  RIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMISTSGKLHEYISPSTSTKQLFD  291
            +IENQTNRQVTYSKRRNGLFKKA+ELTVLCDAKVSI+M+S++GKLHE+ISPS +TKQLFD
Sbjct  1    KIENQTNRQVTYSKRRNGLFKKANELTVLCDAKVSIVMVSSTGKLHEFISPSITTKQLFD  60

Query  292  QYQKTVGVDLWNSHFEKMQEQLKKLRDVNRALRREIRQRMGEGLNDLSFEQLTELIEDVD  471
             YQKTVGVDLWNSH+EKMQEQL+KL DVNR LRREIRQRMGE LNDL++EQL EL+E+VD
Sbjct  61   LYQKTVGVDLWNSHYEKMQEQLRKLMDVNRNLRREIRQRMGESLNDLNYEQLEELMENVD  120

Query  472  NSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDPY-GLVDHEGDYNSV  648
            NS+KLIRERKYK IGNQIET+KKKVRNVEEIHRNLLLE +ARQEDPY GLV+ EGDYNSV
Sbjct  121  NSLKLIRERKYKSIGNQIETYKKKVRNVEEIHRNLLLEFDARQEDPYGGLVEQEGDYNSV  180

Query  649  LGFPNGGPRILALRLQPD  702
            LGFPNGG  ILALRLQP+
Sbjct  181  LGFPNGGAGILALRLQPN  198



>ref|XP_011074633.1| PREDICTED: floral homeotic protein DEFICIENS [Sesamum indicum]
 gb|AIS82594.1| APETALA 3 [Sesamum indicum]
Length=234

 Score =   345 bits (885),  Expect = 8e-115, Method: Compositional matrix adjust.
 Identities = 164/204 (80%), Positives = 187/204 (92%), Gaps = 1/204 (0%)
 Frame = +1

Query  85   MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMISTSGKLHEYISP  264
            MARGKIQIK+IENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSI+MIS++ KLHEYISP
Sbjct  1    MARGKIQIKKIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSILMISSTQKLHEYISP  60

Query  265  STSTKQLFDQYQKTVGVDLWNSHFEKMQEQLKKLRDVNRALRREIRQRMGEGLNDLSFEQ  444
            + +TKQLFDQYQ    VDLWNSH+EKMQ+ LKKL++VNR LRREIRQRMGE LNDL + +
Sbjct  61   TITTKQLFDQYQTAATVDLWNSHYEKMQQHLKKLKEVNRNLRREIRQRMGESLNDLGYGE  120

Query  445  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLV  621
            +  LIED+DNS++LIR+RKYKVIGNQI+T KKK+RNVEEIHRNL LE +ARQEDP YGLV
Sbjct  121  MVNLIEDMDNSLRLIRDRKYKVIGNQIDTSKKKLRNVEEIHRNLALEFDARQEDPQYGLV  180

Query  622  DHEGDYNSVLGFPNGGPRILALRL  693
            ++EGDYNSVLGFPNGGPRI+ALRL
Sbjct  181  ENEGDYNSVLGFPNGGPRIIALRL  204



>gb|AAS45984.1| deficiens [Erythranthe guttata]
Length=244

 Score =   344 bits (883),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 162/207 (78%), Positives = 193/207 (93%), Gaps = 1/207 (0%)
 Frame = +1

Query  85   MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMISTSGKLHEYISP  264
            MARGKIQIK+IENQTNRQVTYSKRRNGLFKKAHEL+VLCDAKVSI+MIS++ KLHEYISP
Sbjct  1    MARGKIQIKKIENQTNRQVTYSKRRNGLFKKAHELSVLCDAKVSIVMISSTQKLHEYISP  60

Query  265  STSTKQLFDQYQKTVGVDLWNSHFEKMQEQLKKLRDVNRALRREIRQRMGEGLNDLSFEQ  444
            S +TKQ+FDQYQK VGVDLWN+H++KMQ+ L+KL++VNR LR+EIRQRMGE LNDL ++Q
Sbjct  61   SITTKQVFDQYQKAVGVDLWNTHYQKMQDHLQKLKEVNRNLRKEIRQRMGESLNDLGYDQ  120

Query  445  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLV  621
            +  LIE+VDNS+ LIRE+KYKVIGN+IET KKK+RNVEEIHR+L+LE +ARQEDP YGLV
Sbjct  121  MVNLIEEVDNSLGLIREKKYKVIGNRIETSKKKLRNVEEIHRSLVLEFDARQEDPHYGLV  180

Query  622  DHEGDYNSVLGFPNGGPRILALRLQPD  702
            ++EGDYNSVLGFP+GGPRI+ALRL P+
Sbjct  181  ENEGDYNSVLGFPHGGPRIIALRLPPN  207



>gb|AAS45992.1| deficiens [Erythranthe guttata]
 gb|EYU36756.1| hypothetical protein MIMGU_mgv1a012867mg [Erythranthe guttata]
Length=237

 Score =   341 bits (874),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 160/204 (78%), Positives = 188/204 (92%), Gaps = 1/204 (0%)
 Frame = +1

Query  85   MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMISTSGKLHEYISP  264
            MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSI+MIS++ KLHEYISP
Sbjct  1    MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSILMISSTQKLHEYISP  60

Query  265  STSTKQLFDQYQKTVGVDLWNSHFEKMQEQLKKLRDVNRALRREIRQRMGEGLNDLSFEQ  444
            S +TKQ+FDQYQK VGVD+WN+H+E+MQE LKKL+DVNR LR EIRQR+GE LNDL +EQ
Sbjct  61   SITTKQMFDQYQKAVGVDVWNTHYERMQEHLKKLKDVNRNLRTEIRQRIGESLNDLGYEQ  120

Query  445  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLV  621
            +  LIE++DNS+ +IRE+KYK I +QI+T KKK+RNVEEI+RNL+LE +ARQEDP YGLV
Sbjct  121  MVNLIEEIDNSLTIIREKKYKAISSQIDTSKKKLRNVEEINRNLVLEFDARQEDPHYGLV  180

Query  622  DHEGDYNSVLGFPNGGPRILALRL  693
            ++EGDYNS+LGFPNGGPRI+ALRL
Sbjct  181  ENEGDYNSLLGFPNGGPRIIALRL  204



>gb|AEM60198.1| MADS box transcription factor, partial [Solanum pennellii]
Length=212

 Score =   339 bits (869),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 161/199 (81%), Positives = 188/199 (94%), Gaps = 1/199 (1%)
 Frame = +1

Query  109  KRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMISTSGKLHEYISPSTSTKQLF  288
            K+IENQTNRQVTYSKRRNGLFKKA+ELTVLCDAKVSI+MIS++GKLHE+ISPS +TKQLF
Sbjct  1    KKIENQTNRQVTYSKRRNGLFKKANELTVLCDAKVSIVMISSTGKLHEFISPSITTKQLF  60

Query  289  DQYQKTVGVDLWNSHFEKMQEQLKKLRDVNRALRREIRQRMGEGLNDLSFEQLTELIEDV  468
            D YQKT+GVD+W +H+EKMQEQL+KL+DVNR LR+EIRQRMGE LNDL++EQL E +E+V
Sbjct  61   DLYQKTIGVDIWTTHYEKMQEQLRKLKDVNRNLRKEIRQRMGESLNDLNYEQLEEPMENV  120

Query  469  DNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDPY-GLVDHEGDYNS  645
            DNS+KLIRERK+KVIGNQIET++KKVRNVEEI+RNLLLE +ARQEDPY GLV+H+GDYNS
Sbjct  121  DNSLKLIRERKFKVIGNQIETYRKKVRNVEEINRNLLLEFDARQEDPYGGLVEHDGDYNS  180

Query  646  VLGFPNGGPRILALRLQPD  702
            VLGFP GGPRIL LRLQP+
Sbjct  181  VLGFPTGGPRILDLRLQPN  199



>gb|AEM60199.1| MADS box transcription factor, partial [Solanum nigrum]
Length=212

 Score =   338 bits (868),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 161/198 (81%), Positives = 186/198 (94%), Gaps = 1/198 (1%)
 Frame = +1

Query  109  KRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMISTSGKLHEYISPSTSTKQLF  288
            K+IENQTNRQVTYSKRRNGLFKKA+ELTVLCDAKVSI+MIS++GKLHE+ISPS +TKQLF
Sbjct  1    KKIENQTNRQVTYSKRRNGLFKKANELTVLCDAKVSIVMISSTGKLHEFISPSITTKQLF  60

Query  289  DQYQKTVGVDLWNSHFEKMQEQLKKLRDVNRALRREIRQRMGEGLNDLSFEQLTELIEDV  468
            D YQ T+GVD+W +H+EKMQEQL+KL+DVNR LR+EIRQR+GE LNDL+FEQL EL+E+V
Sbjct  61   DLYQNTIGVDIWTTHYEKMQEQLRKLKDVNRNLRKEIRQRVGESLNDLNFEQLEELMENV  120

Query  469  DNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDPY-GLVDHEGDYNS  645
            DNS+KLIRERKYKVI NQI+T+K+KVRNVEEIHRNLLLE +ARQEDPY GLV+ EGDYNS
Sbjct  121  DNSLKLIRERKYKVISNQIDTYKEKVRNVEEIHRNLLLEFDARQEDPYGGLVEQEGDYNS  180

Query  646  VLGFPNGGPRILALRLQP  699
            +LGFPNGG RILALRLQP
Sbjct  181  MLGFPNGGGRILALRLQP  198



>gb|AEM60180.1| MADS box transcription factor, partial [Sesamum indicum]
Length=217

 Score =   337 bits (865),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 161/196 (82%), Positives = 182/196 (93%), Gaps = 1/196 (1%)
 Frame = +1

Query  109  KRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMISTSGKLHEYISPSTSTKQLF  288
            K+IENQTNRQVTYSKRRNGLFKKAHELTVLCDA+VSIIMIS++ KLHEYISPST+TKQ+F
Sbjct  1    KKIENQTNRQVTYSKRRNGLFKKAHELTVLCDARVSIIMISSTQKLHEYISPSTTTKQVF  60

Query  289  DQYQKTVGVDLWNSHFEKMQEQLKKLRDVNRALRREIRQRMGEGLNDLSFEQLTELIEDV  468
            DQYQK V VDLW+SH+EKMQE LKKL+DVNR LRREIRQRMGE LNDL ++Q+  LIED+
Sbjct  61   DQYQKAVAVDLWSSHYEKMQEHLKKLKDVNRNLRREIRQRMGESLNDLGYDQMVNLIEDM  120

Query  469  DNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLVDHEGDYNS  645
            D+S++LIRERKYKVIGNQIET KKK+RNVEEIHRNL LE +ARQEDP YGLV++EG YNS
Sbjct  121  DSSLRLIRERKYKVIGNQIETSKKKLRNVEEIHRNLALEFDARQEDPQYGLVENEGGYNS  180

Query  646  VLGFPNGGPRILALRL  693
            VLGFPNGGPRI+ALRL
Sbjct  181  VLGFPNGGPRIIALRL  196



>gb|ABG20622.1| DEF [Brunfelsia uniflora]
Length=228

 Score =   337 bits (865),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 165/195 (85%), Positives = 184/195 (94%), Gaps = 1/195 (1%)
 Frame = +1

Query  112  RIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMISTSGKLHEYISPSTSTKQLFD  291
            RIENQTNRQVTYSKRRNGLFKKA+ELTVLCDAKVSIIMIS++GKLHE+ISPS +TKQLFD
Sbjct  1    RIENQTNRQVTYSKRRNGLFKKANELTVLCDAKVSIIMISSTGKLHEFISPSLTTKQLFD  60

Query  292  QYQKTVGVDLWNSHFEKMQEQLKKLRDVNRALRREIRQRMGEGLNDLSFEQLTELIEDVD  471
             YQ TVGVDLWNSH+E+MQEQL+KL+DVNR LR+EIRQRMGE LNDL++EQL +L+E+VD
Sbjct  61   LYQNTVGVDLWNSHYEQMQEQLRKLKDVNRNLRKEIRQRMGESLNDLNYEQLEKLMENVD  120

Query  472  NSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDPYGLVDHEGDYNSVL  651
            +S+KLIRERKYKVIGNQIET KKKVRNVEEIHRNLLLE +ARQEDPYGLV+ EGDYNSVL
Sbjct  121  DSLKLIRERKYKVIGNQIETCKKKVRNVEEIHRNLLLEFDARQEDPYGLVEQEGDYNSVL  180

Query  652  GFPNG-GPRILALRL  693
            GFPNG G RILALRL
Sbjct  181  GFPNGSGHRILALRL  195



>gb|AAS45985.1| deficiens [Erythranthe lewisii]
Length=238

 Score =   337 bits (863),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 160/207 (77%), Positives = 189/207 (91%), Gaps = 1/207 (0%)
 Frame = +1

Query  85   MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMISTSGKLHEYISP  264
            MARGKIQIK+IENQTNRQVTYSKRRNGLFKKAHEL+VLCDAKVSI+MIS++ KLHEYISP
Sbjct  1    MARGKIQIKKIENQTNRQVTYSKRRNGLFKKAHELSVLCDAKVSIVMISSTQKLHEYISP  60

Query  265  STSTKQLFDQYQKTVGVDLWNSHFEKMQEQLKKLRDVNRALRREIRQRMGEGLNDLSFEQ  444
            S +TKQ+FDQYQK VGVDLWNSH++KMQE L+KL+DVNR LR+EIRQRMGE LNDL +EQ
Sbjct  61   SITTKQVFDQYQKAVGVDLWNSHYQKMQEHLQKLKDVNRNLRKEIRQRMGESLNDLGYEQ  120

Query  445  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLV  621
               LIE+VD ++ LIRE+KYKVIGN+IET KKK+RNVEEIHR+L+LE ++ QE+P YGLV
Sbjct  121  TVNLIEEVDTALSLIREKKYKVIGNRIETSKKKLRNVEEIHRSLVLEFDSIQEEPHYGLV  180

Query  622  DHEGDYNSVLGFPNGGPRILALRLQPD  702
            ++EGDYNSVLGF +GGPRI+ALRL P+
Sbjct  181  ENEGDYNSVLGFQHGGPRIIALRLPPN  207



>gb|ABG20627.1| DEF1 [Scopolia carniolica]
Length=219

 Score =   336 bits (861),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 165/198 (83%), Positives = 184/198 (93%), Gaps = 2/198 (1%)
 Frame = +1

Query  112  RIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMISTSGKLHEYISPSTSTKQLFD  291
            RIENQTNRQVTYSKRRNGLFKKA+ELTVLCDAKVSIIMIS +GKLHE+ISPS +TKQLFD
Sbjct  1    RIENQTNRQVTYSKRRNGLFKKANELTVLCDAKVSIIMISNTGKLHEFISPSITTKQLFD  60

Query  292  QYQKTVGVDLWNSHFEKMQEQLKKLRDVNRALRREIRQRMGEGLNDLSFEQLTELIEDVD  471
             YQKTVGVDLWN H+EKMQEQL+KL+DVNR LRREIRQRMGE LNDL++EQL +L+E+VD
Sbjct  61   LYQKTVGVDLWNFHYEKMQEQLRKLKDVNRNLRREIRQRMGESLNDLNYEQLEQLMENVD  120

Query  472  NSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDPY-GLVDHEGDYNSV  648
            NS+KLIRERKYKVIGNQIET KKKVRNVEEIHRNL+LE +AR+EDPY GLV+  GDYNS+
Sbjct  121  NSLKLIRERKYKVIGNQIETFKKKVRNVEEIHRNLMLEFDAREEDPYGGLVEQGGDYNSM  180

Query  649  LGFPNGGPRILALRLQPD  702
            LGFPNGG RILAL LQP+
Sbjct  181  LGFPNGG-RILALHLQPN  197



>gb|ABG20628.1| DEF2 [Scopolia carniolica]
Length=222

 Score =   335 bits (860),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 165/198 (83%), Positives = 184/198 (93%), Gaps = 2/198 (1%)
 Frame = +1

Query  112  RIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMISTSGKLHEYISPSTSTKQLFD  291
            RIENQTNRQVTYSKRRNGLFKKA+ELTVLCDAKVSIIMIS++GKLHE+ISPS +TKQLFD
Sbjct  1    RIENQTNRQVTYSKRRNGLFKKANELTVLCDAKVSIIMISSTGKLHEFISPSITTKQLFD  60

Query  292  QYQKTVGVDLWNSHFEKMQEQLKKLRDVNRALRREIRQRMGEGLNDLSFEQLTELIEDVD  471
             YQKTVGVDLWNSH+EKMQEQL+KL+DVNR LRREIRQRMGE LNDL++EQL EL+E+VD
Sbjct  61   LYQKTVGVDLWNSHYEKMQEQLRKLKDVNRNLRREIRQRMGESLNDLNYEQLEELMENVD  120

Query  472  NSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDPY-GLVDHEGDYNSV  648
            NS+KLIRERKYKVIGNQIET KKKVRNVEEIH+NLLLE +AR+EDPY GLV+ EGDYN +
Sbjct  121  NSLKLIRERKYKVIGNQIETFKKKVRNVEEIHKNLLLEFDAREEDPYGGLVEQEGDYNFM  180

Query  649  LGFPNGGPRILALRLQPD  702
            LGFPN G  IL LRLQP+
Sbjct  181  LGFPN-GDHILTLRLQPN  197



>gb|AAS45990.1| deficiens, partial [Paulownia tomentosa]
Length=219

 Score =   335 bits (860),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 161/199 (81%), Positives = 182/199 (91%), Gaps = 1/199 (1%)
 Frame = +1

Query  109  KRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMISTSGKLHEYISPSTSTKQLF  288
            KRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSI+MIS++ KLHEYISP+T+TKQLF
Sbjct  1    KRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSILMISSTQKLHEYISPNTTTKQLF  60

Query  289  DQYQKTVGVDLWNSHFEKMQEQLKKLRDVNRALRREIRQRMGEGLNDLSFEQLTELIEDV  468
            DQYQK VGVDLWNSH+ KMQE LKKL +VNR LR E+RQR+GE LNDL ++Q   LIED+
Sbjct  61   DQYQKAVGVDLWNSHYMKMQEHLKKLNEVNRNLRMEVRQRVGESLNDLGYDQTVNLIEDI  120

Query  469  DNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLVDHEGDYNS  645
            +NS+KLIRERKYKVIGNQI+T KKK+RNVEEIHR LLLE +ARQEDP YGLV++EGDYNS
Sbjct  121  ENSLKLIRERKYKVIGNQIDTSKKKLRNVEEIHRTLLLEFDARQEDPHYGLVENEGDYNS  180

Query  646  VLGFPNGGPRILALRLQPD  702
            VLGFPNGGPRI+ALRL P+
Sbjct  181  VLGFPNGGPRIIALRLPPN  199



>gb|AEM60183.1| MADS box transcription factor, partial [Halleria lucida]
Length=215

 Score =   335 bits (859),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 159/198 (80%), Positives = 184/198 (93%), Gaps = 1/198 (1%)
 Frame = +1

Query  109  KRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMISTSGKLHEYISPSTSTKQLF  288
            K+IENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMIS++ KLHEYISP+T+TKQLF
Sbjct  1    KKIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMISSTQKLHEYISPATTTKQLF  60

Query  289  DQYQKTVGVDLWNSHFEKMQEQLKKLRDVNRALRREIRQRMGEGLNDLSFEQLTELIEDV  468
            DQYQK VGVDLWN H+EKMQE LKKL++VNR LRREIRQRMGE LN+L ++Q+  LIE++
Sbjct  61   DQYQKAVGVDLWNPHYEKMQEHLKKLKEVNRNLRREIRQRMGESLNNLGYDQMVNLIEEM  120

Query  469  DNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLVDHEGDYNS  645
            D+S++LIR+RKYKVIGNQIET KKK+RNVEEIH+NL+LE +ARQEDP YGLV++EGDYNS
Sbjct  121  DSSLRLIRDRKYKVIGNQIETSKKKLRNVEEIHKNLVLEFDARQEDPHYGLVENEGDYNS  180

Query  646  VLGFPNGGPRILALRLQP  699
            VLGFPNGG RI+ALRL P
Sbjct  181  VLGFPNGGSRIIALRLPP  198



>gb|AEM60188.1| MADS box transcription factor, partial [Eustoma sp. VFI-2011]
Length=209

 Score =   334 bits (857),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 159/199 (80%), Positives = 185/199 (93%), Gaps = 1/199 (1%)
 Frame = +1

Query  109  KRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMISTSGKLHEYISPSTSTKQLF  288
            KRIENQTNRQVTYSKRRNGLFKKAHELTVLCDA+VSIIM+S++ KLHEYISP+ +TKQL 
Sbjct  1    KRIENQTNRQVTYSKRRNGLFKKAHELTVLCDARVSIIMVSSTHKLHEYISPTATTKQLI  60

Query  289  DQYQKTVGVDLWNSHFEKMQEQLKKLRDVNRALRREIRQRMGEGLNDLSFEQLTELIEDV  468
            DQYQK +GVDLW+SH+EKMQEQL+KL++VNR LR+EIRQRMGE LNDLS++QL  L+EDV
Sbjct  61   DQYQKALGVDLWSSHYEKMQEQLRKLKEVNRNLRKEIRQRMGESLNDLSYDQLGNLMEDV  120

Query  469  DNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLVDHEGDYNS  645
            DN+++ IRERK+KVIGNQIETHKKK+RNVEEIHRNLLLE +ARQEDP YGLVD+ GDYNS
Sbjct  121  DNALRGIRERKFKVIGNQIETHKKKLRNVEEIHRNLLLELDARQEDPHYGLVDNGGDYNS  180

Query  646  VLGFPNGGPRILALRLQPD  702
            V+GF NGGP +LALRLQP+
Sbjct  181  VVGFSNGGPCMLALRLQPN  199



>gb|ADU56837.1| MADS-box protein DEF subfamily [Coffea arabica]
 gb|AHW58030.1| AP3 [Coffea arabica]
 emb|CDP07446.1| unnamed protein product [Coffea canephora]
Length=224

 Score =   335 bits (858),  Expect = 8e-111, Method: Compositional matrix adjust.
 Identities = 167/207 (81%), Positives = 186/207 (90%), Gaps = 6/207 (3%)
 Frame = +1

Query  85   MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMISTSGKLHEYISP  264
            MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDA+VSIIM+S++ KLHEYISP
Sbjct  1    MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDARVSIIMVSSTQKLHEYISP  60

Query  265  STSTKQLFDQYQKTVGVDLWNSHFEKMQEQLKKLRDVNRALRREIRQRMGEGLNDLSFEQ  444
            + +TKQL DQYQK VGVDLW+SH EKMQEQLKKL++VNR LR+EIRQRMGE LNDLS+++
Sbjct  61   TATTKQLVDQYQKAVGVDLWSSHHEKMQEQLKKLKEVNRNLRKEIRQRMGESLNDLSYDE  120

Query  445  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLV  621
            L  LIEDVDNS++ IRERKYKVIGNQIETHKKKVRNVEEIHRNLLLE +AR EDP YGLV
Sbjct  121  LGFLIEDVDNSLRAIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLELDARGEDPHYGLV  180

Query  622  DH-EGDYNSVLGFPNGGPRILALRLQP  699
            D+  GDYN VLG+    PR+LALR QP
Sbjct  181  DNGGGDYNPVLGY----PRVLALRFQP  203



>gb|AAS45979.1| deficiens, partial [Syringa vulgaris]
Length=219

 Score =   334 bits (856),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 159/196 (81%), Positives = 183/196 (93%), Gaps = 1/196 (1%)
 Frame = +1

Query  109  KRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMISTSGKLHEYISPSTSTKQLF  288
            KRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMIS++ K+HEYISP++STKQLF
Sbjct  1    KRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMISSTQKIHEYISPTSSTKQLF  60

Query  289  DQYQKTVGVDLWNSHFEKMQEQLKKLRDVNRALRREIRQRMGEGLNDLSFEQLTELIEDV  468
            D YQ TVGVDLW +H+E+MQE L+KL+D+N+ LRREIRQRMGE LNDL+++Q+  LIEDV
Sbjct  61   DLYQTTVGVDLWITHYERMQEHLRKLKDINKNLRREIRQRMGESLNDLNYDQIVSLIEDV  120

Query  469  DNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLVDHEGDYNS  645
            D+S++ IRERKYKVIGNQIET KKK+RNVEEIHRN+LLE +ARQEDP YGLVD+EGDYNS
Sbjct  121  DDSLRKIRERKYKVIGNQIETSKKKLRNVEEIHRNILLEFDARQEDPQYGLVDNEGDYNS  180

Query  646  VLGFPNGGPRILALRL  693
            VLGFPNGGPRI+ALRL
Sbjct  181  VLGFPNGGPRIIALRL  196



>gb|AGA61764.1| apetala 3 [Cornus florida]
Length=228

 Score =   334 bits (856),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 162/207 (78%), Positives = 185/207 (89%), Gaps = 1/207 (0%)
 Frame = +1

Query  85   MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMISTSGKLHEYISP  264
            MARGKIQIKRIEN TNRQVTYSKRRNGLFKKA+ELTVLCDAKVSIIM S++GKLHE+ISP
Sbjct  1    MARGKIQIKRIENSTNRQVTYSKRRNGLFKKANELTVLCDAKVSIIMFSSTGKLHEFISP  60

Query  265  STSTKQLFDQYQKTVGVDLWNSHFEKMQEQLKKLRDVNRALRREIRQRMGEGLNDLSFEQ  444
            ST+TKQLFDQYQKT+G+DLW+SH+E+MQE LKKL+D+NR LRREIRQR GE LNDLS+E 
Sbjct  61   STTTKQLFDQYQKTLGIDLWSSHYERMQENLKKLKDINRKLRREIRQRTGESLNDLSYED  120

Query  445  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLV  621
            L  L ED++ S+K+IR+RKYKVIGNQIET+KKKVRNVEEIHRNLL E E + EDP YGLV
Sbjct  121  LLRLQEDMEISLKIIRDRKYKVIGNQIETYKKKVRNVEEIHRNLLHEFETKGEDPHYGLV  180

Query  622  DHEGDYNSVLGFPNGGPRILALRLQPD  702
            D+ GDY+SVLGF  G   ILALRLQP+
Sbjct  181  DNGGDYDSVLGFTGGAASILALRLQPN  207



>gb|AAS45969.1| deficiens, partial [Diplacus kelloggii]
Length=219

 Score =   333 bits (854),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 159/199 (80%), Positives = 183/199 (92%), Gaps = 1/199 (1%)
 Frame = +1

Query  109  KRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMISTSGKLHEYISPSTSTKQLF  288
            KRIENQTNRQVTYSKRRNGLFKKAHEL+VLCDAKVSIIMIS++ KLHEYISPS STKQ+F
Sbjct  1    KRIENQTNRQVTYSKRRNGLFKKAHELSVLCDAKVSIIMISSTHKLHEYISPSISTKQVF  60

Query  289  DQYQKTVGVDLWNSHFEKMQEQLKKLRDVNRALRREIRQRMGEGLNDLSFEQLTELIEDV  468
            DQYQK VGVDLWNSH++KMQ+ L+KL+DVNR LRREIRQRMGE LNDL +EQ+ +LIEDV
Sbjct  61   DQYQKAVGVDLWNSHYQKMQDHLQKLKDVNRNLRREIRQRMGESLNDLGYEQMVDLIEDV  120

Query  469  DNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLVDHEGDYNS  645
            D+S++LIRE+KYKVI N+IET KKK+RNVEEIHRNL LE +  QEDP YGLV++EGDYNS
Sbjct  121  DSSLRLIREKKYKVISNRIETSKKKLRNVEEIHRNLALEFDTLQEDPHYGLVENEGDYNS  180

Query  646  VLGFPNGGPRILALRLQPD  702
            VLGFP+GGPRI+ALRL P+
Sbjct  181  VLGFPHGGPRIIALRLPPN  199



>gb|ADU15474.1| AP3 [Actinidia eriantha]
Length=226

 Score =   332 bits (850),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 162/207 (78%), Positives = 186/207 (90%), Gaps = 1/207 (0%)
 Frame = +1

Query  85   MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMISTSGKLHEYISP  264
            MARGKIQIKRIEN TNRQVTYSKRRNGLFKKA+ELTVLCDAKVSIIMIS++GKLHEYISP
Sbjct  1    MARGKIQIKRIENSTNRQVTYSKRRNGLFKKANELTVLCDAKVSIIMISSTGKLHEYISP  60

Query  265  STSTKQLFDQYQKTVGVDLWNSHFEKMQEQLKKLRDVNRALRREIRQRMGEGLNDLSFEQ  444
            S STKQLFDQYQKT+G+DLW+SH+EKMQE LKKL+DVNR  RREIRQRMGE LN+LS+E 
Sbjct  61   SVSTKQLFDQYQKTLGIDLWSSHYEKMQEHLKKLKDVNRNFRREIRQRMGESLNELSYED  120

Query  445  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLV  621
            L  L +D++ S+K+IR+RKYKVIGNQIET+KKK+RNVEEIHR+LL E +A   DP YGLV
Sbjct  121  LRGLEQDMETSLKIIRDRKYKVIGNQIETYKKKLRNVEEIHRSLLHEFDAIGADPTYGLV  180

Query  622  DHEGDYNSVLGFPNGGPRILALRLQPD  702
            D+EGDY+SVL + +GG  ILALRLQPD
Sbjct  181  DNEGDYDSVLAYSDGGRGILALRLQPD  207



>gb|AAS45982.1| deficiens, partial [Pedicularis groenlandica]
Length=219

 Score =   331 bits (849),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 160/196 (82%), Positives = 181/196 (92%), Gaps = 1/196 (1%)
 Frame = +1

Query  109  KRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMISTSGKLHEYISPSTSTKQLF  288
            KRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMIS++ KLHEYISPST TKQ+F
Sbjct  1    KRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMISSTQKLHEYISPSTMTKQVF  60

Query  289  DQYQKTVGVDLWNSHFEKMQEQLKKLRDVNRALRREIRQRMGEGLNDLSFEQLTELIEDV  468
            DQYQK VGVDLW +H+EKMQ  L+KL+DVNR LR+EIRQRMGE LNDL +EQ+  LIED+
Sbjct  61   DQYQKAVGVDLWKTHYEKMQGHLQKLKDVNRNLRKEIRQRMGECLNDLGYEQMVNLIEDI  120

Query  469  DNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLVDHEGDYNS  645
            DNS++LIRERKYKVIGNQIET KKK+RNVEEIHRNL+LE +AR+EDP YGLV++EGDYNS
Sbjct  121  DNSLRLIRERKYKVIGNQIETGKKKLRNVEEIHRNLVLEFDAREEDPHYGLVENEGDYNS  180

Query  646  VLGFPNGGPRILALRL  693
            VLG+PNGG RI+ALRL
Sbjct  181  VLGYPNGGSRIIALRL  196



>gb|AEM60182.1| MADS box transcription factor, partial [Antirrhinum sp. VFI-2011]
Length=216

 Score =   330 bits (846),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 161/198 (81%), Positives = 181/198 (91%), Gaps = 3/198 (2%)
 Frame = +1

Query  109  KRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMISTSGKLHEYISPSTSTKQLF  288
            KRIENQTNRQVTYSKRRNGLFKKAHEL+VLCDAKVSIIMIS++ KLHEYISPST+TKQLF
Sbjct  1    KRIENQTNRQVTYSKRRNGLFKKAHELSVLCDAKVSIIMISSTSKLHEYISPSTATKQLF  60

Query  289  DQYQKTVGVDLWNSHFEKMQEQLKKLRDVNRALRREIRQRMGEGLNDLSFEQLTELIEDV  468
            DQYQK VGVDLWNSH++KMQE LKKL +VNR LR+EIRQRMGE LNDL +EQ+  LIED+
Sbjct  61   DQYQKAVGVDLWNSHYQKMQEHLKKLNEVNRNLRKEIRQRMGESLNDLGYEQIVNLIEDI  120

Query  469  DNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLVDHEG--DY  639
            DNS+KLIRERKYKVI NQI+T KKKVRNVEEIHRNL+LE +AR+EDP +GLV++EG   Y
Sbjct  121  DNSLKLIRERKYKVISNQIDTSKKKVRNVEEIHRNLVLEFDARREDPHFGLVENEGHDHY  180

Query  640  NSVLGFPNGGPRILALRL  693
            NSVLGFPNGGPRI+ LRL
Sbjct  181  NSVLGFPNGGPRIITLRL  198



>gb|AAS45972.1| deficiens, partial [Leucocarpus perfoliatus]
Length=227

 Score =   330 bits (847),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 156/196 (80%), Positives = 182/196 (93%), Gaps = 1/196 (1%)
 Frame = +1

Query  109  KRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMISTSGKLHEYISPSTSTKQLF  288
            KRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSI+MIS++ KLHEYISPS +TKQLF
Sbjct  1    KRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSILMISSTQKLHEYISPSITTKQLF  60

Query  289  DQYQKTVGVDLWNSHFEKMQEQLKKLRDVNRALRREIRQRMGEGLNDLSFEQLTELIEDV  468
            DQYQK VGVDLWNSH+E+MQE LKKL++VNR LRREIRQR+GE LNDL ++Q+  LIED+
Sbjct  61   DQYQKAVGVDLWNSHYERMQEHLKKLKEVNRNLRREIRQRIGESLNDLGYDQMVNLIEDI  120

Query  469  DNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLVDHEGDYNS  645
            DNS+++IRE+KYK I NQI+T KKK+RNVEEI+RNL+LE +ARQEDP YGLV++EGDYNS
Sbjct  121  DNSLRIIREKKYKAISNQIDTSKKKLRNVEEINRNLVLEFDARQEDPHYGLVENEGDYNS  180

Query  646  VLGFPNGGPRILALRL  693
            +LGFPNGGPRI+ALRL
Sbjct  181  LLGFPNGGPRIIALRL  196



>gb|AAS45967.1| deficiens [Mimulus ringens]
Length=235

 Score =   331 bits (848),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 156/207 (75%), Positives = 186/207 (90%), Gaps = 1/207 (0%)
 Frame = +1

Query  85   MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMISTSGKLHEYISP  264
            MARGKIQIK+IENQTNRQVTYSKRRNGLFKKAHEL+VLCDAKVSI+M+S+S KLHEYISP
Sbjct  1    MARGKIQIKKIENQTNRQVTYSKRRNGLFKKAHELSVLCDAKVSIVMVSSSQKLHEYISP  60

Query  265  STSTKQLFDQYQKTVGVDLWNSHFEKMQEQLKKLRDVNRALRREIRQRMGEGLNDLSFEQ  444
            + +TKQ+FD YQ  VGVDLW+SH++KMQE L+KL++VNR L REIRQR+GE LNDL ++Q
Sbjct  61   TITTKQVFDDYQTAVGVDLWSSHYQKMQEHLQKLKEVNRNLTREIRQRVGESLNDLGYDQ  120

Query  445  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLV  621
            +  LIED+D S+ +IRE+KYKVIGN+IET KKKVRNVEEIHRNL+LE EARQEDP YGLV
Sbjct  121  MVNLIEDIDKSLGVIREKKYKVIGNRIETGKKKVRNVEEIHRNLVLEFEARQEDPHYGLV  180

Query  622  DHEGDYNSVLGFPNGGPRILALRLQPD  702
            ++EGDYNS LGF +GGPRI+AL + P+
Sbjct  181  ENEGDYNSFLGFAHGGPRIVALHVPPN  207



>gb|AAS45981.1| deficiens, partial [Verbena officinalis]
Length=226

 Score =   330 bits (846),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 161/201 (80%), Positives = 184/201 (92%), Gaps = 4/201 (2%)
 Frame = +1

Query  109  KRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMISTSGKLHEYISPSTSTKQLF  288
            K+IENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMIS++ KLHEYISPST+TKQ+F
Sbjct  1    KKIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMISSTQKLHEYISPSTATKQVF  60

Query  289  DQYQKTVGVDLWNSHFEKMQEQLKKLRDVNRALRREIRQRMGEGLNDLSFEQLTELIEDV  468
            DQYQK VGVDLW SH+EKMQE LKKL++VNR LR+EIRQRMGE LNDL ++ +  LIED+
Sbjct  61   DQYQKAVGVDLWQSHYEKMQEHLKKLKEVNRNLRKEIRQRMGESLNDLGYDHMVNLIEDM  120

Query  469  DNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLVDHEGDYNS  645
            DNS++LIRERKYKVIGNQIET KKK+RNVEEIHRNL+LE +ARQEDP Y LV++EGDYNS
Sbjct  121  DNSLRLIRERKYKVIGNQIETSKKKLRNVEEIHRNLVLEFDARQEDPHYALVENEGDYNS  180

Query  646  VLGFPN--GGPRILALRL-QP  699
            V+G+PN  GGPRI+ALRL QP
Sbjct  181  VIGYPNGGGGPRIIALRLPQP  201



>gb|AEM60172.1| MADS box transcription factor, partial [Betonica officinalis]
Length=222

 Score =   329 bits (844),  Expect = 8e-109, Method: Compositional matrix adjust.
 Identities = 155/198 (78%), Positives = 182/198 (92%), Gaps = 1/198 (1%)
 Frame = +1

Query  109  KRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMISTSGKLHEYISPSTSTKQLF  288
            K+IENQTNRQVTYSKRRNGLFKKAHELTVLCDAK+SI+MI ++ KLHEYISP+ +TK +F
Sbjct  1    KKIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKISIVMIPSTQKLHEYISPTITTKSMF  60

Query  289  DQYQKTVGVDLWNSHFEKMQEQLKKLRDVNRALRREIRQRMGEGLNDLSFEQLTELIEDV  468
            DQYQK VGVDLW+SH+EKMQE  KKL++VNR LRREIRQRMGE LNDL +EQ+ +LIED+
Sbjct  61   DQYQKAVGVDLWSSHYEKMQENSKKLKEVNRNLRREIRQRMGECLNDLGYEQMVDLIEDM  120

Query  469  DNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLVDHEGDYNS  645
            D S++LIR+RKYKVIGNQI+THKKK RNVEEIHR+L+LE +ARQEDP YGLV++EGDYNS
Sbjct  121  DKSLRLIRDRKYKVIGNQIDTHKKKFRNVEEIHRSLVLEFDARQEDPHYGLVENEGDYNS  180

Query  646  VLGFPNGGPRILALRLQP  699
            VLGFP+GGPRI+ALRL P
Sbjct  181  VLGFPHGGPRIIALRLPP  198



>gb|AEM60174.1| MADS box transcription factor, partial [Sesamum indicum]
Length=217

 Score =   329 bits (843),  Expect = 9e-109, Method: Compositional matrix adjust.
 Identities = 156/196 (80%), Positives = 179/196 (91%), Gaps = 1/196 (1%)
 Frame = +1

Query  109  KRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMISTSGKLHEYISPSTSTKQLF  288
            K+IENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSI+MIS++ KLHEYISP+ +TKQLF
Sbjct  1    KKIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSILMISSTQKLHEYISPTITTKQLF  60

Query  289  DQYQKTVGVDLWNSHFEKMQEQLKKLRDVNRALRREIRQRMGEGLNDLSFEQLTELIEDV  468
            DQYQ    VDLWNSH+EKMQ+ LKKL++VNR LRREIRQRMGE LNDL + ++  LIED+
Sbjct  61   DQYQTAATVDLWNSHYEKMQQHLKKLKEVNRNLRREIRQRMGESLNDLGYGEMVNLIEDM  120

Query  469  DNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLVDHEGDYNS  645
            DNS++LIR+RKYKVIGNQI+T KKK+RNVEEIHRNL LE +ARQEDP YGLV++EGDYNS
Sbjct  121  DNSLRLIRDRKYKVIGNQIDTSKKKLRNVEEIHRNLALEFDARQEDPQYGLVENEGDYNS  180

Query  646  VLGFPNGGPRILALRL  693
            VLGFPNGGPRI+ALRL
Sbjct  181  VLGFPNGGPRIIALRL  196



>gb|AEM60195.1| MADS box transcription factor, partial [Ligustrum vulgare]
Length=210

 Score =   328 bits (841),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 157/196 (80%), Positives = 181/196 (92%), Gaps = 1/196 (1%)
 Frame = +1

Query  109  KRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMISTSGKLHEYISPSTSTKQLF  288
            KRIENQTNRQVTYSKRRNGLFKKAHEL+VLCDAKVSIIMIS++ K+HEYISP++STKQLF
Sbjct  1    KRIENQTNRQVTYSKRRNGLFKKAHELSVLCDAKVSIIMISSTQKIHEYISPTSSTKQLF  60

Query  289  DQYQKTVGVDLWNSHFEKMQEQLKKLRDVNRALRREIRQRMGEGLNDLSFEQLTELIEDV  468
            D YQK VGVDLW  H+E+MQE L+KL+D+N+ LRREIRQRMGE LNDL+++Q+  LIEDV
Sbjct  61   DLYQKAVGVDLWIIHYERMQEHLRKLKDINKNLRREIRQRMGESLNDLNYDQIVSLIEDV  120

Query  469  DNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLVDHEGDYNS  645
            D+S++ IRERKYKVI NQIET KKK+RNVEEIHRN+LLE +ARQEDP YGLVD+EGDYNS
Sbjct  121  DDSLRKIRERKYKVISNQIETGKKKLRNVEEIHRNMLLEFDARQEDPQYGLVDNEGDYNS  180

Query  646  VLGFPNGGPRILALRL  693
            VLGFPNGGPRI+ALRL
Sbjct  181  VLGFPNGGPRIIALRL  196



>ref|XP_011083640.1| PREDICTED: floral homeotic protein DEFICIENS-like [Sesamum indicum]
Length=217

 Score =   328 bits (841),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 156/189 (83%), Positives = 177/189 (94%), Gaps = 1/189 (1%)
 Frame = +1

Query  85   MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMISTSGKLHEYISP  264
            MARGKIQIK+IENQTNRQVTYSKRRNGLFKKAHELTVLCDA+VSIIMIS++ KLHEYISP
Sbjct  1    MARGKIQIKKIENQTNRQVTYSKRRNGLFKKAHELTVLCDARVSIIMISSTQKLHEYISP  60

Query  265  STSTKQLFDQYQKTVGVDLWNSHFEKMQEQLKKLRDVNRALRREIRQRMGEGLNDLSFEQ  444
            ST+TKQ+FDQYQK V VDLW+SH+EKMQE LKKL+DVNR LRREIRQRMGE LNDL ++Q
Sbjct  61   STTTKQVFDQYQKAVAVDLWSSHYEKMQEHLKKLKDVNRNLRREIRQRMGESLNDLGYDQ  120

Query  445  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLV  621
            +  LIED+D+S++LIRERKYKVIGNQIET KKK+RNVEEIHRNL+LE +ARQEDP YGLV
Sbjct  121  MVNLIEDMDSSLRLIRERKYKVIGNQIETSKKKLRNVEEIHRNLVLELDARQEDPHYGLV  180

Query  622  DHEGDYNSV  648
            +H+GDYNSV
Sbjct  181  EHDGDYNSV  189



>gb|AEM60186.1| MADS box transcription factor, partial [Streptocarpus x hybridus]
Length=207

 Score =   327 bits (839),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 160/196 (82%), Positives = 181/196 (92%), Gaps = 4/196 (2%)
 Frame = +1

Query  109  KRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMISTSGKLHEYISPSTSTKQLF  288
            KRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMIS++ KLHEYISPS++TKQLF
Sbjct  1    KRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMISSTQKLHEYISPSSTTKQLF  60

Query  289  DQYQKTVGVDLWNSHFEKMQEQLKKLRDVNRALRREIRQRMGEGLNDLSFEQLTELIEDV  468
            DQYQK VGVDLW+SH+EKMQE LKKL++VNR LRREIRQRMGE LNDL + Q+  LIED+
Sbjct  61   DQYQKAVGVDLWSSHYEKMQEHLKKLKEVNRNLRREIRQRMGESLNDLDYHQMVNLIEDM  120

Query  469  DNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLVDHEGDYNS  645
            D+S+K+IRERKYKVIGNQIET KKK+RNVEEIHRNL+LE +ARQEDP YGLVD+EGDYN+
Sbjct  121  DSSLKIIRERKYKVIGNQIETGKKKLRNVEEIHRNLVLEFDARQEDPHYGLVDNEGDYNT  180

Query  646  VLGFPNGGPRILALRL  693
            VLG+PN   RI+ALRL
Sbjct  181  VLGYPN---RIIALRL  193



>gb|AEM60193.1| MADS box transcription factor, partial [Jasminum humile]
Length=210

 Score =   327 bits (839),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 156/196 (80%), Positives = 181/196 (92%), Gaps = 1/196 (1%)
 Frame = +1

Query  109  KRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMISTSGKLHEYISPSTSTKQLF  288
            KRIENQTNRQVTYSKRRNGLFKKAHELTVLCDA+VSIIMIS++ K+HEYISP+T+TKQLF
Sbjct  1    KRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAEVSIIMISSTQKIHEYISPATTTKQLF  60

Query  289  DQYQKTVGVDLWNSHFEKMQEQLKKLRDVNRALRREIRQRMGEGLNDLSFEQLTELIEDV  468
            D+YQK VGVDLW +H+EKMQ+ L+ L+D+N+ LRREIRQRMGE LNDL+++Q+  LIEDV
Sbjct  61   DKYQKAVGVDLWITHYEKMQQHLRNLKDINKNLRREIRQRMGESLNDLNYDQIVNLIEDV  120

Query  469  DNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLVDHEGDYNS  645
            D S++ IRERKYKVI NQIET KKK+RNVEEIHRN+LLE EARQEDP YGLVD+EGDYNS
Sbjct  121  DESLRKIRERKYKVITNQIETSKKKLRNVEEIHRNILLEFEARQEDPQYGLVDNEGDYNS  180

Query  646  VLGFPNGGPRILALRL  693
            VLGFP+GGPRI+ALRL
Sbjct  181  VLGFPDGGPRIIALRL  196



>gb|AEM60190.1| MADS box transcription factor, partial [Pentas lanceolata]
Length=207

 Score =   327 bits (838),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 162/198 (82%), Positives = 179/198 (90%), Gaps = 4/198 (2%)
 Frame = +1

Query  109  KRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMISTSGKLHEYISPSTSTKQLF  288
            KRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIM+S++ KLHEYISPST+TKQ+ 
Sbjct  1    KRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMVSSTHKLHEYISPSTTTKQMV  60

Query  289  DQYQKTVGVDLWNSHFEKMQEQLKKLRDVNRALRREIRQRMGEGLNDLSFEQLTELIEDV  468
            DQYQK VGVDLWNSH+E+MQEQLKKL+DVNR LRRE+RQRMGE LNDLS+E+L  LIEDV
Sbjct  61   DQYQKVVGVDLWNSHYERMQEQLKKLKDVNRNLRREMRQRMGESLNDLSYEELGVLIEDV  120

Query  469  DNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLVDHEGDYNS  645
            DNSI+ IRERK KVI NQIETHKKK+RNVEEIHRNLLLE +ARQEDP YGLVD+ GDY+S
Sbjct  121  DNSIRSIRERKIKVISNQIETHKKKLRNVEEIHRNLLLELDARQEDPHYGLVDNGGDYSS  180

Query  646  VLGFPNGGPRILALRLQP  699
            VL      PR+LALRLQP
Sbjct  181  VLA---AYPRLLALRLQP  195



>gb|AAS45973.1| deficiens, partial [Diplacus kelloggii]
Length=225

 Score =   327 bits (839),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 154/196 (79%), Positives = 181/196 (92%), Gaps = 1/196 (1%)
 Frame = +1

Query  109  KRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMISTSGKLHEYISPSTSTKQLF  288
            KRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSI+MIS++ KLHEYISPS +TKQ+F
Sbjct  1    KRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSILMISSTQKLHEYISPSITTKQMF  60

Query  289  DQYQKTVGVDLWNSHFEKMQEQLKKLRDVNRALRREIRQRMGEGLNDLSFEQLTELIEDV  468
            DQYQK VGVDLWNSH++KMQE LKKL++VNR LRREIRQR+GE LNDL ++Q+  LIED+
Sbjct  61   DQYQKAVGVDLWNSHYQKMQEHLKKLKEVNRNLRREIRQRIGESLNDLGYDQMVNLIEDI  120

Query  469  DNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLVDHEGDYNS  645
            DNS+++IRE+KYK I +QI+T KKK+RNVEEI+RNL LE +ARQEDP YGLV++EGDYNS
Sbjct  121  DNSLRIIREKKYKAINSQIDTSKKKLRNVEEINRNLALEFDARQEDPHYGLVENEGDYNS  180

Query  646  VLGFPNGGPRILALRL  693
            +LGFPNGGPRI+ALRL
Sbjct  181  LLGFPNGGPRIIALRL  196



>gb|AEM60192.1| MADS box transcription factor, partial [Jasminum mesnyi]
Length=210

 Score =   327 bits (837),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 156/196 (80%), Positives = 179/196 (91%), Gaps = 1/196 (1%)
 Frame = +1

Query  109  KRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMISTSGKLHEYISPSTSTKQLF  288
            KRIENQTNRQVTYSKRRNGLFKKAHELTVLCDA+VSIIMIS++ K+HEYISP+T+TKQLF
Sbjct  1    KRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAEVSIIMISSTQKIHEYISPTTTTKQLF  60

Query  289  DQYQKTVGVDLWNSHFEKMQEQLKKLRDVNRALRREIRQRMGEGLNDLSFEQLTELIEDV  468
            D+YQK VGVDLW +H+EKMQE L+ L+D+N+ LR EIRQRMGE LNDL+++Q+  LIEDV
Sbjct  61   DKYQKAVGVDLWITHYEKMQEHLRNLKDINKNLRTEIRQRMGESLNDLNYDQVVNLIEDV  120

Query  469  DNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLVDHEGDYNS  645
            D S++ IRERKYKVI NQIET KKK+RNVEEIHRN+LLE EARQEDP YGLVD+EGDYNS
Sbjct  121  DESLRKIRERKYKVITNQIETSKKKLRNVEEIHRNILLEFEARQEDPQYGLVDNEGDYNS  180

Query  646  VLGFPNGGPRILALRL  693
            VLGFPN GPRI+ALRL
Sbjct  181  VLGFPNAGPRIIALRL  196



>gb|AGA61754.1| apetala 3 [Cornus kousa]
Length=228

 Score =   327 bits (838),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 157/207 (76%), Positives = 184/207 (89%), Gaps = 1/207 (0%)
 Frame = +1

Query  85   MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMISTSGKLHEYISP  264
            MARGKIQIKRIEN TNRQVTYSKRRNGLFKKA+ELTVLCDAKVSIIM S++GKLHE+ISP
Sbjct  1    MARGKIQIKRIENSTNRQVTYSKRRNGLFKKANELTVLCDAKVSIIMFSSTGKLHEFISP  60

Query  265  STSTKQLFDQYQKTVGVDLWNSHFEKMQEQLKKLRDVNRALRREIRQRMGEGLNDLSFEQ  444
            ST+TKQLFDQYQKT+G+DLW+SH+E+MQE LKKL+++NR  RREIRQR GE LNDLS+E 
Sbjct  61   STTTKQLFDQYQKTLGIDLWSSHYERMQENLKKLKEINRKFRREIRQRTGESLNDLSYED  120

Query  445  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLV  621
            L  L ED++ S+K+IR+RKYKVIGNQIET+KKK+RNVEEIHRNLL E + + EDP YGLV
Sbjct  121  LLRLQEDMEISLKIIRDRKYKVIGNQIETYKKKLRNVEEIHRNLLHEFDIKGEDPHYGLV  180

Query  622  DHEGDYNSVLGFPNGGPRILALRLQPD  702
            D+ GDY+SVLGF  G   +LALRLQP+
Sbjct  181  DNGGDYDSVLGFTGGAASVLALRLQPN  207



>gb|AAS45986.1| deficiens, partial [Verbena officinalis]
Length=225

 Score =   326 bits (835),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 153/195 (78%), Positives = 179/195 (92%), Gaps = 1/195 (1%)
 Frame = +1

Query  109  KRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMISTSGKLHEYISPSTSTKQLF  288
            K+IENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSI+MIS++ KLHEYISP  +TKQLF
Sbjct  1    KKIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSILMISSTQKLHEYISPPATTKQLF  60

Query  289  DQYQKTVGVDLWNSHFEKMQEQLKKLRDVNRALRREIRQRMGEGLNDLSFEQLTELIEDV  468
            D YQK VGVDLW +H+EKMQE L+KL++VNR LRREIRQRMGE LND+ ++ +  LIED+
Sbjct  61   DNYQKAVGVDLWQTHYEKMQEHLRKLKEVNRNLRREIRQRMGESLNDMGYDHMVNLIEDM  120

Query  469  DNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLVDHEGDYNS  645
            DNS++LIR+RKYKVIGNQI+T KKK+RNVEEIH+NL+LE +ARQEDP YGLV++EGDYNS
Sbjct  121  DNSLRLIRDRKYKVIGNQIDTSKKKLRNVEEIHKNLVLEFDARQEDPHYGLVENEGDYNS  180

Query  646  VLGFPNGGPRILALR  690
            VLGFPNGGPRI+ALR
Sbjct  181  VLGFPNGGPRIIALR  195



>dbj|BAG24492.1| DEFICIENS-like MADS-box protein [Torenia fournieri]
Length=234

 Score =   326 bits (835),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 157/208 (75%), Positives = 184/208 (88%), Gaps = 2/208 (1%)
 Frame = +1

Query  85   MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMISTSGKLHEYISP  264
            MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMIS++ KLHEYISP
Sbjct  1    MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMISSTQKLHEYISP  60

Query  265  STSTKQLFDQYQKTVGVDLWNSHFEKMQEQLKKLRDVNRALRREIRQRMGEGLNDLSFEQ  444
            ST+TKQ+FDQYQK VGVDLW + ++KMQE LKKL++VNR L+REIRQRMGE LND+S+E 
Sbjct  61   STTTKQVFDQYQKAVGVDLWQTSYQKMQEHLKKLKEVNRNLKREIRQRMGECLNDMSYEH  120

Query  445  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLV  621
            +  LIED+DNS+++IRERKYKVI +QIET KKK+RNVEEIH+ L+ E +AR EDP YGLV
Sbjct  121  MVNLIEDIDNSLRVIRERKYKVITSQIETGKKKLRNVEEIHKKLVFEYDARHEDPHYGLV  180

Query  622  DHEG-DYNSVLGFPNGGPRILALRLQPD  702
            ++E  DY+SVLGFPN G R +ALR  P+
Sbjct  181  ENEAVDYHSVLGFPNNGSRTIALRYVPN  208



>gb|AEM60169.1| MADS box transcription factor, partial [Buddleja davidii]
Length=211

 Score =   324 bits (831),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 156/199 (78%), Positives = 180/199 (90%), Gaps = 1/199 (1%)
 Frame = +1

Query  109  KRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMISTSGKLHEYISPSTSTKQLF  288
            KRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMIS++ KLHEYI+P+ +TKQLF
Sbjct  1    KRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMISSTQKLHEYITPNITTKQLF  60

Query  289  DQYQKTVGVDLWNSHFEKMQEQLKKLRDVNRALRREIRQRMGEGLNDLSFEQLTELIEDV  468
            DQYQK V  DLWNSH+EKMQE LKKL++VNR LRREIRQRMGE LNDL ++Q+  LIE++
Sbjct  61   DQYQKNVRADLWNSHYEKMQEHLKKLKEVNRNLRREIRQRMGESLNDLGYDQMVNLIEEM  120

Query  469  DNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLVDHEGDYNS  645
            D S+ LIR+RKYKVI NQI+T KKK+RNVEEIHR+LLLE +ARQ+DP YGLV++EGDYNS
Sbjct  121  DKSVTLIRDRKYKVISNQIDTGKKKLRNVEEIHRSLLLEFDARQDDPHYGLVENEGDYNS  180

Query  646  VLGFPNGGPRILALRLQPD  702
            VLGFPNGG RI+ALRL P+
Sbjct  181  VLGFPNGGSRIVALRLPPN  199



>gb|AAS45971.1| deficiens [Mimulus ringens]
Length=244

 Score =   325 bits (834),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 154/203 (76%), Positives = 185/203 (91%), Gaps = 1/203 (0%)
 Frame = +1

Query  85   MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMISTSGKLHEYISP  264
            MARGKIQIK+IENQTNRQVTYSKRRNGLFKKAHELTVLCDA+VSI+M+S++ KLHEYISP
Sbjct  1    MARGKIQIKKIENQTNRQVTYSKRRNGLFKKAHELTVLCDAQVSILMVSSTQKLHEYISP  60

Query  265  STSTKQLFDQYQKTVGVDLWNSHFEKMQEQLKKLRDVNRALRREIRQRMGEGLNDLSFEQ  444
            S +TKQLFD+YQ  VG+DLW+SH+EKMQE LKK ++VNR LRREIRQR+GE LNDL ++Q
Sbjct  61   SITTKQLFDKYQNAVGLDLWSSHYEKMQEHLKKQKEVNRNLRREIRQRVGESLNDLGYDQ  120

Query  445  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLV  621
            +  LIED++NS++LIRE+KYK I   I+T +KKVRNVEEIHR+LLL+ +ARQEDP YGLV
Sbjct  121  IVNLIEDINNSLELIREKKYKSISGLIDTTRKKVRNVEEIHRSLLLDYDARQEDPHYGLV  180

Query  622  DHEGDYNSVLGFPNGGPRILALR  690
            ++EGDYNS+LGFPNGGPRI+ALR
Sbjct  181  ENEGDYNSLLGFPNGGPRIIALR  203



>gb|AEM60167.1| MADS box transcription factor, partial [Lantana camara]
Length=213

 Score =   324 bits (830),  Expect = 8e-107, Method: Compositional matrix adjust.
 Identities = 155/197 (79%), Positives = 182/197 (92%), Gaps = 2/197 (1%)
 Frame = +1

Query  109  KRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMISTSGKLHEYISPSTSTKQLF  288
            KRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSI+MIST+ KLHEYISP+T+TKQLF
Sbjct  1    KRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSILMISTTQKLHEYISPATTTKQLF  60

Query  289  DQYQKTVGVDLWNSHFEKMQEQLKKLRDVNRALRREIRQRMGEGLNDLSFEQLTELIEDV  468
            D YQ+ VGVDLW +H+EKMQE L+KL++VN+ LR+EIRQRMGE LNDL ++Q+  LI+D+
Sbjct  61   DYYQEAVGVDLWQTHYEKMQEHLRKLKEVNKNLRKEIRQRMGESLNDLGYDQMVTLIDDM  120

Query  469  DNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLVDHEGDYNS  645
            DNS++LIR+RKYKVIGNQI+T KKKVRNVEEIH+NL+LE +ARQEDP YGLV++EGDYNS
Sbjct  121  DNSLRLIRDRKYKVIGNQIDTSKKKVRNVEEIHKNLVLEFDARQEDPHYGLVENEGDYNS  180

Query  646  VLGFPN-GGPRILALRL  693
            VLGFPN GGP I+ALRL
Sbjct  181  VLGFPNGGGPGIIALRL  197



>gb|AEM60200.1| MADS box transcription factor, partial [Solanum pyracanthum]
Length=222

 Score =   324 bits (830),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 158/198 (80%), Positives = 181/198 (91%), Gaps = 6/198 (3%)
 Frame = +1

Query  109  KRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMISTSGKLHEYISPSTSTKQLF  288
            K+IENQTNRQVTYSKRRNGLFKKA+ELTVLCDA+VSI+MIS++GKLHE+ISPS +TKQLF
Sbjct  1    KKIENQTNRQVTYSKRRNGLFKKANELTVLCDAQVSIVMISSTGKLHEFISPSITTKQLF  60

Query  289  DQYQKTVGVDLWNSHFEKMQEQLKKLRDVNRALRREIRQRMGEGLNDLSFEQLTELIEDV  468
            D YQKT+GVD+W SH+EKMQEQL+KL+DVNR LR+EIRQRMGE LNDL++EQL EL+E+V
Sbjct  61   DLYQKTIGVDIWTSHYEKMQEQLRKLKDVNRNLRKEIRQRMGESLNDLNYEQLEELMENV  120

Query  469  DNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDPY-GLVDHEGDYNS  645
            DNS+K+IRERKYKVI NQI+T KKKVRNVEEIHRNLLLE +ARQEDPY GLV+ EGDYNS
Sbjct  121  DNSLKIIRERKYKVISNQIDTFKKKVRNVEEIHRNLLLEFDARQEDPYGGLVEQEGDYNS  180

Query  646  VLGFPNGGPRILALRLQP  699
            VL     G RILALRLQP
Sbjct  181  VL-----GARILALRLQP  193



>gb|AEM60168.1| MADS box transcription factor, partial [Lantana camara]
Length=217

 Score =   323 bits (828),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 154/200 (77%), Positives = 184/200 (92%), Gaps = 2/200 (1%)
 Frame = +1

Query  109  KRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMISTSGKLHEYISPSTSTKQLF  288
            KRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSI+MIS++ KLHEYISP+ +TKQLF
Sbjct  1    KRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSILMISSTQKLHEYISPAMTTKQLF  60

Query  289  DQYQKTVGVDLWNSHFEKMQEQLKKLRDVNRALRREIRQRMGEGLNDLSFEQLTELIEDV  468
            D YQ+ VGVDLW +H+EKMQE L+KL++V++ LR+EIRQRMGE LNDL ++Q+  LI+D+
Sbjct  61   DYYQEAVGVDLWQTHYEKMQEHLRKLKEVSKNLRKEIRQRMGESLNDLGYDQMVNLIDDM  120

Query  469  DNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLVDHEGDYNS  645
            DNS++LIR+RKYKVIGNQI+T KKKVRNVEEIH+NL+LE +ARQEDP YGLV++EGDYNS
Sbjct  121  DNSLRLIRDRKYKVIGNQIDTSKKKVRNVEEIHKNLVLEFDARQEDPHYGLVENEGDYNS  180

Query  646  VLGFPN-GGPRILALRLQPD  702
            VLGFPN GGPRI+ALRL P+
Sbjct  181  VLGFPNGGGPRIIALRLPPN  200



>gb|AEM60187.1| MADS box transcription factor, partial [Gardenia jasminoides]
Length=207

 Score =   323 bits (827),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 160/199 (80%), Positives = 181/199 (91%), Gaps = 6/199 (3%)
 Frame = +1

Query  109  KRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMISTSGKLHEYISPSTSTKQLF  288
            KRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIM+S++ KLH+YISP+ +TKQL 
Sbjct  1    KRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMVSSTQKLHDYISPTATTKQLV  60

Query  289  DQYQKTVGVDLWNSHFEKMQEQLKKLRDVNRALRREIRQRMGEGLNDLSFEQLTELIEDV  468
            DQYQK VGVDLW+SH+EKMQEQLKKL+DVNR LRREIRQRMGE LN+LS+++L  LIEDV
Sbjct  61   DQYQKAVGVDLWSSHYEKMQEQLKKLKDVNRNLRREIRQRMGESLNELSYDELGFLIEDV  120

Query  469  DNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLVDH-EGDYN  642
            DNS++ IRERK+KVIGNQIETH+KK RNVEEIHRNLLL+ EARQEDP YGLVD+  GDYN
Sbjct  121  DNSLRSIRERKFKVIGNQIETHRKKFRNVEEIHRNLLLQLEARQEDPHYGLVDNGGGDYN  180

Query  643  SVLGFPNGGPRILALRLQP  699
            SVLG+    PR+LALRLQP
Sbjct  181  SVLGY----PRVLALRLQP  195



>gb|ACK43086.1| deficiens 2 protein [Eustoma exaltatum subsp. russellianum]
Length=226

 Score =   323 bits (829),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 153/207 (74%), Positives = 185/207 (89%), Gaps = 1/207 (0%)
 Frame = +1

Query  85   MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMISTSGKLHEYISP  264
            MARGKIQIK+IENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIM+S++ KLHE+ISP
Sbjct  1    MARGKIQIKKIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMLSSTSKLHEFISP  60

Query  265  STSTKQLFDQYQKTVGVDLWNSHFEKMQEQLKKLRDVNRALRREIRQRMGEGLNDLSFEQ  444
            +T+TKQL DQYQK +GVDLW+SH+EKMQEQLKKL+DVNR LRREIRQR+GE LND+S+++
Sbjct  61   TTTTKQLMDQYQKALGVDLWSSHYEKMQEQLKKLKDVNRNLRREIRQRLGESLNDMSYDE  120

Query  445  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLV  621
            L +L +++D S+K IRERK K I NQIET KKKV++  +IHRNLLLE +ARQEDP YGLV
Sbjct  121  LRKLTDEIDESLKAIRERKIKAISNQIETLKKKVKSANDIHRNLLLELDARQEDPHYGLV  180

Query  622  DHEGDYNSVLGFPNGGPRILALRLQPD  702
            ++ GDY+S++G PNGG  +LAL LQP+
Sbjct  181  ENAGDYHSLIGLPNGGHHVLALCLQPN  207



>gb|AEM60170.1| MADS box transcription factor, partial [Clerodendrum infortunatum]
Length=216

 Score =   322 bits (826),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 151/199 (76%), Positives = 184/199 (92%), Gaps = 1/199 (1%)
 Frame = +1

Query  109  KRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMISTSGKLHEYISPSTSTKQLF  288
            K+IENQTNRQVTYSKRRNGLFKKAHELTVLCDAK+SIIMIS++ KLHEYISP+ +TKQ+F
Sbjct  1    KKIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKISIIMISSTQKLHEYISPTITTKQMF  60

Query  289  DQYQKTVGVDLWNSHFEKMQEQLKKLRDVNRALRREIRQRMGEGLNDLSFEQLTELIEDV  468
            D+YQ+ VGVDLW+SH+E+MQE LKKL++VNR LR+EIRQR G+ LNDL +EQ+ +LIED+
Sbjct  61   DKYQEAVGVDLWSSHYERMQEHLKKLKEVNRNLRKEIRQRTGDCLNDLGYEQIVDLIEDM  120

Query  469  DNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLVDHEGDYNS  645
            + S+KLIRE+KYKVIGNQI+T KKK+RNVEEIHR+L+LE +ARQEDP YGLV++EGDYNS
Sbjct  121  NTSVKLIREKKYKVIGNQIDTSKKKLRNVEEIHRSLVLEFDARQEDPHYGLVENEGDYNS  180

Query  646  VLGFPNGGPRILALRLQPD  702
            VLGFP+GGPRI+AL L P+
Sbjct  181  VLGFPHGGPRIIALHLPPN  199



>gb|AAS45968.1| deficiens, partial [Leucocarpus perfoliatus]
Length=228

 Score =   323 bits (827),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 153/196 (78%), Positives = 179/196 (91%), Gaps = 1/196 (1%)
 Frame = +1

Query  109  KRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMISTSGKLHEYISPSTSTKQLF  288
            K+IENQTNRQVTYSKRRNGLFKKAHEL+VLCDAKVSI+MIS++ KLHEYISP  +TKQ+F
Sbjct  1    KKIENQTNRQVTYSKRRNGLFKKAHELSVLCDAKVSIVMISSTQKLHEYISPIITTKQVF  60

Query  289  DQYQKTVGVDLWNSHFEKMQEQLKKLRDVNRALRREIRQRMGEGLNDLSFEQLTELIEDV  468
            DQYQK VGVDLWNSH++KMQE L+KL++VNR LR EIRQRMGE LNDL + Q+  LIEDV
Sbjct  61   DQYQKAVGVDLWNSHYQKMQEHLQKLKEVNRNLRMEIRQRMGESLNDLGYHQMVNLIEDV  120

Query  469  DNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLVDHEGDYNS  645
            DNS+ LIRE+KYKVIGN+IET KKK+RNVEEIHR+L+LE +ARQEDP +GLV++EGDYNS
Sbjct  121  DNSLALIREKKYKVIGNRIETSKKKLRNVEEIHRSLVLEFDARQEDPHFGLVENEGDYNS  180

Query  646  VLGFPNGGPRILALRL  693
            VLGFP+GGPRI+AL L
Sbjct  181  VLGFPHGGPRIIALHL  196



>gb|AAS45989.1| deficiens, partial [Pedicularis groenlandica]
Length=217

 Score =   322 bits (825),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 156/198 (79%), Positives = 177/198 (89%), Gaps = 1/198 (1%)
 Frame = +1

Query  109  KRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMISTSGKLHEYISPSTSTKQLF  288
            KRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSI+MIS++ KLHEYISP+  TKQLF
Sbjct  1    KRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSILMISSTQKLHEYISPAIMTKQLF  60

Query  289  DQYQKTVGVDLWNSHFEKMQEQLKKLRDVNRALRREIRQRMGEGLNDLSFEQLTELIEDV  468
            DQYQK VGVDLWNS +EKMQE LKKL++VNR LRREIRQR+GE  NDL ++Q+  LIED+
Sbjct  61   DQYQKDVGVDLWNSQYEKMQEHLKKLKEVNRNLRREIRQRIGESSNDLGYDQIVNLIEDI  120

Query  469  DNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLVDHEGDYNS  645
            ++S+ LIRERKYKVIG QI+T KKK+RNVEEIHRNL LE + RQEDP YGLV++EGDYNS
Sbjct  121  ESSLSLIRERKYKVIGGQIDTSKKKLRNVEEIHRNLALEYDVRQEDPHYGLVENEGDYNS  180

Query  646  VLGFPNGGPRILALRLQP  699
            VLGFPNGG RI+ALRL P
Sbjct  181  VLGFPNGGTRIIALRLPP  198



>gb|AEM60166.1| MADS box transcription factor, partial [Justicia brandegeana]
Length=226

 Score =   322 bits (825),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 151/200 (76%), Positives = 181/200 (91%), Gaps = 2/200 (1%)
 Frame = +1

Query  109  KRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMISTSGKLHEYISPSTSTKQLF  288
            KRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMIS++ KLHEYI+PS +TKQ+F
Sbjct  1    KRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMISSTQKLHEYITPSIATKQMF  60

Query  289  DQYQKTVGVDLWNSHFEKMQEQLKKLRDVNRALRREIRQRMGEGLNDLSFEQLTELIEDV  468
            D YQKT G+DLW +H+++M+E +KK++++NR LR EIRQRMGE LNDL +E++  LIE++
Sbjct  61   DHYQKTTGIDLWQTHYQRMEEHMKKMKEINRNLRMEIRQRMGESLNDLGYEEMVNLIEEI  120

Query  469  DNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLVDHEGDYNS  645
            DNS++LIRERKYKVIGNQI+T KKKVRNVEEIHRNLLLE  AR EDP YGLV++EGDYNS
Sbjct  121  DNSLRLIRERKYKVIGNQIDTSKKKVRNVEEIHRNLLLEFGARHEDPHYGLVENEGDYNS  180

Query  646  VLGFPNG-GPRILALRLQPD  702
            +LGFPNG GPRI+ALR+ P+
Sbjct  181  MLGFPNGVGPRIVALRIPPN  200



>gb|AAS45988.1| deficiens [Salvia coccinea]
Length=242

 Score =   322 bits (825),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 151/204 (74%), Positives = 185/204 (91%), Gaps = 1/204 (0%)
 Frame = +1

Query  85   MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMISTSGKLHEYISP  264
            MARGKIQIK+IENQTNRQVTYSKRRNGLFKKAHELTVLCDAK+SIIMIS++ KLHEYISP
Sbjct  1    MARGKIQIKKIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKISIIMISSTQKLHEYISP  60

Query  265  STSTKQLFDQYQKTVGVDLWNSHFEKMQEQLKKLRDVNRALRREIRQRMGEGLNDLSFEQ  444
            + +TKQ+ D+YQKTV  D+W+SH+EKMQE LKKL+++NR L  EIRQR GE LNDL +EQ
Sbjct  61   TITTKQIVDEYQKTVRTDIWSSHYEKMQEHLKKLKEINRNLMMEIRQRRGESLNDLGYEQ  120

Query  445  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLV  621
            +  LIED+DNS+K+IRE+KYKVI ++I+T +KK+RNVEEIHR L+L+ +ARQEDP YGLV
Sbjct  121  MVNLIEDMDNSMKVIREKKYKVISSRIDTSRKKLRNVEEIHRGLVLQFDARQEDPHYGLV  180

Query  622  DHEGDYNSVLGFPNGGPRILALRL  693
            ++EGDYNS+LGFP+GGPRI+A+RL
Sbjct  181  ENEGDYNSMLGFPHGGPRIIAVRL  204



>gb|AAS45966.1| deficiens [Mazus reptans]
Length=252

 Score =   322 bits (826),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 158/210 (75%), Positives = 187/210 (89%), Gaps = 4/210 (2%)
 Frame = +1

Query  85   MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMISTSGKLHEYISP  264
            MARGKIQIK+IENQTNRQVTYSKRRNGLFKKAHEL+VLCDAKVSIIMIS + KLHEYISP
Sbjct  1    MARGKIQIKKIENQTNRQVTYSKRRNGLFKKAHELSVLCDAKVSIIMISGTQKLHEYISP  60

Query  265  STSTKQLFDQYQKTVGVDLWNSHFEKMQEQLKKLRDVNRALRREIRQRMGEGLNDLSFEQ  444
            S STKQ+ D YQK VG D+W+SH+EKMQE L+KL++VN  LR+EIRQRMGE LNDLS+EQ
Sbjct  61   SISTKQVLDLYQKAVGADVWSSHYEKMQEHLRKLKEVNSNLRKEIRQRMGECLNDLSYEQ  120

Query  445  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQ--EDP-YG  615
            +  LI+D+D+S++LIRE+KYKVIG++IET KKK+RNVEEIH NL+LE +ARQ  EDP YG
Sbjct  121  MVNLIQDIDSSLELIREKKYKVIGSRIETSKKKLRNVEEIHSNLVLEFDARQEVEDPHYG  180

Query  616  LVDH-EGDYNSVLGFPNGGPRILALRLQPD  702
            LV++ E  YNSVLGFP+GGPRI+A+RL PD
Sbjct  181  LVENGEDPYNSVLGFPHGGPRIMAVRLPPD  210



>gb|AJN00603.1| MADS domain transcription factor AP3-like protein [Camellia oleifera]
Length=226

 Score =   321 bits (822),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 154/207 (74%), Positives = 185/207 (89%), Gaps = 1/207 (0%)
 Frame = +1

Query  85   MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMISTSGKLHEYISP  264
            MARGKIQIKRIEN TNRQVTYSKRRNGLFKKA+ELTVLCDAKVSIIM+S++GKLHE+ISP
Sbjct  1    MARGKIQIKRIENSTNRQVTYSKRRNGLFKKANELTVLCDAKVSIIMVSSTGKLHEFISP  60

Query  265  STSTKQLFDQYQKTVGVDLWNSHFEKMQEQLKKLRDVNRALRREIRQRMGEGLNDLSFEQ  444
            STSTKQ++DQYQK +G+DLW SH+E+MQE LKKL+DVN+ LR EIRQRMG+ LNDLS+E+
Sbjct  61   STSTKQMYDQYQKALGIDLWCSHYERMQEHLKKLKDVNKNLRTEIRQRMGDCLNDLSYEE  120

Query  445  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLV  621
            L  L +D+++S+K+IR+RKYKV+ NQIET KKK RNVEEIHRNLL +  +++EDP YGLV
Sbjct  121  LCGLEQDMESSVKIIRDRKYKVLNNQIETQKKKKRNVEEIHRNLLHQVNSKEEDPQYGLV  180

Query  622  DHEGDYNSVLGFPNGGPRILALRLQPD  702
            D+  DYNS+LGF NGG  ILALRLQP+
Sbjct  181  DNGVDYNSILGFSNGGHGILALRLQPN  207



>ref|XP_007017681.1| Floral homeotic protein DEFICIENS isoform 1 [Theobroma cacao]
 gb|EOY14906.1| Floral homeotic protein DEFICIENS isoform 1 [Theobroma cacao]
Length=225

 Score =   321 bits (822),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 151/206 (73%), Positives = 184/206 (89%), Gaps = 0/206 (0%)
 Frame = +1

Query  85   MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMISTSGKLHEYISP  264
            MARGKIQIK IEN TNRQVTYSKRRNGLFKKA+ELTVLCDA+ SIIM S++GKLHE+ISP
Sbjct  1    MARGKIQIKLIENATNRQVTYSKRRNGLFKKANELTVLCDARASIIMFSSTGKLHEFISP  60

Query  265  STSTKQLFDQYQKTVGVDLWNSHFEKMQEQLKKLRDVNRALRREIRQRMGEGLNDLSFEQ  444
            STSTKQ++DQYQK +GVDLW +H+EKMQEQLKKL++VNR LR+EIRQRMG+ LND+SFE 
Sbjct  61   STSTKQIYDQYQKVLGVDLWTTHYEKMQEQLKKLKEVNRNLRKEIRQRMGDCLNDVSFED  120

Query  445  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDPYGLVD  624
            L  L ++++ S+KLIR+RKY+VI NQI+T +KKVRNVEEIHRNLL E +A +EDPYGLVD
Sbjct  121  LQALEQEMETSVKLIRDRKYRVISNQIDTSRKKVRNVEEIHRNLLHELDAIKEDPYGLVD  180

Query  625  HEGDYNSVLGFPNGGPRILALRLQPD  702
            +  DY++++G+ NGGPRI ALRLQP+
Sbjct  181  NGVDYDTIIGYQNGGPRIFALRLQPN  206



>gb|AAS45970.1| deficiens [Mazus reptans]
Length=237

 Score =   321 bits (823),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 155/205 (76%), Positives = 180/205 (88%), Gaps = 2/205 (1%)
 Frame = +1

Query  85   MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMISTSGKLHEYISP  264
            MARGKIQIK+IENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMIS++ KLHEYISP
Sbjct  1    MARGKIQIKKIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMISSTQKLHEYISP  60

Query  265  STSTKQLFDQYQKTVGVDLWNSHFEKMQEQLKKLRDVNRALRREIRQRMGEGLNDLSFEQ  444
            S +TKQ+FDQYQK   VD+W  H+EKMQE LKKL++VNR LRREI QR+GE + DLS++Q
Sbjct  61   SITTKQMFDQYQKIAQVDVWQPHYEKMQEHLKKLKEVNRNLRREIMQRVGESVTDLSYDQ  120

Query  445  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLV  621
            +  LI D+DN++K+IRE+KYK I  QI+T KKKVRNVEEIHR L+LE EAR EDP YGLV
Sbjct  121  IVNLIADIDNALKVIREKKYKTISGQIDTTKKKVRNVEEIHRGLVLEYEARHEDPHYGLV  180

Query  622  DHEGD-YNSVLGFPNGGPRILALRL  693
            ++EGD YNSVLGFP+GGPRI+AL L
Sbjct  181  ENEGDPYNSVLGFPSGGPRIVALHL  205



>gb|ADL57412.1| MADS domain transcription factor [Camellia japonica]
Length=226

 Score =   321 bits (822),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 154/207 (74%), Positives = 185/207 (89%), Gaps = 1/207 (0%)
 Frame = +1

Query  85   MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMISTSGKLHEYISP  264
            MARGKIQIKRIEN TNRQVTYSKRRNGLFKKA+ELTVLCDAKVSIIM+S++GKLHE+ISP
Sbjct  1    MARGKIQIKRIENSTNRQVTYSKRRNGLFKKANELTVLCDAKVSIIMVSSTGKLHEFISP  60

Query  265  STSTKQLFDQYQKTVGVDLWNSHFEKMQEQLKKLRDVNRALRREIRQRMGEGLNDLSFEQ  444
            STSTKQ++DQYQK +G+DLW SH+E+MQE LKKL+DVN+ LR EIRQRMG+ LNDLS+E+
Sbjct  61   STSTKQMYDQYQKALGIDLWCSHYERMQEHLKKLKDVNKNLRTEIRQRMGDCLNDLSYEE  120

Query  445  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLV  621
            L  L +D+++S+K+IR+RKYKV+ NQIET KKK RNVEEIHRNLL +  +++EDP YGLV
Sbjct  121  LCGLEQDMESSVKIIRDRKYKVLNNQIETQKKKKRNVEEIHRNLLHQVNSKEEDPQYGLV  180

Query  622  DHEGDYNSVLGFPNGGPRILALRLQPD  702
            D+  DYNS+LGF NGG  ILALRLQP+
Sbjct  181  DNGVDYNSILGFSNGGHGILALRLQPN  207



>gb|AEM60194.1| MADS box transcription factor, partial [Polypremum procumbens]
Length=213

 Score =   320 bits (820),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 158/200 (79%), Positives = 179/200 (90%), Gaps = 4/200 (2%)
 Frame = +1

Query  112  RIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMISTSGKLHEYISPSTSTKQLFD  291
            RIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVS+IMIS++ KLHEYISPST+TKQL D
Sbjct  1    RIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSVIMISSTHKLHEYISPSTTTKQLID  60

Query  292  QYQKTVGVDLWNSHFEKMQEQLKKLRDVNRALRREIRQRMGEGLNDLSFEQLTELIEDVD  471
            QYQKTV VDLWNSH+E MQE L+KL +VN+ LRREIRQRMGE LND+ ++++ +LI DVD
Sbjct  61   QYQKTVNVDLWNSHYENMQENLRKLMEVNKNLRREIRQRMGESLNDVGYDEIVKLIGDVD  120

Query  472  NSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLVDH---EGDY  639
            +S+KLIRERKYKVIGNQIET KKK+RNV+EI+RNLLL  +ARQEDP YGLVD    EG Y
Sbjct  121  DSLKLIRERKYKVIGNQIETGKKKLRNVDEIYRNLLLGFDARQEDPHYGLVDDEGIEGHY  180

Query  640  NSVLGFPNGGPRILALRLQP  699
            NSVLGFPNGGPRI+ALRL P
Sbjct  181  NSVLGFPNGGPRIIALRLPP  200



>gb|AEM60176.1| MADS box transcription factor, partial [Lantana camara]
Length=225

 Score =   320 bits (821),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 158/197 (80%), Positives = 181/197 (92%), Gaps = 3/197 (2%)
 Frame = +1

Query  109  KRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMISTSGKLHEYISPSTSTKQLF  288
            KRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMIS++ KLHEYISPST+TKQ+F
Sbjct  1    KRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMISSTQKLHEYISPSTATKQIF  60

Query  289  DQYQKTVGVDLWNSHFEKMQEQLKKLRDVNRALRREIRQRMGEGLNDLSFEQLTELIEDV  468
            DQYQK VGVDLW++H+EKMQE LKKL++VN+ LRREIRQRMGE LN+L ++Q+  LI D+
Sbjct  61   DQYQKAVGVDLWHTHYEKMQEHLKKLKEVNKNLRREIRQRMGESLNNLGYDQMVNLIYDM  120

Query  469  DNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLVDHEGDY-N  642
            DNS +LIRERKYKVIGNQIET KKKVRNVEEIHRNL+LE +ARQEDP YGLV++EGDY +
Sbjct  121  DNSQRLIRERKYKVIGNQIETSKKKVRNVEEIHRNLVLEFDARQEDPHYGLVENEGDYTH  180

Query  643  SVLGFPN-GGPRILALR  690
             VLG+PN GGPRI+ALR
Sbjct  181  PVLGYPNGGGPRIVALR  197



>gb|ABG20623.1| DEF [Solanum pseudolulo]
Length=217

 Score =   320 bits (819),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 156/197 (79%), Positives = 180/197 (91%), Gaps = 6/197 (3%)
 Frame = +1

Query  112  RIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMISTSGKLHEYISPSTSTKQLFD  291
            +IENQTNRQVTYSKRRNGLFKKA+ELTVLCDAKVSI+MIS++GKLHE+ISPS +TKQLFD
Sbjct  1    KIENQTNRQVTYSKRRNGLFKKANELTVLCDAKVSIVMISSTGKLHEFISPSITTKQLFD  60

Query  292  QYQKTVGVDLWNSHFEKMQEQLKKLRDVNRALRREIRQRMGEGLNDLSFEQLTELIEDVD  471
             YQKT+GVD+W SH+EKMQEQL+KL+DVNR LR+EIRQRMGE LNDL+++QL EL+E+VD
Sbjct  61   LYQKTIGVDIWTSHYEKMQEQLRKLKDVNRNLRKEIRQRMGESLNDLNYQQLEELMENVD  120

Query  472  NSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDPY-GLVDHEGDYNSV  648
            N++K+IRERKYKVI NQI+T KKKVRNVEEIHRNLLLE +ARQEDPY GLV+ EGDYNSV
Sbjct  121  NALKIIRERKYKVISNQIDTCKKKVRNVEEIHRNLLLEFDARQEDPYGGLVEQEGDYNSV  180

Query  649  LGFPNGGPRILALRLQP  699
            L     G RILALRLQP
Sbjct  181  L-----GARILALRLQP  192



>gb|ABQ59274.4| deficiens 1 protein [Eustoma exaltatum subsp. russellianum]
Length=226

 Score =   320 bits (820),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 152/207 (73%), Positives = 184/207 (89%), Gaps = 1/207 (0%)
 Frame = +1

Query  85   MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMISTSGKLHEYISP  264
            MARGKIQIK+IENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIM+ST+ KLHE+ISP
Sbjct  1    MARGKIQIKKIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMLSTTHKLHEFISP  60

Query  265  STSTKQLFDQYQKTVGVDLWNSHFEKMQEQLKKLRDVNRALRREIRQRMGEGLNDLSFEQ  444
            +T+TKQL DQYQK +GVDLW+SH+EKMQEQLKKL++VN+ LRREIRQR+GEGLNDLSF++
Sbjct  61   TTTTKQLMDQYQKALGVDLWSSHYEKMQEQLKKLKEVNKNLRREIRQRLGEGLNDLSFDE  120

Query  445  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLV  621
            +  L  ++D S++ IRERK K I NQI+T KKKV++  +IHRNLLLE +ARQEDP YGLV
Sbjct  121  MHNLTHEIDESLRAIRERKIKAISNQIDTLKKKVKSANDIHRNLLLELDARQEDPHYGLV  180

Query  622  DHEGDYNSVLGFPNGGPRILALRLQPD  702
            ++ GDY+S++GFP GG  +LAL LQP+
Sbjct  181  ENAGDYHSLIGFPIGGHHLLALFLQPN  207



>gb|AEM60191.1| MADS box transcription factor, partial [Forsythia x intermedia]
Length=210

 Score =   319 bits (817),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 151/196 (77%), Positives = 179/196 (91%), Gaps = 1/196 (1%)
 Frame = +1

Query  109  KRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMISTSGKLHEYISPSTSTKQLF  288
            KRIENQTNRQVTYSKRRNGLFKKAHELTVLC AKVSIIMIS++ K+HEYISP+T+TK LF
Sbjct  1    KRIENQTNRQVTYSKRRNGLFKKAHELTVLCGAKVSIIMISSTQKIHEYISPTTTTKHLF  60

Query  289  DQYQKTVGVDLWNSHFEKMQEQLKKLRDVNRALRREIRQRMGEGLNDLSFEQLTELIEDV  468
            DQYQK VGVDLW S++EKMQ+ L+KL+D+N+ LR EIRQRMGE LNDL+++Q+  L+EDV
Sbjct  61   DQYQKAVGVDLWISNYEKMQDHLRKLKDINKNLRMEIRQRMGESLNDLNYDQIVNLVEDV  120

Query  469  DNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLVDHEGDYNS  645
            D+S++ IRE+KYKVI NQIET KKK+RNVEEIHR +L+E +ARQEDP YGLVD+EGDYNS
Sbjct  121  DDSLRKIREKKYKVISNQIETSKKKLRNVEEIHRKILVEFDARQEDPHYGLVDNEGDYNS  180

Query  646  VLGFPNGGPRILALRL  693
            VLGFPNGGPRI+ALR+
Sbjct  181  VLGFPNGGPRIIALRM  196



>gb|AAS45980.1| deficiens, partial [Chelone glabra]
Length=219

 Score =   318 bits (816),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 157/200 (79%), Positives = 178/200 (89%), Gaps = 5/200 (3%)
 Frame = +1

Query  109  KRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMISTSGKLHEYISPSTSTKQLF  288
            KRIENQTNRQVTYSKRRNGLFKKA+EL+VLCDAKVSIIMIS++ KLHEYISP+T+TKQL 
Sbjct  1    KRIENQTNRQVTYSKRRNGLFKKANELSVLCDAKVSIIMISSTQKLHEYISPTTTTKQLL  60

Query  289  DQYQKTVGVDLWNSHFEKMQEQLKKLRDVNRALRREIRQRMGEGLNDLSFEQLTELIEDV  468
            DQYQK VGVD+WNSH+EKMQE LKKL+DVNR LRREIRQRMGE LNDL +E+L  LIEDV
Sbjct  61   DQYQKAVGVDIWNSHYEKMQEHLKKLKDVNRNLRREIRQRMGESLNDLGYEELVNLIEDV  120

Query  469  DNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDPYGLVDHEGDYNSV  648
            D+S+ LIRERKYKVIGNQIET KKKVRNVEEIHR+L+LE +A     YGL+++EGDYNS+
Sbjct  121  DSSLSLIRERKYKVIGNQIETSKKKVRNVEEIHRSLVLEFDATH---YGLIENEGDYNSI  177

Query  649  LGFPNGGPRILALRL--QPD  702
            LGFPN G RI+ALRL   PD
Sbjct  178  LGFPNRGQRIIALRLPTHPD  197



>gb|AEM60185.1| MADS box transcription factor, partial [Digitalis purpurea]
Length=207

 Score =   318 bits (815),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 156/200 (78%), Positives = 178/200 (89%), Gaps = 5/200 (3%)
 Frame = +1

Query  109  KRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMISTSGKLHEYISPSTSTKQLF  288
            +RIENQTNRQVTYSKRRNGL KKAHELTVLCDAKVSIIMIS++ KLHEYISPST+TKQ+F
Sbjct  1    RRIENQTNRQVTYSKRRNGLLKKAHELTVLCDAKVSIIMISSTQKLHEYISPSTTTKQVF  60

Query  289  DQYQKTVGVDLWNSHFEKMQEQLKKLRDVNRALRREIRQRMGEGLNDLSFEQLTELIEDV  468
            DQYQK VGVDLW+SH+EKMQE LKKL +VNR LRREIRQRMGE LNDL +EQ+  L+ED+
Sbjct  61   DQYQKAVGVDLWSSHYEKMQEHLKKLNEVNRNLRREIRQRMGESLNDLGYEQMVNLVEDM  120

Query  469  DNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLVDHE-GDYN  642
            DNS+K+IRERKYKV+ NQI+T KKKVRNVEEIHRNL+LE E    DP YGLV++E GDYN
Sbjct  121  DNSLKIIRERKYKVLSNQIDTGKKKVRNVEEIHRNLVLEFEG---DPHYGLVENEAGDYN  177

Query  643  SVLGFPNGGPRILALRLQPD  702
            SVLGFP+GGP I+ LRL P+
Sbjct  178  SVLGFPHGGPSIITLRLPPN  197



>gb|AEM60178.1| MADS box transcription factor, partial [Utricularia sp. VFI-2011]
Length=215

 Score =   318 bits (815),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 153/196 (78%), Positives = 176/196 (90%), Gaps = 2/196 (1%)
 Frame = +1

Query  109  KRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMISTSGKLHEYISPSTSTKQLF  288
            K+IENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSI+M+S++ KLHEYISPST+TKQ+F
Sbjct  1    KKIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIVMVSSTQKLHEYISPSTTTKQVF  60

Query  289  DQYQKTVGVDLWNSHFEKMQEQLKKLRDVNRALRREIRQRMGEGLNDLSFEQLTELIEDV  468
            DQYQK VGVDLWN+H+EK QE LKKL++VNR LR+EIRQRMGE LNDL +EQ+ +LIE++
Sbjct  61   DQYQKAVGVDLWNTHYEKTQEHLKKLKEVNRNLRKEIRQRMGECLNDLGYEQMVDLIENM  120

Query  469  DNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECE-ARQEDP-YGLVDHEGDYN  642
            D SI LIRERKYKVIGNQIET KKKVRN EE+HR  LLE + ARQEDP YGLV++E D+N
Sbjct  121  DKSISLIRERKYKVIGNQIETSKKKVRNAEEVHRKNLLEFDAARQEDPHYGLVENEADFN  180

Query  643  SVLGFPNGGPRILALR  690
            SVLGFP GGPRI+ LR
Sbjct  181  SVLGFPGGGPRIITLR  196



>gb|AAS45983.1| deficiens, partial [Paulownia tomentosa]
Length=214

 Score =   318 bits (814),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 150/187 (80%), Positives = 173/187 (93%), Gaps = 1/187 (1%)
 Frame = +1

Query  145  YSKRRNGLFKKAHELTVLCDAKVSIIMISTSGKLHEYISPSTSTKQLFDQYQKTVGVDLW  324
            YSKRRNGLFK AHELTVLCDAKVSIIMIS++ KLHEYISP+T TKQ+FDQYQK VGVDLW
Sbjct  1    YSKRRNGLFKTAHELTVLCDAKVSIIMISSTQKLHEYISPTTMTKQVFDQYQKAVGVDLW  60

Query  325  NSHFEKMQEQLKKLRDVNRALRREIRQRMGEGLNDLSFEQLTELIEDVDNSIKLIRERKY  504
            +SH+EKMQE L+KL++VNR LRREIRQRMGE LNDL ++Q+  LIED+D+S++LIRERKY
Sbjct  61   SSHYEKMQEHLQKLKEVNRNLRREIRQRMGESLNDLGYDQMVNLIEDMDSSLRLIRERKY  120

Query  505  KVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLVDHEGDYNSVLGFPNGGPRIL  681
            KVIGNQIET KKK+RNVEEIHRNL+LE +ARQEDP YGLV++EGDYNSVLGFPNGGPRI+
Sbjct  121  KVIGNQIETSKKKLRNVEEIHRNLVLEIDARQEDPHYGLVENEGDYNSVLGFPNGGPRII  180

Query  682  ALRLQPD  702
            ALRL P+
Sbjct  181  ALRLPPN  187



>gb|AEJ76847.1| MADS24 [Gossypium hirsutum]
 gb|AGW23355.1| MADS box protein MADS53 [Gossypium hirsutum]
 gb|KJB59772.1| hypothetical protein B456_009G271100 [Gossypium raimondii]
Length=225

 Score =   318 bits (815),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 148/206 (72%), Positives = 186/206 (90%), Gaps = 0/206 (0%)
 Frame = +1

Query  85   MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMISTSGKLHEYISP  264
            MARGKIQIK IEN TNRQVTYSKRRNGLFKKA+ELTVLCDA+VSIIM ST+GKLHE+ISP
Sbjct  1    MARGKIQIKLIENSTNRQVTYSKRRNGLFKKANELTVLCDARVSIIMFSTTGKLHEFISP  60

Query  265  STSTKQLFDQYQKTVGVDLWNSHFEKMQEQLKKLRDVNRALRREIRQRMGEGLNDLSFEQ  444
            ST+TKQ+ DQYQKT+G+D+WN+H+EKMQEQLK+L++VNR LR+EIR+RMG+ LNDLS E 
Sbjct  61   STTTKQVIDQYQKTLGIDIWNTHYEKMQEQLKQLKEVNRNLRKEIRRRMGDCLNDLSIED  120

Query  445  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDPYGLVD  624
            L  L +++++S+ LIR+RKY+V+ NQI+T +KKVRNVEEIH+NLL E E+ +EDPYGLVD
Sbjct  121  LGALEQEMESSVTLIRDRKYRVLSNQIDTSRKKVRNVEEIHKNLLHELESLKEDPYGLVD  180

Query  625  HEGDYNSVLGFPNGGPRILALRLQPD  702
            + GDY++++G+ NGGPRI ALRLQP+
Sbjct  181  NGGDYDTLIGYQNGGPRIFALRLQPN  206



>gb|KHG05937.1| Floral homeotic DEFICIENS [Gossypium arboreum]
Length=225

 Score =   317 bits (812),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 147/206 (71%), Positives = 186/206 (90%), Gaps = 0/206 (0%)
 Frame = +1

Query  85   MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMISTSGKLHEYISP  264
            MARGKIQIK IEN TNRQVTYSKRRNGLFKKA+ELTVLCDA+VSIIM ST+GKLHE+ISP
Sbjct  1    MARGKIQIKLIENSTNRQVTYSKRRNGLFKKANELTVLCDARVSIIMFSTTGKLHEFISP  60

Query  265  STSTKQLFDQYQKTVGVDLWNSHFEKMQEQLKKLRDVNRALRREIRQRMGEGLNDLSFEQ  444
            ST+TKQ+ DQYQK++G+D+WN+H+EKMQEQLK+L++VNR LR+EIR+RMG+ LNDLS E 
Sbjct  61   STTTKQVIDQYQKSLGIDIWNTHYEKMQEQLKQLKEVNRNLRKEIRRRMGDCLNDLSIED  120

Query  445  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDPYGLVD  624
            L  L +++++S+ LIR+RKY+V+ NQI+T +KKVRNVEEIH+NLL E E+ +EDPYGLVD
Sbjct  121  LGALEQEMESSVTLIRDRKYRVLSNQIDTSRKKVRNVEEIHKNLLHELESLKEDPYGLVD  180

Query  625  HEGDYNSVLGFPNGGPRILALRLQPD  702
            + GDY++++G+ NGGPRI ALRLQP+
Sbjct  181  NGGDYDTLIGYQNGGPRIFALRLQPN  206



>gb|AEX10627.1| DEFICIENS, partial [Lophospermum atrosanguineum]
Length=205

 Score =   314 bits (804),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 150/182 (82%), Positives = 170/182 (93%), Gaps = 1/182 (1%)
 Frame = +1

Query  151  KRRNGLFKKAHELTVLCDAKVSIIMISTSGKLHEYISPSTSTKQLFDQYQKTVGVDLWNS  330
            KRRNGLFKKAHEL+VLCDAKVSIIMIS++ KLHEYISP+T+TKQLFDQYQK VGVDLW+S
Sbjct  1    KRRNGLFKKAHELSVLCDAKVSIIMISSTQKLHEYISPTTATKQLFDQYQKAVGVDLWSS  60

Query  331  HFEKMQEQLKKLRDVNRALRREIRQRMGEGLNDLSFEQLTELIEDVDNSIKLIRERKYKV  510
            H+EKMQE LKKL ++NR LRREIRQRMGE LNDL +EQ+  LIED+DNS+KLIRERKYKV
Sbjct  61   HYEKMQEHLKKLNEINRNLRREIRQRMGESLNDLGYEQIVNLIEDMDNSLKLIRERKYKV  120

Query  511  IGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLVDHEGDYNSVLGFPNGGPRILAL  687
            IGNQI+T KKKVRNVEEIHRNL+LE EAR+EDP +GLV++EGDYNSVLGFPNGGPRI+AL
Sbjct  121  IGNQIDTSKKKVRNVEEIHRNLVLEFEARREDPHFGLVENEGDYNSVLGFPNGGPRIIAL  180

Query  688  RL  693
            RL
Sbjct  181  RL  182



>gb|AEM60161.1| MADS box transcription factor, partial [Salvia greggii]
Length=226

 Score =   311 bits (797),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 145/199 (73%), Positives = 179/199 (90%), Gaps = 1/199 (1%)
 Frame = +1

Query  109  KRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMISTSGKLHEYISPSTSTKQLF  288
            KRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAK+SIIMIS++ KLHEYISP+ +TKQ+ 
Sbjct  1    KRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKISIIMISSTQKLHEYISPTITTKQIV  60

Query  289  DQYQKTVGVDLWNSHFEKMQEQLKKLRDVNRALRREIRQRMGEGLNDLSFEQLTELIEDV  468
            D+YQKTV  D+W+SH+EKMQE LKKL+++NR L  EIRQR GE LNDL +EQ+  LIED+
Sbjct  61   DEYQKTVRTDIWSSHYEKMQEHLKKLKEINRNLMMEIRQRRGESLNDLGYEQMVNLIEDM  120

Query  469  DNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLVDHEGDYNS  645
            DNS+K+IRE+KYKVI ++I+T +KK+RNVEEIHR L+L+ +ARQEDP YGLV++EGDYNS
Sbjct  121  DNSMKVIREKKYKVISSRIDTSRKKLRNVEEIHRGLVLQFDARQEDPHYGLVENEGDYNS  180

Query  646  VLGFPNGGPRILALRLQPD  702
            +LGFP+GGPRI+A+RL P+
Sbjct  181  MLGFPHGGPRIIAVRLSPN  199



>gb|AAC42583.1| APETALA3 homolog LeAP3 [Solanum lycopersicum]
Length=203

 Score =   310 bits (794),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 146/182 (80%), Positives = 172/182 (95%), Gaps = 1/182 (1%)
 Frame = +1

Query  160  NGLFKKAHELTVLCDAKVSIIMISTSGKLHEYISPSTSTKQLFDQYQKTVGVDLWNSHFE  339
            NGLFKKA+ELTVLCDAKVSI+MIS++GKLHE+ISPS +TKQLFD YQKT+GVD+W +H+E
Sbjct  1    NGLFKKANELTVLCDAKVSIVMISSTGKLHEFISPSITTKQLFDLYQKTIGVDIWTTHYE  60

Query  340  KMQEQLKKLRDVNRALRREIRQRMGEGLNDLSFEQLTELIEDVDNSIKLIRERKYKVIGN  519
            KMQEQL+KL+DVNR LR+EIRQRMGE LNDL++EQL EL+E+VDNS+KLIRERK+KVIGN
Sbjct  61   KMQEQLRKLKDVNRNLRKEIRQRMGESLNDLNYEQLEELMENVDNSLKLIRERKFKVIGN  120

Query  520  QIETHKKKVRNVEEIHRNLLLECEARQEDPY-GLVDHEGDYNSVLGFPNGGPRILALRLQ  696
            QIET++KKVRNVEEI+RNLLLE +ARQEDPY GLV+H+GDYNSVLGFP GGPRIL LRLQ
Sbjct  121  QIETYRKKVRNVEEINRNLLLEFDARQEDPYGGLVEHDGDYNSVLGFPTGGPRILDLRLQ  180

Query  697  PD  702
            P+
Sbjct  181  PN  182



>gb|AEM60177.1| MADS box transcription factor, partial [Torenia fournieri]
Length=226

 Score =   310 bits (793),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 149/200 (75%), Positives = 176/200 (88%), Gaps = 2/200 (1%)
 Frame = +1

Query  109  KRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMISTSGKLHEYISPSTSTKQLF  288
            KRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMIS++ KLHEYISPST+TKQ+F
Sbjct  1    KRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMISSTQKLHEYISPSTTTKQVF  60

Query  289  DQYQKTVGVDLWNSHFEKMQEQLKKLRDVNRALRREIRQRMGEGLNDLSFEQLTELIEDV  468
            DQYQK VGVDLW + ++KMQE LKKL++VNR L+REIRQRMGE LND+S+E +  LIED+
Sbjct  61   DQYQKAVGVDLWQTSYQKMQEHLKKLKEVNRNLKREIRQRMGECLNDMSYEHMVNLIEDI  120

Query  469  DNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLVDHEG-DYN  642
            DNS+++IRERKYKVI +QIET KKK+RNVEEIH+ L+ E +AR EDP YGLV++E  DY+
Sbjct  121  DNSLRVIRERKYKVITSQIETGKKKLRNVEEIHKKLVFEYDARHEDPHYGLVENEAVDYH  180

Query  643  SVLGFPNGGPRILALRLQPD  702
            SVLGFPN G R +ALR  P+
Sbjct  181  SVLGFPNNGSRTIALRYVPN  200



>gb|AEM60181.1| MADS box transcription factor, partial [Torenia fournieri]
Length=216

 Score =   309 bits (792),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 149/200 (75%), Positives = 176/200 (88%), Gaps = 2/200 (1%)
 Frame = +1

Query  109  KRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMISTSGKLHEYISPSTSTKQLF  288
            KRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMIS++ KLHEYISPST+TKQ+F
Sbjct  1    KRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMISSTQKLHEYISPSTTTKQVF  60

Query  289  DQYQKTVGVDLWNSHFEKMQEQLKKLRDVNRALRREIRQRMGEGLNDLSFEQLTELIEDV  468
            DQYQK VGVDLW + ++KMQE LKKL++VNR L+REIRQRMGE LND+S+E +  LIED+
Sbjct  61   DQYQKAVGVDLWQTSYQKMQEHLKKLKEVNRNLKREIRQRMGECLNDMSYEHMVNLIEDI  120

Query  469  DNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLVDHEG-DYN  642
            DNS+++IRERKYKVI +QIET KKK+RNVEEIH+ L+ E +AR EDP YGLV++E  DY+
Sbjct  121  DNSLRVIRERKYKVITSQIETGKKKLRNVEEIHKKLVFEYDARHEDPHYGLVENEAVDYH  180

Query  643  SVLGFPNGGPRILALRLQPD  702
            SVLGFPN G R +ALR  P+
Sbjct  181  SVLGFPNNGSRTIALRYVPN  200



>gb|AEM60163.1| MADS box transcription factor, partial [Salvia greggii]
Length=226

 Score =   309 bits (791),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 144/196 (73%), Positives = 178/196 (91%), Gaps = 1/196 (1%)
 Frame = +1

Query  109  KRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMISTSGKLHEYISPSTSTKQLF  288
            K+IENQTNRQVTYSKRRNGLFKKAHELTVLCDAK+SIIMIS++ KLHEYISP+ +TKQ+F
Sbjct  1    KKIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKISIIMISSTQKLHEYISPTITTKQIF  60

Query  289  DQYQKTVGVDLWNSHFEKMQEQLKKLRDVNRALRREIRQRMGEGLNDLSFEQLTELIEDV  468
            D+YQKTV  DLW+SH+EKMQE LKKL+++NR L +EIRQR GE LNDL ++Q   LIED+
Sbjct  61   DEYQKTVRADLWSSHYEKMQEHLKKLKEINRNLIKEIRQRTGESLNDLGYDQTVNLIEDI  120

Query  469  DNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLVDHEGDYNS  645
            DNS+K+IRE+KYKVI ++I+T +KK+RNVEEIHR L+L+ +ARQEDP YGLV++EGDYNS
Sbjct  121  DNSMKVIREKKYKVISSRIDTSRKKLRNVEEIHRGLVLQFDARQEDPHYGLVENEGDYNS  180

Query  646  VLGFPNGGPRILALRL  693
            +LGFP+GGPRI+A+RL
Sbjct  181  MLGFPHGGPRIIAVRL  196



>ref|NP_001267960.1| flowering-related B-class MADS-box protein APETALA3 [Vitis vinifera]
 gb|ABN71371.1| flowering-related B-class MADS-box protein APETALA3 [Vitis vinifera]
 gb|ACZ26526.1| apetala3 [Vitis vinifera]
Length=226

 Score =   308 bits (790),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 148/207 (71%), Positives = 181/207 (87%), Gaps = 1/207 (0%)
 Frame = +1

Query  85   MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMISTSGKLHEYISP  264
            MARGKI+IKRIEN TNRQVTYSKRRNG+FKKA ELTVLCDAKVSIIM+S++GKLHEYISP
Sbjct  1    MARGKIEIKRIENSTNRQVTYSKRRNGIFKKASELTVLCDAKVSIIMLSSTGKLHEYISP  60

Query  265  STSTKQLFDQYQKTVGVDLWNSHFEKMQEQLKKLRDVNRALRREIRQRMGEGLNDLSFEQ  444
            ST+TKQ+FDQYQ T+GVDLW+ H+E+MQE LKKL+DVN+ LR+EIRQRMGE L+DLS E+
Sbjct  61   STTTKQIFDQYQNTLGVDLWSYHYERMQENLKKLKDVNKNLRKEIRQRMGEHLSDLSVEE  120

Query  445  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLV  621
            L +L +++++S+K++R+RKY+VI NQIET KKKVRNVE+IH+NLL E +AR  D  YGLV
Sbjct  121  LRDLEQEMESSLKMVRDRKYQVINNQIETFKKKVRNVEQIHKNLLHEFDARDRDQYYGLV  180

Query  622  DHEGDYNSVLGFPNGGPRILALRLQPD  702
            D+ GDY SVLGF NG   + AL LQP+
Sbjct  181  DNGGDYESVLGFSNGSSPVFALSLQPN  207



>gb|ABN46893.1| AP3-like MADS-box protein [Vitis labrusca x Vitis vinifera]
 emb|CBI19790.3| unnamed protein product [Vitis vinifera]
Length=226

 Score =   308 bits (790),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 148/207 (71%), Positives = 181/207 (87%), Gaps = 1/207 (0%)
 Frame = +1

Query  85   MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMISTSGKLHEYISP  264
            MARGKI+IKRIEN TNRQVTYSKRRNG+FKKA ELTVLCDAKVSIIM+S++GKLHEYISP
Sbjct  1    MARGKIEIKRIENSTNRQVTYSKRRNGIFKKASELTVLCDAKVSIIMLSSTGKLHEYISP  60

Query  265  STSTKQLFDQYQKTVGVDLWNSHFEKMQEQLKKLRDVNRALRREIRQRMGEGLNDLSFEQ  444
            ST+TKQ+FDQYQ T+GVDLW+ H+E+MQE LKKL+DVN+ LR+EIRQRMGE L+DLS E+
Sbjct  61   STTTKQIFDQYQNTLGVDLWSYHYERMQENLKKLKDVNKNLRKEIRQRMGEHLSDLSVEE  120

Query  445  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLV  621
            L +L +++++S+K++R+RKY+VI NQIET KKKVRNVE+IH+NLL E +AR  D  YGLV
Sbjct  121  LRDLEQEMESSLKMVRDRKYQVINNQIETFKKKVRNVEQIHKNLLHEFDARDRDQHYGLV  180

Query  622  DHEGDYNSVLGFPNGGPRILALRLQPD  702
            D+ GDY SVLGF NG   + AL LQP+
Sbjct  181  DNGGDYESVLGFSNGSSPVFALSLQPN  207



>gb|AEM60189.1| MADS box transcription factor, partial [Allamanda cathartica]
Length=209

 Score =   307 bits (786),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 146/199 (73%), Positives = 177/199 (89%), Gaps = 1/199 (1%)
 Frame = +1

Query  109  KRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMISTSGKLHEYISPSTSTKQLF  288
            K+IENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIM+ST+ KLHE+ISP+T+TKQL 
Sbjct  1    KKIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMLSTTHKLHEFISPTTTTKQLM  60

Query  289  DQYQKTVGVDLWNSHFEKMQEQLKKLRDVNRALRREIRQRMGEGLNDLSFEQLTELIEDV  468
            DQYQK +GVDLW+SH+EKMQEQLKKL+DVNR LRREIRQR+GE LND+S+++L +L +++
Sbjct  61   DQYQKALGVDLWSSHYEKMQEQLKKLKDVNRNLRREIRQRLGESLNDMSYDELRKLTDEI  120

Query  469  DNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLVDHEGDYNS  645
            D S+K IRERK K I NQIET KKKV++  +IHRNLLLE +ARQEDP YGLV++ GDY+S
Sbjct  121  DESLKSIRERKIKAISNQIETLKKKVKSANDIHRNLLLELDARQEDPHYGLVENAGDYHS  180

Query  646  VLGFPNGGPRILALRLQPD  702
            ++G PNGG  +LAL LQP+
Sbjct  181  LIGLPNGGHHVLALCLQPN  199



>gb|AEM60162.1| MADS box transcription factor, partial [Salvia coccinea]
Length=225

 Score =   307 bits (786),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 144/196 (73%), Positives = 177/196 (90%), Gaps = 1/196 (1%)
 Frame = +1

Query  109  KRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMISTSGKLHEYISPSTSTKQLF  288
            K+IENQTNRQVTYSKRRNGLFKKAHELTVLCDAK+SIIMIS++ KLHEYISP+ +TKQ+ 
Sbjct  1    KKIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKISIIMISSTQKLHEYISPTITTKQIV  60

Query  289  DQYQKTVGVDLWNSHFEKMQEQLKKLRDVNRALRREIRQRMGEGLNDLSFEQLTELIEDV  468
            D+YQKTV  D+W+SH+EKMQE LKKL++VNR L  EIRQR GE LNDL +EQ+  LIED+
Sbjct  61   DEYQKTVRTDIWSSHYEKMQEHLKKLKEVNRNLMMEIRQRRGESLNDLGYEQMVNLIEDM  120

Query  469  DNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLVDHEGDYNS  645
            DNS+K+IRE+KYKVI ++I+T +KK+RNVEEIHR L+L+ +ARQEDP YGLV++EGDYNS
Sbjct  121  DNSMKVIREKKYKVISSRIDTSRKKLRNVEEIHRGLVLQFDARQEDPHYGLVENEGDYNS  180

Query  646  VLGFPNGGPRILALRL  693
            +LGFP+GGPRI+A+RL
Sbjct  181  MLGFPHGGPRIIAVRL  196



>gb|ACY08914.1| MADS-domain transcription factor, partial [Halesia diptera]
Length=211

 Score =   306 bits (784),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 148/192 (77%), Positives = 172/192 (90%), Gaps = 1/192 (1%)
 Frame = +1

Query  127  TNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMISTSGKLHEYISPSTSTKQLFDQYQKT  306
            TNRQVTYSKR NGLFKKA+ELTVLCDAKVSIIM ST+GKLHEYISP+ +TKQ++DQYQK 
Sbjct  3    TNRQVTYSKRSNGLFKKANELTVLCDAKVSIIMFSTTGKLHEYISPAATTKQMYDQYQKA  62

Query  307  VGVDLWNSHFEKMQEQLKKLRDVNRALRREIRQRMGEGLNDLSFEQLTELIEDVDNSIKL  486
            + VDLW+SH+E+MQE LKKL++VNR LRREIRQRMGE L DLSFE+L  L +D+++S+K+
Sbjct  63   LEVDLWSSHYERMQEHLKKLKEVNRNLRREIRQRMGESLTDLSFEELRGLEQDIEDSLKV  122

Query  487  IRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLVDHEGDYNSVLGFPN  663
            IRERKYKVI NQIET KKK+RNVEEIHRNLLLE +AR++DP YGLVD  GDY+SVLGF N
Sbjct  123  IRERKYKVISNQIETSKKKLRNVEEIHRNLLLEFDAREDDPHYGLVDDGGDYDSVLGFSN  182

Query  664  GGPRILALRLQP  699
            GG RILALRLQP
Sbjct  183  GGHRILALRLQP  194



>gb|AEG19541.1| apetala3-like protein [Vitis labrusca x Vitis vinifera]
Length=226

 Score =   306 bits (785),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 147/207 (71%), Positives = 180/207 (87%), Gaps = 1/207 (0%)
 Frame = +1

Query  85   MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMISTSGKLHEYISP  264
            MARGKI+IKRIEN TNRQVTYSKRRNG+FKKA ELTVLCDAKVSIIM+S++GKLHEYISP
Sbjct  1    MARGKIEIKRIENSTNRQVTYSKRRNGIFKKASELTVLCDAKVSIIMLSSTGKLHEYISP  60

Query  265  STSTKQLFDQYQKTVGVDLWNSHFEKMQEQLKKLRDVNRALRREIRQRMGEGLNDLSFEQ  444
            S +TKQ+FDQYQ T+GVDLW+ H+E+MQE LKKL+DVN+ LR+EIRQRMGE L+DLS E+
Sbjct  61   SATTKQIFDQYQNTLGVDLWSYHYERMQENLKKLKDVNKNLRKEIRQRMGEHLSDLSVEE  120

Query  445  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLV  621
            L +L +++++S+K++R+RKY+VI NQIET KKKVRNVE+IH+NLL E +AR  D  YGLV
Sbjct  121  LRDLEQEMESSLKMVRDRKYQVINNQIETFKKKVRNVEQIHKNLLHEFDARDRDQYYGLV  180

Query  622  DHEGDYNSVLGFPNGGPRILALRLQPD  702
            D+ GDY SVLGF NG   + AL LQP+
Sbjct  181  DNGGDYESVLGFSNGSSPVFALSLQPN  207



>gb|ACY08901.1| MADS-domain transcription factor, partial [Napoleonaea vogelii]
Length=207

 Score =   306 bits (783),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 149/190 (78%), Positives = 171/190 (90%), Gaps = 2/190 (1%)
 Frame = +1

Query  136  QVTYSKRR-NGLFKKAHELTVLCDAKVSIIMISTSGKLHEYISPSTSTKQLFDQYQKTVG  312
            QVTYSKRR NGLFKKAHELTVLCDAKVSIIMIS++ KLHEYISPSTSTKQLFDQYQ  +G
Sbjct  1    QVTYSKRRRNGLFKKAHELTVLCDAKVSIIMISSTNKLHEYISPSTSTKQLFDQYQNALG  60

Query  313  VDLWNSHFEKMQEQLKKLRDVNRALRREIRQRMGEGLNDLSFEQLTELIEDVDNSIKLIR  492
            VDLW+SH+EKMQE LKKL++VNR+LRREIRQRMGE LNDLSF++L  L +DVD S+K+IR
Sbjct  61   VDLWSSHYEKMQEHLKKLKEVNRSLRREIRQRMGESLNDLSFDELLGLEQDVDTSLKMIR  120

Query  493  ERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLVDHEGDYNSVLGFPNGG  669
            ERKYKVIGNQI+THKKK+RN +EI+R+L+LE +AR EDP YGLVD+ GDYNSVLGF N G
Sbjct  121  ERKYKVIGNQIDTHKKKMRNAQEINRSLILEFDARGEDPHYGLVDNGGDYNSVLGFSNRG  180

Query  670  PRILALRLQP  699
            P +LAL LQP
Sbjct  181  PHLLALHLQP  190



>ref|XP_006581063.1| PREDICTED: MADS-box protein GmNMH7 isoform X1 [Glycine max]
 gb|KHN22206.1| Floral homeotic protein DEFICIENS [Glycine soja]
Length=227

 Score =   304 bits (779),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 147/206 (71%), Positives = 172/206 (83%), Gaps = 1/206 (0%)
 Frame = +1

Query  85   MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMISTSGKLHEYISP  264
            MARGKIQIKRIEN TNRQVTYSKRRNGLFKKA+ELTVLCDAKVSIIM S++GKLHEYISP
Sbjct  1    MARGKIQIKRIENTTNRQVTYSKRRNGLFKKANELTVLCDAKVSIIMFSSTGKLHEYISP  60

Query  265  STSTKQLFDQYQKTVGVDLWNSHFEKMQEQLKKLRDVNRALRREIRQRMGEGLNDLSFEQ  444
            STSTKQ FDQYQ T+GVDLWNSH+E MQE LKKL+DVNR LR+EIRQRMG+ LNDL  E 
Sbjct  61   STSTKQFFDQYQMTLGVDLWNSHYENMQENLKKLKDVNRNLRKEIRQRMGDCLNDLGMED  120

Query  445  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLV  621
            L  L E++D + K++RERKYKVI NQI+T +KK  N +E+H  LL + +AR EDP + L+
Sbjct  121  LKLLEEEMDKAAKVVRERKYKVITNQIDTQRKKFNNEKEVHNRLLRDLDARAEDPRFALI  180

Query  622  DHEGDYNSVLGFPNGGPRILALRLQP  699
            D+ G+Y SV+GF N GPR+ AL LQP
Sbjct  181  DNGGEYESVIGFSNLGPRMFALSLQP  206



>ref|NP_001236857.1| MADS-box protein GmNMH7 [Glycine max]
 gb|AAQ81636.1| MADS-box protein GmNMH7 [Glycine max]
Length=252

 Score =   304 bits (779),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 147/206 (71%), Positives = 172/206 (83%), Gaps = 1/206 (0%)
 Frame = +1

Query  85   MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMISTSGKLHEYISP  264
            MARGKIQIKRIEN TNRQVTYSKRRNGLFKKA+ELTVLCDAKVSIIM S++GKLHEYISP
Sbjct  1    MARGKIQIKRIENTTNRQVTYSKRRNGLFKKANELTVLCDAKVSIIMFSSTGKLHEYISP  60

Query  265  STSTKQLFDQYQKTVGVDLWNSHFEKMQEQLKKLRDVNRALRREIRQRMGEGLNDLSFEQ  444
            STSTKQ FDQYQ T+GVDLWNSH+E MQE LKKL+DVNR LR+EIRQRMG+ LNDL  E 
Sbjct  61   STSTKQFFDQYQMTLGVDLWNSHYENMQENLKKLKDVNRNLRKEIRQRMGDCLNDLGMED  120

Query  445  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLV  621
            L  L E++D + K++RERKYKVI NQI+T +KK  N +E+H  LL + +AR EDP + L+
Sbjct  121  LKLLEEEMDKAAKVVRERKYKVITNQIDTQRKKFNNEKEVHNRLLRDLDARAEDPRFALI  180

Query  622  DHEGDYNSVLGFPNGGPRILALRLQP  699
            D+ G+Y SV+GF N GPR+ AL LQP
Sbjct  181  DNGGEYESVIGFSNLGPRMFALSLQP  206



>gb|ACY08903.1| MADS-domain transcription factor, partial [Diospyros digyna]
Length=223

 Score =   303 bits (776),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 144/192 (75%), Positives = 175/192 (91%), Gaps = 1/192 (1%)
 Frame = +1

Query  127  TNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMISTSGKLHEYISPSTSTKQLFDQYQKT  306
            TNRQVTYSKRRNGLFKKA+ELTVLCDA+VSIIM+S++GK+HEYI+P+T+TKQLFDQYQKT
Sbjct  3    TNRQVTYSKRRNGLFKKANELTVLCDARVSIIMVSSTGKIHEYINPTTTTKQLFDQYQKT  62

Query  307  VGVDLWNSHFEKMQEQLKKLRDVNRALRREIRQRMGEGLNDLSFEQLTELIEDVDNSIKL  486
            + +DLW+SH+E+MQE LKKL+DVNR LRR+IRQRMGE LNDL+F ++  L ED+++S+K+
Sbjct  63   LNIDLWSSHYERMQENLKKLKDVNRNLRRQIRQRMGESLNDLNFNEMHGLEEDIESSLKV  122

Query  487  IRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLVDHEGDYNSVLGFPN  663
            IRERKYKVIGNQIET+KKK+RNVEEI+RNL+ E  AR+EDP YGLVD+  DY  VLGF N
Sbjct  123  IRERKYKVIGNQIETYKKKMRNVEEINRNLMHEFGAREEDPHYGLVDNGVDYEHVLGFLN  182

Query  664  GGPRILALRLQP  699
            GGPR+LALRLQP
Sbjct  183  GGPRMLALRLQP  194



>gb|AAS45991.1| deficiens [Erythranthe lewisii]
Length=218

 Score =   303 bits (775),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 147/203 (72%), Positives = 173/203 (85%), Gaps = 15/203 (7%)
 Frame = +1

Query  85   MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMISTSGKLHEYISP  264
            MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSI+MIS++         
Sbjct  1    MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSILMISST---------  51

Query  265  STSTKQLFDQYQKTVGVDLWNSHFEKMQEQLKKLRDVNRALRREIRQRMGEGLNDLSFEQ  444
                 Q+FDQYQK VGVD+WNSH+EKMQE LKKL+DVNR LRREIRQR+GE LNDL + Q
Sbjct  52   -----QMFDQYQKAVGVDIWNSHYEKMQEHLKKLKDVNRNLRREIRQRVGECLNDLGYHQ  106

Query  445  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLV  621
            +  L +D+DNS+++IRE+KYK I NQI+  KKK+RNVEEI+RNL LE +ARQEDP YGLV
Sbjct  107  MVNLSDDIDNSLRIIREKKYKAISNQIDNSKKKLRNVEEINRNLALEFDARQEDPHYGLV  166

Query  622  DHEGDYNSVLGFPNGGPRILALR  690
            +++GDYN++LGFPNGGPRI+ALR
Sbjct  167  ENDGDYNALLGFPNGGPRIVALR  189



>gb|AAS45987.1| deficiens [Salvia coccinea]
Length=231

 Score =   303 bits (775),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 143/202 (71%), Positives = 174/202 (86%), Gaps = 1/202 (0%)
 Frame = +1

Query  85   MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMISTSGKLHEYISP  264
            MARGKIQIK+IENQTNRQVTYSKRRNGLFKKAHELTVLCDAK+SIIMIS++ KLHEYISP
Sbjct  1    MARGKIQIKKIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKISIIMISSTQKLHEYISP  60

Query  265  STSTKQLFDQYQKTVGVDLWNSHFEKMQEQLKKLRDVNRALRREIRQRMGEGLNDLSFEQ  444
            + +TKQ+ D+YQKTV  DLW+ H+EKMQE LKKL+++N  LR++IRQR GE LNDL +EQ
Sbjct  61   TITTKQIVDEYQKTVRTDLWSFHYEKMQEHLKKLKEMNMNLRKDIRQRSGESLNDLGYEQ  120

Query  445  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLV  621
            +  LIED+D S+  IRERKYK +GNQI+  KKK+RNVE+IH++LL    AR +DP YGLV
Sbjct  121  VVSLIEDIDKSLAFIRERKYKALGNQIDNTKKKLRNVEDIHKSLLFGFNARHDDPQYGLV  180

Query  622  DHEGDYNSVLGFPNGGPRILAL  687
            ++EG YNS+LGF +GGPRI+AL
Sbjct  181  ENEGHYNSMLGFRHGGPRIIAL  202



>gb|ACU13442.1| unknown [Glycine max]
Length=227

 Score =   302 bits (774),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 146/206 (71%), Positives = 171/206 (83%), Gaps = 1/206 (0%)
 Frame = +1

Query  85   MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMISTSGKLHEYISP  264
            MARGKIQIKRIEN TNRQVTYSKRRNGLFKKA+ELTVLCDAKVSIIM S++GKLHEYISP
Sbjct  1    MARGKIQIKRIENTTNRQVTYSKRRNGLFKKANELTVLCDAKVSIIMFSSTGKLHEYISP  60

Query  265  STSTKQLFDQYQKTVGVDLWNSHFEKMQEQLKKLRDVNRALRREIRQRMGEGLNDLSFEQ  444
            STSTKQ FDQYQ T+GVDLWNSH+E MQE LKKL+DVNR LR+EIRQRMG+ LNDL  E 
Sbjct  61   STSTKQFFDQYQMTLGVDLWNSHYENMQENLKKLKDVNRNLRKEIRQRMGDCLNDLGMED  120

Query  445  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLV  621
            L  L E++D + K++RERKYKVI NQI+T +KK  N +E+H  LL + + R EDP + L+
Sbjct  121  LKLLEEEMDKAAKVVRERKYKVITNQIDTQRKKFNNEKEVHNRLLRDLDVRAEDPRFALI  180

Query  622  DHEGDYNSVLGFPNGGPRILALRLQP  699
            D+ G+Y SV+GF N GPR+ AL LQP
Sbjct  181  DNGGEYESVIGFSNLGPRMFALSLQP  206



>ref|XP_003603721.1| Apetala3-like protein [Medicago truncatula]
 gb|AES73972.1| MADS-box transcription factor [Medicago truncatula]
 gb|AEW43601.1| MADS-box transcription factor NMH7 [Medicago truncatula]
Length=229

 Score =   302 bits (773),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 147/206 (71%), Positives = 171/206 (83%), Gaps = 1/206 (0%)
 Frame = +1

Query  85   MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMISTSGKLHEYISP  264
            MARGKIQIKRIEN TNRQVTYSKRRNGLFKKA+ELTVLCDAKVSIIM S++GKLHEYISP
Sbjct  1    MARGKIQIKRIENTTNRQVTYSKRRNGLFKKANELTVLCDAKVSIIMFSSTGKLHEYISP  60

Query  265  STSTKQLFDQYQKTVGVDLWNSHFEKMQEQLKKLRDVNRALRREIRQRMGEGLNDLSFEQ  444
            S STKQ FDQYQ TVG+DLWNSH+E MQE LKKL+DVNR LR+EIRQRMGE LNDLS E+
Sbjct  61   SASTKQFFDQYQMTVGIDLWNSHYENMQENLKKLKDVNRNLRKEIRQRMGECLNDLSMEE  120

Query  445  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLV  621
            L  L +++D + K IRERKYKVI NQI+T +KK  N  E+H  LL + +AR EDP + ++
Sbjct  121  LRLLEDEMDKAAKAIRERKYKVITNQIDTQRKKFNNEREVHNRLLRDLDARAEDPRFEMM  180

Query  622  DHEGDYNSVLGFPNGGPRILALRLQP  699
            D+ G+Y SV+GF N GPR+ AL LQP
Sbjct  181  DNGGEYESVIGFSNLGPRMFALSLQP  206



>gb|AAC42584.1| APETALA3 homolog SvAP3 [Syringa vulgaris]
Length=202

 Score =   300 bits (769),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 142/179 (79%), Positives = 166/179 (93%), Gaps = 1/179 (1%)
 Frame = +1

Query  160  NGLFKKAHELTVLCDAKVSIIMISTSGKLHEYISPSTSTKQLFDQYQKTVGVDLWNSHFE  339
            NGLFKKAHELTVLCDAKVSIIMIS++ K+HEYISP++STKQLFD YQ TVGVDLW +H+E
Sbjct  1    NGLFKKAHELTVLCDAKVSIIMISSTQKIHEYISPTSSTKQLFDLYQTTVGVDLWITHYE  60

Query  340  KMQEQLKKLRDVNRALRREIRQRMGEGLNDLSFEQLTELIEDVDNSIKLIRERKYKVIGN  519
            +MQE L+KL+D+N+ LRREIRQRMGE LNDL+++Q+  LIEDVD+S++ IRERKYKVIGN
Sbjct  61   RMQEHLRKLKDINKNLRREIRQRMGESLNDLNYDQIVSLIEDVDDSLRKIRERKYKVIGN  120

Query  520  QIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLVDHEGDYNSVLGFPNGGPRILALRL  693
            QIET KKK+RNVEEIHRN+LLE +ARQEDP YGLVD+EGDYNSVLGFPNGGPRI+ALRL
Sbjct  121  QIETSKKKLRNVEEIHRNILLEFDARQEDPQYGLVDNEGDYNSVLGFPNGGPRIIALRL  179



>gb|AEM60173.1| MADS box transcription factor, partial [Buddleja davidii]
Length=193

 Score =   300 bits (767),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 144/183 (79%), Positives = 168/183 (92%), Gaps = 2/183 (1%)
 Frame = +1

Query  160  NGLFKKAHELTVLCDAKVSIIMISTSGKLHEYISPSTSTKQLFDQYQKTVGVDLWNSHFE  339
            NGLFKKAHELTVLCDAKVSIIMIS++ KLHEYISP+ +TKQ+FDQYQK VGVDLW+SH+E
Sbjct  1    NGLFKKAHELTVLCDAKVSIIMISSTQKLHEYISPTVTTKQMFDQYQKAVGVDLWSSHYE  60

Query  340  KMQEQLKKLRDVNRALRREIRQRMGEGLNDLSFEQLTELIEDVDNSIKLIRERKYKVIGN  519
            KMQE LKKL++VNR LRREIRQRMGE LNDL ++Q+  LIEDVD+S++LIR+RKYKVIGN
Sbjct  61   KMQEHLKKLKEVNRNLRREIRQRMGESLNDLGYDQMVNLIEDVDSSLRLIRDRKYKVIGN  120

Query  520  QIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLVDHEGDYNSV-LGFPNGGPRILALRL  693
            QI+T KKK+RNVEEIHRNL+LE +ARQEDP YGLV++EGDYNSV LGFPNGG RI+ALRL
Sbjct  121  QIDTTKKKLRNVEEIHRNLVLEFDARQEDPHYGLVENEGDYNSVNLGFPNGGSRIIALRL  180

Query  694  QPD  702
             P+
Sbjct  181  PPN  183



>gb|AAX13301.1| MADS box protein AP3 [Lotus japonicus]
Length=229

 Score =   297 bits (761),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 145/206 (70%), Positives = 173/206 (84%), Gaps = 1/206 (0%)
 Frame = +1

Query  85   MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMISTSGKLHEYISP  264
            MARGKIQIKRIEN TNRQVTYSKRRNGLFKKA+ELTVLCDAKVSIIM S++GKLHEYISP
Sbjct  1    MARGKIQIKRIENTTNRQVTYSKRRNGLFKKANELTVLCDAKVSIIMFSSTGKLHEYISP  60

Query  265  STSTKQLFDQYQKTVGVDLWNSHFEKMQEQLKKLRDVNRALRREIRQRMGEGLNDLSFEQ  444
            STSTKQ FDQYQ TVGVDLW+SH+E MQE LKKL++VNR LR+EIRQR+G+ LNDLS ++
Sbjct  61   STSTKQFFDQYQMTVGVDLWSSHYENMQENLKKLKEVNRNLRKEIRQRVGDCLNDLSMDE  120

Query  445  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQED-PYGLV  621
            L  L +++DN+ K +RERKYKVI NQI+T +KK  N  E+H  LL + +AR E+ PY L+
Sbjct  121  LRLLEQEMDNAAKAVRERKYKVITNQIDTQRKKFNNEREVHNRLLRDLDARAENPPYELM  180

Query  622  DHEGDYNSVLGFPNGGPRILALRLQP  699
            D+ G+Y SV+GF N GPR+ AL LQP
Sbjct  181  DNGGEYESVIGFSNLGPRMFALSLQP  206



>gb|AAC15419.1| MADS-box protein NMH 7 [Medicago sativa]
Length=229

 Score =   296 bits (759),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 145/206 (70%), Positives = 170/206 (83%), Gaps = 1/206 (0%)
 Frame = +1

Query  85   MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMISTSGKLHEYISP  264
            MARGKIQIKRIEN TNRQVTYSKRR+GLFKKA+ELTVLCDAKVSIIM S++GKLHEYISP
Sbjct  1    MARGKIQIKRIENTTNRQVTYSKRRDGLFKKANELTVLCDAKVSIIMFSSTGKLHEYISP  60

Query  265  STSTKQLFDQYQKTVGVDLWNSHFEKMQEQLKKLRDVNRALRREIRQRMGEGLNDLSFEQ  444
            S STKQ FDQYQ TVG+DLWNSH+E MQE LKKL+DVNR LR+EIRQ MGE LNDLS E+
Sbjct  61   SASTKQFFDQYQMTVGIDLWNSHYENMQENLKKLKDVNRNLRKEIRQGMGECLNDLSMEE  120

Query  445  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLV  621
            L  L +++D + K IRERKYKVI NQI+T +KK  N  E+H  LL + +AR EDP + ++
Sbjct  121  LRLLEDEMDKAAKAIRERKYKVITNQIDTQRKKSNNEREVHNRLLRDLDARAEDPRFEMM  180

Query  622  DHEGDYNSVLGFPNGGPRILALRLQP  699
            D+ G+Y SV+GF N GPR+ AL LQP
Sbjct  181  DNGGEYESVIGFSNLGPRMFALSLQP  206



>gb|KHN45898.1| Floral homeotic protein DEFICIENS [Glycine soja]
Length=227

 Score =   295 bits (754),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 141/206 (68%), Positives = 171/206 (83%), Gaps = 1/206 (0%)
 Frame = +1

Query  85   MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMISTSGKLHEYISP  264
            MARGKIQIKRIEN TNRQVTYSKRRNGLFKKA+ELTVLCDAKVSIIM S++GKLH+YISP
Sbjct  1    MARGKIQIKRIENNTNRQVTYSKRRNGLFKKANELTVLCDAKVSIIMFSSTGKLHQYISP  60

Query  265  STSTKQLFDQYQKTVGVDLWNSHFEKMQEQLKKLRDVNRALRREIRQRMGEGLNDLSFEQ  444
            STSTKQ FDQYQ T+GVDLWNSH+E MQE LKKL++VNR LR+E RQRMG+ LN+L  E 
Sbjct  61   STSTKQFFDQYQMTLGVDLWNSHYENMQENLKKLKEVNRNLRKEFRQRMGDCLNELGMED  120

Query  445  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLV  621
            L  L E++D + K++RERKYKVI NQI+T +KK  N +E+H  LL + +A+ EDP + L+
Sbjct  121  LKLLEEEMDKAAKVVRERKYKVITNQIDTQRKKFNNEKEVHNRLLHDLDAKAEDPRFALI  180

Query  622  DHEGDYNSVLGFPNGGPRILALRLQP  699
            D+ G+Y SV+GF N GPR+ AL +QP
Sbjct  181  DNGGEYESVIGFSNLGPRMFALSIQP  206



>ref|XP_008466510.1| PREDICTED: floral homeotic protein DEFICIENS [Cucumis melo]
Length=270

 Score =   295 bits (756),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 149/216 (69%), Positives = 181/216 (84%), Gaps = 11/216 (5%)
 Frame = +1

Query  85   MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMISTSGKLHEYISP  264
            MARGKIQIKRIEN TNRQVTYSKRRNGLFKKA+ELTVLCDAKVSIIM S++GKLHEYISP
Sbjct  27   MARGKIQIKRIENPTNRQVTYSKRRNGLFKKANELTVLCDAKVSIIMFSSTGKLHEYISP  86

Query  265  STSTKQLFDQYQKTVGVDLWNSHFEKMQEQLKKLRDVNRALRREIRQRMGEGLNDLSFEQ  444
            +TSTK+LFDQYQKT+GVDLW SH+E+MQ+ LKKL+D+NR LRR+IRQRMGE +NDLSFE+
Sbjct  87   ATSTKELFDQYQKTLGVDLWISHYERMQDNLKKLKDINRNLRRQIRQRMGECMNDLSFEE  146

Query  445  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECE-ARQEDPY---  612
            L  L +D+DN++++IRERKY+VI NQIETHKKK+++V EIH++LL E + A +EDP+   
Sbjct  147  LRCLEQDMDNAVRIIRERKYRVISNQIETHKKKLKSVGEIHKSLLQEFDIATEEDPHYGL  206

Query  613  ------GLVDHEGDYNSVLGFPNGG-PRILALRLQP  699
                  G+    GDY S++GF     PRI ALRLQP
Sbjct  207  VDNGGVGVGIGGGDYESIMGFSGAAHPRIFALRLQP  242



>gb|AAB48660.1| MADS-box protein [Medicago sativa]
Length=247

 Score =   294 bits (753),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 144/206 (70%), Positives = 169/206 (82%), Gaps = 1/206 (0%)
 Frame = +1

Query  85   MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMISTSGKLHEYISP  264
            MARGKIQIKRIEN TNRQV YSKRRNGLFKKA+ELTVLCDAKVSIIM S++GKLHEYISP
Sbjct  1    MARGKIQIKRIENTTNRQVIYSKRRNGLFKKANELTVLCDAKVSIIMFSSTGKLHEYISP  60

Query  265  STSTKQLFDQYQKTVGVDLWNSHFEKMQEQLKKLRDVNRALRREIRQRMGEGLNDLSFEQ  444
            S STKQ FDQYQ TVG+DLWNSH+E MQE LKKL+DVNR LR+EIRQ MGE LNDLS E+
Sbjct  61   SASTKQFFDQYQTTVGIDLWNSHYENMQENLKKLKDVNRNLRKEIRQGMGECLNDLSMEE  120

Query  445  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLV  621
            L  L +++D ++K IRERKYKVI NQI+T +KK  N  E+   LL + +AR EDP + ++
Sbjct  121  LRLLEDEMDKALKAIRERKYKVITNQIDTQRKKFNNEREVDNRLLRDLDARAEDPRFEMM  180

Query  622  DHEGDYNSVLGFPNGGPRILALRLQP  699
            D+ G+Y SV+GF N GPR+ AL LQP
Sbjct  181  DNGGEYESVIGFSNLGPRMFALSLQP  206



>gb|AEA76416.1| putative DEF1, partial [Catharanthus roseus]
Length=163

 Score =   290 bits (741),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 139/163 (85%), Positives = 153/163 (94%), Gaps = 0/163 (0%)
 Frame = +1

Query  115  IENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMISTSGKLHEYISPSTSTKQLFDQ  294
            IENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIM+S++ KLHEYISP+TSTKQL DQ
Sbjct  1    IENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMVSSTQKLHEYISPTTSTKQLIDQ  60

Query  295  YQKTVGVDLWNSHFEKMQEQLKKLRDVNRALRREIRQRMGEGLNDLSFEQLTELIEDVDN  474
            YQK +GVDLWNSH+EKMQEQLKKL+DVNR LRREIRQRMGE LN+L+++QL  LIEDVDN
Sbjct  61   YQKALGVDLWNSHYEKMQEQLKKLKDVNRNLRREIRQRMGESLNELTYDQLGNLIEDVDN  120

Query  475  SIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQE  603
            S+  IRERK+KVIGNQIETHKKKVRNVEEIHRNLLLE +ARQE
Sbjct  121  SLSAIRERKFKVIGNQIETHKKKVRNVEEIHRNLLLELDARQE  163



>dbj|BAK20024.1| PgMADS protein9 [Panax ginseng]
Length=240

 Score =   292 bits (747),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 149/212 (70%), Positives = 175/212 (83%), Gaps = 8/212 (4%)
 Frame = +1

Query  85   MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMISTSGKLHEYISP  264
            MARGKIQIKRIEN TNRQVTYSKRRNGLFKKA+ELTVLCDAKVSIIM+ST+ KLHEYISP
Sbjct  1    MARGKIQIKRIENSTNRQVTYSKRRNGLFKKANELTVLCDAKVSIIMVSTTNKLHEYISP  60

Query  265  STSTKQLFDQYQKTVGVDLWNSHFEKMQEQLKKLRDVNRALRREIRQRMGEGLNDLSFEQ  444
            S STKQ FD YQKT  +DLW+SH+E MQEQL+KL++VN+ L+REIR+RMGE LN ++ E+
Sbjct  61   SISTKQFFDLYQKTKRIDLWSSHYEAMQEQLRKLKEVNKNLKREIRRRMGESLNGMTLEE  120

Query  445  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLV  621
            L  L + +D S+K+IRERK KVIGNQIETHKKKVRN EEIHRNLL E E R+EDP YGLV
Sbjct  121  LWSLEQKMDESVKIIRERKMKVIGNQIETHKKKVRNGEEIHRNLLHEFELREEDPRYGLV  180

Query  622  DHEGDY----NSVLGFPNGG---PRILALRLQ  696
            ++ G+     +SV+G+       PRILA RLQ
Sbjct  181  ENGGEEYEYDSSVVGYSQEAVLLPRILAFRLQ  212



>ref|XP_012071964.1| PREDICTED: floral homeotic protein DEFICIENS-like isoform X2 
[Jatropha curcas]
 gb|KDP38582.1| hypothetical protein JCGZ_04507 [Jatropha curcas]
Length=221

 Score =   291 bits (744),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 149/208 (72%), Positives = 173/208 (83%), Gaps = 8/208 (4%)
 Frame = +1

Query  85   MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMISTSGKLHEYISP  264
            MARGKIQIKRIEN TNRQVTYSKRRNGLFKKA+ELTVLCDAKVSIIM S++GKLHEYISP
Sbjct  1    MARGKIQIKRIENSTNRQVTYSKRRNGLFKKANELTVLCDAKVSIIMFSSTGKLHEYISP  60

Query  265  STSTKQLFDQYQKTVGVDLWNSHFEKMQEQLKKLRDVNRALRREIRQRMGEGLNDLSFEQ  444
            ST+TKQLFD+YQKT+G+DLW++ +  MQE LKKL+DVNR L  EIRQRMGE LND SFE 
Sbjct  61   STTTKQLFDEYQKTLGIDLWSTQYASMQENLKKLKDVNRNLITEIRQRMGECLNDASFEH  120

Query  445  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLV  621
            L  L +DVD ++ L+R+RK K+I NQI+T +KKVRNVEEIH+NLL E EAR EDP YGLV
Sbjct  121  LRSLEQDVDTALLLVRQRKNKMINNQIQTCRKKVRNVEEIHQNLLREFEARDEDPHYGLV  180

Query  622  DH-EGDYNSVLGFPNGGPRILALRLQPD  702
            D+  GDY+S+L        I ALRLQP+
Sbjct  181  DNGAGDYDSML------RNIFALRLQPN  202



>gb|AEM60196.1| MADS box transcription factor, partial [Osmanthus fragrans]
Length=188

 Score =   288 bits (738),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 137/179 (77%), Positives = 162/179 (91%), Gaps = 1/179 (1%)
 Frame = +1

Query  160  NGLFKKAHELTVLCDAKVSIIMISTSGKLHEYISPSTSTKQLFDQYQKTVGVDLWNSHFE  339
            NGLFKKAHELTVL DAKVSIIMIS++ K+HEYISP+++TKQLFDQYQK VG+DLW +H+E
Sbjct  1    NGLFKKAHELTVLRDAKVSIIMISSTQKIHEYISPTSTTKQLFDQYQKAVGIDLWTTHYE  60

Query  340  KMQEQLKKLRDVNRALRREIRQRMGEGLNDLSFEQLTELIEDVDNSIKLIRERKYKVIGN  519
            KMQE L+KL+D+++ LR EIRQRMGE LNDL+++Q+  LIEDVD+S+K IRE KYKVIGN
Sbjct  61   KMQEHLRKLKDIHKNLRTEIRQRMGESLNDLNYDQIVNLIEDVDDSLKKIREGKYKVIGN  120

Query  520  QIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLVDHEGDYNSVLGFPNGGPRILALRL  693
            QIET KKK+RNVEEIHRN+LLE +ARQEDP YGLVD+EGDYNSVLGF NGGPRI+A RL
Sbjct  121  QIETSKKKLRNVEEIHRNILLEFDARQEDPQYGLVDNEGDYNSVLGFSNGGPRIIAYRL  179



>gb|AEM60179.1| MADS box transcription factor, partial [Utricularia sp. VFI-2011]
Length=207

 Score =   288 bits (738),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 138/180 (77%), Positives = 160/180 (89%), Gaps = 2/180 (1%)
 Frame = +1

Query  160  NGLFKKAHELTVLCDAKVSIIMISTSGKLHEYISPSTSTKQLFDQYQKTVGVDLWNSHFE  339
            NGLFKKAHELTVLCDAKVSI+M+S++ KLHEYISPST+TKQ+FDQYQK VGVDLWN+H+E
Sbjct  1    NGLFKKAHELTVLCDAKVSIVMVSSTQKLHEYISPSTTTKQVFDQYQKAVGVDLWNTHYE  60

Query  340  KMQEQLKKLRDVNRALRREIRQRMGEGLNDLSFEQLTELIEDVDNSIKLIRERKYKVIGN  519
            KMQE LKKL++ NR LR+EIRQRMGE LNDL +EQ+ +LIE++D SI LIRERKYKVIGN
Sbjct  61   KMQEHLKKLKEANRNLRKEIRQRMGECLNDLGYEQMVDLIENMDKSISLIRERKYKVIGN  120

Query  520  QIETHKKKVRNVEEIHRNLLLECE-ARQEDP-YGLVDHEGDYNSVLGFPNGGPRILALRL  693
            QIET KKKVRN EE+HR  LLE + ARQEDP YGLV++E D+NSVLGFP GGPRI+ LRL
Sbjct  121  QIETSKKKVRNAEEVHRKNLLEFDAARQEDPHYGLVENEADFNSVLGFPGGGPRIITLRL  180



>gb|AAX37273.1| MADS box protein [Cucumis sativus]
Length=244

 Score =   290 bits (741),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 146/216 (68%), Positives = 180/216 (83%), Gaps = 11/216 (5%)
 Frame = +1

Query  85   MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMISTSGKLHEYISP  264
            MARGKIQIKRIEN TNRQVTYSKRRNGL KKA+ELTVLCDAKVSIIM S++GKLHEYISP
Sbjct  1    MARGKIQIKRIENPTNRQVTYSKRRNGLLKKANELTVLCDAKVSIIMFSSTGKLHEYISP  60

Query  265  STSTKQLFDQYQKTVGVDLWNSHFEKMQEQLKKLRDVNRALRREIRQRMGEGLNDLSFEQ  444
            +TSTK+LFDQYQKT+GVDLW +H+E+MQ+ LKKL+D+NR LRR+IRQRMGE +NDLSFE+
Sbjct  61   ATSTKELFDQYQKTLGVDLWITHYERMQDNLKKLKDINRNLRRQIRQRMGECMNDLSFEE  120

Query  445  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECE-ARQEDPY---  612
            L  L +D+D+++++IRERKY+VI NQIETHKKK+++V EIH++LL E + A +EDP+   
Sbjct  121  LRCLEQDMDSAVRIIRERKYRVISNQIETHKKKLKSVGEIHKSLLQEFDIATEEDPHYGL  180

Query  613  ------GLVDHEGDYNSVLGFPNGG-PRILALRLQP  699
                  G+    GDY S++GF     PRI ALRLQP
Sbjct  181  VDNGGVGVGIGGGDYESIMGFSGAAHPRIFALRLQP  216



>gb|ABD78317.1| Def-like protein [Primula vulgaris]
 gb|ABD78319.1| Def-like protein [Primula vulgaris]
Length=228

 Score =   288 bits (736),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 141/209 (67%), Positives = 178/209 (85%), Gaps = 3/209 (1%)
 Frame = +1

Query  85   MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMISTSGKLHEYISP  264
            MARGKIQIK+IEN TNRQVTYSKRRNGLFKKA EL VLCDAKVSIIM+S + K+HE+ SP
Sbjct  1    MARGKIQIKKIENATNRQVTYSKRRNGLFKKAGELAVLCDAKVSIIMLSGTNKIHEFHSP  60

Query  265  S-TSTKQLFDQYQKTVGVDLWNSHFEKMQEQLKKLRDVNRALRREIRQRMGEGLNDLSFE  441
               +TKQLFDQYQ+T+G+DLW+SH+EKMQE L+K +++N+ LR+EIRQRMG+ L++L   
Sbjct  61   DHVTTKQLFDQYQQTMGIDLWSSHYEKMQEDLRKRKEINKNLRQEIRQRMGDSLSELDLN  120

Query  442  QLTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGL  618
            +L  L +D++ S++ IR RKYKVIGNQIET +KKVRN EE+HR LLLE +AR+EDP YGL
Sbjct  121  KLQTLEQDMEKSLEAIRGRKYKVIGNQIETSRKKVRNGEEVHRTLLLEFDAREEDPHYGL  180

Query  619  VDHEGDYNSVLGFPN-GGPRILALRLQPD  702
            VD+ GDY+SV+G+ N G PR+L+LRLQP+
Sbjct  181  VDNGGDYDSVIGYTNEGEPRMLSLRLQPN  209



>gb|AEM60165.1| MADS box transcription factor, partial [Nepeta grandiflora]
Length=226

 Score =   286 bits (731),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 133/195 (68%), Positives = 168/195 (86%), Gaps = 1/195 (1%)
 Frame = +1

Query  109  KRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMISTSGKLHEYISPSTSTKQLF  288
            K+IENQTNRQVTYSKRRNGLFKKAHELTVLCDAK+SI+MIS++ KLHEYISP+ +TKQ+F
Sbjct  1    KKIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKISILMISSTQKLHEYISPTITTKQIF  60

Query  289  DQYQKTVGVDLWNSHFEKMQEQLKKLRDVNRALRREIRQRMGEGLNDLSFEQLTELIEDV  468
            D+YQKT   DLW+SH+EKMQE LKKL+++NR L +EI QRMGE LNDL ++Q   LIED+
Sbjct  61   DEYQKTARTDLWSSHYEKMQEHLKKLKEINRNLMKEISQRMGESLNDLGYDQTVHLIEDM  120

Query  469  DNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLVDHEGDYNS  645
            + S++ IRE+KYK I ++I+T +KK RNV+EIH NLL + +AR EDP YGLV+++GDYN 
Sbjct  121  NQSLEKIREKKYKSISSKIDTTRKKQRNVQEIHNNLLSQLDARHEDPHYGLVENDGDYNC  180

Query  646  VLGFPNGGPRILALR  690
            VLGFP+GGPRI+ +R
Sbjct  181  VLGFPHGGPRIIPVR  195



>ref|XP_004500961.1| PREDICTED: floral homeotic protein PMADS 1-like [Cicer arietinum]
Length=230

 Score =   285 bits (730),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 144/206 (70%), Positives = 169/206 (82%), Gaps = 1/206 (0%)
 Frame = +1

Query  85   MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMISTSGKLHEYISP  264
            MARGKIQIKRIEN TNRQVTYSKRRNGLFKKA+ELTVLCDAKVSIIM S++GKLHEYISP
Sbjct  1    MARGKIQIKRIENTTNRQVTYSKRRNGLFKKANELTVLCDAKVSIIMFSSTGKLHEYISP  60

Query  265  STSTKQLFDQYQKTVGVDLWNSHFEKMQEQLKKLRDVNRALRREIRQRMGEGLNDLSFEQ  444
            S S+KQ FD YQ TVG DLW SH+E MQE LKKL+DVNR LR+EIRQRMG+ LNDLS E+
Sbjct  61   SISSKQFFDLYQMTVGTDLWTSHYENMQEHLKKLKDVNRNLRKEIRQRMGDCLNDLSMEE  120

Query  445  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLV  621
            L  L E++D ++K+IRE+KYK I +QI+TH+KK  N  E+H  LL + +AR EDP Y L+
Sbjct  121  LRLLEEEMDKAVKVIREKKYKGITSQIDTHRKKFNNEREVHNRLLHDLDARGEDPRYELM  180

Query  622  DHEGDYNSVLGFPNGGPRILALRLQP  699
            D  G+Y SV+GF N GPR+ AL LQP
Sbjct  181  DKGGEYESVIGFSNLGPRMFALTLQP  206



>gb|AEM60175.1| MADS box transcription factor, partial [Justicia brandegeana]
Length=219

 Score =   284 bits (726),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 144/194 (74%), Positives = 167/194 (86%), Gaps = 8/194 (4%)
 Frame = +1

Query  109  KRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMISTSGKLHEYISPSTSTKQLF  288
            KRIENQTNRQVTYSKRRNGLFKKA ELTV CDAKVSIIMIS++ KLHEYISP+  TKQ+F
Sbjct  1    KRIENQTNRQVTYSKRRNGLFKKAQELTVPCDAKVSIIMISSTQKLHEYISPTIGTKQVF  60

Query  289  DQYQKTVGVDLWNSHFEKMQEQLKKLRDVNRALRREIRQRMGEGLNDLSFEQLTELIEDV  468
            DQYQK VGVDLWN+H+EKMQE LKKL++ NR LR+EIRQRMGE LNDL ++Q+  LIE++
Sbjct  61   DQYQKAVGVDLWNTHYEKMQEHLKKLKEFNRNLRKEIRQRMGECLNDLGYDQMVNLIEEI  120

Query  469  DNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLV-DHEGDYN  642
            D S+ LIRERKYKVIGNQI+T KKK+RNVEEIHRNL+LE +ARQEDP YGLV +++GDY 
Sbjct  121  DASLGLIRERKYKVIGNQIDTSKKKLRNVEEIHRNLMLEFDARQEDPHYGLVENNDGDY-  179

Query  643  SVLGFPNGGPRILA  684
              LGF    P I+A
Sbjct  180  --LGFR---PHIIA  188



>gb|AEM60171.1| MADS box transcription factor, partial [Clerodendrum infortunatum]
Length=202

 Score =   283 bits (723),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 132/179 (74%), Positives = 163/179 (91%), Gaps = 1/179 (1%)
 Frame = +1

Query  160  NGLFKKAHELTVLCDAKVSIIMISTSGKLHEYISPSTSTKQLFDQYQKTVGVDLWNSHFE  339
            NGLFKKAHELTVLCDAK+SIIMIS++ KLHEYISP+ +TKQ+FD+YQ+ VGVDLW+SH+E
Sbjct  1    NGLFKKAHELTVLCDAKISIIMISSTQKLHEYISPTITTKQMFDKYQEAVGVDLWSSHYE  60

Query  340  KMQEQLKKLRDVNRALRREIRQRMGEGLNDLSFEQLTELIEDVDNSIKLIRERKYKVIGN  519
            +MQE LKKL++VNR LR+EIRQR G+ LNDL +EQ+ +LIED++ S+KLIRE+KYKVI N
Sbjct  61   RMQEHLKKLKEVNRNLRKEIRQRTGDCLNDLGYEQIVDLIEDMNTSVKLIREKKYKVISN  120

Query  520  QIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLVDHEGDYNSVLGFPNGGPRILALRL  693
            QI+T KKK+RNVEEIHR+L+LE +ARQEDP YGLV++ GDYNSVLGFP+GGPRI+A RL
Sbjct  121  QIDTTKKKLRNVEEIHRSLVLEFDARQEDPHYGLVENGGDYNSVLGFPHGGPRIIAFRL  179



>gb|AEW43604.1| MADS-box transcription factor NMH7 [Pisum sativum]
Length=233

 Score =   284 bits (726),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 145/207 (70%), Positives = 169/207 (82%), Gaps = 2/207 (1%)
 Frame = +1

Query  85   MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMISTSGKLHEYISP  264
            MARGKIQIKRIEN TNRQVTYSKRRNGLFKKA+ELTVLCDAKVSIIM S++GKLHEYISP
Sbjct  1    MARGKIQIKRIENTTNRQVTYSKRRNGLFKKANELTVLCDAKVSIIMFSSTGKLHEYISP  60

Query  265  STSTKQLFDQYQKTVGVDLWNSHFEKMQEQLKKLRDVNRALRREIRQRMGEGLNDLSFEQ  444
            S STKQ FDQYQ TVG+DLWNSH+E MQE LKKL+DVNR LR+EIRQRMG+ LNDLS E+
Sbjct  61   SVSTKQFFDQYQMTVGIDLWNSHYENMQENLKKLKDVNRNLRKEIRQRMGDCLNDLSMEE  120

Query  445  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLV  621
            L  L E++D + K IRERKYKVI NQI+T +KK  N  E+H  LL + +AR ED  + ++
Sbjct  121  LRLLEEEMDKAAKAIRERKYKVITNQIDTQRKKFNNEREVHNRLLRDLDARAEDGRFEMM  180

Query  622  DH-EGDYNSVLGFPNGGPRILALRLQP  699
            ++   DY SV+GF N GPR+ AL LQP
Sbjct  181  ENGAADYESVIGFSNLGPRMFALTLQP  207



>gb|AEM60164.1| MADS box transcription factor, partial [Salvia coccinea]
Length=214

 Score =   283 bits (723),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 134/194 (69%), Positives = 164/194 (85%), Gaps = 1/194 (1%)
 Frame = +1

Query  109  KRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMISTSGKLHEYISPSTSTKQLF  288
            K+IENQTNRQVTYSKRRNGLFKKAHELTVLCDAK SIIMIS++ KLH YISP+ +TKQ+ 
Sbjct  1    KKIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKTSIIMISSTQKLHGYISPTITTKQIV  60

Query  289  DQYQKTVGVDLWNSHFEKMQEQLKKLRDVNRALRREIRQRMGEGLNDLSFEQLTELIEDV  468
            D+YQKTV  DLW+ H+EKMQE LKKL+++N  LR++IRQR GE LNDL +EQ+  LIED+
Sbjct  61   DEYQKTVRTDLWSFHYEKMQEHLKKLKEMNMNLRKDIRQRSGESLNDLGYEQVVSLIEDI  120

Query  469  DNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLVDHEGDYNS  645
            D S+  IRERKYK +GNQI+  KKK+RNVE+IH++LL    AR +DP YGLV++EG YNS
Sbjct  121  DKSLAFIRERKYKALGNQIDNTKKKLRNVEDIHKSLLFGFNARHDDPQYGLVENEGHYNS  180

Query  646  VLGFPNGGPRILAL  687
            +LGF +GGPRI+AL
Sbjct  181  MLGFRHGGPRIIAL  194



>gb|ACY08917.1| MADS-domain transcription factor, partial [Galax urceolata]
Length=205

 Score =   282 bits (722),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 136/189 (72%), Positives = 163/189 (86%), Gaps = 1/189 (1%)
 Frame = +1

Query  139  VTYSKRRNGLFKKAHELTVLCDAKVSIIMISTSGKLHEYISPSTSTKQLFDQYQKTVGVD  318
            VTYSKRRNGLFKKA+ELTVLCDAKVSIIM STS KLHEYISP TSTKQ+FD YQ+  G+D
Sbjct  1    VTYSKRRNGLFKKANELTVLCDAKVSIIMFSTSNKLHEYISPCTSTKQMFDLYQQAKGID  60

Query  319  LWNSHFEKMQEQLKKLRDVNRALRREIRQRMGEGLNDLSFEQLTELIEDVDNSIKLIRER  498
            LW++H+EKMQE L+ L++ NR +RREIR RMGEGLNDL F++L  L +D+D+S+K +RER
Sbjct  61   LWSTHYEKMQENLRNLKETNRNIRREIRHRMGEGLNDLDFDELRGLEQDMDSSLKTVRER  120

Query  499  KYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLVDHEGDYNSVLGFPNGGPR  675
            K+K+IGNQI+T KKKVRN EE++RNLL E E R+EDP YGLVD+ GDY+SVL F NGGPR
Sbjct  121  KFKMIGNQIDTFKKKVRNGEEVNRNLLHEFEIREEDPHYGLVDNGGDYDSVLRFANGGPR  180

Query  676  ILALRLQPD  702
            ILALRLQ +
Sbjct  181  ILALRLQSN  189



>ref|XP_011652440.1| PREDICTED: floral homeotic protein DEFICIENS [Cucumis sativus]
Length=282

 Score =   285 bits (729),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 146/222 (66%), Positives = 180/222 (81%), Gaps = 17/222 (8%)
 Frame = +1

Query  85   MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMISTSGKLH-----  249
            MARGKIQIKRIEN TNRQVTYSKRRNGLFKKA+ELTVLCDAKVSIIM S++GKLH     
Sbjct  33   MARGKIQIKRIENPTNRQVTYSKRRNGLFKKANELTVLCDAKVSIIMFSSTGKLHDTEKL  92

Query  250  -EYISPSTSTKQLFDQYQKTVGVDLWNSHFEKMQEQLKKLRDVNRALRREIRQRMGEGLN  426
             EY +P+TSTK+LFDQYQKT+GVDLW +H+E+MQ+ LKKL+D+NR LRR+IRQRMGE +N
Sbjct  93   HEYTTPATSTKELFDQYQKTLGVDLWITHYERMQDNLKKLKDINRNLRRQIRQRMGECMN  152

Query  427  DLSFEQLTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECE-ARQE  603
            DLSFE+L  L +D+DN++++IRERKY+VI NQIETHKKK+++V EIH++LL E + A +E
Sbjct  153  DLSFEELRCLEQDMDNAVRIIRERKYRVISNQIETHKKKLKSVGEIHKSLLQEFDIATEE  212

Query  604  DPY---------GLVDHEGDYNSVLGFPNGG-PRILALRLQP  699
            DP+         G+    GDY S++GF     PRI ALRLQP
Sbjct  213  DPHYGLVDNGGVGVGIGGGDYESIMGFSGAAHPRIFALRLQP  254



>gb|ABF56131.1| APETALA3-like protein [Ilex aquifolium]
Length=200

 Score =   281 bits (718),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 134/182 (74%), Positives = 161/182 (88%), Gaps = 1/182 (1%)
 Frame = +1

Query  160  NGLFKKAHELTVLCDAKVSIIMISTSGKLHEYISPSTSTKQLFDQYQKTVGVDLWNSHFE  339
            +GLFKKAHELTVLCDAKVSIIM S + KLHEYISPS +TKQ FDQYQ+T+GVDLW+SH+E
Sbjct  1    SGLFKKAHELTVLCDAKVSIIMFSCTNKLHEYISPSITTKQFFDQYQRTLGVDLWSSHYE  60

Query  340  KMQEQLKKLRDVNRALRREIRQRMGEGLNDLSFEQLTELIEDVDNSIKLIRERKYKVIGN  519
            +MQ  LKKL++VNR LRREIRQR+GE LNDL++++L  L ++VD S+K+IRERKYKVI N
Sbjct  61   EMQGHLKKLKEVNRNLRREIRQRLGESLNDLNYDELRGLEQEVDGSVKIIRERKYKVISN  120

Query  520  QIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLVDHEGDYNSVLGFPNGGPRILALRLQ  696
            Q++T+KKK+RNVEEIHRNLL E + R EDP YGLVD+ GDY+SVLGFPNGGP ILALRLQ
Sbjct  121  QVDTYKKKLRNVEEIHRNLLHEFDLRDEDPHYGLVDNGGDYDSVLGFPNGGPHILALRLQ  180

Query  697  PD  702
            P+
Sbjct  181  PN  182



>gb|ACY08913.1| MADS-domain transcription factor, partial [Sarracenia drummondii]
Length=206

 Score =   281 bits (718),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 139/188 (74%), Positives = 166/188 (88%), Gaps = 2/188 (1%)
 Frame = +1

Query  142  TYSKRRNGLFKKAHELTVLCDAKVSIIMISTSGKLHEYISPSTSTKQLFDQYQKTVGVDL  321
            TYSKRRNGLFKKA+ELTVLCDAKVSIIM+S++GKLHEYISPS STKQLFDQYQKT+G+DL
Sbjct  1    TYSKRRNGLFKKANELTVLCDAKVSIIMLSSTGKLHEYISPSASTKQLFDQYQKTLGIDL  60

Query  322  WNSHFEKMQEQLKKLRDVNRALRREIRQRMGEGLNDLSFEQLTELIEDVDNSIKLIRERK  501
            W+SH+EKMQE LKKL++VNR+LRREIRQRMGE LN +SF +L +L +D+D+S+K+IRERK
Sbjct  61   WSSHYEKMQEHLKKLQEVNRSLRREIRQRMGESLNGVSFAELGDLEKDMDSSLKIIRERK  120

Query  502  YKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLVDHEGDYNSVLGFPNGGPR-  675
            YK+I NQI+T KKK RN EE+HR+LL E +A  EDP YGLVD+ GDY SVLG+ N G + 
Sbjct  121  YKMINNQIDTCKKKHRNAEEVHRSLLHEFDAIGEDPHYGLVDNGGDYESVLGYSNRGYQG  180

Query  676  ILALRLQP  699
            ILALRLQP
Sbjct  181  ILALRLQP  188



>gb|AEM60184.1| MADS box transcription factor, partial [Plantago lanceolata]
Length=207

 Score =   280 bits (717),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 135/198 (68%), Positives = 169/198 (85%), Gaps = 4/198 (2%)
 Frame = +1

Query  109  KRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMISTSGKLHEYISPSTSTKQLF  288
            K+IENQTNRQVTYSKRRNGLFKKA ELTVLCDAKVSIIMIS++ KLHE+ISP+T+TKQ+F
Sbjct  1    KKIENQTNRQVTYSKRRNGLFKKASELTVLCDAKVSIIMISSTQKLHEFISPTTTTKQIF  60

Query  289  DQYQKTVGVDLWNSHFEKMQEQLKKLRDVNRALRREIRQRMGEGLNDLSFEQLTELIEDV  468
            DQYQK +GVDLWNS +E+MQE LKK  ++NR L +EIRQR+GE LNDL + ++  L++ +
Sbjct  61   DQYQKALGVDLWNSQYERMQEDLKKHTEINRKLHKEIRQRVGESLNDLGYREIVNLLDMM  120

Query  469  DNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLVDHEGDYNS  645
            D+++K IRERKYKV+ NQI+T KKK+RNVEE HRN +LE +    DP YGLV++EGDYNS
Sbjct  121  DDALKNIRERKYKVLSNQIDTTKKKLRNVEEQHRNRILELDG---DPHYGLVENEGDYNS  177

Query  646  VLGFPNGGPRILALRLQP  699
            VLG+ +GGPRI+ LR+ P
Sbjct  178  VLGYHHGGPRIITLRMPP  195



>gb|ACY08899.1| MADS-domain transcription factor, partial [Alangium platanifolium]
Length=211

 Score =   280 bits (717),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 137/193 (71%), Positives = 163/193 (84%), Gaps = 1/193 (1%)
 Frame = +1

Query  127  TNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMISTSGKLHEYISPSTSTKQLFDQYQKT  306
            TNRQVTYSKRRNGLFKKA+ELTVLCDAK+SIIM S++GKLHEYISPST+ K LFDQYQ+T
Sbjct  3    TNRQVTYSKRRNGLFKKANELTVLCDAKLSIIMFSSTGKLHEYISPSTTMKHLFDQYQRT  62

Query  307  VGVDLWNSHFEKMQEQLKKLRDVNRALRREIRQRMGEGLNDLSFEQLTELIEDVDNSIKL  486
            +GVDLW+SH+E+MQE LKKL+DVNR +RR+IRQRMGE LNDLS+E+L  L ++++NS+K+
Sbjct  63   MGVDLWSSHYERMQENLKKLKDVNRNIRRKIRQRMGESLNDLSYEELRGLEQEMENSLKI  122

Query  487  IRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLVDHEGDYNSVLGFPN  663
            IRERK +VIGNQIET +KKVRNVEEIHRNLL E E  +ED   G  D  G+  SVLGF  
Sbjct  123  IRERKNRVIGNQIETQRKKVRNVEEIHRNLLNEFEMMEEDSRCGFFDSGGNSGSVLGFSA  182

Query  664  GGPRILALRLQPD  702
            GG RILAL   P+
Sbjct  183  GGARILALHFHPN  195



>dbj|BAK09615.1| MADS-box transcription factor [Cyclamen persicum]
Length=226

 Score =   280 bits (716),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 138/209 (66%), Positives = 174/209 (83%), Gaps = 3/209 (1%)
 Frame = +1

Query  85   MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMISTSGKLHEYISP  264
            MARGKIQI++IEN TNRQVTYSKRRNGLFKKA EL VLCDA+VSI+M+S + K+HE+  P
Sbjct  1    MARGKIQIRKIENPTNRQVTYSKRRNGLFKKAGELAVLCDARVSIVMLSGTNKIHEFHCP  60

Query  265  S-TSTKQLFDQYQKTVGVDLWNSHFEKMQEQLKKLRDVNRALRREIRQRMGEGLNDLSFE  441
               STKQLFD YQ+T G+DLW+SH+EKMQE+L+K +++N+ L REIRQRMG+ L +L  +
Sbjct  61   EHISTKQLFDHYQQTTGIDLWSSHYEKMQEELRKRKEINKNLHREIRQRMGDSLTELDLD  120

Query  442  QLTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGL  618
            +L  L +D++ S+++IR RKYKVI NQIET +KKVRN EE+HR LLLE E R+EDP YGL
Sbjct  121  ELQTLEQDMEKSLEVIRCRKYKVITNQIETCRKKVRNGEEVHRTLLLEFETREEDPHYGL  180

Query  619  VDHEGDYNSVLGFPN-GGPRILALRLQPD  702
            VD+ GDY+SV+GF N G PR+LALRLQP+
Sbjct  181  VDNGGDYDSVIGFTNEGPPRMLALRLQPN  209



>gb|ADO16135.1| MADS [Ipomoea aquatica]
Length=134

 Score =   276 bits (706),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 134/134 (100%), Positives = 134/134 (100%), Gaps = 0/134 (0%)
 Frame = +1

Query  244  LHEYISPSTSTKQLFDQYQKTVGVDLWNSHFEKMQEQLKKLRDVNRALRREIRQRMGEGL  423
            LHEYISPSTSTKQLFDQYQKTVGVDLWNSHFEKMQEQLKKLRDVNRALRREIRQRMGEGL
Sbjct  1    LHEYISPSTSTKQLFDQYQKTVGVDLWNSHFEKMQEQLKKLRDVNRALRREIRQRMGEGL  60

Query  424  NDLSFEQLTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQE  603
            NDLSFEQLTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQE
Sbjct  61   NDLSFEQLTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQE  120

Query  604  DPYGLVDHEGDYNS  645
            DPYGLVDHEGDYNS
Sbjct  121  DPYGLVDHEGDYNS  134



>gb|ADO16143.1| MADS [Ipomoea ochracea]
Length=134

 Score =   275 bits (703),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 133/134 (99%), Positives = 134/134 (100%), Gaps = 0/134 (0%)
 Frame = +1

Query  244  LHEYISPSTSTKQLFDQYQKTVGVDLWNSHFEKMQEQLKKLRDVNRALRREIRQRMGEGL  423
            LHEYISPSTSTKQLFDQYQKTVG+DLWNSHFEKMQEQLKKLRDVNRALRREIRQRMGEGL
Sbjct  1    LHEYISPSTSTKQLFDQYQKTVGLDLWNSHFEKMQEQLKKLRDVNRALRREIRQRMGEGL  60

Query  424  NDLSFEQLTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQE  603
            NDLSFEQLTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQE
Sbjct  61   NDLSFEQLTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQE  120

Query  604  DPYGLVDHEGDYNS  645
            DPYGLVDHEGDYNS
Sbjct  121  DPYGLVDHEGDYNS  134



>gb|ACY08910.1| MADS-domain transcription factor, partial [Clethra tomentosa]
Length=206

 Score =   278 bits (710),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 136/190 (72%), Positives = 163/190 (86%), Gaps = 1/190 (1%)
 Frame = +1

Query  136  QVTYSKRRNGLFKKAHELTVLCDAKVSIIMISTSGKLHEYISPSTSTKQLFDQYQKTVGV  315
            QVTYSKRRNGLFKKA+ELTVLCDAKVSIIMIS+SGK HE+ISPSTS KQ++D YQK +G+
Sbjct  1    QVTYSKRRNGLFKKANELTVLCDAKVSIIMISSSGKHHEFISPSTSMKQMYDDYQKALGI  60

Query  316  DLWNSHFEKMQEQLKKLRDVNRALRREIRQRMGEGLNDLSFEQLTELIEDVDNSIKLIRE  495
            DLW+SH+EKMQEQLK+L +VNR LRR+IRQRMGE LND+S+E L  L +D+D+S+K IRE
Sbjct  61   DLWSSHYEKMQEQLKRLNEVNRNLRRQIRQRMGESLNDVSYEDLRVLEQDMDSSVKDIRE  120

Query  496  RKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLVDHEGDYNSVLGFPNGGP  672
            RKYKV+ NQ +T+KKKVRN EEIHR+LL E +   EDP YGLVD+ GDY SV+G+ NGG 
Sbjct  121  RKYKVLSNQTDTYKKKVRNGEEIHRSLLHEFDVIGEDPHYGLVDNGGDYESVIGYSNGGR  180

Query  673  RILALRLQPD  702
             ILAL LQP+
Sbjct  181  GILALGLQPN  190



>gb|ADO16150.1| MADS [Ipomoea quamoclit]
Length=134

 Score =   274 bits (700),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 132/134 (99%), Positives = 134/134 (100%), Gaps = 0/134 (0%)
 Frame = +1

Query  244  LHEYISPSTSTKQLFDQYQKTVGVDLWNSHFEKMQEQLKKLRDVNRALRREIRQRMGEGL  423
            LHEYISPSTSTKQLFDQYQKTVGVDLWNSHFEKMQEQ+KKLRDVNRALRREIRQRMGEGL
Sbjct  1    LHEYISPSTSTKQLFDQYQKTVGVDLWNSHFEKMQEQMKKLRDVNRALRREIRQRMGEGL  60

Query  424  NDLSFEQLTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQE  603
            NDLSFEQLTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQE
Sbjct  61   NDLSFEQLTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQE  120

Query  604  DPYGLVDHEGDYNS  645
            DPYGLVDHEGDY+S
Sbjct  121  DPYGLVDHEGDYSS  134



>gb|ACY08915.1| MADS-domain transcription factor, partial [Styrax japonicus]
Length=194

 Score =   275 bits (704),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 132/178 (74%), Positives = 159/178 (89%), Gaps = 1/178 (1%)
 Frame = +1

Query  172  KKAHELTVLCDAKVSIIMISTSGKLHEYISPSTSTKQLFDQYQKTVGVDLWNSHFEKMQE  351
            KKA E+TVLCDAKVSIIM+S++GK HEYISPS STKQL+D+YQKT+GVDLWN H+++MQE
Sbjct  1    KKAKEITVLCDAKVSIIMLSSTGKFHEYISPSASTKQLYDEYQKTLGVDLWNPHYQRMQE  60

Query  352  QLKKLRDVNRALRREIRQRMGEGLNDLSFEQLTELIEDVDNSIKLIRERKYKVIGNQIET  531
             L++L++VNR LR+EIRQRMGE LNDLSF++L  L +D+D+S+K+IRERKYKVI NQIET
Sbjct  61   HLRQLKEVNRNLRKEIRQRMGESLNDLSFDELRGLEQDIDDSLKVIRERKYKVINNQIET  120

Query  532  HKKKVRNVEEIHRNLLLECEARQEDP-YGLVDHEGDYNSVLGFPNGGPRILALRLQPD  702
             KKK+RNVEEIHRNLLLE +AR+EDP YGLVD+  DY SVLGF NGG RILALRLQP+
Sbjct  121  SKKKLRNVEEIHRNLLLEFDAREEDPHYGLVDNGVDYGSVLGFSNGGHRILALRLQPN  178



>ref|NP_001267937.1| flowering-related B-class MADS-box protein [Vitis vinifera]
 gb|ABI98021.1| flowering-related B-class MADS-box protein [Vitis vinifera]
 emb|CAN66176.1| hypothetical protein VITISV_019954 [Vitis vinifera]
Length=225

 Score =   276 bits (706),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 132/205 (64%), Positives = 164/205 (80%), Gaps = 1/205 (0%)
 Frame = +1

Query  85   MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMISTSGKLHEYISP  264
            M RGKI+IKRIEN TNRQVTYSKRRNG+FKKA ELTVLCDAKVS+IM S +GK HEY SP
Sbjct  1    MGRGKIEIKRIENPTNRQVTYSKRRNGIFKKAQELTVLCDAKVSLIMFSNTGKFHEYTSP  60

Query  265  STSTKQLFDQYQKTVGVDLWNSHFEKMQEQLKKLRDVNRALRREIRQRMGEGLNDLSFEQ  444
            + +TK+++DQYQKT+G+DLW+SH+E+MQE L+KL+++N  LRREIRQRMGE L DLS E 
Sbjct  61   TITTKKVYDQYQKTLGIDLWSSHYERMQENLRKLKEINNKLRREIRQRMGEDLGDLSIED  120

Query  445  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLV  621
            L  L + +D S+ L+RERKY VI  Q ET++KKVRN+EE H NLLL  EA+ +DP YGLV
Sbjct  121  LRGLEQKMDASLGLVRERKYHVIKTQTETYRKKVRNLEEQHGNLLLNFEAKCDDPHYGLV  180

Query  622  DHEGDYNSVLGFPNGGPRILALRLQ  696
            +++GDY S + F NG   + A RL 
Sbjct  181  ENDGDYESAVAFANGASNLYAFRLH  205



>gb|ACV53813.1| MADS-box protein [Gerbera hybrid cultivar]
Length=231

 Score =   276 bits (707),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 132/208 (63%), Positives = 167/208 (80%), Gaps = 2/208 (1%)
 Frame = +1

Query  85   MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMISTSGKLHEYISP  264
            MARGKIQIK+IEN TNRQVTYSKRRNGLFKKA ELTVLCDAKVSIIM+S + KLHEYISP
Sbjct  1    MARGKIQIKKIENSTNRQVTYSKRRNGLFKKASELTVLCDAKVSIIMVSCTDKLHEYISP  60

Query  265  STSTKQLFDQYQKTVGVDLWNSHFEKMQEQLKKLRDVNRALRREIRQRMGEGLNDLSFEQ  444
            S +TKQ FDQYQK  G+DLWNSH++KMQE+L++L++VNR LRR+IRQR+G+ L DL FE 
Sbjct  61   SITTKQFFDQYQKASGIDLWNSHYQKMQEELRQLKEVNRNLRRQIRQRLGDCLEDLGFED  120

Query  445  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLV  621
               L  D   ++ +IRERK KVIGN++ET KKKVR+ +++++ L+ E + R EDP YG++
Sbjct  121  FLALENDSQQAVSIIRERKLKVIGNKVETSKKKVRSAQDVYKKLMREFDLRGEDPQYGMI  180

Query  622  DHEGDYNSVLGFPNG-GPRILALRLQPD  702
            +   +Y ++ G+P    PRIL LRLQPD
Sbjct  181  EDGREYENMYGYPQMVAPRILTLRLQPD  208



>gb|ABE11601.1| MADS-box transcription factor AP3 [Trochodendron aralioides]
Length=225

 Score =   276 bits (705),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 131/206 (64%), Positives = 168/206 (82%), Gaps = 1/206 (0%)
 Frame = +1

Query  85   MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMISTSGKLHEYISP  264
            M RGKI+IKRIEN TN+QVTYSKRR G+FKKA ELTVLCDAKVS+IMIS +GK+HE+ISP
Sbjct  1    MGRGKIEIKRIENSTNKQVTYSKRRKGIFKKASELTVLCDAKVSLIMISNTGKMHEFISP  60

Query  265  STSTKQLFDQYQKTVGVDLWNSHFEKMQEQLKKLRDVNRALRREIRQRMGEGLNDLSFEQ  444
            ST+TKQ++DQYQ T G++LW+SH+EKMQ+ LKKL+++N  LRREI +R G  LN LSF +
Sbjct  61   STTTKQIYDQYQLTTGINLWSSHYEKMQDNLKKLKEINHNLRREIGRRTGGDLNGLSFAE  120

Query  445  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLV  621
            L  L ++++ S+ ++RERKY+VI  Q ET++KK RN+EEI+RNLL E EAR +DP YGLV
Sbjct  121  LRGLEQNMEESLNIVRERKYRVISTQTETYRKKKRNMEEINRNLLNEFEARDDDPHYGLV  180

Query  622  DHEGDYNSVLGFPNGGPRILALRLQP  699
            D+ GDY S +   NGG +I A R+QP
Sbjct  181  DNGGDYESAVRLANGGSQIFAFRMQP  206



>gb|ADO16147.1| MADS [Ipomoea plebeia]
Length=134

 Score =   273 bits (697),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 132/134 (99%), Positives = 133/134 (99%), Gaps = 0/134 (0%)
 Frame = +1

Query  244  LHEYISPSTSTKQLFDQYQKTVGVDLWNSHFEKMQEQLKKLRDVNRALRREIRQRMGEGL  423
            LHEYISPSTSTKQLFDQYQKTVGVDLW+SHFEKMQEQLKKLRDVNRALRREIRQRMGE L
Sbjct  1    LHEYISPSTSTKQLFDQYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESL  60

Query  424  NDLSFEQLTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQE  603
            NDLSFEQLTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQE
Sbjct  61   NDLSFEQLTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQE  120

Query  604  DPYGLVDHEGDYNS  645
            DPYGLVDHEGDYNS
Sbjct  121  DPYGLVDHEGDYNS  134



>emb|CAA08803.1| MADS-box protein, GDEF2 [Gerbera hybrid cultivar]
Length=228

 Score =   275 bits (703),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 131/209 (63%), Positives = 170/209 (81%), Gaps = 3/209 (1%)
 Frame = +1

Query  85   MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMISTSGKLHEYISP  264
            MARGKIQIK+IEN TNRQVTYSKRRNGLFKKA ELTVLCDAKVSIIM+S + KLHEYISP
Sbjct  1    MARGKIQIKKIENSTNRQVTYSKRRNGLFKKASELTVLCDAKVSIIMVSCTDKLHEYISP  60

Query  265  STSTKQLFDQYQKTVGVDLWNSHFEKMQEQLKKLRDVNRALRREIRQRMGEGLNDLSFEQ  444
            S +TKQ FDQYQK  G+DLWNSH+EKMQE+L++L++VNR LRR+IRQR+G+ L DL FE+
Sbjct  61   SITTKQFFDQYQKASGIDLWNSHYEKMQEELRQLKEVNRNLRRQIRQRLGDCLEDLGFEE  120

Query  445  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLV  621
              +L ++   ++ +IRERK KVIGN++ET KKKVR+ +++++ L+ E + R EDP YG++
Sbjct  121  FLDLEKESQEAVYIIRERKLKVIGNKLETSKKKVRSAQDVYKKLMHEFDIRGEDPQYGMI  180

Query  622  DHEGDYNSVLGFPN--GGPRILALRLQPD  702
            +   +Y ++ G+P     PRIL LRLQP+
Sbjct  181  EDGVEYEALYGYPPHISAPRILTLRLQPN  209



>gb|ADO16133.1| MADS [Ipomoea alba]
Length=134

 Score =   271 bits (694),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 131/134 (98%), Positives = 133/134 (99%), Gaps = 0/134 (0%)
 Frame = +1

Query  244  LHEYISPSTSTKQLFDQYQKTVGVDLWNSHFEKMQEQLKKLRDVNRALRREIRQRMGEGL  423
            LHEYISPSTSTKQLFDQYQKTVGVDLW+SHFEKMQEQLKKLRDVN+ALRREIRQRMGE L
Sbjct  1    LHEYISPSTSTKQLFDQYQKTVGVDLWSSHFEKMQEQLKKLRDVNKALRREIRQRMGESL  60

Query  424  NDLSFEQLTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQE  603
            NDLSFEQLTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQE
Sbjct  61   NDLSFEQLTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQE  120

Query  604  DPYGLVDHEGDYNS  645
            DPYGLVDHEGDYNS
Sbjct  121  DPYGLVDHEGDYNS  134



>gb|ADO16136.1| MADS [Ipomoea argillicola]
 gb|ADO16138.1| MADS [Ipomoea diamantinensis]
 gb|ADO16141.1| MADS [Ipomoea nil]
 gb|ADO16146.1| MADS [Ipomoea platensis]
 gb|ADO16149.1| MADS [Ipomoea purpurea]
Length=134

 Score =   271 bits (693),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 131/134 (98%), Positives = 133/134 (99%), Gaps = 0/134 (0%)
 Frame = +1

Query  244  LHEYISPSTSTKQLFDQYQKTVGVDLWNSHFEKMQEQLKKLRDVNRALRREIRQRMGEGL  423
            LHEYISPST+TKQLFDQYQKTVGVDLW+SHFEKMQEQLKKLRDVNRALRREIRQRMGE L
Sbjct  1    LHEYISPSTTTKQLFDQYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESL  60

Query  424  NDLSFEQLTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQE  603
            NDLSFEQLTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQE
Sbjct  61   NDLSFEQLTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQE  120

Query  604  DPYGLVDHEGDYNS  645
            DPYGLVDHEGDYNS
Sbjct  121  DPYGLVDHEGDYNS  134



>gb|ABR18734.1| MADS-box transcription factor HAM2 [Helianthus annuus]
Length=239

 Score =   275 bits (703),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 133/209 (64%), Positives = 171/209 (82%), Gaps = 3/209 (1%)
 Frame = +1

Query  85   MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMISTSGKLHEYISP  264
            MARGKIQIK+IEN TNRQVTYSKRRNGLFKKA ELTVLCDAKVSIIM+S + KLHEYISP
Sbjct  1    MARGKIQIKKIENSTNRQVTYSKRRNGLFKKASELTVLCDAKVSIIMVSCTDKLHEYISP  60

Query  265  STSTKQLFDQYQKTVGVDLWNSHFEKMQEQLKKLRDVNRALRREIRQRMGEGLNDLSFEQ  444
            S + KQ FDQYQK  GVDLWNSH++KMQ++L++ ++VNR LR++IRQR+G+ L DLSFE+
Sbjct  61   SITMKQFFDQYQKASGVDLWNSHYQKMQDELRQQKEVNRNLRKQIRQRLGDCLEDLSFEE  120

Query  445  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLV  621
            L  L +D   ++ +IRERK KVIGN++ET KKKVR+ +++++ L+ E + R EDP YGL+
Sbjct  121  LLALEKDSQEAVYVIRERKLKVIGNKVETSKKKVRSAQDVYKKLMHEFDIRGEDPQYGLI  180

Query  622  DHEGDYNSVLGFPNGG--PRILALRLQPD  702
            ++  +Y++V G+P  G  P IL LRLQPD
Sbjct  181  ENGIEYDNVYGYPQMGAPPHILTLRLQPD  209



>gb|ADO16137.1| MADS [Ipomoea cordatotriloba]
Length=134

 Score =   271 bits (693),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 131/134 (98%), Positives = 133/134 (99%), Gaps = 0/134 (0%)
 Frame = +1

Query  244  LHEYISPSTSTKQLFDQYQKTVGVDLWNSHFEKMQEQLKKLRDVNRALRREIRQRMGEGL  423
            LHEYISPSTSTKQLFDQYQKTVGVDLW+SHFEKMQ+QLKKLRDVNRALRREIRQRMGE L
Sbjct  1    LHEYISPSTSTKQLFDQYQKTVGVDLWSSHFEKMQDQLKKLRDVNRALRREIRQRMGESL  60

Query  424  NDLSFEQLTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQE  603
            NDLSFEQLTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQE
Sbjct  61   NDLSFEQLTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQE  120

Query  604  DPYGLVDHEGDYNS  645
            DPYGLVDHEGDYNS
Sbjct  121  DPYGLVDHEGDYNS  134



>gb|ADO16139.1| MADS [Ipomoea eriocarpa]
Length=134

 Score =   271 bits (692),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 131/134 (98%), Positives = 133/134 (99%), Gaps = 0/134 (0%)
 Frame = +1

Query  244  LHEYISPSTSTKQLFDQYQKTVGVDLWNSHFEKMQEQLKKLRDVNRALRREIRQRMGEGL  423
            LHEYISPSTSTKQLFDQYQKTVGVDLW+SHFEKMQEQLKKLRDVNRALRREIRQRMGE L
Sbjct  1    LHEYISPSTSTKQLFDQYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESL  60

Query  424  NDLSFEQLTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQE  603
            NDLSFEQLTELIEDVD+SIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQE
Sbjct  61   NDLSFEQLTELIEDVDSSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQE  120

Query  604  DPYGLVDHEGDYNS  645
            DPYGLVDHEGDYNS
Sbjct  121  DPYGLVDHEGDYNS  134



>gb|AAD53326.1|AF180365_1 DEFICIENS homolog DEF2 [Hieracium piloselloides]
Length=228

 Score =   274 bits (700),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 131/209 (63%), Positives = 172/209 (82%), Gaps = 4/209 (2%)
 Frame = +1

Query  85   MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMISTSGKLHEYISP  264
            MARGKIQIK+IEN TNRQVTYSKRRNGLFKKA ELTVLCDAKVSIIM+S + KLHEYISP
Sbjct  1    MARGKIQIKKIENSTNRQVTYSKRRNGLFKKASELTVLCDAKVSIIMVSCTDKLHEYISP  60

Query  265  STSTKQLFDQYQKTVGVDLWNSHFEKMQEQLKKLRDVNRALRREIRQRMGEGLNDLSFEQ  444
            ST+TKQ FDQYQK  G+DLWNSH+EKMQE+L++L++VN+ LRR+IRQR+G+ L  L FE+
Sbjct  61   STTTKQFFDQYQKAAGIDLWNSHYEKMQEELRQLKEVNKNLRRQIRQRLGDCLEHLGFEK  120

Query  445  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLV  621
            L +L ++   ++ +IRERK KVIGN++ET KKKVR+ +++++ L+ E   R EDP +G++
Sbjct  121  LLDLEKESQEAVYIIRERKLKVIGNKLETSKKKVRSAQDVYKKLMHEFGIRGEDPQFGMI  180

Query  622  DHEGDYNSVLGFPN--GGPRILALRLQPD  702
            + +G+Y++V G+P     PRIL  RLQP+
Sbjct  181  E-DGEYDAVYGYPPQMSAPRILTFRLQPN  208



>ref|XP_012071963.1| PREDICTED: floral homeotic protein DEFICIENS-like isoform X1 
[Jatropha curcas]
Length=253

 Score =   275 bits (702),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 149/240 (62%), Positives = 174/240 (73%), Gaps = 40/240 (17%)
 Frame = +1

Query  85   MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMISTSGKLHEYISP  264
            MARGKIQIKRIEN TNRQVTYSKRRNGLFKKA+ELTVLCDAKVSIIM S++GKLHEYISP
Sbjct  1    MARGKIQIKRIENSTNRQVTYSKRRNGLFKKANELTVLCDAKVSIIMFSSTGKLHEYISP  60

Query  265  STSTKQLFDQYQKTVGVDLWNSHF--------------------------------EKMQ  348
            ST+TKQLFD+YQKT+G+DLW++ +                                + MQ
Sbjct  61   STTTKQLFDEYQKTLGIDLWSTQYAVCIVPMFLICLYMCKRNYLSTFDHMLFFMWMQSMQ  120

Query  349  EQLKKLRDVNRALRREIRQRMGEGLNDLSFEQLTELIEDVDNSIKLIRERKYKVIGNQIE  528
            E LKKL+DVNR L  EIRQRMGE LND SFE L  L +DVD ++ L+R+RK K+I NQI+
Sbjct  121  ENLKKLKDVNRNLITEIRQRMGECLNDASFEHLRSLEQDVDTALLLVRQRKNKMINNQIQ  180

Query  529  THKKKVRNVEEIHRNLLLECEARQEDP-YGLVDH-EGDYNSVLGFPNGGPRILALRLQPD  702
            T +KKVRNVEEIH+NLL E EAR EDP YGLVD+  GDY+S+L        I ALRLQP+
Sbjct  181  TCRKKVRNVEEIHQNLLREFEARDEDPHYGLVDNGAGDYDSML------RNIFALRLQPN  234



>gb|ABR18735.1| MADS-box transcription factor HAM63 [Helianthus annuus]
Length=229

 Score =   273 bits (699),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 130/210 (62%), Positives = 170/210 (81%), Gaps = 4/210 (2%)
 Frame = +1

Query  85   MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMISTSGKLHEYISP  264
            MARGKIQIK+IEN TNRQVTYSKRRNGLFKKA+ELTVLCDAKVSIIM+S + KLHEYISP
Sbjct  1    MARGKIQIKKIENSTNRQVTYSKRRNGLFKKANELTVLCDAKVSIIMVSCTEKLHEYISP  60

Query  265  STSTKQLFDQYQKTVGVDLWNSHFEKMQEQLKKLRDVNRALRREIRQRMGEGLNDLSFEQ  444
            S +TKQ FDQYQK  G+DLWNSH+EKMQE+L++L+DVN  LRR+IRQR+G+ L ++ FE+
Sbjct  61   SITTKQFFDQYQKASGIDLWNSHYEKMQEELRQLKDVNTNLRRQIRQRLGDCLENVGFEE  120

Query  445  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLV  621
            L +L  +   ++ +IRERK KVI N++ET KKKVR+ +++++ L+ E + R EDP YG++
Sbjct  121  LLDLERESQEAVYIIRERKLKVISNKLETCKKKVRSAQDVYKKLMHEFDIRGEDPQYGMI  180

Query  622  DHEGDYNSVLGFP---NGGPRILALRLQPD  702
            +  G+Y ++ G+P      PRIL LRLQP+
Sbjct  181  EDAGEYEALYGYPPRIAAAPRILTLRLQPN  210



>gb|ADO16151.1| MADS [Ipomoea saintronanensis]
Length=134

 Score =   270 bits (690),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 130/134 (97%), Positives = 133/134 (99%), Gaps = 0/134 (0%)
 Frame = +1

Query  244  LHEYISPSTSTKQLFDQYQKTVGVDLWNSHFEKMQEQLKKLRDVNRALRREIRQRMGEGL  423
            LHEYISPST+TKQLFDQYQKTVGVDLW+SHFEKMQEQLKKLRDVNRALRREIRQRMGE L
Sbjct  1    LHEYISPSTTTKQLFDQYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESL  60

Query  424  NDLSFEQLTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQE  603
            NDLSFEQLT+LIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQE
Sbjct  61   NDLSFEQLTDLIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQE  120

Query  604  DPYGLVDHEGDYNS  645
            DPYGLVDHEGDYNS
Sbjct  121  DPYGLVDHEGDYNS  134



>ref|XP_010061014.1| PREDICTED: floral homeotic protein DEFICIENS [Eucalyptus grandis]
 gb|KCW67911.1| hypothetical protein EUGRSUZ_F01615 [Eucalyptus grandis]
Length=233

 Score =   273 bits (698),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 133/214 (62%), Positives = 174/214 (81%), Gaps = 8/214 (4%)
 Frame = +1

Query  85   MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMISTSGKLHEYISP  264
            MARGKIQIK IEN TNRQVTYSKRRNGLFKKA+ELTVLCDAKVSIIMIS++GKLHEYISP
Sbjct  1    MARGKIQIKLIENTTNRQVTYSKRRNGLFKKANELTVLCDAKVSIIMISSTGKLHEYISP  60

Query  265  STSTKQLFDQYQKTVGVDLWNSHFEKMQEQLKKLRDVNRALRREIRQRMGEGLNDLSFEQ  444
            STSTK+++DQYQ+ + VDLW+SH+EKMQE L+KL++VN+ L+ E+R+R GEGLN +S  +
Sbjct  61   STSTKKMYDQYQQALEVDLWSSHYEKMQENLRKLKEVNKKLQLEVRRRFGEGLNGMSLSE  120

Query  445  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLEC-----EARQEDP  609
            L  L +D+DN++ LIRERKYK +GNQI+T +KK +N EEI+++LL +        R++DP
Sbjct  121  LCGLEQDMDNAVSLIRERKYKTLGNQIDTARKKKKNAEEINKSLLQDWTNLIKHLREDDP  180

Query  610  -YGLVDHEGDYNSVLGFPN--GGPRILALRLQPD  702
             +G+VD+  DY +V+G+ +     R+  LRLQPD
Sbjct  181  HFGMVDNGRDYEAVIGYTDAAAAARLYTLRLQPD  214



>gb|ABR68543.1| APETALA3-like [Dillenia indica]
Length=205

 Score =   272 bits (695),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 129/190 (68%), Positives = 160/190 (84%), Gaps = 3/190 (2%)
 Frame = +1

Query  115  IENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMISTSGKLHEYISPSTSTKQLFDQ  294
            IEN TNRQVTYSKRRNGLFKKA ELTVLCDAKVSIIM S +GK+HE+ISPS +TKQ++D 
Sbjct  1    IENATNRQVTYSKRRNGLFKKAGELTVLCDAKVSIIMFSGTGKMHEFISPSLTTKQVYDD  60

Query  295  YQKTVGVDLWNSHFEKMQEQLKKLRDVNRALRREIRQRMGEGLNDLSFEQLTELIEDVDN  474
            YQK +G+DLW +H+E+MQE LKKL++ NR LR+EIRQRMGE LNDL  ++L  L E+++N
Sbjct  61   YQKAMGIDLWKTHYERMQENLKKLKETNRNLRKEIRQRMGEQLNDLGIDELRALEENMEN  120

Query  475  SIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLVDHEG--DYNS  645
            ++K+IR+RKYKVI  QIETHKKK RNV++IHR LL E +AR+EDP YG VD+ G  DYNS
Sbjct  121  AVKVIRDRKYKVINGQIETHKKKWRNVQDIHRKLLQELDAREEDPHYGFVDNGGGVDYNS  180

Query  646  VLGFPNGGPR  675
            ++ + NGGPR
Sbjct  181  MIAYANGGPR  190



>gb|ADO16148.1| MADS [Ipomoea plebeia]
Length=134

 Score =   269 bits (688),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 130/134 (97%), Positives = 134/134 (100%), Gaps = 0/134 (0%)
 Frame = +1

Query  244  LHEYISPSTSTKQLFDQYQKTVGVDLWNSHFEKMQEQLKKLRDVNRALRREIRQRMGEGL  423
            LHEYISPSTSTKQLFDQYQKTVGVDLW+SHFEKMQEQLKKLRDVNRALRREIRQRMGEGL
Sbjct  1    LHEYISPSTSTKQLFDQYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGEGL  60

Query  424  NDLSFEQLTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQE  603
            NDLSFEQLT+LIEDVDNSIKLIRERKYKVIGNQIET+KKKVRNVEEIHRNLLLECEARQ+
Sbjct  61   NDLSFEQLTDLIEDVDNSIKLIRERKYKVIGNQIETYKKKVRNVEEIHRNLLLECEARQK  120

Query  604  DPYGLVDHEGDYNS  645
            DPYGLVDHEGDYNS
Sbjct  121  DPYGLVDHEGDYNS  134



>gb|AAD53325.1|AF180364_1 DEFICIENS homolog DEF1 [Hieracium piloselloides]
Length=224

 Score =   272 bits (696),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 130/209 (62%), Positives = 171/209 (82%), Gaps = 4/209 (2%)
 Frame = +1

Query  85   MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMISTSGKLHEYISP  264
            MARGKIQIK+IEN TNRQVTYSKRRNGLFKKA ELTVLCDAKVSIIM+S + KLHEYISP
Sbjct  1    MARGKIQIKKIENSTNRQVTYSKRRNGLFKKASELTVLCDAKVSIIMVSCTDKLHEYISP  60

Query  265  STSTKQLFDQYQKTVGVDLWNSHFEKMQEQLKKLRDVNRALRREIRQRMGEGLNDLSFEQ  444
            ST+TKQ FDQYQK  G+DLWNSH+EKMQE+L++L++VN+ LRR+IRQR+G+ L  L FE+
Sbjct  61   STTTKQFFDQYQKAAGIDLWNSHYEKMQEELRQLKEVNKNLRRQIRQRLGDCLEHLGFEK  120

Query  445  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLV  621
            L +L ++   ++ +IRERK KVIGN++ET KKKVR+ +++++ L+ E   R EDP +G++
Sbjct  121  LLDLEKESQEAVYIIRERKLKVIGNKLETSKKKVRSAQDVYKKLMHEFGIRGEDPQFGMI  180

Query  622  DHEGDYNSVLGFPN--GGPRILALRLQPD  702
            + +G+Y++V G+P     PRIL  RL P+
Sbjct  181  E-DGEYDAVYGYPPQMSAPRILTFRLHPN  208



>gb|ADO16134.1| MADS [Ipomoea amnicola]
Length=134

 Score =   269 bits (687),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 129/134 (96%), Positives = 133/134 (99%), Gaps = 0/134 (0%)
 Frame = +1

Query  244  LHEYISPSTSTKQLFDQYQKTVGVDLWNSHFEKMQEQLKKLRDVNRALRREIRQRMGEGL  423
            LHEYISP+T+TKQLFDQYQKT+GVDLW+SHFEKMQEQLKKLRDVNRALRREIRQRMGE L
Sbjct  1    LHEYISPATTTKQLFDQYQKTLGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESL  60

Query  424  NDLSFEQLTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQE  603
            NDLSFEQLTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQE
Sbjct  61   NDLSFEQLTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQE  120

Query  604  DPYGLVDHEGDYNS  645
            DPYGLVDHEGDYNS
Sbjct  121  DPYGLVDHEGDYNS  134



>gb|ADU15473.1| AP3 [Actinidia chinensis]
Length=227

 Score =   272 bits (696),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 132/208 (63%), Positives = 169/208 (81%), Gaps = 2/208 (1%)
 Frame = +1

Query  85   MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMISTSGKLHEYISP  264
            M RGKI+IKRIEN TNRQVTYSKRRNG+FKKA ELTVLCDAKVS+IM+S +GKLHEYISP
Sbjct  1    MGRGKIEIKRIENPTNRQVTYSKRRNGIFKKAQELTVLCDAKVSLIMLSNTGKLHEYISP  60

Query  265  STSTKQLFDQYQKTVGVDLWNSHFEKMQEQLKKLRDVNRALRREIRQRMGEGLNDLSFEQ  444
            + STK+++DQYQKT+G+DLW++H+E+MQE L+KL++VN  LRREIRQ+MGE LNDLS  +
Sbjct  61   NISTKKIYDQYQKTLGIDLWSTHYERMQEHLRKLKEVNNRLRREIRQKMGEELNDLSVHE  120

Query  445  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQE--DPYGL  618
            L  L + +  S+ +IR+RKY VI  Q ET++KKVRN+EE H NLLL+ EA+ +    Y L
Sbjct  121  LRGLEQKMSASLTIIRDRKYHVIKTQTETYRKKVRNLEERHGNLLLDFEAKCDLAPQYEL  180

Query  619  VDHEGDYNSVLGFPNGGPRILALRLQPD  702
            V++EGDY+S + F NG   + A RLQP+
Sbjct  181  VENEGDYDSAVAFANGVSNLYAFRLQPN  208



>gb|ADO16145.1| MADS [Ipomoea pes-tigridis]
Length=134

 Score =   268 bits (686),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 129/134 (96%), Positives = 132/134 (99%), Gaps = 0/134 (0%)
 Frame = +1

Query  244  LHEYISPSTSTKQLFDQYQKTVGVDLWNSHFEKMQEQLKKLRDVNRALRREIRQRMGEGL  423
            LHEYISPSTSTKQLFDQYQKTVGVDLW+SHFEKMQEQLKKLRDVNR LRREIRQRMGE L
Sbjct  1    LHEYISPSTSTKQLFDQYQKTVGVDLWSSHFEKMQEQLKKLRDVNRGLRREIRQRMGESL  60

Query  424  NDLSFEQLTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQE  603
            NDLSFEQLTEL+ED+DNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQE
Sbjct  61   NDLSFEQLTELVEDMDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQE  120

Query  604  DPYGLVDHEGDYNS  645
            DPYGLVDHEGDYNS
Sbjct  121  DPYGLVDHEGDYNS  134



>ref|XP_006425563.1| hypothetical protein CICLE_v10026433mg [Citrus clementina]
 ref|XP_006466888.1| PREDICTED: floral homeotic protein DEFICIENS-like [Citrus sinensis]
 gb|ESR38803.1| hypothetical protein CICLE_v10026433mg [Citrus clementina]
Length=223

 Score =   271 bits (694),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 126/205 (61%), Positives = 166/205 (81%), Gaps = 2/205 (1%)
 Frame = +1

Query  85   MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMISTSGKLHEYISP  264
            M RGKI+IKRIEN TNRQVTYSKRRNG+FKKA ELTVLCDAKVS+IM+S +GK HEYISP
Sbjct  1    MGRGKIEIKRIENPTNRQVTYSKRRNGIFKKAQELTVLCDAKVSLIMVSNTGKFHEYISP  60

Query  265  STSTKQLFDQYQKTVGVDLWNSHFEKMQEQLKKLRDVNRALRREIRQRMGEGLNDLSFEQ  444
            +T+TK++FDQYQK++GVDLW++H+ KMQE  +KL+++N  LR++IRQRMGE L+DL+FE+
Sbjct  61   TTTTKKMFDQYQKSLGVDLWSTHYAKMQESYRKLKEINNKLRKDIRQRMGEDLDDLTFEE  120

Query  445  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLV  621
            L  L +++ +S   +RERK+ VI  Q +T+KKKVRN+EE H N+LL+ E + +DP YGLV
Sbjct  121  LRGLEQNMSSSAATVRERKFHVIKTQTDTYKKKVRNLEERHGNILLDFETKYDDPHYGLV  180

Query  622  DHEGDYNSVLGFPNGGPRILALRLQ  696
            D+ GDY S +   NG   + A R+Q
Sbjct  181  DN-GDYQSAMALANGASNLYAFRMQ  204



>gb|ADO16153.1| MADS [Ipomoea wrightii]
Length=134

 Score =   268 bits (686),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 130/134 (97%), Positives = 132/134 (99%), Gaps = 0/134 (0%)
 Frame = +1

Query  244  LHEYISPSTSTKQLFDQYQKTVGVDLWNSHFEKMQEQLKKLRDVNRALRREIRQRMGEGL  423
            LHEYISPST+TKQLFDQYQKTVGVDLW+SHFEKMQEQLKKLRDVNRALRREIRQRMGE L
Sbjct  1    LHEYISPSTTTKQLFDQYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESL  60

Query  424  NDLSFEQLTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQE  603
            NDLSFEQLTELIEDVDNSIKLI ERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQE
Sbjct  61   NDLSFEQLTELIEDVDNSIKLIPERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQE  120

Query  604  DPYGLVDHEGDYNS  645
            DPYGLVDHEGDYNS
Sbjct  121  DPYGLVDHEGDYNS  134



>gb|ACY08912.1| MADS-domain transcription factor, partial [Stewartia pseudocamellia]
Length=194

 Score =   270 bits (691),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 129/177 (73%), Positives = 155/177 (88%), Gaps = 1/177 (1%)
 Frame = +1

Query  175  KAHELTVLCDAKVSIIMISTSGKLHEYISPSTSTKQLFDQYQKTVGVDLWNSHFEKMQEQ  354
            K +ELTVLCDAKVSIIM+S++ KLHEYISPSTSTKQ+FDQYQK +G+DLW SH+E+MQE 
Sbjct  1    KDNELTVLCDAKVSIIMLSSTNKLHEYISPSTSTKQMFDQYQKALGIDLWCSHYERMQEH  60

Query  355  LKKLRDVNRALRREIRQRMGEGLNDLSFEQLTELIEDVDNSIKLIRERKYKVIGNQIETH  534
            LKKL++ NR LRREIRQRMGE LNDLSFE L  L +D+++S+K+IR+RKYKV+GNQIETH
Sbjct  61   LKKLKEFNRNLRREIRQRMGESLNDLSFEDLCSLEQDMESSVKIIRDRKYKVLGNQIETH  120

Query  535  KKKVRNVEEIHRNLLLECEARQEDP-YGLVDHEGDYNSVLGFPNGGPRILALRLQPD  702
            KKK RNVEEIHRN L + +A +EDP YGLVD+ GDY+S+LGF NGG  ILALRLQP+
Sbjct  121  KKKKRNVEEIHRNFLHDIKAVEEDPQYGLVDNGGDYDSILGFSNGGHSILALRLQPN  177



>gb|AIC33047.1| flower development transporter AP3 [Chrysanthemum lavandulifolium]
Length=229

 Score =   271 bits (693),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 129/209 (62%), Positives = 169/209 (81%), Gaps = 3/209 (1%)
 Frame = +1

Query  85   MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMISTSGKLHEYISP  264
            MARGKIQIK+IEN TNRQVTYSKRRNGLFKKA ELTVLCDAKVSIIM+S + KLHEYISP
Sbjct  1    MARGKIQIKKIENSTNRQVTYSKRRNGLFKKASELTVLCDAKVSIIMVSCTDKLHEYISP  60

Query  265  STSTKQLFDQYQKTVGVDLWNSHFEKMQEQLKKLRDVNRALRREIRQRMGEGLNDLSFEQ  444
            S +TKQ FDQYQK  G+DLWNSH+EKMQE+L++L+DVN+ LR  IRQR+G+ L+ L FE+
Sbjct  61   SITTKQFFDQYQKASGIDLWNSHYEKMQEELRQLKDVNKKLRTHIRQRLGDCLDHLGFEE  120

Query  445  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLV  621
            L +L ++   ++ +IRERK KVIGN++ET KKKVR+ +++++ L+ E + R EDP +G++
Sbjct  121  LLDLEKESQEAVYVIRERKLKVIGNKLETSKKKVRSAQDVYKKLMHEFDIRGEDPQFGMI  180

Query  622  DHEGDYNSVLGFPN--GGPRILALRLQPD  702
            +  G+Y ++ G+P      RIL LRLQP+
Sbjct  181  EDAGEYETIYGYPPHIATQRILTLRLQPN  209



>gb|KDO71079.1| hypothetical protein CISIN_1g027470mg [Citrus sinensis]
Length=223

 Score =   271 bits (692),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 126/205 (61%), Positives = 165/205 (80%), Gaps = 2/205 (1%)
 Frame = +1

Query  85   MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMISTSGKLHEYISP  264
            M RGKI+IKRIEN TNRQVTYSKRRNG+FKKA ELTVLCDAKVS+IM S +GK HEYISP
Sbjct  1    MGRGKIEIKRIENPTNRQVTYSKRRNGIFKKAQELTVLCDAKVSLIMFSNTGKFHEYISP  60

Query  265  STSTKQLFDQYQKTVGVDLWNSHFEKMQEQLKKLRDVNRALRREIRQRMGEGLNDLSFEQ  444
            +T+TK++FDQYQK++GVDLW++H+ KMQE  +KL+++N  LR++IRQRMGE L+DL+FE+
Sbjct  61   TTTTKKMFDQYQKSLGVDLWSTHYAKMQESYRKLKEINNKLRKDIRQRMGEDLDDLTFEE  120

Query  445  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLV  621
            L  L +++ +S   +RERK+ VI  Q +T+KKKVRN+EE H N+LL+ E + +DP YGLV
Sbjct  121  LRGLEQNMSSSAATVRERKFHVIKTQTDTYKKKVRNLEERHGNILLDFETKYDDPHYGLV  180

Query  622  DHEGDYNSVLGFPNGGPRILALRLQ  696
            D+ GDY S +   NG   + A R+Q
Sbjct  181  DN-GDYQSAMALANGASNLYAFRMQ  204



>gb|ACY08909.1| MADS-domain transcription factor, partial [Synsepalum dulcificum]
Length=186

 Score =   269 bits (688),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 127/171 (74%), Positives = 155/171 (91%), Gaps = 1/171 (1%)
 Frame = +1

Query  193  VLCDAKVSIIMISTSGKLHEYISPSTSTKQLFDQYQKTVGVDLWNSHFEKMQEQLKKLRD  372
            VLCDAKVSIIM+S++GKLHE+ISPST+TK+L+DQYQKT+G+DLW+SH+E+MQE LKKL+D
Sbjct  1    VLCDAKVSIIMLSSTGKLHEFISPSTTTKELYDQYQKTLGIDLWSSHYERMQEHLKKLKD  60

Query  373  VNRALRREIRQRMGEGLNDLSFEQLTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRN  552
            VNR LRREIRQRMGE LNDLSFE+L  L +D++ S+K IRERKYK +GNQIETH+KK+RN
Sbjct  61   VNRNLRREIRQRMGESLNDLSFEELRGLEQDMEISVKNIRERKYKALGNQIETHRKKLRN  120

Query  553  VEEIHRNLLLECEARQEDP-YGLVDHEGDYNSVLGFPNGGPRILALRLQPD  702
            VEEIH+NLL E +  +EDP YGLVD+ GDY+SVLGF NGGPRIL+LRLQP+
Sbjct  121  VEEIHKNLLHEFDVAEEDPHYGLVDNGGDYDSVLGFSNGGPRILSLRLQPN  171



>ref|XP_011028945.1| PREDICTED: floral homeotic protein DEFICIENS-like [Populus euphratica]
Length=191

 Score =   270 bits (689),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 125/191 (65%), Positives = 164/191 (86%), Gaps = 0/191 (0%)
 Frame = +1

Query  85   MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMISTSGKLHEYISP  264
            MARGKIQIK+IEN TNRQVTYSKRRNGLFKKAHELTVLCDA+VS++M+S + K+H+Y SP
Sbjct  1    MARGKIQIKKIENSTNRQVTYSKRRNGLFKKAHELTVLCDAEVSLVMVSCTHKVHDYTSP  60

Query  265  STSTKQLFDQYQKTVGVDLWNSHFEKMQEQLKKLRDVNRALRREIRQRMGEGLNDLSFEQ  444
            ST+TK++FDQYQ+T G+DLW+SH+E M+E+L+KL++VN  +RRE+RQRMG+ LNDLSF+ 
Sbjct  61   STTTKRIFDQYQQTKGIDLWSSHYEIMKEKLEKLKEVNMKIRREMRQRMGQCLNDLSFQD  120

Query  445  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDPYGLVD  624
            L  L  D++++ ++I +R  +V+ NQIET KKK RNVE+I+R L +E EA  +DPYGLVD
Sbjct  121  LHSLESDMESAWRVIHDRADRVLTNQIETSKKKARNVEQINRKLHVELEAMDQDPYGLVD  180

Query  625  HEGDYNSVLGF  657
            + GDYNSV+GF
Sbjct  181  NGGDYNSVMGF  191



>gb|ADO16152.1| MADS [Ipomoea umbraticola]
Length=134

 Score =   267 bits (683),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 128/134 (96%), Positives = 133/134 (99%), Gaps = 0/134 (0%)
 Frame = +1

Query  244  LHEYISPSTSTKQLFDQYQKTVGVDLWNSHFEKMQEQLKKLRDVNRALRREIRQRMGEGL  423
            LH+YISPST+TKQLFDQYQKTVG+DLW+SHFEKMQ+QLKKLRDVNRALRREIRQRMGE L
Sbjct  1    LHQYISPSTTTKQLFDQYQKTVGLDLWSSHFEKMQDQLKKLRDVNRALRREIRQRMGESL  60

Query  424  NDLSFEQLTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQE  603
            NDLSFEQLTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQE
Sbjct  61   NDLSFEQLTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQE  120

Query  604  DPYGLVDHEGDYNS  645
            DPYGLVDHEGDYNS
Sbjct  121  DPYGLVDHEGDYNS  134



>gb|AAO22988.1| MADS-box transcription factor CDM19 [Chrysanthemum x morifolium]
Length=232

 Score =   271 bits (692),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 130/206 (63%), Positives = 167/206 (81%), Gaps = 2/206 (1%)
 Frame = +1

Query  91   RGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMISTSGKLHEYISPST  270
            RGKIQIK+IEN TNRQVTYSKRRNGLFKKA ELTVLCDAKVSIIM+S + KLHEYISPS 
Sbjct  2    RGKIQIKKIENSTNRQVTYSKRRNGLFKKASELTVLCDAKVSIIMVSCTDKLHEYISPSI  61

Query  271  STKQLFDQYQKTVGVDLWNSHFEKMQEQLKKLRDVNRALRREIRQRMGEGLNDLSFEQLT  450
            + KQ FDQYQKT G+DLWNSH++KMQE+L++ ++VNR LR++IRQR+G+ L DL FE+L 
Sbjct  62   TMKQFFDQYQKTTGIDLWNSHYQKMQEELRQQKEVNRNLRKQIRQRLGDCLEDLGFEELL  121

Query  451  ELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLVDH  627
             L +D   ++ +IRERK KVIGN++ET KKKVR+ +++++ L+ E + R EDP YG+++ 
Sbjct  122  ALEKDSQEAVYIIRERKLKVIGNKVETSKKKVRSAQDVYKKLMHEFDIRGEDPQYGMIED  181

Query  628  EGDYNSVLGFPN-GGPRILALRLQPD  702
              DY +V G+P+ G   IL LRLQPD
Sbjct  182  GVDYENVYGYPHMGAQHILTLRLQPD  207



>gb|ADO16140.1| MADS [Ipomoea lobata]
Length=134

 Score =   267 bits (682),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 129/134 (96%), Positives = 132/134 (99%), Gaps = 0/134 (0%)
 Frame = +1

Query  244  LHEYISPSTSTKQLFDQYQKTVGVDLWNSHFEKMQEQLKKLRDVNRALRREIRQRMGEGL  423
            LHEYISPST+TKQLFDQYQKTVGVDLW+SHFEKMQEQLKKLRDVNRALRREIRQRMGE L
Sbjct  1    LHEYISPSTTTKQLFDQYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESL  60

Query  424  NDLSFEQLTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQE  603
            NDLSFEQLTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQE
Sbjct  61   NDLSFEQLTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQE  120

Query  604  DPYGLVDHEGDYNS  645
            DP+GLVD EGDYNS
Sbjct  121  DPFGLVDREGDYNS  134



>gb|AGH39936.1| MADS domain protein [Actaea vaginata]
Length=220

 Score =   270 bits (689),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 127/205 (62%), Positives = 165/205 (80%), Gaps = 4/205 (2%)
 Frame = +1

Query  85   MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMISTSGKLHEYISP  264
            M RGKI+IKRIEN TNRQVTYSKRR G+ KKA ELTVLCDA+VS+IM S++GKL EYISP
Sbjct  1    MGRGKIEIKRIENTTNRQVTYSKRRTGIVKKARELTVLCDAEVSLIMFSSTGKLSEYISP  60

Query  265  STSTKQLFDQYQKTVGVDLWNSHFEKMQEQLKKLRDVNRALRREIRQRMGEGLNDLSFEQ  444
            ST+TK+++D YQ+  GVDLWNSH+EKM+E LKK ++ N  LR+EIRQR+GEGL+DLSFE+
Sbjct  61   STTTKKIYDTYQQVNGVDLWNSHYEKMKETLKKQKESNMKLRKEIRQRIGEGLDDLSFEE  120

Query  445  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDPYGLVD  624
            L  L +D+D S+K++R+RKY +I  Q ET++KK+RN++E H +L+ E +AR EDPY    
Sbjct  121  LRGLEQDLDGSVKVVRDRKYHMIATQTETYRKKLRNLQETHTHLMREFDARGEDPY----  176

Query  625  HEGDYNSVLGFPNGGPRILALRLQP  699
            ++GDY S+LG  NG   +L  RLQP
Sbjct  177  YDGDYESLLGMSNGAAHLLPYRLQP  201



>gb|ADO16142.1| MADS [Ipomoea obscura]
Length=134

 Score =   266 bits (680),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 129/134 (96%), Positives = 131/134 (98%), Gaps = 0/134 (0%)
 Frame = +1

Query  244  LHEYISPSTSTKQLFDQYQKTVGVDLWNSHFEKMQEQLKKLRDVNRALRREIRQRMGEGL  423
            LHEYISPSTSTKQLFDQYQKTVGVDLW+SHFEKMQEQLKKLRDVNRA RREIRQRMGE L
Sbjct  1    LHEYISPSTSTKQLFDQYQKTVGVDLWSSHFEKMQEQLKKLRDVNRAFRREIRQRMGESL  60

Query  424  NDLSFEQLTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQE  603
            NDLSFEQLTELIEDVDNSIKLIRERKYKVI NQIET+KKKVRNVEEIHRNLLLECEARQE
Sbjct  61   NDLSFEQLTELIEDVDNSIKLIRERKYKVITNQIETNKKKVRNVEEIHRNLLLECEARQE  120

Query  604  DPYGLVDHEGDYNS  645
            DPYGLVDHEGDYNS
Sbjct  121  DPYGLVDHEGDYNS  134



>gb|ADO16144.1| MADS [Ipomoea ochracea]
Length=134

 Score =   266 bits (680),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 129/134 (96%), Positives = 131/134 (98%), Gaps = 0/134 (0%)
 Frame = +1

Query  244  LHEYISPSTSTKQLFDQYQKTVGVDLWNSHFEKMQEQLKKLRDVNRALRREIRQRMGEGL  423
            LHEYISPSTSTKQLFDQYQKTVGVDLW+SHFEKMQEQLKKLRDVNRALRREIRQRMGE L
Sbjct  1    LHEYISPSTSTKQLFDQYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESL  60

Query  424  NDLSFEQLTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQE  603
            NDLSFEQLTELI DVDNSIKLIR+RKYKVI NQIETHKKKVRNVEEIHRNLLLECEARQE
Sbjct  61   NDLSFEQLTELIGDVDNSIKLIRDRKYKVISNQIETHKKKVRNVEEIHRNLLLECEARQE  120

Query  604  DPYGLVDHEGDYNS  645
            DPYGLVDHEGDYNS
Sbjct  121  DPYGLVDHEGDYNS  134



>gb|AAO22985.1| MADS-box transcription factor CDM115 [Chrysanthemum x morifolium]
Length=229

 Score =   270 bits (689),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 129/209 (62%), Positives = 168/209 (80%), Gaps = 3/209 (1%)
 Frame = +1

Query  85   MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMISTSGKLHEYISP  264
            MARGKIQIK+IEN TNRQVTYSKRRNGLFKKA ELTVLCDAKVSIIM+S + KLHEYISP
Sbjct  1    MARGKIQIKKIENSTNRQVTYSKRRNGLFKKASELTVLCDAKVSIIMVSCTDKLHEYISP  60

Query  265  STSTKQLFDQYQKTVGVDLWNSHFEKMQEQLKKLRDVNRALRREIRQRMGEGLNDLSFEQ  444
            S +TKQ FDQYQK  G+DLWNSH+EKMQE L++L+DVN+ LR  IRQR+G+ L+ L FE+
Sbjct  61   SITTKQFFDQYQKASGIDLWNSHYEKMQEVLRQLKDVNKKLRTHIRQRLGDCLDHLGFEE  120

Query  445  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLV  621
            L +L ++   ++ +IRERK KVIGN++ET KKKVR+ +++++ L+ E + R EDP +G++
Sbjct  121  LLDLEKESQEAVYVIRERKLKVIGNKLETSKKKVRSAQDVYKKLMHEFDIRGEDPQFGMI  180

Query  622  DHEGDYNSVLGFPN--GGPRILALRLQPD  702
            +  G+Y ++ G+P      RIL LRLQP+
Sbjct  181  EDAGEYETIYGYPPHIATQRILTLRLQPN  209



>ref|XP_006386194.1| MADS-box protein GmNMH7 [Populus trichocarpa]
 gb|ERP63991.1| MADS-box protein GmNMH7 [Populus trichocarpa]
Length=191

 Score =   267 bits (683),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 124/191 (65%), Positives = 162/191 (85%), Gaps = 0/191 (0%)
 Frame = +1

Query  85   MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMISTSGKLHEYISP  264
            MARGKIQIK+IEN TNRQVTYSKRRNGLFKKAHELTVLCDA+VS++M+S + K+H+Y SP
Sbjct  1    MARGKIQIKKIENSTNRQVTYSKRRNGLFKKAHELTVLCDAEVSLVMVSCTDKVHDYTSP  60

Query  265  STSTKQLFDQYQKTVGVDLWNSHFEKMQEQLKKLRDVNRALRREIRQRMGEGLNDLSFEQ  444
            ST+TK++FDQYQ+T G+DLW+SH+E M+E L+KL++VN  +RRE+RQRMG+ LN LSF+ 
Sbjct  61   STTTKRIFDQYQQTKGIDLWSSHYEIMKENLEKLKEVNMKIRREMRQRMGQCLNGLSFQD  120

Query  445  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDPYGLVD  624
            L  L  D++++ ++I +R  +V+ NQIET KKK RNVE+I+R L +E EA  +DPYGLVD
Sbjct  121  LQSLESDMESAWRVIHDRADRVLTNQIETSKKKARNVEQINRKLQVELEAMDQDPYGLVD  180

Query  625  HEGDYNSVLGF  657
            + GDYNSV+GF
Sbjct  181  NGGDYNSVMGF  191



>gb|ACY08902.1| MADS-domain transcription factor, partial [Phlox paniculata]
Length=209

 Score =   267 bits (683),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 143/193 (74%), Positives = 167/193 (87%), Gaps = 6/193 (3%)
 Frame = +1

Query  127  TNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMISTSGKLHEYISPSTSTKQLFDQYQKT  306
            TNRQVT     NGLFKKA ELTVLCDAKVS++M S++GKLHEYISPST+TKQLFDQYQKT
Sbjct  3    TNRQVT----SNGLFKKASELTVLCDAKVSLLMFSSTGKLHEYISPSTTTKQLFDQYQKT  58

Query  307  VGVDLWNSHFEKMQEQLKKLRDVNRALRREIRQRMGEGLNDLSFEQLTELIEDVDNSIKL  486
            +G+DLW+SH+EKMQE LKKL+DVNR LRREIR+RMGE LNDL+FE+L  L  D+D ++K+
Sbjct  59   LGIDLWSSHYEKMQEHLKKLKDVNRNLRREIRRRMGECLNDLTFEELRTLELDMDEAVKV  118

Query  487  IRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLVDHEGDYNSVLGFPN  663
            IRERK KVI NQI+T+KKK RNV+EIHRNLLLE +AR+EDP YGLVD+ GDY SVLGF  
Sbjct  119  IRERKNKVINNQIDTYKKKWRNVQEIHRNLLLEFDAREEDPHYGLVDNGGDYESVLGFQG  178

Query  664  GG-PRILALRLQP  699
            G  PR+LALRLQP
Sbjct  179  GSHPRMLALRLQP  191



>gb|AAF73931.1|AF230702_1 MADS box transcription factor AP3 [Hydrangea macrophylla]
Length=202

 Score =   267 bits (682),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 129/183 (70%), Positives = 159/183 (87%), Gaps = 2/183 (1%)
 Frame = +1

Query  160  NGLFKKAHELTVLCDAKVSIIMISTSGKLHEYISPSTSTKQLFDQYQKTVGVDLWNSHFE  339
            NGLFKKA+ELTVLCDAKVSIIM ST+ KLHEYISPS STK+LFD YQ T+G+DLW+SH+E
Sbjct  1    NGLFKKANELTVLCDAKVSIIMFSTTNKLHEYISPSISTKELFDLYQTTMGIDLWSSHYE  60

Query  340  KMQEQLKKLRDVNRALRREIRQRMGEGLNDLSFEQLTELIEDVDNSIKLIRERKYKVIGN  519
            +MQE LKKL+DVNR LR EIRQRMGE LNDLS++ L  L +++D+S+K+IRERKY+V+GN
Sbjct  61   RMQENLKKLKDVNRNLRMEIRQRMGESLNDLSWKDLRGLEQEMDSSVKIIRERKYRVLGN  120

Query  520  QIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLVDHEGDYNSVLGFPNGG-PRILALRL  693
            QI+TH+KKVRN EEIHR ++ E E ++EDP YGLVD+ G+Y+SVLGFPN G PRI+A RL
Sbjct  121  QIDTHRKKVRNAEEIHRYIIHEFEVKEEDPHYGLVDNGGNYDSVLGFPNDGPPRIVAFRL  180

Query  694  QPD  702
            Q +
Sbjct  181  QTN  183



>gb|AHH28294.1| MADS-box transcription factor, partial [Clutia sp. DAV B80.252/F1980.8371]
Length=206

 Score =   267 bits (682),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 130/186 (70%), Positives = 157/186 (84%), Gaps = 2/186 (1%)
 Frame = +1

Query  151  KRRNGLFKKAHELTVLCDAKVSIIMISTSGKLHEYISPSTSTKQLFDQYQKTVGVDLWNS  330
            KRRNGLFKKA+ELTVLCDAKVSIIM S++GKLHEYIS STS KQ +DQYQK  G+DLWN+
Sbjct  1    KRRNGLFKKANELTVLCDAKVSIIMFSSTGKLHEYISSSTSMKQFYDQYQKNAGIDLWNT  60

Query  331  HFEKMQEQLKKLRDVNRALRREIRQRMGEGLNDLSFEQLTELIEDVDNSIKLIRERKYKV  510
            H+E+MQE L+K ++ NR LRREIRQRMG+ LNDL FE L  L +D+D ++  IRERK +V
Sbjct  61   HYERMQESLRKQKETNRNLRREIRQRMGDCLNDLKFEDLRFLEQDMDTALTNIRERKNRV  120

Query  511  IGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLVDHEGDYNSVLGFPNGGPR-ILA  684
            I NQIET+KKK+RNVEEIHRNLL E E+R++DP YGLVD+ GDY+SV G+ NGGPR + A
Sbjct  121  ITNQIETYKKKLRNVEEIHRNLLHEFESREDDPHYGLVDNGGDYDSVFGYQNGGPRNMFA  180

Query  685  LRLQPD  702
            LRLQP+
Sbjct  181  LRLQPN  186



>ref|XP_006435093.1| hypothetical protein CICLE_v10002410mg [Citrus clementina]
 gb|ESR48333.1| hypothetical protein CICLE_v10002410mg [Citrus clementina]
Length=221

 Score =   268 bits (684),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 135/209 (65%), Positives = 168/209 (80%), Gaps = 3/209 (1%)
 Frame = +1

Query  85   MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMISTSGKLHEYISP  264
            MARGKIQIKRIEN TNRQVT+SKRRNGLFKKA ELTVLCDAKVSIIM S++GK+ EY+S 
Sbjct  1    MARGKIQIKRIENATNRQVTFSKRRNGLFKKAQELTVLCDAKVSIIMCSSTGKVQEYVSS  60

Query  265  STSTKQLFDQYQKTVGVDLWNSHFEKMQEQLKKLRDVNRALRREIRQRMGEGLNDLSFEQ  444
            ST+TKQL D+YQ+ + +DLW+S +EKMQE LK L++VN  L++EIRQR+GE LNDLS ++
Sbjct  61   STTTKQLLDEYQRRLKIDLWSSQYEKMQENLKNLKEVNINLKKEIRQRLGESLNDLSLKK  120

Query  445  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLL--LECEARQEDP-YG  615
            L++L +DVDN +++IRERK + I  QI THKKKVR  EE +R L       A++ED  Y 
Sbjct  121  LSDLEQDVDNCLRIIRERKLRAISGQIVTHKKKVRREEEENRKLRNGFIINAKEEDQHYE  180

Query  616  LVDHEGDYNSVLGFPNGGPRILALRLQPD  702
            LVD+EG Y+SV+ F NGGP I ALRLQP+
Sbjct  181  LVDNEGHYDSVIRFQNGGPGIFALRLQPN  209



>gb|AGH39930.1| truncated MADS domain protein [Leptopyrum fumarioides]
Length=207

 Score =   267 bits (682),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 127/206 (62%), Positives = 166/206 (81%), Gaps = 5/206 (2%)
 Frame = +1

Query  85   MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMISTSGKLHEYISP  264
            M RGKI+IKRIEN TNRQVTYSKRR G+ KKA ELTVLCDA+VS+IM ST+GKL E+ISP
Sbjct  1    MGRGKIEIKRIENTTNRQVTYSKRRTGIVKKARELTVLCDAEVSLIMFSTTGKLSEFISP  60

Query  265  STSTKQLFDQYQKTVGVDLWNSHFEKMQEQLKKLRDVNRALRREIRQRMGEGL-NDLSFE  441
            ST+TK+++DQYQ+  G++LWNSHFEKMQE LKK ++ N  LR EIRQR+GE L +D+SF+
Sbjct  61   STTTKKVYDQYQQVSGINLWNSHFEKMQESLKKQKETNMRLRNEIRQRIGESLYDDMSFD  120

Query  442  QLTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDPYGLV  621
            +L  L +D+D S+KL+R+RKY +I  Q ET++KK+RN++E H +L+ E EAR EDPY   
Sbjct  121  ELRGLEQDLDESVKLVRDRKYHMIATQTETYRKKLRNLQETHTHLVREFEARGEDPY---  177

Query  622  DHEGDYNSVLGFPNGGPRILALRLQP  699
             +EGDY S+LG P+G   +++ RLQP
Sbjct  178  -YEGDYESLLGMPSGSAHLVSYRLQP  202



>ref|XP_008221326.1| PREDICTED: LOW QUALITY PROTEIN: floral homeotic protein DEFICIENS-like 
[Prunus mume]
Length=229

 Score =   267 bits (683),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 132/207 (64%), Positives = 172/207 (83%), Gaps = 4/207 (2%)
 Frame = +1

Query  85   MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMISTSGKLHEYISP  264
            M RGKIQIKRIEN TNRQVTYSKRRNGLFKKAHELTVLCDA VS+IM+S+SGK+HEYISP
Sbjct  1    MTRGKIQIKRIENATNRQVTYSKRRNGLFKKAHELTVLCDATVSLIMVSSSGKIHEYISP  60

Query  265  STSTKQLFDQYQKTVGVDLWNSHFEKMQEQLKKLRDVNRALRREIRQR-MGEGLNDLSFE  441
            ST+TKQ FDQ+QKT GVD+W+SH+E MQE LKKL++VNR+L+++IRQR +GE LND+SF+
Sbjct  61   STTTKQFFDQFQKTKGVDIWSSHYEAMQEHLKKLKEVNRSLQKQIRQRVLGECLNDMSFD  120

Query  442  QLTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDPYGLV  621
            +L  + ++++ ++ +IR+RK ++I NQI+T KKK+R+  E++RN L E +AR +  Y LV
Sbjct  121  ELRGVEQEMEGAVDVIRKRKIRMISNQIDTTKKKLRSATEMNRN-LHEFDARDDTHYRLV  179

Query  622  DHEG-DYNSVLGF-PNGGPRILALRLQ  696
            ++ G DY S  G+  NGGPRI  LRLQ
Sbjct  180  ENGGEDYESAFGYSSNGGPRIFXLRLQ  206



>gb|ABF67489.1| MADS-domain protein [Impatiens hawkeri]
Length=259

 Score =   268 bits (685),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 127/174 (73%), Positives = 155/174 (89%), Gaps = 0/174 (0%)
 Frame = +1

Query  85   MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMISTSGKLHEYISP  264
            MARGKIQIKRIEN TNRQVTYSKRRNGLF+KA ELTVLCDAK+SI+M S++ KLHE+ISP
Sbjct  1    MARGKIQIKRIENDTNRQVTYSKRRNGLFRKAGELTVLCDAKISILMFSSTSKLHEFISP  60

Query  265  STSTKQLFDQYQKTVGVDLWNSHFEKMQEQLKKLRDVNRALRREIRQRMGEGLNDLSFEQ  444
            S S KQLFDQYQKTVGVDLW+S +E+MQE LKKL++ NR+LR EIRQRMG+ LN+L +EQ
Sbjct  61   SISAKQLFDQYQKTVGVDLWSSQYERMQEHLKKLKEGNRSLRTEIRQRMGDCLNELCYEQ  120

Query  445  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQED  606
            L  L +D+D+S++ IR+RK+KV+GNQIETH+KK+RNVE+IHRNLL E + R+ED
Sbjct  121  LVGLEQDMDSSLQRIRDRKFKVLGNQIETHRKKLRNVEQIHRNLLQEFDVREED  174



>gb|AHY19023.1| AP3 MADS box protein [Ribes diacanthum]
Length=233

 Score =   267 bits (682),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 135/207 (65%), Positives = 167/207 (81%), Gaps = 3/207 (1%)
 Frame = +1

Query  85   MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMISTSGKLHEYISP  264
            MARGKI+IKRIEN TNRQVTYSKRRNGLFKKA+ELTVLCDAKVSIIM S++ KLHEY+SP
Sbjct  1    MARGKIEIKRIENSTNRQVTYSKRRNGLFKKANELTVLCDAKVSIIMFSSTNKLHEYLSP  60

Query  265  STSTKQLFDQYQKTVGVDLWNSHFEKMQEQLKKLRDVNRALRREIRQRMGEGLNDLSFEQ  444
              STKQ+FDQYQ  +G+DLW +HFE+MQE LK+L+DVN  LR EIR RMG  L+ LS  +
Sbjct  61   FISTKQVFDQYQNQLGIDLWQTHFERMQEHLKQLKDVNNNLRMEIRHRMGASLDGLSLAE  120

Query  445  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLV  621
            L  L E++D S+ +IRERK  VIGNQI+T KKKVRN EE++R L+ E + R+EDP +GLV
Sbjct  121  LRNLEEEMDGSLDIIRERKRHVIGNQIDTLKKKVRNSEEVNRKLVHEFDVRREDPHFGLV  180

Query  622  DHEG-DYNSVLGFPN-GGPRILALRLQ  696
            ++ G +Y++V G+ N GG RI AL +Q
Sbjct  181  ENGGSEYDTVFGYQNGGGARIFALPMQ  207



>gb|KDO84726.1| hypothetical protein CISIN_1g040046mg [Citrus sinensis]
Length=221

 Score =   266 bits (680),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 134/209 (64%), Positives = 168/209 (80%), Gaps = 3/209 (1%)
 Frame = +1

Query  85   MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMISTSGKLHEYISP  264
            MARGKIQIKRIEN TNRQVT+SKRRNGLFKKA ELTVLCDAKVSIIM S++GK+ EY+S 
Sbjct  1    MARGKIQIKRIENATNRQVTFSKRRNGLFKKAQELTVLCDAKVSIIMCSSTGKVQEYVSS  60

Query  265  STSTKQLFDQYQKTVGVDLWNSHFEKMQEQLKKLRDVNRALRREIRQRMGEGLNDLSFEQ  444
            ST+TKQL D+YQ+ + +DLW+S +EKMQE LK L++VN  L++EIRQR+GE LNDLS ++
Sbjct  61   STTTKQLLDEYQRRLKIDLWSSQYEKMQENLKNLKEVNINLKKEIRQRLGESLNDLSLKK  120

Query  445  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLL--LECEARQEDP-YG  615
            L++L +DVDN +++IRERK + I  QI TH+KKVR  EE +R L       A++ED  Y 
Sbjct  121  LSDLEQDVDNCLRIIRERKLRAISGQIVTHRKKVRREEEENRKLRNGFIINAKEEDQHYE  180

Query  616  LVDHEGDYNSVLGFPNGGPRILALRLQPD  702
            LVD+EG Y+SV+ F NGGP I ALRLQP+
Sbjct  181  LVDNEGHYDSVIRFQNGGPGIFALRLQPN  209



>gb|AHH28320.1| MADS-box transcription factor, partial [Garcia nutans]
Length=209

 Score =   265 bits (678),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 131/186 (70%), Positives = 160/186 (86%), Gaps = 2/186 (1%)
 Frame = +1

Query  148  SKRRNGLFKKAHELTVLCDAKVSIIMISTSGKLHEYISPSTSTKQLFDQYQKTVGVDLWN  327
            SKRRNGLFKKA+ELTVLCDAKVS+IM S +GKLHE+ISPST+TKQLFDQYQKT+GVDLW 
Sbjct  1    SKRRNGLFKKANELTVLCDAKVSLIMFSGTGKLHEFISPSTTTKQLFDQYQKTLGVDLWI  60

Query  328  SHFEKMQEQLKKLRDVNRALRREIRQRMGEGLNDLSFEQLTELIEDVDNSIKLIRERKYK  507
            + +E+MQE LKKL+DVNR LR+EIRQRMGE L+D++FE L  L ED+D ++ +IRERK +
Sbjct  61   TQYERMQENLKKLKDVNRNLRKEIRQRMGECLDDVNFEHLRSLEEDMDTALNVIRERKNR  120

Query  508  VIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLVDHEGDYNSVLGFPNGGPR-IL  681
            VI NQIET+KKK+RNVE+IHRNLL E +AR EDP YGLVD+ GDY+S++GF  GG R + 
Sbjct  121  VITNQIETYKKKLRNVEQIHRNLLREFDARDEDPHYGLVDNGGDYDSMIGFHYGGIRNVF  180

Query  682  ALRLQP  699
             +RLQP
Sbjct  181  GIRLQP  186



>gb|AIU94279.1| APETALA3-like protein transcript variant 1 [Prunus pseudocerasus]
Length=204

 Score =   265 bits (676),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 130/204 (64%), Positives = 171/204 (84%), Gaps = 4/204 (2%)
 Frame = +1

Query  85   MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMISTSGKLHEYISP  264
            MARGKIQIKRIEN TNRQVTYSKRRNGLFKKAHELTVLCDA VS+IM+S+SGK+HEYISP
Sbjct  1    MARGKIQIKRIENATNRQVTYSKRRNGLFKKAHELTVLCDATVSLIMVSSSGKIHEYISP  60

Query  265  STSTKQLFDQYQKTVGVDLWNSHFEKMQEQLKKLRDVNRALRREIRQR-MGEGLNDLSFE  441
            ST+TKQ FDQ+QKT GVD+W+SH+E MQE LKKL++VNR+LR++IRQR +GE LND+SF+
Sbjct  61   STTTKQFFDQFQKTKGVDIWSSHYEAMQEHLKKLKEVNRSLRKQIRQRVLGECLNDMSFD  120

Query  442  QLTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGL  618
            +L  + ++++ ++ +IR+RK ++I NQI+T KKK+R+  E++RNL    +A ++DP Y L
Sbjct  121  ELRGVGQEMEGAVDVIRKRKNRMISNQIDTTKKKLRSATEMNRNLREFIKAARDDPHYRL  180

Query  619  VDHEG-DYNSVLGFPN-GGPRILA  684
            V++ G DY S  G+ + GGPRI A
Sbjct  181  VENGGEDYESAFGYSSKGGPRIFA  204



>gb|ABF67492.1| MADS-domain transcription factor [Marcgravia umbellata]
Length=209

 Score =   265 bits (676),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 129/191 (68%), Positives = 159/191 (83%), Gaps = 1/191 (1%)
 Frame = +1

Query  133  RQVTYSKRRNGLFKKAHELTVLCDAKVSIIMISTSGKLHEYISPSTSTKQLFDQYQKTVG  312
            RQVT+ KRRNGLFKKA EL+VLCDA+VSIIM S++GKLHEYISPS STKQLFDQYQKTVG
Sbjct  1    RQVTFCKRRNGLFKKARELSVLCDARVSIIMFSSTGKLHEYISPSISTKQLFDQYQKTVG  60

Query  313  VDLWNSHFEKMQEQLKKLRDVNRALRREIRQRMGEGLNDLSFEQLTELIEDVDNSIKLIR  492
            +DLW+ H+E+MQE LKKL++VN  LRREIRQRMGE L++L +  L  L   +D+S++LIR
Sbjct  61   IDLWSIHYERMQEHLKKLKEVNGGLRREIRQRMGESLDELRYADLLALEHAMDSSLQLIR  120

Query  493  ERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLVDHEGDYNSVLGFPNGG  669
            +RK KVIGNQIET KKK++NVE+IHRNLL E + R+++P YGLVD+ G+Y    GF    
Sbjct  121  DRKNKVIGNQIETFKKKLKNVEQIHRNLLQEFDLREDEPHYGLVDNGGEYAPFNGFTTRS  180

Query  670  PRILALRLQPD  702
            PRILA+RLQP+
Sbjct  181  PRILAVRLQPN  191



>ref|XP_006473587.1| PREDICTED: floral homeotic protein DEFICIENS-like [Citrus sinensis]
Length=223

 Score =   265 bits (677),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 133/209 (64%), Positives = 168/209 (80%), Gaps = 3/209 (1%)
 Frame = +1

Query  85   MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMISTSGKLHEYISP  264
            MARGKIQIKRIEN TNRQVT+SKRRNGLFKKA ELTVLCDAKVSIIM S++GK+ EY+S 
Sbjct  3    MARGKIQIKRIENATNRQVTFSKRRNGLFKKAQELTVLCDAKVSIIMCSSTGKVQEYVSS  62

Query  265  STSTKQLFDQYQKTVGVDLWNSHFEKMQEQLKKLRDVNRALRREIRQRMGEGLNDLSFEQ  444
            ST+TKQL D+YQ+ + +DLW+S +EKMQ+ LK L++VN  L++EIRQR+GE LNDLS ++
Sbjct  63   STTTKQLLDEYQRRLKIDLWSSQYEKMQKNLKNLKEVNINLKKEIRQRLGESLNDLSLKK  122

Query  445  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLL--LECEARQEDP-YG  615
            L++L +DVDN +++IRERK + I  QI TH+KKVR  EE +R L       A++ED  Y 
Sbjct  123  LSDLEQDVDNCLRIIRERKLRAISGQIVTHRKKVRREEEENRKLRNGFIINAKEEDQHYE  182

Query  616  LVDHEGDYNSVLGFPNGGPRILALRLQPD  702
            LVD+EG Y+SV+ F NGGP I ALRLQP+
Sbjct  183  LVDNEGHYDSVIRFQNGGPGIFALRLQPN  211



>ref|XP_006340689.1| PREDICTED: floral homeotic protein DEFICIENS-like [Solanum tuberosum]
Length=225

 Score =   264 bits (675),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 125/206 (61%), Positives = 165/206 (80%), Gaps = 1/206 (0%)
 Frame = +1

Query  85   MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMISTSGKLHEYISP  264
            M RGKI+IK+IEN TNRQVTYSKRRNG+FKKA ELTVLCDAK+S+IM+S++ K HEY SP
Sbjct  1    MGRGKIEIKKIENSTNRQVTYSKRRNGIFKKAKELTVLCDAKISLIMLSSTRKYHEYTSP  60

Query  265  STSTKQLFDQYQKTVGVDLWNSHFEKMQEQLKKLRDVNRALRREIRQRMGEGLNDLSFEQ  444
            +T+TK++ DQYQ  +GVD+W++H+EKMQE LK+L+++N  LRREIRQR GE ++ L+ ++
Sbjct  61   NTTTKKMIDQYQSALGVDIWSTHYEKMQENLKRLQEINNKLRREIRQRTGEDMSGLNLQE  120

Query  445  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLV  621
            L  L E++  S+  IRERKY VI NQ +T +KKVRN+EE H NL+L+ EA+ EDP YG+V
Sbjct  121  LCHLQENITESVAEIRERKYHVIKNQTDTCRKKVRNLEEQHGNLVLDLEAKCEDPKYGVV  180

Query  622  DHEGDYNSVLGFPNGGPRILALRLQP  699
            ++EG YNS + F NG   + A RLQP
Sbjct  181  ENEGHYNSAVAFANGVHNLYAFRLQP  206



>gb|ACY08898.1| MADS-domain transcription factor, partial [Jacquinia aurantiaca]
Length=215

 Score =   264 bits (674),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 133/195 (68%), Positives = 161/195 (83%), Gaps = 3/195 (2%)
 Frame = +1

Query  127  TNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMISTSGKLHEYISPST-STKQLFDQYQK  303
            TNRQVTYSKRRNGLFKKA EL VLCDAKVSIIM+S + K+HE+ SP+  S KQLFDQYQ+
Sbjct  3    TNRQVTYSKRRNGLFKKAGELAVLCDAKVSIIMLSGTNKVHEFHSPTNISVKQLFDQYQQ  62

Query  304  TVGVDLWNSHFEKMQEQLKKLRDVNRALRREIRQRMGEGLNDLSFEQLTELIEDVDNSIK  483
            T G+DLW+SH+EKMQE LKK +++NR L REIRQRMG+ LN+L    L  L +D++ S++
Sbjct  63   TTGIDLWSSHYEKMQEDLKKRKEINRNLLREIRQRMGDSLNELDLNDLQALEQDMEKSLE  122

Query  484  LIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLVDHEGDYNSVLGFP  660
             IR RK+KV+GNQIET +KKVRNVE+IHRNLLLE +AR+EDP YGLVD  G Y+SVLGF 
Sbjct  123  NIRLRKFKVLGNQIETSRKKVRNVEDIHRNLLLEFDAREEDPHYGLVDDGGHYDSVLGFT  182

Query  661  N-GGPRILALRLQPD  702
            N G  R+LALRLQP+
Sbjct  183  NEGAHRMLALRLQPE  197



>ref|XP_012078388.1| PREDICTED: floral homeotic protein DEFICIENS-like [Jatropha curcas]
Length=230

 Score =   264 bits (675),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 125/207 (60%), Positives = 169/207 (82%), Gaps = 3/207 (1%)
 Frame = +1

Query  85   MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMISTSGKLHEYISP  264
            M RGKI+IKRIEN TNRQVTYSKRRNG+FKKA ELTVLCDAKVS+IM S++GK HE+ISP
Sbjct  1    MGRGKIEIKRIENSTNRQVTYSKRRNGIFKKAQELTVLCDAKVSLIMFSSTGKFHEFISP  60

Query  265  STSTKQLFDQYQKTVGVDLWNSHFEKMQEQLKKLRDVNRALRREIRQRMGEGLNDLSFEQ  444
            +TSTK++FDQYQK +G+DLW++H+E+MQE L+KLR++N  LRREIRQR+GE LNDLS ++
Sbjct  61   TTSTKKIFDQYQKNLGIDLWSTHYERMQENLRKLREINTKLRREIRQRLGEDLNDLSIDE  120

Query  445  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEA--RQEDP-YG  615
            +  L E +D+++KL+R++KY++I  +  T +KKV+++EE + +LLLE +A  + EDP YG
Sbjct  121  MRSLEERMDSALKLVRDKKYRLIETKTGTQRKKVKSLEERYGDLLLEFDAIGKCEDPQYG  180

Query  616  LVDHEGDYNSVLGFPNGGPRILALRLQ  696
            LV++EGDY S +   NG   + A RL 
Sbjct  181  LVENEGDYESAVALANGASNLYAFRLH  207



>dbj|BAN13567.1| apetala3/pistillata-like protein [Chrysanthemum seticuspe f. 
boreale]
Length=232

 Score =   263 bits (673),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 127/206 (62%), Positives = 165/206 (80%), Gaps = 2/206 (1%)
 Frame = +1

Query  91   RGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMISTSGKLHEYISPST  270
            RGKIQIK+I + TNRQVTYSKRRNGLFKKA ELTVLCDA VSIIM+S + KLHEYISPS 
Sbjct  2    RGKIQIKKIFHSTNRQVTYSKRRNGLFKKASELTVLCDANVSIIMVSCTDKLHEYISPSI  61

Query  271  STKQLFDQYQKTVGVDLWNSHFEKMQEQLKKLRDVNRALRREIRQRMGEGLNDLSFEQLT  450
            + KQ FDQYQKT G+DLWNSH++KMQE+L++ ++VNR LR++IRQR+G+ L DL FE+L 
Sbjct  62   TMKQFFDQYQKTTGIDLWNSHYQKMQEELRQQKEVNRNLRKQIRQRLGDCLEDLGFEELL  121

Query  451  ELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLVDH  627
             L +D   ++ +IRERK KVIGN++ET KKKVR+ +++++ L+ E + R EDP YG+++ 
Sbjct  122  ALEKDSQEAVYIIRERKLKVIGNKVETSKKKVRSAQDVYKKLMHEFDIRGEDPQYGMIED  181

Query  628  EGDYNSVLGFPN-GGPRILALRLQPD  702
              DY +V G+P+ G   IL LRLQPD
Sbjct  182  GVDYENVYGYPHMGAQHILTLRLQPD  207



>emb|CDP01943.1| unnamed protein product [Coffea canephora]
Length=220

 Score =   262 bits (670),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 128/207 (62%), Positives = 163/207 (79%), Gaps = 3/207 (1%)
 Frame = +1

Query  85   MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMISTSGKLHEYISP  264
            M RGKI+I++IEN TNRQVTYSKRRNG+FKKAHEL+VLCDAKVS+IM+S + K HEY SP
Sbjct  1    MGRGKIEIRKIENSTNRQVTYSKRRNGIFKKAHELSVLCDAKVSLIMLSDTKKFHEYTSP  60

Query  265  STSTKQLFDQYQKTVGVDLWNSHFEKMQEQLKKLRDVNRALRREIRQRMGEGLNDLSFEQ  444
            S +TK++ D YQ  VGVDLW++H+EKMQE L++L++ N  LRR+IRQRMGE LNDL+++ 
Sbjct  61   SITTKKVMDDYQSAVGVDLWSTHYEKMQENLRRLKETNNKLRRDIRQRMGEDLNDLNWDN  120

Query  445  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQ-EDP-YGL  618
            +  L E + +S+ +IR RKY VI NQ +T+KKKVRN++E H NLL E EAR  EDP YG+
Sbjct  121  MCRLQEKIVDSLAIIRHRKYHVIKNQTDTYKKKVRNLKERHGNLLYELEARSCEDPKYGI  180

Query  619  VDHEGDYNSVLGFPNGG-PRILALRLQ  696
            VD+  DYNS L   +GG   + ALRLQ
Sbjct  181  VDNARDYNSALALADGGLSNLYALRLQ  207



>ref|XP_006403587.1| hypothetical protein EUTSA_v10010683mg [Eutrema salsugineum]
 gb|ESQ45040.1| hypothetical protein EUTSA_v10010683mg [Eutrema salsugineum]
Length=232

 Score =   262 bits (670),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 128/207 (62%), Positives = 166/207 (80%), Gaps = 1/207 (0%)
 Frame = +1

Query  85   MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMISTSGKLHEYISP  264
            MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDA+VSIIM S+S KLHE+ISP
Sbjct  1    MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDARVSIIMFSSSNKLHEFISP  60

Query  265  STSTKQLFDQYQKTVGVDLWNSHFEKMQEQLKKLRDVNRALRREIRQRMGEGLNDLSFEQ  444
            +T+TK++ D YQ    VD+W++H+E+MQE  +KL + NR LR +I+QR+GE L++L  E+
Sbjct  61   NTTTKEIIDLYQTVSDVDVWSTHYERMQETKRKLLETNRNLRTQIKQRLGECLDELDVEE  120

Query  445  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLV  621
            L  L ++++N+ KL+RERK+K +GNQIET KKK ++ ++I +NL+ E E R EDP YGLV
Sbjct  121  LRSLEDEMENTFKLVRERKFKSLGNQIETTKKKNKSQQDIQKNLIHELELRAEDPHYGLV  180

Query  622  DHEGDYNSVLGFPNGGPRILALRLQPD  702
            D+ GDY+SVLG+   G R  ALR   +
Sbjct  181  DNGGDYDSVLGYQIEGSRAYALRFHQN  207



>gb|AHH28321.1| MADS-box transcription factor, partial [Garcia nutans]
Length=210

 Score =   261 bits (668),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 132/187 (71%), Positives = 158/187 (84%), Gaps = 3/187 (2%)
 Frame = +1

Query  148  SKRRNGLFKKAHELTVLCDAKVSIIMISTSGKLHEYISPSTSTKQLFDQYQKTVGVDLWN  327
            SKRRNGLFKKA+ELTVLCDAKVSIIM S++GKLHEY+SPS +TKQLFDQYQKT+GVDLW 
Sbjct  1    SKRRNGLFKKANELTVLCDAKVSIIMFSSTGKLHEYVSPSPTTKQLFDQYQKTLGVDLWI  60

Query  328  SHFEKMQEQLKKLRDVNRALRREIRQRMGEGLNDLSFEQLTELIEDVDNSIKLIRERKYK  507
            + +E++QE LKKL+DVNR L  EIRQRMGE LND SFE L  L ED+D ++K+IRERK +
Sbjct  61   TQYERLQEHLKKLKDVNRNLWTEIRQRMGECLNDASFEHLLSLEEDMDTALKVIRERKNR  120

Query  508  VIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLVDHEGDYNSVLGFPNGGPRILA  684
            VI NQIET+KKK+RNVE+IHRNLL E +AR EDP YGLVD+ GDY+S++G  +GG R + 
Sbjct  121  VITNQIETYKKKLRNVEQIHRNLLHEFDARDEDPLYGLVDNGGDYDSMIGLHSGGIRNIF  180

Query  685  --LRLQP  699
              LRLQP
Sbjct  181  GRLRLQP  187



>ref|XP_009116122.1| PREDICTED: floral homeotic protein APETALA 3 [Brassica rapa]
 gb|AAB08877.1| homeotic protein boi1AP3 [Brassica oleracea var. italica]
Length=232

 Score =   262 bits (670),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 128/203 (63%), Positives = 165/203 (81%), Gaps = 1/203 (0%)
 Frame = +1

Query  85   MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMISTSGKLHEYISP  264
            MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDA+VSIIM S+S KLHE+ISP
Sbjct  1    MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDARVSIIMFSSSNKLHEFISP  60

Query  265  STSTKQLFDQYQKTVGVDLWNSHFEKMQEQLKKLRDVNRALRREIRQRMGEGLNDLSFEQ  444
            +T+TK++ D YQ    VD+W++H+E+MQE  +KL + NR LR +I+QR+GE L++L  ++
Sbjct  61   NTTTKEIIDLYQTVSDVDVWSAHYERMQETKRKLLETNRKLRTQIKQRLGECLDELDIQE  120

Query  445  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLV  621
            L  L E+++N+ KL+RERK+K +GNQIET KKK ++ ++I +NL+ E E R EDP YGLV
Sbjct  121  LRSLEEEMENTFKLVRERKFKSLGNQIETTKKKNKSQQDIQKNLIHELELRAEDPHYGLV  180

Query  622  DHEGDYNSVLGFPNGGPRILALR  690
            D+ GDY+SVLG+   G R  ALR
Sbjct  181  DNGGDYDSVLGYQIEGSRAYALR  203



>gb|ABD24434.1| APETALA3-3 [Brassica napus]
Length=232

 Score =   262 bits (670),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 128/203 (63%), Positives = 165/203 (81%), Gaps = 1/203 (0%)
 Frame = +1

Query  85   MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMISTSGKLHEYISP  264
            MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDA+VSIIM S+S KLHE+ISP
Sbjct  1    MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDARVSIIMFSSSNKLHEFISP  60

Query  265  STSTKQLFDQYQKTVGVDLWNSHFEKMQEQLKKLRDVNRALRREIRQRMGEGLNDLSFEQ  444
            +T+TK++ D YQ    VD+W++H+E+MQE  +KL + NR LR +I+QR+GE L++L  ++
Sbjct  61   NTTTKEIIDLYQTVSDVDVWSAHYERMQETKRKLLETNRKLRTQIKQRLGECLDELDIQE  120

Query  445  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLV  621
            L  L E+++N+ KL+RERK+K +GNQIET KKK ++ ++I +NL+ E E R EDP YGLV
Sbjct  121  LRSLEEEMENTFKLVRERKFKSLGNQIETTKKKNKSQQDIQKNLIHELELRAEDPHYGLV  180

Query  622  DHEGDYNSVLGFPNGGPRILALR  690
            D+ GDY+SVLG+   G R  ALR
Sbjct  181  DNGGDYDSVLGYQIEGSRAYALR  203



>gb|AGS42079.2| AP3a [Brassica oleracea var. viridis]
 emb|CDX73487.1| BnaC08g25160D [Brassica napus]
Length=232

 Score =   262 bits (670),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 128/203 (63%), Positives = 165/203 (81%), Gaps = 1/203 (0%)
 Frame = +1

Query  85   MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMISTSGKLHEYISP  264
            MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDA+VSIIM S+S KLHE+ISP
Sbjct  1    MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDARVSIIMFSSSNKLHEFISP  60

Query  265  STSTKQLFDQYQKTVGVDLWNSHFEKMQEQLKKLRDVNRALRREIRQRMGEGLNDLSFEQ  444
            +T+TK++ D YQ    VD+W++H+E+MQE  +KL + NR LR +I+QR+GE L++L  ++
Sbjct  61   NTTTKEIIDLYQTVSDVDVWSAHYERMQETKRKLLETNRKLRTQIKQRLGECLDELDIQE  120

Query  445  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLV  621
            L  L E+++N+ KL+RERK+K +GNQIET KKK ++ ++I +NL+ E E R EDP YGLV
Sbjct  121  LRSLEEEMENTFKLVRERKFKSLGNQIETTKKKNKSQQDIQKNLIHELELRAEDPHYGLV  180

Query  622  DHEGDYNSVLGFPNGGPRILALR  690
            D+ GDY+SVLG+   G R  ALR
Sbjct  181  DNGGDYDSVLGYQIEGSRAYALR  203



>gb|ACY08911.1| MADS-domain transcription factor, partial [Camellia japonica]
Length=193

 Score =   260 bits (664),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 124/177 (70%), Positives = 155/177 (88%), Gaps = 1/177 (1%)
 Frame = +1

Query  175  KAHELTVLCDAKVSIIMISTSGKLHEYISPSTSTKQLFDQYQKTVGVDLWNSHFEKMQEQ  354
            KA+ELTVLCDAKVSIIM+S++GKLHE+ISPSTSTKQ++DQYQK +G+DLW SH+E+MQE 
Sbjct  1    KANELTVLCDAKVSIIMVSSTGKLHEFISPSTSTKQMYDQYQKALGIDLWCSHYERMQEH  60

Query  355  LKKLRDVNRALRREIRQRMGEGLNDLSFEQLTELIEDVDNSIKLIRERKYKVIGNQIETH  534
            LKKL+DVN+ LR EIRQRMG+ LNDLS+E+L  L +D+++S+K+IR+RKYKV+ NQIET 
Sbjct  61   LKKLKDVNKNLRTEIRQRMGDCLNDLSYEELCGLEQDMESSVKIIRDRKYKVLNNQIETQ  120

Query  535  KKKVRNVEEIHRNLLLECEARQEDP-YGLVDHEGDYNSVLGFPNGGPRILALRLQPD  702
            KKK RNVEEIHRNLL +  +++EDP YGLVD+   YNS+LGF NGG  ILALRLQP+
Sbjct  121  KKKKRNVEEIHRNLLHQVNSKEEDPQYGLVDNGVHYNSILGFSNGGHGILALRLQPN  177



>gb|AGH39927.1| MADS domain protein [Isopyrum manshuricum]
Length=223

 Score =   261 bits (667),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 124/207 (60%), Positives = 167/207 (81%), Gaps = 6/207 (3%)
 Frame = +1

Query  85   MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMISTSGKLHEYISP  264
            M RGKI+IKRIEN TNRQVTYSKRR G+ KKA ELTVLCDA+VS+IM S++GKL E+ISP
Sbjct  1    MGRGKIEIKRIENTTNRQVTYSKRRTGIVKKARELTVLCDAEVSLIMFSSTGKLSEFISP  60

Query  265  STSTKQLFDQYQKTVGVDLWNSHFEKMQEQLKKLRDVNRALRREIRQRMGEGL-NDLSFE  441
            ST+TK+++DQYQ+  G+DLWNSH+EKMQE LKK ++ N  LR+EIRQR+GE L +D+SF+
Sbjct  61   STTTKKIYDQYQQLSGIDLWNSHYEKMQESLKKQKETNMKLRKEIRQRIGESLDDDMSFD  120

Query  442  QLTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDPYGLV  621
            +L  L +D+D S+KL+R+RKY +I  Q ET++KK+RN++E H +L+ E EAR EDPY   
Sbjct  121  ELRSLEQDLDESVKLVRDRKYHMIATQTETYRKKLRNLQETHTHLVREFEARGEDPY---  177

Query  622  DHEGDYNSVLGFPNGG-PRILALRLQP  699
             +EGDY ++LG  +GG   +++ R+QP
Sbjct  178  -YEGDYEALLGMSSGGAAHLVSYRVQP  203



>gb|ADU56836.1| MADS-box protein DEF subfamily [Coffea arabica]
 gb|AHW58039.1| TM6 [Coffea arabica]
Length=219

 Score =   261 bits (666),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 127/208 (61%), Positives = 163/208 (78%), Gaps = 3/208 (1%)
 Frame = +1

Query  85   MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMISTSGKLHEYISP  264
            M RGKI+I++IEN TNRQVTYSKRRNG+FKKAHEL+VLCDAKVS+IM+S + K HEY SP
Sbjct  1    MGRGKIEIRKIENSTNRQVTYSKRRNGIFKKAHELSVLCDAKVSLIMLSDTKKFHEYTSP  60

Query  265  STSTKQLFDQYQKTVGVDLWNSHFEKMQEQLKKLRDVNRALRREIRQRMGEGLNDLSFEQ  444
            S +TK++ D YQ  VGVDLW++H+EKMQE L++L++ N  LRR+IRQRMGE LNDL+++ 
Sbjct  61   SITTKKVMDDYQSAVGVDLWSTHYEKMQENLRRLKETNNKLRRDIRQRMGEDLNDLNWDN  120

Query  445  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQ-EDP-YGL  618
            +  L E + +S+ +IR RKY VI NQ +T+KKKVRN++E H NLL + EAR  EDP YG+
Sbjct  121  MCRLQEKIVDSLAIIRHRKYHVIKNQTDTYKKKVRNLKERHGNLLYDLEARSCEDPKYGI  180

Query  619  VDHEGDYNSVLGFPNGG-PRILALRLQP  699
            VD+  DYNS L   +GG   + ALRLQ 
Sbjct  181  VDNARDYNSALALADGGLSNLYALRLQS  208



>gb|AGA61783.1| apetala 3, partial [Cornus officinalis]
Length=194

 Score =   260 bits (664),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 124/174 (71%), Positives = 150/174 (86%), Gaps = 1/174 (1%)
 Frame = +1

Query  184  ELTVLCDAKVSIIMISTSGKLHEYISPSTSTKQLFDQYQKTVGVDLWNSHFEKMQEQLKK  363
            ELTVLCDAKVSIIM S++GKLHE+ISP T+TKQLFDQYQKT+G+DLWNSH+E+MQE LKK
Sbjct  1    ELTVLCDAKVSIIMFSSTGKLHEFISPCTTTKQLFDQYQKTLGIDLWNSHYERMQESLKK  60

Query  364  LRDVNRALRREIRQRMGEGLNDLSFEQLTELIEDVDNSIKLIRERKYKVIGNQIETHKKK  543
            L+D+NR  RREIRQR GE LNDLS+E L  L ED++ S+K+IR+RKYKVIGNQI+T+KKK
Sbjct  61   LKDINRNFRREIRQRTGESLNDLSYEDLLRLQEDMEISLKIIRDRKYKVIGNQIDTYKKK  120

Query  544  VRNVEEIHRNLLLECEARQEDP-YGLVDHEGDYNSVLGFPNGGPRILALRLQPD  702
            +R+  EIHRNLL E E ++EDP YGLVD+  DY+SVLGF  G P I+ALRLQP+
Sbjct  121  LRSAVEIHRNLLNEFEIKEEDPHYGLVDNGADYDSVLGFSGGDPHIIALRLQPN  174



>gb|ABP01802.1| MADS transcription factor AP3-3 [Aquilegia vulgaris]
Length=221

 Score =   260 bits (665),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 123/206 (60%), Positives = 165/206 (80%), Gaps = 5/206 (2%)
 Frame = +1

Query  85   MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMISTSGKLHEYISP  264
            M RGKI+IKRIEN TNRQVTYSKRR G+ KKA ELTVLCDA+VS+IM S++GKL E+ISP
Sbjct  1    MGRGKIEIKRIENTTNRQVTYSKRRTGIVKKARELTVLCDAEVSLIMFSSTGKLSEFISP  60

Query  265  STSTKQLFDQYQKTVGVDLWNSHFEKMQEQLKKLRDVNRALRREIRQRMGEGL-NDLSFE  441
            ST+TK+++DQYQ+  G++LWNSH+EKMQE LKK ++ N  LRREIRQR+GE L +D+SF+
Sbjct  61   STTTKKIYDQYQQVSGINLWNSHYEKMQESLKKQKETNMRLRREIRQRIGESLDDDMSFD  120

Query  442  QLTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDPYGLV  621
            +L  L +D+D S+KL+R+RKY +I  Q ET++KK+RN++E H +L+ E E R EDPY   
Sbjct  121  ELRSLEQDLDESVKLVRDRKYHMIATQTETYRKKLRNLQETHTHLVREFETRGEDPY---  177

Query  622  DHEGDYNSVLGFPNGGPRILALRLQP  699
             +EGDY S+LG  + G  +++ R+QP
Sbjct  178  -YEGDYESLLGMSSVGAHLVSYRVQP  202



>gb|ADC79696.1| APETALA3-like protein [Euptelea pleiosperma]
 gb|AEG25813.1| APETALA3-like protein [Euptelea pleiosperma]
Length=223

 Score =   260 bits (665),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 123/206 (60%), Positives = 165/206 (80%), Gaps = 2/206 (1%)
 Frame = +1

Query  85   MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMISTSGKLHEYISP  264
            M RGKI+IKRIEN TNRQVTYSKRR G+ KKA ELTVLCDA+VS+IM S +GKL E+ISP
Sbjct  1    MGRGKIEIKRIENSTNRQVTYSKRRAGIMKKAQELTVLCDAEVSLIMFSNTGKLFEFISP  60

Query  265  STSTKQLFDQYQKTVGVDLWNSHFEKMQEQLKKLRDVNRALRREIRQRMGEGLNDLSFEQ  444
            STSTK++FD+YQ   G++LWNSH+E+MQ+ L + +++N  LRREIRQR+GE LNDL+ ++
Sbjct  61   STSTKKIFDRYQHAQGINLWNSHYERMQDNLNRQKEINNKLRREIRQRIGEELNDLNIQE  120

Query  445  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLV  621
            L  L +++++S+K++R+RKY+VIG   +T++KKV+N+EE  +NLL + E   EDP Y LV
Sbjct  121  LRGLEQNLESSLKIVRDRKYQVIGTSTDTYRKKVKNLEETRKNLLRDFEMTDEDPHYALV  180

Query  622  DHEGDYNSVLGFPNGGPRILALRLQP  699
            DHEG Y+++ G  NGG  I A RLQP
Sbjct  181  DHEGQYDAI-GLANGGSHIFAFRLQP  205



>gb|ACY08907.1| MADS-domain transcription factor, partial [Primula denticulata]
Length=209

 Score =   260 bits (664),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 127/193 (66%), Positives = 163/193 (84%), Gaps = 3/193 (2%)
 Frame = +1

Query  133  RQVTYSKRRNGLFKKAHELTVLCDAKVSIIMISTSGKLHEYISPS-TSTKQLFDQYQKTV  309
            RQVTYSKRRNGLFKKA EL VLCDAKVSIIM+S + K+HE+ SP   +TKQLFDQYQ+T+
Sbjct  1    RQVTYSKRRNGLFKKAGELAVLCDAKVSIIMLSGTNKIHEFHSPDHVTTKQLFDQYQQTM  60

Query  310  GVDLWNSHFEKMQEQLKKLRDVNRALRREIRQRMGEGLNDLSFEQLTELIEDVDNSIKLI  489
            G+DLW+SH+EKMQE L+K +++N+ LR+EIRQRMG+ L++L   +L  L +D++ S++ I
Sbjct  61   GIDLWSSHYEKMQEDLRKRKEINKNLRQEIRQRMGDSLSELDLNKLQTLEQDMEKSLEAI  120

Query  490  RERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLVDHEGDYNSVLGFPN-  663
            R RKYKVIGNQIET +KKVRN EE+HR LLLE +AR+EDP YGLVD+ GDY+SV+G+ N 
Sbjct  121  RGRKYKVIGNQIETSRKKVRNGEEVHRTLLLEFDAREEDPHYGLVDNGGDYDSVIGYTNE  180

Query  664  GGPRILALRLQPD  702
            G PR+L+LRLQP+
Sbjct  181  GEPRMLSLRLQPN  193



>ref|XP_010271509.1| PREDICTED: floral homeotic protein DEFICIENS-like [Nelumbo nucifera]
Length=225

 Score =   259 bits (663),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 121/207 (58%), Positives = 164/207 (79%), Gaps = 1/207 (0%)
 Frame = +1

Query  85   MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMISTSGKLHEYISP  264
            M RGKI+IKRIEN TNRQVTYSKRR G+ KKA ELTVLCDA+VS+IM S++GK  EYIS 
Sbjct  1    MGRGKIEIKRIENSTNRQVTYSKRRGGIVKKARELTVLCDAEVSLIMFSSTGKFSEYISH  60

Query  265  STSTKQLFDQYQKTVGVDLWNSHFEKMQEQLKKLRDVNRALRREIRQRMGEGLNDLSFEQ  444
            +T+TK++FD+YQ+  G++LW+SH+E+MQE L K +++N  L+REIR+RMG  L+D+S E+
Sbjct  61   TTTTKKIFDRYQQVSGINLWSSHYERMQEHLNKQKEINNNLQREIRRRMGGDLDDMSIEE  120

Query  445  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLV  621
            L  L ++++NS+K++RERKY VI  Q +T+KKK+RN++E H NLL + E R EDP YGLV
Sbjct  121  LRGLEQNLENSLKVVRERKYHVISTQTDTYKKKIRNLQEAHTNLLRQFEERDEDPHYGLV  180

Query  622  DHEGDYNSVLGFPNGGPRILALRLQPD  702
            D++ DY S LG  N G  + + RLQP+
Sbjct  181  DNDADYESSLGLSNAGSHLFSFRLQPN  207



>ref|XP_010504236.1| PREDICTED: floral homeotic protein APETALA 3-like [Camelina sativa]
Length=232

 Score =   259 bits (663),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 128/203 (63%), Positives = 163/203 (80%), Gaps = 1/203 (0%)
 Frame = +1

Query  85   MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMISTSGKLHEYISP  264
            MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDA+VSIIM S+S KLHEYISP
Sbjct  1    MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDARVSIIMFSSSNKLHEYISP  60

Query  265  STSTKQLFDQYQKTVGVDLWNSHFEKMQEQLKKLRDVNRALRREIRQRMGEGLNDLSFEQ  444
            +T+TK++ D YQ    VD+W++ +E+MQE  +KL + NR LR +I+QR+GE L +L + +
Sbjct  61   NTTTKEIVDLYQSISDVDVWSTQYERMQETKRKLLETNRNLRTQIKQRLGECLEELDYHE  120

Query  445  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLV  621
            L  L ++++N+ KL+RERK K +GNQIET KKK ++ ++I +NL+ E E R EDP YGLV
Sbjct  121  LRRLEDEMENTFKLVRERKIKSLGNQIETTKKKNKSQQDIQKNLIHELELRAEDPHYGLV  180

Query  622  DHEGDYNSVLGFPNGGPRILALR  690
            D+EGDY+SVLG+   G R  ALR
Sbjct  181  DNEGDYDSVLGYQIEGSRAYALR  203



>gb|AGH39924.1| MADS domain protein [Enemion raddeanum]
Length=222

 Score =   259 bits (662),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 123/207 (59%), Positives = 167/207 (81%), Gaps = 6/207 (3%)
 Frame = +1

Query  85   MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMISTSGKLHEYISP  264
            M RGKI+IKRIEN TNRQVTYSKRR G+ KKA ELTVLCDA+VS+IM S++GKL E+ISP
Sbjct  1    MGRGKIEIKRIENTTNRQVTYSKRRTGIVKKARELTVLCDAEVSLIMFSSTGKLSEFISP  60

Query  265  STSTKQLFDQYQKTVGVDLWNSHFEKMQEQLKKLRDVNRALRREIRQRMGEGL-NDLSFE  441
            ST+TK+++DQYQ+  G++LWNSH+EKMQE LKK ++ N  LR+EIRQR+GE L +D+SF+
Sbjct  61   STTTKKIYDQYQQLSGINLWNSHYEKMQESLKKQKETNMKLRKEIRQRIGESLDDDMSFD  120

Query  442  QLTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDPYGLV  621
            +L  L +D+D S+KL+R+RKY +I  Q ET++KK+RN++E H +L+ E EAR EDPY   
Sbjct  121  ELRSLEQDLDESVKLVRDRKYHMIATQTETYRKKLRNLQETHTHLVCEFEARGEDPY---  177

Query  622  DHEGDYNSVLGFPNGG-PRILALRLQP  699
             +EGDY ++LG  +GG   +++ R+QP
Sbjct  178  -YEGDYEALLGMSSGGAAHLVSYRVQP  203



>ref|XP_011028630.1| PREDICTED: floral homeotic protein DEFICIENS-like [Populus euphratica]
Length=229

 Score =   259 bits (661),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 124/205 (60%), Positives = 158/205 (77%), Gaps = 1/205 (0%)
 Frame = +1

Query  85   MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMISTSGKLHEYISP  264
            M RGKI+IK+IEN TNRQVTYSKRRNG+FKKA ELTVLCDAKVS+IM S + K HEYISP
Sbjct  1    MGRGKIEIKKIENPTNRQVTYSKRRNGIFKKAQELTVLCDAKVSLIMFSNTNKFHEYISP  60

Query  265  STSTKQLFDQYQKTVGVDLWNSHFEKMQEQLKKLRDVNRALRREIRQRMGEGLNDLSFEQ  444
            ST+TK+++DQYQK +G+DLW++ +EKMQEQL+KL+D+N  L++EIRQR+GE LN+LS + 
Sbjct  61   STTTKKIYDQYQKALGIDLWSTQYEKMQEQLRKLKDINHKLKKEIRQRIGEDLNELSIDH  120

Query  445  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLV  621
            L  L  ++  ++  +R RKY VI  Q ET+KKKVR++EE H NL +E EA+ EDP +GLV
Sbjct  121  LRVLEHNMTEALNGVRGRKYHVIKTQTETYKKKVRSLEERHGNLWMEYEAKMEDPRFGLV  180

Query  622  DHEGDYNSVLGFPNGGPRILALRLQ  696
            D EG Y S     NG   + A RL 
Sbjct  181  DSEGGYESAAALVNGASNLYAFRLH  205



>ref|XP_009605879.1| PREDICTED: floral homeotic protein DEFICIENS-like [Nicotiana 
tomentosiformis]
Length=225

 Score =   258 bits (660),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 120/206 (58%), Positives = 163/206 (79%), Gaps = 1/206 (0%)
 Frame = +1

Query  85   MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMISTSGKLHEYISP  264
            M RGKI+IK+IEN TNRQVTYSKRRNG+ KKA ELTVLCDAK+S++M+S++ K HEY SP
Sbjct  1    MGRGKIEIKKIENSTNRQVTYSKRRNGIIKKAKELTVLCDAKISLLMLSSTRKFHEYTSP  60

Query  265  STSTKQLFDQYQKTVGVDLWNSHFEKMQEQLKKLRDVNRALRREIRQRMGEGLNDLSFEQ  444
            +T+ K++ DQYQ+T+GVD+W++H+EKMQE LK+L+++N  LRREIRQR GE ++ L+  +
Sbjct  61   NTTQKKMIDQYQRTLGVDIWSTHYEKMQENLKRLKEINNKLRREIRQRTGEDMSGLNLLE  120

Query  445  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLV  621
            L  L E++  S+  IRERKY VI  Q +T +KKV+N+EE H NL+L+ EA+ EDP YG+V
Sbjct  121  LCHLQENISESLAEIRERKYHVIKTQTDTFRKKVKNLEEQHGNLVLDLEAKSEDPKYGVV  180

Query  622  DHEGDYNSVLGFPNGGPRILALRLQP  699
            ++EG+YNS + F NG   + A RLQ 
Sbjct  181  ENEGEYNSAMAFANGAHNLYAFRLQS  206



>dbj|BAG68950.1| APETALA3 like protein [Hydrangea macrophylla]
Length=226

 Score =   258 bits (660),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 126/206 (61%), Positives = 161/206 (78%), Gaps = 1/206 (0%)
 Frame = +1

Query  85   MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMISTSGKLHEYISP  264
            M RG+I+IKRIEN TNRQVTYSKRRNG+ KKA ELTVLCDAKVS+IMIST+GK HEY SP
Sbjct  1    MGRGRIEIKRIENPTNRQVTYSKRRNGIIKKAQELTVLCDAKVSLIMISTTGKFHEYTSP  60

Query  265  STSTKQLFDQYQKTVGVDLWNSHFEKMQEQLKKLRDVNRALRREIRQRMGEGLNDLSFEQ  444
            ST+TKQ++DQYQKT+ +DLW++H+E+MQE L+KL++VN  LRREI QR+GE LNDL+  +
Sbjct  61   STTTKQIYDQYQKTLDIDLWSTHYERMQEHLRKLKEVNNKLRREISQRLGEDLNDLNLNE  120

Query  445  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQED-PYGLV  621
            L +L +    S  +IRERKY V+  Q ET +KKVRN+EE + NL L+ E + ED  YGLV
Sbjct  121  LRDLEQKSAASTAVIRERKYHVLKTQTETCRKKVRNLEERYGNLFLDWEGKCEDLQYGLV  180

Query  622  DHEGDYNSVLGFPNGGPRILALRLQP  699
            +++G+Y+S + F N  P   A  LQP
Sbjct  181  ENDGEYDSAVAFANRVPNSYAFGLQP  206



>gb|AGH39926.1| MADS domain protein [Isopyrum manshuricum]
Length=227

 Score =   258 bits (660),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 123/206 (60%), Positives = 159/206 (77%), Gaps = 1/206 (0%)
 Frame = +1

Query  85   MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMISTSGKLHEYISP  264
            M RGKI+IKRIEN TNRQVTYSKRR G+ KKA ELTVLCDA+VS++M+S++GK+HEYISP
Sbjct  1    MGRGKIEIKRIENSTNRQVTYSKRRAGIVKKAKELTVLCDAEVSLLMVSSTGKIHEYISP  60

Query  265  STSTKQLFDQYQKTVGVDLWNSHFEKMQEQLKKLRDVNRALRREIRQRMGEGLNDLSFEQ  444
            S + K L+D+YQ+  G+DLW  H+EKMQE L+KL+D+N  LR+EIRQR GE L+DLSF+Q
Sbjct  61   SCTHKNLYDRYQQASGIDLWQPHYEKMQEHLQKLKDINNKLRKEIRQRNGEDLDDLSFQQ  120

Query  445  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQED-PYGLV  621
            L  L ++++ S++ +R RK+ VI  Q +T KKKV+N EE H +LL E E R  D  +  +
Sbjct  121  LRGLEQNMEKSVECVRNRKFHVITTQTDTFKKKVKNHEETHNSLLREFEERDADFRFPSL  180

Query  622  DHEGDYNSVLGFPNGGPRILALRLQP  699
            D EGDY S +GF NG P+I A RLQP
Sbjct  181  DFEGDYQSTIGFANGNPQIFAFRLQP  206



>gb|AAM64919.1| floral homeotic protein APETALA3 (AP3) [Arabidopsis thaliana]
Length=232

 Score =   258 bits (660),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 128/207 (62%), Positives = 163/207 (79%), Gaps = 1/207 (0%)
 Frame = +1

Query  85   MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMISTSGKLHEYISP  264
            MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDA+VSIIM S+S KLHEYISP
Sbjct  1    MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDARVSIIMFSSSNKLHEYISP  60

Query  265  STSTKQLFDQYQKTVGVDLWNSHFEKMQEQLKKLRDVNRALRREIRQRMGEGLNDLSFEQ  444
            +T+TK++ D YQ    VD+W + +E+MQE  +KL + NR LR +I+QR+GE LN L  ++
Sbjct  61   NTTTKEIVDLYQTISDVDVWATQYERMQETKRKLLETNRNLRTQIKQRLGECLNKLDIQE  120

Query  445  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLV  621
            L  L ++++N+ KL+RERK+K +GNQIET KKK ++ ++I +NL+ E E R EDP YGLV
Sbjct  121  LRRLEDEMENTFKLVRERKFKSLGNQIETTKKKNKSQQDIQKNLIHELELRAEDPHYGLV  180

Query  622  DHEGDYNSVLGFPNGGPRILALRLQPD  702
            D+ GDY+SVLG+   G R  ALR   +
Sbjct  181  DNGGDYDSVLGYQIEGSRAYALRFHQN  207



>ref|XP_002533305.1| Floral homeotic protein DEFICIENS, putative [Ricinus communis]
 gb|EEF29082.1| Floral homeotic protein DEFICIENS, putative [Ricinus communis]
Length=235

 Score =   258 bits (660),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 128/206 (62%), Positives = 157/206 (76%), Gaps = 2/206 (1%)
 Frame = +1

Query  85   MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMISTSG-KLHEYIS  261
            M RGKI+IK+IEN TNRQVTYSKRRNG+FKKA ELTVLCDAKVS+IM S SG K HE+IS
Sbjct  1    MGRGKIEIKKIENPTNRQVTYSKRRNGIFKKAQELTVLCDAKVSLIMFSNSGRKFHEFIS  60

Query  262  PSTSTKQLFDQYQKTVGVDLWNSHFEKMQEQLKKLRDVNRALRREIRQRMGEGLNDLSFE  441
            P T+TK++FDQYQKT+G+DLW +H+E+MQ+ LKKL D+N  LRR+IRQRMGE LNDLSF+
Sbjct  61   PGTTTKKIFDQYQKTLGIDLWITHYERMQDHLKKLNDINNKLRRDIRQRMGEDLNDLSFD  120

Query  442  QLTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGL  618
            +L  L + +  ++ +IRERKY  I  Q  T +KK RN+ E HR LL   EA  EDP YGL
Sbjct  121  ELRGLEQRMAPALHMIRERKYHFIETQTNTKRKKERNLVERHRELLQRYEANCEDPQYGL  180

Query  619  VDHEGDYNSVLGFPNGGPRILALRLQ  696
            VD+EGDY S +   NG   + + RL 
Sbjct  181  VDYEGDYESAIALANGASNLYSFRLH  206



>ref|XP_004232453.1| PREDICTED: floral homeotic protein DEFICIENS isoform X2 [Solanum 
lycopersicum]
Length=225

 Score =   258 bits (658),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 123/206 (60%), Positives = 163/206 (79%), Gaps = 1/206 (0%)
 Frame = +1

Query  85   MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMISTSGKLHEYISP  264
            M RGKI+IK+IEN TNRQVTYSKRRNG+FKKA ELTVLCDAK+S+IM+S++ K HEY SP
Sbjct  1    MGRGKIEIKKIENSTNRQVTYSKRRNGIFKKAKELTVLCDAKISLIMLSSTRKYHEYTSP  60

Query  265  STSTKQLFDQYQKTVGVDLWNSHFEKMQEQLKKLRDVNRALRREIRQRMGEGLNDLSFEQ  444
            +T+TK++ DQYQ  +GVD+W+ H+EKMQE LK+L+++N  LRREIRQR GE ++ L+ ++
Sbjct  61   NTTTKKMIDQYQSALGVDIWSIHYEKMQENLKRLKEINNKLRREIRQRTGEDMSGLNLQE  120

Query  445  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLV  621
            L  L E++  S+  IRERKY VI NQ +T KKK RN+EE + NL+L+ EA+ EDP YG+V
Sbjct  121  LCHLQENITESVAEIRERKYHVIKNQTDTCKKKARNLEEQNGNLVLDLEAKCEDPKYGVV  180

Query  622  DHEGDYNSVLGFPNGGPRILALRLQP  699
            ++EG Y+S + F NG   + A RLQP
Sbjct  181  ENEGHYHSAVAFANGVHNLYAFRLQP  206



>ref|XP_008241774.1| PREDICTED: floral homeotic protein DEFICIENS-like isoform X2 
[Prunus mume]
Length=235

 Score =   258 bits (659),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 121/207 (58%), Positives = 160/207 (77%), Gaps = 1/207 (0%)
 Frame = +1

Query  85   MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMISTSGKLHEYISP  264
            M RGKI+IK IEN TNRQVTYSKRRNG+FKKA ELTVLCDAKVS+IM+S +GK+HEYISP
Sbjct  1    MGRGKIEIKLIENHTNRQVTYSKRRNGIFKKAQELTVLCDAKVSLIMLSNTGKMHEYISP  60

Query  265  STSTKQLFDQYQKTVGVDLWNSHFEKMQEQLKKLRDVNRALRREIRQRMGEGLNDLSFEQ  444
            +T+TK+++D YQKT+GVDLW+SH++ M++ L KL+++N  LRREIRQR+G  LN L++EQ
Sbjct  61   TTTTKRMYDDYQKTLGVDLWSSHYQAMKDTLWKLKEINNKLRREIRQRLGHDLNGLTYEQ  120

Query  445  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLV  621
            L  L + + +S++ IRERKY V+  Q+ET+KKKV+N++E   N+L   E   EDP YG V
Sbjct  121  LHSLEDKMASSLEAIRERKYHVLKTQMETYKKKVKNLQERRGNMLHGYEVASEDPQYGYV  180

Query  622  DHEGDYNSVLGFPNGGPRILALRLQPD  702
            D+EGDY S +   NG   +  + L  D
Sbjct  181  DNEGDYESAVALANGASNLFTIHLHQD  207



>ref|XP_002877970.1| APETALA3 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH54229.1| APETALA3 [Arabidopsis lyrata subsp. lyrata]
Length=232

 Score =   258 bits (659),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 128/205 (62%), Positives = 162/205 (79%), Gaps = 1/205 (0%)
 Frame = +1

Query  85   MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMISTSGKLHEYISP  264
            MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDA+VSIIM S+S KLHEYISP
Sbjct  1    MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDARVSIIMFSSSNKLHEYISP  60

Query  265  STSTKQLFDQYQKTVGVDLWNSHFEKMQEQLKKLRDVNRALRREIRQRMGEGLNDLSFEQ  444
            +T+TK++ D YQ    VD+W + +E+MQE  +KL + NR LR +I+QR+GE L++L  ++
Sbjct  61   NTTTKEIVDLYQTVSDVDVWATQYERMQETKRKLLETNRNLRTQIKQRLGECLDELDIQE  120

Query  445  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLV  621
            L  L +++DN+ KL+RERK K +GNQIET KKK ++ ++I +NL+ E E R EDP YGLV
Sbjct  121  LRRLEDEMDNTFKLVRERKIKSLGNQIETTKKKNKSQQDIQKNLIHELELRAEDPHYGLV  180

Query  622  DHEGDYNSVLGFPNGGPRILALRLQ  696
            D+ GDY+SVLG+   G R  ALR  
Sbjct  181  DNGGDYDSVLGYQIEGSRAYALRFH  205



>gb|AAD51901.1| floral homeotic protein AP3 [Arabidopsis thaliana]
Length=232

 Score =   258 bits (658),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 127/207 (61%), Positives = 164/207 (79%), Gaps = 1/207 (0%)
 Frame = +1

Query  85   MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMISTSGKLHEYISP  264
            MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDA+VSIIM S+S KLHEYISP
Sbjct  1    MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDARVSIIMFSSSNKLHEYISP  60

Query  265  STSTKQLFDQYQKTVGVDLWNSHFEKMQEQLKKLRDVNRALRREIRQRMGEGLNDLSFEQ  444
            +T+TK++ D YQ    VD+W + +E+MQE  +KL + NR LR +I+QR+GE L++L  ++
Sbjct  61   NTTTKEIVDLYQTISDVDVWATQYERMQETKRKLLETNRNLRTQIKQRVGECLDELDIQE  120

Query  445  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLV  621
            L  L ++++N+ KL+RERK+K +GNQIET KKK ++ ++I +NL+ E E R EDP YGLV
Sbjct  121  LRRLEDEMENTFKLVRERKFKSLGNQIETTKKKSKSQQDIQKNLIHELELRAEDPHYGLV  180

Query  622  DHEGDYNSVLGFPNGGPRILALRLQPD  702
            D+ GDY+SVLG+   G R  ALR   +
Sbjct  181  DNGGDYDSVLGYQIEGSRAYALRFHQN  207



>gb|EPS57782.1| hypothetical protein M569_17035, partial [Genlisea aurea]
Length=155

 Score =   255 bits (651),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 121/155 (78%), Positives = 143/155 (92%), Gaps = 0/155 (0%)
 Frame = +1

Query  85   MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMISTSGKLHEYISP  264
            MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMIS++ KLHEYISP
Sbjct  1    MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMISSTQKLHEYISP  60

Query  265  STSTKQLFDQYQKTVGVDLWNSHFEKMQEQLKKLRDVNRALRREIRQRMGEGLNDLSFEQ  444
            ST+TKQ+FD YQKT+GVDLWN+H+E++Q+ LKKL++ NR LR+EIRQRMGE LN+L +E+
Sbjct  61   STTTKQVFDLYQKTLGVDLWNTHYERLQDHLKKLKEGNRNLRKEIRQRMGECLNELGYEE  120

Query  445  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVR  549
            +  LIE++D S+KLIRERKYKV+ NQI+T KKKVR
Sbjct  121  VVNLIENIDASLKLIRERKYKVLANQIDTSKKKVR  155



>ref|XP_010263856.1| PREDICTED: floral homeotic protein DEFICIENS-like [Nelumbo nucifera]
Length=225

 Score =   258 bits (658),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 122/207 (59%), Positives = 163/207 (79%), Gaps = 1/207 (0%)
 Frame = +1

Query  85   MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMISTSGKLHEYISP  264
            M RGKI+IKRIEN TNRQVTYSKRR G+FKKA ELTVLCDA+VS+IM S++GKL EY+S 
Sbjct  1    MGRGKIEIKRIENSTNRQVTYSKRRGGIFKKAAELTVLCDAEVSLIMFSSTGKLSEYVSH  60

Query  265  STSTKQLFDQYQKTVGVDLWNSHFEKMQEQLKKLRDVNRALRREIRQRMGEGLNDLSFEQ  444
            + +TK++FD+YQ+  G++LWNSH+E+MQE L K ++VN  LRREIRQRMGE L+DLS ++
Sbjct  61   TATTKKIFDRYQQVSGINLWNSHYERMQEHLSKQKEVNNNLRREIRQRMGEDLDDLSVDE  120

Query  445  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLV  621
            L  L ++++NS+K++RERKY VI  Q +T KKK+RN+++ + +LL + E R E P +G V
Sbjct  121  LRGLEQNMENSLKVVRERKYHVISTQTDTCKKKIRNLQDTNASLLRQLEERDEIPHFGFV  180

Query  622  DHEGDYNSVLGFPNGGPRILALRLQPD  702
            D+ GDY S LG  N G  + A RLQP+
Sbjct  181  DNGGDYESALGLANNGSHLFAFRLQPN  207



>ref|NP_191002.1| Floral homeotic protein APETALA 3 [Arabidopsis thaliana]
 sp|P35632.1|AP3_ARATH RecName: Full=Floral homeotic protein APETALA 3 [Arabidopsis 
thaliana]
 gb|AAA32740.1| APETELA3 [Arabidopsis thaliana]
 gb|AAD51888.1| floral homeotic protein AP3 [Arabidopsis thaliana]
 gb|AAD51889.1| floral homeotic protein AP3 [Arabidopsis thaliana]
 gb|AAD51891.1| floral homeotic protein AP3 [Arabidopsis thaliana]
 gb|AAD51893.1| floral homeotic protein AP3 [Arabidopsis thaliana]
 gb|AAD51900.1| floral homeotic protein AP3 [Arabidopsis thaliana]
 gb|AAD51903.1| floral homeotic protein AP3 [Arabidopsis thaliana]
 emb|CAB81799.1| floral homeotic protein APETALA3 (AP3) [Arabidopsis thaliana]
 gb|AAL49893.1| putative floral homeotic protein APETALA3 (AP3) [Arabidopsis 
thaliana]
 gb|AAN13159.1| putative floral homeotic protein APETALA3 (AP3) [Arabidopsis 
thaliana]
 gb|AEE79216.1| Floral homeotic protein APETALA 3 [Arabidopsis thaliana]
Length=232

 Score =   257 bits (657),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 127/207 (61%), Positives = 164/207 (79%), Gaps = 1/207 (0%)
 Frame = +1

Query  85   MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMISTSGKLHEYISP  264
            MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDA+VSIIM S+S KLHEYISP
Sbjct  1    MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDARVSIIMFSSSNKLHEYISP  60

Query  265  STSTKQLFDQYQKTVGVDLWNSHFEKMQEQLKKLRDVNRALRREIRQRMGEGLNDLSFEQ  444
            +T+TK++ D YQ    VD+W + +E+MQE  +KL + NR LR +I+QR+GE L++L  ++
Sbjct  61   NTTTKEIVDLYQTISDVDVWATQYERMQETKRKLLETNRNLRTQIKQRLGECLDELDIQE  120

Query  445  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLV  621
            L  L ++++N+ KL+RERK+K +GNQIET KKK ++ ++I +NL+ E E R EDP YGLV
Sbjct  121  LRRLEDEMENTFKLVRERKFKSLGNQIETTKKKNKSQQDIQKNLIHELELRAEDPHYGLV  180

Query  622  DHEGDYNSVLGFPNGGPRILALRLQPD  702
            D+ GDY+SVLG+   G R  ALR   +
Sbjct  181  DNGGDYDSVLGYQIEGSRAYALRFHQN  207



>gb|AAD51895.1| floral homeotic protein AP3 [Arabidopsis thaliana]
Length=232

 Score =   257 bits (657),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 127/205 (62%), Positives = 162/205 (79%), Gaps = 1/205 (0%)
 Frame = +1

Query  85   MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMISTSGKLHEYISP  264
            MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDA+VSIIM S+S KLHEYISP
Sbjct  1    MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDARVSIIMFSSSNKLHEYISP  60

Query  265  STSTKQLFDQYQKTVGVDLWNSHFEKMQEQLKKLRDVNRALRREIRQRMGEGLNDLSFEQ  444
             T+TK++ D YQ    VD+W + +E+MQE  +KL + NR LR +I+QR+GE L++L  ++
Sbjct  61   DTTTKEIVDLYQTISDVDVWATQYERMQETKRKLLETNRNLRTQIKQRLGECLDELDIQE  120

Query  445  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLV  621
            L  L ++++N+ KL+RERK+K +GNQIET KKK ++ ++I +NL+ E E R EDP YGLV
Sbjct  121  LRRLEDEMENTFKLVRERKFKSLGNQIETTKKKNKSQQDIQKNLIHELELRAEDPHYGLV  180

Query  622  DHEGDYNSVLGFPNGGPRILALRLQ  696
            D+ GDY+SVLG+   G R  ALR  
Sbjct  181  DNGGDYDSVLGYQIEGSRAYALRFH  205



>dbj|BAC79180.1| MADS-box protein [Rosa rugosa]
Length=229

 Score =   257 bits (656),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 127/209 (61%), Positives = 170/209 (81%), Gaps = 5/209 (2%)
 Frame = +1

Query  85   MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMISTSGKLHEYISP  264
            MARGKIQIKRIEN TNRQVTYSKRRNGLFKKA+ELTVLCDAKVS++M+S+SGKLHE+ISP
Sbjct  1    MARGKIQIKRIENVTNRQVTYSKRRNGLFKKANELTVLCDAKVSLLMVSSSGKLHEFISP  60

Query  265  STSTKQLFDQYQKTVGVDLWNSHFEKMQEQLKKLRDVNRALRREIRQRMGEGLNDLSFEQ  444
            ST+TKQ++D+YQK +G+DLW SH+E MQE LKKL+++N++LRR+I  R+GE LNDL F +
Sbjct  61   STTTKQVYDEYQKLLGIDLWKSHYETMQENLKKLKEINKSLRRQISHRVGECLNDLRFAE  120

Query  445  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDPYGLVD  624
            L  L ++++++++++R RK K+I NQI+T +KK+RN  E +R  L E +A +E  YGLVD
Sbjct  121  LHSLEKEMESAVEVVRNRKLKLISNQIDTKRKKIRNATECNRR-LYEYDAMEEPHYGLVD  179

Query  625  HEGDY--NSVLGF-PNGGPR-ILALRLQP  699
              GDY  ++V+G+  N  P  +  LRLQP
Sbjct  180  DGGDYYDSAVIGYSANEDPHNVFPLRLQP  208



>ref|XP_006292594.1| hypothetical protein CARUB_v10018833mg [Capsella rubella]
 gb|EOA25492.1| hypothetical protein CARUB_v10018833mg [Capsella rubella]
Length=232

 Score =   257 bits (656),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 127/207 (61%), Positives = 163/207 (79%), Gaps = 1/207 (0%)
 Frame = +1

Query  85   MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMISTSGKLHEYISP  264
            MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDA+VSIIM S+S KLHEYISP
Sbjct  1    MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDARVSIIMFSSSNKLHEYISP  60

Query  265  STSTKQLFDQYQKTVGVDLWNSHFEKMQEQLKKLRDVNRALRREIRQRMGEGLNDLSFEQ  444
            +T+TK++ D YQ    VD+W++ +E+MQE  +KL + NR LR +I+QR+GE L +L + +
Sbjct  61   NTTTKEIVDLYQSISDVDVWSTQYERMQETKRKLLETNRNLRTQIKQRLGECLEELDYHE  120

Query  445  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLV  621
            L  L ++++N+ KL+RERK K +GNQIET KKK ++ ++I +NL+ E E R EDP YGLV
Sbjct  121  LRRLEDEMENTFKLVRERKIKSLGNQIETTKKKNKSQQDIQKNLIHELELRAEDPHYGLV  180

Query  622  DHEGDYNSVLGFPNGGPRILALRLQPD  702
            D+ GDY+SVLG+   G R  ALR   +
Sbjct  181  DNGGDYDSVLGYQIEGSRAYALRFHQN  207



>ref|XP_010515958.1| PREDICTED: floral homeotic protein APETALA 3 [Camelina sativa]
Length=232

 Score =   256 bits (655),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 127/203 (63%), Positives = 162/203 (80%), Gaps = 1/203 (0%)
 Frame = +1

Query  85   MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMISTSGKLHEYISP  264
            MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDA+VSIIM S+S KLHEYISP
Sbjct  1    MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDARVSIIMFSSSNKLHEYISP  60

Query  265  STSTKQLFDQYQKTVGVDLWNSHFEKMQEQLKKLRDVNRALRREIRQRMGEGLNDLSFEQ  444
            +T+TK++ D YQ    VD+W++ +E+MQE  +KL + NR LR +I+QR+GE L +L + +
Sbjct  61   NTTTKEIVDLYQSISDVDVWSTQYERMQETKRKLLETNRNLRTQIKQRLGECLEELDYHE  120

Query  445  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLV  621
            L  L ++++N+ KL+RERK K +GNQIET KKK ++ ++I +NL+ E E R EDP YGLV
Sbjct  121  LRRLEDEMENTFKLVRERKIKSLGNQIETTKKKNKSQQDIQKNLIHELELRAEDPHYGLV  180

Query  622  DHEGDYNSVLGFPNGGPRILALR  690
            D+ GDY+SVLG+   G R  ALR
Sbjct  181  DNGGDYDSVLGYQIEGSRAYALR  203



>gb|AAD51887.1| floral homeotic protein AP3 [Arabidopsis thaliana]
 gb|AAD51892.1| floral homeotic protein AP3 [Arabidopsis thaliana]
Length=232

 Score =   256 bits (655),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 127/207 (61%), Positives = 163/207 (79%), Gaps = 1/207 (0%)
 Frame = +1

Query  85   MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMISTSGKLHEYISP  264
            MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDA+VSIIM S+S KLHEYISP
Sbjct  1    MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDARVSIIMFSSSNKLHEYISP  60

Query  265  STSTKQLFDQYQKTVGVDLWNSHFEKMQEQLKKLRDVNRALRREIRQRMGEGLNDLSFEQ  444
            +T+TK++ D YQ    VD+W + +E+MQE  +KL + NR LR +I+QR+GE L+ L  ++
Sbjct  61   NTTTKEIVDLYQTISDVDVWATQYERMQETKRKLLETNRNLRTQIKQRLGECLDKLDIQE  120

Query  445  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLV  621
            L  L ++++N+ KL+RERK+K +GNQIET KKK ++ ++I +NL+ E E R EDP YGLV
Sbjct  121  LRRLEDEMENTFKLVRERKFKSLGNQIETTKKKNKSQQDIQKNLIHELELRAEDPHYGLV  180

Query  622  DHEGDYNSVLGFPNGGPRILALRLQPD  702
            D+ GDY+SVLG+   G R  ALR   +
Sbjct  181  DNGGDYDSVLGYQIEGSRAYALRFHQN  207



>gb|KFK34668.1| hypothetical protein AALP_AA5G175900 [Arabis alpina]
Length=232

 Score =   256 bits (655),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 127/203 (63%), Positives = 163/203 (80%), Gaps = 1/203 (0%)
 Frame = +1

Query  85   MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMISTSGKLHEYISP  264
            MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDA+VSIIM S+S KLHEYISP
Sbjct  1    MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDARVSIIMFSSSNKLHEYISP  60

Query  265  STSTKQLFDQYQKTVGVDLWNSHFEKMQEQLKKLRDVNRALRREIRQRMGEGLNDLSFEQ  444
            +T+TK++ D YQ    VD+W++ +E+MQE  +KL + NR LR +I+QR+GE L++L  E+
Sbjct  61   NTTTKEIVDLYQTVSDVDVWSTQYERMQETKRKLLETNRNLRTQIKQRLGECLDELDIEE  120

Query  445  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLV  621
            L  L ++++N+ KL+RERK K +GNQIET KKK ++ ++I +NL+ E E R EDP YGLV
Sbjct  121  LRRLEDEMENTFKLVRERKIKSLGNQIETTKKKNKSQQDIQKNLIHELELRAEDPHYGLV  180

Query  622  DHEGDYNSVLGFPNGGPRILALR  690
            D+ GDY++VLG+   G R  ALR
Sbjct  181  DNGGDYDAVLGYQIEGSRAYALR  203



>gb|AGS42080.1| AP3.b [Brassica oleracea var. viridis]
Length=224

 Score =   256 bits (654),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 123/192 (64%), Positives = 159/192 (83%), Gaps = 1/192 (1%)
 Frame = +1

Query  85   MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMISTSGKLHEYISP  264
            MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDA+VSIIM S+S KLHE+ISP
Sbjct  1    MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDARVSIIMFSSSNKLHEFISP  60

Query  265  STSTKQLFDQYQKTVGVDLWNSHFEKMQEQLKKLRDVNRALRREIRQRMGEGLNDLSFEQ  444
            +T+TK++ D YQ    VD+WN+H+E+MQE  +KL + NR LR +I+QR+GE L++   ++
Sbjct  61   NTTTKEILDLYQTVSDVDVWNAHYERMQETKRKLLETNRNLRTQIKQRLGECLDEFDMQE  120

Query  445  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLV  621
            L  L E+++N+ KL+RERK+K +GNQIET KKK ++ ++I +NL+ E E R EDP YGLV
Sbjct  121  LRSLEEEMENTFKLVRERKFKSLGNQIETTKKKNKSQQDIQKNLIHELELRAEDPHYGLV  180

Query  622  DHEGDYNSVLGF  657
            D+ GDY+SVLG+
Sbjct  181  DNGGDYDSVLGY  192



>ref|XP_010427128.1| PREDICTED: floral homeotic protein APETALA 3-like [Camelina sativa]
Length=232

 Score =   256 bits (654),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 127/203 (63%), Positives = 162/203 (80%), Gaps = 1/203 (0%)
 Frame = +1

Query  85   MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMISTSGKLHEYISP  264
            MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDA+VSIIM S+S KLHEYISP
Sbjct  1    MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDARVSIIMFSSSNKLHEYISP  60

Query  265  STSTKQLFDQYQKTVGVDLWNSHFEKMQEQLKKLRDVNRALRREIRQRMGEGLNDLSFEQ  444
            +T+TK++ D YQ    VD+W++ +E+MQE  +KL + NR LR +I+QR+GE L +L + +
Sbjct  61   NTTTKEIVDLYQSISEVDVWSTQYERMQETKRKLLETNRNLRTQIKQRLGECLEELDYHE  120

Query  445  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLV  621
            L  L ++++N+ KL+RERK K +GNQIET KKK ++ ++I +NL+ E E R EDP YGLV
Sbjct  121  LRRLEDEMENTFKLVRERKIKSLGNQIETTKKKNKSQQDIQKNLIHELELRAEDPHYGLV  180

Query  622  DHEGDYNSVLGFPNGGPRILALR  690
            D+ GDY+SVLG+   G R  ALR
Sbjct  181  DNGGDYDSVLGYQIEGSRAYALR  203



>gb|ADD14338.1| APETALA3 [Spinacia oleracea]
Length=214

 Score =   256 bits (653),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 127/207 (61%), Positives = 170/207 (82%), Gaps = 4/207 (2%)
 Frame = +1

Query  85   MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMISTSGKLHEYISP  264
            MARGKIQIK+IEN TNRQVTYSKRRNGLFKKA+EL+VLCDA VSI+MIS S KLHE+++P
Sbjct  1    MARGKIQIKKIENNTNRQVTYSKRRNGLFKKANELSVLCDATVSIVMISNSNKLHEFLTP  60

Query  265  -STSTKQLFDQYQKTVGVDLWNSHFEKMQEQLKKLRDVNRALRREIRQRMGEGLNDLSFE  441
             +T+TK+++D+YQ  +GVDLW   ++KMQE+L+KL D+NR L+++IR+RMG+ L DL++ 
Sbjct  61   GTTTTKEVYDKYQAAMGVDLWAKQYQKMQEELQKLNDINRGLQKDIRRRMGDCLEDLTYH  120

Query  442  QLTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGL  618
            +L+ L E++ NS+K+IRERK K I N I+T KKKVRN  E+H++LL   +  +++P YGL
Sbjct  121  ELSSLKEEMVNSVKVIRERKAKKIENHIDTTKKKVRNCNEVHKSLLQAFDIPKDEPQYGL  180

Query  619  VDHEGDYNSVLGFPNGGPRILALRLQP  699
            VD+ G+YN VLG+ N   RILALRLQP
Sbjct  181  VDN-GEYNHVLGY-NDDSRILALRLQP  205



>gb|AAD51897.1| floral homeotic protein AP3 [Arabidopsis thaliana]
Length=232

 Score =   256 bits (654),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 126/207 (61%), Positives = 164/207 (79%), Gaps = 1/207 (0%)
 Frame = +1

Query  85   MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMISTSGKLHEYISP  264
            MARGKIQIKRIENQTNRQVTYSKRRNGLFK+AHELTVLCDA+VSIIM S+S KLHEYISP
Sbjct  1    MARGKIQIKRIENQTNRQVTYSKRRNGLFKRAHELTVLCDARVSIIMFSSSNKLHEYISP  60

Query  265  STSTKQLFDQYQKTVGVDLWNSHFEKMQEQLKKLRDVNRALRREIRQRMGEGLNDLSFEQ  444
            +T+TK++ D YQ    VD+W + +E+MQE  +KL + NR LR +I+QR+GE L++L  ++
Sbjct  61   NTTTKEIVDLYQTISDVDVWATQYERMQETKRKLLETNRNLRTQIKQRLGECLDELDIQE  120

Query  445  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLV  621
            L  L ++++N+ KL+RERK+K +GNQIET KKK ++ ++I +NL+ E E R EDP YGLV
Sbjct  121  LRRLEDEMENTFKLVRERKFKSLGNQIETTKKKNKSQQDIQKNLIHELELRAEDPHYGLV  180

Query  622  DHEGDYNSVLGFPNGGPRILALRLQPD  702
            D+ GDY+SVLG+   G R  ALR   +
Sbjct  181  DNGGDYDSVLGYQIEGSRAYALRFHQN  207



>dbj|BAA04665.1| APETALA3 [Arabidopsis thaliana]
Length=232

 Score =   256 bits (654),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 127/207 (61%), Positives = 164/207 (79%), Gaps = 1/207 (0%)
 Frame = +1

Query  85   MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMISTSGKLHEYISP  264
            MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDA+VSIIM S+S KLHEYISP
Sbjct  1    MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDARVSIIMFSSSNKLHEYISP  60

Query  265  STSTKQLFDQYQKTVGVDLWNSHFEKMQEQLKKLRDVNRALRREIRQRMGEGLNDLSFEQ  444
            +T+TK++ D YQ    VD+W + +E+MQE  +KL + NR LR +I+QR+GE L++L  ++
Sbjct  61   NTTTKEIVDLYQTISDVDVWATQYERMQETKRKLLETNRNLRTQIKQRLGECLDELDIQE  120

Query  445  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLV  621
            L  L ++++N+ KL+RERK+K +GNQIET KKK ++ ++I +NL+ E E R EDP YGLV
Sbjct  121  LRRLEDEMENTFKLVRERKFKSLGNQIETTKKKNKSQQDIQKNLIHELELRAEDPHYGLV  180

Query  622  DHEGDYNSVLGFPNGGPRILALRLQPD  702
            D+ GDY+SVLG+   G R  ALR   +
Sbjct  181  DNGGDYDSVLGYQIEGSRRYALRFHQN  207



>gb|AGH39931.1| MADS domain protein [Nigella damascena]
Length=221

 Score =   256 bits (653),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 121/206 (59%), Positives = 163/206 (79%), Gaps = 5/206 (2%)
 Frame = +1

Query  85   MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMISTSGKLHEYISP  264
            M RGKI+IKRIEN TNRQVTYSKRR G+ KKA ELTVLCDA+VS+IM S++GKL EYISP
Sbjct  1    MGRGKIEIKRIENTTNRQVTYSKRRTGIVKKARELTVLCDAEVSLIMFSSTGKLSEYISP  60

Query  265  STSTKQLFDQYQKTVGVDLWNSHFEKMQEQLKKLRDVNRALRREIRQRMGEGLNDLSFEQ  444
            ST+TK+ FDQYQ+   ++LW+SH+EKMQE L+K +++N  LR+EIRQR+GE ++DL+FE+
Sbjct  61   STTTKKFFDQYQQVTAINLWDSHYEKMQENLRKQKEINMKLRKEIRQRIGESVDDLTFEE  120

Query  445  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDPYGLVD  624
            L  L +D+D S+K++R+RKY +I  Q ET++KK+RN++E H +L+ E EAR EDPY    
Sbjct  121  LRGLEQDLDGSLKVVRDRKYHMIATQTETYRKKLRNLQETHTHLVREFEARGEDPY----  176

Query  625  HEGDYNSVLGFPNGGPRILAL-RLQP  699
            ++ DY S+LG  +G   +L   RLQP
Sbjct  177  YDADYESLLGMSSGAGHLLPYHRLQP  202



>gb|AAD51902.1| floral homeotic protein AP3 [Arabidopsis thaliana]
Length=232

 Score =   256 bits (654),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 127/207 (61%), Positives = 163/207 (79%), Gaps = 1/207 (0%)
 Frame = +1

Query  85   MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMISTSGKLHEYISP  264
            MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDA+VSIIM S+S KLHEYISP
Sbjct  1    MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDARVSIIMFSSSNKLHEYISP  60

Query  265  STSTKQLFDQYQKTVGVDLWNSHFEKMQEQLKKLRDVNRALRREIRQRMGEGLNDLSFEQ  444
            +T+TK++ D YQ    VD+W + +E+MQE  +KL + NR LR +I+QR+GE L++L  ++
Sbjct  61   NTTTKEIVDLYQTISDVDVWATQYERMQETKRKLLETNRNLRTQIKQRLGECLDELDIQE  120

Query  445  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLV  621
            L  L ++ +N+ KL+RERK+K +GNQIET KKK ++ ++I +NL+ E E R EDP YGLV
Sbjct  121  LRRLEDEKENTFKLVRERKFKSLGNQIETTKKKNKSQQDIQKNLIHELELRAEDPHYGLV  180

Query  622  DHEGDYNSVLGFPNGGPRILALRLQPD  702
            D+ GDY+SVLG+   G R  ALR   +
Sbjct  181  DNGGDYDSVLGYQIEGSRAYALRFHQN  207



>gb|AAD51899.1| floral homeotic protein AP3 [Arabidopsis thaliana]
Length=232

 Score =   256 bits (653),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 126/207 (61%), Positives = 164/207 (79%), Gaps = 1/207 (0%)
 Frame = +1

Query  85   MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMISTSGKLHEYISP  264
            MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDA+VSIIM S+S KLHEYISP
Sbjct  1    MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDARVSIIMFSSSNKLHEYISP  60

Query  265  STSTKQLFDQYQKTVGVDLWNSHFEKMQEQLKKLRDVNRALRREIRQRMGEGLNDLSFEQ  444
            +T+TK++ D YQ    VD+W + +E+MQE  +KL + NR LR +I+QR+GE L++L  ++
Sbjct  61   NTTTKEIVDLYQTISDVDVWATQYERMQETKRKLLETNRNLRTQIKQRLGECLDELDIQE  120

Query  445  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLV  621
            L  L ++++N+ KL+RERK+K +G+QIET KKK ++ ++I +NL+ E E R EDP YGLV
Sbjct  121  LRRLEDEMENTFKLVRERKFKSLGSQIETTKKKNKSQQDIQKNLIHELELRAEDPHYGLV  180

Query  622  DHEGDYNSVLGFPNGGPRILALRLQPD  702
            D+ GDY+SVLG+   G R  ALR   +
Sbjct  181  DNGGDYDSVLGYQIEGSRAYALRFHQN  207



>gb|ABE11655.1| DEFICIENS [Nicotiana benthamiana]
Length=150

 Score =   253 bits (645),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 122/142 (86%), Positives = 135/142 (95%), Gaps = 0/142 (0%)
 Frame = +1

Query  124  QTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMISTSGKLHEYISPSTSTKQLFDQYQK  303
            QTNRQVTYSKRRNGLFKKA+ELTVLCDAKVSIIMIS++GKLHE+ISPS +TKQLFD YQK
Sbjct  3    QTNRQVTYSKRRNGLFKKANELTVLCDAKVSIIMISSTGKLHEFISPSVTTKQLFDLYQK  62

Query  304  TVGVDLWNSHFEKMQEQLKKLRDVNRALRREIRQRMGEGLNDLSFEQLTELIEDVDNSIK  483
            TVGVDLWNSH+EKMQEQL+KL+DVNR LRREIRQRMGE LNDL++EQL EL E+VDNS+K
Sbjct  63   TVGVDLWNSHYEKMQEQLRKLKDVNRNLRREIRQRMGESLNDLNYEQLEELNENVDNSLK  122

Query  484  LIRERKYKVIGNQIETHKKKVR  549
            LIRERKYKVI NQIET+KKKVR
Sbjct  123  LIRERKYKVISNQIETYKKKVR  144



>ref|XP_007046776.1| Floral homeotic protein DEFICIENS, putative isoform 3 [Theobroma 
cacao]
 gb|EOX90933.1| Floral homeotic protein DEFICIENS, putative isoform 3 [Theobroma 
cacao]
Length=224

 Score =   255 bits (652),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 122/206 (59%), Positives = 162/206 (79%), Gaps = 2/206 (1%)
 Frame = +1

Query  85   MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMISTSGKLHEYISP  264
            M RGKI+IK+IEN TNRQVTYSKRRNG+FKKA ELTVLCDAKVS+IM S+SGK HE+ISP
Sbjct  1    MGRGKIEIKKIENTTNRQVTYSKRRNGIFKKAQELTVLCDAKVSLIMFSSSGKFHEFISP  60

Query  265  STSTKQLFDQYQKTVGVDLWNSHFEKMQEQLKKLRDVNRALRREIRQRMGEGLNDLSFEQ  444
            + STK  FD YQKT+G+DLW+SH+EKMQE  ++L+++N  LRREIRQR+GE L+DL+ ++
Sbjct  61   NISTKTFFDLYQKTLGIDLWSSHYEKMQENYRRLKEINNRLRREIRQRIGEDLDDLNIKE  120

Query  445  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDPYGLVD  624
            L  L   + +S++ +R+RKY VI  Q +T+KKKVRN+E+ H NL+L+ EA+ ED  G+V+
Sbjct  121  LQALEAKMASSLEAVRQRKYHVIKTQTDTYKKKVRNLEQRHANLVLDLEAKLED--GIVE  178

Query  625  HEGDYNSVLGFPNGGPRILALRLQPD  702
            +E  Y S +G  NG   + ALRL  +
Sbjct  179  NEAYYESSMGLANGASNLYALRLHQN  204



>gb|AAF28894.1|AF124814_1 APETALA3 [Brassica napus]
 gb|AAT42251.1| floral homeotic protein APETALA3 [Brassica rapa subsp. chinensis]
 gb|ABD24435.1| APETALA3-4 [Brassica napus]
 emb|CDX76152.1| BnaA04g04160D [Brassica napus]
Length=224

 Score =   255 bits (652),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 123/192 (64%), Positives = 160/192 (83%), Gaps = 1/192 (1%)
 Frame = +1

Query  85   MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMISTSGKLHEYISP  264
            MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDA+VSIIM S+S KLHE+ISP
Sbjct  1    MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDARVSIIMFSSSNKLHEFISP  60

Query  265  STSTKQLFDQYQKTVGVDLWNSHFEKMQEQLKKLRDVNRALRREIRQRMGEGLNDLSFEQ  444
            +T+TK++ D YQ    VD+W++H+E+MQE  +KL + NR LR +I+QR+GE L++L  ++
Sbjct  61   NTTTKEIIDLYQTVSDVDVWSAHYERMQETKRKLLETNRNLRTQIKQRLGECLDELDIQE  120

Query  445  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLV  621
            L  L E+++N+ KL+RERK+K +GNQIET KKK ++ ++I +NL+ E E R EDP YGLV
Sbjct  121  LRSLEEEMENTFKLVRERKFKSLGNQIETTKKKNKSQQDIQKNLIHELELRAEDPHYGLV  180

Query  622  DHEGDYNSVLGF  657
            D+ GDY+SVLG+
Sbjct  181  DNGGDYDSVLGY  192



>gb|ABF67488.1| MADS-domain protein [Impatiens hawkeri]
Length=188

 Score =   254 bits (648),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 125/187 (67%), Positives = 154/187 (82%), Gaps = 2/187 (1%)
 Frame = +1

Query  85   MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMISTSGKLHEYISP  264
            MARGKIQIKRI+N TNRQVTYSKRRNGLFKKA ELTVLCDAKVSIIM S++GKLHEYIS 
Sbjct  1    MARGKIQIKRIDNDTNRQVTYSKRRNGLFKKAGELTVLCDAKVSIIMXSSTGKLHEYISS  60

Query  265  STSTKQLFDQYQKTVGVDLWNSHFEKMQEQLKKLRDVNRALRREIRQRMGEGLNDLSFEQ  444
            S STKQLFD YQ T+ VDLW+S +++MQE LKKL++ NR LR EI QRMGE L+ L +E 
Sbjct  61   SISTKQLFDHYQNTLAVDLWSSKYQRMQEHLKKLKEANRLLRLEISQRMGENLSQLCYED  120

Query  445  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP--YGL  618
            + +L +DVD+S++ IR+RK+KV+GNQIE HKKK+RNVE+ HRNLL +   R+E+   Y L
Sbjct  121  VMKLEQDVDSSLQQIRDRKFKVLGNQIEIHKKKLRNVEQTHRNLLQQFGFREEEETQYAL  180

Query  619  VDHEGDY  639
             ++EG +
Sbjct  181  AENEGGW  187



>ref|XP_009798453.1| PREDICTED: floral homeotic protein DEFICIENS-like [Nicotiana 
sylvestris]
Length=225

 Score =   255 bits (651),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 119/206 (58%), Positives = 163/206 (79%), Gaps = 1/206 (0%)
 Frame = +1

Query  85   MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMISTSGKLHEYISP  264
            M RGKI+IK+IEN TNRQVTYSKRRNG+ KKA ELTVLCDAK+S++M+S++ K HEY SP
Sbjct  1    MGRGKIEIKKIENSTNRQVTYSKRRNGIIKKAKELTVLCDAKISLLMLSSTRKFHEYTSP  60

Query  265  STSTKQLFDQYQKTVGVDLWNSHFEKMQEQLKKLRDVNRALRREIRQRMGEGLNDLSFEQ  444
            +T+ K++ DQYQ+T+GVD+W++H+E+MQE LK+L+++N  LRREIRQR GE ++ LS ++
Sbjct  61   NTTQKKMIDQYQRTLGVDIWSTHYERMQENLKRLKEINNKLRREIRQRTGEDMSGLSLQE  120

Query  445  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLV  621
            L  L E++  S+  IRERKY VI  Q +T +KKV+N+E+ H NL+L+ EA+ EDP YG+V
Sbjct  121  LCHLQENISESLDEIRERKYHVIKTQTDTCRKKVKNLEKRHGNLVLDLEAKSEDPKYGVV  180

Query  622  DHEGDYNSVLGFPNGGPRILALRLQP  699
            ++EG YNS + F NG   + A RLQ 
Sbjct  181  ENEGQYNSAMAFANGVHNLYAFRLQS  206



>gb|ABF56128.1| APETALA3-like protein [Corylopsis pauciflora]
Length=205

 Score =   254 bits (649),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 125/184 (68%), Positives = 154/184 (84%), Gaps = 4/184 (2%)
 Frame = +1

Query  163  GLFKKAHELTVLCDAKVSIIMISTSGKLHEYISPSTSTKQLFDQYQKTVGVDLWNSHFEK  342
            GLFKKA+ELTVLCDAKVSIIM+S++GKLHEYISPST+TKQ FDQYQ+T G+DLW+SH+E+
Sbjct  2    GLFKKANELTVLCDAKVSIIMLSSTGKLHEYISPSTTTKQSFDQYQRTSGIDLWSSHYER  61

Query  343  MQEQLKKLRDVNRALRREIRQRMGEGLNDLSFEQLTELIEDVDNSIKLIRERKYKVIGNQ  522
            MQE L++L++VN  LRR+IRQRMGE LNDLS  +L +L ED DNS+K+IR+RKY+ I NQ
Sbjct  62   MQENLRELKEVNNKLRRQIRQRMGEHLNDLSVWELRDLEEDTDNSLKIIRDRKYRAITNQ  121

Query  523  IETHKKKVRNVEEIHRNLLLE---CEARQEDP-YGLVDHEGDYNSVLGFPNGGPRILALR  690
            IET KKK RN E++HRNLL E    +AR  DP +GLVD+ GDY+SVLG  N G R+ ALR
Sbjct  122  IETCKKKKRNGEQVHRNLLHEFVSMDARNVDPHFGLVDNGGDYDSVLGLQNVGARLFALR  181

Query  691  LQPD  702
            LQP+
Sbjct  182  LQPN  185



>gb|AGH39923.1| MADS domain protein [Enemion raddeanum]
Length=227

 Score =   255 bits (651),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 121/206 (59%), Positives = 157/206 (76%), Gaps = 1/206 (0%)
 Frame = +1

Query  85   MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMISTSGKLHEYISP  264
            M RGKI+IKRIEN TNRQVTYSKRR G+ KKA ELTVLCDA+VS++M+S++GK+HEYISP
Sbjct  1    MGRGKIEIKRIENSTNRQVTYSKRRAGIVKKAKELTVLCDAEVSLLMVSSTGKIHEYISP  60

Query  265  STSTKQLFDQYQKTVGVDLWNSHFEKMQEQLKKLRDVNRALRREIRQRMGEGLNDLSFEQ  444
            S + K L+D+YQ+  G DLW  H+EKMQE L+KL+D+N  LR+EIRQR GE L+DL F+Q
Sbjct  61   SCTHKNLYDRYQQASGTDLWQPHYEKMQEHLQKLKDINNKLRKEIRQRHGEDLDDLGFQQ  120

Query  445  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQED-PYGLV  621
            L  L ++++ S++ +R RK+ VI  Q +T KKKV+N EE H +L+ E E R  D  +  +
Sbjct  121  LRGLEQNMEKSVECVRNRKFHVITTQTDTFKKKVKNHEETHNSLIREFEERDADFRFPSL  180

Query  622  DHEGDYNSVLGFPNGGPRILALRLQP  699
            D EGDY S +GF NG P+I A RLQP
Sbjct  181  DFEGDYQSTIGFANGNPQIFAFRLQP  206



>gb|ABQ51322.1| B-class MADS-box protein TM6-2 [Carica papaya]
Length=227

 Score =   255 bits (651),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 125/206 (61%), Positives = 163/206 (79%), Gaps = 2/206 (1%)
 Frame = +1

Query  85   MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMISTSGKLHEYISP  264
            M RGKI+IKRIEN TNRQVTYSKRRNG+FKKA ELTVLCDAKVS+IMIS +GKLHE+ISP
Sbjct  1    MGRGKIEIKRIENPTNRQVTYSKRRNGIFKKAQELTVLCDAKVSLIMISNTGKLHEFISP  60

Query  265  STSTKQLFDQYQKTVGVDLWNSHFEKMQEQLKKLRDVNRALRREIRQRMGEGLNDLSFEQ  444
            + +TK++ DQYQ T+GVDLW++H++KMQ+ LKKLR++N  LRREIRQR GE L+D S E+
Sbjct  61   TATTKKMIDQYQSTLGVDLWSTHYQKMQDNLKKLREINNKLRREIRQRSGEDLHDASVEE  120

Query  445  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEAR-QEDP-YGL  618
            L  L +++ +++++IRERK+  I  Q +T+KKKVRN+EE + NLLL+ E R   DP YGL
Sbjct  121  LRGLEQNMASALEVIRERKFHTIKTQTDTYKKKVRNLEEQNGNLLLKFETRYHGDPHYGL  180

Query  619  VDHEGDYNSVLGFPNGGPRILALRLQ  696
            +++E DY S +   NG   + A RL 
Sbjct  181  IENERDYESAIALANGASNLHAFRLH  206



>gb|AAD51896.1| floral homeotic protein AP3 [Arabidopsis thaliana]
Length=232

 Score =   255 bits (651),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 126/207 (61%), Positives = 163/207 (79%), Gaps = 1/207 (0%)
 Frame = +1

Query  85   MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMISTSGKLHEYISP  264
            MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDA+VSII  S+S KLHEYISP
Sbjct  1    MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDARVSIITFSSSNKLHEYISP  60

Query  265  STSTKQLFDQYQKTVGVDLWNSHFEKMQEQLKKLRDVNRALRREIRQRMGEGLNDLSFEQ  444
            +T+TK++ D YQ    VD+W + +E+MQE  +KL + NR LR +I+QR+GE L++L  ++
Sbjct  61   NTTTKEIVDLYQTISDVDVWATQYERMQETKRKLLETNRNLRTQIKQRLGECLDELDIQE  120

Query  445  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLV  621
            L  L ++++N+ KL+RERK+K +GNQIET KKK ++ ++I +NL+ E E R EDP YGLV
Sbjct  121  LRRLEDEMENTFKLVRERKFKSLGNQIETTKKKNKSQQDIQKNLIHELELRAEDPHYGLV  180

Query  622  DHEGDYNSVLGFPNGGPRILALRLQPD  702
            D+ GDY+SVLG+   G R  ALR   +
Sbjct  181  DNGGDYDSVLGYQIEGSRAYALRFHQN  207



>gb|AAD51890.1| floral homeotic protein AP3 [Arabidopsis thaliana]
Length=232

 Score =   254 bits (650),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 126/207 (61%), Positives = 163/207 (79%), Gaps = 1/207 (0%)
 Frame = +1

Query  85   MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMISTSGKLHEYISP  264
            MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDA+VSIIM S+S KLHEYISP
Sbjct  1    MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDARVSIIMFSSSNKLHEYISP  60

Query  265  STSTKQLFDQYQKTVGVDLWNSHFEKMQEQLKKLRDVNRALRREIRQRMGEGLNDLSFEQ  444
            +T+TK++ D YQ    VD+W + +E+MQE  +KL + NR LR +I+QR+GE L++L  ++
Sbjct  61   NTTTKEIVDLYQSISDVDVWATQYERMQETKRKLLETNRNLRTQIKQRLGECLDELDIQE  120

Query  445  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLV  621
            L  L ++++N+ KL+RERK+K +GNQIET KKK ++ + I ++L+ E E R EDP YGLV
Sbjct  121  LRRLEDEMENTFKLVRERKFKSLGNQIETTKKKNKSQQNIQKDLIHELELRAEDPHYGLV  180

Query  622  DHEGDYNSVLGFPNGGPRILALRLQPD  702
            D+ GDY+SVLG+   G R  ALR   +
Sbjct  181  DNGGDYDSVLGYQIEGSRAYALRFHQN  207



>ref|XP_008241773.1| PREDICTED: floral homeotic protein DEFICIENS-like isoform X1 
[Prunus mume]
Length=238

 Score =   255 bits (651),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 121/210 (58%), Positives = 161/210 (77%), Gaps = 4/210 (2%)
 Frame = +1

Query  85   MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMISTSGKLHEYISP  264
            M RGKI+IK IEN TNRQVTYSKRRNG+FKKA ELTVLCDAKVS+IM+S +GK+HEYISP
Sbjct  1    MGRGKIEIKLIENHTNRQVTYSKRRNGIFKKAQELTVLCDAKVSLIMLSNTGKMHEYISP  60

Query  265  STSTKQLFDQYQKTVGVDLWNSHFEKMQEQLKKLRDVNRALRREIRQRMGEGLNDLSFEQ  444
            +T+TK+++D YQKT+GVDLW+SH++ M++ L KL+++N  LRREIRQR+G  LN L++EQ
Sbjct  61   TTTTKRMYDDYQKTLGVDLWSSHYQAMKDTLWKLKEINNKLRREIRQRLGHDLNGLTYEQ  120

Query  445  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLL---LECEARQEDP-Y  612
            L  L + + +S++ IRERKY V+  Q+ET+KKKV+N++E   N+L    + E   EDP Y
Sbjct  121  LHSLEDKMASSLEAIRERKYHVLKTQMETYKKKVKNLQERRGNMLHGYFDQEVASEDPQY  180

Query  613  GLVDHEGDYNSVLGFPNGGPRILALRLQPD  702
            G VD+EGDY S +   NG   +  + L  D
Sbjct  181  GYVDNEGDYESAVALANGASNLFTIHLHQD  210



>gb|AAP93899.1| APETALA3 [Brassica napus]
 emb|CDY13200.1| BnaC04g26350D [Brassica napus]
Length=224

 Score =   254 bits (649),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 122/192 (64%), Positives = 159/192 (83%), Gaps = 1/192 (1%)
 Frame = +1

Query  85   MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMISTSGKLHEYISP  264
            MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDA+VSIIM S+S KLHE+ISP
Sbjct  1    MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDARVSIIMFSSSNKLHEFISP  60

Query  265  STSTKQLFDQYQKTVGVDLWNSHFEKMQEQLKKLRDVNRALRREIRQRMGEGLNDLSFEQ  444
            +T+TK++ D YQ    VD+W++H+E+MQE  +KL + NR LR +I+QR+GE L++   ++
Sbjct  61   NTTTKEILDLYQTVSDVDVWSAHYERMQETKRKLLETNRNLRTQIKQRLGECLDEFDIQE  120

Query  445  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLV  621
            L  L E+++N+ KL+RERK+K +GNQIET KKK ++ ++I +NL+ E E R EDP YGLV
Sbjct  121  LRSLEEEMENTFKLVRERKFKSLGNQIETTKKKNKSQQDIQKNLIHELELRAEDPHYGLV  180

Query  622  DHEGDYNSVLGF  657
            D+ GDY+SVLG+
Sbjct  181  DNGGDYDSVLGY  192



>emb|CAC81070.1| MADS box transcription factor [Daucus carota subsp. sativus]
Length=223

 Score =   254 bits (648),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 128/208 (62%), Positives = 160/208 (77%), Gaps = 2/208 (1%)
 Frame = +1

Query  85   MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMISTSGKLHEYISP  264
            MARGKIQIK+IEN TNRQVTYSKRRNGLFKKAHEL+VLCDAKVSIIM+S++ KLHE+I+P
Sbjct  1    MARGKIQIKKIENATNRQVTYSKRRNGLFKKAHELSVLCDAKVSIIMVSSTNKLHEFITP  60

Query  265  STSTKQLFDQYQKTVGVDLWNSHFEKMQEQLKKLRDVNRALRREIRQRMGEGLNDLSFEQ  444
            + S KQL+DQYQK    DLW++H++ MQEQL+KLR+VNR LR EI  R GE LN +S E+
Sbjct  61   NLSQKQLYDQYQKAKPCDLWSNHYQAMQEQLRKLREVNRNLRNEISHRKGESLNGVSHEE  120

Query  445  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEA-RQEDP-YGL  618
            L  L + +  ++ + R +K K I NQIE  KKKVRN E++ R LL + E  ++EDP YGL
Sbjct  121  LYILEQKMQEAVDITRAQKMKTITNQIEKSKKKVRNGEQVQRTLLQDLELFKEEDPHYGL  180

Query  619  VDHEGDYNSVLGFPNGGPRILALRLQPD  702
            VD+ GDY +V G  N  P +LALRLQ +
Sbjct  181  VDNGGDYETVFGCSNAYPGLLALRLQSN  208



>gb|AAD51898.1| floral homeotic protein AP3 [Arabidopsis thaliana]
Length=232

 Score =   254 bits (648),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 125/207 (60%), Positives = 163/207 (79%), Gaps = 1/207 (0%)
 Frame = +1

Query  85   MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMISTSGKLHEYISP  264
            MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDA+VSIIM S+S KLHEYISP
Sbjct  1    MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDARVSIIMFSSSNKLHEYISP  60

Query  265  STSTKQLFDQYQKTVGVDLWNSHFEKMQEQLKKLRDVNRALRREIRQRMGEGLNDLSFEQ  444
            +T+TK++ D YQ    VD+W + +E+MQE  +KL + NR LR +I+QR+GE L++L  ++
Sbjct  61   NTTTKEIVDLYQTISDVDVWATQYERMQETKRKLLETNRNLRTQIKQRLGECLDELDIQE  120

Query  445  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLV  621
            L  L ++++N+ KL+R RK++ +GNQIET KKK ++ ++I +NL+ E E R EDP YGLV
Sbjct  121  LRRLEDEMENTFKLVRARKFESLGNQIETTKKKNKSQQDIQKNLIHELELRAEDPHYGLV  180

Query  622  DHEGDYNSVLGFPNGGPRILALRLQPD  702
            D+ GDY+SVLG+   G R  ALR   +
Sbjct  181  DNGGDYDSVLGYQIEGSRAYALRFHQN  207



>ref|XP_009139246.1| PREDICTED: floral homeotic protein APETALA 3-like [Brassica rapa]
Length=224

 Score =   253 bits (647),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 122/192 (64%), Positives = 160/192 (83%), Gaps = 1/192 (1%)
 Frame = +1

Query  85   MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMISTSGKLHEYISP  264
            MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDA+VSIIM S+S KLHE+ISP
Sbjct  1    MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDARVSIIMFSSSNKLHEFISP  60

Query  265  STSTKQLFDQYQKTVGVDLWNSHFEKMQEQLKKLRDVNRALRREIRQRMGEGLNDLSFEQ  444
            +T+TK++ D YQ    VD+W++H+E+MQE  +KL + NR LR +I+QR+GE L++L  ++
Sbjct  61   NTTTKEIIDLYQTVSDVDVWSAHYERMQETKRKLLETNRNLRTQIKQRLGECLDELDIQE  120

Query  445  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLV  621
            L  L E+++N+ KL+RERK+K +GNQIET KKK ++ ++I +NL+ E E R EDP YGLV
Sbjct  121  LRSLEEEMENTFKLVRERKFKSLGNQIETTKKKNKSQQDIQKNLIHELELRAEDPHYGLV  180

Query  622  DHEGDYNSVLGF  657
            ++ GDY+SVLG+
Sbjct  181  ENGGDYDSVLGY  192



>gb|AAD51894.1| floral homeotic protein AP3 [Arabidopsis thaliana]
Length=232

 Score =   253 bits (647),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 126/207 (61%), Positives = 162/207 (78%), Gaps = 1/207 (0%)
 Frame = +1

Query  85   MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMISTSGKLHEYISP  264
            MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDA+VSIIM S+S KLHEYISP
Sbjct  1    MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDARVSIIMFSSSNKLHEYISP  60

Query  265  STSTKQLFDQYQKTVGVDLWNSHFEKMQEQLKKLRDVNRALRREIRQRMGEGLNDLSFEQ  444
            +T+TK++ D YQ    VD+W + +E+MQE  +KL + NR LR +I+QR+GE L++L  ++
Sbjct  61   NTTTKEIVDLYQTISDVDVWATQYERMQETKRKLLETNRNLRTQIKQRLGECLDELDIQE  120

Query  445  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLV  621
            L  L ++++N+ KL+RERK+K +GNQIET  KK ++ + I +NL+ E E R EDP YGLV
Sbjct  121  LRRLEDEMENTFKLVRERKFKSLGNQIETTMKKNKSQQGIQKNLIHELELRAEDPHYGLV  180

Query  622  DHEGDYNSVLGFPNGGPRILALRLQPD  702
            D+ GDY+SVLG+   G R  ALR   +
Sbjct  181  DNGGDYDSVLGYQIEGSRAYALRFHQN  207



>gb|AAY63866.1| APETALA3 [Brassica juncea]
Length=224

 Score =   253 bits (646),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 126/207 (61%), Positives = 163/207 (79%), Gaps = 9/207 (4%)
 Frame = +1

Query  85   MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMISTSGKLHEYISP  264
            MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDA+VSIIM S+S KLHE+ISP
Sbjct  1    MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDARVSIIMFSSSNKLHEFISP  60

Query  265  STSTKQLFDQYQKTVGVDLWNSHFEKMQEQLKKLRDVNRALRREIRQRMGEGLNDLSFEQ  444
            +T+TK++ D YQ    VD+W++H+E+MQE  +KL + NR LR +I+QR+GE L++L  ++
Sbjct  61   NTTTKEIIDLYQTVSDVDVWSAHYERMQETKRKLLETNRNLRTQIKQRLGECLDELDTQE  120

Query  445  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLV  621
            L  L E+++N+ KL+R RK+K +GNQIET KKK ++ ++I +NL+ E E R EDP YGLV
Sbjct  121  LRSLEEEMENTFKLVRGRKFKSLGNQIETTKKKNKSQQDIQKNLIHELELRAEDPHYGLV  180

Query  622  DHEGDYNSVLGFPNGGPRILALRLQPD  702
            D  GDY+SVLG+         LR QP+
Sbjct  181  DDGGDYDSVLGY--------QLRFQPN  199



>gb|KGN60009.1| hypothetical protein Csa_3G865440 [Cucumis sativus]
Length=206

 Score =   252 bits (643),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 125/188 (66%), Positives = 153/188 (81%), Gaps = 21/188 (11%)
 Frame = +1

Query  85   MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAK------------------  210
            MARGKIQIKRIEN TNRQVTYSKRRNGLFKKA+ELTVLCDAK                  
Sbjct  1    MARGKIQIKRIENPTNRQVTYSKRRNGLFKKANELTVLCDAKHWKTSRVFKKANELTVLC  60

Query  211  ---VSIIMISTSGKLHEYISPSTSTKQLFDQYQKTVGVDLWNSHFEKMQEQLKKLRDVNR  381
               VSIIM S++ KLHEY +P+TSTK+LFDQYQKT+GVDLW +H+E+MQ+ LKKL+D+NR
Sbjct  61   DAKVSIIMFSSTEKLHEYTTPATSTKELFDQYQKTLGVDLWITHYERMQDNLKKLKDINR  120

Query  382  ALRREIRQRMGEGLNDLSFEQLTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEE  561
             LRR+IRQRMGE +NDLSFE+L  L +D+DN++++IRERKY+VI NQIETHKKK+++V E
Sbjct  121  NLRRQIRQRMGECMNDLSFEELRCLEQDMDNAVRIIRERKYRVISNQIETHKKKLKSVGE  180

Query  562  IHRNLLLE  585
            IH++LL E
Sbjct  181  IHKSLLQE  188



>ref|XP_010672335.1| PREDICTED: floral homeotic protein DEFICIENS-like isoform X1 
[Beta vulgaris subsp. vulgaris]
Length=225

 Score =   253 bits (645),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 127/206 (62%), Positives = 166/206 (81%), Gaps = 3/206 (1%)
 Frame = +1

Query  85   MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMISTSGKLHEYISP  264
            MARGKIQIK+IENQTNRQVTYSKRRNGLFKKA+ELTVLCDA VSIIM+S S K+HEYISP
Sbjct  1    MARGKIQIKKIENQTNRQVTYSKRRNGLFKKANELTVLCDATVSIIMVSNSNKIHEYISP  60

Query  265  STSTKQLFDQYQKTVGVDLWNSHFEKMQEQLKKLRDVNRALRREIRQRMGEGLNDLSFEQ  444
              +TK+++D+YQK   VD+W   ++KMQ++L KL + NR L+R+IR+RMG+ L DL+  +
Sbjct  61   GNTTKEIYDRYQKDKKVDVWMKQYQKMQQELMKLNETNRELQRDIRRRMGDCLEDLTLNE  120

Query  445  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLV  621
            L  L ++V+NS+ +IRERK K + +QI+T KKK+RN  E+H+NLL + +  +E+P YGLV
Sbjct  121  LCCLGQEVNNSVTVIRERKMKKLDSQIDTTKKKLRNSSEVHKNLLSQFDLPKEEPQYGLV  180

Query  622  DHEGDYNSVLGFPNGGPRILALRLQP  699
            D+ G+YN VLG+ N   RILALRLQP
Sbjct  181  DN-GEYNHVLGY-NDDSRILALRLQP  204



>gb|AAT46097.1| APETALA3-like protein [Akebia trifoliata]
Length=225

 Score =   252 bits (644),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 117/205 (57%), Positives = 157/205 (77%), Gaps = 1/205 (0%)
 Frame = +1

Query  85   MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMISTSGKLHEYISP  264
            M RGKI+IKRIEN T+RQVTYSKRR G+ KKA ELTVLCDA+VS+IM S++GK  EYISP
Sbjct  1    MGRGKIEIKRIENSTSRQVTYSKRRAGIMKKAQELTVLCDAEVSLIMFSSTGKFTEYISP  60

Query  265  STSTKQLFDQYQKTVGVDLWNSHFEKMQEQLKKLRDVNRALRREIRQRMGEGLNDLSFEQ  444
            S +TKQ+FDQYQK  G+++W  H+E+MQ+ L K +++N  LRREIRQR+GE L+DL+   
Sbjct  61   SVTTKQIFDQYQKVSGINIWQPHYERMQDNLNKQKEINNKLRREIRQRIGEDLDDLTIHD  120

Query  445  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLV  621
            L  L +++++S+K +R+RK++VI  + ETHKKK +N+EE H  LL E E R ++P + + 
Sbjct  121  LRGLEQNMESSLKTVRDRKFQVISTRTETHKKKFKNMEETHAKLLREFEGRDDEPHFAMA  180

Query  622  DHEGDYNSVLGFPNGGPRILALRLQ  696
             HEG+Y SVLG  NGG  + A RLQ
Sbjct  181  GHEGEYESVLGLGNGGSHVFAFRLQ  205



>gb|AAF73933.1|AF230704_1 MADS box transcription factor TM6 [Petunia x hybrida]
 gb|AAS46017.1| MADS-box protein TM6 [Petunia x hybrida]
Length=225

 Score =   252 bits (644),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 120/205 (59%), Positives = 160/205 (78%), Gaps = 1/205 (0%)
 Frame = +1

Query  85   MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMISTSGKLHEYISP  264
            M RGKI+IK+IEN TNRQVTYSKRRNGLFKKA ELTVLCDAK+ +IM+S++ K HEY SP
Sbjct  1    MGRGKIEIKKIENSTNRQVTYSKRRNGLFKKAKELTVLCDAKICLIMLSSTRKFHEYTSP  60

Query  265  STSTKQLFDQYQKTVGVDLWNSHFEKMQEQLKKLRDVNRALRREIRQRMGEGLNDLSFEQ  444
            +T+TK++ D YQ+T+GVD+WN H+EKMQE L +L+D+N  LRREIRQR GE ++ L+ ++
Sbjct  61   NTTTKKMIDLYQRTLGVDIWNKHYEKMQENLNRLKDINNKLRREIRQRTGEDMSGLNLQE  120

Query  445  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLV  621
            L  L  +V +S+  IRERKY VI  Q +T +K+VRN+EE H +L+ + EA+ EDP YG+V
Sbjct  121  LCHLQGNVSDSLAEIRERKYHVIKTQTDTCRKRVRNLEEQHGSLVHDLEAKSEDPTYGVV  180

Query  622  DHEGDYNSVLGFPNGGPRILALRLQ  696
            ++EG +NS + F NG   + A RLQ
Sbjct  181  ENEGHFNSAMAFANGVHNLYAFRLQ  205



>gb|KJB17703.1| hypothetical protein B456_003G011500 [Gossypium raimondii]
Length=224

 Score =   252 bits (643),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 121/204 (59%), Positives = 157/204 (77%), Gaps = 1/204 (0%)
 Frame = +1

Query  85   MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMISTSGKLHEYISP  264
            M RGKI+IK+IEN TNRQVTYSKRRNGLFKKA ELTVLCDAKVS+IM S++GK HE++SP
Sbjct  1    MGRGKIEIKKIENATNRQVTYSKRRNGLFKKAQELTVLCDAKVSLIMFSSTGKFHEFLSP  60

Query  265  STSTKQLFDQYQKTVGVDLWNSHFEKMQEQLKKLRDVNRALRREIRQRMGEGLNDLSFEQ  444
            + STK +FD YQK  G+DLWNSH+E+M E  ++L+++N+ LRREIRQRMG  LN+L+ ++
Sbjct  61   NISTKGVFDLYQKATGIDLWNSHYERMDENYRRLKEINKKLRREIRQRMGGDLNELNIKE  120

Query  445  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDPYGLVD  624
            L  L   +D+S+  IRERKY VI  Q + HKKKVRN+EE H NL+++ EA+ +D  G+V+
Sbjct  121  LQALEAKMDSSLLAIRERKYHVIKTQTDKHKKKVRNLEERHANLVMDLEAKLDDQDGIVE  180

Query  625  HEGDYNSVLG-FPNGGPRILALRL  693
              G Y S +G  P G   + ALRL
Sbjct  181  TGGYYESTMGLLPTGASNLYALRL  204



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2720663101320