BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig287

Length=1500
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

dbj|BAE32324.1|  unnamed protein product                                194   1e-72   Mus musculus [mouse]
ref|XP_006450366.1|  hypothetical protein CICLE_v10009763mg             192   1e-54   Citrus clementina [clementine]
gb|KDO61816.1|  hypothetical protein CISIN_1g031480mg                   191   2e-54   Citrus sinensis [apfelsine]
ref|XP_002526494.1|  40S ribosomal protein S11, putative                191   2e-54   Ricinus communis
ref|XP_003549708.1|  PREDICTED: 40S ribosomal protein S11-like          190   7e-54   Glycine max [soybeans]
ref|XP_008800685.1|  PREDICTED: 40S ribosomal protein S11-like          189   1e-53   Phoenix dactylifera
ref|XP_004976788.1|  PREDICTED: 40S ribosomal protein S11-like          189   1e-53   Setaria italica
ref|XP_010904992.1|  PREDICTED: 40S ribosomal protein S11 isoform X2    188   1e-53   Elaeis guineensis
ref|XP_004492502.1|  PREDICTED: 40S ribosomal protein S11-like          189   1e-53   Cicer arietinum [garbanzo]
sp|Q9M5M1.1|RS11_EUPES  RecName: Full=40S ribosomal protein S11         189   2e-53   Euphorbia esula [wolf's milk]
ref|XP_010417155.1|  PREDICTED: 40S ribosomal protein S11-1-like ...    188   2e-53   Camelina sativa [gold-of-pleasure]
ref|NP_001236968.1|  40S ribosomal protein S11                          189   2e-53   Glycine max [soybeans]
ref|XP_004252282.1|  PREDICTED: 40S ribosomal protein S11               189   2e-53   Solanum lycopersicum
ref|XP_006361121.1|  PREDICTED: 40S ribosomal protein S11-like          189   2e-53   Solanum tuberosum [potatoes]
ref|XP_010904991.1|  PREDICTED: 40S ribosomal protein S11 isoform X1    189   2e-53   Elaeis guineensis
ref|XP_008809330.1|  PREDICTED: 40S ribosomal protein S11               189   2e-53   Phoenix dactylifera
ref|XP_009605477.1|  PREDICTED: 40S ribosomal protein S11-like          189   2e-53   Nicotiana tomentosiformis
ref|XP_004241368.1|  PREDICTED: 40S ribosomal protein S11-like          189   2e-53   Solanum lycopersicum
ref|XP_002880547.1|  ribosomal protein S11-beta                         189   2e-53   Arabidopsis lyrata subsp. lyrata
ref|XP_006296532.1|  hypothetical protein CARUB_v10025724mg             189   2e-53   Capsella rubella
ref|XP_009392143.1|  PREDICTED: 40S ribosomal protein S11-like          188   3e-53   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003629390.1|  40S ribosomal protein S11                          188   3e-53   Medicago truncatula
ref|XP_008776674.1|  PREDICTED: 40S ribosomal protein S11-like          188   3e-53   Phoenix dactylifera
ref|XP_002454168.1|  hypothetical protein SORBIDRAFT_04g025870          188   4e-53   
dbj|BAK05865.1|  predicted protein                                      188   4e-53   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_007155106.1|  hypothetical protein PHAVU_003G173800g             187   5e-53   Phaseolus vulgaris [French bean]
ref|XP_010240412.1|  PREDICTED: 40S ribosomal protein S11               187   5e-53   Brachypodium distachyon [annual false brome]
ref|XP_010927344.1|  PREDICTED: 40S ribosomal protein S11-like          187   5e-53   Elaeis guineensis
ref|XP_004953088.1|  PREDICTED: 40S ribosomal protein S11-like is...    187   6e-53   Setaria italica
ref|XP_002301243.1|  40S ribosomal protein S11                          187   7e-53   Populus trichocarpa [western balsam poplar]
ref|NP_001060007.1|  Os07g0565000                                       187   8e-53   
ref|XP_012076480.1|  PREDICTED: 40S ribosomal protein S11-like          187   8e-53   Jatropha curcas
ref|XP_006652811.1|  PREDICTED: 40S ribosomal protein S11-like          187   8e-53   Oryza brachyantha
ref|XP_009610574.1|  PREDICTED: 40S ribosomal protein S11               187   8e-53   Nicotiana tomentosiformis
ref|XP_008813136.1|  PREDICTED: 40S ribosomal protein S11-like          187   8e-53   Phoenix dactylifera
gb|ACG35231.1|  40S ribosomal protein S11                               187   9e-53   Zea mays [maize]
ref|XP_004287236.1|  PREDICTED: 40S ribosomal protein S11-like          187   9e-53   Fragaria vesca subsp. vesca
ref|XP_011032811.1|  PREDICTED: 40S ribosomal protein S11               187   9e-53   Populus euphratica
ref|NP_001105562.1|  40S ribosomal protein S11                          187   9e-53   Zea mays [maize]
ref|NP_001146950.1|  40S ribosomal protein S11                          187   1e-52   Zea mays [maize]
ref|XP_006375200.1|  40S ribosomal protein S11                          187   1e-52   Populus trichocarpa [western balsam poplar]
ref|XP_012083751.1|  PREDICTED: 40S ribosomal protein S11               187   1e-52   Jatropha curcas
ref|XP_006284663.1|  hypothetical protein CARUB_v10005922mg             187   1e-52   Capsella rubella
ref|XP_012081114.1|  PREDICTED: 40S ribosomal protein S11-like          187   1e-52   Jatropha curcas
ref|XP_010432945.1|  PREDICTED: 40S ribosomal protein S11-3-like        186   1e-52   Camelina sativa [gold-of-pleasure]
gb|KJB22832.1|  hypothetical protein B456_004G068000                    186   1e-52   Gossypium raimondii
ref|XP_007159633.1|  hypothetical protein PHAVU_002G254000g             186   1e-52   Phaseolus vulgaris [French bean]
ref|XP_007052409.1|  Ribosomal protein S11-beta isoform 2               186   1e-52   
ref|XP_007013672.1|  Ribosomal protein S11-beta                         186   2e-52   
gb|KJB27059.1|  hypothetical protein B456_004G275200                    186   2e-52   Gossypium raimondii
ref|XP_009407362.1|  PREDICTED: 40S ribosomal protein S11               186   2e-52   Musa acuminata subsp. malaccensis [pisang utan]
gb|AFX66997.1|  40s ribosomal protein S11                               186   2e-52   Solanum tuberosum [potatoes]
ref|XP_009398660.1|  PREDICTED: 40S ribosomal protein S11-like          186   2e-52   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009764798.1|  PREDICTED: 40S ribosomal protein S11               186   2e-52   Nicotiana sylvestris
gb|KFK41361.1|  hypothetical protein AALP_AA2G120000                    186   2e-52   Arabis alpina [alpine rockcress]
ref|XP_004138716.1|  PREDICTED: 40S ribosomal protein S11               186   2e-52   Cucumis sativus [cucumbers]
ref|XP_008445242.1|  PREDICTED: 40S ribosomal protein S11               186   2e-52   Cucumis melo [Oriental melon]
gb|KJB64607.1|  hypothetical protein B456_010G056800                    186   2e-52   Gossypium raimondii
ref|XP_002532505.1|  40S ribosomal protein S11, putative                186   2e-52   Ricinus communis
gb|AFK46727.1|  unknown                                                 186   2e-52   Lotus japonicus
ref|XP_010493497.1|  PREDICTED: 40S ribosomal protein S11-3             186   2e-52   Camelina sativa [gold-of-pleasure]
ref|XP_002325170.1|  40S ribosomal protein S11-2                        186   3e-52   Populus trichocarpa [western balsam poplar]
gb|AFK49430.1|  unknown                                                 186   3e-52   Lotus japonicus
ref|XP_009611608.1|  PREDICTED: 40S ribosomal protein S11-like          185   3e-52   Nicotiana tomentosiformis
ref|XP_007146683.1|  hypothetical protein PHAVU_006G060600g             185   4e-52   Phaseolus vulgaris [French bean]
gb|AAA32866.1|  ribosomal protein S11 (probable start codon at bp...    186   4e-52   Arabidopsis thaliana [mouse-ear cress]
gb|KDP28900.1|  hypothetical protein JCGZ_14671                         185   4e-52   Jatropha curcas
ref|XP_006288822.1|  hypothetical protein CARUB_v10002158mg             185   4e-52   Capsella rubella
emb|CDP18807.1|  unnamed protein product                                185   5e-52   Coffea canephora [robusta coffee]
ref|XP_002874145.1|  ribosomal protein S11-beta                         185   5e-52   Arabidopsis lyrata subsp. lyrata
ref|XP_002869362.1|  40S ribosomal protein S11                          185   6e-52   
ref|XP_006291971.1|  hypothetical protein CARUB_v10018158mg             185   6e-52   Capsella rubella
ref|XP_010687771.1|  PREDICTED: 40S ribosomal protein S11-3             185   6e-52   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007052408.1|  Ribosomal protein S11-beta isoform 1               186   6e-52   
ref|XP_010421183.1|  PREDICTED: 40S ribosomal protein S11-3-like        184   7e-52   Camelina sativa [gold-of-pleasure]
ref|XP_007202693.1|  hypothetical protein PRUPE_ppa012656mg             184   7e-52   Prunus persica
ref|XP_002877637.1|  EMB1080                                            184   8e-52   Arabidopsis lyrata subsp. lyrata
ref|XP_010914246.1|  PREDICTED: 40S ribosomal protein S11-like          184   8e-52   Elaeis guineensis
ref|XP_009130101.1|  PREDICTED: 40S ribosomal protein S11-3             184   8e-52   Brassica rapa
ref|XP_010941685.1|  PREDICTED: 40S ribosomal protein S11-like          184   9e-52   Elaeis guineensis
ref|XP_004288615.1|  PREDICTED: 40S ribosomal protein S11               184   1e-51   Fragaria vesca subsp. vesca
ref|NP_001053235.1|  Os04g0502300                                       184   1e-51   
pdb|3J60|L  Chain L, Localization Of The Small Subunit Ribosomal ...    184   1e-51   Triticum aestivum [Canadian hard winter wheat]
ref|XP_009358523.1|  PREDICTED: 40S ribosomal protein S11-like          184   1e-51   Pyrus x bretschneideri [bai li]
ref|XP_010665687.1|  PREDICTED: 40S ribosomal protein S11               184   1e-51   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006659214.1|  PREDICTED: 40S ribosomal protein S11-like          184   1e-51   Oryza brachyantha
ref|XP_009405706.1|  PREDICTED: 40S ribosomal protein S11-like          184   1e-51   Musa acuminata subsp. malaccensis [pisang utan]
gb|EEC83094.1|  hypothetical protein OsI_28229                          184   1e-51   Oryza sativa Indica Group [Indian rice]
gb|KJB23700.1|  hypothetical protein B456_004G110600                    184   1e-51   Gossypium raimondii
ref|XP_002267523.1|  PREDICTED: 40S ribosomal protein S11               184   1e-51   Vitis vinifera
dbj|BAJ94606.1|  predicted protein                                      184   1e-51   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006404202.1|  hypothetical protein EUTSA_v10010781mg             184   2e-51   Eutrema salsugineum [saltwater cress]
ref|XP_008336943.1|  PREDICTED: 40S ribosomal protein S11-like          184   2e-51   
ref|NP_197763.1|  40S ribosomal protein S11-3                           184   2e-51   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001236713.1|  uncharacterized protein LOC100500094               183   2e-51   Glycine max [soybeans]
ref|XP_009149784.1|  PREDICTED: 40S ribosomal protein S11-3-like ...    183   2e-51   Brassica rapa
ref|NP_001238157.1|  uncharacterized protein LOC100500186               183   2e-51   Glycine max [soybeans]
gb|KFK34189.1|  hypothetical protein AALP_AA5G112300                    183   2e-51   Arabis alpina [alpine rockcress]
emb|CAK22271.1|  40S ribosomal protein S11                              183   2e-51   Oxybasis rubra [pigweed]
ref|NP_190462.1|  40S ribosomal protein S11-1                           183   2e-51   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006394638.1|  hypothetical protein EUTSA_v10005057mg             183   3e-51   Eutrema salsugineum [saltwater cress]
ref|XP_009150903.1|  PREDICTED: 40S ribosomal protein S11-3-like        183   3e-51   Brassica rapa
ref|XP_010557632.1|  PREDICTED: 40S ribosomal protein S11               183   3e-51   Tarenaya hassleriana [spider flower]
ref|XP_009410372.1|  PREDICTED: 40S ribosomal protein S11-like          183   3e-51   Musa acuminata subsp. malaccensis [pisang utan]
gb|KFK29657.1|  hypothetical protein AALP_AA7G161800                    183   3e-51   Arabis alpina [alpine rockcress]
ref|XP_009355796.1|  PREDICTED: 40S ribosomal protein S11               182   4e-51   Pyrus x bretschneideri [bai li]
ref|XP_008378412.1|  PREDICTED: 40S ribosomal protein S11               182   4e-51   Malus domestica [apple tree]
ref|XP_009141711.1|  PREDICTED: 40S ribosomal protein S11-3-like        182   4e-51   Brassica rapa
ref|XP_010266772.1|  PREDICTED: 40S ribosomal protein S11               182   4e-51   Nelumbo nucifera [Indian lotus]
ref|XP_007223638.1|  hypothetical protein PRUPE_ppa012659mg             182   5e-51   Prunus persica
ref|NP_194809.1|  40S ribosomal protein S11-2                           182   5e-51   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008447825.1|  PREDICTED: 40S ribosomal protein S11-like          182   5e-51   Cucumis melo [Oriental melon]
emb|CDY05882.1|  BnaC08g20590D                                          182   6e-51   
dbj|BAJ89702.1|  predicted protein                                      182   8e-51   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009151636.1|  PREDICTED: 40S ribosomal protein S11-3             182   8e-51   Brassica rapa
gb|AFK38811.1|  unknown                                                 182   9e-51   Lotus japonicus
emb|CDY64632.1|  BnaCnng44460D                                          184   1e-50   Brassica napus [oilseed rape]
ref|XP_003609505.1|  40S ribosomal protein S11                          181   1e-50   Medicago truncatula
emb|CDX80385.1|  BnaC07g30590D                                          189   1e-50   
ref|XP_011089695.1|  PREDICTED: 40S ribosomal protein S11               181   1e-50   Sesamum indicum [beniseed]
emb|CDX88047.1|  BnaA06g26380D                                          183   1e-50   
ref|XP_010245616.1|  PREDICTED: 40S ribosomal protein S11-like          181   1e-50   Nelumbo nucifera [Indian lotus]
ref|XP_002285422.1|  PREDICTED: 40S ribosomal protein S11               181   1e-50   Vitis vinifera
ref|XP_004953087.1|  PREDICTED: 40S ribosomal protein S11-like is...    181   2e-50   
ref|XP_011017934.1|  PREDICTED: 40S ribosomal protein S11 isoform X1    181   2e-50   Populus euphratica
ref|XP_011089115.1|  PREDICTED: 40S ribosomal protein S11-like          181   2e-50   Sesamum indicum [beniseed]
ref|XP_011081506.1|  PREDICTED: 40S ribosomal protein S11               181   2e-50   Sesamum indicum [beniseed]
ref|XP_011077210.1|  PREDICTED: 40S ribosomal protein S11-like          181   2e-50   Sesamum indicum [beniseed]
ref|XP_004153463.1|  PREDICTED: 40S ribosomal protein S11-like          181   2e-50   Cucumis sativus [cucumbers]
gb|KCW50239.1|  hypothetical protein EUGRSUZ_J00035                     182   2e-50   Eucalyptus grandis [rose gum]
gb|KFK27670.1|  hypothetical protein AALP_AA8G413500                    180   3e-50   Arabis alpina [alpine rockcress]
gb|KJB83250.1|  hypothetical protein B456_013G237400                    180   3e-50   Gossypium raimondii
gb|KHG26586.1|  40S ribosomal S11                                       180   3e-50   Gossypium arboreum [tree cotton]
ref|XP_010533097.1|  PREDICTED: 40S ribosomal protein S11-like          180   3e-50   Tarenaya hassleriana [spider flower]
gb|KDO61813.1|  hypothetical protein CISIN_1g031480mg                   179   5e-50   Citrus sinensis [apfelsine]
ref|XP_003575346.1|  PREDICTED: 40S ribosomal protein S11-like          180   5e-50   Brachypodium distachyon [annual false brome]
ref|XP_010542070.1|  PREDICTED: 40S ribosomal protein S11-like          179   5e-50   Tarenaya hassleriana [spider flower]
gb|KJB27060.1|  hypothetical protein B456_004G275200                    179   5e-50   Gossypium raimondii
ref|XP_006852797.1|  PREDICTED: 40S ribosomal protein S11-1             179   8e-50   Amborella trichopoda
ref|XP_006349147.1|  PREDICTED: 40S ribosomal protein S11-like          179   1e-49   
emb|CDY16867.1|  BnaA09g05150D                                          179   1e-49   Brassica napus [oilseed rape]
dbj|BAC22544.1|  putative 40S ribosomal protein S11                     179   1e-49   Oryza sativa Japonica Group [Japonica rice]
tpg|DAA37074.1|  TPA: 40S ribosomal protein S11                         189   1e-49   
ref|XP_003573544.1|  PREDICTED: 40S ribosomal protein S11-like is...    178   2e-49   Brachypodium distachyon [annual false brome]
gb|AAA32867.1|  ribosomal protein S11                                   177   3e-49   Arabidopsis thaliana [mouse-ear cress]
gb|EAY94752.1|  hypothetical protein OsI_16531                          178   3e-49   Oryza sativa Indica Group [Indian rice]
emb|CDY44261.1|  BnaC02g41560D                                          178   4e-49   Brassica napus [oilseed rape]
ref|XP_011627847.1|  PREDICTED: 40S ribosomal protein S11-1             176   9e-49   Amborella trichopoda
ref|XP_006586636.1|  PREDICTED: uncharacterized protein LOC100500...    177   1e-48   
gb|ABK22030.1|  unknown                                                 176   2e-48   Picea sitchensis
gb|EEE68230.1|  hypothetical protein OsJ_26414                          185   3e-48   Oryza sativa Japonica Group [Japonica rice]
gb|EMS61594.1|  40S ribosomal protein S11                               174   4e-48   Triticum urartu
ref|XP_010234462.1|  PREDICTED: 40S ribosomal protein S11-like is...    174   5e-48   
ref|XP_010048926.1|  PREDICTED: 40S ribosomal protein S11-like          174   7e-48   Eucalyptus grandis [rose gum]
ref|XP_003589042.1|  40S ribosomal protein S11                          174   1e-47   Medicago truncatula
ref|XP_010030990.1|  PREDICTED: 40S ribosomal protein S11               173   1e-47   Eucalyptus grandis [rose gum]
emb|CAE05213.3|  OSJNBa0070C17.20                                       173   3e-47   Oryza sativa Japonica Group [Japonica rice]
gb|EYU20230.1|  hypothetical protein MIMGU_mgv1a015021mg                170   6e-47   Erythranthe guttata [common monkey flower]
ref|NP_001175260.1|  Os07g0565101                                       170   7e-47   
gb|EMT05895.1|  40S ribosomal protein S11                               171   9e-47   
ref|XP_008219543.1|  PREDICTED: 40S ribosomal protein S11               170   2e-46   Prunus mume [ume]
tpg|DAA36048.1|  TPA: hypothetical protein ZEAMMB73_665324              168   2e-46   
gb|ACL53880.1|  unknown                                                 168   3e-46   Zea mays [maize]
gb|EYU20229.1|  hypothetical protein MIMGU_mgv1a015021mg                170   3e-46   Erythranthe guttata [common monkey flower]
gb|EYU32366.1|  hypothetical protein MIMGU_mgv1a015357mg                169   7e-46   Erythranthe guttata [common monkey flower]
ref|XP_009149783.1|  PREDICTED: 40S ribosomal protein S11-3-like ...    169   1e-45   Brassica rapa
gb|ERN17930.1|  hypothetical protein AMTR_s00046p00028310               168   3e-45   Amborella trichopoda
ref|XP_001761870.1|  predicted protein                                  167   3e-45   
ref|XP_009362323.1|  PREDICTED: 40S ribosomal protein S11-like          167   4e-45   
tpg|DAA37073.1|  TPA: hypothetical protein ZEAMMB73_529952              177   4e-45   
gb|KCW50240.1|  hypothetical protein EUGRSUZ_J00035                     166   5e-45   Eucalyptus grandis [rose gum]
ref|XP_007011791.1|  Ribosomal protein S11-beta                         167   6e-45   
ref|XP_001756109.1|  predicted protein                                  165   1e-44   
gb|EMT19025.1|  40S ribosomal protein S11                               166   4e-44   
ref|XP_010099867.1|  40S ribosomal protein S11                          164   6e-44   
gb|EEC77985.1|  hypothetical protein OsI_17370                          172   2e-43   Oryza sativa Indica Group [Indian rice]
gb|AAA34006.1|  ribosomal protein S11                                   159   9e-43   Glycine max [soybeans]
ref|XP_002982779.1|  hypothetical protein SELMODRAFT_268639             155   4e-41   Selaginella moellendorffii
ref|XP_008242908.1|  PREDICTED: 40S ribosomal protein S11-like          155   7e-41   Prunus mume [ume]
ref|XP_009338409.1|  PREDICTED: 40S ribosomal protein S11-like          155   8e-41   Pyrus x bretschneideri [bai li]
ref|XP_002158762.1|  PREDICTED: 40S ribosomal protein S11-like          149   1e-38   Hydra vulgaris
emb|CCQ18653.1|  40S ribosomal protein S11                              148   2e-38   Sycon ciliatum
ref|XP_005643310.1|  ribosomal protein S11 component of cytosolic...    147   4e-38   Coccomyxa subellipsoidea C-169
gb|AEI83509.1|  40S ribosomal protein S11                               146   8e-38   Wolffia arrhiza
ref|XP_001418420.1|  Ribosomal protein S11, component of cytosoli...    146   8e-38   Ostreococcus lucimarinus CCE9901
gb|KHG16535.1|  40S ribosomal S11                                       145   2e-37   Gossypium arboreum [tree cotton]
gb|ABD64589.1|  40S ribosomal protein S11                               145   3e-37   Chlamydomonas sp. ICE-L
ref|XP_003148073.1|  40S ribosomal protein S11                          145   3e-37   Loa loa
gb|AGH70195.1|  40S ribosomal protein S11                               144   4e-37   Placozoa sp. H4
ref|XP_008610788.1|  40S ribosomal protein S11                          144   5e-37   Saprolegnia diclina VS20
gb|ERG79209.1|  40s ribosomal protein s11                               144   5e-37   
ref|XP_002841871.1|  40S ribosomal protein S11                          144   6e-37   Tuber melanosporum Mel28
gb|AAX48887.1|  S11                                                     144   6e-37   Suberites domuncula
gb|EMF17289.1|  40S ribosomal protein S11                               144   7e-37   Sphaerulina musiva SO2202
gb|KHN77184.1|  40S ribosomal protein S11                               144   9e-37   Toxocara canis
ref|XP_001898199.1|  40S ribosomal protein S11                          144   9e-37   Brugia malayi [agent of lymphatic filariasis]
gb|EHK40336.1|  hypothetical protein TRIATDRAFT_302714                  144   1e-36   Trichoderma atroviride IMI 206040
ref|XP_002115583.1|  expressed hypothetical protein                     143   1e-36   Trichoplax adhaerens
gb|ABM55589.1|  putative ribosomal protein S11                          143   1e-36   Maconellicoccus hirsutus [pink hibiscus mealybug]
ref|XP_003382520.1|  PREDICTED: 40S ribosomal protein S11-like          143   1e-36   Amphimedon queenslandica
ref|XP_003323062.2|  40S ribosomal protein S11                          143   1e-36   Puccinia graminis f. sp. tritici CRL 75-36-700-3
ref|XP_008860970.1|  archaeal ribosomal protein S17P                    143   2e-36   Aphanomyces invadans
gb|KFZ16779.1|  hypothetical protein V502_04895                         143   2e-36   Pseudogymnoascus sp. VKM F-4520 (FW-2644)
gb|KFY96632.1|  hypothetical protein V500_02366                         143   2e-36   Pseudogymnoascus sp. VKM F-4518 (FW-2643)
ref|XP_009830155.1|  archaeal ribosomal protein S17P                    143   2e-36   Aphanomyces astaci
ref|XP_007408686.1|  hypothetical protein MELLADRAFT_35136              143   2e-36   Melampsora larici-populina 98AG31
ref|XP_002947898.1|  component of cytosolic 80S ribosome and 40S ...    142   2e-36   Volvox carteri f. nagariensis
gb|KIE01292.1|  Ribosomal protein S17                                   143   2e-36   Metarhizium majus ARSEF 297
emb|CCT63377.1|  probable 40s ribosomal protein s11.e, cytosolic        142   3e-36   Fusarium fujikuroi IMI 58289
ref|XP_001702980.1|  ribosomal protein S11, component of cytosoli...    142   3e-36   Chlamydomonas reinhardtii
ref|XP_011555771.1|  PREDICTED: 40S ribosomal protein S11 isoform X2    142   3e-36   Plutella xylostella [cabbage moth]
ref|XP_003059480.1|  predicted protein                                  142   3e-36   Micromonas pusilla CCMP1545
gb|EMT61393.1|  40S ribosomal protein S11-B                             142   3e-36   Fusarium oxysporum f. sp. cubense race 4
emb|CDR37295.1|  RHTO0S02e13058g1_1                                     142   3e-36   Rhodotorula toruloides
ref|NP_001155823.1|  40S ribosomal protein S11                          142   3e-36   Acyrthosiphon pisum
gb|KFY68897.1|  hypothetical protein V496_00720                         142   3e-36   Pseudogymnoascus sp. VKM F-4515 (FW-2607)
emb|CEF98300.1|  Ribosomal protein S17                                  141   4e-36   Ostreococcus tauri
ref|XP_002501446.1|  ribosomal protein                                  142   4e-36   Micromonas commoda
gb|ELR05457.1|  40S ribosomal protein S11                               142   4e-36   Pseudogymnoascus destructans 20631-21
gb|ELU08745.1|  hypothetical protein CAPTEDRAFT_165333                  142   4e-36   Capitella teleta
ref|XP_002901699.1|  40S ribosomal protein S11                          142   5e-36   Phytophthora infestans T30-4
ref|XP_008470793.1|  PREDICTED: 40S ribosomal protein S11 isoform X2    141   5e-36   Diaphorina citri
ref|XP_007920165.1|  hypothetical protein MYCFIDRAFT_55564              142   5e-36   Pseudocercospora fijiensis CIRAD86
gb|KFY31291.1|  hypothetical protein V493_01246                         142   5e-36   Pseudogymnoascus sp. VKM F-4281 (FW-2241)
gb|KFY00910.1|  hypothetical protein O988_03033                         142   5e-36   Pseudogymnoascus sp. VKM F-3808
ref|XP_011412459.1|  PREDICTED: 40S ribosomal protein S11-like          141   5e-36   Crassostrea gigas
gb|KFY15673.1|  hypothetical protein V491_05601                         141   6e-36   Pseudogymnoascus sp. VKM F-3775
gb|EYB33503.1|  hypothetical protein FG05_00671                         142   6e-36   Fusarium graminearum
ref|XP_009252037.1|  hypothetical protein FPSE_00642                    142   6e-36   Fusarium pseudograminearum CS3096
ref|XP_007292620.1|  40S ribosomal protein S11                          141   6e-36   Marssonina brunnea f. sp. 'multigermtubi' MB_m1
gb|KHN96715.1|  40S ribosomal protein S11                               142   7e-36   Metarhizium album ARSEF 1941
ref|XP_001560156.1|  40S ribosomal protein S11                          141   7e-36   Botrytis cinerea B05.10
ref|XP_003659345.1|  hypothetical protein MYCTH_2088473                 141   8e-36   Thermothelomyces thermophila ATCC 42464
gb|KHG21494.1|  40S ribosomal S11                                       140   8e-36   Gossypium arboreum [tree cotton]
dbj|GAO17180.1|  hypothetical protein UVI_045350                        141   8e-36   Ustilaginoidea virens
gb|KIH88584.1|  small subunit ribosomal protein S11e                    141   8e-36   Sporothrix brasiliensis 5110
gb|ERT02285.1|  40S ribosomal protein S11                               141   8e-36   Sporothrix schenckii ATCC 58251
gb|EXV02037.1|  40S ribosomal protein S17                               141   8e-36   Metarhizium robertsii
gb|EPE10077.1|  40s ribosomal protein s11                               141   8e-36   Ophiostoma piceae UAMH 11346
gb|KHJ35420.1|  putative 40s ribosomal protein s11                      141   9e-36   Erysiphe necator
ref|XP_007797900.1|  putative 40s ribosomal protein s11 protein         141   9e-36   
gb|KFG78441.1|  40S ribosomal protein S11                               141   9e-36   Metarhizium anisopliae
ref|XP_006696347.1|  40S ribosomal protein S11-like protein             141   9e-36   Chaetomium thermophilum var. thermophilum DSM 1495
ref|XP_011316367.1|  40S ribosomal protein S11                          141   1e-35   Fusarium graminearum PH-1
gb|ESX00172.1|  40S ribosomal protein S11-A                             140   1e-35   Ogataea parapolymorpha DL-1
gb|KID89820.1|  Ribosomal protein S17                                   141   1e-35   Metarhizium guizhouense ARSEF 977
ref|XP_011555770.1|  PREDICTED: 40S ribosomal protein S11 isoform X1    140   1e-35   Plutella xylostella [cabbage moth]
gb|ABZ04263.1|  ribosomal protein rps11                                 140   1e-35   Lineus viridis
gb|KFY15274.1|  hypothetical protein V492_02114                         143   1e-35   Pseudogymnoascus sp. VKM F-4246
gb|KEZ42227.1|  hypothetical protein SAPIO_CDS6080                      140   1e-35   Scedosporium apiospermum
ref|XP_964961.1|  40S ribosomal protein S11                             140   1e-35   Neurospora crassa OR74A
ref|XP_011305230.1|  PREDICTED: 40S ribosomal protein S11               140   1e-35   Fopius arisanus
gb|EFX82959.1|  hypothetical protein DAPPUDRAFT_230714                  140   1e-35   Daphnia pulex
gb|EPQ62013.1|  Protein component of the small (40S) ribosomal su...    140   1e-35   Blumeria graminis f. sp. tritici 96224
ref|XP_002432586.1|  40S ribosomal protein S11, putative                140   1e-35   Pediculus humanus corporis [human body lice]
gb|EFW99488.1|  40S ribosomal protein s11                               140   1e-35   Grosmannia clavigera kw1407
ref|XP_003716203.1|  40S ribosomal protein S11                          140   1e-35   Magnaporthe oryzae 70-15
ref|XP_002620373.1|  40S ribosomal protein S11                          140   2e-35   Blastomyces gilchristii SLH14081
ref|XP_003652243.1|  40S ribosomal protein S11                          140   2e-35   Thielavia terrestris NRRL 8126
ref|XP_006966565.1|  hypothetical protein TRIREDRAFT_122587             140   2e-35   Trichoderma reesei QM6a
gb|EHK25200.1|  hypothetical protein TRIVIDRAFT_79227                   140   2e-35   Trichoderma virens Gv29-8
emb|CEF72646.1|  unnamed protein product                                140   2e-35   
ref|XP_008595076.1|  40S ribosomal protein S11                          141   2e-35   Beauveria bassiana ARSEF 2860
ref|XP_001639879.1|  predicted protein                                  140   2e-35   Nematostella vectensis
gb|EWG36522.1|  40S ribosomal protein S11                               140   2e-35   Fusarium verticillioides 7600
gb|AAO92287.1|  40S ribosomal protein S11                               139   2e-35   Dermacentor variabilis
ref|XP_009224414.1|  40S ribosomal protein S11                          140   2e-35   Gaeumannomyces tritici R3-111a-1
gb|KIL84538.1|  40s ribosomal protein s11                               140   2e-35   Fusarium avenaceum
ref|XP_001537464.1|  40S ribosomal protein S11                          140   3e-35   Histoplasma capsulatum NAm1
gb|KJX99765.1|  40s ribosomal protein s11                               139   3e-35   Zymoseptoria brevis
ref|XP_007276194.1|  40s ribosomal protein s11                          139   3e-35   
ref|XP_002791628.1|  40S ribosomal protein S11                          139   3e-35   Paracoccidioides lutzii Pb01
ref|XP_002849541.1|  40S ribosomal protein S11                          139   3e-35   Microsporum canis CBS 113480
ref|XP_001507045.1|  PREDICTED: 40S ribosomal protein S11               138   3e-35   
gb|KIM97508.1|  hypothetical protein OIDMADRAFT_20590                   139   3e-35   Oidiodendron maius Zn
gb|KGG51260.1|  hypothetical protein DI09_3p220                         139   3e-35   Mitosporidium daphniae
dbj|BAM17738.1|  ribosomal protein S11                                  139   3e-35   Papilio xuthus [Chinese swallowtail]
ref|XP_001220066.1|  40S ribosomal protein S11                          138   3e-35   Chaetomium globosum CBS 148.51
gb|KFH68814.1|  40S ribosomal protein S11                               139   3e-35   Mortierella verticillata NRRL 6337
ref|XP_003348336.1|  40S ribosomal protein S11                          139   3e-35   
ref|XP_012153964.1|  PREDICTED: 40S ribosomal protein S11 isoform X2    138   4e-35   
ref|XP_007813619.1|  40S ribosomal protein S11                          140   4e-35   
gb|KKA22820.1|  40S ribosomal protein S11                               139   4e-35   
ref|XP_007914554.1|  putative 40s ribosomal protein s11 protein         139   4e-35   
ref|XP_001240883.1|  40S ribosomal protein S11                          139   4e-35   
ref|XP_002483612.1|  40S ribosomal protein S11                          139   4e-35   
ref|XP_006220152.1|  PREDICTED: 40S ribosomal protein S11-like          137   4e-35   
ref|XP_010991488.1|  PREDICTED: 40S ribosomal protein S11               139   4e-35   
gb|ABI52698.1|  40S ribosomal protein S11                               139   5e-35   
gb|ACY71278.1|  ribosomal protein S11                                   139   5e-35   
ref|XP_001908839.1|  hypothetical protein                               139   5e-35   
gb|AII98113.1|  BLTX795                                                 139   5e-35   
gb|ABR27861.1|  40S ribosomal protein S11                               140   5e-35   
ref|XP_002542812.1|  40S ribosomal protein S11                          139   5e-35   
emb|CEJ89080.1|  Putative 40S ribosomal protein S11                     139   6e-35   
gb|AAN05599.1|  ribosomal protein S11                                   138   7e-35   
ref|XP_001589541.1|  40S ribosomal protein S11                          138   7e-35   
ref|XP_003170224.1|  40S ribosomal protein S11                          138   8e-35   
ref|XP_003700346.1|  PREDICTED: 40S ribosomal protein S11 isoform X1    138   8e-35   
ref|XP_001383352.1|  40S ribosomal protein S11                          138   8e-35   
gb|AII97645.1|  BLTX251                                                 138   8e-35   
gb|ESZ94422.1|  40S ribosomal protein S11                               138   9e-35   
ref|XP_008470786.1|  PREDICTED: 40S ribosomal protein S11 isoform X1    138   9e-35   
gb|AEB54646.1|  ribosomal protein S11                                   138   1e-34   
ref|XP_002829609.1|  PREDICTED: 40S ribosomal protein S11               136   1e-34   
ref|XP_004597224.1|  PREDICTED: 40S ribosomal protein S11               138   1e-34   
ref|XP_001363138.1|  PREDICTED: 40S ribosomal protein S11               137   1e-34   
gb|KEY65160.1|  hypothetical protein S7711_04250                        139   1e-34   
ref|XP_007941031.1|  PREDICTED: 40S ribosomal protein S11               137   1e-34   
ref|XP_007003936.1|  hypothetical protein TREMEDRAFT_38602              137   1e-34   
ref|XP_005689754.1|  PREDICTED: 40S ribosomal protein S11-like          137   1e-34   
ref|XP_008723287.1|  40S ribosomal protein S11                          138   1e-34   
ref|XP_001492034.1|  PREDICTED: 40S ribosomal protein S11               137   1e-34   
ref|XP_004343181.1|  ribosomal protein S11                              137   1e-34   
ref|XP_007753775.1|  40S ribosomal protein S11                          137   1e-34   
gb|ABR23471.1|  40S ribosomal protein S11                               137   1e-34   
gb|ESA19990.1|  hypothetical protein GLOINDRAFT_343834                  137   1e-34   
ref|XP_011339198.1|  PREDICTED: 40S ribosomal protein S11               137   1e-34   
ref|NP_001106708.1|  ribosomal protein S11 isoform 1                    137   1e-34   
ref|XP_003053807.1|  40S ribosomal protein S11                          137   1e-34   
ref|XP_004368153.1|  ribosomal protein S17, putative                    137   2e-34   
ref|NP_001019739.1|  40S ribosomal protein S11                          137   2e-34   
ref|XP_011053203.1|  PREDICTED: 40S ribosomal protein S11-like          137   2e-34   
gb|KIV94214.1|  40S ribosomal protein S11                               137   2e-34   
gb|AAH58465.1|  Ribosomal protein S11                                   137   2e-34   
ref|NP_001080676.1|  40S ribosomal protein S11                          137   2e-34   
ref|XP_010872877.1|  PREDICTED: 40S ribosomal protein S11               137   2e-34   
gb|KIW72189.1|  40S ribosomal protein S11                               137   2e-34   
ref|XP_007840090.1|  40S ribosomal protein S11-B                        137   2e-34   
gb|ABE73519.1|  ribosomal protein S11                                   136   2e-34   
gb|KIX00453.1|  40S ribosomal protein S11                               137   2e-34   
ref|XP_002150585.1|  40S ribosomal protein S11                          137   2e-34   
ref|XP_008120642.1|  PREDICTED: 40S ribosomal protein S11               137   2e-34   
ref|XP_003696299.1|  PREDICTED: 40S ribosomal protein S11-like          137   2e-34   
gb|AAX29372.1|  ribosomal protein S11                                   137   2e-34   
gb|EIF46030.1|  40s ribosomal protein s11                               137   2e-34   
ref|NP_001006.1|  40S ribosomal protein S11                             137   2e-34   
sp|P41115.1|RS11_XENLA  RecName: Full=40S ribosomal protein S11         137   2e-34   
sp|P42756.1|RS11_DUNTE  RecName: Full=40S ribosomal protein S11         137   2e-34   
dbj|GAM38479.1|  40S ribosomal protein                                  137   2e-34   
ref|XP_007597210.1|  ribosomal protein S17                              137   2e-34   
gb|AAY66952.1|  40S ribosomal protein S11                               137   2e-34   
emb|CAJ17183.1|  ribosomal protein S11e                                 137   2e-34   
ref|XP_002731417.1|  PREDICTED: 40S ribosomal protein S11-like          137   2e-34   
ref|XP_007803015.1|  40S ribosomal protein S11                          137   2e-34   
dbj|BAB23843.1|  unnamed protein product                                137   2e-34   
emb|CCI40506.1|  unnamed protein product                                137   2e-34   
ref|XP_008084795.1|  Nucleic acid-binding protein                       137   2e-34   
gb|ADV03049.1|  ribosomal protein S11                                   137   2e-34   
gb|EFQ25346.1|  ribosomal protein S17                                   137   2e-34   
ref|XP_003395706.1|  PREDICTED: 40S ribosomal protein S11-like          137   2e-34   
sp|Q9XSU4.2|RS11_CANFA  RecName: Full=40S ribosomal protein S11         137   3e-34   
ref|NP_001026004.1|  40S ribosomal protein S11                          137   3e-34   
gb|KEQ70704.1|  putative 40S ribosomal protein S11-B                    137   3e-34   
ref|XP_005230846.1|  PREDICTED: 40S ribosomal protein S11-like          137   3e-34   
ref|XP_005664771.1|  PREDICTED: 40S ribosomal protein S11 isoform X1    136   3e-34   
ref|XP_002491500.1|  40S ribosomal protein S11                          136   3e-34   
gb|EYC29909.1|  hypothetical protein Y032_0005g2327                     137   3e-34   
gb|KJZ77328.1|  hypothetical protein HIM_03052                          139   3e-34   
ref|XP_007735993.1|  40S ribosomal protein S11                          137   3e-34   
ref|XP_007716446.1|  hypothetical protein COCCADRAFT_29638              136   3e-34   
dbj|BAN20146.1|  ribosomal protein S11                                  136   3e-34   
emb|CCE33266.1|  probable 40s ribosomal protein s11.e, cytosolic        136   3e-34   
emb|CCA19404.1|  40S ribosomal protein S11 putative                     136   3e-34   
ref|XP_003005854.1|  40S ribosomal protein S11                          136   4e-34   
gb|KIW42686.1|  40S ribosomal protein S11                               136   4e-34   
ref|XP_007699400.1|  hypothetical protein COCSADRAFT_170685             136   4e-34   
ref|XP_005842843.1|  hypothetical protein CHLNCDRAFT_37706              136   4e-34   
gb|ETN78129.1|  ribosomal protein S17                                   135   4e-34   
gb|KIW17565.1|  40S ribosomal protein S11                               136   4e-34   
gb|KDR16697.1|  40S ribosomal protein S11                               136   4e-34   
ref|XP_007684806.1|  hypothetical protein COCMIDRAFT_2527               136   4e-34   
ref|XP_001941535.1|  40S ribosomal protein S11                          136   4e-34   
gb|EQK97980.1|  Ribosomal protein S17                                   139   4e-34   
gb|KIW98718.1|  40S ribosomal protein S11                               136   4e-34   
gb|KIX93783.1|  40S ribosomal protein S11                               136   4e-34   
ref|XP_007998197.1|  PREDICTED: 40S ribosomal protein S11-like          136   4e-34   
gb|KFM09336.1|  40S ribosomal protein S11                               136   4e-34   
ref|XP_009648215.1|  40S ribosomal protein S11                          136   4e-34   
ref|XP_003233956.1|  40S ribosomal protein S11                          136   4e-34   
ref|XP_003302475.1|  40S ribosomal protein S11                          136   4e-34   
gb|ABW90417.1|  putative ribosomal protein S11                          136   4e-34   
gb|EKG21256.1|  Ribosomal protein S17                                   136   4e-34   
gb|KGL93721.1|  40S ribosomal protein S11                               136   4e-34   
emb|CCF41628.1|  40S ribosomal protein S11                              136   4e-34   
ref|XP_007728122.1|  40S ribosomal protein S11                          136   5e-34   
gb|KDB13118.1|  40s ribosomal protein S11                               143   5e-34   
gb|KHG16468.1|  40S ribosomal S11                                       135   5e-34   
emb|CDW53800.1|  Ribosomal S17 domain containing protein                136   6e-34   
gb|KJK79722.1|  hypothetical protein H634G_05314                        143   6e-34   
gb|ELK29561.1|  40S ribosomal protein S11                               135   6e-34   
ref|XP_001260046.1|  40S ribosomal protein S11                          135   6e-34   
gb|KIW30255.1|  40S ribosomal protein S11                               136   6e-34   
ref|NP_001005113.1|  ribosomal protein S11                              135   6e-34   
ref|XP_005996772.1|  PREDICTED: LOW QUALITY PROTEIN: 40S ribosoma...    137   6e-34   
gb|ADT80671.1|  ribosomal protein S11 isoform 1                         135   6e-34   
gb|KEQ63360.1|  40S ribosomal protein S11                               135   6e-34   
gb|KIW61958.1|  40S ribosomal protein S11                               135   6e-34   
ref|XP_011399858.1|  40S ribosomal protein S11                          135   6e-34   
ref|XP_001803831.1|  hypothetical protein SNOG_13626                    135   7e-34   
gb|ADT80670.1|  ribosomal protein S11 isoform 2                         135   7e-34   
ref|XP_009152832.1|  40S ribosomal protein S11                          135   7e-34   
ref|NP_001232080.1|  putative ribosomal protein S11                     135   7e-34   
ref|XP_006262496.1|  PREDICTED: 40S ribosomal protein S11-like          135   7e-34   
ref|XP_007739187.1|  40S ribosomal protein S11                          135   7e-34   
gb|EPQ03678.1|  40S ribosomal protein S11                               135   7e-34   
gb|EMG47972.1|  Protein component of the small (40S) ribosomal su...    135   7e-34   
ref|XP_006614024.1|  PREDICTED: 40S ribosomal protein S11-like is...    136   7e-34   
emb|CEI85848.1|  Putative RPYS18 protein                                135   7e-34   
ref|XP_003853041.1|  40S ribosomal protein S11                          135   7e-34   
ref|XP_003834224.1|  similar to 40S ribosomal protein S11               135   8e-34   
emb|CEG64053.1|  Putative RPYS18 protein                                135   8e-34   
gb|EGU78363.1|  hypothetical protein FOXB_11114                         135   8e-34   
ref|XP_010848409.1|  PREDICTED: 40S ribosomal protein S11-like          135   8e-34   
ref|NP_001291096.1|  ribosomal protein S11                              135   8e-34   
gb|AEL28851.1|  ribosomal protein S11                                   135   8e-34   
gb|ADV03029.1|  ribosomal protein S11                                   135   9e-34   
ref|XP_001272771.1|  40S ribosomal protein S11                          135   9e-34   
gb|AAK59928.1|AF379640_1  ribosomal protein S11                         135   9e-34   
ref|XP_007558258.1|  PREDICTED: 40S ribosomal protein S11               135   9e-34   
ref|NP_001037111.1|  ribosomal protein S11 isoform 2                    135   9e-34   
ref|XP_005859830.1|  PREDICTED: 40S ribosomal protein S11-like          136   9e-34   
ref|XP_001030186.1|  ribosomal protein S17 containing protein           135   1e-33   
gb|KIH55043.1|  CDC50 family protein, LEM3 family                       135   1e-33   
ref|XP_008028385.1|  hypothetical protein SETTUDRAFT_155266             135   1e-33   
gb|KIW80430.1|  40S ribosomal protein S11                               135   1e-33   
emb|CCX31886.1|  Similar to 40S ribosomal protein S11-A; acc. no....    135   1e-33   
ref|XP_005037104.1|  PREDICTED: 40S ribosomal protein S11-like is...    135   1e-33   
tpe|CAL69097.1|  TPA: putative 40S ribosomal protein S11 isoform 1      135   1e-33   
ref|XP_004196145.1|  Piso0_005592                                       135   1e-33   
gb|KIK70963.1|  hypothetical protein GYMLUDRAFT_33052                   135   1e-33   
ref|XP_007579944.1|  putative 40s ribosomal protein s11 protein         135   1e-33   
ref|XP_749545.1|  40S ribosomal protein S11                             135   1e-33   
gb|KFQ26180.1|  40S ribosomal protein S11                               135   1e-33   
ref|XP_011498635.1|  PREDICTED: 40S ribosomal protein S11               135   1e-33   
ref|XP_002766754.1|  40S ribosomal protein S11, putative                135   1e-33   
gb|AFM87671.1|  40S ribosomal protein S11                               135   1e-33   
gb|AFM86650.1|  putative ribosomal protein S11                          135   1e-33   
gb|ELK28586.1|  40S ribosomal protein S11                               137   1e-33   
gb|AEE62007.1|  unknown                                                 134   1e-33   
ref|NP_001279140.1|  ribosomal protein S11                              135   1e-33   
ref|XP_008934728.1|  PREDICTED: 40S ribosomal protein S11               135   1e-33   
ref|XP_003279788.1|  PREDICTED: 40S ribosomal protein S11-like is...    135   1e-33   
ref|XP_002420385.1|  40S ribosomal protein S11                          135   1e-33   
gb|EGE06855.1|  40S ribosomal protein S11                               135   1e-33   
ref|XP_011809390.1|  PREDICTED: 40S ribosomal protein S11-like          135   1e-33   
ref|XP_002750334.1|  PREDICTED: 40S ribosomal protein S11-like          135   1e-33   
dbj|GAD94975.1|  40S ribosomal protein S11                              135   1e-33   
gb|KKA78325.1|  ribosomal protein                                       135   1e-33   
ref|XP_004040146.1|  hypothetical protein IMG5_000700                   135   1e-33   
gb|KIY64191.1|  hypothetical protein CYLTODRAFT_381196                  134   1e-33   
ref|XP_004032536.1|  hypothetical protein IMG5_120550                   134   1e-33   
ref|XP_008556574.1|  PREDICTED: 40S ribosomal protein S11               134   1e-33   
ref|XP_566991.1|  ribosomal protein S11                                 134   1e-33   
ref|XP_004195051.1|  Piso0_005592                                       134   1e-33   
gb|ACS92720.1|  ribosomal protein S11e                                  134   2e-33   
ref|XP_003037299.1|  40S ribosomal protein S11                          134   2e-33   
ref|XP_008208376.1|  PREDICTED: 40S ribosomal protein S11               134   2e-33   
ref|XP_009332519.1|  PREDICTED: 40S ribosomal protein S11               136   2e-33   
gb|KFM69029.1|  40S ribosomal protein S11                               132   2e-33   
gb|KIV78116.1|  40S ribosomal protein S11                               134   2e-33   
ref|XP_006110309.1|  PREDICTED: 40S ribosomal protein S11-like          137   2e-33   
ref|XP_006107850.1|  PREDICTED: 40S ribosomal protein S11               134   2e-33   
gb|EFB23939.1|  hypothetical protein PANDA_006272                       134   2e-33   
ref|XP_008719121.1|  40S ribosomal protein S11                          134   2e-33   
ref|XP_007777835.1|  40S ribosomal protein S11                          134   2e-33   
gb|AAX62419.1|  ribosomal protein S11                                   134   2e-33   
ref|XP_010411544.1|  PREDICTED: 40S ribosomal protein S11               134   2e-33   
ref|XP_002718781.1|  PREDICTED: 40S ribosomal protein S11-like          134   2e-33   
gb|EME48396.1|  hypothetical protein DOTSEDRAFT_39766                   134   2e-33   
emb|CDX96205.1|  BnaC02g14460D                                          134   2e-33   
gb|KIM21521.1|  hypothetical protein M408DRAFT_102891                   134   2e-33   
ref|XP_008195119.1|  PREDICTED: 40S ribosomal protein S11 isoform X1    134   2e-33   
ref|XP_003191621.1|  ribosomal protein S11                              134   2e-33   
ref|XP_007375354.1|  hypothetical protein SPAPADRAFT_61162              134   2e-33   
gb|EZF24360.1|  40S ribosomal protein S11                               137   2e-33   
gb|ACY95332.1|  ribosomal protein S11-2                                 134   2e-33   
gb|KDD74259.1|  hypothetical protein H632_c1451p1                       134   2e-33   
gb|KEF63246.1|  40S ribosomal protein S11                               134   2e-33   
ref|XP_662826.1|  hypothetical protein AN5222.2                         134   2e-33   
gb|KEQ97871.1|  hypothetical protein AUEXF2481DRAFT_63329               134   2e-33   
ref|XP_009577263.1|  PREDICTED: 40S ribosomal protein S11               134   2e-33   
gb|EJY85778.1|  40S ribosomal protein rpS11e                            134   2e-33   
gb|ACD65144.1|  putative 40S ribosomal protein RPS11                    134   3e-33   
ref|XP_011276817.1|  40S ribosomal protein S11                          134   3e-33   
gb|AAV91402.1|  ribosomal protein 4                                     134   3e-33   
emb|CDR41874.1|  CYFA0S08e01046g1_1                                     134   3e-33   
emb|CAH04326.1|  S11e ribosomal protein                                 134   3e-33   
ref|XP_011117184.1|  hypothetical protein AOL_s00004g232                134   3e-33   
gb|EWC44663.1|  40S ribosomal protein S11-B                             134   3e-33   
gb|EZF24359.1|  40S ribosomal protein S11                               137   4e-33   
gb|AIU94808.1|  40S ribosomal protein                                   133   4e-33   
ref|XP_010791578.1|  PREDICTED: 40S ribosomal protein S11               134   4e-33   
ref|XP_009883848.1|  PREDICTED: 40S ribosomal protein S11               134   4e-33   
gb|KDE05824.1|  40S ribosomal protein S11                               133   4e-33   
emb|CAA06411.1|  40S ribosomal protein S11                              133   5e-33   
gb|ACO15454.1|  40S ribosomal protein S11                               133   5e-33   
emb|CDW82785.1|  40s ribosomal protein                                  133   5e-33   
ref|XP_007948352.1|  PREDICTED: 40S ribosomal protein S11-like          133   5e-33   
ref|XP_009541115.1|  hypothetical protein HETIRDRAFT_406926             133   5e-33   



>dbj|BAE32324.1| unnamed protein product [Mus musculus]
 dbj|BAE29008.1| unnamed protein product [Mus musculus]
Length=242

 Score =   194 bits (494),  Expect(2) = 1e-72, Method: Compositional matrix adjust.
 Identities = 170/171 (99%), Positives = 170/171 (99%), Gaps = 0/171 (0%)
 Frame = +3

Query  780   MQMSPGGSNPPSPRLPGTLALAPSSRAPACPELWSPILPEAADLLGAQRLSGYaaagarv  959
             MQMSPGGSNPPSPRLPGTLALAPSSRAPACPELWSPILPEAADLLGAQRLSGYAAAGARV
Sbjct  1     MQMSPGGSNPPSPRLPGTLALAPSSRAPACPELWSPILPEAADLLGAQRLSGYAAAGARV  60

Query  960   maavraaaSDTKCSERTSAARRSQGSPSLRAAPRRSTRPVHSSSargrdpggvrpraraa  1139
             MAAVRAAASDTKCSERTSAARRSQGSPSLRAAPRRSTRPVHSSSARGRDPGGVRPRARAA
Sbjct  61    MAAVRAAASDTKCSERTSAARRSQGSPSLRAAPRRSTRPVHSSSARGRDPGGVRPRARAA  120

Query  1140  rgSTSSPRKFrpavpryfpppqprpparrpprnprTAQQVCARVPACVCLH  1292
             RGSTSSPRKFRPAVPRYFPPPQPRPPARRPPRNPRTAQQVCARVPACVCL 
Sbjct  121   RGSTSSPRKFRPAVPRYFPPPQPRPPARRPPRNPRTAQQVCARVPACVCLR  171


 Score =   108 bits (271),  Expect(2) = 1e-72, Method: Compositional matrix adjust.
 Identities = 56/57 (98%), Positives = 56/57 (98%), Gaps = 0/57 (0%)
 Frame = +1

Query  1330  TPARHLPSSLSSTIISGAPCPAAARLGREKGGDSGRALAGRPVLGQLAGSNYPLVRL  1500
             TPARHLPSSLSSTIISGAPCPAAARLGREKG DSGRALAGRPVLGQLAGSNYPLVRL
Sbjct  184   TPARHLPSSLSSTIISGAPCPAAARLGREKGADSGRALAGRPVLGQLAGSNYPLVRL  240



>ref|XP_006450366.1| hypothetical protein CICLE_v10009763mg [Citrus clementina]
 ref|XP_006483413.1| PREDICTED: 40S ribosomal protein S11-like [Citrus sinensis]
 gb|ESR63606.1| hypothetical protein CICLE_v10009763mg [Citrus clementina]
 gb|KDO61814.1| hypothetical protein CISIN_1g031480mg [Citrus sinensis]
Length=159

 Score =   192 bits (487),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 105/108 (97%), Positives = 105/108 (97%), Gaps = 0/108 (0%)
 Frame = +1

Query  76   MAEQTEKAFLKQPGVFLSSkktgkgkrpgkggNRFWKSIGLGFKTPREATEGTYIDKKCP  255
            MAEQTEKAFLKQP VFLSSKK GKGKRPGKGGNRFWKSIGLGFKTPREA EGTYIDKKCP
Sbjct  1    MAEQTEKAFLKQPKVFLSSKKAGKGKRPGKGGNRFWKSIGLGFKTPREAIEGTYIDKKCP  60

Query  256  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNI  399
            FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNI
Sbjct  61   FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNI  108



>gb|KDO61816.1| hypothetical protein CISIN_1g031480mg [Citrus sinensis]
Length=130

 Score =   191 bits (484),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 105/108 (97%), Positives = 105/108 (97%), Gaps = 0/108 (0%)
 Frame = +1

Query  76   MAEQTEKAFLKQPGVFLSSkktgkgkrpgkggNRFWKSIGLGFKTPREATEGTYIDKKCP  255
            MAEQTEKAFLKQP VFLSSKK GKGKRPGKGGNRFWKSIGLGFKTPREA EGTYIDKKCP
Sbjct  1    MAEQTEKAFLKQPKVFLSSKKAGKGKRPGKGGNRFWKSIGLGFKTPREAIEGTYIDKKCP  60

Query  256  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNI  399
            FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNI
Sbjct  61   FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNI  108



>ref|XP_002526494.1| 40S ribosomal protein S11, putative [Ricinus communis]
 gb|EEF35885.1| 40S ribosomal protein S11, putative [Ricinus communis]
Length=159

 Score =   191 bits (485),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 105/108 (97%), Positives = 106/108 (98%), Gaps = 0/108 (0%)
 Frame = +1

Query  76   MAEQTEKAFLKQPGVFLSSkktgkgkrpgkggNRFWKSIGLGFKTPREATEGTYIDKKCP  255
            MAEQTEKAFLKQP VFLSSKKTGKGKRPGKGGNRFWKSIGLGFKTPREA EGTYIDKKCP
Sbjct  1    MAEQTEKAFLKQPKVFLSSKKTGKGKRPGKGGNRFWKSIGLGFKTPREAIEGTYIDKKCP  60

Query  256  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNI  399
            FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHF+KKYQRYEKRHSNI
Sbjct  61   FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFIKKYQRYEKRHSNI  108



>ref|XP_003549708.1| PREDICTED: 40S ribosomal protein S11-like [Glycine max]
 gb|KHN18603.1| 40S ribosomal protein S11 [Glycine soja]
Length=159

 Score =   190 bits (482),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 104/108 (96%), Positives = 105/108 (97%), Gaps = 0/108 (0%)
 Frame = +1

Query  76   MAEQTEKAFLKQPGVFLSSkktgkgkrpgkggNRFWKSIGLGFKTPREATEGTYIDKKCP  255
            MAEQTEKAFLKQP VFLSSKKTGKGKRPGKGGNRFWKSIGLGFKTPREA EGTYIDKKCP
Sbjct  1    MAEQTEKAFLKQPKVFLSSKKTGKGKRPGKGGNRFWKSIGLGFKTPREAIEGTYIDKKCP  60

Query  256  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNI  399
            FTG VSIRGRILAGTCHSAKMNRTIIVRRNYLHF+KKYQRYEKRHSNI
Sbjct  61   FTGNVSIRGRILAGTCHSAKMNRTIIVRRNYLHFIKKYQRYEKRHSNI  108



>ref|XP_008800685.1| PREDICTED: 40S ribosomal protein S11-like [Phoenix dactylifera]
Length=159

 Score =   189 bits (481),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 102/109 (94%), Positives = 104/109 (95%), Gaps = 0/109 (0%)
 Frame = +1

Query  76   MAEQTEKAFLKQPGVFLSSkktgkgkrpgkggNRFWKSIGLGFKTPREATEGTYIDKKCP  255
            MAEQTE+AFLKQP VFLSSKK  KGKRPGKGGNRFWKSIGLGFKTPREA EGTYIDKKCP
Sbjct  1    MAEQTERAFLKQPKVFLSSKKPSKGKRPGKGGNRFWKSIGLGFKTPREAIEGTYIDKKCP  60

Query  256  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIA  402
            FTG VSIRGRILAGTCHSAKMNRTIIVRRNYLH+VKKYQRYEKRHSNIA
Sbjct  61   FTGNVSIRGRILAGTCHSAKMNRTIIVRRNYLHYVKKYQRYEKRHSNIA  109



>ref|XP_004976788.1| PREDICTED: 40S ribosomal protein S11-like [Setaria italica]
Length=161

 Score =   189 bits (481),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 102/108 (94%), Positives = 106/108 (98%), Gaps = 0/108 (0%)
 Frame = +1

Query  76   MAEQTEKAFLKQPGVFLSSkktgkgkrpgkggNRFWKSIGLGFKTPREATEGTYIDKKCP  255
            MAEQTEKAFLKQP VFLS+KK+GKGK+PGKGGNRFWKSIGLGFKTPREA EGTYIDKKCP
Sbjct  1    MAEQTEKAFLKQPKVFLSTKKSGKGKKPGKGGNRFWKSIGLGFKTPREAIEGTYIDKKCP  60

Query  256  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNI  399
            FTGTVSIRGRI+AGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNI
Sbjct  61   FTGTVSIRGRIIAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNI  108



>ref|XP_010904992.1| PREDICTED: 40S ribosomal protein S11 isoform X2 [Elaeis guineensis]
Length=133

 Score =   188 bits (478),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 103/109 (94%), Positives = 105/109 (96%), Gaps = 0/109 (0%)
 Frame = +1

Query  76   MAEQTEKAFLKQPGVFLSSkktgkgkrpgkggNRFWKSIGLGFKTPREATEGTYIDKKCP  255
            MAEQTE+AFLKQP VFL SKK GKGKRPGKGGNRFWKSIGLGFKTPREA EGTYIDKKCP
Sbjct  1    MAEQTERAFLKQPKVFLCSKKAGKGKRPGKGGNRFWKSIGLGFKTPREAIEGTYIDKKCP  60

Query  256  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIA  402
            FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLH+VKKYQRYEKRHSNIA
Sbjct  61   FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHYVKKYQRYEKRHSNIA  109



>ref|XP_004492502.1| PREDICTED: 40S ribosomal protein S11-like [Cicer arietinum]
 ref|XP_004508404.1| PREDICTED: 40S ribosomal protein S11-like [Cicer arietinum]
Length=160

 Score =   189 bits (480),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 103/108 (95%), Positives = 105/108 (97%), Gaps = 0/108 (0%)
 Frame = +1

Query  76   MAEQTEKAFLKQPGVFLSSkktgkgkrpgkggNRFWKSIGLGFKTPREATEGTYIDKKCP  255
            MAEQTEKAFLKQP VFL SKK+GKGKRPGKGGNRFWKSIGLGFKTPREATEGTYIDKKCP
Sbjct  1    MAEQTEKAFLKQPKVFLCSKKSGKGKRPGKGGNRFWKSIGLGFKTPREATEGTYIDKKCP  60

Query  256  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNI  399
            FTG VSIRGRILAGTCHSAKMNRTIIVRRNYLHF+KKYQRYEKRHSNI
Sbjct  61   FTGNVSIRGRILAGTCHSAKMNRTIIVRRNYLHFIKKYQRYEKRHSNI  108



>sp|Q9M5M1.1|RS11_EUPES RecName: Full=40S ribosomal protein S11 [Euphorbia esula]
 gb|AAF34771.1|AF227626_1 40S ribosomal protein S11 [Euphorbia esula]
Length=159

 Score =   189 bits (480),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 103/108 (95%), Positives = 106/108 (98%), Gaps = 0/108 (0%)
 Frame = +1

Query  76   MAEQTEKAFLKQPGVFLSSkktgkgkrpgkggNRFWKSIGLGFKTPREATEGTYIDKKCP  255
            MAEQTEKAFLKQP VFL+SKKTGKGKRPGKGGNRFWKSIGLGFKTPREA +GTYIDKKCP
Sbjct  1    MAEQTEKAFLKQPKVFLASKKTGKGKRPGKGGNRFWKSIGLGFKTPREAIDGTYIDKKCP  60

Query  256  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNI  399
            FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHF+KKYQRYEKRHSNI
Sbjct  61   FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFIKKYQRYEKRHSNI  108



>ref|XP_010417155.1| PREDICTED: 40S ribosomal protein S11-1-like isoform X2 [Camelina 
sativa]
 ref|XP_010429367.1| PREDICTED: 40S ribosomal protein S11-1-like isoform X2 [Camelina 
sativa]
Length=131

 Score =   188 bits (477),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 103/108 (95%), Positives = 105/108 (97%), Gaps = 0/108 (0%)
 Frame = +1

Query  76   MAEQTEKAFLKQPGVFLSSkktgkgkrpgkggNRFWKSIGLGFKTPREATEGTYIDKKCP  255
            MAEQTEKAFLKQP VFLSSKK+GKGKRPGKGGNRFWK+IGLGFKTPREATEG YIDKKCP
Sbjct  1    MAEQTEKAFLKQPKVFLSSKKSGKGKRPGKGGNRFWKNIGLGFKTPREATEGAYIDKKCP  60

Query  256  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNI  399
            FTGTVSIRGRILAGTCHSAKM RTIIVRRNYLHFVKKYQRYEKRHSNI
Sbjct  61   FTGTVSIRGRILAGTCHSAKMQRTIIVRRNYLHFVKKYQRYEKRHSNI  108



>ref|NP_001236968.1| 40S ribosomal protein S11 [Glycine max]
 sp|P17093.2|RS11_SOYBN RecName: Full=40S ribosomal protein S11 [Glycine max]
 gb|AAC14469.1| ribosomal protein S11 [Glycine max]
 gb|ACU13267.1| unknown [Glycine max]
 gb|KHN47133.1| 40S ribosomal protein S11 [Glycine soja]
Length=159

 Score =   189 bits (479),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 103/108 (95%), Positives = 105/108 (97%), Gaps = 0/108 (0%)
 Frame = +1

Query  76   MAEQTEKAFLKQPGVFLSSkktgkgkrpgkggNRFWKSIGLGFKTPREATEGTYIDKKCP  255
            MAEQTEKAFLKQP VFLS+KKTGKGKRPGKGGNRFWKSIGLGFKTPREA EGTYIDKKCP
Sbjct  1    MAEQTEKAFLKQPKVFLSTKKTGKGKRPGKGGNRFWKSIGLGFKTPREAIEGTYIDKKCP  60

Query  256  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNI  399
            FTG VSIRGRILAGTCHSAKMNRTIIVRRNYLHF+KKYQRYEKRHSNI
Sbjct  61   FTGNVSIRGRILAGTCHSAKMNRTIIVRRNYLHFIKKYQRYEKRHSNI  108



>ref|XP_004252282.1| PREDICTED: 40S ribosomal protein S11 [Solanum lycopersicum]
 ref|XP_006346633.1| PREDICTED: 40S ribosomal protein S11-like [Solanum tuberosum]
 ref|XP_006346634.1| PREDICTED: 40S ribosomal protein S11-like [Solanum tuberosum]
 ref|XP_006361120.1| PREDICTED: 40S ribosomal protein S11-like [Solanum tuberosum]
Length=159

 Score =   189 bits (479),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 104/108 (96%), Positives = 107/108 (99%), Gaps = 0/108 (0%)
 Frame = +1

Query  76   MAEQTEKAFLKQPGVFLSSkktgkgkrpgkggNRFWKSIGLGFKTPREATEGTYIDKKCP  255
            MAEQTEKAFLKQPGVFLSSKKTGKGKRPGKGGNR++KSIGLGFKTPREATEGTYIDKKCP
Sbjct  1    MAEQTEKAFLKQPGVFLSSKKTGKGKRPGKGGNRYFKSIGLGFKTPREATEGTYIDKKCP  60

Query  256  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNI  399
            FTG VSIRGRILAGTCHSAKMNRTIIVRRNYLH+VKKYQRYEKRHSNI
Sbjct  61   FTGNVSIRGRILAGTCHSAKMNRTIIVRRNYLHYVKKYQRYEKRHSNI  108



>ref|XP_006361121.1| PREDICTED: 40S ribosomal protein S11-like [Solanum tuberosum]
Length=159

 Score =   189 bits (479),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 104/108 (96%), Positives = 107/108 (99%), Gaps = 0/108 (0%)
 Frame = +1

Query  76   MAEQTEKAFLKQPGVFLSSkktgkgkrpgkggNRFWKSIGLGFKTPREATEGTYIDKKCP  255
            MAEQTEKAFLKQPGVFLSSKKTGKGKRPGKGGNR++KSIGLGFKTPREATEGTYIDKKCP
Sbjct  1    MAEQTEKAFLKQPGVFLSSKKTGKGKRPGKGGNRYFKSIGLGFKTPREATEGTYIDKKCP  60

Query  256  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNI  399
            FTG VSIRGRILAGTCHSAKMNRTIIVRRNYLH+VKKYQRYEKRHSNI
Sbjct  61   FTGNVSIRGRILAGTCHSAKMNRTIIVRRNYLHYVKKYQRYEKRHSNI  108



>ref|XP_010904991.1| PREDICTED: 40S ribosomal protein S11 isoform X1 [Elaeis guineensis]
Length=160

 Score =   189 bits (479),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 103/109 (94%), Positives = 105/109 (96%), Gaps = 0/109 (0%)
 Frame = +1

Query  76   MAEQTEKAFLKQPGVFLSSkktgkgkrpgkggNRFWKSIGLGFKTPREATEGTYIDKKCP  255
            MAEQTE+AFLKQP VFL SKK GKGKRPGKGGNRFWKSIGLGFKTPREA EGTYIDKKCP
Sbjct  1    MAEQTERAFLKQPKVFLCSKKAGKGKRPGKGGNRFWKSIGLGFKTPREAIEGTYIDKKCP  60

Query  256  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIA  402
            FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLH+VKKYQRYEKRHSNIA
Sbjct  61   FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHYVKKYQRYEKRHSNIA  109



>ref|XP_008809330.1| PREDICTED: 40S ribosomal protein S11 [Phoenix dactylifera]
Length=159

 Score =   189 bits (479),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 103/109 (94%), Positives = 106/109 (97%), Gaps = 0/109 (0%)
 Frame = +1

Query  76   MAEQTEKAFLKQPGVFLSSkktgkgkrpgkggNRFWKSIGLGFKTPREATEGTYIDKKCP  255
            MAEQTE+AFLKQP VFL SKK+GKGKRPGKGGNRFWKSIGLGFKTPREA EGTYIDKKCP
Sbjct  1    MAEQTERAFLKQPKVFLCSKKSGKGKRPGKGGNRFWKSIGLGFKTPREAIEGTYIDKKCP  60

Query  256  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIA  402
            FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLH+VKKYQRYEKRHSNIA
Sbjct  61   FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHYVKKYQRYEKRHSNIA  109



>ref|XP_009605477.1| PREDICTED: 40S ribosomal protein S11-like [Nicotiana tomentosiformis]
 ref|XP_009788979.1| PREDICTED: 40S ribosomal protein S11-like [Nicotiana sylvestris]
Length=159

 Score =   189 bits (479),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 104/108 (96%), Positives = 107/108 (99%), Gaps = 0/108 (0%)
 Frame = +1

Query  76   MAEQTEKAFLKQPGVFLSSkktgkgkrpgkggNRFWKSIGLGFKTPREATEGTYIDKKCP  255
            MAEQTEKAFLKQPGVFLSSKKTGKGKRPGKGGNR++KSIGLGFKTPREATEGTYIDKKCP
Sbjct  1    MAEQTEKAFLKQPGVFLSSKKTGKGKRPGKGGNRYFKSIGLGFKTPREATEGTYIDKKCP  60

Query  256  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNI  399
            FTG VSIRGRILAGTCHSAKMNRTIIVRRNYLH+VKKYQRYEKRHSNI
Sbjct  61   FTGNVSIRGRILAGTCHSAKMNRTIIVRRNYLHYVKKYQRYEKRHSNI  108



>ref|XP_004241368.1| PREDICTED: 40S ribosomal protein S11-like [Solanum lycopersicum]
 ref|XP_004241369.1| PREDICTED: 40S ribosomal protein S11-like [Solanum lycopersicum]
Length=159

 Score =   189 bits (479),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 104/108 (96%), Positives = 107/108 (99%), Gaps = 0/108 (0%)
 Frame = +1

Query  76   MAEQTEKAFLKQPGVFLSSkktgkgkrpgkggNRFWKSIGLGFKTPREATEGTYIDKKCP  255
            MAEQTEKAFLKQPGVFLSSKKTGKGKRPGKGGNR++KSIGLGFKTPREATEGTYIDKKCP
Sbjct  1    MAEQTEKAFLKQPGVFLSSKKTGKGKRPGKGGNRYFKSIGLGFKTPREATEGTYIDKKCP  60

Query  256  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNI  399
            FTG VSIRGRILAGTCHSAKMNRTIIVRRNYLH+VKKYQRYEKRHSNI
Sbjct  61   FTGNVSIRGRILAGTCHSAKMNRTIIVRRNYLHYVKKYQRYEKRHSNI  108



>ref|XP_002880547.1| ribosomal protein S11-beta [Arabidopsis lyrata subsp. lyrata]
 ref|XP_010472410.1| PREDICTED: 40S ribosomal protein S11-3-like [Camelina sativa]
 gb|EFH56806.1| ribosomal protein S11-beta [Arabidopsis lyrata subsp. lyrata]
Length=159

 Score =   189 bits (479),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 103/108 (95%), Positives = 105/108 (97%), Gaps = 0/108 (0%)
 Frame = +1

Query  76   MAEQTEKAFLKQPGVFLSSkktgkgkrpgkggNRFWKSIGLGFKTPREATEGTYIDKKCP  255
            MAEQTEKAFLKQP VFLSSKK+GKGKRPGKGGNRFWK+IGLGFKTPREATEG YIDKKCP
Sbjct  1    MAEQTEKAFLKQPKVFLSSKKSGKGKRPGKGGNRFWKNIGLGFKTPREATEGAYIDKKCP  60

Query  256  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNI  399
            FTGTVSIRGRILAGTCHSAKM RTIIVRRNYLHFVKKYQRYEKRHSNI
Sbjct  61   FTGTVSIRGRILAGTCHSAKMQRTIIVRRNYLHFVKKYQRYEKRHSNI  108



>ref|XP_006296532.1| hypothetical protein CARUB_v10025724mg [Capsella rubella]
 ref|XP_010417154.1| PREDICTED: 40S ribosomal protein S11-3-like isoform X1 [Camelina 
sativa]
 ref|XP_010429366.1| PREDICTED: 40S ribosomal protein S11-3-like isoform X1 [Camelina 
sativa]
 gb|EOA29430.1| hypothetical protein CARUB_v10025724mg [Capsella rubella]
Length=159

 Score =   189 bits (479),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 103/108 (95%), Positives = 105/108 (97%), Gaps = 0/108 (0%)
 Frame = +1

Query  76   MAEQTEKAFLKQPGVFLSSkktgkgkrpgkggNRFWKSIGLGFKTPREATEGTYIDKKCP  255
            MAEQTEKAFLKQP VFLSSKK+GKGKRPGKGGNRFWK+IGLGFKTPREATEG YIDKKCP
Sbjct  1    MAEQTEKAFLKQPKVFLSSKKSGKGKRPGKGGNRFWKNIGLGFKTPREATEGAYIDKKCP  60

Query  256  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNI  399
            FTGTVSIRGRILAGTCHSAKM RTIIVRRNYLHFVKKYQRYEKRHSNI
Sbjct  61   FTGTVSIRGRILAGTCHSAKMQRTIIVRRNYLHFVKKYQRYEKRHSNI  108



>ref|XP_009392143.1| PREDICTED: 40S ribosomal protein S11-like [Musa acuminata subsp. 
malaccensis]
Length=160

 Score =   188 bits (478),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 103/109 (94%), Positives = 105/109 (96%), Gaps = 0/109 (0%)
 Frame = +1

Query  76   MAEQTEKAFLKQPGVFLSSkktgkgkrpgkggNRFWKSIGLGFKTPREATEGTYIDKKCP  255
            MAEQTEKAFLKQP VFL SKK+GKGKRPGKGGNRFWKSIGLGFKTPREA EGTYIDKKCP
Sbjct  1    MAEQTEKAFLKQPKVFLCSKKSGKGKRPGKGGNRFWKSIGLGFKTPREAIEGTYIDKKCP  60

Query  256  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIA  402
            FTG VSIRGRILAGTCHSAKMNRTIIVRRNYLH+VKKYQRYEKRHSNIA
Sbjct  61   FTGNVSIRGRILAGTCHSAKMNRTIIVRRNYLHYVKKYQRYEKRHSNIA  109



>ref|XP_003629390.1| 40S ribosomal protein S11 [Medicago truncatula]
 gb|ACJ83891.1| unknown [Medicago truncatula]
 gb|AET03866.1| 40S ribosomal protein S11-1 [Medicago truncatula]
 gb|AFK33686.1| unknown [Medicago truncatula]
Length=160

 Score =   188 bits (478),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 102/108 (94%), Positives = 105/108 (97%), Gaps = 0/108 (0%)
 Frame = +1

Query  76   MAEQTEKAFLKQPGVFLSSkktgkgkrpgkggNRFWKSIGLGFKTPREATEGTYIDKKCP  255
            MAEQTEKAFLKQP VFL SKK+GKGKRPGKGGNRFWKS+GLGFKTPREATEGTYIDKKCP
Sbjct  1    MAEQTEKAFLKQPKVFLCSKKSGKGKRPGKGGNRFWKSVGLGFKTPREATEGTYIDKKCP  60

Query  256  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNI  399
            FTG VSIRGRILAGTCHSAKMNRTIIVRRNYLHF+KKYQRYEKRHSNI
Sbjct  61   FTGNVSIRGRILAGTCHSAKMNRTIIVRRNYLHFIKKYQRYEKRHSNI  108



>ref|XP_008776674.1| PREDICTED: 40S ribosomal protein S11-like [Phoenix dactylifera]
Length=160

 Score =   188 bits (477),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 103/109 (94%), Positives = 104/109 (95%), Gaps = 0/109 (0%)
 Frame = +1

Query  76   MAEQTEKAFLKQPGVFLSSkktgkgkrpgkggNRFWKSIGLGFKTPREATEGTYIDKKCP  255
            MAEQTEKAFLKQP VFL SKK GKGKRPGKGGNRFWKSIGLGFKTPREA EGTYIDKKCP
Sbjct  1    MAEQTEKAFLKQPKVFLCSKKAGKGKRPGKGGNRFWKSIGLGFKTPREAIEGTYIDKKCP  60

Query  256  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIA  402
            FTG VSIRGRILAGTCHSAKMNRTIIVRRNYLH+VKKYQRYEKRHSNIA
Sbjct  61   FTGNVSIRGRILAGTCHSAKMNRTIIVRRNYLHYVKKYQRYEKRHSNIA  109



>ref|XP_002454168.1| hypothetical protein SORBIDRAFT_04g025870 [Sorghum bicolor]
 ref|XP_002448129.1| hypothetical protein SORBIDRAFT_06g021750 [Sorghum bicolor]
 ref|XP_004976135.1| PREDICTED: 40S ribosomal protein S11-like [Setaria italica]
 gb|EES07144.1| hypothetical protein SORBIDRAFT_04g025870 [Sorghum bicolor]
 gb|EES12457.1| hypothetical protein SORBIDRAFT_06g021750 [Sorghum bicolor]
Length=160

 Score =   188 bits (477),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 99/108 (92%), Positives = 102/108 (94%), Gaps = 0/108 (0%)
 Frame = +1

Query  76   MAEQTEKAFLKQPGVFLSSkktgkgkrpgkggNRFWKSIGLGFKTPREATEGTYIDKKCP  255
            MAEQTEKAFLKQP VFL SKK  KG +PGKGGNRFWK+IGLGFKTPREA EGTYIDKKCP
Sbjct  1    MAEQTEKAFLKQPKVFLCSKKAAKGNKPGKGGNRFWKNIGLGFKTPREAIEGTYIDKKCP  60

Query  256  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNI  399
            FTGTVSIRGRI+AGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNI
Sbjct  61   FTGTVSIRGRIIAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNI  108



>dbj|BAK05865.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=159

 Score =   188 bits (477),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 97/108 (90%), Positives = 102/108 (94%), Gaps = 0/108 (0%)
 Frame = +1

Query  76   MAEQTEKAFLKQPGVFLSSkktgkgkrpgkggNRFWKSIGLGFKTPREATEGTYIDKKCP  255
            MAEQTEK+FLKQP VFLS+KK  K KRPGK GNRFWKS+GLGFKTPREA EGTYIDKKCP
Sbjct  1    MAEQTEKSFLKQPKVFLSTKKADKAKRPGKAGNRFWKSVGLGFKTPREAIEGTYIDKKCP  60

Query  256  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNI  399
            FTGTV+IRGRI+AGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNI
Sbjct  61   FTGTVAIRGRIIAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNI  108



>ref|XP_007155106.1| hypothetical protein PHAVU_003G173800g [Phaseolus vulgaris]
 ref|XP_007155107.1| hypothetical protein PHAVU_003G173900g [Phaseolus vulgaris]
 gb|ESW27100.1| hypothetical protein PHAVU_003G173800g [Phaseolus vulgaris]
 gb|ESW27101.1| hypothetical protein PHAVU_003G173900g [Phaseolus vulgaris]
Length=159

 Score =   187 bits (476),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 102/108 (94%), Positives = 105/108 (97%), Gaps = 0/108 (0%)
 Frame = +1

Query  76   MAEQTEKAFLKQPGVFLSSkktgkgkrpgkggNRFWKSIGLGFKTPREATEGTYIDKKCP  255
            MAEQTEKAFLKQP VFLSSKKTGKGKRPGKGGNRFWKSIGLGFKTPR+A EGTYIDKKCP
Sbjct  1    MAEQTEKAFLKQPKVFLSSKKTGKGKRPGKGGNRFWKSIGLGFKTPRDAIEGTYIDKKCP  60

Query  256  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNI  399
            FTG VSIRGRILAGTCHSAKMNRTI+VRRNYLHF+KKYQRYEKRHSNI
Sbjct  61   FTGNVSIRGRILAGTCHSAKMNRTIVVRRNYLHFIKKYQRYEKRHSNI  108



>ref|XP_010240412.1| PREDICTED: 40S ribosomal protein S11 [Brachypodium distachyon]
Length=158

 Score =   187 bits (476),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 97/108 (90%), Positives = 102/108 (94%), Gaps = 0/108 (0%)
 Frame = +1

Query  76   MAEQTEKAFLKQPGVFLSSkktgkgkrpgkggNRFWKSIGLGFKTPREATEGTYIDKKCP  255
            MAEQTEKAFLKQP VFLS+KK  K KRPGK GNRFWKS+GLGFKTPREA EGTYIDKKCP
Sbjct  1    MAEQTEKAFLKQPKVFLSTKKADKAKRPGKAGNRFWKSVGLGFKTPREAIEGTYIDKKCP  60

Query  256  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNI  399
            FTGTV+IRGRI+AGTCHSAKMNRTIIVRR+YLHFVKKYQRYEKRHSNI
Sbjct  61   FTGTVAIRGRIIAGTCHSAKMNRTIIVRRDYLHFVKKYQRYEKRHSNI  108



>ref|XP_010927344.1| PREDICTED: 40S ribosomal protein S11-like [Elaeis guineensis]
Length=160

 Score =   187 bits (476),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 100/109 (92%), Positives = 104/109 (95%), Gaps = 0/109 (0%)
 Frame = +1

Query  76   MAEQTEKAFLKQPGVFLSSkktgkgkrpgkggNRFWKSIGLGFKTPREATEGTYIDKKCP  255
            MAEQTE+AFLKQP VFL SKK  KGK+PGKGGNRFWKSIGLGFKTPREA EGTYIDKKCP
Sbjct  1    MAEQTERAFLKQPKVFLCSKKAAKGKKPGKGGNRFWKSIGLGFKTPREAIEGTYIDKKCP  60

Query  256  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIA  402
            FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLH+V+KYQRYEKRHSNIA
Sbjct  61   FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHYVRKYQRYEKRHSNIA  109



>ref|XP_004953088.1| PREDICTED: 40S ribosomal protein S11-like isoform X2 [Setaria 
italica]
Length=160

 Score =   187 bits (476),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 99/108 (92%), Positives = 101/108 (94%), Gaps = 0/108 (0%)
 Frame = +1

Query  76   MAEQTEKAFLKQPGVFLSSkktgkgkrpgkggNRFWKSIGLGFKTPREATEGTYIDKKCP  255
            MAEQTEKAFLKQP VFL  KK  KG +PGKGGNRFWKSIGLGFKTPREA EGTYIDKKCP
Sbjct  1    MAEQTEKAFLKQPKVFLCPKKAAKGNKPGKGGNRFWKSIGLGFKTPREAIEGTYIDKKCP  60

Query  256  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNI  399
            FTGTVSIRGRI+AGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNI
Sbjct  61   FTGTVSIRGRIIAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNI  108



>ref|XP_002301243.1| 40S ribosomal protein S11 [Populus trichocarpa]
 ref|XP_011017414.1| PREDICTED: 40S ribosomal protein S11 [Populus euphratica]
 gb|ABK93959.1| unknown [Populus trichocarpa]
 gb|ABK94519.1| unknown [Populus trichocarpa]
 gb|EEE80516.1| 40S ribosomal protein S11 [Populus trichocarpa]
Length=159

 Score =   187 bits (475),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 102/108 (94%), Positives = 106/108 (98%), Gaps = 0/108 (0%)
 Frame = +1

Query  76   MAEQTEKAFLKQPGVFLSSkktgkgkrpgkggNRFWKSIGLGFKTPREATEGTYIDKKCP  255
            MAEQTEKAFLKQP VFLSSKK+GKGKRPGKGGNRFWKSIGLGFKTPR+A EGTYIDKKCP
Sbjct  1    MAEQTEKAFLKQPRVFLSSKKSGKGKRPGKGGNRFWKSIGLGFKTPRDAIEGTYIDKKCP  60

Query  256  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNI  399
            FTGTVS+RGRILAGTCHSAKMNRTIIVRRNYLH+VKKYQRYEKRHSNI
Sbjct  61   FTGTVSVRGRILAGTCHSAKMNRTIIVRRNYLHWVKKYQRYEKRHSNI  108



>ref|NP_001060007.1| Os07g0565000 [Oryza sativa Japonica Group]
 ref|NP_001053856.2| Os04g0613600 [Oryza sativa Japonica Group]
 dbj|BAC79661.1| putative 40S ribosomal protein S11 [Oryza sativa Japonica Group]
 dbj|BAD30107.1| putative 40S ribosomal protein S11 [Oryza sativa Japonica Group]
 dbj|BAF21921.1| Os07g0565000 [Oryza sativa Japonica Group]
 dbj|BAH00296.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC77986.1| hypothetical protein OsI_17372 [Oryza sativa Indica Group]
 gb|EEE67424.1| hypothetical protein OsJ_24764 [Oryza sativa Japonica Group]
 dbj|BAF15770.2| Os04g0613600 [Oryza sativa Japonica Group]
Length=161

 Score =   187 bits (475),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 103/108 (95%), Positives = 106/108 (98%), Gaps = 0/108 (0%)
 Frame = +1

Query  76   MAEQTEKAFLKQPGVFLSSkktgkgkrpgkggNRFWKSIGLGFKTPREATEGTYIDKKCP  255
            MAEQTEKAFLKQP VFLSSKK+GKGK+PGKGGNRFWKSIGLGFKTPREA EGTYIDKKCP
Sbjct  1    MAEQTEKAFLKQPKVFLSSKKSGKGKKPGKGGNRFWKSIGLGFKTPREAIEGTYIDKKCP  60

Query  256  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNI  399
            FTGTVSIRGRI+AGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNI
Sbjct  61   FTGTVSIRGRIIAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNI  108



>ref|XP_012076480.1| PREDICTED: 40S ribosomal protein S11-like [Jatropha curcas]
 gb|KDP33551.1| hypothetical protein JCGZ_07122 [Jatropha curcas]
Length=159

 Score =   187 bits (475),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 102/108 (94%), Positives = 104/108 (96%), Gaps = 0/108 (0%)
 Frame = +1

Query  76   MAEQTEKAFLKQPGVFLSSkktgkgkrpgkggNRFWKSIGLGFKTPREATEGTYIDKKCP  255
            MAEQTEKAFLKQP VFLSSKK GKGKRPGKGGNRFWKSIGLGFKTPREA EGTYIDKKCP
Sbjct  1    MAEQTEKAFLKQPKVFLSSKKLGKGKRPGKGGNRFWKSIGLGFKTPREAIEGTYIDKKCP  60

Query  256  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNI  399
            FTGTVS+RGRILAGTCHSAKM RTIIVRRNYLHF+KKYQRYEKRHSNI
Sbjct  61   FTGTVSVRGRILAGTCHSAKMMRTIIVRRNYLHFIKKYQRYEKRHSNI  108



>ref|XP_006652811.1| PREDICTED: 40S ribosomal protein S11-like [Oryza brachyantha]
 ref|XP_006663985.1| PREDICTED: 40S ribosomal protein S11-like [Oryza brachyantha]
Length=161

 Score =   187 bits (475),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 103/108 (95%), Positives = 106/108 (98%), Gaps = 0/108 (0%)
 Frame = +1

Query  76   MAEQTEKAFLKQPGVFLSSkktgkgkrpgkggNRFWKSIGLGFKTPREATEGTYIDKKCP  255
            MAEQTEKAFLKQP VFLSSKK+GKGK+PGKGGNRFWKSIGLGFKTPREA EGTYIDKKCP
Sbjct  1    MAEQTEKAFLKQPKVFLSSKKSGKGKKPGKGGNRFWKSIGLGFKTPREAIEGTYIDKKCP  60

Query  256  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNI  399
            FTGTVSIRGRI+AGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNI
Sbjct  61   FTGTVSIRGRIIAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNI  108



>ref|XP_009610574.1| PREDICTED: 40S ribosomal protein S11 [Nicotiana tomentosiformis]
Length=159

 Score =   187 bits (475),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 103/108 (95%), Positives = 106/108 (98%), Gaps = 0/108 (0%)
 Frame = +1

Query  76   MAEQTEKAFLKQPGVFLSSkktgkgkrpgkggNRFWKSIGLGFKTPREATEGTYIDKKCP  255
            MAEQTEKAFLKQPGVFLSSKKTGKGKRPGKGGNR++KSIGLGFKTPREA EGTYIDKKCP
Sbjct  1    MAEQTEKAFLKQPGVFLSSKKTGKGKRPGKGGNRYFKSIGLGFKTPREAVEGTYIDKKCP  60

Query  256  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNI  399
            FTG VSIRGRILAGTCHSAKMNRTIIVRRNYLH+VKKYQRYEKRHSNI
Sbjct  61   FTGNVSIRGRILAGTCHSAKMNRTIIVRRNYLHYVKKYQRYEKRHSNI  108



>ref|XP_008813136.1| PREDICTED: 40S ribosomal protein S11-like [Phoenix dactylifera]
Length=160

 Score =   187 bits (475),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 102/109 (94%), Positives = 104/109 (95%), Gaps = 0/109 (0%)
 Frame = +1

Query  76   MAEQTEKAFLKQPGVFLSSkktgkgkrpgkggNRFWKSIGLGFKTPREATEGTYIDKKCP  255
            MAEQTE+AFLKQP VFL SKK GKGKRPGKGGNRFWKSIGLGFKTPREA EGTYIDKKCP
Sbjct  1    MAEQTERAFLKQPKVFLCSKKAGKGKRPGKGGNRFWKSIGLGFKTPREAIEGTYIDKKCP  60

Query  256  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIA  402
            FTG VSIRGRILAGTCHSAKMNRTIIVRRNYLH+VKKYQRYEKRHSNIA
Sbjct  61   FTGNVSIRGRILAGTCHSAKMNRTIIVRRNYLHYVKKYQRYEKRHSNIA  109



>gb|ACG35231.1| 40S ribosomal protein S11 [Zea mays]
Length=160

 Score =   187 bits (475),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 97/108 (90%), Positives = 101/108 (94%), Gaps = 0/108 (0%)
 Frame = +1

Query  76   MAEQTEKAFLKQPGVFLSSkktgkgkrpgkggNRFWKSIGLGFKTPREATEGTYIDKKCP  255
            MAEQTE+AFLKQP VFL SKK  K  +PGKGGNRFWK+IGLGFKTPREA EGTYIDKKCP
Sbjct  1    MAEQTERAFLKQPKVFLCSKKATKVNKPGKGGNRFWKNIGLGFKTPREAIEGTYIDKKCP  60

Query  256  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNI  399
            FTGTVSIRGRI+AGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNI
Sbjct  61   FTGTVSIRGRIIAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNI  108



>ref|XP_004287236.1| PREDICTED: 40S ribosomal protein S11-like [Fragaria vesca subsp. 
vesca]
Length=160

 Score =   187 bits (475),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 101/109 (93%), Positives = 106/109 (97%), Gaps = 0/109 (0%)
 Frame = +1

Query  76   MAEQTEKAFLKQPGVFLSSkktgkgkrpgkggNRFWKSIGLGFKTPREATEGTYIDKKCP  255
            MAEQTEKAFLKQP VFLSSKKTGKGKRPGKGGNRFWKS+GLGFKTPR+A EGTYIDKKCP
Sbjct  1    MAEQTEKAFLKQPKVFLSSKKTGKGKRPGKGGNRFWKSVGLGFKTPRDAIEGTYIDKKCP  60

Query  256  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIA  402
            FTG VSIRGRILAGTCHSAKMN+TIIVRRNYLH++KKYQRYEKRHSNIA
Sbjct  61   FTGNVSIRGRILAGTCHSAKMNKTIIVRRNYLHYIKKYQRYEKRHSNIA  109



>ref|XP_011032811.1| PREDICTED: 40S ribosomal protein S11 [Populus euphratica]
Length=159

 Score =   187 bits (474),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 103/108 (95%), Positives = 106/108 (98%), Gaps = 0/108 (0%)
 Frame = +1

Query  76   MAEQTEKAFLKQPGVFLSSkktgkgkrpgkggNRFWKSIGLGFKTPREATEGTYIDKKCP  255
            MAEQTEKAFLKQP VFLSSKKTGKGKRPGKGGNRFWKSIGLGFKTPR+A EGTYIDKKCP
Sbjct  1    MAEQTEKAFLKQPKVFLSSKKTGKGKRPGKGGNRFWKSIGLGFKTPRDAIEGTYIDKKCP  60

Query  256  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNI  399
            FTGTVSIRGRIL+GTCHSAKMNRTIIVRRNYLH+VKKYQRYEKRHSNI
Sbjct  61   FTGTVSIRGRILSGTCHSAKMNRTIIVRRNYLHWVKKYQRYEKRHSNI  108



>ref|NP_001105562.1| 40S ribosomal protein S11 [Zea mays]
 ref|XP_002447086.1| hypothetical protein SORBIDRAFT_06g028330 [Sorghum bicolor]
 ref|XP_008668895.1| PREDICTED: 40S ribosomal protein S11 [Zea mays]
 sp|P25460.1|RS11_MAIZE RecName: Full=40S ribosomal protein S11 [Zea mays]
 emb|CAA39438.1| ribosomal protein S11 [Zea mays]
 gb|ACG31238.1| 40S ribosomal protein S11 [Zea mays]
 gb|ACG34039.1| 40S ribosomal protein S11 [Zea mays]
 gb|ACG37864.1| 40S ribosomal protein S11 [Zea mays]
 gb|ACG46678.1| 40S ribosomal protein S11 [Zea mays]
 gb|ACN28179.1| unknown [Zea mays]
 gb|ACN31404.1| unknown [Zea mays]
 gb|ACN31475.1| unknown [Zea mays]
 gb|EES11414.1| hypothetical protein SORBIDRAFT_06g028330 [Sorghum bicolor]
 gb|AFW59427.1| ribosomal protein S11 [Zea mays]
 tpg|DAA36049.1| TPA: 40S ribosomal protein S11 [Zea mays]
Length=159

 Score =   187 bits (474),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 103/108 (95%), Positives = 106/108 (98%), Gaps = 0/108 (0%)
 Frame = +1

Query  76   MAEQTEKAFLKQPGVFLSSkktgkgkrpgkggNRFWKSIGLGFKTPREATEGTYIDKKCP  255
            MAEQTEKAFLKQP VFLSSKK+GKGK+PGKGGNRFWKSIGLGFKTPREA EGTYIDKKCP
Sbjct  1    MAEQTEKAFLKQPKVFLSSKKSGKGKKPGKGGNRFWKSIGLGFKTPREAIEGTYIDKKCP  60

Query  256  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNI  399
            FTGTVSIRGRI+AGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNI
Sbjct  61   FTGTVSIRGRIIAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNI  108



>ref|NP_001146950.1| 40S ribosomal protein S11 [Zea mays]
 gb|ACG24698.1| 40S ribosomal protein S11 [Zea mays]
Length=160

 Score =   187 bits (474),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 98/108 (91%), Positives = 102/108 (94%), Gaps = 0/108 (0%)
 Frame = +1

Query  76   MAEQTEKAFLKQPGVFLSSkktgkgkrpgkggNRFWKSIGLGFKTPREATEGTYIDKKCP  255
            MAEQTE+AFLKQP VFL SKK  KG +PGKGGNRFWK+IGLGFKTPREA EGTYIDKKCP
Sbjct  1    MAEQTERAFLKQPKVFLCSKKASKGNKPGKGGNRFWKNIGLGFKTPREAIEGTYIDKKCP  60

Query  256  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNI  399
            FTGTVSIRGRI+AGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNI
Sbjct  61   FTGTVSIRGRIIAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNI  108



>ref|XP_006375200.1| 40S ribosomal protein S11 [Populus trichocarpa]
 gb|ABK92709.1| unknown [Populus trichocarpa]
 gb|ERP52997.1| 40S ribosomal protein S11 [Populus trichocarpa]
Length=159

 Score =   187 bits (474),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 103/108 (95%), Positives = 106/108 (98%), Gaps = 0/108 (0%)
 Frame = +1

Query  76   MAEQTEKAFLKQPGVFLSSkktgkgkrpgkggNRFWKSIGLGFKTPREATEGTYIDKKCP  255
            MAEQTEKAFLKQP VFLSSKKTGKGKRPGKGGNRFWKSIGLGFKTPR+A EGTYIDKKCP
Sbjct  1    MAEQTEKAFLKQPKVFLSSKKTGKGKRPGKGGNRFWKSIGLGFKTPRDAIEGTYIDKKCP  60

Query  256  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNI  399
            FTGTVSIRGRIL+GTCHSAKMNRTIIVRRNYLH+VKKYQRYEKRHSNI
Sbjct  61   FTGTVSIRGRILSGTCHSAKMNRTIIVRRNYLHWVKKYQRYEKRHSNI  108



>ref|XP_012083751.1| PREDICTED: 40S ribosomal protein S11 [Jatropha curcas]
Length=159

 Score =   187 bits (474),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 102/108 (94%), Positives = 104/108 (96%), Gaps = 0/108 (0%)
 Frame = +1

Query  76   MAEQTEKAFLKQPGVFLSSkktgkgkrpgkggNRFWKSIGLGFKTPREATEGTYIDKKCP  255
            MAEQTEKAFLKQP VFLSSKK+GKGKRPGKGGNRFWKSIGLGFKTPREA  GTYIDKKCP
Sbjct  1    MAEQTEKAFLKQPKVFLSSKKSGKGKRPGKGGNRFWKSIGLGFKTPREAVTGTYIDKKCP  60

Query  256  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNI  399
            FTGTVSIRGRILAGTCHSAKM RTIIVRRNYLHF+KKYQRYEKRHSNI
Sbjct  61   FTGTVSIRGRILAGTCHSAKMTRTIIVRRNYLHFIKKYQRYEKRHSNI  108



>ref|XP_006284663.1| hypothetical protein CARUB_v10005922mg [Capsella rubella]
 gb|EOA17561.1| hypothetical protein CARUB_v10005922mg [Capsella rubella]
Length=159

 Score =   187 bits (474),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 102/108 (94%), Positives = 104/108 (96%), Gaps = 0/108 (0%)
 Frame = +1

Query  76   MAEQTEKAFLKQPGVFLSSkktgkgkrpgkggNRFWKSIGLGFKTPREATEGTYIDKKCP  255
            MAEQTEKAFLKQP VFLSSKK+GKGKRPGKGGNRFWK+IGLGFKTPREA EG YIDKKCP
Sbjct  1    MAEQTEKAFLKQPKVFLSSKKSGKGKRPGKGGNRFWKNIGLGFKTPREAIEGAYIDKKCP  60

Query  256  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNI  399
            FTGTVSIRGRILAGTCHSAKM RTIIVRRNYLHFVKKYQRYEKRHSNI
Sbjct  61   FTGTVSIRGRILAGTCHSAKMQRTIIVRRNYLHFVKKYQRYEKRHSNI  108



>ref|XP_012081114.1| PREDICTED: 40S ribosomal protein S11-like [Jatropha curcas]
 gb|KDP30187.1| hypothetical protein JCGZ_16969 [Jatropha curcas]
Length=159

 Score =   187 bits (474),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 102/108 (94%), Positives = 105/108 (97%), Gaps = 0/108 (0%)
 Frame = +1

Query  76   MAEQTEKAFLKQPGVFLSSkktgkgkrpgkggNRFWKSIGLGFKTPREATEGTYIDKKCP  255
            MAEQTEKAFLKQP VFLSSKK+GKGKRPGKGGNRFWKSIGLGFKTPREA EGTYIDKKCP
Sbjct  1    MAEQTEKAFLKQPKVFLSSKKSGKGKRPGKGGNRFWKSIGLGFKTPREAIEGTYIDKKCP  60

Query  256  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNI  399
            FTGTVS+RGRILAGTCHSAKM RTIIVRRNYLHF+KKYQRYEKRHSNI
Sbjct  61   FTGTVSVRGRILAGTCHSAKMIRTIIVRRNYLHFIKKYQRYEKRHSNI  108



>ref|XP_010432945.1| PREDICTED: 40S ribosomal protein S11-3-like [Camelina sativa]
 ref|XP_010438132.1| PREDICTED: 40S ribosomal protein S11-3-like [Camelina sativa]
 ref|XP_010447671.1| PREDICTED: 40S ribosomal protein S11-3-like [Camelina sativa]
Length=159

 Score =   186 bits (473),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 102/108 (94%), Positives = 104/108 (96%), Gaps = 0/108 (0%)
 Frame = +1

Query  76   MAEQTEKAFLKQPGVFLSSkktgkgkrpgkggNRFWKSIGLGFKTPREATEGTYIDKKCP  255
            MAEQTEKAFLKQP VFLSSKK+GKGKRPGKGGNRFWK+IGLGFKTPREA EG YIDKKCP
Sbjct  1    MAEQTEKAFLKQPKVFLSSKKSGKGKRPGKGGNRFWKNIGLGFKTPREAIEGAYIDKKCP  60

Query  256  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNI  399
            FTGTVSIRGRILAGTCHSAKM RTIIVRRNYLHFVKKYQRYEKRHSNI
Sbjct  61   FTGTVSIRGRILAGTCHSAKMQRTIIVRRNYLHFVKKYQRYEKRHSNI  108



>gb|KJB22832.1| hypothetical protein B456_004G068000 [Gossypium raimondii]
Length=159

 Score =   186 bits (473),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 103/108 (95%), Positives = 105/108 (97%), Gaps = 0/108 (0%)
 Frame = +1

Query  76   MAEQTEKAFLKQPGVFLSSkktgkgkrpgkggNRFWKSIGLGFKTPREATEGTYIDKKCP  255
            MAEQTEKAFLKQP VFLSSKKTGKGKRPGKGGNRFWKSIGLGFKTPREA EGTYIDKKCP
Sbjct  1    MAEQTEKAFLKQPKVFLSSKKTGKGKRPGKGGNRFWKSIGLGFKTPREAIEGTYIDKKCP  60

Query  256  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNI  399
            FTGTVSIRGRILAGTCHSAKM RTIIVRRNYLH++KKYQRYEKRHSNI
Sbjct  61   FTGTVSIRGRILAGTCHSAKMVRTIIVRRNYLHYIKKYQRYEKRHSNI  108



>ref|XP_007159633.1| hypothetical protein PHAVU_002G254000g [Phaseolus vulgaris]
 gb|ESW31627.1| hypothetical protein PHAVU_002G254000g [Phaseolus vulgaris]
Length=159

 Score =   186 bits (473),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 102/108 (94%), Positives = 104/108 (96%), Gaps = 0/108 (0%)
 Frame = +1

Query  76   MAEQTEKAFLKQPGVFLSSkktgkgkrpgkggNRFWKSIGLGFKTPREATEGTYIDKKCP  255
            MAEQTEKAFLKQP VFLSSKKTGKGKRPGKGGNRFWKSIGL FKTPREA EGTYIDKKCP
Sbjct  1    MAEQTEKAFLKQPKVFLSSKKTGKGKRPGKGGNRFWKSIGLSFKTPREAIEGTYIDKKCP  60

Query  256  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNI  399
            FTG VSIRGRILAGTCHSAKMNRTI+VRRNYLHF+KKYQRYEKRHSNI
Sbjct  61   FTGNVSIRGRILAGTCHSAKMNRTIVVRRNYLHFIKKYQRYEKRHSNI  108



>ref|XP_007052409.1| Ribosomal protein S11-beta isoform 2 [Theobroma cacao]
 gb|EOX96566.1| Ribosomal protein S11-beta isoform 2 [Theobroma cacao]
Length=159

 Score =   186 bits (473),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 102/108 (94%), Positives = 105/108 (97%), Gaps = 0/108 (0%)
 Frame = +1

Query  76   MAEQTEKAFLKQPGVFLSSkktgkgkrpgkggNRFWKSIGLGFKTPREATEGTYIDKKCP  255
            MAEQTEKAFLKQP VFLSSKK+GKGKRPGKGGNRFWKSIGLGFKTPREA EGTYIDKKCP
Sbjct  1    MAEQTEKAFLKQPKVFLSSKKSGKGKRPGKGGNRFWKSIGLGFKTPREAIEGTYIDKKCP  60

Query  256  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNI  399
            FTGTVSIRGRILAGTCHSAKM RTIIVRRNYLH++KKYQRYEKRHSNI
Sbjct  61   FTGTVSIRGRILAGTCHSAKMMRTIIVRRNYLHYIKKYQRYEKRHSNI  108



>ref|XP_007013672.1| Ribosomal protein S11-beta [Theobroma cacao]
 gb|EOY31291.1| Ribosomal protein S11-beta [Theobroma cacao]
Length=159

 Score =   186 bits (473),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 102/108 (94%), Positives = 105/108 (97%), Gaps = 0/108 (0%)
 Frame = +1

Query  76   MAEQTEKAFLKQPGVFLSSkktgkgkrpgkggNRFWKSIGLGFKTPREATEGTYIDKKCP  255
            MAEQTEKAFLKQP VFLSSKK+GKGKRPGKGGNRFWKSIGLGFKTPREA EGTYIDKKCP
Sbjct  1    MAEQTEKAFLKQPKVFLSSKKSGKGKRPGKGGNRFWKSIGLGFKTPREAIEGTYIDKKCP  60

Query  256  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNI  399
            FTGTVSIRGRILAGTCHSAKM RTIIVRRNYLH++KKYQRYEKRHSNI
Sbjct  61   FTGTVSIRGRILAGTCHSAKMMRTIIVRRNYLHYIKKYQRYEKRHSNI  108



>gb|KJB27059.1| hypothetical protein B456_004G275200 [Gossypium raimondii]
Length=159

 Score =   186 bits (472),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 102/108 (94%), Positives = 104/108 (96%), Gaps = 0/108 (0%)
 Frame = +1

Query  76   MAEQTEKAFLKQPGVFLSSkktgkgkrpgkggNRFWKSIGLGFKTPREATEGTYIDKKCP  255
            MAEQTEKAFLKQP VFLSSKK GKGKRPGKGGNRFWKSIGLGFKTPREA EGTYIDKKCP
Sbjct  1    MAEQTEKAFLKQPKVFLSSKKGGKGKRPGKGGNRFWKSIGLGFKTPREAIEGTYIDKKCP  60

Query  256  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNI  399
            FTGTVSIRGRILAGTCHSAKM RTIIVRRNYLH++KKYQRYEKRHSNI
Sbjct  61   FTGTVSIRGRILAGTCHSAKMVRTIIVRRNYLHYIKKYQRYEKRHSNI  108



>ref|XP_009407362.1| PREDICTED: 40S ribosomal protein S11 [Musa acuminata subsp. malaccensis]
Length=159

 Score =   186 bits (472),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 102/109 (94%), Positives = 103/109 (94%), Gaps = 0/109 (0%)
 Frame = +1

Query  76   MAEQTEKAFLKQPGVFLSSkktgkgkrpgkggNRFWKSIGLGFKTPREATEGTYIDKKCP  255
            MAEQTEKAFLKQP VFL  KK GKGKRPGKGGNRFWKSIGLGFKTPREA EGTYIDKKCP
Sbjct  1    MAEQTEKAFLKQPKVFLCPKKPGKGKRPGKGGNRFWKSIGLGFKTPREAIEGTYIDKKCP  60

Query  256  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIA  402
            FTG VSIRGRILAGTCHSAKMNRTIIVRRNYLH+VKKYQRYEKRHSNIA
Sbjct  61   FTGNVSIRGRILAGTCHSAKMNRTIIVRRNYLHYVKKYQRYEKRHSNIA  109



>gb|AFX66997.1| 40s ribosomal protein S11 [Solanum tuberosum]
Length=159

 Score =   186 bits (472),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 103/108 (95%), Positives = 106/108 (98%), Gaps = 0/108 (0%)
 Frame = +1

Query  76   MAEQTEKAFLKQPGVFLSSkktgkgkrpgkggNRFWKSIGLGFKTPREATEGTYIDKKCP  255
            MAEQTEKAFLKQPG FLSSKKTGKGKRPGKGGNR++KSIGLGFKTPREATEGTYIDKKCP
Sbjct  1    MAEQTEKAFLKQPGEFLSSKKTGKGKRPGKGGNRYFKSIGLGFKTPREATEGTYIDKKCP  60

Query  256  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNI  399
            FTG VSIRGRILAGTCHSAKMNRTIIVRRNYLH+VKKYQRYEKRHSNI
Sbjct  61   FTGNVSIRGRILAGTCHSAKMNRTIIVRRNYLHYVKKYQRYEKRHSNI  108



>ref|XP_009398660.1| PREDICTED: 40S ribosomal protein S11-like [Musa acuminata subsp. 
malaccensis]
Length=160

 Score =   186 bits (472),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 102/108 (94%), Positives = 104/108 (96%), Gaps = 0/108 (0%)
 Frame = +1

Query  76   MAEQTEKAFLKQPGVFLSSkktgkgkrpgkggNRFWKSIGLGFKTPREATEGTYIDKKCP  255
            MAEQTEKAFLKQP VFL SKK+GKGKRPGKGGNRFWKSIGLGFKTPREA EGTYIDKKCP
Sbjct  1    MAEQTEKAFLKQPKVFLCSKKSGKGKRPGKGGNRFWKSIGLGFKTPREAIEGTYIDKKCP  60

Query  256  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNI  399
            FTG VSIRGRILAGTCHSAKMNRTIIVRRNYLH+VKKYQRYEKRHSNI
Sbjct  61   FTGNVSIRGRILAGTCHSAKMNRTIIVRRNYLHYVKKYQRYEKRHSNI  108



>ref|XP_009764798.1| PREDICTED: 40S ribosomal protein S11 [Nicotiana sylvestris]
Length=159

 Score =   186 bits (472),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 102/108 (94%), Positives = 106/108 (98%), Gaps = 0/108 (0%)
 Frame = +1

Query  76   MAEQTEKAFLKQPGVFLSSkktgkgkrpgkggNRFWKSIGLGFKTPREATEGTYIDKKCP  255
            MAEQTEKAFLKQPGVFLSSKKTGKGKRPGKGGNR++KSIGLGFKTPREA EGTYIDKKCP
Sbjct  1    MAEQTEKAFLKQPGVFLSSKKTGKGKRPGKGGNRYFKSIGLGFKTPREAVEGTYIDKKCP  60

Query  256  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNI  399
            FTG VSIRGRI+AGTCHSAKMNRTIIVRRNYLH+VKKYQRYEKRHSNI
Sbjct  61   FTGNVSIRGRIIAGTCHSAKMNRTIIVRRNYLHYVKKYQRYEKRHSNI  108



>gb|KFK41361.1| hypothetical protein AALP_AA2G120000 [Arabis alpina]
Length=159

 Score =   186 bits (472),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 102/108 (94%), Positives = 104/108 (96%), Gaps = 0/108 (0%)
 Frame = +1

Query  76   MAEQTEKAFLKQPGVFLSSkktgkgkrpgkggNRFWKSIGLGFKTPREATEGTYIDKKCP  255
            MAEQTEKAFLKQP VFL SKK+GKGKRPGKGGNRFWKSIGLGFKTPREATEG YIDKKCP
Sbjct  1    MAEQTEKAFLKQPKVFLCSKKSGKGKRPGKGGNRFWKSIGLGFKTPREATEGAYIDKKCP  60

Query  256  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNI  399
            FTGTVSIRGRILAGTCHSAKM RTIIVRR+YLHFVKKYQRYEKRHSNI
Sbjct  61   FTGTVSIRGRILAGTCHSAKMQRTIIVRRDYLHFVKKYQRYEKRHSNI  108



>ref|XP_004138716.1| PREDICTED: 40S ribosomal protein S11 [Cucumis sativus]
 gb|KGN62969.1| hypothetical protein Csa_2G382430 [Cucumis sativus]
Length=159

 Score =   186 bits (472),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 102/108 (94%), Positives = 105/108 (97%), Gaps = 0/108 (0%)
 Frame = +1

Query  76   MAEQTEKAFLKQPGVFLSSkktgkgkrpgkggNRFWKSIGLGFKTPREATEGTYIDKKCP  255
            MAEQTEKAFLKQP VFLSSKK+GKGKRPGKGGNRFWKSIGLGFKTPR+A EGTYIDKKCP
Sbjct  1    MAEQTEKAFLKQPKVFLSSKKSGKGKRPGKGGNRFWKSIGLGFKTPRDAIEGTYIDKKCP  60

Query  256  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNI  399
            FTGTVSIRGRILAGTCHSAKM RTIIVRRNYLH+VKKYQRYEKRHSNI
Sbjct  61   FTGTVSIRGRILAGTCHSAKMVRTIIVRRNYLHYVKKYQRYEKRHSNI  108



>ref|XP_008445242.1| PREDICTED: 40S ribosomal protein S11 [Cucumis melo]
Length=159

 Score =   186 bits (472),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 102/108 (94%), Positives = 105/108 (97%), Gaps = 0/108 (0%)
 Frame = +1

Query  76   MAEQTEKAFLKQPGVFLSSkktgkgkrpgkggNRFWKSIGLGFKTPREATEGTYIDKKCP  255
            MAEQTEKAFLKQP VFLSSKK+GKGKRPGKGGNRFWKSIGLGFKTPR+A EGTYIDKKCP
Sbjct  1    MAEQTEKAFLKQPKVFLSSKKSGKGKRPGKGGNRFWKSIGLGFKTPRDAIEGTYIDKKCP  60

Query  256  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNI  399
            FTGTVSIRGRILAGTCHSAKM RTIIVRRNYLH+VKKYQRYEKRHSNI
Sbjct  61   FTGTVSIRGRILAGTCHSAKMVRTIIVRRNYLHYVKKYQRYEKRHSNI  108



>gb|KJB64607.1| hypothetical protein B456_010G056800 [Gossypium raimondii]
Length=159

 Score =   186 bits (472),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 102/108 (94%), Positives = 105/108 (97%), Gaps = 0/108 (0%)
 Frame = +1

Query  76   MAEQTEKAFLKQPGVFLSSkktgkgkrpgkggNRFWKSIGLGFKTPREATEGTYIDKKCP  255
            MAEQTEKAFLKQP VFLSSKK+GKGKRPGKGGNRFWKSIGLGFKTPREATEG YIDKKCP
Sbjct  1    MAEQTEKAFLKQPKVFLSSKKSGKGKRPGKGGNRFWKSIGLGFKTPREATEGIYIDKKCP  60

Query  256  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNI  399
            FTGTVSIRGRILAGTCHSAKM RTIIVRRNYLH++KKYQRYEKRHSNI
Sbjct  61   FTGTVSIRGRILAGTCHSAKMIRTIIVRRNYLHYIKKYQRYEKRHSNI  108



>ref|XP_002532505.1| 40S ribosomal protein S11, putative [Ricinus communis]
 gb|EEF29881.1| 40S ribosomal protein S11, putative [Ricinus communis]
Length=159

 Score =   186 bits (472),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 102/108 (94%), Positives = 105/108 (97%), Gaps = 0/108 (0%)
 Frame = +1

Query  76   MAEQTEKAFLKQPGVFLSSkktgkgkrpgkggNRFWKSIGLGFKTPREATEGTYIDKKCP  255
            MAEQTEKAFLKQP VFLSSKKTGKGKRPGKGGNRFWKS+GLGFKTPREA EGTYIDKKCP
Sbjct  1    MAEQTEKAFLKQPKVFLSSKKTGKGKRPGKGGNRFWKSVGLGFKTPREAIEGTYIDKKCP  60

Query  256  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNI  399
            FTGTVSIRGRILAGTCHSAKM R+IIVRRNYLHF+KKYQRYEKRHSNI
Sbjct  61   FTGTVSIRGRILAGTCHSAKMMRSIIVRRNYLHFIKKYQRYEKRHSNI  108



>gb|AFK46727.1| unknown [Lotus japonicus]
Length=151

 Score =   186 bits (471),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 101/108 (94%), Positives = 104/108 (96%), Gaps = 0/108 (0%)
 Frame = +1

Query  76   MAEQTEKAFLKQPGVFLSSkktgkgkrpgkggNRFWKSIGLGFKTPREATEGTYIDKKCP  255
            MAEQTEKAFLKQP VFLSSKK+GKGKRPGKGGNRFWKSIGLGFKTPR+A EGTYIDKKCP
Sbjct  1    MAEQTEKAFLKQPKVFLSSKKSGKGKRPGKGGNRFWKSIGLGFKTPRDAIEGTYIDKKCP  60

Query  256  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNI  399
            FTG VSIRGRILAGTCHSAKM RTIIVRRNYLHF+KKYQRYEKRHSNI
Sbjct  61   FTGNVSIRGRILAGTCHSAKMTRTIIVRRNYLHFIKKYQRYEKRHSNI  108



>ref|XP_010493497.1| PREDICTED: 40S ribosomal protein S11-3 [Camelina sativa]
Length=159

 Score =   186 bits (472),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 101/108 (94%), Positives = 104/108 (96%), Gaps = 0/108 (0%)
 Frame = +1

Query  76   MAEQTEKAFLKQPGVFLSSkktgkgkrpgkggNRFWKSIGLGFKTPREATEGTYIDKKCP  255
            MAEQTEKAFLKQP VFLSSKK+GKGKRPGKGGNRFWK+IGLGFKTPREA EG YIDKKCP
Sbjct  1    MAEQTEKAFLKQPKVFLSSKKSGKGKRPGKGGNRFWKNIGLGFKTPREAIEGAYIDKKCP  60

Query  256  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNI  399
            FTGTVS+RGRILAGTCHSAKM RTIIVRRNYLHFVKKYQRYEKRHSNI
Sbjct  61   FTGTVSVRGRILAGTCHSAKMQRTIIVRRNYLHFVKKYQRYEKRHSNI  108



>ref|XP_002325170.1| 40S ribosomal protein S11-2 [Populus trichocarpa]
 gb|EEF03735.1| 40S ribosomal protein S11-2 [Populus trichocarpa]
Length=159

 Score =   186 bits (471),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 103/108 (95%), Positives = 105/108 (97%), Gaps = 0/108 (0%)
 Frame = +1

Query  76   MAEQTEKAFLKQPGVFLSSkktgkgkrpgkggNRFWKSIGLGFKTPREATEGTYIDKKCP  255
            MAEQTEKAFLKQP VFLSSKK+GKGKRPGKGGNRFWKSIGL FKTPREATEGTYIDKKCP
Sbjct  1    MAEQTEKAFLKQPKVFLSSKKSGKGKRPGKGGNRFWKSIGLSFKTPREATEGTYIDKKCP  60

Query  256  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNI  399
            FTGTVSIRGRILAGTCHSAKM RTIIVRRNYLH+VKKYQRYEKRHSNI
Sbjct  61   FTGTVSIRGRILAGTCHSAKMVRTIIVRRNYLHWVKKYQRYEKRHSNI  108



>gb|AFK49430.1| unknown [Lotus japonicus]
Length=159

 Score =   186 bits (471),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 101/108 (94%), Positives = 104/108 (96%), Gaps = 0/108 (0%)
 Frame = +1

Query  76   MAEQTEKAFLKQPGVFLSSkktgkgkrpgkggNRFWKSIGLGFKTPREATEGTYIDKKCP  255
            MAEQTEKAFLKQP VFLSSKK+GKGKRPGKGGNRFWKSIGLGFKTPR+A EGTYIDKKCP
Sbjct  1    MAEQTEKAFLKQPKVFLSSKKSGKGKRPGKGGNRFWKSIGLGFKTPRDAIEGTYIDKKCP  60

Query  256  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNI  399
            FTG VSIRGRILAGTCHSAKM RTIIVRRNYLHF+KKYQRYEKRHSNI
Sbjct  61   FTGNVSIRGRILAGTCHSAKMTRTIIVRRNYLHFIKKYQRYEKRHSNI  108



>ref|XP_009611608.1| PREDICTED: 40S ribosomal protein S11-like [Nicotiana tomentosiformis]
 ref|XP_009765521.1| PREDICTED: 40S ribosomal protein S11-like [Nicotiana sylvestris]
Length=159

 Score =   185 bits (470),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 102/108 (94%), Positives = 106/108 (98%), Gaps = 0/108 (0%)
 Frame = +1

Query  76   MAEQTEKAFLKQPGVFLSSkktgkgkrpgkggNRFWKSIGLGFKTPREATEGTYIDKKCP  255
            MAEQTEKAFLKQPGVFLSSKKTGKGKRPGKGGNR++KSIGLGFKTPREA EG+YIDKKCP
Sbjct  1    MAEQTEKAFLKQPGVFLSSKKTGKGKRPGKGGNRYFKSIGLGFKTPREAIEGSYIDKKCP  60

Query  256  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNI  399
            FTG VSIRGRILAGTCHSAKMNRTIIVRRNYLH+VKKYQRYEKRHSNI
Sbjct  61   FTGNVSIRGRILAGTCHSAKMNRTIIVRRNYLHYVKKYQRYEKRHSNI  108



>ref|XP_007146683.1| hypothetical protein PHAVU_006G060600g [Phaseolus vulgaris]
 gb|ESW18677.1| hypothetical protein PHAVU_006G060600g [Phaseolus vulgaris]
Length=159

 Score =   185 bits (470),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 101/108 (94%), Positives = 104/108 (96%), Gaps = 0/108 (0%)
 Frame = +1

Query  76   MAEQTEKAFLKQPGVFLSSkktgkgkrpgkggNRFWKSIGLGFKTPREATEGTYIDKKCP  255
            MAEQTEKAFLKQP VFLSSKKTGKGKRPGKGGNRFWKSIGL FKTPR+A EGTYIDKKCP
Sbjct  1    MAEQTEKAFLKQPKVFLSSKKTGKGKRPGKGGNRFWKSIGLSFKTPRDAIEGTYIDKKCP  60

Query  256  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNI  399
            FTG VSIRGRILAGTCHSAKMNRTI+VRRNYLHF+KKYQRYEKRHSNI
Sbjct  61   FTGNVSIRGRILAGTCHSAKMNRTIVVRRNYLHFIKKYQRYEKRHSNI  108



>gb|AAA32866.1| ribosomal protein S11 (probable start codon at bp 67), partial 
[Arabidopsis thaliana]
Length=182

 Score =   186 bits (472),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 100/113 (88%), Positives = 107/113 (95%), Gaps = 0/113 (0%)
 Frame = +1

Query  61   SAATIMAEQTEKAFLKQPGVFLSSkktgkgkrpgkggNRFWKSIGLGFKTPREATEGTYI  240
            S+ + MAEQTEKAFLKQP VFLSSKK+GKGKRPGKGGNRFWK+IGLGFKTPREA +G Y+
Sbjct  18   SSTSAMAEQTEKAFLKQPKVFLSSKKSGKGKRPGKGGNRFWKNIGLGFKTPREAIDGAYV  77

Query  241  DKKCPFTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNI  399
            DKKCPFTGTVSIRGRILAGTCHSAKM RTIIVRR+YLHFVKKYQRYEKRHSNI
Sbjct  78   DKKCPFTGTVSIRGRILAGTCHSAKMQRTIIVRRDYLHFVKKYQRYEKRHSNI  130



>gb|KDP28900.1| hypothetical protein JCGZ_14671 [Jatropha curcas]
Length=159

 Score =   185 bits (470),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 102/108 (94%), Positives = 104/108 (96%), Gaps = 0/108 (0%)
 Frame = +1

Query  76   MAEQTEKAFLKQPGVFLSSkktgkgkrpgkggNRFWKSIGLGFKTPREATEGTYIDKKCP  255
            MAEQTEKAFLKQP VFLSSKK+GKGKRPGKGGNRFWKSIGLGFKTPREA  GTYIDKKCP
Sbjct  1    MAEQTEKAFLKQPKVFLSSKKSGKGKRPGKGGNRFWKSIGLGFKTPREAGGGTYIDKKCP  60

Query  256  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNI  399
            FTGTVSIRGRILAGTCHSAKM RTIIVRRNYLHF+KKYQRYEKRHSNI
Sbjct  61   FTGTVSIRGRILAGTCHSAKMTRTIIVRRNYLHFIKKYQRYEKRHSNI  108



>ref|XP_006288822.1| hypothetical protein CARUB_v10002158mg [Capsella rubella]
 gb|EOA21720.1| hypothetical protein CARUB_v10002158mg [Capsella rubella]
Length=159

 Score =   185 bits (470),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 101/108 (94%), Positives = 104/108 (96%), Gaps = 0/108 (0%)
 Frame = +1

Query  76   MAEQTEKAFLKQPGVFLSSkktgkgkrpgkggNRFWKSIGLGFKTPREATEGTYIDKKCP  255
            MAEQTEKAFLKQP VFLSSKK+GKGKRPGKGGNRFWK+IGLGFKTPREA EG YID+KCP
Sbjct  1    MAEQTEKAFLKQPKVFLSSKKSGKGKRPGKGGNRFWKNIGLGFKTPREAIEGAYIDQKCP  60

Query  256  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNI  399
            FTGTVSIRGRILAGTCHSAKM RTIIVRRNYLHFVKKYQRYEKRHSNI
Sbjct  61   FTGTVSIRGRILAGTCHSAKMQRTIIVRRNYLHFVKKYQRYEKRHSNI  108



>emb|CDP18807.1| unnamed protein product [Coffea canephora]
Length=159

 Score =   185 bits (470),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 101/108 (94%), Positives = 106/108 (98%), Gaps = 0/108 (0%)
 Frame = +1

Query  76   MAEQTEKAFLKQPGVFLSSkktgkgkrpgkggNRFWKSIGLGFKTPREATEGTYIDKKCP  255
            MAEQTEKAFLKQP VFLSSKKTGKGKRPGKGGNR+WKSIGLGFKTPREA EGTYIDKKCP
Sbjct  1    MAEQTEKAFLKQPKVFLSSKKTGKGKRPGKGGNRYWKSIGLGFKTPREAIEGTYIDKKCP  60

Query  256  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNI  399
            FTG+VSIRGRI+AGTCHSAKM++TIIVRRNYLHFVKKYQRYEKRHSNI
Sbjct  61   FTGSVSIRGRIIAGTCHSAKMDKTIIVRRNYLHFVKKYQRYEKRHSNI  108



>ref|XP_002874145.1| ribosomal protein S11-beta [Arabidopsis lyrata subsp. lyrata]
 gb|EFH50404.1| ribosomal protein S11-beta [Arabidopsis lyrata subsp. lyrata]
Length=159

 Score =   185 bits (470),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 100/108 (93%), Positives = 102/108 (94%), Gaps = 0/108 (0%)
 Frame = +1

Query  76   MAEQTEKAFLKQPGVFLSSkktgkgkrpgkggNRFWKSIGLGFKTPREATEGTYIDKKCP  255
            MAEQTEKAFLKQP VFLSSK +GKGKRPGKGGNRFWK+IGLGFKTPREA EG YID KCP
Sbjct  1    MAEQTEKAFLKQPKVFLSSKTSGKGKRPGKGGNRFWKNIGLGFKTPREAIEGAYIDSKCP  60

Query  256  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNI  399
            FTGTVSIRGRILAGTCHSAKM RTIIVRRNYLHFVKKYQRYEKRHSNI
Sbjct  61   FTGTVSIRGRILAGTCHSAKMQRTIIVRRNYLHFVKKYQRYEKRHSNI  108



>ref|XP_002869362.1| 40S ribosomal protein S11 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH45621.1| 40S ribosomal protein S11 [Arabidopsis lyrata subsp. lyrata]
Length=159

 Score =   185 bits (469),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 99/108 (92%), Positives = 103/108 (95%), Gaps = 0/108 (0%)
 Frame = +1

Query  76   MAEQTEKAFLKQPGVFLSSkktgkgkrpgkggNRFWKSIGLGFKTPREATEGTYIDKKCP  255
            MAEQTEKAFLKQP VFLSSKK+GK KRPGKGGNRFWK+IGLGFKTPREA EG Y+DKKCP
Sbjct  1    MAEQTEKAFLKQPKVFLSSKKSGKEKRPGKGGNRFWKNIGLGFKTPREAIEGAYVDKKCP  60

Query  256  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNI  399
            FTGTVSIRGRILAGTCHSAKM RTIIVRR+YLHFVKKYQRYEKRHSNI
Sbjct  61   FTGTVSIRGRILAGTCHSAKMQRTIIVRRDYLHFVKKYQRYEKRHSNI  108



>ref|XP_006291971.1| hypothetical protein CARUB_v10018158mg [Capsella rubella]
 ref|XP_010503537.1| PREDICTED: 40S ribosomal protein S11-1 [Camelina sativa]
 ref|XP_010515228.1| PREDICTED: 40S ribosomal protein S11-1 isoform X1 [Camelina sativa]
 ref|XP_010515229.1| PREDICTED: 40S ribosomal protein S11-1 isoform X2 [Camelina sativa]
 ref|XP_010515230.1| PREDICTED: 40S ribosomal protein S11-1 isoform X3 [Camelina sativa]
 ref|XP_010426394.1| PREDICTED: 40S ribosomal protein S11-1 [Camelina sativa]
 gb|EOA24869.1| hypothetical protein CARUB_v10018158mg [Capsella rubella]
Length=160

 Score =   185 bits (469),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 100/108 (93%), Positives = 104/108 (96%), Gaps = 0/108 (0%)
 Frame = +1

Query  76   MAEQTEKAFLKQPGVFLSSkktgkgkrpgkggNRFWKSIGLGFKTPREATEGTYIDKKCP  255
            MAEQTEKAFLKQP VFLSSKK+GKGKRPGKGGNRFWK+IGLGFKTPREA +G Y+DKKCP
Sbjct  1    MAEQTEKAFLKQPKVFLSSKKSGKGKRPGKGGNRFWKNIGLGFKTPREAIDGAYVDKKCP  60

Query  256  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNI  399
            FTGTVSIRGRILAGTCHSAKM RTIIVRRNYLHFVKKYQRYEKRHSNI
Sbjct  61   FTGTVSIRGRILAGTCHSAKMQRTIIVRRNYLHFVKKYQRYEKRHSNI  108



>ref|XP_010687771.1| PREDICTED: 40S ribosomal protein S11-3 [Beta vulgaris subsp. 
vulgaris]
Length=159

 Score =   185 bits (469),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 100/109 (92%), Positives = 105/109 (96%), Gaps = 0/109 (0%)
 Frame = +1

Query  76   MAEQTEKAFLKQPGVFLSSkktgkgkrpgkggNRFWKSIGLGFKTPREATEGTYIDKKCP  255
            MAEQTEKAFLKQP +FLSSKK+GKGKRPGKGGNRFWKSIGLGFKTPREA EG YIDKKCP
Sbjct  1    MAEQTEKAFLKQPKLFLSSKKSGKGKRPGKGGNRFWKSIGLGFKTPREAIEGAYIDKKCP  60

Query  256  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIA  402
            FTG+VSIRGRILAGTCHSAKM RTIIVRRNYLH++KKYQRYEKRHSNIA
Sbjct  61   FTGSVSIRGRILAGTCHSAKMQRTIIVRRNYLHYIKKYQRYEKRHSNIA  109



>ref|XP_007052408.1| Ribosomal protein S11-beta isoform 1 [Theobroma cacao]
 gb|EOX96565.1| Ribosomal protein S11-beta isoform 1 [Theobroma cacao]
Length=186

 Score =   186 bits (471),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 102/108 (94%), Positives = 105/108 (97%), Gaps = 0/108 (0%)
 Frame = +1

Query  76   MAEQTEKAFLKQPGVFLSSkktgkgkrpgkggNRFWKSIGLGFKTPREATEGTYIDKKCP  255
            MAEQTEKAFLKQP VFLSSKK+GKGKRPGKGGNRFWKSIGLGFKTPREA EGTYIDKKCP
Sbjct  1    MAEQTEKAFLKQPKVFLSSKKSGKGKRPGKGGNRFWKSIGLGFKTPREAIEGTYIDKKCP  60

Query  256  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNI  399
            FTGTVSIRGRILAGTCHSAKM RTIIVRRNYLH++KKYQRYEKRHSNI
Sbjct  61   FTGTVSIRGRILAGTCHSAKMMRTIIVRRNYLHYIKKYQRYEKRHSNI  108



>ref|XP_010421183.1| PREDICTED: 40S ribosomal protein S11-3-like [Camelina sativa]
 ref|XP_010454662.1| PREDICTED: 40S ribosomal protein S11-3-like [Camelina sativa]
Length=159

 Score =   184 bits (468),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 100/108 (93%), Positives = 104/108 (96%), Gaps = 0/108 (0%)
 Frame = +1

Query  76   MAEQTEKAFLKQPGVFLSSkktgkgkrpgkggNRFWKSIGLGFKTPREATEGTYIDKKCP  255
            MAEQTEKAFLKQP VFLSSKK+GKGKRPGKGGNRFWK+IGLGFKTPREA EG YID+KCP
Sbjct  1    MAEQTEKAFLKQPKVFLSSKKSGKGKRPGKGGNRFWKNIGLGFKTPREAIEGAYIDRKCP  60

Query  256  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNI  399
            FTGTVS+RGRILAGTCHSAKM RTIIVRRNYLHFVKKYQRYEKRHSNI
Sbjct  61   FTGTVSVRGRILAGTCHSAKMQRTIIVRRNYLHFVKKYQRYEKRHSNI  108



>ref|XP_007202693.1| hypothetical protein PRUPE_ppa012656mg [Prunus persica]
 gb|EMJ03892.1| hypothetical protein PRUPE_ppa012656mg [Prunus persica]
Length=159

 Score =   184 bits (468),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 98/108 (91%), Positives = 105/108 (97%), Gaps = 0/108 (0%)
 Frame = +1

Query  76   MAEQTEKAFLKQPGVFLSSkktgkgkrpgkggNRFWKSIGLGFKTPREATEGTYIDKKCP  255
            MAEQTEKAFLKQP VF+SSKK+GKGKRPGKGGNRFWKS+GLGFKTPREA EGTYIDKKCP
Sbjct  1    MAEQTEKAFLKQPKVFISSKKSGKGKRPGKGGNRFWKSVGLGFKTPREAIEGTYIDKKCP  60

Query  256  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNI  399
            FTG VSIRGRILAGTCHSAKMN+TII+RRNYLH++KKYQRYEKRHSNI
Sbjct  61   FTGNVSIRGRILAGTCHSAKMNKTIIIRRNYLHYIKKYQRYEKRHSNI  108



>ref|XP_002877637.1| EMB1080 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH53896.1| EMB1080 [Arabidopsis lyrata subsp. lyrata]
Length=160

 Score =   184 bits (468),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 100/108 (93%), Positives = 104/108 (96%), Gaps = 0/108 (0%)
 Frame = +1

Query  76   MAEQTEKAFLKQPGVFLSSkktgkgkrpgkggNRFWKSIGLGFKTPREATEGTYIDKKCP  255
            MAEQTEKAFLKQP VFLSSKK+GKGKRPGKGGNRFWKSIGLGFKTPREA +G Y+DKKCP
Sbjct  1    MAEQTEKAFLKQPKVFLSSKKSGKGKRPGKGGNRFWKSIGLGFKTPREAIDGAYVDKKCP  60

Query  256  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNI  399
            FTGTVSIRGRILAGTCHSAKM RTIIVRR+YLHFVKKYQRYEKRHSNI
Sbjct  61   FTGTVSIRGRILAGTCHSAKMQRTIIVRRDYLHFVKKYQRYEKRHSNI  108



>ref|XP_010914246.1| PREDICTED: 40S ribosomal protein S11-like [Elaeis guineensis]
Length=159

 Score =   184 bits (468),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 100/109 (92%), Positives = 105/109 (96%), Gaps = 0/109 (0%)
 Frame = +1

Query  76   MAEQTEKAFLKQPGVFLSSkktgkgkrpgkggNRFWKSIGLGFKTPREATEGTYIDKKCP  255
            MAEQTE+AFLKQP VFL SKK+GKGKRPGKGGNRFWK+IGLGFKTPREA EGTYIDKKCP
Sbjct  1    MAEQTERAFLKQPKVFLCSKKSGKGKRPGKGGNRFWKNIGLGFKTPREAIEGTYIDKKCP  60

Query  256  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIA  402
            FTG VSIRGRILAGTCHSAKMNRTIIVRRNYLH+V+KYQRYEKRHSNIA
Sbjct  61   FTGNVSIRGRILAGTCHSAKMNRTIIVRRNYLHYVRKYQRYEKRHSNIA  109



>ref|XP_009130101.1| PREDICTED: 40S ribosomal protein S11-3 [Brassica rapa]
 emb|CDY46968.1| BnaA02g32780D [Brassica napus]
Length=159

 Score =   184 bits (468),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 99/108 (92%), Positives = 105/108 (97%), Gaps = 0/108 (0%)
 Frame = +1

Query  76   MAEQTEKAFLKQPGVFLSSkktgkgkrpgkggNRFWKSIGLGFKTPREATEGTYIDKKCP  255
            MAEQTEKAFLKQP VFLSSKK+GKGKRPGKGGNRFWK+IGLGFKTPR+A +GTYID+KCP
Sbjct  1    MAEQTEKAFLKQPKVFLSSKKSGKGKRPGKGGNRFWKNIGLGFKTPRDAIDGTYIDRKCP  60

Query  256  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNI  399
            FTGTVS+RGRILAGTCHSAKM RTIIVRRNYLHFVKKYQRYEKRHSNI
Sbjct  61   FTGTVSVRGRILAGTCHSAKMQRTIIVRRNYLHFVKKYQRYEKRHSNI  108



>ref|XP_010941685.1| PREDICTED: 40S ribosomal protein S11-like [Elaeis guineensis]
Length=163

 Score =   184 bits (468),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 100/109 (92%), Positives = 104/109 (95%), Gaps = 0/109 (0%)
 Frame = +1

Query  76   MAEQTEKAFLKQPGVFLSSkktgkgkrpgkggNRFWKSIGLGFKTPREATEGTYIDKKCP  255
            MAEQTE+AFLKQP VFL SKK+GKGKRPGKGGNRFWKSIGLGFKTPREA EG Y+DKKCP
Sbjct  1    MAEQTERAFLKQPKVFLCSKKSGKGKRPGKGGNRFWKSIGLGFKTPREAIEGAYVDKKCP  60

Query  256  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIA  402
            FTG VSIRGRILAGTCHSAKMNRTIIVRRNYLH+VKKYQRYEKRHSNIA
Sbjct  61   FTGNVSIRGRILAGTCHSAKMNRTIIVRRNYLHYVKKYQRYEKRHSNIA  109



>ref|XP_004288615.1| PREDICTED: 40S ribosomal protein S11 [Fragaria vesca subsp. vesca]
 ref|XP_004290932.1| PREDICTED: 40S ribosomal protein S11 [Fragaria vesca subsp. vesca]
Length=160

 Score =   184 bits (467),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 100/108 (93%), Positives = 105/108 (97%), Gaps = 0/108 (0%)
 Frame = +1

Query  76   MAEQTEKAFLKQPGVFLSSkktgkgkrpgkggNRFWKSIGLGFKTPREATEGTYIDKKCP  255
            MAEQTEKAFLKQP VFLSSKKTGKGKRPGKGGNRFWKS+GLGFKTPR+A EGTYIDKKCP
Sbjct  1    MAEQTEKAFLKQPKVFLSSKKTGKGKRPGKGGNRFWKSVGLGFKTPRDAIEGTYIDKKCP  60

Query  256  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNI  399
            FTG VSIRGRILAGTCHSAKM+RTIIVRRNYLH++KKYQRYEKRHSNI
Sbjct  61   FTGNVSIRGRILAGTCHSAKMSRTIIVRRNYLHYIKKYQRYEKRHSNI  108



>ref|NP_001053235.1| Os04g0502300 [Oryza sativa Japonica Group]
 dbj|BAF15149.1| Os04g0502300 [Oryza sativa Japonica Group]
 emb|CAH67584.1| OSIGBa0112M24.1 [Oryza sativa Indica Group]
Length=160

 Score =   184 bits (467),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 99/108 (92%), Positives = 103/108 (95%), Gaps = 0/108 (0%)
 Frame = +1

Query  76   MAEQTEKAFLKQPGVFLSSkktgkgkrpgkggNRFWKSIGLGFKTPREATEGTYIDKKCP  255
            MAEQTE+AFLKQP VFL  KKT KGK+PGKGGNRFWK+IGLGFKTPREA EGTYIDKKCP
Sbjct  1    MAEQTERAFLKQPKVFLCPKKTTKGKKPGKGGNRFWKNIGLGFKTPREAIEGTYIDKKCP  60

Query  256  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNI  399
            FTGTVSIRGRI+AGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNI
Sbjct  61   FTGTVSIRGRIIAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNI  108



>pdb|3J60|L Chain L, Localization Of The Small Subunit Ribosomal Proteins 
Into A 5.5 A Cryo-em Map Of Triticum Aestivum Translating 80s 
Ribosome
Length=160

 Score =   184 bits (467),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 99/108 (92%), Positives = 103/108 (95%), Gaps = 0/108 (0%)
 Frame = +1

Query  76   MAEQTEKAFLKQPGVFLSSkktgkgkrpgkggNRFWKSIGLGFKTPREATEGTYIDKKCP  255
            MAEQTE+AFLKQP VFL  KKT KGK+PGKGGNRFWK+IGLGFKTPREA EGTYIDKKCP
Sbjct  1    MAEQTERAFLKQPKVFLCPKKTTKGKKPGKGGNRFWKNIGLGFKTPREAIEGTYIDKKCP  60

Query  256  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNI  399
            FTGTVSIRGRI+AGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNI
Sbjct  61   FTGTVSIRGRIIAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNI  108



>ref|XP_009358523.1| PREDICTED: 40S ribosomal protein S11-like [Pyrus x bretschneideri]
 ref|XP_009358525.1| PREDICTED: 40S ribosomal protein S11-like [Pyrus x bretschneideri]
Length=159

 Score =   184 bits (467),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 98/108 (91%), Positives = 105/108 (97%), Gaps = 0/108 (0%)
 Frame = +1

Query  76   MAEQTEKAFLKQPGVFLSSkktgkgkrpgkggNRFWKSIGLGFKTPREATEGTYIDKKCP  255
            MAEQTEKAFLKQP VF+SSKK+GKGKRPGKGGNRFWKS+GLGFKTPR+A EGTYIDKKCP
Sbjct  1    MAEQTEKAFLKQPKVFISSKKSGKGKRPGKGGNRFWKSVGLGFKTPRDAIEGTYIDKKCP  60

Query  256  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNI  399
            FTG VSIRGRILAGTCHSAKMN+TIIVRRNYLH++KKYQRYEKRHSNI
Sbjct  61   FTGNVSIRGRILAGTCHSAKMNKTIIVRRNYLHYIKKYQRYEKRHSNI  108



>ref|XP_010665687.1| PREDICTED: 40S ribosomal protein S11 [Beta vulgaris subsp. vulgaris]
Length=159

 Score =   184 bits (466),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 100/108 (93%), Positives = 105/108 (97%), Gaps = 0/108 (0%)
 Frame = +1

Query  76   MAEQTEKAFLKQPGVFLSSkktgkgkrpgkggNRFWKSIGLGFKTPREATEGTYIDKKCP  255
            MAEQTEKAFLKQP +FLSSKKTGKGKRPGKGGNRFWKSIGLGFKTPR+A EGTYIDKKCP
Sbjct  1    MAEQTEKAFLKQPKLFLSSKKTGKGKRPGKGGNRFWKSIGLGFKTPRDAIEGTYIDKKCP  60

Query  256  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNI  399
            FTG+VSIRGRILAGTCHSAKM RTIIVRRNYLH++KKYQRYEKRHSNI
Sbjct  61   FTGSVSIRGRILAGTCHSAKMQRTIIVRRNYLHYIKKYQRYEKRHSNI  108



>ref|XP_006659214.1| PREDICTED: 40S ribosomal protein S11-like [Oryza brachyantha]
Length=159

 Score =   184 bits (466),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 99/108 (92%), Positives = 104/108 (96%), Gaps = 0/108 (0%)
 Frame = +1

Query  76   MAEQTEKAFLKQPGVFLSSkktgkgkrpgkggNRFWKSIGLGFKTPREATEGTYIDKKCP  255
            MAEQTE+AFLKQP VFL  KK+GKGK+PGKGGNRFWK+IGLGFKTPREA EGTYIDKKCP
Sbjct  1    MAEQTERAFLKQPKVFLCPKKSGKGKKPGKGGNRFWKNIGLGFKTPREAIEGTYIDKKCP  60

Query  256  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNI  399
            FTGTVSIRGRI+AGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNI
Sbjct  61   FTGTVSIRGRIIAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNI  108



>ref|XP_009405706.1| PREDICTED: 40S ribosomal protein S11-like [Musa acuminata subsp. 
malaccensis]
Length=160

 Score =   184 bits (467),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 102/109 (94%), Positives = 104/109 (95%), Gaps = 0/109 (0%)
 Frame = +1

Query  76   MAEQTEKAFLKQPGVFLSSkktgkgkrpgkggNRFWKSIGLGFKTPREATEGTYIDKKCP  255
            MAEQTEKAFLKQ  VFL SKKTGKGKRPGKGGNRFWKSIGLGFKTP+EA EGTYIDKKCP
Sbjct  1    MAEQTEKAFLKQSKVFLCSKKTGKGKRPGKGGNRFWKSIGLGFKTPKEAIEGTYIDKKCP  60

Query  256  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIA  402
            FTG VSIRGRILAGTCHSAKMNRTIIVRRNYLH+VKKYQRYEKRHSNIA
Sbjct  61   FTGNVSIRGRILAGTCHSAKMNRTIIVRRNYLHYVKKYQRYEKRHSNIA  109



>gb|EEC83094.1| hypothetical protein OsI_28229 [Oryza sativa Indica Group]
Length=159

 Score =   184 bits (466),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 99/108 (92%), Positives = 104/108 (96%), Gaps = 0/108 (0%)
 Frame = +1

Query  76   MAEQTEKAFLKQPGVFLSSkktgkgkrpgkggNRFWKSIGLGFKTPREATEGTYIDKKCP  255
            MAEQTE+AFLKQP VFL  KK+GKGK+PGKGGNRFWK+IGLGFKTPREA EGTYIDKKCP
Sbjct  1    MAEQTERAFLKQPKVFLCPKKSGKGKKPGKGGNRFWKNIGLGFKTPREAIEGTYIDKKCP  60

Query  256  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNI  399
            FTGTVSIRGRI+AGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNI
Sbjct  61   FTGTVSIRGRIIAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNI  108



>gb|KJB23700.1| hypothetical protein B456_004G110600 [Gossypium raimondii]
Length=159

 Score =   184 bits (466),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 101/108 (94%), Positives = 104/108 (96%), Gaps = 0/108 (0%)
 Frame = +1

Query  76   MAEQTEKAFLKQPGVFLSSkktgkgkrpgkggNRFWKSIGLGFKTPREATEGTYIDKKCP  255
            MAEQTEKAFLKQP VFLSSKKTGKGKRPGKGGNRFWKSIGLGFKTPREA EGTYIDKKCP
Sbjct  1    MAEQTEKAFLKQPKVFLSSKKTGKGKRPGKGGNRFWKSIGLGFKTPREAIEGTYIDKKCP  60

Query  256  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNI  399
            FTG VS+RGRILAGTCHSAKM RTIIVRRNYLH++KKYQRYEKRHSNI
Sbjct  61   FTGPVSVRGRILAGTCHSAKMMRTIIVRRNYLHYIKKYQRYEKRHSNI  108



>ref|XP_002267523.1| PREDICTED: 40S ribosomal protein S11 [Vitis vinifera]
 emb|CBI25585.3| unnamed protein product [Vitis vinifera]
Length=160

 Score =   184 bits (466),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 100/108 (93%), Positives = 103/108 (95%), Gaps = 0/108 (0%)
 Frame = +1

Query  76   MAEQTEKAFLKQPGVFLSSkktgkgkrpgkggNRFWKSIGLGFKTPREATEGTYIDKKCP  255
            MAEQTEKAFLKQP VFL SKK+ KGKRPGKGGNRFWKSIGLGFKTPR+A EGTYIDKKCP
Sbjct  1    MAEQTEKAFLKQPKVFLCSKKSAKGKRPGKGGNRFWKSIGLGFKTPRDAIEGTYIDKKCP  60

Query  256  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNI  399
            FTGTVSIRGRILAGTCHSAKM RTIIVRRNYLH+VKKYQRYEKRHSNI
Sbjct  61   FTGTVSIRGRILAGTCHSAKMMRTIIVRRNYLHYVKKYQRYEKRHSNI  108



>dbj|BAJ94606.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=159

 Score =   184 bits (466),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 96/108 (89%), Positives = 101/108 (94%), Gaps = 0/108 (0%)
 Frame = +1

Query  76   MAEQTEKAFLKQPGVFLSSkktgkgkrpgkggNRFWKSIGLGFKTPREATEGTYIDKKCP  255
            MAEQTEK+FLKQP VFLS+KK  K KRPGK GNRFWKS+GLGFKTPREA EGTYIDKKCP
Sbjct  1    MAEQTEKSFLKQPKVFLSTKKADKAKRPGKAGNRFWKSVGLGFKTPREAIEGTYIDKKCP  60

Query  256  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNI  399
            FTGTV+IRGRI+AGT HSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNI
Sbjct  61   FTGTVAIRGRIIAGTYHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNI  108



>ref|XP_006404202.1| hypothetical protein EUTSA_v10010781mg [Eutrema salsugineum]
 gb|ESQ45655.1| hypothetical protein EUTSA_v10010781mg [Eutrema salsugineum]
Length=159

 Score =   184 bits (466),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 100/108 (93%), Positives = 104/108 (96%), Gaps = 0/108 (0%)
 Frame = +1

Query  76   MAEQTEKAFLKQPGVFLSSkktgkgkrpgkggNRFWKSIGLGFKTPREATEGTYIDKKCP  255
            MAEQTEKAFLKQP VFLSSKK+GKGKRPGKGGNRFWK+IGLGFKTPR+A EGTYID+KCP
Sbjct  1    MAEQTEKAFLKQPKVFLSSKKSGKGKRPGKGGNRFWKNIGLGFKTPRDAIEGTYIDQKCP  60

Query  256  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNI  399
            FTG VSIRGRILAGTCHSAKM RTIIVRRNYLHFVKKYQRYEKRHSNI
Sbjct  61   FTGIVSIRGRILAGTCHSAKMQRTIIVRRNYLHFVKKYQRYEKRHSNI  108



>ref|XP_008336943.1| PREDICTED: 40S ribosomal protein S11-like [Malus domestica]
Length=159

 Score =   184 bits (466),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 98/108 (91%), Positives = 105/108 (97%), Gaps = 0/108 (0%)
 Frame = +1

Query  76   MAEQTEKAFLKQPGVFLSSkktgkgkrpgkggNRFWKSIGLGFKTPREATEGTYIDKKCP  255
            MAEQTEKAFLKQP VF+SSKK+GKGKRPGKGGNRFWKS+GLGFKTPR+A EGTYIDKKCP
Sbjct  1    MAEQTEKAFLKQPKVFISSKKSGKGKRPGKGGNRFWKSVGLGFKTPRDAIEGTYIDKKCP  60

Query  256  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNI  399
            FTG VSIRGRILAGTCHSAKMN+TIIVRRNYLH++KKYQRYEKRHSNI
Sbjct  61   FTGNVSIRGRILAGTCHSAKMNKTIIVRRNYLHYIKKYQRYEKRHSNI  108



>ref|NP_197763.1| 40S ribosomal protein S11-3 [Arabidopsis thaliana]
 sp|P42733.2|RS113_ARATH RecName: Full=40S ribosomal protein S11-3 [Arabidopsis thaliana]
 gb|AAK25990.1|AF360280_1 putative 40S ribosomal protein S11 [Arabidopsis thaliana]
 dbj|BAB10047.1| 40S ribosomal protein S11 [Arabidopsis thaliana]
 gb|AAL33787.1| putative 40S ribosomal protein S11 [Arabidopsis thaliana]
 gb|AAM64796.1| 40S ribosomal protein S11 [Arabidopsis thaliana]
 gb|AED93206.1| 40S ribosomal protein S11-3 [Arabidopsis thaliana]
Length=159

 Score =   184 bits (466),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 99/108 (92%), Positives = 102/108 (94%), Gaps = 0/108 (0%)
 Frame = +1

Query  76   MAEQTEKAFLKQPGVFLSSkktgkgkrpgkggNRFWKSIGLGFKTPREATEGTYIDKKCP  255
            MAEQTEKAFLKQP VFLSSK +GKGKRPGKGGNRFWK+IGLGFKTPREA +G YID KCP
Sbjct  1    MAEQTEKAFLKQPKVFLSSKISGKGKRPGKGGNRFWKNIGLGFKTPREAIDGAYIDSKCP  60

Query  256  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNI  399
            FTGTVSIRGRILAGTCHSAKM RTIIVRRNYLHFVKKYQRYEKRHSNI
Sbjct  61   FTGTVSIRGRILAGTCHSAKMQRTIIVRRNYLHFVKKYQRYEKRHSNI  108



>ref|NP_001236713.1| uncharacterized protein LOC100500094 [Glycine max]
 gb|ACU14888.1| unknown [Glycine max]
 gb|KHN34834.1| 40S ribosomal protein S11 [Glycine soja]
Length=159

 Score =   183 bits (465),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 100/108 (93%), Positives = 102/108 (94%), Gaps = 0/108 (0%)
 Frame = +1

Query  76   MAEQTEKAFLKQPGVFLSSkktgkgkrpgkggNRFWKSIGLGFKTPREATEGTYIDKKCP  255
            MAEQTEKAFLKQP VFL SKK GKGKRPGKGGNRFWKSIGLGFKTPR+A EGTYIDKKCP
Sbjct  1    MAEQTEKAFLKQPKVFLCSKKGGKGKRPGKGGNRFWKSIGLGFKTPRDAIEGTYIDKKCP  60

Query  256  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNI  399
            FTG VSIRGRILAGTCHSAKM RTIIVRRNYLHF+KKYQRYEKRHSNI
Sbjct  61   FTGNVSIRGRILAGTCHSAKMTRTIIVRRNYLHFIKKYQRYEKRHSNI  108



>ref|XP_009149784.1| PREDICTED: 40S ribosomal protein S11-3-like isoform X2 [Brassica 
rapa]
 emb|CDY64707.1| BnaA06g38660D [Brassica napus]
Length=159

 Score =   183 bits (465),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 100/108 (93%), Positives = 103/108 (95%), Gaps = 0/108 (0%)
 Frame = +1

Query  76   MAEQTEKAFLKQPGVFLSSkktgkgkrpgkggNRFWKSIGLGFKTPREATEGTYIDKKCP  255
            MAEQTEKAFLKQP VFLSSK +GKGKRPGKGGNRF K+IGLGFKTPREAT+GTYID KCP
Sbjct  1    MAEQTEKAFLKQPKVFLSSKISGKGKRPGKGGNRFVKNIGLGFKTPREATQGTYIDSKCP  60

Query  256  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNI  399
            FTGTVSIRGRILAGTCHSAKM RTIIVRRNYLHFVKKYQRYEKRHSNI
Sbjct  61   FTGTVSIRGRILAGTCHSAKMQRTIIVRRNYLHFVKKYQRYEKRHSNI  108



>ref|NP_001238157.1| uncharacterized protein LOC100500186 [Glycine max]
 gb|ACU15150.1| unknown [Glycine max]
 gb|KHN34835.1| 40S ribosomal protein S11 [Glycine soja]
Length=159

 Score =   183 bits (465),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 100/108 (93%), Positives = 102/108 (94%), Gaps = 0/108 (0%)
 Frame = +1

Query  76   MAEQTEKAFLKQPGVFLSSkktgkgkrpgkggNRFWKSIGLGFKTPREATEGTYIDKKCP  255
            MAEQTEKAFLKQP VFL SKK GKGKRPGKGGNRFWKSIGLGFKTPR+A EGTYIDKKCP
Sbjct  1    MAEQTEKAFLKQPKVFLCSKKGGKGKRPGKGGNRFWKSIGLGFKTPRDAIEGTYIDKKCP  60

Query  256  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNI  399
            FTG VSIRGRILAGTCHSAKM RTIIVRRNYLHF+KKYQRYEKRHSNI
Sbjct  61   FTGNVSIRGRILAGTCHSAKMTRTIIVRRNYLHFIKKYQRYEKRHSNI  108



>gb|KFK34189.1| hypothetical protein AALP_AA5G112300 [Arabis alpina]
Length=159

 Score =   183 bits (465),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 100/108 (93%), Positives = 104/108 (96%), Gaps = 0/108 (0%)
 Frame = +1

Query  76   MAEQTEKAFLKQPGVFLSSkktgkgkrpgkggNRFWKSIGLGFKTPREATEGTYIDKKCP  255
            MAEQTEKAFLKQP VFL SKK+GKGKRPGKGGNRFWK+IGLGFKTPREATEG YIDKKCP
Sbjct  1    MAEQTEKAFLKQPKVFLCSKKSGKGKRPGKGGNRFWKNIGLGFKTPREATEGAYIDKKCP  60

Query  256  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNI  399
            FTGTVSIRGRIL+GTCHSAKM RTIIVRR+YLHFVKKYQRYEKRHSNI
Sbjct  61   FTGTVSIRGRILSGTCHSAKMQRTIIVRRDYLHFVKKYQRYEKRHSNI  108



>emb|CAK22271.1| 40S ribosomal protein S11 [Oxybasis rubra]
Length=159

 Score =   183 bits (465),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 98/108 (91%), Positives = 103/108 (95%), Gaps = 0/108 (0%)
 Frame = +1

Query  76   MAEQTEKAFLKQPGVFLSSkktgkgkrpgkggNRFWKSIGLGFKTPREATEGTYIDKKCP  255
            MAEQTEKAFLKQP VFLSS K+GKGKRPGKGGNRFWK+IGLGFKTPR+A EGTYIDKKCP
Sbjct  1    MAEQTEKAFLKQPKVFLSSNKSGKGKRPGKGGNRFWKNIGLGFKTPRDAIEGTYIDKKCP  60

Query  256  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNI  399
            FTG VSIRGRILAGTCHSAKM RTIIVRRNYLH++KKYQRYEKRHSNI
Sbjct  61   FTGNVSIRGRILAGTCHSAKMQRTIIVRRNYLHYIKKYQRYEKRHSNI  108



>ref|NP_190462.1| 40S ribosomal protein S11-1 [Arabidopsis thaliana]
 sp|P16181.1|RS111_ARATH RecName: Full=40S ribosomal protein S11-1; AltName: Full=Protein 
EMBRYO DEFECTIVE 1080 [Arabidopsis thaliana]
 gb|AAC14454.1| ribosomal protein S11 [Arabidopsis thaliana]
 emb|CAB62017.1| cytosolic ribosomal protein S11 [Arabidopsis thaliana]
 gb|AAL24429.1| cytosolic ribosomal protein S11 [Arabidopsis thaliana]
 gb|AAM10176.1| cytosolic ribosomal protein S11 [Arabidopsis thaliana]
 gb|AAM65578.1| cytosolic ribosomal protein S11 [Arabidopsis thaliana]
 gb|AEE78474.1| 40S ribosomal protein S11-1 [Arabidopsis thaliana]
Length=160

 Score =   183 bits (465),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 99/108 (92%), Positives = 104/108 (96%), Gaps = 0/108 (0%)
 Frame = +1

Query  76   MAEQTEKAFLKQPGVFLSSkktgkgkrpgkggNRFWKSIGLGFKTPREATEGTYIDKKCP  255
            MAEQTEKAFLKQP VFLSSKK+GKGKRPGKGGNRFWK+IGLGFKTPREA +G Y+DKKCP
Sbjct  1    MAEQTEKAFLKQPKVFLSSKKSGKGKRPGKGGNRFWKNIGLGFKTPREAIDGAYVDKKCP  60

Query  256  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNI  399
            FTGTVSIRGRILAGTCHSAKM RTIIVRR+YLHFVKKYQRYEKRHSNI
Sbjct  61   FTGTVSIRGRILAGTCHSAKMQRTIIVRRDYLHFVKKYQRYEKRHSNI  108



>ref|XP_006394638.1| hypothetical protein EUTSA_v10005057mg [Eutrema salsugineum]
 gb|ESQ31924.1| hypothetical protein EUTSA_v10005057mg [Eutrema salsugineum]
Length=159

 Score =   183 bits (464),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 100/108 (93%), Positives = 104/108 (96%), Gaps = 0/108 (0%)
 Frame = +1

Query  76   MAEQTEKAFLKQPGVFLSSkktgkgkrpgkggNRFWKSIGLGFKTPREATEGTYIDKKCP  255
            MAEQTEKAFLKQP VFLSSKK+GKGKRPGKGGNRFWK+IGLGFKTPR+A EG+YID KCP
Sbjct  1    MAEQTEKAFLKQPKVFLSSKKSGKGKRPGKGGNRFWKNIGLGFKTPRDAIEGSYIDGKCP  60

Query  256  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNI  399
            FTGTVSIRGRILAGTCHSAKM RTIIVRRNYLHFVKKYQRYEKRHSNI
Sbjct  61   FTGTVSIRGRILAGTCHSAKMQRTIIVRRNYLHFVKKYQRYEKRHSNI  108



>ref|XP_009150903.1| PREDICTED: 40S ribosomal protein S11-3-like [Brassica rapa]
Length=159

 Score =   183 bits (464),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 99/108 (92%), Positives = 104/108 (96%), Gaps = 0/108 (0%)
 Frame = +1

Query  76   MAEQTEKAFLKQPGVFLSSkktgkgkrpgkggNRFWKSIGLGFKTPREATEGTYIDKKCP  255
            MAEQTEKAFLKQP VFLSSKK+GKGKRPGKGGNRFWK+IGLGFKTPR+A +G YIDKKCP
Sbjct  1    MAEQTEKAFLKQPKVFLSSKKSGKGKRPGKGGNRFWKNIGLGFKTPRDAIDGHYIDKKCP  60

Query  256  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNI  399
            FTGTVS+RGRILAGTCHSAKM RTIIVRRNYLHFVKKYQRYEKRHSNI
Sbjct  61   FTGTVSVRGRILAGTCHSAKMQRTIIVRRNYLHFVKKYQRYEKRHSNI  108



>ref|XP_010557632.1| PREDICTED: 40S ribosomal protein S11 [Tarenaya hassleriana]
Length=159

 Score =   183 bits (464),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 100/108 (93%), Positives = 104/108 (96%), Gaps = 0/108 (0%)
 Frame = +1

Query  76   MAEQTEKAFLKQPGVFLSSkktgkgkrpgkggNRFWKSIGLGFKTPREATEGTYIDKKCP  255
            MAEQTEKAFLKQP VFL SKKTGKGKRPGKGGNRFWK+IGLGFKTPREA EGT+IDKKCP
Sbjct  1    MAEQTEKAFLKQPKVFLCSKKTGKGKRPGKGGNRFWKNIGLGFKTPREAIEGTFIDKKCP  60

Query  256  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNI  399
            FTGTVS+RGRILAGTCHSAKM RTIIVRRNYLHFV+KYQRYEKRHSNI
Sbjct  61   FTGTVSVRGRILAGTCHSAKMQRTIIVRRNYLHFVRKYQRYEKRHSNI  108



>ref|XP_009410372.1| PREDICTED: 40S ribosomal protein S11-like [Musa acuminata subsp. 
malaccensis]
Length=160

 Score =   183 bits (464),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 101/108 (94%), Positives = 103/108 (95%), Gaps = 0/108 (0%)
 Frame = +1

Query  76   MAEQTEKAFLKQPGVFLSSkktgkgkrpgkggNRFWKSIGLGFKTPREATEGTYIDKKCP  255
            MAEQTEKAFLKQP VFL SKK+GKGKRPGKGGNRFWKSIGLGFKTPREA EGTYIDKKCP
Sbjct  1    MAEQTEKAFLKQPKVFLCSKKSGKGKRPGKGGNRFWKSIGLGFKTPREAIEGTYIDKKCP  60

Query  256  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNI  399
            FTG VSIRG ILAGTCHSAKMNRTIIVRRNYLH+VKKYQRYEKRHSNI
Sbjct  61   FTGNVSIRGCILAGTCHSAKMNRTIIVRRNYLHYVKKYQRYEKRHSNI  108



>gb|KFK29657.1| hypothetical protein AALP_AA7G161800 [Arabis alpina]
Length=159

 Score =   183 bits (464),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 100/108 (93%), Positives = 103/108 (95%), Gaps = 0/108 (0%)
 Frame = +1

Query  76   MAEQTEKAFLKQPGVFLSSkktgkgkrpgkggNRFWKSIGLGFKTPREATEGTYIDKKCP  255
            MAEQTEKAFLKQP VFL SKK+GKGKRPGKGGNRFWKSIGLGFKTPR+A EG YIDKKCP
Sbjct  1    MAEQTEKAFLKQPKVFLCSKKSGKGKRPGKGGNRFWKSIGLGFKTPRDAIEGAYIDKKCP  60

Query  256  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNI  399
            FTGTVSIRGRILAGTCHSAKM RTIIVRR+YLHFVKKYQRYEKRHSNI
Sbjct  61   FTGTVSIRGRILAGTCHSAKMQRTIIVRRDYLHFVKKYQRYEKRHSNI  108



>ref|XP_009355796.1| PREDICTED: 40S ribosomal protein S11 [Pyrus x bretschneideri]
Length=159

 Score =   182 bits (463),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 98/108 (91%), Positives = 105/108 (97%), Gaps = 0/108 (0%)
 Frame = +1

Query  76   MAEQTEKAFLKQPGVFLSSkktgkgkrpgkggNRFWKSIGLGFKTPREATEGTYIDKKCP  255
            MAEQTEKAFLKQP VFLSSKKTGKGK+PGKGGNRFWKS+GLGFKTPR+A EGTYIDKKCP
Sbjct  1    MAEQTEKAFLKQPKVFLSSKKTGKGKKPGKGGNRFWKSVGLGFKTPRDAIEGTYIDKKCP  60

Query  256  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNI  399
            FTG VSIRGRIL+GTCHSAKM+RTIIVRRNYLH++KKYQRYEKRHSNI
Sbjct  61   FTGNVSIRGRILSGTCHSAKMSRTIIVRRNYLHYIKKYQRYEKRHSNI  108



>ref|XP_008378412.1| PREDICTED: 40S ribosomal protein S11 [Malus domestica]
 ref|XP_008394149.1| PREDICTED: 40S ribosomal protein S11 [Malus domestica]
Length=159

 Score =   182 bits (463),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 99/108 (92%), Positives = 105/108 (97%), Gaps = 0/108 (0%)
 Frame = +1

Query  76   MAEQTEKAFLKQPGVFLSSkktgkgkrpgkggNRFWKSIGLGFKTPREATEGTYIDKKCP  255
            MAEQTEKAFLKQP VFLSSKKTGKGKRPGKGGNRFWKS+GLGFKTPR+A EGTYIDKKCP
Sbjct  1    MAEQTEKAFLKQPKVFLSSKKTGKGKRPGKGGNRFWKSVGLGFKTPRDAIEGTYIDKKCP  60

Query  256  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNI  399
            FTG VSIRGRIL+GTCHSAKM+RTIIVRRNYLH++KKYQRYEKRHSNI
Sbjct  61   FTGNVSIRGRILSGTCHSAKMSRTIIVRRNYLHYIKKYQRYEKRHSNI  108



>ref|XP_009141711.1| PREDICTED: 40S ribosomal protein S11-3-like [Brassica rapa]
 emb|CDY69343.1| BnaAnng30090D [Brassica napus]
 emb|CDX87158.1| BnaC09g04730D [Brassica napus]
Length=159

 Score =   182 bits (463),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 99/108 (92%), Positives = 104/108 (96%), Gaps = 0/108 (0%)
 Frame = +1

Query  76   MAEQTEKAFLKQPGVFLSSkktgkgkrpgkggNRFWKSIGLGFKTPREATEGTYIDKKCP  255
            MAEQTEKAFLKQP VFLSSKK+GKGKRPGKGGNRFWK+IGL FKTPR+A +GTYID+KCP
Sbjct  1    MAEQTEKAFLKQPKVFLSSKKSGKGKRPGKGGNRFWKNIGLSFKTPRDAIDGTYIDRKCP  60

Query  256  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNI  399
            FTGTVSIRGRILAGTCHSAKM RTIIVRRNYLHFVKKYQRYEKRHSNI
Sbjct  61   FTGTVSIRGRILAGTCHSAKMQRTIIVRRNYLHFVKKYQRYEKRHSNI  108



>ref|XP_010266772.1| PREDICTED: 40S ribosomal protein S11 [Nelumbo nucifera]
Length=160

 Score =   182 bits (463),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 101/108 (94%), Positives = 103/108 (95%), Gaps = 0/108 (0%)
 Frame = +1

Query  76   MAEQTEKAFLKQPGVFLSSkktgkgkrpgkggNRFWKSIGLGFKTPREATEGTYIDKKCP  255
            MAEQTEKAFLKQP VFL SKK+GKGKRPGKGGNRFWKSIGLGFKTPREA EGTYIDKKCP
Sbjct  1    MAEQTEKAFLKQPKVFLCSKKSGKGKRPGKGGNRFWKSIGLGFKTPREAIEGTYIDKKCP  60

Query  256  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNI  399
            FTG VSIRGRILAGTCHSAKM RTIIVRRNYLH+VKKYQRYEKRHSNI
Sbjct  61   FTGDVSIRGRILAGTCHSAKMIRTIIVRRNYLHYVKKYQRYEKRHSNI  108



>ref|XP_007223638.1| hypothetical protein PRUPE_ppa012659mg [Prunus persica]
 gb|EMJ24837.1| hypothetical protein PRUPE_ppa012659mg [Prunus persica]
Length=159

 Score =   182 bits (463),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 98/108 (91%), Positives = 105/108 (97%), Gaps = 0/108 (0%)
 Frame = +1

Query  76   MAEQTEKAFLKQPGVFLSSkktgkgkrpgkggNRFWKSIGLGFKTPREATEGTYIDKKCP  255
            MAEQTEKAFLKQP VFLSSKKTGKGKRPGKGGNRFWKS+GLGFKTPR+A EGTYIDKKCP
Sbjct  1    MAEQTEKAFLKQPKVFLSSKKTGKGKRPGKGGNRFWKSVGLGFKTPRDAIEGTYIDKKCP  60

Query  256  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNI  399
            FTG VSIRGR+L+GTCHSAKM+RTIIVRRNYLH++KKYQRYEKRHSNI
Sbjct  61   FTGNVSIRGRVLSGTCHSAKMSRTIIVRRNYLHYIKKYQRYEKRHSNI  108



>ref|NP_194809.1| 40S ribosomal protein S11-2 [Arabidopsis thaliana]
 sp|O65569.2|RS112_ARATH RecName: Full=40S ribosomal protein S11-2 [Arabidopsis thaliana]
 emb|CAA18213.2| ribosomal protein S11-like [Arabidopsis thaliana]
 emb|CAB79798.1| ribosomal protein S11-like [Arabidopsis thaliana]
 gb|AAK76711.1| putative ribosomal protein S11 [Arabidopsis thaliana]
 gb|AAM14143.1| putative ribosomal protein S11 [Arabidopsis thaliana]
 gb|AEE85810.1| 40S ribosomal protein S11-2 [Arabidopsis thaliana]
Length=159

 Score =   182 bits (462),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 99/108 (92%), Positives = 105/108 (97%), Gaps = 0/108 (0%)
 Frame = +1

Query  76   MAEQTEKAFLKQPGVFLSSkktgkgkrpgkggNRFWKSIGLGFKTPREATEGTYIDKKCP  255
            MAEQTEKAFLKQP VFLSSKK+GKGKRPGKGGNRFWK+IGLGFKTPREA EGTYID+KCP
Sbjct  1    MAEQTEKAFLKQPKVFLSSKKSGKGKRPGKGGNRFWKNIGLGFKTPREAIEGTYIDQKCP  60

Query  256  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNI  399
            FTGTVSIRGRIL+GTCHSAKM RTIIVRR+YLHFVKKY+RYEKRHSNI
Sbjct  61   FTGTVSIRGRILSGTCHSAKMQRTIIVRRDYLHFVKKYRRYEKRHSNI  108



>ref|XP_008447825.1| PREDICTED: 40S ribosomal protein S11-like [Cucumis melo]
Length=159

 Score =   182 bits (462),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 100/108 (93%), Positives = 102/108 (94%), Gaps = 0/108 (0%)
 Frame = +1

Query  76   MAEQTEKAFLKQPGVFLSSkktgkgkrpgkggNRFWKSIGLGFKTPREATEGTYIDKKCP  255
            MAEQTEKAFLKQP VFL SKKT KGKRPGKGGNRFWKSIGLGFKTPR+A EGTYIDKKCP
Sbjct  1    MAEQTEKAFLKQPKVFLCSKKTAKGKRPGKGGNRFWKSIGLGFKTPRDAIEGTYIDKKCP  60

Query  256  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNI  399
            F GTVSIRGRILAGTCHSAKM RTIIVRRNYLH+VKKYQRYEKRHSNI
Sbjct  61   FAGTVSIRGRILAGTCHSAKMVRTIIVRRNYLHYVKKYQRYEKRHSNI  108



>emb|CDY05882.1| BnaC08g20590D [Brassica napus]
Length=159

 Score =   182 bits (462),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 99/108 (92%), Positives = 103/108 (95%), Gaps = 0/108 (0%)
 Frame = +1

Query  76   MAEQTEKAFLKQPGVFLSSkktgkgkrpgkggNRFWKSIGLGFKTPREATEGTYIDKKCP  255
            MAEQTEKAFLKQP VFLSSK +GKGKRPGKGGNRF K+IGLGFKTPREA++GTYID KCP
Sbjct  1    MAEQTEKAFLKQPKVFLSSKISGKGKRPGKGGNRFVKNIGLGFKTPREASQGTYIDSKCP  60

Query  256  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNI  399
            FTGTVSIRGRILAGTCHSAKM RTIIVRRNYLHFVKKYQRYEKRHSNI
Sbjct  61   FTGTVSIRGRILAGTCHSAKMQRTIIVRRNYLHFVKKYQRYEKRHSNI  108



>dbj|BAJ89702.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=161

 Score =   182 bits (461),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 94/109 (86%), Positives = 99/109 (91%), Gaps = 1/109 (1%)
 Frame = +1

Query  76   MAEQTEKAFLKQPGVFL-SSkktgkgkrpgkggNRFWKSIGLGFKTPREATEGTYIDKKC  252
            MAEQTEKAFLKQP VFL S K T    +PGK GNRFWKS+GLGFKTP+EA EGTYIDKKC
Sbjct  1    MAEQTEKAFLKQPKVFLCSKKATKGNNKPGKEGNRFWKSVGLGFKTPKEAIEGTYIDKKC  60

Query  253  PFTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNI  399
            PFTGTVSIRGRI+AGTCHSAKMNRTIIVRRNYLH+VKKYQRYEKRHSNI
Sbjct  61   PFTGTVSIRGRIIAGTCHSAKMNRTIIVRRNYLHYVKKYQRYEKRHSNI  109



>ref|XP_009151636.1| PREDICTED: 40S ribosomal protein S11-3 [Brassica rapa]
 emb|CDX83060.1| BnaA01g20600D [Brassica napus]
Length=159

 Score =   182 bits (461),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 99/108 (92%), Positives = 103/108 (95%), Gaps = 0/108 (0%)
 Frame = +1

Query  76   MAEQTEKAFLKQPGVFLSSkktgkgkrpgkggNRFWKSIGLGFKTPREATEGTYIDKKCP  255
            MAEQTEKAFLKQP VFLSSK +GKGKRPGKGGNRF K+IGLGFKTPREA +GTYID+KCP
Sbjct  1    MAEQTEKAFLKQPKVFLSSKISGKGKRPGKGGNRFSKNIGLGFKTPREAIQGTYIDRKCP  60

Query  256  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNI  399
            FTGTVSIRGRILAGTCHSAKM RTIIVRRNYLHFVKKYQRYEKRHSNI
Sbjct  61   FTGTVSIRGRILAGTCHSAKMQRTIIVRRNYLHFVKKYQRYEKRHSNI  108



>gb|AFK38811.1| unknown [Lotus japonicus]
 gb|AFK49311.1| unknown [Lotus japonicus]
Length=159

 Score =   182 bits (461),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 98/108 (91%), Positives = 103/108 (95%), Gaps = 0/108 (0%)
 Frame = +1

Query  76   MAEQTEKAFLKQPGVFLSSkktgkgkrpgkggNRFWKSIGLGFKTPREATEGTYIDKKCP  255
            MAEQTEKAFLKQP VFL SKK+GKGKRPGKGGNRFWKSIGLGFKTPR+A EG+YIDKKCP
Sbjct  1    MAEQTEKAFLKQPKVFLCSKKSGKGKRPGKGGNRFWKSIGLGFKTPRDAIEGSYIDKKCP  60

Query  256  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNI  399
            FTG VS+RGRILAGTCHSAKM RTIIVRRNYLHF+KKYQRYEKRHSNI
Sbjct  61   FTGNVSVRGRILAGTCHSAKMTRTIIVRRNYLHFIKKYQRYEKRHSNI  108



>emb|CDY64632.1| BnaCnng44460D [Brassica napus]
Length=230

 Score =   184 bits (467),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 104/120 (87%), Positives = 109/120 (91%), Gaps = 2/120 (2%)
 Frame = +1

Query  40   LLSSCDTSAATIMAEQTEKAFLKQPGVFLSSkktgkgkrpgkggNRFWKSIGLGFKTPRE  219
            L SS   +AA  MAEQTEKAFLKQP VFLSSK +GKGKRPGKGGNRF K+IGLGFKTPRE
Sbjct  48   LASSFHKTAA--MAEQTEKAFLKQPKVFLSSKISGKGKRPGKGGNRFSKNIGLGFKTPRE  105

Query  220  ATEGTYIDKKCPFTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNI  399
            A +GTYID+KCPFTGTVSIRGRILAGTCHSAKM RTIIVRRNYLHFVKKYQRYEKRHSNI
Sbjct  106  AIQGTYIDRKCPFTGTVSIRGRILAGTCHSAKMQRTIIVRRNYLHFVKKYQRYEKRHSNI  165



>ref|XP_003609505.1| 40S ribosomal protein S11 [Medicago truncatula]
 gb|ACJ85897.1| unknown [Medicago truncatula]
 gb|AES91702.1| 40S ribosomal protein S11-1 [Medicago truncatula]
 gb|AFK37047.1| unknown [Medicago truncatula]
Length=160

 Score =   181 bits (460),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 98/108 (91%), Positives = 104/108 (96%), Gaps = 0/108 (0%)
 Frame = +1

Query  76   MAEQTEKAFLKQPGVFLSSkktgkgkrpgkggNRFWKSIGLGFKTPREATEGTYIDKKCP  255
            MAEQTEKAFLKQP VFL SKK+GKGKRPGKGGNRF+KS+GLGFKTPREA +GTYIDKKCP
Sbjct  1    MAEQTEKAFLKQPKVFLCSKKSGKGKRPGKGGNRFFKSVGLGFKTPREAIDGTYIDKKCP  60

Query  256  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNI  399
            FTG VSIRGRILAGTCHSAKMNRTI+VRRNYLHF+KKYQRYEKRHSNI
Sbjct  61   FTGNVSIRGRILAGTCHSAKMNRTIVVRRNYLHFIKKYQRYEKRHSNI  108



>emb|CDX80385.1| BnaC07g30590D [Brassica napus]
Length=388

 Score =   189 bits (479),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 99/108 (92%), Positives = 104/108 (96%), Gaps = 0/108 (0%)
 Frame = +1

Query  76   MAEQTEKAFLKQPGVFLSSkktgkgkrpgkggNRFWKSIGLGFKTPREATEGTYIDKKCP  255
            MAEQTEKAFLKQP VFLSSKK+GKGKRPGKGGNRFWK+IGLGFKTPR+A +G YIDKKCP
Sbjct  230  MAEQTEKAFLKQPKVFLSSKKSGKGKRPGKGGNRFWKNIGLGFKTPRDAIDGHYIDKKCP  289

Query  256  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNI  399
            FTGTVS+RGRILAGTCHSAKM RTIIVRRNYLHFVKKYQRYEKRHSNI
Sbjct  290  FTGTVSVRGRILAGTCHSAKMQRTIIVRRNYLHFVKKYQRYEKRHSNI  337



>ref|XP_011089695.1| PREDICTED: 40S ribosomal protein S11 [Sesamum indicum]
Length=159

 Score =   181 bits (460),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 99/108 (92%), Positives = 102/108 (94%), Gaps = 0/108 (0%)
 Frame = +1

Query  76   MAEQTEKAFLKQPGVFLSSkktgkgkrpgkggNRFWKSIGLGFKTPREATEGTYIDKKCP  255
            MAEQTEKAFLKQP VFL SKK+GKGK PGKGGNR+WKSIGLGFKTPREA EGTYIDKKCP
Sbjct  1    MAEQTEKAFLKQPKVFLCSKKSGKGKAPGKGGNRYWKSIGLGFKTPREAVEGTYIDKKCP  60

Query  256  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNI  399
            FTG VSIRGRILAGTCHSAKM RTIIVRRNYLH+VKKYQRYEKRHSNI
Sbjct  61   FTGNVSIRGRILAGTCHSAKMMRTIIVRRNYLHWVKKYQRYEKRHSNI  108



>emb|CDX88047.1| BnaA06g26380D [Brassica napus]
Length=206

 Score =   183 bits (464),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 99/108 (92%), Positives = 104/108 (96%), Gaps = 0/108 (0%)
 Frame = +1

Query  76   MAEQTEKAFLKQPGVFLSSkktgkgkrpgkggNRFWKSIGLGFKTPREATEGTYIDKKCP  255
            MAEQTEKAFLKQP VFLSSKK+GKGKRPGKGGNRFWK+IGLGFKTPR+A +G YIDKKCP
Sbjct  48   MAEQTEKAFLKQPKVFLSSKKSGKGKRPGKGGNRFWKNIGLGFKTPRDAIDGHYIDKKCP  107

Query  256  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNI  399
            FTGTVS+RGRILAGTCHSAKM RTIIVRRNYLHFVKKYQRYEKRHSNI
Sbjct  108  FTGTVSVRGRILAGTCHSAKMQRTIIVRRNYLHFVKKYQRYEKRHSNI  155



>ref|XP_010245616.1| PREDICTED: 40S ribosomal protein S11-like [Nelumbo nucifera]
Length=160

 Score =   181 bits (459),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 100/109 (92%), Positives = 104/109 (95%), Gaps = 0/109 (0%)
 Frame = +1

Query  76   MAEQTEKAFLKQPGVFLSSkktgkgkrpgkggNRFWKSIGLGFKTPREATEGTYIDKKCP  255
            MAEQTEKAFLKQP V +SSK+TGKGKRPGKGGNRFWKSIGLGFKTPREA EGTYIDKKCP
Sbjct  1    MAEQTEKAFLKQPHVGISSKRTGKGKRPGKGGNRFWKSIGLGFKTPREAIEGTYIDKKCP  60

Query  256  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIA  402
            FTG VSIRGRILAGTCHSAKM RTIIVRRNYLH+VKKYQRYEKRHSNI+
Sbjct  61   FTGNVSIRGRILAGTCHSAKMMRTIIVRRNYLHYVKKYQRYEKRHSNIS  109



>ref|XP_002285422.1| PREDICTED: 40S ribosomal protein S11 [Vitis vinifera]
 emb|CBI21107.3| unnamed protein product [Vitis vinifera]
Length=160

 Score =   181 bits (459),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 100/108 (93%), Positives = 102/108 (94%), Gaps = 0/108 (0%)
 Frame = +1

Query  76   MAEQTEKAFLKQPGVFLSSkktgkgkrpgkggNRFWKSIGLGFKTPREATEGTYIDKKCP  255
            MAEQTEKAFLKQP VFL SKK GKGKRPGKGGNRFWKSIGLGFKTPR+A EGTYIDKKCP
Sbjct  1    MAEQTEKAFLKQPKVFLCSKKGGKGKRPGKGGNRFWKSIGLGFKTPRDAIEGTYIDKKCP  60

Query  256  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNI  399
            FTG VSIRGRILAGTCHSAKM RTIIVRRNYLH+VKKYQRYEKRHSNI
Sbjct  61   FTGGVSIRGRILAGTCHSAKMMRTIIVRRNYLHYVKKYQRYEKRHSNI  108



>ref|XP_004953087.1| PREDICTED: 40S ribosomal protein S11-like isoform X1 [Setaria 
italica]
Length=174

 Score =   181 bits (460),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 96/108 (89%), Positives = 99/108 (92%), Gaps = 0/108 (0%)
 Frame = +1

Query  76   MAEQTEKAFLKQPGVFLSSkktgkgkrpgkggNRFWKSIGLGFKTPREATEGTYIDKKCP  255
            +  QTEKAFLKQP VFL  KK  KG +PGKGGNRFWKSIGLGFKTPREA EGTYIDKKCP
Sbjct  15   LVLQTEKAFLKQPKVFLCPKKAAKGNKPGKGGNRFWKSIGLGFKTPREAIEGTYIDKKCP  74

Query  256  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNI  399
            FTGTVSIRGRI+AGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNI
Sbjct  75   FTGTVSIRGRIIAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNI  122



>ref|XP_011017934.1| PREDICTED: 40S ribosomal protein S11 isoform X1 [Populus euphratica]
 ref|XP_011017935.1| PREDICTED: 40S ribosomal protein S11 isoform X2 [Populus euphratica]
Length=159

 Score =   181 bits (459),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 101/108 (94%), Positives = 104/108 (96%), Gaps = 0/108 (0%)
 Frame = +1

Query  76   MAEQTEKAFLKQPGVFLSSkktgkgkrpgkggNRFWKSIGLGFKTPREATEGTYIDKKCP  255
            MAEQTEKAFLKQP VFLSSKK+GKGKRPGKGGNRFWKSIGL FKTPREA EGTYIDKKCP
Sbjct  1    MAEQTEKAFLKQPKVFLSSKKSGKGKRPGKGGNRFWKSIGLSFKTPREAIEGTYIDKKCP  60

Query  256  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNI  399
            FTGTVSIRGRILAGTC+SAKM RTIIVRRNYLH+VKKYQRYEKRHSNI
Sbjct  61   FTGTVSIRGRILAGTCNSAKMVRTIIVRRNYLHWVKKYQRYEKRHSNI  108



>ref|XP_011089115.1| PREDICTED: 40S ribosomal protein S11-like [Sesamum indicum]
Length=159

 Score =   181 bits (459),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 98/108 (91%), Positives = 103/108 (95%), Gaps = 0/108 (0%)
 Frame = +1

Query  76   MAEQTEKAFLKQPGVFLSSkktgkgkrpgkggNRFWKSIGLGFKTPREATEGTYIDKKCP  255
            MAEQTEKAFLKQP VFL SKK+GKGK PGKGGNR+WKSIGLGFKTPREA EGTYIDKKCP
Sbjct  1    MAEQTEKAFLKQPKVFLCSKKSGKGKTPGKGGNRYWKSIGLGFKTPREAIEGTYIDKKCP  60

Query  256  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNI  399
            FTG+VS+RGRILAGTCHSAKM RTIIVRRNYLH+VKKYQRYEKRHSNI
Sbjct  61   FTGSVSVRGRILAGTCHSAKMMRTIIVRRNYLHWVKKYQRYEKRHSNI  108



>ref|XP_011081506.1| PREDICTED: 40S ribosomal protein S11 [Sesamum indicum]
Length=159

 Score =   181 bits (459),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 98/108 (91%), Positives = 103/108 (95%), Gaps = 0/108 (0%)
 Frame = +1

Query  76   MAEQTEKAFLKQPGVFLSSkktgkgkrpgkggNRFWKSIGLGFKTPREATEGTYIDKKCP  255
            MAEQTEKAFLKQP VFL SKK+GKGK PGKGGNR+WKSIGLGFKTPREA EGTYIDKKCP
Sbjct  1    MAEQTEKAFLKQPKVFLCSKKSGKGKAPGKGGNRYWKSIGLGFKTPREAIEGTYIDKKCP  60

Query  256  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNI  399
            FTG+VSIRGRILAGTCHSAKM RTI+VRRNYLH+VKKYQRYEKRHSNI
Sbjct  61   FTGSVSIRGRILAGTCHSAKMMRTIVVRRNYLHWVKKYQRYEKRHSNI  108



>ref|XP_011077210.1| PREDICTED: 40S ribosomal protein S11-like [Sesamum indicum]
Length=159

 Score =   181 bits (459),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 99/108 (92%), Positives = 102/108 (94%), Gaps = 0/108 (0%)
 Frame = +1

Query  76   MAEQTEKAFLKQPGVFLSSkktgkgkrpgkggNRFWKSIGLGFKTPREATEGTYIDKKCP  255
            MAEQTEKAFLKQP VFL SKK+GKGK PGKGGNR+WKSIGLGFKTPREA EGTYIDKKCP
Sbjct  1    MAEQTEKAFLKQPKVFLCSKKSGKGKAPGKGGNRYWKSIGLGFKTPREAVEGTYIDKKCP  60

Query  256  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNI  399
            FTG VSIRGRILAGTCHSAKM RTIIVRRNYLH+VKKYQRYEKRHSNI
Sbjct  61   FTGDVSIRGRILAGTCHSAKMVRTIIVRRNYLHWVKKYQRYEKRHSNI  108



>ref|XP_004153463.1| PREDICTED: 40S ribosomal protein S11-like [Cucumis sativus]
 gb|KGN43351.1| hypothetical protein Csa_7G025720 [Cucumis sativus]
Length=159

 Score =   181 bits (459),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 97/108 (90%), Positives = 101/108 (94%), Gaps = 0/108 (0%)
 Frame = +1

Query  76   MAEQTEKAFLKQPGVFLSSkktgkgkrpgkggNRFWKSIGLGFKTPREATEGTYIDKKCP  255
            MAEQTEKAFLKQP VFL SKKT KG +PGKGGNRFWK+IGLGFKTPR+A EGTYIDKKCP
Sbjct  1    MAEQTEKAFLKQPKVFLCSKKTAKGNKPGKGGNRFWKNIGLGFKTPRDAIEGTYIDKKCP  60

Query  256  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNI  399
            F GTVSIRGRILAGTCHSAKM RTIIVRRNYLH+VKKYQRYEKRHSNI
Sbjct  61   FAGTVSIRGRILAGTCHSAKMVRTIIVRRNYLHYVKKYQRYEKRHSNI  108



>gb|KCW50239.1| hypothetical protein EUGRSUZ_J00035 [Eucalyptus grandis]
Length=205

 Score =   182 bits (462),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 102/120 (85%), Positives = 106/120 (88%), Gaps = 0/120 (0%)
 Frame = +1

Query  40   LLSSCDTSAATIMAEQTEKAFLKQPGVFLSSkktgkgkrpgkggNRFWKSIGLGFKTPRE  219
            L S+C  S A  M  QTEKAFLKQP VFL SKK+GKGKRPGKGGNR+ KS+GLGFKTPRE
Sbjct  34   LASACSISQALKMDAQTEKAFLKQPKVFLCSKKSGKGKRPGKGGNRYHKSVGLGFKTPRE  93

Query  220  ATEGTYIDKKCPFTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNI  399
            A EGTYIDKKCPFTG VSIRGRILAGTCHSAKM RTIIVRRNYLHFVKKYQRYEKRHSNI
Sbjct  94   AIEGTYIDKKCPFTGNVSIRGRILAGTCHSAKMMRTIIVRRNYLHFVKKYQRYEKRHSNI  153



>gb|KFK27670.1| hypothetical protein AALP_AA8G413500 [Arabis alpina]
Length=159

 Score =   180 bits (457),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 99/108 (92%), Positives = 103/108 (95%), Gaps = 0/108 (0%)
 Frame = +1

Query  76   MAEQTEKAFLKQPGVFLSSkktgkgkrpgkggNRFWKSIGLGFKTPREATEGTYIDKKCP  255
            MAEQTEKAFLKQP VFLSSKK+GKGK PGKGGNRFWK+IGLGFKTPREA EG YIDKKCP
Sbjct  1    MAEQTEKAFLKQPKVFLSSKKSGKGKGPGKGGNRFWKNIGLGFKTPREAIEGGYIDKKCP  60

Query  256  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNI  399
            FTGTVS+RGRILAG+CHSAKM RTIIVRRNYLHFVKKYQRYEKRHSNI
Sbjct  61   FTGTVSVRGRILAGSCHSAKMQRTIIVRRNYLHFVKKYQRYEKRHSNI  108



>gb|KJB83250.1| hypothetical protein B456_013G237400 [Gossypium raimondii]
Length=159

 Score =   180 bits (457),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 100/108 (93%), Positives = 103/108 (95%), Gaps = 0/108 (0%)
 Frame = +1

Query  76   MAEQTEKAFLKQPGVFLSSkktgkgkrpgkggNRFWKSIGLGFKTPREATEGTYIDKKCP  255
            MAEQTEKAFLKQP VFLSSKK+ KGKRPGKGGNRFWKSIGLGFKTPREA EGTYIDKKCP
Sbjct  1    MAEQTEKAFLKQPKVFLSSKKSSKGKRPGKGGNRFWKSIGLGFKTPREAIEGTYIDKKCP  60

Query  256  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNI  399
            F GTVSIRGRILAGTCHSAKM RTIIVRRNYLH++KKYQRYEKRHSNI
Sbjct  61   FAGTVSIRGRILAGTCHSAKMIRTIIVRRNYLHYIKKYQRYEKRHSNI  108



>gb|KHG26586.1| 40S ribosomal S11 [Gossypium arboreum]
Length=164

 Score =   180 bits (457),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 101/113 (89%), Positives = 103/113 (91%), Gaps = 5/113 (4%)
 Frame = +1

Query  76   MAEQTEKAFLKQPGVFLSSkktgkgkrpgkggNRFWKSIGLGFKTPREATEGTYIDKKCP  255
            MAEQTEKAFLKQP VFLSS K GKGKRPGKGGNRFWKSIGLGFKTPREA EGTYIDKKCP
Sbjct  1    MAEQTEKAFLKQPKVFLSSNKGGKGKRPGKGGNRFWKSIGLGFKTPREAIEGTYIDKKCP  60

Query  256  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQR-----YEKRHSNI  399
            FTGTVSIRGRILAGTCHSAKM RTIIVRRNYLH++KKYQR     YEKRHSNI
Sbjct  61   FTGTVSIRGRILAGTCHSAKMVRTIIVRRNYLHYIKKYQRHDSASYEKRHSNI  113



>ref|XP_010533097.1| PREDICTED: 40S ribosomal protein S11-like [Tarenaya hassleriana]
Length=159

 Score =   180 bits (457),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 98/108 (91%), Positives = 103/108 (95%), Gaps = 0/108 (0%)
 Frame = +1

Query  76   MAEQTEKAFLKQPGVFLSSkktgkgkrpgkggNRFWKSIGLGFKTPREATEGTYIDKKCP  255
            MAEQTEKAFLKQP VFL SKKTGKGKRPGKGGNRFWK++GLGFKTPREA EGT+IDKKCP
Sbjct  1    MAEQTEKAFLKQPKVFLCSKKTGKGKRPGKGGNRFWKNVGLGFKTPREAIEGTFIDKKCP  60

Query  256  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNI  399
            FTG VS+RGRILAGTCHSAKM RTIIVRRNYLHFV+KYQRYEKRHSNI
Sbjct  61   FTGPVSVRGRILAGTCHSAKMQRTIIVRRNYLHFVRKYQRYEKRHSNI  108



>gb|KDO61813.1| hypothetical protein CISIN_1g031480mg [Citrus sinensis]
Length=144

 Score =   179 bits (454),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 92/108 (85%), Positives = 92/108 (85%), Gaps = 15/108 (14%)
 Frame = +1

Query  76   MAEQTEKAFLKQPGVFLSSkktgkgkrpgkggNRFWKSIGLGFKTPREATEGTYIDKKCP  255
            MAEQTEKAFLKQPG               KGGNRFWKSIGLGFKTPREA EGTYIDKKCP
Sbjct  1    MAEQTEKAFLKQPG---------------KGGNRFWKSIGLGFKTPREAIEGTYIDKKCP  45

Query  256  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNI  399
            FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNI
Sbjct  46   FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNI  93



>ref|XP_003575346.1| PREDICTED: 40S ribosomal protein S11-like [Brachypodium distachyon]
Length=161

 Score =   180 bits (456),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 93/109 (85%), Positives = 98/109 (90%), Gaps = 1/109 (1%)
 Frame = +1

Query  76   MAEQTEKAFLKQPGVFL-SSkktgkgkrpgkggNRFWKSIGLGFKTPREATEGTYIDKKC  252
            MAEQTEK+FLKQP VFL   K T    +PGK GNRFWKS+GLGFKTP+EA EGTYIDKKC
Sbjct  1    MAEQTEKSFLKQPKVFLCPKKITKGNNKPGKQGNRFWKSVGLGFKTPKEAIEGTYIDKKC  60

Query  253  PFTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNI  399
            PFTGTVSIRGRI+AGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNI
Sbjct  61   PFTGTVSIRGRIIAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNI  109



>ref|XP_010542070.1| PREDICTED: 40S ribosomal protein S11-like [Tarenaya hassleriana]
Length=159

 Score =   179 bits (455),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 98/108 (91%), Positives = 103/108 (95%), Gaps = 0/108 (0%)
 Frame = +1

Query  76   MAEQTEKAFLKQPGVFLSSkktgkgkrpgkggNRFWKSIGLGFKTPREATEGTYIDKKCP  255
            MAEQTEKAFLKQP VFL SKKTGKGKRPGKGGNRFWK++GLGFKTPREA EGT+IDKKCP
Sbjct  1    MAEQTEKAFLKQPRVFLCSKKTGKGKRPGKGGNRFWKNVGLGFKTPREAIEGTFIDKKCP  60

Query  256  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNI  399
            FTG VS+RGRILAGTCHSAKM RTIIVRRNYLHFV+KYQRYEKRHSNI
Sbjct  61   FTGPVSVRGRILAGTCHSAKMQRTIIVRRNYLHFVRKYQRYEKRHSNI  108



>gb|KJB27060.1| hypothetical protein B456_004G275200 [Gossypium raimondii]
Length=161

 Score =   179 bits (455),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 101/110 (92%), Positives = 103/110 (94%), Gaps = 2/110 (2%)
 Frame = +1

Query  76   MAEQTEKAFLKQPGV--FLSSkktgkgkrpgkggNRFWKSIGLGFKTPREATEGTYIDKK  249
            MAEQTEKAFLKQP V  F SSKK GKGKRPGKGGNRFWKSIGLGFKTPREA EGTYIDKK
Sbjct  1    MAEQTEKAFLKQPKVVLFFSSKKGGKGKRPGKGGNRFWKSIGLGFKTPREAIEGTYIDKK  60

Query  250  CPFTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNI  399
            CPFTGTVSIRGRILAGTCHSAKM RTIIVRRNYLH++KKYQRYEKRHSNI
Sbjct  61   CPFTGTVSIRGRILAGTCHSAKMVRTIIVRRNYLHYIKKYQRYEKRHSNI  110



>ref|XP_006852797.1| PREDICTED: 40S ribosomal protein S11-1 [Amborella trichopoda]
 gb|ERN14264.1| hypothetical protein AMTR_s00033p00158320 [Amborella trichopoda]
Length=160

 Score =   179 bits (454),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 98/108 (91%), Positives = 104/108 (96%), Gaps = 0/108 (0%)
 Frame = +1

Query  76   MAEQTEKAFLKQPGVFLSSkktgkgkrpgkggNRFWKSIGLGFKTPREATEGTYIDKKCP  255
            MAEQTEKAFLKQP VFLSSKK+GKGKRPGKGGNRFWK+IGLGFKTPREA EGT+IDKKCP
Sbjct  1    MAEQTEKAFLKQPKVFLSSKKSGKGKRPGKGGNRFWKNIGLGFKTPREAIEGTFIDKKCP  60

Query  256  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNI  399
            FTG+VSIRGRIL GTC+SAKM RTIIVRR+YLHFVKKYQRYEKRHSNI
Sbjct  61   FTGSVSIRGRILTGTCYSAKMTRTIIVRRDYLHFVKKYQRYEKRHSNI  108



>ref|XP_006349147.1| PREDICTED: 40S ribosomal protein S11-like [Solanum tuberosum]
Length=159

 Score =   179 bits (453),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 100/108 (93%), Positives = 104/108 (96%), Gaps = 0/108 (0%)
 Frame = +1

Query  76   MAEQTEKAFLKQPGVFLSSkktgkgkrpgkggNRFWKSIGLGFKTPREATEGTYIDKKCP  255
            MAEQTEKAFLKQPGVFLSSKKTGKGKRPGKGGNR++KSI LG KTPREATEGTYIDKKCP
Sbjct  1    MAEQTEKAFLKQPGVFLSSKKTGKGKRPGKGGNRYFKSIVLGSKTPREATEGTYIDKKCP  60

Query  256  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNI  399
            FTG VSIRGRIL GTCHSAKMNRTIIVRRNYLH+VKKY+RYEKRHSNI
Sbjct  61   FTGNVSIRGRILVGTCHSAKMNRTIIVRRNYLHYVKKYKRYEKRHSNI  108



>emb|CDY16867.1| BnaA09g05150D [Brassica napus]
Length=159

 Score =   179 bits (453),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 97/108 (90%), Positives = 102/108 (94%), Gaps = 0/108 (0%)
 Frame = +1

Query  76   MAEQTEKAFLKQPGVFLSSkktgkgkrpgkggNRFWKSIGLGFKTPREATEGTYIDKKCP  255
            MAEQTEKAFLKQP VFLSSKK+GKGKRPGKGGNRFWK+IGL FKTPR+A +GTYID+KCP
Sbjct  1    MAEQTEKAFLKQPKVFLSSKKSGKGKRPGKGGNRFWKNIGLSFKTPRDAIDGTYIDRKCP  60

Query  256  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNI  399
            FTGTVSIRGRILAGTCHSAKM RTII RRNY HFVKKYQRYEKRHSNI
Sbjct  61   FTGTVSIRGRILAGTCHSAKMQRTIIFRRNYFHFVKKYQRYEKRHSNI  108



>dbj|BAC22544.1| putative 40S ribosomal protein S11 [Oryza sativa Japonica Group]
 emb|CAE05212.3| OSJNBa0070C17.19 [Oryza sativa Japonica Group]
 dbj|BAD30108.1| putative 40S ribosomal protein S11 [Oryza sativa Japonica Group]
 gb|EAY95523.1| hypothetical protein OsI_17369 [Oryza sativa Indica Group]
 gb|EAZ40319.1| hypothetical protein OsJ_24765 [Oryza sativa Japonica Group]
Length=170

 Score =   179 bits (454),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 103/117 (88%), Positives = 106/117 (91%), Gaps = 9/117 (8%)
 Frame = +1

Query  76   MAEQTEKAFLKQPGVFLSSkktgkgkrpgkggNRFWKSIGLGFKTPREATEGTYIDKKCP  255
            MAEQTEKAFLKQP VFLSSKK+GKGK+PGKGGNRFWKSIGLGFKTPREA EGTYIDKKCP
Sbjct  1    MAEQTEKAFLKQPKVFLSSKKSGKGKKPGKGGNRFWKSIGLGFKTPREAIEGTYIDKKCP  60

Query  256  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQ---------RYEKRHSNI  399
            FTGTVSIRGRI+AGTCHSAKMNRTIIVRRNYLHFVKKYQ         RYEKRHSNI
Sbjct  61   FTGTVSIRGRIIAGTCHSAKMNRTIIVRRNYLHFVKKYQRQGANLPPCRYEKRHSNI  117



>tpg|DAA37074.1| TPA: 40S ribosomal protein S11 [Zea mays]
Length=571

 Score =   189 bits (481),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 98/112 (88%), Positives = 103/112 (92%), Gaps = 0/112 (0%)
 Frame = +1

Query  64   AATIMAEQTEKAFLKQPGVFLSSkktgkgkrpgkggNRFWKSIGLGFKTPREATEGTYID  243
            +A  MAEQTE+AFLKQP VFL SKK  K  +PGKGGNRFWK+IGLGFKTPREA EGTYID
Sbjct  408  SAASMAEQTERAFLKQPKVFLCSKKATKVNKPGKGGNRFWKNIGLGFKTPREAIEGTYID  467

Query  244  KKCPFTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNI  399
            KKCPFTGTVSIRGRI+AGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNI
Sbjct  468  KKCPFTGTVSIRGRIIAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNI  519



>ref|XP_003573544.1| PREDICTED: 40S ribosomal protein S11-like isoform X2 [Brachypodium 
distachyon]
Length=160

 Score =   178 bits (451),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 94/108 (87%), Positives = 100/108 (93%), Gaps = 0/108 (0%)
 Frame = +1

Query  76   MAEQTEKAFLKQPGVFLSSkktgkgkrpgkggNRFWKSIGLGFKTPREATEGTYIDKKCP  255
            MAEQTEKAFLKQP VFL  KK+ KGKRPGK GNRFWK++GLGFKTP+EA EG YIDKKCP
Sbjct  1    MAEQTEKAFLKQPKVFLCPKKSDKGKRPGKAGNRFWKNVGLGFKTPKEAIEGAYIDKKCP  60

Query  256  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNI  399
            FTGTVSIRGRI+AGTCHSAKMNRTII+ RNYLHFVKKYQRYEKRHSNI
Sbjct  61   FTGTVSIRGRIIAGTCHSAKMNRTIIICRNYLHFVKKYQRYEKRHSNI  108



>gb|AAA32867.1| ribosomal protein S11 [Arabidopsis thaliana]
Length=159

 Score =   177 bits (450),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 96/108 (89%), Positives = 101/108 (94%), Gaps = 0/108 (0%)
 Frame = +1

Query  76   MAEQTEKAFLKQPGVFLSSkktgkgkrpgkggNRFWKSIGLGFKTPREATEGTYIDKKCP  255
            MAEQTEKAFLKQP VFLSSK +GKGKRPGKGGNRFWK+IGLGFKTPREA +G YID KCP
Sbjct  1    MAEQTEKAFLKQPKVFLSSKISGKGKRPGKGGNRFWKNIGLGFKTPREAIDGAYIDSKCP  60

Query  256  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNI  399
            FTGTVSIRGRILAGTCHSAKM RTIIVRR+YLHFVKKY RYEKRHS+I
Sbjct  61   FTGTVSIRGRILAGTCHSAKMQRTIIVRRDYLHFVKKYPRYEKRHSHI  108



>gb|EAY94752.1| hypothetical protein OsI_16531 [Oryza sativa Indica Group]
 gb|EAZ31257.1| hypothetical protein OsJ_15361 [Oryza sativa Japonica Group]
Length=167

 Score =   178 bits (451),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 99/115 (86%), Positives = 103/115 (90%), Gaps = 7/115 (6%)
 Frame = +1

Query  76   MAEQTEKAFLKQPGVFLSSkktgkgkrpgkggNRFWKSIGLGFKTPREATEGTYIDKKCP  255
            MAEQTE+AFLKQP VFL  KKT KGK+PGKGGNRFWK+IGLGFKTPREA EGTYIDKKCP
Sbjct  1    MAEQTERAFLKQPKVFLCPKKTTKGKKPGKGGNRFWKNIGLGFKTPREAIEGTYIDKKCP  60

Query  256  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQR-------YEKRHSNI  399
            FTGTVSIRGRI+AGTCHSAKMNRTIIVRRNYLHFVKKYQR       YEKRHSNI
Sbjct  61   FTGTVSIRGRIIAGTCHSAKMNRTIIVRRNYLHFVKKYQRQVNLVAGYEKRHSNI  115



>emb|CDY44261.1| BnaC02g41560D [Brassica napus]
Length=177

 Score =   178 bits (451),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 95/105 (90%), Positives = 102/105 (97%), Gaps = 0/105 (0%)
 Frame = +1

Query  85   QTEKAFLKQPGVFLSSkktgkgkrpgkggNRFWKSIGLGFKTPREATEGTYIDKKCPFTG  264
            QTEKAFLKQP VFLSSKK+GKGKRPGKGGNRFWK+IGLGFKTPR+A +GTYID+KCPFTG
Sbjct  22   QTEKAFLKQPKVFLSSKKSGKGKRPGKGGNRFWKNIGLGFKTPRDAIDGTYIDRKCPFTG  81

Query  265  TVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNI  399
            TVS+RGRILAGTCHSAKM RTI+VRRNYLHFVKKYQRYEKRHSNI
Sbjct  82   TVSVRGRILAGTCHSAKMQRTIVVRRNYLHFVKKYQRYEKRHSNI  126



>ref|XP_011627847.1| PREDICTED: 40S ribosomal protein S11-1 [Amborella trichopoda]
Length=160

 Score =   176 bits (447),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 97/108 (90%), Positives = 102/108 (94%), Gaps = 0/108 (0%)
 Frame = +1

Query  76   MAEQTEKAFLKQPGVFLSSkktgkgkrpgkggNRFWKSIGLGFKTPREATEGTYIDKKCP  255
            MAEQTEKAFLKQP VF SSKK+GKGKRPGKGGNRFWK+IGLGFKTPREA EGTYIDKKCP
Sbjct  1    MAEQTEKAFLKQPKVFQSSKKSGKGKRPGKGGNRFWKNIGLGFKTPREAIEGTYIDKKCP  60

Query  256  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNI  399
            F+G VSIRGRIL GTC+SAKM RTIIVRR+YLHFVKKYQRYEKRHSNI
Sbjct  61   FSGNVSIRGRILTGTCYSAKMTRTIIVRRDYLHFVKKYQRYEKRHSNI  108



>ref|XP_006586636.1| PREDICTED: uncharacterized protein LOC100500186 isoform X1 [Glycine 
max]
Length=177

 Score =   177 bits (448),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 101/122 (83%), Positives = 104/122 (85%), Gaps = 4/122 (3%)
 Frame = +1

Query  34   NSLLSSCDTSAATIMAEQTEKAFLKQPGVFLSSkktgkgkrpgkggNRFWKSIGLGFKTP  213
            NSL   C  +       QTEKAFLKQP VFL SKK GKGKRPGKGGNRFWKSIGLGFKTP
Sbjct  9    NSLFIICFLN----FGLQTEKAFLKQPKVFLCSKKGGKGKRPGKGGNRFWKSIGLGFKTP  64

Query  214  REATEGTYIDKKCPFTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHS  393
            R+A EGTYIDKKCPFTG VSIRGRILAGTCHSAKM RTIIVRRNYLHF+KKYQRYEKRHS
Sbjct  65   RDAIEGTYIDKKCPFTGNVSIRGRILAGTCHSAKMTRTIIVRRNYLHFIKKYQRYEKRHS  124

Query  394  NI  399
            NI
Sbjct  125  NI  126



>gb|ABK22030.1| unknown [Picea sitchensis]
 gb|ABK22500.1| unknown [Picea sitchensis]
 gb|ABR18448.1| unknown [Picea sitchensis]
 gb|ACN40680.1| unknown [Picea sitchensis]
Length=160

 Score =   176 bits (445),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 95/108 (88%), Positives = 104/108 (96%), Gaps = 0/108 (0%)
 Frame = +1

Query  76   MAEQTEKAFLKQPGVFLSSkktgkgkrpgkggNRFWKSIGLGFKTPREATEGTYIDKKCP  255
            MAEQTE+AFLKQP VFLSSKK+GKGKRPGKGGNRF+K++GLGFKTP+EA +GTYIDKKCP
Sbjct  1    MAEQTERAFLKQPKVFLSSKKSGKGKRPGKGGNRFFKNVGLGFKTPKEAVQGTYIDKKCP  60

Query  256  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNI  399
            FTG VSIRGRILAGTC+SAKM RTIIVRR+YLHFVKKYQRYEKRHSNI
Sbjct  61   FTGNVSIRGRILAGTCYSAKMTRTIIVRRDYLHFVKKYQRYEKRHSNI  108



>gb|EEE68230.1| hypothetical protein OsJ_26414 [Oryza sativa Japonica Group]
Length=519

 Score =   185 bits (470),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 99/108 (92%), Positives = 104/108 (96%), Gaps = 0/108 (0%)
 Frame = +1

Query  76   MAEQTEKAFLKQPGVFLSSkktgkgkrpgkggNRFWKSIGLGFKTPREATEGTYIDKKCP  255
            MAEQTE+AFLKQP VFL  KK+GKGK+PGKGGNRFWK+IGLGFKTPREA EGTYIDKKCP
Sbjct  1    MAEQTERAFLKQPKVFLCPKKSGKGKKPGKGGNRFWKNIGLGFKTPREAIEGTYIDKKCP  60

Query  256  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNI  399
            FTGTVSIRGRI+AGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNI
Sbjct  61   FTGTVSIRGRIIAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNI  108



>gb|EMS61594.1| 40S ribosomal protein S11 [Triticum urartu]
Length=156

 Score =   174 bits (442),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 93/108 (86%), Positives = 99/108 (92%), Gaps = 3/108 (3%)
 Frame = +1

Query  76   MAEQTEKAFLKQPGVFLSSkktgkgkrpgkggNRFWKSIGLGFKTPREATEGTYIDKKCP  255
            MAEQTEK+FLKQP VFLS+KK  K KRPGK GNRFWKS+GLGFKTPREA +GTYIDKKCP
Sbjct  1    MAEQTEKSFLKQPKVFLSTKKADKAKRPGKAGNRFWKSVGLGFKTPREAIDGTYIDKKCP  60

Query  256  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNI  399
            FTGTV+IRGRI+AGTCHSAKMNRTIIVRRNYLHFVKK   YEKRHSNI
Sbjct  61   FTGTVAIRGRIIAGTCHSAKMNRTIIVRRNYLHFVKK---YEKRHSNI  105



>ref|XP_010234462.1| PREDICTED: 40S ribosomal protein S11-like isoform X1 [Brachypodium 
distachyon]
Length=170

 Score =   174 bits (442),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 93/116 (80%), Positives = 100/116 (86%), Gaps = 0/116 (0%)
 Frame = +1

Query  52   CDTSAATIMAEQTEKAFLKQPGVFLSSkktgkgkrpgkggNRFWKSIGLGFKTPREATEG  231
            C       M+ QTEKAFLKQP VFL  KK+ KGKRPGK GNRFWK++GLGFKTP+EA EG
Sbjct  3    CSVVRPKQMSGQTEKAFLKQPKVFLCPKKSDKGKRPGKAGNRFWKNVGLGFKTPKEAIEG  62

Query  232  TYIDKKCPFTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNI  399
             YIDKKCPFTGTVSIRGRI+AGTCHSAKMNRTII+ RNYLHFVKKYQRYEKRHSNI
Sbjct  63   AYIDKKCPFTGTVSIRGRIIAGTCHSAKMNRTIIICRNYLHFVKKYQRYEKRHSNI  118



>ref|XP_010048926.1| PREDICTED: 40S ribosomal protein S11-like [Eucalyptus grandis]
 gb|KCW81347.1| hypothetical protein EUGRSUZ_C02730 [Eucalyptus grandis]
 gb|KCW81348.1| hypothetical protein EUGRSUZ_C02730 [Eucalyptus grandis]
Length=160

 Score =   174 bits (441),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 96/108 (89%), Positives = 100/108 (93%), Gaps = 0/108 (0%)
 Frame = +1

Query  76   MAEQTEKAFLKQPGVFLSSkktgkgkrpgkggNRFWKSIGLGFKTPREATEGTYIDKKCP  255
            M  QTEKAFLKQP VFL S+K+GKGKRPGKGGNR+ KS+GLGFKTPREA EGTYIDKKCP
Sbjct  1    MDAQTEKAFLKQPKVFLCSQKSGKGKRPGKGGNRYHKSVGLGFKTPREAVEGTYIDKKCP  60

Query  256  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNI  399
            FTG VSIRGRILAGTCHSAKM RTIIVRRNYLHFVKKYQRYEKRHSNI
Sbjct  61   FTGNVSIRGRILAGTCHSAKMMRTIIVRRNYLHFVKKYQRYEKRHSNI  108



>ref|XP_003589042.1| 40S ribosomal protein S11 [Medicago truncatula]
 gb|AES59293.1| 40S ribosomal protein S11-1 [Medicago truncatula]
Length=161

 Score =   174 bits (440),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 93/108 (86%), Positives = 101/108 (94%), Gaps = 0/108 (0%)
 Frame = +1

Query  76   MAEQTEKAFLKQPGVFLSSkktgkgkrpgkggNRFWKSIGLGFKTPREATEGTYIDKKCP  255
            MAEQTEKAFLKQ  VFL SK +GKGKRPGKGGNRF K++GLGFKTPREA EGTYIDKKCP
Sbjct  1    MAEQTEKAFLKQNKVFLCSKISGKGKRPGKGGNRFHKTVGLGFKTPREAIEGTYIDKKCP  60

Query  256  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNI  399
            FTG VSIRGRI++GTCHSAKMN+TI+VRRNYLHF+KKYQRYEKRHSNI
Sbjct  61   FTGNVSIRGRIISGTCHSAKMNKTIVVRRNYLHFIKKYQRYEKRHSNI  108



>ref|XP_010030990.1| PREDICTED: 40S ribosomal protein S11 [Eucalyptus grandis]
Length=160

 Score =   173 bits (439),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 97/108 (90%), Positives = 100/108 (93%), Gaps = 0/108 (0%)
 Frame = +1

Query  76   MAEQTEKAFLKQPGVFLSSkktgkgkrpgkggNRFWKSIGLGFKTPREATEGTYIDKKCP  255
            M  QTEKAFLKQP VFL SKK+GKGKRPGKGGNR+ KS+GLGFKTPREA EGTYIDKKCP
Sbjct  1    MDAQTEKAFLKQPKVFLCSKKSGKGKRPGKGGNRYHKSVGLGFKTPREAIEGTYIDKKCP  60

Query  256  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNI  399
            FTG VSIRGRILAGTCHSAKM RTIIVRRNYLHFVKKYQRYEKRHSNI
Sbjct  61   FTGNVSIRGRILAGTCHSAKMMRTIIVRRNYLHFVKKYQRYEKRHSNI  108



>emb|CAE05213.3| OSJNBa0070C17.20 [Oryza sativa Japonica Group]
Length=185

 Score =   173 bits (438),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 103/132 (78%), Positives = 106/132 (80%), Gaps = 24/132 (18%)
 Frame = +1

Query  76   MAEQTEKAFLKQPGVFLSSkktgkgkrpgkggNRFWKSIGLGFKTPREATEGTYIDKKCP  255
            MAEQTEKAFLKQP VFLSSKK+GKGK+PGKGGNRFWKSIGLGFKTPREA EGTYIDKKCP
Sbjct  1    MAEQTEKAFLKQPKVFLSSKKSGKGKKPGKGGNRFWKSIGLGFKTPREAIEGTYIDKKCP  60

Query  256  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQ---------------------  372
            FTGTVSIRGRI+AGTCHSAKMNRTIIVRRNYLHFVKKYQ                     
Sbjct  61   FTGTVSIRGRIIAGTCHSAKMNRTIIVRRNYLHFVKKYQRQVNNYGFYLCFFSFFFPISD  120

Query  373  ---RYEKRHSNI  399
               RYEKRHSNI
Sbjct  121  LGCRYEKRHSNI  132



>gb|EYU20230.1| hypothetical protein MIMGU_mgv1a015021mg [Erythranthe guttata]
Length=126

 Score =   170 bits (431),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 94/108 (87%), Positives = 101/108 (94%), Gaps = 0/108 (0%)
 Frame = +1

Query  76   MAEQTEKAFLKQPGVFLSSkktgkgkrpgkggNRFWKSIGLGFKTPREATEGTYIDKKCP  255
            MAEQTEKAFLKQP VFL SKK+GKGK PGKGGNR++KSIGL +KTPREA+EGTYIDKKCP
Sbjct  1    MAEQTEKAFLKQPKVFLCSKKSGKGKTPGKGGNRYFKSIGLQYKTPREASEGTYIDKKCP  60

Query  256  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNI  399
            FTG VSIRGRILAGTCHSAKM RTIIVRRNY+H+V KYQRYEKRHSNI
Sbjct  61   FTGDVSIRGRILAGTCHSAKMVRTIIVRRNYMHWVSKYQRYEKRHSNI  108



>ref|NP_001175260.1| Os07g0565101 [Oryza sativa Japonica Group]
 dbj|BAH93988.1| Os07g0565101 [Oryza sativa Japonica Group]
Length=129

 Score =   170 bits (431),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 96/105 (91%), Positives = 99/105 (94%), Gaps = 0/105 (0%)
 Frame = +1

Query  76   MAEQTEKAFLKQPGVFLSSkktgkgkrpgkggNRFWKSIGLGFKTPREATEGTYIDKKCP  255
            MAEQTEKAFLKQP VFLSSKK+GKGK+PGKGGNRFWKSIGLGFKTPREA EGTYIDKKCP
Sbjct  1    MAEQTEKAFLKQPKVFLSSKKSGKGKKPGKGGNRFWKSIGLGFKTPREAIEGTYIDKKCP  60

Query  256  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRH  390
            FTGTVSIRGRI+AGTCHSAKMNRTIIVRRNYLHFVKKYQR    H
Sbjct  61   FTGTVSIRGRIIAGTCHSAKMNRTIIVRRNYLHFVKKYQRQVNYH  105



>gb|EMT05895.1| 40S ribosomal protein S11 [Aegilops tauschii]
Length=176

 Score =   171 bits (434),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 94/124 (76%), Positives = 99/124 (80%), Gaps = 16/124 (13%)
 Frame = +1

Query  76   MAEQTEKAFLKQPGVFL---------SSkktgkgkrpgkggNRFWKSIGLGFKTPREATE  228
            MAEQTEKAFLKQP VFL         S K T    +PGK GNRFWKS+GLGFKTP+EA E
Sbjct  1    MAEQTEKAFLKQPKVFLWYEEVLFSNSKKTTKGNNKPGKEGNRFWKSVGLGFKTPKEAIE  60

Query  229  GTYIDKKCPFTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQR-------YEKR  387
            GTYIDKKCPFTGTVSIRGRI+AGTCHSAKMNRTIIVRRNYLH+VKKYQR       YEKR
Sbjct  61   GTYIDKKCPFTGTVSIRGRIIAGTCHSAKMNRTIIVRRNYLHYVKKYQRQANLLHWYEKR  120

Query  388  HSNI  399
            HSNI
Sbjct  121  HSNI  124



>ref|XP_008219543.1| PREDICTED: 40S ribosomal protein S11 [Prunus mume]
Length=159

 Score =   170 bits (431),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 94/108 (87%), Positives = 100/108 (93%), Gaps = 0/108 (0%)
 Frame = +1

Query  76   MAEQTEKAFLKQPGVFLSSkktgkgkrpgkggNRFWKSIGLGFKTPREATEGTYIDKKCP  255
            MAEQTEKAFLKQP VFLSSKKTGKGKRPGKGGNRFWKS+GLGFKTPR+A EGTYIDKKCP
Sbjct  1    MAEQTEKAFLKQPKVFLSSKKTGKGKRPGKGGNRFWKSVGLGFKTPRDAIEGTYIDKKCP  60

Query  256  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNI  399
            FTG VSIRGRIL+GTCHSAKM+RTIIVRRNYLH++KKYQRY    S I
Sbjct  61   FTGNVSIRGRILSGTCHSAKMSRTIIVRRNYLHYIKKYQRYXXXXSTI  108



>tpg|DAA36048.1| TPA: hypothetical protein ZEAMMB73_665324 [Zea mays]
Length=113

 Score =   168 bits (426),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 94/99 (95%), Positives = 97/99 (98%), Gaps = 0/99 (0%)
 Frame = +1

Query  76   MAEQTEKAFLKQPGVFLSSkktgkgkrpgkggNRFWKSIGLGFKTPREATEGTYIDKKCP  255
            MAEQTEKAFLKQP VFLSSKK+GKGK+PGKGGNRFWKSIGLGFKTPREA EGTYIDKKCP
Sbjct  1    MAEQTEKAFLKQPKVFLSSKKSGKGKKPGKGGNRFWKSIGLGFKTPREAIEGTYIDKKCP  60

Query  256  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQ  372
            FTGTVSIRGRI+AGTCHSAKMNRTIIVRRNYLHFVKKYQ
Sbjct  61   FTGTVSIRGRIIAGTCHSAKMNRTIIVRRNYLHFVKKYQ  99



>gb|ACL53880.1| unknown [Zea mays]
Length=107

 Score =   168 bits (425),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 94/99 (95%), Positives = 97/99 (98%), Gaps = 0/99 (0%)
 Frame = +1

Query  76   MAEQTEKAFLKQPGVFLSSkktgkgkrpgkggNRFWKSIGLGFKTPREATEGTYIDKKCP  255
            MAEQTEKAFLKQP VFLSSKK+GKGK+PGKGGNRFWKSIGLGFKTPREA EGTYIDKKCP
Sbjct  1    MAEQTEKAFLKQPKVFLSSKKSGKGKKPGKGGNRFWKSIGLGFKTPREAIEGTYIDKKCP  60

Query  256  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQ  372
            FTGTVSIRGRI+AGTCHSAKMNRTIIVRRNYLHFVKKYQ
Sbjct  61   FTGTVSIRGRIIAGTCHSAKMNRTIIVRRNYLHFVKKYQ  99



>gb|EYU20229.1| hypothetical protein MIMGU_mgv1a015021mg [Erythranthe guttata]
Length=170

 Score =   170 bits (431),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 94/108 (87%), Positives = 101/108 (94%), Gaps = 0/108 (0%)
 Frame = +1

Query  76   MAEQTEKAFLKQPGVFLSSkktgkgkrpgkggNRFWKSIGLGFKTPREATEGTYIDKKCP  255
            MAEQTEKAFLKQP VFL SKK+GKGK PGKGGNR++KSIGL +KTPREA+EGTYIDKKCP
Sbjct  1    MAEQTEKAFLKQPKVFLCSKKSGKGKTPGKGGNRYFKSIGLQYKTPREASEGTYIDKKCP  60

Query  256  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNI  399
            FTG VSIRGRILAGTCHSAKM RTIIVRRNY+H+V KYQRYEKRHSNI
Sbjct  61   FTGDVSIRGRILAGTCHSAKMVRTIIVRRNYMHWVSKYQRYEKRHSNI  108



>gb|EYU32366.1| hypothetical protein MIMGU_mgv1a015357mg [Erythranthe guttata]
 gb|EYU32367.1| hypothetical protein MIMGU_mgv1a015357mg [Erythranthe guttata]
Length=160

 Score =   169 bits (427),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 91/108 (84%), Positives = 100/108 (93%), Gaps = 0/108 (0%)
 Frame = +1

Query  76   MAEQTEKAFLKQPGVFLSSkktgkgkrpgkggNRFWKSIGLGFKTPREATEGTYIDKKCP  255
            MAEQTEKAFLKQP VFL SKK+GKGK PGKGGNR+WK+IGL +KTPREA EGTYIDKKCP
Sbjct  1    MAEQTEKAFLKQPKVFLCSKKSGKGKTPGKGGNRYWKNIGLIYKTPREAIEGTYIDKKCP  60

Query  256  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNI  399
            FTG VSIRGRI++GTCHSAKM RTIIVR++Y H+VKKYQRYEKRHSNI
Sbjct  61   FTGNVSIRGRIISGTCHSAKMMRTIIVRKDYFHWVKKYQRYEKRHSNI  108



>ref|XP_009149783.1| PREDICTED: 40S ribosomal protein S11-3-like isoform X1 [Brassica 
rapa]
Length=185

 Score =   169 bits (427),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 100/134 (75%), Positives = 103/134 (77%), Gaps = 26/134 (19%)
 Frame = +1

Query  76   MAEQTEKAFLKQPGVFLSSkktgkgkrpgkggNRFWKSIGLGFKTPREATEGTYIDKKCP  255
            MAEQTEKAFLKQP VFLSSK +GKGKRPGKGGNRF K+IGLGFKTPREAT+GTYID KCP
Sbjct  1    MAEQTEKAFLKQPKVFLSSKISGKGKRPGKGGNRFVKNIGLGFKTPREATQGTYIDSKCP  60

Query  256  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQ---------------------  372
            FTGTVSIRGRILAGTCHSAKM RTIIVRRNYLHFVKKYQ                     
Sbjct  61   FTGTVSIRGRILAGTCHSAKMQRTIIVRRNYLHFVKKYQRFDSYIKFTFVHMTFFTSMFI  120

Query  373  -----RYEKRHSNI  399
                 RYEKRHSNI
Sbjct  121  LYFVVRYEKRHSNI  134



>gb|ERN17930.1| hypothetical protein AMTR_s00046p00028310 [Amborella trichopoda]
Length=192

 Score =   168 bits (426),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 93/107 (87%), Positives = 98/107 (92%), Gaps = 0/107 (0%)
 Frame = +1

Query  79   AEQTEKAFLKQPGVFLSSkktgkgkrpgkggNRFWKSIGLGFKTPREATEGTYIDKKCPF  258
               TEKAFLKQP VF SSKK+GKGKRPGKGGNRFWK+IGLGFKTPREA EGTYIDKKCPF
Sbjct  34   GNHTEKAFLKQPKVFQSSKKSGKGKRPGKGGNRFWKNIGLGFKTPREAIEGTYIDKKCPF  93

Query  259  TGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNI  399
            +G VSIRGRIL GTC+SAKM RTIIVRR+YLHFVKKYQRYEKRHSNI
Sbjct  94   SGNVSIRGRILTGTCYSAKMTRTIIVRRDYLHFVKKYQRYEKRHSNI  140



>ref|XP_001761870.1| predicted protein [Physcomitrella patens]
 gb|EDQ73311.1| predicted protein [Physcomitrella patens]
Length=160

 Score =   167 bits (422),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 84/109 (77%), Positives = 94/109 (86%), Gaps = 0/109 (0%)
 Frame = +1

Query  76   MAEQTEKAFLKQPGVFLSSkktgkgkrpgkggNRFWKSIGLGFKTPREATEGTYIDKKCP  255
            MAEQTEK+FLKQP VFLS+K + KGK  GK G RFWK++GLGFKTPREA EGTYIDKKCP
Sbjct  1    MAEQTEKSFLKQPKVFLSTKASSKGKAAGKAGTRFWKNVGLGFKTPREAIEGTYIDKKCP  60

Query  256  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIA  402
            FTG VSIRGRIL GT +  KM RTI +RR+YLHFV+KYQRYEKRHSN+A
Sbjct  61   FTGDVSIRGRILTGTVNCTKMTRTITIRRDYLHFVRKYQRYEKRHSNLA  109



>ref|XP_009362323.1| PREDICTED: 40S ribosomal protein S11-like [Pyrus x bretschneideri]
Length=186

 Score =   167 bits (424),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 98/135 (73%), Positives = 105/135 (78%), Gaps = 27/135 (20%)
 Frame = +1

Query  76   MAEQTEKAFLKQPGVFLSSkktgkgkrpgkggNRFWKS----------------------  189
            MAEQTEKAFLKQP VFLSSKKTGKGK+PGKGGNRFWKS                      
Sbjct  1    MAEQTEKAFLKQPKVFLSSKKTGKGKKPGKGGNRFWKSVGLGFKTPRDAIEGKRPGKGGN  60

Query  190  -----IGLGFKTPREATEGTYIDKKCPFTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLH  354
                 +GLGFKTPR+A EGTYIDKKCPFTG VSIRGRIL+GTCHSAKM+RTIIVRRNYLH
Sbjct  61   RFWKSVGLGFKTPRDAIEGTYIDKKCPFTGNVSIRGRILSGTCHSAKMSRTIIVRRNYLH  120

Query  355  FVKKYQRYEKRHSNI  399
            ++KKYQRYEKRHSNI
Sbjct  121  YIKKYQRYEKRHSNI  135



>tpg|DAA37073.1| TPA: hypothetical protein ZEAMMB73_529952 [Zea mays]
Length=568

 Score =   177 bits (449),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 95/112 (85%), Positives = 100/112 (89%), Gaps = 3/112 (3%)
 Frame = +1

Query  64   AATIMAEQTEKAFLKQPGVFLSSkktgkgkrpgkggNRFWKSIGLGFKTPREATEGTYID  243
            +A  MAEQTE+AFLKQP VFL SKK  K  +PGKGGNRFWK+IGLGFKTPREA EGTYID
Sbjct  408  SAASMAEQTERAFLKQPKVFLCSKKATKVNKPGKGGNRFWKNIGLGFKTPREAIEGTYID  467

Query  244  KKCPFTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNI  399
            KKCPFTGTVSIRGRI+AGTCHSAKMNRTIIVRRNYLHFVKK   YEKRHSNI
Sbjct  468  KKCPFTGTVSIRGRIIAGTCHSAKMNRTIIVRRNYLHFVKK---YEKRHSNI  516



>gb|KCW50240.1| hypothetical protein EUGRSUZ_J00035 [Eucalyptus grandis]
Length=160

 Score =   166 bits (421),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 95/114 (83%), Positives = 99/114 (87%), Gaps = 0/114 (0%)
 Frame = +1

Query  40   LLSSCDTSAATIMAEQTEKAFLKQPGVFLSSkktgkgkrpgkggNRFWKSIGLGFKTPRE  219
            L S+C  S A  M  QTEKAFLKQP VFL SKK+GKGKRPGKGGNR+ KS+GLGFKTPRE
Sbjct  34   LASACSISQALKMDAQTEKAFLKQPKVFLCSKKSGKGKRPGKGGNRYHKSVGLGFKTPRE  93

Query  220  ATEGTYIDKKCPFTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYE  381
            A EGTYIDKKCPFTG VSIRGRILAGTCHSAKM RTIIVRRNYLHFVKKYQR E
Sbjct  94   AIEGTYIDKKCPFTGNVSIRGRILAGTCHSAKMMRTIIVRRNYLHFVKKYQRLE  147



>ref|XP_007011791.1| Ribosomal protein S11-beta [Theobroma cacao]
 gb|EOY29410.1| Ribosomal protein S11-beta [Theobroma cacao]
Length=192

 Score =   167 bits (423),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 93/104 (89%), Positives = 96/104 (92%), Gaps = 0/104 (0%)
 Frame = +1

Query  88   TEKAFLKQPGVFLSSkktgkgkrpgkggNRFWKSIGLGFKTPREATEGTYIDKKCPFTGT  267
            TEKAFL+QP VFL SKK+GKGKRPGKGGNR WKSIGLGFK PREA EGTYIDKKCPFT T
Sbjct  38   TEKAFLRQPKVFLCSKKSGKGKRPGKGGNRLWKSIGLGFKAPREAIEGTYIDKKCPFTDT  97

Query  268  VSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNI  399
            VSIRGRILAGTCH AKM RTIIVRRNYLH+VKKYQRYEKRHSNI
Sbjct  98   VSIRGRILAGTCHGAKMMRTIIVRRNYLHYVKKYQRYEKRHSNI  141



>ref|XP_001756109.1| predicted protein [Physcomitrella patens]
 ref|XP_001757892.1| predicted protein [Physcomitrella patens]
 ref|XP_001765740.1| predicted protein [Physcomitrella patens]
 gb|EDQ69331.1| predicted protein [Physcomitrella patens]
 gb|EDQ77134.1| predicted protein [Physcomitrella patens]
 gb|EDQ78975.1| predicted protein [Physcomitrella patens]
Length=160

 Score =   165 bits (418),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 84/109 (77%), Positives = 94/109 (86%), Gaps = 0/109 (0%)
 Frame = +1

Query  76   MAEQTEKAFLKQPGVFLSSkktgkgkrpgkggNRFWKSIGLGFKTPREATEGTYIDKKCP  255
            MAEQTEK+FLKQP VFLS+K + KGK  GK G RFWK++GLGFKTPREA EGTYIDKKCP
Sbjct  1    MAEQTEKSFLKQPKVFLSTKASAKGKAAGKAGTRFWKNVGLGFKTPREAIEGTYIDKKCP  60

Query  256  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIA  402
            FTG VSIRGRIL GT +  KM RTI +RR+YLHFV+KYQRYEKRHSN+A
Sbjct  61   FTGDVSIRGRILTGTVNCTKMTRTITIRRDYLHFVRKYQRYEKRHSNLA  109



>gb|EMT19025.1| 40S ribosomal protein S11 [Aegilops tauschii]
Length=218

 Score =   166 bits (420),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 89/104 (86%), Positives = 95/104 (91%), Gaps = 3/104 (3%)
 Frame = +1

Query  88   TEKAFLKQPGVFLSSkktgkgkrpgkggNRFWKSIGLGFKTPREATEGTYIDKKCPFTGT  267
            TEK+FLKQP VFLS+KK  K KRPGK GNRFWKS+GLGFKTPREA +GTYIDKKCPFTGT
Sbjct  67   TEKSFLKQPKVFLSTKKADKAKRPGKAGNRFWKSVGLGFKTPREAIDGTYIDKKCPFTGT  126

Query  268  VSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNI  399
            V+IRGRI+AGTCHSAKMNRTIIVRRNYLHFVKK   YEKRHSNI
Sbjct  127  VAIRGRIIAGTCHSAKMNRTIIVRRNYLHFVKK---YEKRHSNI  167



>ref|XP_010099867.1| 40S ribosomal protein S11 [Morus notabilis]
 gb|EXB80744.1| 40S ribosomal protein S11 [Morus notabilis]
Length=184

 Score =   164 bits (415),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 88/100 (88%), Positives = 92/100 (92%), Gaps = 0/100 (0%)
 Frame = +1

Query  76   MAEQTEKAFLKQPGVFLSSkktgkgkrpgkggNRFWKSIGLGFKTPREATEGTYIDKKCP  255
            MAEQTEKAFLKQP VFL SKK  KG+ PGKGGNRFWK++GLGFKTPR+A E TYIDKKCP
Sbjct  56   MAEQTEKAFLKQPKVFLCSKKPLKGRNPGKGGNRFWKNVGLGFKTPRDAIEATYIDKKCP  115

Query  256  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQR  375
            FTGTVSIRGRILAGTCHSAKM RTIIVRRNYLHFVKKYQR
Sbjct  116  FTGTVSIRGRILAGTCHSAKMIRTIIVRRNYLHFVKKYQR  155



>gb|EEC77985.1| hypothetical protein OsI_17370 [Oryza sativa Indica Group]
Length=535

 Score =   172 bits (435),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 95/100 (95%), Positives = 98/100 (98%), Gaps = 0/100 (0%)
 Frame = +1

Query  76   MAEQTEKAFLKQPGVFLSSkktgkgkrpgkggNRFWKSIGLGFKTPREATEGTYIDKKCP  255
            MAEQTEKAFLKQP VFLSSKK+GKGK+PGKGGNRFWKSIGLGFKTPREA EGTYIDKKCP
Sbjct  1    MAEQTEKAFLKQPKVFLSSKKSGKGKKPGKGGNRFWKSIGLGFKTPREAIEGTYIDKKCP  60

Query  256  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQR  375
            FTGTVSIRGRI+AGTCHSAKMNRTIIVRRNYLHFVKKYQR
Sbjct  61   FTGTVSIRGRIIAGTCHSAKMNRTIIVRRNYLHFVKKYQR  100



>gb|AAA34006.1| ribosomal protein S11, partial [Glycine max]
Length=141

 Score =   159 bits (403),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 73/76 (96%), Positives = 74/76 (97%), Gaps = 0/76 (0%)
 Frame = +1

Query  172  NRFWKSIGLGFKTPREATEGTYIDKKCPFTGTVSIRGRILAGTCHSAKMNRTIIVRRNYL  351
            NRFWKSIGLGFKTPREA EGTYIDKKCPFTG VSIRGRILAGTCHSAKMNRTIIVRRNYL
Sbjct  15   NRFWKSIGLGFKTPREAIEGTYIDKKCPFTGNVSIRGRILAGTCHSAKMNRTIIVRRNYL  74

Query  352  HFVKKYQRYEKRHSNI  399
            HF+KKYQRYEKRHSNI
Sbjct  75   HFIKKYQRYEKRHSNI  90



>ref|XP_002982779.1| hypothetical protein SELMODRAFT_268639 [Selaginella moellendorffii]
 ref|XP_002990930.1| hypothetical protein SELMODRAFT_272177 [Selaginella moellendorffii]
 gb|EFJ07974.1| hypothetical protein SELMODRAFT_272177 [Selaginella moellendorffii]
 gb|EFJ16024.1| hypothetical protein SELMODRAFT_268639 [Selaginella moellendorffii]
Length=160

 Score =   155 bits (393),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 84/109 (77%), Positives = 94/109 (86%), Gaps = 0/109 (0%)
 Frame = +1

Query  76   MAEQTEKAFLKQPGVFLSSkktgkgkrpgkggNRFWKSIGLGFKTPREATEGTYIDKKCP  255
            MAEQTE+AFLKQ  VF   K +GK KRPGKGG+RFWK++GLGFKTPREA EGTYIDKKCP
Sbjct  1    MAEQTERAFLKQHKVFPLGKTSGKKKRPGKGGSRFWKNVGLGFKTPREAIEGTYIDKKCP  60

Query  256  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIA  402
            FT  VSIRGRIL GT  + KM R+IIVRR+YLH+VKKYQRYEKRHSN+A
Sbjct  61   FTSDVSIRGRILTGTVATTKMTRSIIVRRDYLHYVKKYQRYEKRHSNVA  109



>ref|XP_008242908.1| PREDICTED: 40S ribosomal protein S11-like [Prunus mume]
Length=156

 Score =   155 bits (391),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 89/108 (82%), Positives = 94/108 (87%), Gaps = 3/108 (3%)
 Frame = +1

Query  76   MAEQTEKAFLKQPGVFLSSkktgkgkrpgkggNRFWKSIGLGFKTPREATEGTYIDKKCP  255
            MAEQTEKAFLKQP VF+SSKK+GKGKRPGKGGNRFW           EA EGTYIDKKCP
Sbjct  1    MAEQTEKAFLKQPKVFISSKKSGKGKRPGKGGNRFWXXXXX---XXXEAIEGTYIDKKCP  57

Query  256  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNI  399
            FTG VSIRGRILAGTCHSAKMN+TIIVRRNYLH++KKYQRYEKRHSNI
Sbjct  58   FTGNVSIRGRILAGTCHSAKMNKTIIVRRNYLHYIKKYQRYEKRHSNI  105



>ref|XP_009338409.1| PREDICTED: 40S ribosomal protein S11-like [Pyrus x bretschneideri]
Length=156

 Score =   155 bits (391),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 89/108 (82%), Positives = 95/108 (88%), Gaps = 3/108 (3%)
 Frame = +1

Query  76   MAEQTEKAFLKQPGVFLSSkktgkgkrpgkggNRFWKSIGLGFKTPREATEGTYIDKKCP  255
            MAEQTEKAFLKQP VF+SSKK+GKGKRPGKGGNRFWKS  + F        GTYIDKKCP
Sbjct  1    MAEQTEKAFLKQPKVFISSKKSGKGKRPGKGGNRFWKSANISFFL---FLTGTYIDKKCP  57

Query  256  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNI  399
            FTG VSIRGRILAGTCHSAKMN+TIIVRRNYLH++KKYQRYEKRHSNI
Sbjct  58   FTGNVSIRGRILAGTCHSAKMNKTIIVRRNYLHYIKKYQRYEKRHSNI  105



>ref|XP_002158762.1| PREDICTED: 40S ribosomal protein S11-like [Hydra vulgaris]
Length=156

 Score =   149 bits (376),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 70/109 (64%), Positives = 83/109 (76%), Gaps = 1/109 (1%)
 Frame = +1

Query  76   MAEQTEKAFLKQPGVFLSSkktgkgkrpgkggNRFWKSIGLGFKTPREATEGTYIDKKCP  255
            MAEQ E+AF KQP +FL+ K+        K   R+ +++GLGFKTPREA EGTYIDKKCP
Sbjct  1    MAEQNERAFQKQPAIFLNKKRVVAKTTKNKEL-RYVRNVGLGFKTPREAIEGTYIDKKCP  59

Query  256  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIA  402
            FTG VSIRGRIL G   S KM RTI++RR+YLHF+KKYQRYEKRH N+ 
Sbjct  60   FTGNVSIRGRILTGIVKSLKMKRTIVIRRDYLHFIKKYQRYEKRHKNLV  108



>emb|CCQ18653.1| 40S ribosomal protein S11 [Sycon ciliatum]
Length=153

 Score =   148 bits (373),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 72/109 (66%), Positives = 85/109 (78%), Gaps = 4/109 (4%)
 Frame = +1

Query  76   MAEQTEKAFLKQPGVFLSSkktgkgkrpgkggNRFWKSIGLGFKTPREATEGTYIDKKCP  255
            MAEQTEKAF KQP VFL+ K     K+     +RF +++GLGFKTPREA EGTYIDKKCP
Sbjct  1    MAEQTEKAFQKQPTVFLNRKAVPGQKKT----SRFVRNVGLGFKTPREAEEGTYIDKKCP  56

Query  256  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIA  402
            FTG VSIRGRIL G   S KM RTI++RR+YLH+++KY RYEKRH NI+
Sbjct  57   FTGNVSIRGRILTGVVASMKMKRTIVIRRDYLHYIRKYNRYEKRHKNIS  105



>ref|XP_005643310.1| ribosomal protein S11 component of cytosolic 80S ribosome and 
40S small subunit [Coccomyxa subellipsoidea C-169]
 gb|EIE18766.1| ribosomal protein S11 component of cytosolic 80S ribosome and 
40S small subunit [Coccomyxa subellipsoidea C-169]
Length=156

 Score =   147 bits (371),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 77/109 (71%), Positives = 88/109 (81%), Gaps = 1/109 (1%)
 Frame = +1

Query  76   MAEQTEKAFLKQPGVFLSSkktgkgkrpgkggNRFWKSIGLGFKTPREATEGTYIDKKCP  255
            MA+QTE+AF KQ GV +   K    K PGK G R+WK++GLGFKTP+EA EGTYIDKKCP
Sbjct  1    MADQTERAFQKQLGVNIG-FKKAAKKIPGKFGQRYWKNVGLGFKTPKEAIEGTYIDKKCP  59

Query  256  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIA  402
            FTG VSIRGRIL+G   S KMNRTIIVRRNY H++KKY RYEKRH+NIA
Sbjct  60   FTGNVSIRGRILSGIVRSTKMNRTIIVRRNYAHYIKKYARYEKRHTNIA  108



>gb|AEI83509.1| 40S ribosomal protein S11 [Wolffia arrhiza]
Length=142

 Score =   146 bits (368),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 65/76 (86%), Positives = 71/76 (93%), Gaps = 0/76 (0%)
 Frame = +1

Query  172  NRFWKSIGLGFKTPREATEGTYIDKKCPFTGTVSIRGRILAGTCHSAKMNRTIIVRRNYL  351
            NR+WKSIGLGFK PREA EGTYIDKKCPFTG VSIRGRIL+G CHSAKMNRTIIVR++Y 
Sbjct  16   NRYWKSIGLGFKVPREAIEGTYIDKKCPFTGNVSIRGRILSGVCHSAKMNRTIIVRKDYP  75

Query  352  HFVKKYQRYEKRHSNI  399
            H+V+KYQRYEKRHSNI
Sbjct  76   HYVRKYQRYEKRHSNI  91



>ref|XP_001418420.1| Ribosomal protein S11, component of cytosolic 80S ribosome and 
40S small subunit [Ostreococcus lucimarinus CCE9901]
 gb|ABO96713.1| Ribosomal protein S11, component of cytosolic 80S ribosome and 
40S small subunit [Ostreococcus lucimarinus CCE9901]
Length=158

 Score =   146 bits (369),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 75/110 (68%), Positives = 89/110 (81%), Gaps = 0/110 (0%)
 Frame = +1

Query  73   IMAEQTEKAFLKQPGVFLSSkktgkgkrpgkggNRFWKSIGLGFKTPREATEGTYIDKKC  252
            + AEQ E+AF KQ GV +      K K PGKGGNR++K++GLGFKTPREA EGTYIDKKC
Sbjct  1    MAAEQHERAFQKQLGVNVGFASATKKKTPGKGGNRYYKNVGLGFKTPREAIEGTYIDKKC  60

Query  253  PFTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIA  402
            PFTG VSIRGRIL G   S KMNRTI++R +YLHF++KYQRYEKRH+NI+
Sbjct  61   PFTGNVSIRGRILTGVVKSTKMNRTIVMRMDYLHFIRKYQRYEKRHTNIS  110



>gb|KHG16535.1| 40S ribosomal S11 [Gossypium arboreum]
Length=153

 Score =   145 bits (366),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 85/98 (87%), Positives = 87/98 (89%), Gaps = 0/98 (0%)
 Frame = +1

Query  76   MAEQTEKAFLKQPGVFLSSkktgkgkrpgkggNRFWKSIGLGFKTPREATEGTYIDKKCP  255
            MAEQTEKAFLKQP VFLSSKK+GKGKRPGKGGNRFWKSIGLGFKTPREATEGTYIDKKCP
Sbjct  1    MAEQTEKAFLKQPKVFLSSKKSGKGKRPGKGGNRFWKSIGLGFKTPREATEGTYIDKKCP  60

Query  256  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKY  369
            FTG VSIRGRILAGTCHSAKM RTIIVR     +   Y
Sbjct  61   FTGIVSIRGRILAGTCHSAKMIRTIIVREETFKYPCTY  98



>gb|ABD64589.1| 40S ribosomal protein S11 [Chlamydomonas sp. ICE-L]
Length=155

 Score =   145 bits (365),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 78/109 (72%), Positives = 88/109 (81%), Gaps = 1/109 (1%)
 Frame = +1

Query  76   MAEQTEKAFLKQPGVFLSSkktgkgkrpgkggNRFWKSIGLGFKTPREATEGTYIDKKCP  255
            MAEQ EKA+ KQ GV  +  K    K PGKGG+RF+KS+GLGFKTP+ A EGTYIDKKCP
Sbjct  1    MAEQNEKAYQKQLGV-TAGFKVKDKKAPGKGGHRFYKSVGLGFKTPQSAIEGTYIDKKCP  59

Query  256  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIA  402
            FTG VSIRGRIL GT  S KM RTI+VRR+YLHFVKKY RYEKRHSN++
Sbjct  60   FTGDVSIRGRILTGTVKSTKMTRTIVVRRDYLHFVKKYARYEKRHSNLS  108



>ref|XP_003148073.1| 40S ribosomal protein S11 [Loa loa]
 gb|EFO15995.1| 40S ribosomal protein S11 [Loa loa]
Length=158

 Score =   145 bits (365),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 70/110 (64%), Positives = 84/110 (76%), Gaps = 1/110 (1%)
 Frame = +1

Query  76   MAEQTEKAFLKQPGVFLSSkktgkgkrpgkggN-RFWKSIGLGFKTPREATEGTYIDKKC  252
            MAEQTE+AF KQP VFL+SK    G       + R+ +++GLGFKTPREA  GTYIDKKC
Sbjct  1    MAEQTERAFQKQPTVFLNSKLRTLGIGKKAKKDVRYVRNVGLGFKTPREAITGTYIDKKC  60

Query  253  PFTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIA  402
            PFTG VSIRGRIL G     KM RTI++RR+YLHF+KKY+RYEKRH N++
Sbjct  61   PFTGNVSIRGRILTGVVVKMKMQRTIVIRRDYLHFIKKYRRYEKRHRNMS  110



>gb|AGH70195.1| 40S ribosomal protein S11 [Placozoa sp. H4]
Length=154

 Score =   144 bits (364),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 70/109 (64%), Positives = 82/109 (75%), Gaps = 3/109 (3%)
 Frame = +1

Query  76   MAEQTEKAFLKQPGVFLSSkktgkgkrpgkggNRFWKSIGLGFKTPREATEGTYIDKKCP  255
            MAEQ EKA+ KQP +F + K     K+      R+ +S+GLGFKTPREATEGTYIDKKCP
Sbjct  1    MAEQIEKAYQKQPTIFQNKKNVLASKKKE---RRYVRSVGLGFKTPREATEGTYIDKKCP  57

Query  256  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIA  402
            FTG VSIRGRIL G     KM RTII+RR+YLH++KKY RYEKRH N+A
Sbjct  58   FTGNVSIRGRILTGVVAKMKMRRTIIIRRDYLHYIKKYNRYEKRHKNLA  106



>ref|XP_008610788.1| 40S ribosomal protein S11 [Saprolegnia diclina VS20]
 gb|EQC36026.1| 40S ribosomal protein S11 [Saprolegnia diclina VS20]
 gb|KDO29959.1| 40S ribosomal protein S11 [Saprolegnia parasitica CBS 223.65]
Length=159

 Score =   144 bits (364),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 73/107 (68%), Positives = 82/107 (77%), Gaps = 4/107 (4%)
 Frame = +1

Query  82   EQTEKAFLKQPGVFLSSkktgkgkrpgkggNRFWKSIGLGFKTPREATEGTYIDKKCPFT  261
            EQ EKAF KQ GVFL+SKK    K       RF+KSIGLGFKTP+ A EG Y+DKKCPFT
Sbjct  5    EQNEKAFQKQDGVFLASKKFAGKKSGP----RFYKSIGLGFKTPKTAIEGAYVDKKCPFT  60

Query  262  GTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIA  402
            G VSIRGRIL G   S KM RTIIVRR+YLHF+KKY+R+EKRH N+A
Sbjct  61   GNVSIRGRILKGVVLSTKMKRTIIVRRDYLHFIKKYKRFEKRHKNVA  107



>gb|ERG79209.1| 40s ribosomal protein s11 [Ascaris suum]
Length=158

 Score =   144 bits (364),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 70/110 (64%), Positives = 84/110 (76%), Gaps = 1/110 (1%)
 Frame = +1

Query  76   MAEQTEKAFLKQPGVFLSSkktgkgkrpgkggN-RFWKSIGLGFKTPREATEGTYIDKKC  252
            MAEQTE+AF KQP +FL++K    G       + R+ ++IGLGFKTPREA  GTYIDKKC
Sbjct  1    MAEQTERAFQKQPTIFLNNKLRTLGIGKKAKKDVRYVRNIGLGFKTPREAITGTYIDKKC  60

Query  253  PFTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIA  402
            PFTG VSIRGRIL G     KM RTI++RR+YLHFVKKY+RYEKRH N++
Sbjct  61   PFTGNVSIRGRILTGVVVKTKMQRTIVIRRDYLHFVKKYRRYEKRHKNMS  110



>ref|XP_002841871.1| 40S ribosomal protein S11 [Tuber melanosporum Mel28]
 emb|CAZ86062.1| unnamed protein product [Tuber melanosporum]
Length=161

 Score =   144 bits (363),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 72/112 (64%), Positives = 90/112 (80%), Gaps = 0/112 (0%)
 Frame = +1

Query  67   ATIMAEQTEKAFLKQPGVFLSSkktgkgkrpgkggNRFWKSIGLGFKTPREATEGTYIDK  246
            AT +  Q+E+AF KQP +FL+SK     +R GKGG R++K +GLGFKTP+ A EGTYIDK
Sbjct  2    ATELTVQSERAFQKQPHIFLASKTRPAKRRVGKGGRRWYKDVGLGFKTPKTAIEGTYIDK  61

Query  247  KCPFTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIA  402
            KCPFTG VSIRGRIL GT  S KM+RT+++RR+YLH++ KYQRYEKRH NI+
Sbjct  62   KCPFTGLVSIRGRILTGTVISTKMHRTLVIRRDYLHYIPKYQRYEKRHKNIS  113



>gb|AAX48887.1| S11 [Suberites domuncula]
Length=157

 Score =   144 bits (363),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 68/109 (62%), Positives = 83/109 (76%), Gaps = 0/109 (0%)
 Frame = +1

Query  76   MAEQTEKAFLKQPGVFLSSkktgkgkrpgkggNRFWKSIGLGFKTPREATEGTYIDKKCP  255
            MAEQTE+A+ KQ  +F +SK    G    K   RF +++GLGFKTPREA EGTYIDKKCP
Sbjct  1    MAEQTERAYQKQKPIFQNSKTVILGGSKKKKDQRFVRNVGLGFKTPREAVEGTYIDKKCP  60

Query  256  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIA  402
            FTG VSIRGRIL G   S KM RTI++RR+YLH++KKY R+EKRH N++
Sbjct  61   FTGNVSIRGRILTGIVKSLKMKRTIVIRRDYLHYIKKYHRFEKRHKNLS  109



>gb|EMF17289.1| 40S ribosomal protein S11 [Sphaerulina musiva SO2202]
Length=161

 Score =   144 bits (363),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 75/112 (67%), Positives = 88/112 (79%), Gaps = 0/112 (0%)
 Frame = +1

Query  67   ATIMAEQTEKAFLKQPGVFLSSkktgkgkrpgkggNRFWKSIGLGFKTPREATEGTYIDK  246
            AT +  Q+E+AF KQP +FL+SK   K  R GKGG R++K +GLGF+TP+ A EG YIDK
Sbjct  2    ATELTVQSERAFQKQPHIFLNSKSQKKSTRVGKGGRRWYKDVGLGFRTPKTAIEGQYIDK  61

Query  247  KCPFTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIA  402
            KCPFTG VSIRGRIL GT  SAKM+RTII+RR YLHFV KY RYEKRH N+A
Sbjct  62   KCPFTGLVSIRGRILTGTVVSAKMHRTIIIRREYLHFVPKYSRYEKRHKNLA  113



>gb|KHN77184.1| 40S ribosomal protein S11 [Toxocara canis]
Length=158

 Score =   144 bits (362),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 69/110 (63%), Positives = 84/110 (76%), Gaps = 1/110 (1%)
 Frame = +1

Query  76   MAEQTEKAFLKQPGVFLSSkktgkgkrpgkggN-RFWKSIGLGFKTPREATEGTYIDKKC  252
            MAEQTE+AF KQP +FL++K    G       + R+ +++GLGFKTPREA  GTYIDKKC
Sbjct  1    MAEQTERAFQKQPTIFLNNKLRTLGIGKKAKKDIRYVRNVGLGFKTPREAITGTYIDKKC  60

Query  253  PFTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIA  402
            PFTG VSIRGRIL G     KM RTI++RR+YLHFVKKY+RYEKRH N++
Sbjct  61   PFTGNVSIRGRILTGVVVKTKMQRTIVIRRDYLHFVKKYRRYEKRHKNMS  110



>ref|XP_001898199.1| 40S ribosomal protein S11 [Brugia malayi]
 gb|EJW88706.1| 40S ribosomal protein S11 [Wuchereria bancrofti]
 emb|CDP95951.1| Protein BM-RPS-11 [Brugia malayi]
Length=158

 Score =   144 bits (362),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 69/110 (63%), Positives = 84/110 (76%), Gaps = 1/110 (1%)
 Frame = +1

Query  76   MAEQTEKAFLKQPGVFLSSkktgkgkrpgkggN-RFWKSIGLGFKTPREATEGTYIDKKC  252
            MAEQTE+AF KQP VFL++K    G       + R+ +++GLGFKTPREA  GTYIDKKC
Sbjct  1    MAEQTERAFQKQPTVFLNNKLRTLGIGKKAKKDVRYVRNVGLGFKTPREAITGTYIDKKC  60

Query  253  PFTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIA  402
            PFTG VSIRGRIL G     KM RTI++RR+YLHF+KKY+RYEKRH N++
Sbjct  61   PFTGNVSIRGRILTGVVVKMKMQRTIVIRRDYLHFIKKYRRYEKRHRNMS  110



>gb|EHK40336.1| hypothetical protein TRIATDRAFT_302714 [Trichoderma atroviride 
IMI 206040]
Length=161

 Score =   144 bits (362),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 74/112 (66%), Positives = 90/112 (80%), Gaps = 0/112 (0%)
 Frame = +1

Query  67   ATIMAEQTEKAFLKQPGVFLSSkktgkgkrpgkggNRFWKSIGLGFKTPREATEGTYIDK  246
            AT +  Q+E+AF KQP +FL+SK   K  RPGKGG R++K +GLGF+TP+ A EG+YIDK
Sbjct  2    ATELTVQSERAFQKQPHIFLNSKTKTKSARPGKGGRRWYKDVGLGFRTPKAAIEGSYIDK  61

Query  247  KCPFTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIA  402
            KCPFTGTVSIRGRIL GT  S KM+RT+I+RR YLHF+ KY RYEKRH N+A
Sbjct  62   KCPFTGTVSIRGRILTGTVVSTKMHRTVIIRREYLHFIPKYSRYEKRHKNLA  113



>ref|XP_002115583.1| expressed hypothetical protein [Trichoplax adhaerens]
 gb|EDV21946.1| expressed hypothetical protein [Trichoplax adhaerens]
Length=154

 Score =   143 bits (361),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 70/109 (64%), Positives = 82/109 (75%), Gaps = 3/109 (3%)
 Frame = +1

Query  76   MAEQTEKAFLKQPGVFLSSkktgkgkrpgkggNRFWKSIGLGFKTPREATEGTYIDKKCP  255
            MAEQ EKA+ KQP +F + K     KR      R+ ++IGLGFKTPREATEGTYIDKKCP
Sbjct  1    MAEQIEKAYQKQPTIFQNKKNVLATKRKD---RRYVRNIGLGFKTPREATEGTYIDKKCP  57

Query  256  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIA  402
            FTG VSIRGRIL G     KM RTI++RR+YLH++KKY RYEKRH N+A
Sbjct  58   FTGNVSIRGRILTGVVAKMKMRRTIVIRRDYLHYIKKYNRYEKRHKNLA  106



>gb|ABM55589.1| putative ribosomal protein S11 [Maconellicoccus hirsutus]
Length=152

 Score =   143 bits (360),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 68/109 (62%), Positives = 83/109 (76%), Gaps = 5/109 (5%)
 Frame = +1

Query  76   MAEQTEKAFLKQPGVFLSSkktgkgkrpgkggNRFWKSIGLGFKTPREATEGTYIDKKCP  255
            MA+Q E+AF KQP VFL+ K   K K+      R++K +GLGFKTPREA EGTYIDKKCP
Sbjct  1    MADQNERAFQKQPTVFLNRKFNTKKKKL-----RYYKDVGLGFKTPREAIEGTYIDKKCP  55

Query  256  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIA  402
            FTG VSIRGRIL G     KM RTI++RR+YLH++KKY R+EKRH N++
Sbjct  56   FTGNVSIRGRILTGVVQKMKMQRTIVIRRDYLHYIKKYNRFEKRHKNMS  104



>ref|XP_003382520.1| PREDICTED: 40S ribosomal protein S11-like [Amphimedon queenslandica]
Length=158

 Score =   143 bits (361),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 71/110 (65%), Positives = 86/110 (78%), Gaps = 1/110 (1%)
 Frame = +1

Query  76   MAEQTEKAFLKQPGVFLSSkktgkgkrpgkgg-NRFWKSIGLGFKTPREATEGTYIDKKC  252
            MA+QTEKA+ KQ GVF +SK    G    KG   RF +++GLGFKTP+EA EGTYIDKKC
Sbjct  1    MADQTEKAYQKQKGVFQNSKAVLLGLGKKKGKGQRFVRNVGLGFKTPKEAIEGTYIDKKC  60

Query  253  PFTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIA  402
            PFTG VSIRGRIL GT  S KM RTI++RR+YLH++KKY R+EKRH N++
Sbjct  61   PFTGNVSIRGRILTGTVRSMKMKRTIVIRRDYLHYIKKYNRFEKRHKNLS  110



>ref|XP_003323062.2| 40S ribosomal protein S11 [Puccinia graminis f. sp. tritici CRL 
75-36-700-3]
 gb|EFP78643.2| 40S ribosomal protein S11 [Puccinia graminis f. sp. tritici CRL 
75-36-700-3]
Length=162

 Score =   143 bits (361),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 73/113 (65%), Positives = 83/113 (73%), Gaps = 1/113 (1%)
 Frame = +1

Query  64   AATIMAEQTEKAFLKQPGVFLSSkktgkgkrpgkggNRFWKSIGLGFKTPREATEGTYID  243
            A TI AEQTEKAF KQP +F +SK    GK+      R++K +GLGFKTP EA  GTYID
Sbjct  2    ATTISAEQTEKAFQKQP-IFQNSKIKSAGKKVASKDRRWYKDVGLGFKTPAEAINGTYID  60

Query  244  KKCPFTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIA  402
            KKCPFTG VSIRGRIL G   S KM RTII+RR YLH++ KY RYEKRH N+A
Sbjct  61   KKCPFTGEVSIRGRILTGVVVSTKMTRTIIIRREYLHYIPKYSRYEKRHQNMA  113



>ref|XP_008860970.1| archaeal ribosomal protein S17P [Aphanomyces invadans]
 gb|ETW09559.1| archaeal ribosomal protein S17P [Aphanomyces invadans]
Length=161

 Score =   143 bits (360),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 73/112 (65%), Positives = 85/112 (76%), Gaps = 4/112 (4%)
 Frame = +1

Query  67   ATIMAEQTEKAFLKQPGVFLSSkktgkgkrpgkggNRFWKSIGLGFKTPREATEGTYIDK  246
            +T   +QTEKAF KQ GVFL+SKK    K       RF+KSIGLGFKTP+ A EG Y+DK
Sbjct  2    STEHVDQTEKAFQKQDGVFLASKKFAGKKSGP----RFYKSIGLGFKTPKTAIEGGYVDK  57

Query  247  KCPFTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIA  402
            KCPFTG VSIRGRIL G   S KM RTIIVRR+YLH++KKY+R+EKRH N+A
Sbjct  58   KCPFTGNVSIRGRILKGVVLSNKMKRTIIVRRDYLHYIKKYKRFEKRHKNVA  109



>gb|KFZ16779.1| hypothetical protein V502_04895 [Pseudogymnoascus pannorum VKM 
F-4520 (FW-2644)]
Length=161

 Score =   143 bits (360),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 74/112 (66%), Positives = 87/112 (78%), Gaps = 0/112 (0%)
 Frame = +1

Query  67   ATIMAEQTEKAFLKQPGVFLSSkktgkgkrpgkggNRFWKSIGLGFKTPREATEGTYIDK  246
            AT +  Q+E+AF KQP +FL+SK   K  R GKGG R++K +GLGFKTP+ A EGTYIDK
Sbjct  2    ATELTVQSERAFQKQPHIFLNSKVKAKSARAGKGGRRWYKDVGLGFKTPKNAIEGTYIDK  61

Query  247  KCPFTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIA  402
            KCPF G VSIRGRIL GT  S KM+RT+I+RR YLHFV KY RYEKRH N+A
Sbjct  62   KCPFVGEVSIRGRILTGTVVSTKMHRTLIIRREYLHFVPKYARYEKRHKNLA  113



>gb|KFY96632.1| hypothetical protein V500_02366 [Pseudogymnoascus pannorum VKM 
F-4518 (FW-2643)]
Length=161

 Score =   143 bits (360),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 74/112 (66%), Positives = 87/112 (78%), Gaps = 0/112 (0%)
 Frame = +1

Query  67   ATIMAEQTEKAFLKQPGVFLSSkktgkgkrpgkggNRFWKSIGLGFKTPREATEGTYIDK  246
            AT +  Q+E+AF KQP +FL+SK   K  R GKGG R++K +GLGFKTP+ A EGTYIDK
Sbjct  2    ATELTVQSERAFQKQPHIFLNSKVKAKSARAGKGGRRWYKDVGLGFKTPKNAIEGTYIDK  61

Query  247  KCPFTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIA  402
            KCPF G VSIRGRIL GT  S KM+RT+I+RR YLHFV KY RYEKRH N+A
Sbjct  62   KCPFVGEVSIRGRILTGTVVSTKMHRTLIIRREYLHFVPKYARYEKRHKNLA  113



>ref|XP_009830155.1| archaeal ribosomal protein S17P [Aphanomyces astaci]
 gb|ETV80231.1| archaeal ribosomal protein S17P [Aphanomyces astaci]
Length=161

 Score =   143 bits (360),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 72/108 (67%), Positives = 83/108 (77%), Gaps = 4/108 (4%)
 Frame = +1

Query  79   AEQTEKAFLKQPGVFLSSkktgkgkrpgkggNRFWKSIGLGFKTPREATEGTYIDKKCPF  258
             +QTEKAF KQ GVFL+SKK    K       RF+KSIGLGFKTP+ A EG Y+DKKCPF
Sbjct  6    VDQTEKAFQKQDGVFLASKKFAGKKNGP----RFYKSIGLGFKTPKAAIEGGYVDKKCPF  61

Query  259  TGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIA  402
            TG VSIRGRIL G   S KM RTIIVRR+YLH++KKY+R+EKRH N+A
Sbjct  62   TGNVSIRGRILKGVVLSNKMKRTIIVRRDYLHYIKKYKRFEKRHKNVA  109



>ref|XP_007408686.1| hypothetical protein MELLADRAFT_35136 [Melampsora larici-populina 
98AG31]
 gb|EGG07921.1| hypothetical protein MELLADRAFT_35136 [Melampsora larici-populina 
98AG31]
Length=162

 Score =   143 bits (360),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 75/113 (66%), Positives = 84/113 (74%), Gaps = 1/113 (1%)
 Frame = +1

Query  64   AATIMAEQTEKAFLKQPGVFLSSkktgkgkrpgkggNRFWKSIGLGFKTPREATEGTYID  243
            A TI AEQTEKAF KQP +F +SK    GK+      R++K++GLGFKTP EA  GTYID
Sbjct  2    ATTIGAEQTEKAFQKQP-IFQNSKIKSTGKKTAGKERRWYKNVGLGFKTPTEAINGTYID  60

Query  244  KKCPFTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIA  402
            KKCPFTG VSIRGRIL G   S KM RTII+RR YLHFV KY RYEKRH N+A
Sbjct  61   KKCPFTGEVSIRGRILTGRVVSTKMTRTIIIRREYLHFVPKYSRYEKRHQNMA  113



>ref|XP_002947898.1| component of cytosolic 80S ribosome and 40S small subunit [Volvox 
carteri f. nagariensis]
 gb|EFJ50886.1| component of cytosolic 80S ribosome and 40S small subunit [Volvox 
carteri f. nagariensis]
Length=156

 Score =   142 bits (359),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 77/109 (71%), Positives = 88/109 (81%), Gaps = 1/109 (1%)
 Frame = +1

Query  76   MAEQTEKAFLKQPGVFLSSkktgkgkrpgkggNRFWKSIGLGFKTPREATEGTYIDKKCP  255
            MA+QTE+AF KQ GV     K+ + K PGK G+R++K IGLGFKTP+EA EG YIDKKCP
Sbjct  1    MADQTERAFQKQFGV-TGCFKSKEKKAPGKSGHRYYKQIGLGFKTPKEAIEGHYIDKKCP  59

Query  256  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIA  402
            FTG VSIRGRIL+G   S KMNRTIIVRR+YLH+VKKY RYEKRH NIA
Sbjct  60   FTGNVSIRGRILSGVVKSTKMNRTIIVRRDYLHYVKKYGRYEKRHRNIA  108



>gb|KIE01292.1| Ribosomal protein S17, partial [Metarhizium majus ARSEF 297]
Length=167

 Score =   143 bits (360),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 75/118 (64%), Positives = 91/118 (77%), Gaps = 0/118 (0%)
 Frame = +1

Query  49   SCDTSAATIMAEQTEKAFLKQPGVFLSSkktgkgkrpgkggNRFWKSIGLGFKTPREATE  228
            S  T  AT +  Q+E+AF KQP +FL+SK   K  RPGKGG R++K +GLGF+TP+ A E
Sbjct  2    SSVTVEATELTVQSERAFQKQPHIFLNSKTKAKSSRPGKGGRRWYKDVGLGFRTPKTAIE  61

Query  229  GTYIDKKCPFTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIA  402
            G+YIDKKCPFTG VSIRGRIL GT  S KM+RT+I+RR YLHF+ KY RYEKRH N+A
Sbjct  62   GSYIDKKCPFTGLVSIRGRILTGTVVSTKMHRTLIIRREYLHFIPKYSRYEKRHKNLA  119



>emb|CCT63377.1| probable 40s ribosomal protein s11.e, cytosolic [Fusarium fujikuroi 
IMI 58289]
Length=167

 Score =   142 bits (359),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 74/116 (64%), Positives = 89/116 (77%), Gaps = 0/116 (0%)
 Frame = +1

Query  55   DTSAATIMAEQTEKAFLKQPGVFLSSkktgkgkrpgkggNRFWKSIGLGFKTPREATEGT  234
            D   AT +  Q+E+AF KQP +F +SK   K  RPGKGG R++K +GLGF+TP+ A EG+
Sbjct  4    DDDKATELTVQSERAFQKQPHIFQNSKTKTKSTRPGKGGRRWYKDVGLGFRTPKTAIEGS  63

Query  235  YIDKKCPFTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIA  402
            YIDKKCPFTG VSIRGRIL GT  S KM+RTII+RR YLHF+ KY RYEKRH N+A
Sbjct  64   YIDKKCPFTGLVSIRGRILTGTVVSTKMHRTIIIRREYLHFIPKYSRYEKRHKNVA  119



>ref|XP_001702980.1| ribosomal protein S11, component of cytosolic 80S ribosome and 
40S small subunit [Chlamydomonas reinhardtii]
 gb|EDO96718.1| ribosomal protein S11 [Chlamydomonas reinhardtii]
Length=156

 Score =   142 bits (358),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 78/109 (72%), Positives = 87/109 (80%), Gaps = 1/109 (1%)
 Frame = +1

Query  76   MAEQTEKAFLKQPGVFLSSkktgkgkrpgkggNRFWKSIGLGFKTPREATEGTYIDKKCP  255
            MA+QTE+AF KQ GV     K+ + K PGK G+RF+K IGLGFKTP+EA EG YIDKKCP
Sbjct  1    MADQTERAFQKQFGV-TGCFKSKEKKAPGKSGHRFYKQIGLGFKTPKEAIEGHYIDKKCP  59

Query  256  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIA  402
            FTG VSIRGRIL G   S KMNRTIIVRR+YLHFVKKY RYEKRH NI+
Sbjct  60   FTGNVSIRGRILTGYVKSTKMNRTIIVRRDYLHFVKKYGRYEKRHRNIS  108



>ref|XP_011555771.1| PREDICTED: 40S ribosomal protein S11 isoform X2 [Plutella xylostella]
Length=152

 Score =   142 bits (358),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 71/108 (66%), Positives = 82/108 (76%), Gaps = 5/108 (5%)
 Frame = +1

Query  76   MAEQTEKAFLKQPGVFLSSkktgkgkrpgkggNRFWKSIGLGFKTPREATEGTYIDKKCP  255
            MA+QTEKA+ KQP VFL+ K   K K       R  KS+GLGFKTPREA EGTYIDKKCP
Sbjct  1    MADQTEKAYQKQPTVFLNRKGGLKKKDM-----RHSKSVGLGFKTPREAIEGTYIDKKCP  55

Query  256  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNI  399
            FTG VSIRGRIL+G     KM RTI++RR+YLH+VKKY R+EKRH N+
Sbjct  56   FTGNVSIRGRILSGVVQKMKMQRTIVIRRDYLHYVKKYNRFEKRHKNM  103



>ref|XP_003059480.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH56612.1| predicted protein [Micromonas pusilla CCMP1545]
Length=156

 Score =   142 bits (358),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 75/110 (68%), Positives = 90/110 (82%), Gaps = 2/110 (2%)
 Frame = +1

Query  73   IMAEQTEKAFLKQPGVFLSSkktgkgkrpgkggNRFWKSIGLGFKTPREATEGTYIDKKC  252
            + AEQTEKA+ KQ GV  ++  + K K PGK G R++KS+GLGFKTPREA EGTYIDKKC
Sbjct  1    MAAEQTEKAYQKQLGV--NAGCSIKNKAPGKAGTRYYKSVGLGFKTPREAIEGTYIDKKC  58

Query  253  PFTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIA  402
            PFTG VSIRGRIL GT  S KM RT+I+R +YLH+++KYQRYEKRH+NIA
Sbjct  59   PFTGNVSIRGRILTGTVKSYKMKRTLIMRMDYLHYIQKYQRYEKRHTNIA  108



>gb|EMT61393.1| 40S ribosomal protein S11-B [Fusarium oxysporum f. sp. cubense 
race 4]
 gb|ENH61491.1| 40S ribosomal protein S11-B [Fusarium oxysporum f. sp. cubense 
race 1]
Length=167

 Score =   142 bits (359),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 74/116 (64%), Positives = 89/116 (77%), Gaps = 0/116 (0%)
 Frame = +1

Query  55   DTSAATIMAEQTEKAFLKQPGVFLSSkktgkgkrpgkggNRFWKSIGLGFKTPREATEGT  234
            D   AT +  Q+E+AF KQP +F +SK   K  RPGKGG R++K +GLGF+TP+ A EG+
Sbjct  4    DDDKATELTVQSERAFQKQPHIFQNSKTKTKSTRPGKGGRRWYKDVGLGFRTPKAAIEGS  63

Query  235  YIDKKCPFTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIA  402
            YIDKKCPFTG VSIRGRIL GT  S KM+RTII+RR YLHF+ KY RYEKRH N+A
Sbjct  64   YIDKKCPFTGLVSIRGRILTGTVVSTKMHRTIIIRREYLHFIPKYSRYEKRHKNVA  119



>emb|CDR37295.1| RHTO0S02e13058g1_1 [Rhodosporidium toruloides]
Length=153

 Score =   142 bits (358),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 70/109 (64%), Positives = 81/109 (74%), Gaps = 1/109 (1%)
 Frame = +1

Query  76   MAEQTEKAFLKQPGVFLSSkktgkgkrpgkggNRFWKSIGLGFKTPREATEGTYIDKKCP  255
            MAEQ EK+F KQP +F ++K     ++      R++K +GLGFKTPREA EGTYIDKKCP
Sbjct  1    MAEQVEKSFQKQP-LFHNAKVATTSRKVAGKDRRWYKEVGLGFKTPREAIEGTYIDKKCP  59

Query  256  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIA  402
            FTG VSIRGRIL G   S KM RTII+RR YLHFV KY RYEKRH N+A
Sbjct  60   FTGLVSIRGRILTGKVISTKMTRTIIIRREYLHFVPKYSRYEKRHKNVA  108



>ref|NP_001155823.1| 40S ribosomal protein S11 [Acyrthosiphon pisum]
 dbj|BAH70684.1| ACYPI009948 [Acyrthosiphon pisum]
Length=152

 Score =   142 bits (357),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 69/109 (63%), Positives = 85/109 (78%), Gaps = 5/109 (5%)
 Frame = +1

Query  76   MAEQTEKAFLKQPGVFLSSkktgkgkrpgkggNRFWKSIGLGFKTPREATEGTYIDKKCP  255
            MA+QTEKAF KQP VFL+ K++ K K       R ++S+GLGFKTPREA +GTYIDKKCP
Sbjct  1    MADQTEKAFQKQPTVFLNRKESKKKKPL-----RHYRSVGLGFKTPREAIDGTYIDKKCP  55

Query  256  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIA  402
            FTG VSIRGRIL GT    KM RTI++RR+YLH++ KY R+EKRH N++
Sbjct  56   FTGNVSIRGRILTGTVRKMKMQRTIVIRRDYLHYISKYNRFEKRHKNMS  104



>gb|KFY68897.1| hypothetical protein V496_00720 [Pseudogymnoascus pannorum VKM 
F-4515 (FW-2607)]
 gb|KFY98476.1| hypothetical protein V498_01442 [Pseudogymnoascus pannorum VKM 
F-4517 (FW-2822)]
Length=161

 Score =   142 bits (358),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 73/112 (65%), Positives = 87/112 (78%), Gaps = 0/112 (0%)
 Frame = +1

Query  67   ATIMAEQTEKAFLKQPGVFLSSkktgkgkrpgkggNRFWKSIGLGFKTPREATEGTYIDK  246
            AT +  Q+E+AF KQP +FL+SK   K  R GKGG R++K +GLGFKTP+ A EGTYIDK
Sbjct  2    ATELTVQSERAFQKQPHIFLNSKVKAKSARAGKGGRRWYKDVGLGFKTPKTAIEGTYIDK  61

Query  247  KCPFTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIA  402
            KCPF G +SIRGRIL GT  S KM+RT+I+RR YLHFV KY RYEKRH N+A
Sbjct  62   KCPFVGQISIRGRILTGTVVSTKMHRTLIIRREYLHFVPKYARYEKRHKNLA  113



>emb|CEF98300.1| Ribosomal protein S17 [Ostreococcus tauri]
Length=151

 Score =   141 bits (356),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 70/109 (64%), Positives = 83/109 (76%), Gaps = 6/109 (6%)
 Frame = +1

Query  76   MAEQTEKAFLKQPGVFLSSkktgkgkrpgkggNRFWKSIGLGFKTPREATEGTYIDKKCP  255
            MA+Q E+AF KQ GV              K G R++K++GLGFKTPREA EGTYIDKKCP
Sbjct  1    MADQHERAFQKQLGV------QRGFGSHTKKGERYYKNVGLGFKTPREAIEGTYIDKKCP  54

Query  256  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIA  402
            FTG VSIRGRIL G   SAKMNRTI++R +YLHF++KYQRYEKRH+NI+
Sbjct  55   FTGNVSIRGRILTGVVKSAKMNRTIVMRMDYLHFIRKYQRYEKRHTNIS  103



>ref|XP_002501446.1| ribosomal protein [Micromonas sp. RCC299]
 gb|ACO62704.1| ribosomal protein [Micromonas sp. RCC299]
Length=158

 Score =   142 bits (357),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 73/109 (67%), Positives = 88/109 (81%), Gaps = 0/109 (0%)
 Frame = +1

Query  73   IMAEQTEKAFLKQPGVFLSSkktgkgkrpgkggNRFWKSIGLGFKTPREATEGTYIDKKC  252
            + AEQTEKA+ KQ GV +     GK  RPGK G R++K++GLGFKTPREA EGTYIDKKC
Sbjct  1    MAAEQTEKAYQKQLGVNVGFGPKGKKARPGKNGTRYYKNVGLGFKTPREAIEGTYIDKKC  60

Query  253  PFTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNI  399
            PFTG VSIRGRIL G   + KMNRT+I+R +YLH++KKYQRYEKRH+N+
Sbjct  61   PFTGNVSIRGRILTGLVKTHKMNRTLIMRMDYLHYIKKYQRYEKRHTNL  109



>gb|ELR05457.1| 40S ribosomal protein S11 [Pseudogymnoascus destructans 20631-21]
 gb|KFZ10497.1| hypothetical protein V501_05169 [Pseudogymnoascus pannorum VKM 
F-4519 (FW-2642)]
Length=161

 Score =   142 bits (357),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 73/112 (65%), Positives = 87/112 (78%), Gaps = 0/112 (0%)
 Frame = +1

Query  67   ATIMAEQTEKAFLKQPGVFLSSkktgkgkrpgkggNRFWKSIGLGFKTPREATEGTYIDK  246
            AT +  Q+E+AF KQP +FL+SK   K  R GKGG R++K +GLGF+TP+ A EGTYIDK
Sbjct  2    ATELTVQSERAFQKQPHIFLNSKVKAKSARAGKGGRRWYKDVGLGFRTPKNAIEGTYIDK  61

Query  247  KCPFTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIA  402
            KCPF G VSIRGRIL GT  S KM+RT+I+RR YLHFV KY RYEKRH N+A
Sbjct  62   KCPFVGQVSIRGRILTGTVVSTKMHRTLIIRREYLHFVPKYARYEKRHKNLA  113



>gb|ELU08745.1| hypothetical protein CAPTEDRAFT_165333 [Capitella teleta]
Length=156

 Score =   142 bits (357),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 69/109 (63%), Positives = 84/109 (77%), Gaps = 1/109 (1%)
 Frame = +1

Query  76   MAEQTEKAFLKQPGVFLSSkktgkgkrpgkggNRFWKSIGLGFKTPREATEGTYIDKKCP  255
            MA+Q E+AF KQ G+FL+ KK     +  K   R+ K++GLGFKTPREA EGTYIDKKCP
Sbjct  1    MADQVERAFQKQKGIFLNKKKVVVSGKASKTP-RYVKNVGLGFKTPREAVEGTYIDKKCP  59

Query  256  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIA  402
            FTG VSIRGRIL+G     KM RTI+VRR+YLH+V+KY R+EKRH NI+
Sbjct  60   FTGNVSIRGRILSGIVMKTKMQRTIVVRRDYLHYVRKYNRFEKRHKNIS  108



>ref|XP_002901699.1| 40S ribosomal protein S11 [Phytophthora infestans T30-4]
 ref|XP_008913503.1| archaeal ribosomal protein S17P [Phytophthora parasitica INRA-310]
 ref|XP_009516691.1| hypothetical protein PHYSODRAFT_353636 [Phytophthora sojae]
 ref|XP_009516703.1| hypothetical protein PHYSODRAFT_353660 [Phytophthora sojae]
 gb|EEY58755.1| 40S ribosomal protein S11 [Phytophthora infestans T30-4]
 gb|EGZ29416.1| hypothetical protein PHYSODRAFT_353636 [Phytophthora sojae]
 gb|EGZ29428.1| hypothetical protein PHYSODRAFT_353660 [Phytophthora sojae]
 gb|ETI34812.1| archaeal ribosomal protein S17P [Phytophthora parasitica P1569]
 gb|ETI34831.1| archaeal ribosomal protein S17P [Phytophthora parasitica P1569]
 gb|ETN01176.1| archaeal ribosomal protein S17P [Phytophthora parasitica INRA-310]
 gb|ETO63572.1| archaeal ribosomal protein S17P [Phytophthora parasitica P1976]
 gb|ETO63573.1| archaeal ribosomal protein S17P [Phytophthora parasitica P1976]
 gb|ETP04670.1| archaeal ribosomal protein S17P [Phytophthora parasitica CJ01A1]
 gb|ETP32818.1| archaeal ribosomal protein S17P [Phytophthora parasitica P10297]
Length=159

 Score =   142 bits (357),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 70/108 (65%), Positives = 83/108 (77%), Gaps = 4/108 (4%)
 Frame = +1

Query  79   AEQTEKAFLKQPGVFLSSkktgkgkrpgkggNRFWKSIGLGFKTPREATEGTYIDKKCPF  258
             +QTEKA+ KQ GVFL+SKK    K+      RF+K +GLGFKTP+ A EG Y+DKKCPF
Sbjct  4    VDQTEKAYQKQQGVFLASKKFAGKKKGP----RFYKEVGLGFKTPKSAIEGQYVDKKCPF  59

Query  259  TGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIA  402
            TG +SIRGRIL G   S KM RTIIVRR+YLHFVKKY+R+EKRH N+A
Sbjct  60   TGNISIRGRILKGVVLSTKMKRTIIVRRDYLHFVKKYKRFEKRHKNVA  107



>ref|XP_008470793.1| PREDICTED: 40S ribosomal protein S11 isoform X2 [Diaphorina citri]
 ref|XP_008470802.1| PREDICTED: 40S ribosomal protein S11 isoform X3 [Diaphorina citri]
Length=152

 Score =   141 bits (356),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 69/109 (63%), Positives = 84/109 (77%), Gaps = 5/109 (5%)
 Frame = +1

Query  76   MAEQTEKAFLKQPGVFLSSkktgkgkrpgkggNRFWKSIGLGFKTPREATEGTYIDKKCP  255
            MAEQTE+AF KQP +FL+ K T K K       R+ K++GLGFKTPREA +GTYIDKKCP
Sbjct  1    MAEQTERAFQKQPTIFLARKPTYKKKSL-----RYHKTVGLGFKTPREAIDGTYIDKKCP  55

Query  256  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIA  402
            FTG VSIRGRIL G     KM RTI++RR+YLH++KKY R+EKRH N++
Sbjct  56   FTGNVSIRGRILIGIVRKMKMQRTIVIRRDYLHYIKKYNRFEKRHRNMS  104



>ref|XP_007920165.1| hypothetical protein MYCFIDRAFT_55564 [Pseudocercospora fijiensis 
CIRAD86]
 gb|EME89086.1| hypothetical protein MYCFIDRAFT_55564 [Pseudocercospora fijiensis 
CIRAD86]
Length=161

 Score =   142 bits (357),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 73/112 (65%), Positives = 87/112 (78%), Gaps = 0/112 (0%)
 Frame = +1

Query  67   ATIMAEQTEKAFLKQPGVFLSSkktgkgkrpgkggNRFWKSIGLGFKTPREATEGTYIDK  246
            AT +  Q+E+AF KQP +FL+SK   K  R GKGG R++K +GLGF+TPR A EG YIDK
Sbjct  2    ATELTVQSERAFQKQPHIFLNSKSKAKSTRVGKGGRRWYKDVGLGFRTPRTAIEGKYIDK  61

Query  247  KCPFTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIA  402
            KCPFTG VSIRGRIL GT  S KM+RT+I+RR YLHF+ KY RYEKRH N+A
Sbjct  62   KCPFTGLVSIRGRILTGTVVSTKMHRTLIIRREYLHFIPKYSRYEKRHKNLA  113



>gb|KFY31291.1| hypothetical protein V493_01246 [Pseudogymnoascus pannorum VKM 
F-4281 (FW-2241)]
Length=161

 Score =   142 bits (357),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 73/112 (65%), Positives = 87/112 (78%), Gaps = 0/112 (0%)
 Frame = +1

Query  67   ATIMAEQTEKAFLKQPGVFLSSkktgkgkrpgkggNRFWKSIGLGFKTPREATEGTYIDK  246
            AT +  Q+E+AF KQP +FL+SK   K  R GKGG R++K +GLGF+TP+ A EGTYIDK
Sbjct  2    ATELTVQSERAFQKQPHIFLNSKVKAKSARAGKGGRRWYKDVGLGFRTPKTAIEGTYIDK  61

Query  247  KCPFTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIA  402
            KCPF G VSIRGRIL GT  S KM+RT+I+RR YLHFV KY RYEKRH N+A
Sbjct  62   KCPFVGEVSIRGRILTGTVVSTKMHRTLIIRREYLHFVPKYSRYEKRHKNLA  113



>gb|KFY00910.1| hypothetical protein O988_03033 [Pseudogymnoascus pannorum VKM 
F-3808]
 gb|KFY03132.1| hypothetical protein V490_00279 [Pseudogymnoascus pannorum VKM 
F-3557]
 gb|KFY45545.1| hypothetical protein V495_02920 [Pseudogymnoascus pannorum VKM 
F-4514 (FW-929)]
 gb|KFY61154.1| hypothetical protein V497_03100 [Pseudogymnoascus pannorum VKM 
F-4516 (FW-969)]
 gb|KFY76566.1| hypothetical protein V499_03857 [Pseudogymnoascus pannorum VKM 
F-103]
Length=161

 Score =   142 bits (357),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 73/112 (65%), Positives = 87/112 (78%), Gaps = 0/112 (0%)
 Frame = +1

Query  67   ATIMAEQTEKAFLKQPGVFLSSkktgkgkrpgkggNRFWKSIGLGFKTPREATEGTYIDK  246
            AT +  Q+E+AF KQP +FL+SK   K  R GKGG R++K +GLGF+TP+ A EGTYIDK
Sbjct  2    ATELTVQSERAFQKQPHIFLNSKVKAKSARAGKGGRRWYKDVGLGFRTPKTAIEGTYIDK  61

Query  247  KCPFTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIA  402
            KCPF G VSIRGRIL GT  S KM+RT+I+RR YLHFV KY RYEKRH N+A
Sbjct  62   KCPFVGQVSIRGRILTGTVVSTKMHRTLIIRREYLHFVPKYARYEKRHKNLA  113



>ref|XP_011412459.1| PREDICTED: 40S ribosomal protein S11-like [Crassostrea gigas]
Length=157

 Score =   141 bits (356),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 69/109 (63%), Positives = 85/109 (78%), Gaps = 1/109 (1%)
 Frame = +1

Query  76   MAEQTEKAFLKQPGVFLSSkktgkgkrpgkggNRFWKSIGLGFKTPREATEGTYIDKKCP  255
            MAEQTE++F KQP VFL++KK     +  K   R +KS+GLGF+TPREA  GTYIDKKCP
Sbjct  1    MAEQTERSFQKQPTVFLNNKKNLMSVKGQKN-TRHFKSVGLGFRTPREAMLGTYIDKKCP  59

Query  256  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIA  402
            FTG VSIRGRIL G     KM RTI++RR+YLH+VKKY+R+EKRH N++
Sbjct  60   FTGNVSIRGRILTGVVQKMKMQRTIVIRRDYLHYVKKYKRFEKRHRNMS  108



>gb|KFY15673.1| hypothetical protein V491_05601 [Pseudogymnoascus pannorum VKM 
F-3775]
Length=161

 Score =   141 bits (356),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 73/112 (65%), Positives = 87/112 (78%), Gaps = 0/112 (0%)
 Frame = +1

Query  67   ATIMAEQTEKAFLKQPGVFLSSkktgkgkrpgkggNRFWKSIGLGFKTPREATEGTYIDK  246
            AT +  Q+E+AF KQP +FL+SK   K  R GKGG R++K +GLGF+TP+ A EGTYIDK
Sbjct  2    ATELTVQSERAFQKQPHIFLNSKVKAKSARAGKGGRRWYKDVGLGFRTPKTAIEGTYIDK  61

Query  247  KCPFTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIA  402
            KCPF G VSIRGRIL GT  S KM+RT+I+RR YLHFV KY RYEKRH N+A
Sbjct  62   KCPFVGQVSIRGRILTGTVVSTKMHRTLIIRREYLHFVPKYARYEKRHKNLA  113



>gb|EYB33503.1| hypothetical protein FG05_00671 [Fusarium graminearum]
Length=185

 Score =   142 bits (358),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 74/118 (63%), Positives = 92/118 (78%), Gaps = 0/118 (0%)
 Frame = +1

Query  49   SCDTSAATIMAEQTEKAFLKQPGVFLSSkktgkgkrpgkggNRFWKSIGLGFKTPREATE  228
            +C  + AT +  Q+E+AF KQP +F +SK   K  RPGKGG R++K +GLGF+TP+ A E
Sbjct  20   TCCGARATELTVQSERAFQKQPHIFQNSKTKTKSTRPGKGGRRWYKDVGLGFRTPKTAIE  79

Query  229  GTYIDKKCPFTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIA  402
            G+YIDKKCPFTG VSIRGRIL GT  S KM+RTII+RR YLHF++KY RYEKRH N+A
Sbjct  80   GSYIDKKCPFTGLVSIRGRILTGTVVSTKMHRTIIIRREYLHFIQKYSRYEKRHKNVA  137



>ref|XP_009252037.1| hypothetical protein FPSE_00642 [Fusarium pseudograminearum CS3096]
 gb|EKJ79167.1| hypothetical protein FPSE_00642 [Fusarium pseudograminearum CS3096]
Length=182

 Score =   142 bits (358),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 74/113 (65%), Positives = 90/113 (80%), Gaps = 0/113 (0%)
 Frame = +1

Query  64   AATIMAEQTEKAFLKQPGVFLSSkktgkgkrpgkggNRFWKSIGLGFKTPREATEGTYID  243
            AAT +  Q+E+AF KQP +F +SK   K  RPGKGG R++K +GLGF+TP+ A EG+YID
Sbjct  22   AATELTVQSERAFQKQPHIFQNSKTKTKSTRPGKGGRRWYKDVGLGFRTPKAAIEGSYID  81

Query  244  KKCPFTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIA  402
            KKCPFTG VSIRGRIL GT  S KM+RTII+RR YLHF++KY RYEKRH N+A
Sbjct  82   KKCPFTGLVSIRGRILTGTVVSTKMHRTIIIRREYLHFIQKYSRYEKRHKNVA  134



>ref|XP_007292620.1| 40S ribosomal protein S11 [Marssonina brunnea f. sp. 'multigermtubi' 
MB_m1]
 gb|EKD17154.1| 40S ribosomal protein S11 [Marssonina brunnea f. sp. 'multigermtubi' 
MB_m1]
Length=161

 Score =   141 bits (356),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 71/112 (63%), Positives = 87/112 (78%), Gaps = 0/112 (0%)
 Frame = +1

Query  67   ATIMAEQTEKAFLKQPGVFLSSkktgkgkrpgkggNRFWKSIGLGFKTPREATEGTYIDK  246
            AT +  Q+E+AF KQP +FL+SK   K    GKGG R++K +GLGF+TP+ A EG+YIDK
Sbjct  2    ATELTVQSERAFQKQPHIFLNSKSKSKSTAVGKGGRRWYKDVGLGFRTPKTAIEGSYIDK  61

Query  247  KCPFTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIA  402
            KCPFTG VSIRGRIL GT  S KM+RT+I+RR YLHF+ KY RYEKRH N+A
Sbjct  62   KCPFTGLVSIRGRILTGTVVSTKMHRTLIIRREYLHFIPKYARYEKRHKNLA  113



>gb|KHN96715.1| 40S ribosomal protein S11 [Metarhizium album ARSEF 1941]
Length=172

 Score =   142 bits (357),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 74/121 (61%), Positives = 91/121 (75%), Gaps = 0/121 (0%)
 Frame = +1

Query  40   LLSSCDTSAATIMAEQTEKAFLKQPGVFLSSkktgkgkrpgkggNRFWKSIGLGFKTPRE  219
            L  +     AT +  Q+E+AF KQP +FL+SK   K  RPGKGG R++K +GLGF+TP+ 
Sbjct  4    LFETLTRIMATELTVQSERAFQKQPHIFLNSKTKAKSARPGKGGRRWYKDVGLGFRTPKT  63

Query  220  ATEGTYIDKKCPFTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNI  399
            A EG+YIDKKCPFTG VSIRGRIL GT  S KM+RT+I+RR YLHF+ KY RYEKRH N+
Sbjct  64   AIEGSYIDKKCPFTGLVSIRGRILTGTVVSTKMHRTLIIRREYLHFIPKYSRYEKRHKNL  123

Query  400  A  402
            A
Sbjct  124  A  124



>ref|XP_001560156.1| 40S ribosomal protein S11 [Botrytis cinerea B05.10]
 emb|CCD49311.1| similar to 40S ribosomal protein S11 [Botrytis cinerea T4]
 gb|EMR82615.1| putative 40s ribosomal protein s11 protein [Botrytis cinerea 
BcDW1]
Length=161

 Score =   141 bits (355),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 72/112 (64%), Positives = 88/112 (79%), Gaps = 0/112 (0%)
 Frame = +1

Query  67   ATIMAEQTEKAFLKQPGVFLSSkktgkgkrpgkggNRFWKSIGLGFKTPREATEGTYIDK  246
            AT +  Q+E+AF KQP +FL+SK   K  R GKGG R++K +GLGF+TP+ A EG+YIDK
Sbjct  2    ATELTVQSERAFQKQPHIFLNSKSKTKSSRVGKGGRRWYKDVGLGFRTPKTAIEGSYIDK  61

Query  247  KCPFTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIA  402
            KCPFTG VSIRGRIL GT  S KM+RT+I+RR YLHF+ KY RYEKRH N+A
Sbjct  62   KCPFTGLVSIRGRILTGTVVSTKMHRTLIIRREYLHFIPKYARYEKRHKNLA  113



>ref|XP_003659345.1| hypothetical protein MYCTH_2088473 [Myceliophthora thermophila 
ATCC 42464]
 gb|AEO54100.1| hypothetical protein MYCTH_2088473 [Myceliophthora thermophila 
ATCC 42464]
Length=161

 Score =   141 bits (355),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 74/112 (66%), Positives = 88/112 (79%), Gaps = 0/112 (0%)
 Frame = +1

Query  67   ATIMAEQTEKAFLKQPGVFLSSkktgkgkrpgkggNRFWKSIGLGFKTPREATEGTYIDK  246
            AT +  Q+E+AF KQP +FL+SK   K  RPGKGG R++K +GLGFKTP+ A EG YIDK
Sbjct  2    ATELTVQSERAFQKQPHIFLNSKTKVKSTRPGKGGRRWYKDVGLGFKTPKTAIEGQYIDK  61

Query  247  KCPFTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIA  402
            KCPFTG VSIRGRIL GT  S KM+RTII+RR YLH++ KY RYEKRH N+A
Sbjct  62   KCPFTGMVSIRGRILTGTVVSTKMHRTIIIRREYLHYIPKYNRYEKRHKNLA  113



>gb|KHG21494.1| 40S ribosomal S11 [Gossypium arboreum]
Length=148

 Score =   140 bits (354),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 81/90 (90%), Positives = 83/90 (92%), Gaps = 0/90 (0%)
 Frame = +1

Query  76   MAEQTEKAFLKQPGVFLSSkktgkgkrpgkggNRFWKSIGLGFKTPREATEGTYIDKKCP  255
            MAEQTEKAFLKQP VFLSSKKT KGKRPGKGGNRFWKSIGLGFKTPREA EGTYIDKKCP
Sbjct  1    MAEQTEKAFLKQPKVFLSSKKTSKGKRPGKGGNRFWKSIGLGFKTPREAIEGTYIDKKCP  60

Query  256  FTGTVSIRGRILAGTCHSAKMNRTIIVRRN  345
            FTGTVS+ GRILAG+CHSAKM RTIIVR  
Sbjct  61   FTGTVSVSGRILAGSCHSAKMMRTIIVREE  90



>dbj|GAO17180.1| hypothetical protein UVI_045350 [Ustilaginoidea virens]
Length=167

 Score =   141 bits (356),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 74/118 (63%), Positives = 90/118 (76%), Gaps = 0/118 (0%)
 Frame = +1

Query  49   SCDTSAATIMAEQTEKAFLKQPGVFLSSkktgkgkrpgkggNRFWKSIGLGFKTPREATE  228
            S     AT +  Q+E+AF KQP +FL+SK   K  RPGKGG R++K +GLGF+TP+ A E
Sbjct  2    SVHDFPATELTVQSERAFQKQPHIFLNSKTKTKTARPGKGGRRWYKDVGLGFRTPKTAIE  61

Query  229  GTYIDKKCPFTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIA  402
            G+YIDKKCPFTG VSIRGRIL GT  S KM+RT+I+RR YLHF+ KY RYEKRH N+A
Sbjct  62   GSYIDKKCPFTGLVSIRGRILTGTVVSTKMHRTVIIRREYLHFIPKYSRYEKRHKNLA  119



>gb|KIH88584.1| small subunit ribosomal protein S11e [Sporothrix brasiliensis 
5110]
Length=161

 Score =   141 bits (355),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 72/112 (64%), Positives = 90/112 (80%), Gaps = 0/112 (0%)
 Frame = +1

Query  67   ATIMAEQTEKAFLKQPGVFLSSkktgkgkrpgkggNRFWKSIGLGFKTPREATEGTYIDK  246
            AT +  Q+E+AF KQP +FL+SK   K  RPGK G R++K++GLGF+TP+ A EG+YIDK
Sbjct  2    ATELTVQSERAFQKQPHIFLNSKTKVKTARPGKNGRRWYKNVGLGFRTPKTAIEGSYIDK  61

Query  247  KCPFTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIA  402
            KCPFTG VSIRGRIL GT  S KM+RTII+RR YLH++ KY RYEKRH+N+A
Sbjct  62   KCPFTGLVSIRGRILTGTVVSTKMHRTIIIRREYLHYIPKYARYEKRHTNLA  113



>gb|ERT02285.1| 40S ribosomal protein S11 [Sporothrix schenckii ATCC 58251]
Length=161

 Score =   141 bits (355),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 72/112 (64%), Positives = 90/112 (80%), Gaps = 0/112 (0%)
 Frame = +1

Query  67   ATIMAEQTEKAFLKQPGVFLSSkktgkgkrpgkggNRFWKSIGLGFKTPREATEGTYIDK  246
            AT +  Q+E+AF KQP +FL+SK   K  RPGK G R++K++GLGF+TP+ A EG+YIDK
Sbjct  2    ATELTVQSERAFQKQPHIFLNSKTKVKTARPGKNGRRWYKNVGLGFRTPKTAIEGSYIDK  61

Query  247  KCPFTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIA  402
            KCPFTG VSIRGRIL GT  S KM+RTII+RR YLH++ KY RYEKRH+N+A
Sbjct  62   KCPFTGLVSIRGRILTGTVVSTKMHRTIIIRREYLHYIPKYARYEKRHTNLA  113



>gb|EXV02037.1| 40S ribosomal protein S17 [Metarhizium robertsii]
Length=161

 Score =   141 bits (355),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 73/112 (65%), Positives = 89/112 (79%), Gaps = 0/112 (0%)
 Frame = +1

Query  67   ATIMAEQTEKAFLKQPGVFLSSkktgkgkrpgkggNRFWKSIGLGFKTPREATEGTYIDK  246
            AT +  Q+E+AF KQP +FL+SK   K  RPGKGG R++K +GLGF+TP+ A EG+YIDK
Sbjct  2    ATELTVQSERAFQKQPHIFLNSKTKAKSSRPGKGGRRWYKDVGLGFRTPKTAIEGSYIDK  61

Query  247  KCPFTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIA  402
            KCPFTG VSIRGRIL GT  S KM+RT+I+RR YLHF+ KY RYEKRH N+A
Sbjct  62   KCPFTGLVSIRGRILTGTVVSTKMHRTLIIRREYLHFIPKYSRYEKRHKNLA  113



>gb|EPE10077.1| 40s ribosomal protein s11 [Ophiostoma piceae UAMH 11346]
Length=161

 Score =   141 bits (355),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 72/112 (64%), Positives = 90/112 (80%), Gaps = 0/112 (0%)
 Frame = +1

Query  67   ATIMAEQTEKAFLKQPGVFLSSkktgkgkrpgkggNRFWKSIGLGFKTPREATEGTYIDK  246
            AT +  Q+E+AF KQP +FL+SK   K  RPGK G R++K++GLGF+TP+ A EG+YIDK
Sbjct  2    ATELTVQSERAFQKQPHIFLNSKTKVKTARPGKNGRRWYKNVGLGFRTPKTAIEGSYIDK  61

Query  247  KCPFTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIA  402
            KCPFTG VSIRGRIL GT  S KM+RTII+RR YLH++ KY RYEKRH+N+A
Sbjct  62   KCPFTGLVSIRGRILTGTVVSTKMHRTIIIRREYLHYIPKYSRYEKRHTNLA  113



>gb|KHJ35420.1| putative 40s ribosomal protein s11 [Erysiphe necator]
Length=161

 Score =   141 bits (355),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 72/112 (64%), Positives = 89/112 (79%), Gaps = 0/112 (0%)
 Frame = +1

Query  67   ATIMAEQTEKAFLKQPGVFLSSkktgkgkrpgkggNRFWKSIGLGFKTPREATEGTYIDK  246
            AT +  Q+E+AF KQP +FL+SK   K  +PGKGG R++K +GLGF+TP+ A EGTYIDK
Sbjct  2    ATELTVQSERAFQKQPHIFLNSKVKTKSVKPGKGGRRWYKDVGLGFRTPKTAIEGTYIDK  61

Query  247  KCPFTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIA  402
            KCPFTG +SIRGRIL GT  S KM+RT+IVRR YLHF+ KY RYE+RH N+A
Sbjct  62   KCPFTGLISIRGRILTGTVVSTKMHRTLIVRREYLHFIPKYARYERRHKNLA  113



>ref|XP_007797900.1| putative 40s ribosomal protein s11 protein [Eutypa lata UCREL1]
 gb|EMR62989.1| putative 40s ribosomal protein s11 protein [Eutypa lata UCREL1]
Length=161

 Score =   141 bits (355),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 72/112 (64%), Positives = 88/112 (79%), Gaps = 0/112 (0%)
 Frame = +1

Query  67   ATIMAEQTEKAFLKQPGVFLSSkktgkgkrpgkggNRFWKSIGLGFKTPREATEGTYIDK  246
            AT +  Q+E+AF KQP +FL+SK   K  RPGK G R++K +GLGFKTP+ A +G+YIDK
Sbjct  2    ATELTVQSERAFQKQPHIFLNSKVKAKTSRPGKNGRRWYKDVGLGFKTPKTAIDGSYIDK  61

Query  247  KCPFTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIA  402
            KCPFTG VSIRGRIL GT  S KM+RT+I+RR YLHF+ KY RYEKRH N+A
Sbjct  62   KCPFTGLVSIRGRILTGTVVSTKMHRTLIIRREYLHFIPKYARYEKRHKNLA  113



>gb|KFG78441.1| 40S ribosomal protein S11 [Metarhizium anisopliae]
 gb|KID60391.1| Ribosomal protein S17, partial [Metarhizium anisopliae ARSEF 
549]
 gb|KID75345.1| hypothetical protein MBR_05672, partial [Metarhizium brunneum 
ARSEF 3297]
Length=162

 Score =   141 bits (355),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 73/112 (65%), Positives = 89/112 (79%), Gaps = 0/112 (0%)
 Frame = +1

Query  67   ATIMAEQTEKAFLKQPGVFLSSkktgkgkrpgkggNRFWKSIGLGFKTPREATEGTYIDK  246
            AT +  Q+E+AF KQP +FL+SK   K  RPGKGG R++K +GLGF+TP+ A EG+YIDK
Sbjct  3    ATELTVQSERAFQKQPHIFLNSKTKAKSSRPGKGGRRWYKDVGLGFRTPKTAIEGSYIDK  62

Query  247  KCPFTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIA  402
            KCPFTG VSIRGRIL GT  S KM+RT+I+RR YLHF+ KY RYEKRH N+A
Sbjct  63   KCPFTGLVSIRGRILTGTVVSTKMHRTLIIRREYLHFIPKYSRYEKRHKNLA  114



>ref|XP_006696347.1| 40S ribosomal protein S11-like protein [Chaetomium thermophilum 
var. thermophilum DSM 1495]
 gb|EGS18016.1| 40S ribosomal protein S11-like protein [Chaetomium thermophilum 
var. thermophilum DSM 1495]
Length=161

 Score =   141 bits (355),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 74/112 (66%), Positives = 88/112 (79%), Gaps = 0/112 (0%)
 Frame = +1

Query  67   ATIMAEQTEKAFLKQPGVFLSSkktgkgkrpgkggNRFWKSIGLGFKTPREATEGTYIDK  246
            AT +  Q+E+AFLKQP +FL+SK   K  RPGKGG R++K +GLGFKTP+ A EG YIDK
Sbjct  2    ATELTVQSERAFLKQPHIFLNSKVKVKSTRPGKGGRRWYKDVGLGFKTPKTAIEGHYIDK  61

Query  247  KCPFTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIA  402
            KCPFTG VSIRGRIL G   S KM+RTII+RR YLH++ KY RYEKRH N+A
Sbjct  62   KCPFTGMVSIRGRILTGRVVSTKMHRTIIIRREYLHYIPKYNRYEKRHKNLA  113



>ref|XP_011316367.1| 40S ribosomal protein S11 [Fusarium graminearum PH-1]
 gb|ESU05882.1| 40S ribosomal protein S11 [Fusarium graminearum PH-1]
Length=161

 Score =   141 bits (355),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 73/112 (65%), Positives = 89/112 (79%), Gaps = 0/112 (0%)
 Frame = +1

Query  67   ATIMAEQTEKAFLKQPGVFLSSkktgkgkrpgkggNRFWKSIGLGFKTPREATEGTYIDK  246
            AT +  Q+E+AF KQP +F +SK   K  RPGKGG R++K +GLGF+TP+ A EG+YIDK
Sbjct  2    ATELTVQSERAFQKQPHIFQNSKTKTKSTRPGKGGRRWYKDVGLGFRTPKTAIEGSYIDK  61

Query  247  KCPFTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIA  402
            KCPFTG VSIRGRIL GT  S KM+RTII+RR YLHF++KY RYEKRH N+A
Sbjct  62   KCPFTGLVSIRGRILTGTVVSTKMHRTIIIRREYLHFIQKYSRYEKRHKNVA  113



>gb|ESX00172.1| 40S ribosomal protein S11-A [Ogataea parapolymorpha DL-1]
Length=155

 Score =   140 bits (354),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 68/112 (61%), Positives = 83/112 (74%), Gaps = 5/112 (4%)
 Frame = +1

Query  67   ATIMAEQTEKAFLKQPGVFLSSkktgkgkrpgkggNRFWKSIGLGFKTPREATEGTYIDK  246
            AT +  Q+EKAF KQP +F + K     +       R++K +GLGFKTP+ A EGTYIDK
Sbjct  2    ATELTVQSEKAFQKQPHIFTNPKAKASRRT-----KRWYKDVGLGFKTPKSAIEGTYIDK  56

Query  247  KCPFTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIA  402
            KCPFTGTVSIRGRIL GT  S KM+RTII+RR+YLH++ KY RYEKRH N+A
Sbjct  57   KCPFTGTVSIRGRILTGTVVSTKMHRTIIIRRDYLHYIPKYNRYEKRHKNLA  108



>gb|KID89820.1| Ribosomal protein S17 [Metarhizium guizhouense ARSEF 977]
Length=174

 Score =   141 bits (356),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 73/112 (65%), Positives = 89/112 (79%), Gaps = 0/112 (0%)
 Frame = +1

Query  67   ATIMAEQTEKAFLKQPGVFLSSkktgkgkrpgkggNRFWKSIGLGFKTPREATEGTYIDK  246
            AT +  Q+E+AF KQP +FL+SK   K  RPGKGG R++K +GLGF+TP+ A EG+YIDK
Sbjct  15   ATELTVQSERAFQKQPHIFLNSKTKAKSSRPGKGGRRWYKDVGLGFRTPKTAIEGSYIDK  74

Query  247  KCPFTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIA  402
            KCPFTG VSIRGRIL GT  S KM+RT+I+RR YLHF+ KY RYEKRH N+A
Sbjct  75   KCPFTGLVSIRGRILTGTVVSTKMHRTLIIRREYLHFIPKYSRYEKRHKNLA  126



>ref|XP_011555770.1| PREDICTED: 40S ribosomal protein S11 isoform X1 [Plutella xylostella]
Length=156

 Score =   140 bits (354),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 69/109 (63%), Positives = 84/109 (77%), Gaps = 1/109 (1%)
 Frame = +1

Query  76   MAEQTEKAFLKQPGVFLSSkktgkgkrpgkggNRFWKSIGLGFKTPREATEGTYIDKKCP  255
            MA+QTE++F KQP +FL+ KK    K+  K   R+ K +GLGFKTPREA EGTYIDKKCP
Sbjct  1    MADQTERSFQKQPTIFLNRKKGIGIKKSRKPV-RYHKDVGLGFKTPREAIEGTYIDKKCP  59

Query  256  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIA  402
            FTG VSIRGRIL+G     KM RTI++RR+YLH+VKKY R+EKRH N+ 
Sbjct  60   FTGNVSIRGRILSGVVQKMKMQRTIVIRRDYLHYVKKYNRFEKRHKNMP  108



>gb|ABZ04263.1| ribosomal protein rps11 [Lineus viridis]
Length=157

 Score =   140 bits (354),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 71/110 (65%), Positives = 88/110 (80%), Gaps = 2/110 (2%)
 Frame = +1

Query  76   MAE-QTEKAFLKQPGVFLSSkktgkgkrpgkggNRFWKSIGLGFKTPREATEGTYIDKKC  252
            MA+ QTEKAF KQP +FL+ KK   G +  K   R++KS+GLGFKTPREA EGTYIDKKC
Sbjct  1    MADHQTEKAFQKQPTIFLNKKKALLGSKAPKHP-RYYKSVGLGFKTPREAIEGTYIDKKC  59

Query  253  PFTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIA  402
            PFTG V+IRGRIL+GT    KM RTI++RR+YLH+V+KY R+EKRH N++
Sbjct  60   PFTGNVNIRGRILSGTVLKMKMQRTIVIRRDYLHYVRKYNRFEKRHKNMS  109



>gb|KFY15274.1| hypothetical protein V492_02114 [Pseudogymnoascus pannorum VKM 
F-4246]
 gb|KFY41133.1| hypothetical protein V494_03196 [Pseudogymnoascus pannorum VKM 
F-4513 (FW-928)]
Length=238

 Score =   143 bits (361),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 73/116 (63%), Positives = 89/116 (77%), Gaps = 0/116 (0%)
 Frame = +1

Query  55   DTSAATIMAEQTEKAFLKQPGVFLSSkktgkgkrpgkggNRFWKSIGLGFKTPREATEGT  234
            + + AT +  Q+E+AF KQP +FL+SK   K  R GKGG R++K +GLGF+TP+ A EGT
Sbjct  75   NANMATELTVQSERAFQKQPHIFLNSKVKAKSARAGKGGRRWYKDVGLGFRTPKTAIEGT  134

Query  235  YIDKKCPFTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIA  402
            YIDKKCPF G VSIRGRIL GT  S KM+RT+I+RR YLHFV KY RYEKRH N+A
Sbjct  135  YIDKKCPFVGQVSIRGRILTGTVVSTKMHRTLIIRREYLHFVPKYARYEKRHKNLA  190



>gb|KEZ42227.1| hypothetical protein SAPIO_CDS6080 [Scedosporium apiospermum]
Length=161

 Score =   140 bits (354),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 73/112 (65%), Positives = 89/112 (79%), Gaps = 0/112 (0%)
 Frame = +1

Query  67   ATIMAEQTEKAFLKQPGVFLSSkktgkgkrpgkggNRFWKSIGLGFKTPREATEGTYIDK  246
            AT +  Q+E+A+LKQP +F ++K   K  RPGKGG R++K +GLGF+TP+ A EG YIDK
Sbjct  2    ATELTVQSERAYLKQPHIFQNAKVKVKSTRPGKGGRRWYKDVGLGFRTPKTAIEGNYIDK  61

Query  247  KCPFTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIA  402
            KCPFTG VSIRGRIL GT  S KM+RT+IVRR YLHF+KKY RYEKRH N+A
Sbjct  62   KCPFTGLVSIRGRILTGTVVSTKMHRTVIVRREYLHFIKKYSRYEKRHKNLA  113



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4615548520022