BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig221

Length=734
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009616644.1|  PREDICTED: uncharacterized protein LOC104109132    193   2e-58   Nicotiana tomentosiformis
ref|XP_009617920.1|  PREDICTED: uncharacterized protein LOC104110180    193   3e-58   Nicotiana tomentosiformis
ref|XP_009780123.1|  PREDICTED: uncharacterized protein LOC104229222    193   5e-58   Nicotiana sylvestris
ref|XP_004233121.2|  PREDICTED: uncharacterized protein LOC101247392    192   3e-57   Solanum lycopersicum
ref|XP_009770732.1|  PREDICTED: uncharacterized protein LOC104221363    190   9e-57   Nicotiana sylvestris
ref|XP_006352968.1|  PREDICTED: uncharacterized protein LOC102584190    187   4e-56   Solanum tuberosum [potatoes]
ref|XP_011096558.1|  PREDICTED: uncharacterized protein LOC105175709    179   1e-52   Sesamum indicum [beniseed]
ref|XP_004244804.1|  PREDICTED: uncharacterized protein LOC101267040    176   1e-51   Solanum lycopersicum
emb|CDP19745.1|  unnamed protein product                                174   5e-51   Coffea canephora [robusta coffee]
ref|XP_002519688.1|  conserved hypothetical protein                     162   5e-46   Ricinus communis
emb|CDP04230.1|  unnamed protein product                                162   6e-46   Coffea canephora [robusta coffee]
gb|EYU33362.1|  hypothetical protein MIMGU_mgv11b0121611mg              160   2e-45   Erythranthe guttata [common monkey flower]
ref|XP_010279635.1|  PREDICTED: uncharacterized protein LOC104613500    159   5e-45   Nelumbo nucifera [Indian lotus]
ref|XP_010674249.1|  PREDICTED: uncharacterized protein LOC104890449    159   6e-45   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002275796.1|  PREDICTED: uncharacterized protein LOC100265752    158   1e-44   Vitis vinifera
ref|XP_002305706.1|  hypothetical protein POPTR_0004s06350g             158   2e-44   Populus trichocarpa [western balsam poplar]
ref|XP_010110973.1|  hypothetical protein L484_021667                   155   1e-43   Morus notabilis
ref|XP_011035462.1|  PREDICTED: uncharacterized protein LOC105133252    155   1e-43   Populus euphratica
ref|XP_010529156.1|  PREDICTED: uncharacterized protein LOC104806126    155   1e-43   Tarenaya hassleriana [spider flower]
ref|XP_010274785.1|  PREDICTED: uncharacterized protein LOC104610025    155   2e-43   Nelumbo nucifera [Indian lotus]
ref|XP_006449687.1|  hypothetical protein CICLE_v10017099mg             154   3e-43   Citrus clementina [clementine]
ref|XP_006845351.1|  PREDICTED: uncharacterized protein LOC18435238     153   9e-43   Amborella trichopoda
ref|XP_006467471.1|  PREDICTED: uncharacterized protein At5g01610...    153   1e-42   Citrus sinensis [apfelsine]
ref|XP_008783947.1|  PREDICTED: uncharacterized protein LOC103703026    152   3e-42   Phoenix dactylifera
ref|XP_010915560.1|  PREDICTED: uncharacterized protein LOC105040638    151   8e-42   Elaeis guineensis
emb|CDY62357.1|  BnaCnng40070D                                          150   2e-41   Brassica napus [oilseed rape]
ref|XP_010494795.1|  PREDICTED: uncharacterized protein LOC104771887    150   2e-41   Camelina sativa [gold-of-pleasure]
ref|XP_009101531.1|  PREDICTED: uncharacterized protein LOC103827744    149   2e-41   Brassica rapa
ref|XP_009128852.1|  PREDICTED: uncharacterized protein LOC103853695    149   3e-41   Brassica rapa
emb|CDY33463.1|  BnaA06g36100D                                          149   3e-41   Brassica napus [oilseed rape]
ref|XP_006281138.1|  hypothetical protein CARUB_v10027170mg             150   4e-41   
ref|XP_007025085.1|  Uncharacterized protein TCM_029489                 148   8e-41   Theobroma cacao [chocolate]
ref|XP_010441609.1|  PREDICTED: uncharacterized protein LOC104724761    148   1e-40   Camelina sativa [gold-of-pleasure]
ref|XP_009419764.1|  PREDICTED: uncharacterized protein LOC103999676    147   3e-40   
ref|XP_010056893.1|  PREDICTED: uncharacterized protein LOC104444837    147   3e-40   Eucalyptus grandis [rose gum]
ref|XP_006398313.1|  hypothetical protein EUTSA_v10001128mg             146   4e-40   Eutrema salsugineum [saltwater cress]
emb|CDX87732.1|  BnaC02g32170D                                          145   7e-40   
gb|EAY72987.1|  hypothetical protein OsI_00860                          146   9e-40   Oryza sativa Indica Group [Indian rice]
ref|XP_009114368.1|  PREDICTED: uncharacterized protein LOC103839621    144   2e-39   Brassica rapa
emb|CDY03234.1|  BnaC09g19220D                                          145   4e-39   
gb|KFK31484.1|  hypothetical protein AALP_AA6G118200                    144   4e-39   Arabis alpina [alpine rockcress]
emb|CDY35153.1|  BnaA09g17900D                                          143   6e-39   Brassica napus [oilseed rape]
ref|NP_001042369.1|  Os01g0210600                                       144   6e-39   
ref|XP_006643896.1|  PREDICTED: uncharacterized protein LOC102710914    144   6e-39   Oryza brachyantha
ref|XP_010925673.1|  PREDICTED: uncharacterized protein LOC105048158    143   6e-39   Elaeis guineensis
gb|ACL51746.1|  unknown                                                 143   8e-39   Picea abies
ref|XP_009380497.1|  PREDICTED: uncharacterized protein LOC103968879    143   1e-38   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDM81056.1|  unnamed protein product                                143   1e-38   Triticum aestivum [Canadian hard winter wheat]
ref|XP_002454956.1|  hypothetical protein SORBIDRAFT_03g002080          143   2e-38   Sorghum bicolor [broomcorn]
ref|XP_009409406.1|  PREDICTED: uncharacterized protein LOC103991625    143   2e-38   Musa acuminata subsp. malaccensis [pisang utan]
gb|AHG95251.1|  hypothetical protein                                    141   4e-38   Pinus mugo [mountain pine]
ref|XP_007147904.1|  hypothetical protein PHAVU_006G164700g             142   4e-38   Phaseolus vulgaris [French bean]
ref|XP_003565415.1|  PREDICTED: uncharacterized protein LOC100822009    142   4e-38   Brachypodium distachyon [annual false brome]
emb|CDM86991.1|  unnamed protein product                                141   4e-38   Triticum aestivum [Canadian hard winter wheat]
emb|CDM82139.1|  unnamed protein product                                141   5e-38   Triticum aestivum [Canadian hard winter wheat]
gb|ACL51738.1|  unknown                                                 140   6e-38   Pinus contorta
ref|XP_007025086.1|  Uncharacterized protein TCM_029490                 140   9e-38   
gb|AHG95244.1|  hypothetical protein                                    140   9e-38   Pinus mugo [mountain pine]
ref|XP_002863416.1|  hypothetical protein ARALYDRAFT_494351             140   1e-37   
gb|ACJ70255.1|  unknown                                                 140   1e-37   Pinus sylvestris [Scotch pine]
gb|AHG95265.1|  hypothetical protein                                    140   1e-37   Pinus mugo subsp. x rotundata
gb|AHG95259.1|  hypothetical protein                                    140   1e-37   Pinus sylvestris [Scotch pine]
gb|ACJ70263.1|  unknown                                                 140   2e-37   Pinus sylvestris [Scotch pine]
gb|AHG95242.1|  hypothetical protein                                    139   2e-37   Pinus mugo [mountain pine]
emb|CDM86616.1|  unnamed protein product                                140   2e-37   Triticum aestivum [Canadian hard winter wheat]
gb|ACL51742.1|  unknown                                                 139   2e-37   Pinus pinaster [cluster pine]
gb|ABK22777.1|  unknown                                                 139   2e-37   Picea sitchensis
gb|AHG95267.1|  hypothetical protein                                    139   2e-37   Pinus mugo subsp. uncinata [spirke]
gb|ACJ70297.1|  unknown                                                 139   2e-37   Pinus sylvestris [Scotch pine]
gb|AHG95266.1|  hypothetical protein                                    139   2e-37   Pinus mugo subsp. uncinata [spirke]
gb|AHG95249.1|  hypothetical protein                                    139   2e-37   Pinus mugo [mountain pine]
ref|XP_004968604.1|  PREDICTED: uncharacterized protein LOC101768810    140   2e-37   Setaria italica
gb|AHG95246.1|  hypothetical protein                                    139   3e-37   Pinus mugo [mountain pine]
ref|XP_006398312.1|  hypothetical protein EUTSA_v10001064mg             139   4e-37   Eutrema salsugineum [saltwater cress]
gb|ACJ70294.1|  unknown                                                 139   4e-37   Pinus sylvestris [Scotch pine]
gb|AHG95261.1|  hypothetical protein                                    139   4e-37   Pinus sylvestris [Scotch pine]
ref|XP_003547206.1|  PREDICTED: uncharacterized protein LOC100810285    139   5e-37   Glycine max [soybeans]
emb|CDM86928.1|  unnamed protein product                                139   5e-37   Triticum aestivum [Canadian hard winter wheat]
gb|ACG32637.1|  hypothetical protein                                    139   5e-37   Zea mays [maize]
gb|AHG95248.1|  hypothetical protein                                    138   5e-37   Pinus mugo [mountain pine]
gb|KHN33145.1|  hypothetical protein glysoja_010136                     139   5e-37   Glycine soja [wild soybean]
gb|ACG48493.1|  hypothetical protein                                    139   8e-37   Zea mays [maize]
gb|ACF85015.1|  unknown                                                 138   1e-36   Zea mays [maize]
emb|CDM86613.1|  unnamed protein product                                137   1e-36   Triticum aestivum [Canadian hard winter wheat]
ref|XP_004134915.1|  PREDICTED: uncharacterized protein LOC101215500    137   1e-36   Cucumis sativus [cucumbers]
dbj|BAK01617.1|  predicted protein                                      137   2e-36   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009360970.1|  PREDICTED: uncharacterized protein LOC103951344    137   2e-36   Pyrus x bretschneideri [bai li]
ref|XP_008439638.1|  PREDICTED: uncharacterized protein LOC103484371    137   2e-36   Cucumis melo [Oriental melon]
gb|ACJ70292.1|  unknown                                                 137   2e-36   Pinus sylvestris [Scotch pine]
gb|AHG95250.1|  hypothetical protein                                    137   2e-36   Pinus mugo [mountain pine]
gb|AHG95247.1|  hypothetical protein                                    137   2e-36   Pinus mugo [mountain pine]
gb|AHG95253.1|  hypothetical protein                                    136   3e-36   Pinus mugo [mountain pine]
emb|CDM86617.1|  unnamed protein product                                137   3e-36   Triticum aestivum [Canadian hard winter wheat]
gb|AHG95268.1|  hypothetical protein                                    136   3e-36   Pinus mugo subsp. uncinata [spirke]
ref|NP_568659.1|  uncharacterized protein                               136   3e-36   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007212828.1|  hypothetical protein PRUPE_ppa020725mg             136   3e-36   Prunus persica
gb|KGN49395.1|  hypothetical protein Csa_6G523360                       137   5e-36   Cucumis sativus [cucumbers]
dbj|BAJ89761.1|  predicted protein                                      136   8e-36   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAD43334.1|  unknown protein                                        135   9e-36   Arabidopsis thaliana [mouse-ear cress]
gb|KJB66926.1|  hypothetical protein B456_010G166300                    135   1e-35   Gossypium raimondii
gb|ACJ70293.1|  unknown                                                 134   2e-35   Pinus sylvestris [Scotch pine]
ref|XP_009411053.1|  PREDICTED: uncharacterized protein LOC103992884    134   2e-35   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009411054.1|  PREDICTED: uncharacterized protein LOC103992885    134   2e-35   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010942813.1|  PREDICTED: uncharacterized protein LOC105060703    134   3e-35   Elaeis guineensis
ref|XP_009411055.1|  PREDICTED: uncharacterized protein LOC103992886    133   4e-35   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB81128.1|  hypothetical protein B456_013G130500                    134   4e-35   Gossypium raimondii
ref|XP_008812280.1|  PREDICTED: uncharacterized protein LOC103723209    133   5e-35   Phoenix dactylifera
ref|XP_008225480.1|  PREDICTED: uncharacterized protein LOC103325123    133   5e-35   Prunus mume [ume]
ref|XP_004486287.1|  PREDICTED: uncharacterized protein LOC101492346    133   6e-35   Cicer arietinum [garbanzo]
ref|XP_006841476.1|  PREDICTED: uncharacterized protein LOC18431288     134   6e-35   Amborella trichopoda
ref|XP_008383560.1|  PREDICTED: uncharacterized protein LOC103446249    132   1e-34   
gb|ACJ83877.1|  unknown                                                 133   1e-34   Medicago truncatula
ref|XP_011460196.1|  PREDICTED: uncharacterized protein LOC105350248    132   2e-34   Fragaria vesca subsp. vesca
ref|XP_010942816.1|  PREDICTED: uncharacterized protein LOC105060705    131   3e-34   Elaeis guineensis
gb|ABK21416.1|  unknown                                                 131   4e-34   Picea sitchensis
ref|XP_002281636.1|  PREDICTED: uncharacterized protein LOC100245914    131   4e-34   Vitis vinifera
gb|EMS45819.1|  hypothetical protein TRIUR3_21435                       134   5e-34   Triticum urartu
ref|XP_012072105.1|  PREDICTED: uncharacterized protein LOC105633990    130   5e-34   Jatropha curcas
ref|XP_010092963.1|  hypothetical protein L484_018900                   131   5e-34   Morus notabilis
ref|XP_006433560.1|  hypothetical protein CICLE_v10002714mg             131   6e-34   Citrus clementina [clementine]
ref|XP_006472233.1|  PREDICTED: uncharacterized protein LOC102631030    131   6e-34   Citrus sinensis [apfelsine]
ref|XP_008792572.1|  PREDICTED: uncharacterized protein LOC103709140    130   6e-34   Phoenix dactylifera
ref|XP_006846887.1|  PREDICTED: uncharacterized protein LOC18436599     130   1e-33   Amborella trichopoda
ref|XP_002519164.1|  conserved hypothetical protein                     129   1e-33   Ricinus communis
ref|XP_008792571.1|  PREDICTED: uncharacterized protein LOC103709139    129   2e-33   Phoenix dactylifera
ref|XP_011038970.1|  PREDICTED: uncharacterized protein LOC105135674    130   2e-33   Populus euphratica
ref|XP_007031193.1|  Uncharacterized protein TCM_026789                 129   2e-33   Theobroma cacao [chocolate]
ref|XP_011023804.1|  PREDICTED: uncharacterized protein LOC105125175    129   3e-33   Populus euphratica
ref|XP_008812285.1|  PREDICTED: uncharacterized protein LOC103723212    129   3e-33   Phoenix dactylifera
ref|XP_008464314.1|  PREDICTED: uncharacterized protein LOC103502227    129   3e-33   
ref|XP_004139521.2|  PREDICTED: uncharacterized protein LOC101214389    128   5e-33   Cucumis sativus [cucumbers]
ref|XP_008787182.1|  PREDICTED: uncharacterized protein LOC103705299    128   6e-33   Phoenix dactylifera
ref|XP_002307069.2|  hypothetical protein POPTR_0005s01470g             129   6e-33   Populus trichocarpa [western balsam poplar]
ref|XP_006415521.1|  hypothetical protein EUTSA_v10009038mg             127   7e-33   
ref|XP_006392412.1|  hypothetical protein EUTSA_v10023729mg             128   8e-33   Eutrema salsugineum [saltwater cress]
gb|KGN65013.1|  hypothetical protein Csa_1G181260                       129   8e-33   Cucumis sativus [cucumbers]
ref|XP_002319476.1|  hypothetical protein POPTR_0013s00850g             128   1e-32   Populus trichocarpa [western balsam poplar]
ref|XP_006302926.1|  hypothetical protein CARUB_v10021064mg             127   1e-32   Capsella rubella
ref|XP_002894658.1|  hypothetical protein ARALYDRAFT_892851             128   1e-32   Arabidopsis lyrata subsp. lyrata
ref|XP_010942811.1|  PREDICTED: uncharacterized protein LOC105060700    126   2e-32   Elaeis guineensis
ref|XP_007163314.1|  hypothetical protein PHAVU_001G224400g             127   2e-32   Phaseolus vulgaris [French bean]
gb|KEH24076.1|  plant/F25P12-18 protein                                 127   2e-32   Medicago truncatula
gb|KJB82664.1|  hypothetical protein B456_013G208000                    127   2e-32   Gossypium raimondii
gb|ACL51741.1|  unknown                                                 126   3e-32   Pinus peuce [Balkan pine]
ref|XP_009337639.1|  PREDICTED: uncharacterized protein LOC103930074    126   3e-32   Pyrus x bretschneideri [bai li]
ref|XP_004494532.1|  PREDICTED: uncharacterized protein LOC101506609    126   3e-32   Cicer arietinum [garbanzo]
gb|ACL51745.1|  unknown                                                 126   3e-32   Pinus strobiformis [Mexican white pine]
gb|ACL51739.1|  unknown                                                 126   3e-32   Pinus lambertiana
emb|CDM82254.1|  unnamed protein product                                126   3e-32   Triticum aestivum [Canadian hard winter wheat]
ref|XP_008246159.1|  PREDICTED: uncharacterized protein LOC103344327    127   4e-32   Prunus mume [ume]
ref|XP_008787183.1|  PREDICTED: uncharacterized protein LOC103705300    125   4e-32   
ref|XP_003593930.1|  hypothetical protein MTR_2g019480                  126   4e-32   
emb|CDX95276.1|  BnaC09g15940D                                          126   4e-32   
emb|CDY57268.1|  BnaA03g59570D                                          125   5e-32   Brassica napus [oilseed rape]
ref|XP_009387207.1|  PREDICTED: uncharacterized protein LOC103974170    125   5e-32   Musa acuminata subsp. malaccensis [pisang utan]
gb|EEE54097.1|  hypothetical protein OsJ_00845                          126   5e-32   Oryza sativa Japonica Group [Japonica rice]
emb|CDY41704.1|  BnaA09g15320D                                          125   7e-32   Brassica napus [oilseed rape]
ref|XP_008370369.1|  PREDICTED: uncharacterized protein LOC103433861    125   7e-32   
gb|EMT25031.1|  hypothetical protein F775_27196                         125   9e-32   
emb|CDY04373.1|  BnaC04g18200D                                          124   1e-31   
ref|XP_010939039.1|  PREDICTED: uncharacterized protein LOC105057984    125   1e-31   
ref|XP_009359546.1|  PREDICTED: uncharacterized protein LOC103950122    125   1e-31   Pyrus x bretschneideri [bai li]
ref|XP_010511299.1|  PREDICTED: uncharacterized protein LOC104787...    125   1e-31   
gb|KFK44826.1|  hypothetical protein AALP_AA1G307800                    124   1e-31   Arabis alpina [alpine rockcress]
emb|CDP12223.1|  unnamed protein product                                124   1e-31   Coffea canephora [robusta coffee]
ref|XP_008388456.1|  PREDICTED: uncharacterized protein At5g01610...    125   1e-31   
ref|XP_008239225.1|  PREDICTED: uncharacterized protein LOC103337838    124   1e-31   Prunus mume [ume]
gb|KFK22546.1|  hypothetical protein AALP_AAs68488U000700               125   1e-31   Arabis alpina [alpine rockcress]
ref|NP_564720.1|  protein SMALLER WITH VARIABLE BRANCHES                125   1e-31   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009113380.1|  PREDICTED: uncharacterized protein LOC103838680    124   1e-31   Brassica rapa
ref|XP_008791617.1|  PREDICTED: uncharacterized protein LOC103708464    124   2e-31   Phoenix dactylifera
ref|NP_001238325.1|  uncharacterized protein LOC100306660               124   2e-31   
ref|XP_007209730.1|  hypothetical protein PRUPE_ppa012800mg             124   2e-31   Prunus persica
ref|XP_009373308.1|  PREDICTED: uncharacterized protein LOC103962334    124   3e-31   Pyrus x bretschneideri [bai li]
ref|XP_008374117.1|  PREDICTED: uncharacterized protein LOC103437424    124   3e-31   
ref|XP_010100195.1|  hypothetical protein L484_015340                   124   3e-31   Morus notabilis
gb|ERM99857.1|  hypothetical protein AMTR_s00098p00138460               124   3e-31   Amborella trichopoda
gb|KCW77320.1|  hypothetical protein EUGRSUZ_D01682                     123   4e-31   Eucalyptus grandis [rose gum]
ref|XP_010676901.1|  PREDICTED: uncharacterized protein LOC104892619    124   4e-31   Beta vulgaris subsp. vulgaris [field beet]
emb|CDY48399.1|  BnaAnng09680D                                          124   4e-31   Brassica napus [oilseed rape]
ref|XP_004230326.1|  PREDICTED: uncharacterized protein LOC101254945    124   4e-31   Solanum lycopersicum
gb|KJB66925.1|  hypothetical protein B456_010G166200                    123   5e-31   Gossypium raimondii
ref|XP_004309540.1|  PREDICTED: uncharacterized protein LOC101304828    123   5e-31   Fragaria vesca subsp. vesca
ref|XP_008381148.1|  PREDICTED: uncharacterized protein LOC103444018    125   5e-31   
ref|XP_011022420.1|  PREDICTED: uncharacterized protein LOC105124204    123   6e-31   Populus euphratica
ref|XP_007154458.1|  hypothetical protein PHAVU_003G120900g             123   6e-31   Phaseolus vulgaris [French bean]
ref|XP_008450533.1|  PREDICTED: uncharacterized protein LOC103492107    122   6e-31   Cucumis melo [Oriental melon]
ref|XP_010053069.1|  PREDICTED: uncharacterized protein LOC104441615    124   6e-31   Eucalyptus grandis [rose gum]
ref|XP_007206043.1|  hypothetical protein PRUPE_ppa012574mg             123   7e-31   Prunus persica
ref|XP_002893596.1|  hypothetical protein ARALYDRAFT_473221             123   7e-31   
ref|XP_010251568.1|  PREDICTED: uncharacterized protein LOC104593432    123   7e-31   Nelumbo nucifera [Indian lotus]
ref|XP_006597916.1|  PREDICTED: uncharacterized protein LOC100790662    123   7e-31   Glycine max [soybeans]
ref|XP_011621057.1|  PREDICTED: uncharacterized protein LOC18427898     124   7e-31   Amborella trichopoda
gb|KJB27384.1|  hypothetical protein B456_004G235700                    123   8e-31   Gossypium raimondii
ref|XP_009590351.1|  PREDICTED: uncharacterized protein LOC104087549    121   8e-31   
ref|NP_001145528.1|  uncharacterized protein LOC100278952               122   8e-31   Zea mays [maize]
ref|XP_008806722.1|  PREDICTED: uncharacterized protein LOC103719312    122   1e-30   Phoenix dactylifera
ref|XP_004135756.2|  PREDICTED: uncharacterized protein LOC101222618    122   1e-30   Cucumis sativus [cucumbers]
ref|XP_009587678.1|  PREDICTED: uncharacterized protein LOC104085371    122   1e-30   
gb|KJB76944.1|  hypothetical protein B456_012G113800                    122   1e-30   Gossypium raimondii
ref|XP_006344788.1|  PREDICTED: uncharacterized protein LOC102588001    122   1e-30   Solanum tuberosum [potatoes]
ref|XP_009358708.1|  PREDICTED: uncharacterized protein LOC103949313    122   1e-30   Pyrus x bretschneideri [bai li]
ref|XP_006305687.1|  hypothetical protein CARUB_v10010410mg             122   1e-30   Capsella rubella
ref|XP_009762642.1|  PREDICTED: uncharacterized protein LOC104214639    122   1e-30   Nicotiana sylvestris
ref|NP_001240904.1|  uncharacterized protein LOC100800384               122   2e-30   Glycine max [soybeans]
ref|XP_012088865.1|  PREDICTED: uncharacterized protein LOC105647410    122   2e-30   Jatropha curcas
gb|KHN03236.1|  hypothetical protein glysoja_004262                     122   2e-30   Glycine soja [wild soybean]
ref|NP_001235186.1|  uncharacterized protein LOC100527887               122   2e-30   Glycine max [soybeans]
ref|XP_008390274.1|  PREDICTED: uncharacterized protein LOC103452555    122   2e-30   
ref|XP_011087501.1|  PREDICTED: uncharacterized protein LOC105168965    122   2e-30   Sesamum indicum [beniseed]
ref|XP_009592625.1|  PREDICTED: uncharacterized protein LOC104089434    122   2e-30   Nicotiana tomentosiformis
ref|XP_002512532.1|  conserved hypothetical protein                     121   3e-30   Ricinus communis
gb|EAY93117.1|  hypothetical protein OsI_14920                          120   3e-30   Oryza sativa Indica Group [Indian rice]
ref|XP_008370600.1|  PREDICTED: uncharacterized protein LOC103434068    120   3e-30   
gb|AFK47875.1|  unknown                                                 121   3e-30   Lotus japonicus
ref|XP_012075841.1|  PREDICTED: uncharacterized protein LOC105637055    121   3e-30   Jatropha curcas
gb|KDP31592.1|  hypothetical protein JCGZ_14817                         121   3e-30   Jatropha curcas
ref|XP_004230325.1|  PREDICTED: uncharacterized protein LOC101254641    121   3e-30   Solanum lycopersicum
ref|XP_009391989.1|  PREDICTED: uncharacterized protein LOC103978016    121   4e-30   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_012079750.1|  PREDICTED: uncharacterized protein LOC105640135    120   5e-30   
ref|XP_006439228.1|  hypothetical protein CICLE_v10022654mg             120   5e-30   Citrus clementina [clementine]
ref|XP_007039397.1|  Uncharacterized protein TCM_015652                 120   5e-30   Theobroma cacao [chocolate]
ref|NP_001237907.1|  uncharacterized protein LOC100500427               121   5e-30   
ref|XP_006476294.1|  PREDICTED: uncharacterized protein LOC102610275    120   6e-30   Citrus sinensis [apfelsine]
gb|KHN16045.1|  hypothetical protein glysoja_012021                     121   6e-30   Glycine soja [wild soybean]
gb|EPS61878.1|  hypothetical protein M569_12921                         121   6e-30   Genlisea aurea
ref|XP_010919343.1|  PREDICTED: uncharacterized protein LOC105043480    120   6e-30   Elaeis guineensis
emb|CDY35265.1|  BnaC03g59580D                                          120   6e-30   Brassica napus [oilseed rape]
ref|XP_010931782.1|  PREDICTED: uncharacterized protein LOC105052617    120   7e-30   Elaeis guineensis
ref|XP_010458213.1|  PREDICTED: uncharacterized protein LOC104739524    120   8e-30   Camelina sativa [gold-of-pleasure]
gb|KFK43228.1|  hypothetical protein AALP_AA1G096900                    120   8e-30   Arabis alpina [alpine rockcress]
ref|XP_004230327.1|  PREDICTED: uncharacterized protein LOC101255245    120   8e-30   Solanum lycopersicum
ref|XP_002299430.1|  hypothetical protein POPTR_0001s11330g             120   9e-30   Populus trichocarpa [western balsam poplar]
emb|CDP15235.1|  unnamed protein product                                121   9e-30   Coffea canephora [robusta coffee]
ref|XP_010489912.1|  PREDICTED: uncharacterized protein LOC104767609    120   9e-30   Camelina sativa [gold-of-pleasure]
ref|XP_010475761.1|  PREDICTED: uncharacterized protein LOC104755121    120   1e-29   Camelina sativa [gold-of-pleasure]
emb|CBI34584.3|  unnamed protein product                                119   1e-29   Vitis vinifera
ref|XP_006849141.1|  PREDICTED: uncharacterized protein LOC18438902     119   1e-29   Amborella trichopoda
ref|XP_006494161.1|  PREDICTED: uncharacterized protein LOC102611559    119   2e-29   Citrus sinensis [apfelsine]
ref|XP_002436868.1|  hypothetical protein SORBIDRAFT_10g010350          119   2e-29   Sorghum bicolor [broomcorn]
ref|XP_006344787.1|  PREDICTED: uncharacterized protein LOC102587682    119   2e-29   Solanum tuberosum [potatoes]
ref|XP_006663024.1|  PREDICTED: uncharacterized protein At5g01610...    118   2e-29   Oryza brachyantha
ref|XP_002280209.2|  PREDICTED: uncharacterized protein LOC100242761    119   2e-29   Vitis vinifera
ref|XP_011016768.1|  PREDICTED: uncharacterized protein LOC105120295    119   3e-29   Populus euphratica
gb|AFK38639.1|  unknown                                                 119   3e-29   Lotus japonicus
ref|XP_010549370.1|  PREDICTED: uncharacterized protein LOC104820575    118   4e-29   Tarenaya hassleriana [spider flower]
ref|XP_009779474.1|  PREDICTED: uncharacterized protein LOC104228662    118   5e-29   Nicotiana sylvestris
ref|XP_004495638.1|  PREDICTED: uncharacterized protein LOC101504472    119   6e-29   
ref|XP_006417585.1|  hypothetical protein EUTSA_v10008903mg             118   7e-29   Eutrema salsugineum [saltwater cress]
ref|XP_006343785.1|  PREDICTED: uncharacterized protein LOC102590070    117   8e-29   Solanum tuberosum [potatoes]
ref|XP_010553713.1|  PREDICTED: uncharacterized protein LOC104823717    118   8e-29   Tarenaya hassleriana [spider flower]
ref|XP_002303689.2|  hypothetical protein POPTR_0003s14640g             117   9e-29   Populus trichocarpa [western balsam poplar]
ref|XP_002459251.1|  hypothetical protein SORBIDRAFT_02g001300          117   9e-29   Sorghum bicolor [broomcorn]
ref|XP_009785769.1|  PREDICTED: uncharacterized protein LOC104233984    117   9e-29   Nicotiana sylvestris
gb|ABK26118.1|  unknown                                                 117   1e-28   Picea sitchensis
ref|XP_010325320.1|  PREDICTED: uncharacterized protein LOC101265050    117   1e-28   
ref|XP_011083692.1|  PREDICTED: uncharacterized protein LOC105166144    117   1e-28   Sesamum indicum [beniseed]
ref|XP_008651952.1|  PREDICTED: uncharacterized protein At5g01610...    117   1e-28   Zea mays [maize]
ref|XP_010267907.1|  PREDICTED: uncharacterized protein LOC104605016    117   1e-28   Nelumbo nucifera [Indian lotus]
ref|XP_010267906.1|  PREDICTED: uncharacterized protein LOC104605015    117   1e-28   Nelumbo nucifera [Indian lotus]
ref|XP_009122971.1|  PREDICTED: uncharacterized protein LOC103847637    119   1e-28   Brassica rapa
ref|XP_010933783.1|  PREDICTED: uncharacterized protein LOC105054081    116   1e-28   Elaeis guineensis
ref|XP_009625130.1|  PREDICTED: uncharacterized protein LOC104116057    117   2e-28   Nicotiana tomentosiformis
ref|XP_004300077.1|  PREDICTED: uncharacterized protein LOC101307015    117   2e-28   Fragaria vesca subsp. vesca
ref|XP_009625577.1|  PREDICTED: uncharacterized protein LOC104116431    116   2e-28   Nicotiana tomentosiformis
gb|EMT12013.1|  hypothetical protein F775_21027                         116   2e-28   
ref|XP_006413471.1|  hypothetical protein EUTSA_v10026459mg             116   2e-28   Eutrema salsugineum [saltwater cress]
ref|NP_001145335.1|  uncharacterized protein LOC100278663               116   2e-28   
ref|XP_002459252.1|  hypothetical protein SORBIDRAFT_02g001340          116   2e-28   
ref|XP_008805688.1|  PREDICTED: uncharacterized protein LOC103718577    115   2e-28   Phoenix dactylifera
ref|XP_009396409.1|  PREDICTED: uncharacterized protein LOC103981406    115   2e-28   Musa acuminata subsp. malaccensis [pisang utan]
gb|KFK28977.1|  hypothetical protein AALP_AA7G072700                    116   2e-28   Arabis alpina [alpine rockcress]
gb|EAY93119.1|  hypothetical protein OsI_14922                          116   2e-28   Oryza sativa Indica Group [Indian rice]
ref|XP_002889742.1|  hypothetical protein ARALYDRAFT_471022             117   2e-28   Arabidopsis lyrata subsp. lyrata
ref|XP_008651953.1|  PREDICTED: uncharacterized protein LOC103631895    115   2e-28   Zea mays [maize]
ref|XP_010931781.1|  PREDICTED: uncharacterized protein LOC105052616    116   3e-28   Elaeis guineensis
ref|NP_194144.1|  uncharacterized protein                               116   3e-28   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009785768.1|  PREDICTED: uncharacterized protein LOC104233983    115   3e-28   Nicotiana sylvestris
ref|XP_010270851.1|  PREDICTED: uncharacterized protein LOC104607056    116   3e-28   Nelumbo nucifera [Indian lotus]
ref|NP_563841.1|  uncharacterized protein                               116   4e-28   
ref|XP_004955755.1|  PREDICTED: uncharacterized protein At5g01610...    115   4e-28   
ref|XP_010024143.1|  PREDICTED: uncharacterized protein LOC104414683    115   4e-28   
ref|XP_004488198.1|  PREDICTED: uncharacterized protein LOC101503249    115   5e-28   
ref|NP_001068207.1|  Os11g0594800                                       115   5e-28   
ref|XP_002461349.1|  hypothetical protein SORBIDRAFT_02g001370          115   5e-28   
ref|XP_002461346.1|  hypothetical protein SORBIDRAFT_02g001320          114   6e-28   
ref|XP_010267908.1|  PREDICTED: uncharacterized protein LOC104605017    115   7e-28   
ref|XP_004955753.1|  PREDICTED: uncharacterized protein At5g01610...    114   8e-28   
ref|XP_002869736.1|  hypothetical protein ARALYDRAFT_492450             114   8e-28   
ref|NP_001068206.1|  Os11g0594700                                       114   8e-28   
ref|XP_004955757.1|  PREDICTED: uncharacterized protein At5g01610...    114   9e-28   
ref|XP_002436874.1|  hypothetical protein SORBIDRAFT_10g010410          114   1e-27   
ref|XP_004309754.1|  PREDICTED: uncharacterized protein LOC101308632    114   1e-27   
ref|XP_004955759.1|  PREDICTED: uncharacterized protein At5g01610...    114   1e-27   
gb|EAY81537.1|  hypothetical protein OsI_36705                          114   1e-27   
gb|ADB08691.1|  hypothetical protein                                    114   1e-27   
ref|XP_004302285.1|  PREDICTED: uncharacterized protein LOC101303238    114   1e-27   
ref|XP_008668767.1|  PREDICTED: uncharacterized protein At5g01610...    113   2e-27   
gb|ACJ83938.1|  unknown                                                 114   2e-27   
ref|XP_004955760.1|  PREDICTED: uncharacterized protein At5g01610...    113   2e-27   
ref|XP_004142271.1|  PREDICTED: uncharacterized protein LOC101204611    114   2e-27   
gb|KJB39567.1|  hypothetical protein B456_007G019900                    113   3e-27   
gb|ACJ85881.1|  unknown                                                 114   3e-27   
ref|XP_010448606.1|  PREDICTED: uncharacterized protein LOC104731048    113   4e-27   
ref|XP_008810716.1|  PREDICTED: uncharacterized protein LOC103722061    113   4e-27   
ref|XP_008464697.1|  PREDICTED: uncharacterized protein LOC103502519    113   4e-27   
ref|XP_004955754.1|  PREDICTED: uncharacterized protein LOC101775737    112   4e-27   
ref|XP_004987349.1|  PREDICTED: uncharacterized protein At5g01610...    112   4e-27   
ref|XP_002459601.1|  hypothetical protein SORBIDRAFT_02g007360          112   7e-27   
ref|XP_004955752.1|  PREDICTED: uncharacterized protein LOC101774918    112   7e-27   
ref|XP_004987348.1|  PREDICTED: uncharacterized protein At5g01610...    112   8e-27   
ref|XP_008437444.1|  PREDICTED: uncharacterized protein LOC103482858    112   8e-27   
ref|XP_006663023.1|  PREDICTED: uncharacterized protein At5g01610...    111   1e-26   
ref|XP_009385668.1|  PREDICTED: uncharacterized protein LOC103972968    111   1e-26   
ref|XP_002436872.1|  hypothetical protein SORBIDRAFT_10g010390          111   1e-26   
ref|XP_010497714.1|  PREDICTED: uncharacterized protein LOC104775174    111   1e-26   
ref|XP_004965548.1|  PREDICTED: uncharacterized protein LOC101774859    112   1e-26   
ref|XP_008453262.1|  PREDICTED: uncharacterized protein LOC103494033    112   1e-26   
ref|XP_010544156.1|  PREDICTED: uncharacterized protein LOC104816860    112   1e-26   
ref|XP_010938951.1|  PREDICTED: uncharacterized protein LOC105057926    111   1e-26   
ref|XP_004302286.1|  PREDICTED: uncharacterized protein LOC101303527    111   1e-26   
ref|XP_004982126.1|  PREDICTED: uncharacterized protein At5g01610...    111   1e-26   
ref|XP_011648877.1|  PREDICTED: uncharacterized protein LOC105434559    112   2e-26   
emb|CDY31099.1|  BnaA08g26490D                                          111   2e-26   
gb|ACJ86165.1|  unknown                                                 111   2e-26   
gb|EMS57683.1|  hypothetical protein TRIUR3_00883                       110   2e-26   
ref|XP_010538857.1|  PREDICTED: uncharacterized protein LOC104813059    110   2e-26   
ref|XP_010942812.1|  PREDICTED: uncharacterized protein LOC105060702    110   2e-26   
ref|XP_008668768.1|  PREDICTED: uncharacterized protein LOC103645825    110   2e-26   
gb|KJB76945.1|  hypothetical protein B456_012G113900                    110   3e-26   
ref|XP_010942814.1|  PREDICTED: uncharacterized protein LOC105060704    110   3e-26   
ref|XP_004955758.1|  PREDICTED: uncharacterized protein At5g01610...    110   3e-26   
ref|XP_006284668.1|  hypothetical protein CARUB_v10005927mg             110   3e-26   
ref|XP_010942810.1|  PREDICTED: uncharacterized protein LOC105060699    110   4e-26   
gb|ACG39481.1|  hypothetical protein                                    110   4e-26   
ref|XP_009387582.1|  PREDICTED: uncharacterized protein LOC103974463    110   4e-26   
ref|XP_008805687.1|  PREDICTED: uncharacterized protein LOC103718576    110   4e-26   
ref|XP_004143841.2|  PREDICTED: uncharacterized protein LOC101223048    110   4e-26   
gb|ACG31943.1|  hypothetical protein                                    110   5e-26   
ref|NP_001143526.1|  uncharacterized protein LOC100276213               110   5e-26   
ref|WP_039311077.1|  hypothetical protein                               110   6e-26   
ref|XP_003577394.1|  PREDICTED: uncharacterized protein LOC100846036    109   6e-26   
gb|ACG34341.1|  hypothetical protein                                    110   6e-26   
ref|XP_002436873.1|  hypothetical protein SORBIDRAFT_10g010400          109   6e-26   
emb|CDX93512.1|  BnaA06g05360D                                          109   7e-26   
gb|AEC10970.1|  hypothetical protein                                    110   7e-26   
emb|CDX92616.1|  BnaC07g38740D                                          109   7e-26   
ref|XP_008805686.1|  PREDICTED: uncharacterized protein LOC103718575    109   8e-26   
ref|XP_010942817.1|  PREDICTED: uncharacterized protein LOC105060706    108   9e-26   
emb|CDY10988.1|  BnaA03g46470D                                          109   9e-26   
ref|XP_002438509.1|  hypothetical protein SORBIDRAFT_10g021150          109   1e-25   
ref|XP_009397517.1|  PREDICTED: uncharacterized protein LOC103982339    109   1e-25   
ref|XP_009416261.1|  PREDICTED: uncharacterized protein LOC103996921    108   1e-25   
ref|NP_001068208.1|  Os11g0595000                                       108   1e-25   
ref|XP_010439082.1|  PREDICTED: uncharacterized protein LOC104722586    108   1e-25   
ref|XP_008668769.1|  PREDICTED: uncharacterized protein LOC103645826    108   1e-25   
ref|XP_007145016.1|  hypothetical protein PHAVU_007G202800g             110   1e-25   
ref|XP_002459600.1|  hypothetical protein SORBIDRAFT_02g007350          108   2e-25   
emb|CDY32168.1|  BnaCnng06770D                                          108   2e-25   
ref|XP_009148182.1|  PREDICTED: uncharacterized protein LOC103871657    109   2e-25   
ref|XP_006488797.1|  PREDICTED: uncharacterized protein LOC102606701    108   2e-25   
ref|XP_010433811.1|  PREDICTED: uncharacterized protein LOC104717872    108   2e-25   
gb|ABK26749.1|  unknown                                                 108   2e-25   
ref|XP_009137419.1|  PREDICTED: uncharacterized protein LOC103861464    108   3e-25   
gb|EMT12017.1|  hypothetical protein F775_21028                         107   3e-25   
ref|XP_012084132.1|  PREDICTED: uncharacterized protein LOC105643581    108   3e-25   
ref|XP_010558945.1|  PREDICTED: uncharacterized protein LOC104827471    107   5e-25   
ref|XP_003577396.1|  PREDICTED: uncharacterized protein LOC100846648    107   5e-25   
dbj|BAK03707.1|  predicted protein                                      106   6e-25   
ref|XP_004136119.1|  PREDICTED: uncharacterized protein LOC101210896    106   7e-25   
ref|XP_009110834.1|  PREDICTED: uncharacterized protein LOC103836340    107   7e-25   
gb|EAY93120.1|  hypothetical protein OsI_14923                          106   8e-25   
ref|XP_010674563.1|  PREDICTED: uncharacterized protein LOC104890684    107   9e-25   
ref|XP_004494533.1|  PREDICTED: uncharacterized protein LOC101506943    106   9e-25   
gb|KDP27963.1|  hypothetical protein JCGZ_19043                         107   1e-24   
ref|XP_011096436.1|  PREDICTED: uncharacterized protein LOC105175631    105   1e-24   
ref|XP_009137720.1|  PREDICTED: uncharacterized protein LOC103861763    106   1e-24   
ref|XP_004962756.1|  PREDICTED: uncharacterized protein LOC101765121    108   1e-24   
gb|EMT12014.1|  hypothetical protein F775_32388                         105   2e-24   
ref|XP_011085250.1|  PREDICTED: uncharacterized protein LOC105167294    105   2e-24   
emb|CDY34258.1|  BnaA01g13610D                                          106   2e-24   
ref|XP_004987351.1|  PREDICTED: uncharacterized protein LOC101773675    105   2e-24   
ref|XP_009386146.1|  PREDICTED: uncharacterized protein LOC103973334    105   2e-24   
gb|EAY79214.1|  hypothetical protein OsI_34330                          106   3e-24   
gb|KHN09885.1|  hypothetical protein glysoja_034675                     105   3e-24   
emb|CDM80994.1|  unnamed protein product                                104   3e-24   
gb|EMT29008.1|  hypothetical protein F775_29518                         107   3e-24   
emb|CDY03486.1|  BnaC01g15960D                                          105   3e-24   
ref|XP_008801739.1|  PREDICTED: uncharacterized protein LOC103715769    105   3e-24   
dbj|BAK08009.1|  predicted protein                                      104   3e-24   
ref|XP_010549621.1|  PREDICTED: uncharacterized protein LOC104820744    105   3e-24   
ref|NP_001067038.1|  Os12g0563600                                       106   4e-24   
gb|EEE51270.1|  hypothetical protein OsJ_32168                          105   4e-24   
ref|XP_003577232.1|  PREDICTED: uncharacterized protein LOC100821439    105   6e-24   
ref|XP_008674333.1|  PREDICTED: uncharacterized protein LOC103650536    106   6e-24   
ref|NP_001143412.1|  uncharacterized protein LOC100276059               105   6e-24   
ref|XP_002519273.1|  conserved hypothetical protein                     105   6e-24   
ref|XP_008461296.1|  PREDICTED: uncharacterized protein LOC103499927    103   6e-24   
gb|EMT26540.1|  hypothetical protein F775_29153                         104   8e-24   
gb|EMS57685.1|  hypothetical protein TRIUR3_00885                       103   9e-24   
ref|XP_006419315.1|  hypothetical protein CICLE_v10006457mg             104   1e-23   
gb|EMS57686.1|  hypothetical protein TRIUR3_00886                       103   1e-23   
ref|XP_010480396.1|  PREDICTED: uncharacterized protein LOC104759127    102   1e-23   
ref|NP_174295.1|  uncharacterized protein                               103   2e-23   
ref|XP_008786193.1|  PREDICTED: uncharacterized protein At5g01610...    102   2e-23   
gb|EAY83530.1|  hypothetical protein OsI_38742                          104   2e-23   
ref|XP_010058859.1|  PREDICTED: uncharacterized protein LOC104446737    101   2e-23   
gb|EMS58436.1|  hypothetical protein TRIUR3_29795                       103   3e-23   
ref|XP_010938953.1|  PREDICTED: uncharacterized protein LOC105057928    102   3e-23   
ref|XP_011087012.1|  PREDICTED: uncharacterized protein LOC105168575    102   3e-23   
ref|XP_006306280.1|  hypothetical protein CARUB_v10012142mg             102   3e-23   
ref|XP_010541852.1|  PREDICTED: uncharacterized protein LOC104815231    102   3e-23   
ref|XP_002464366.1|  hypothetical protein SORBIDRAFT_01g017040          103   4e-23   
ref|XP_006664106.1|  PREDICTED: uncharacterized protein LOC102722168    103   4e-23   
gb|ABK25654.1|  unknown                                                 102   4e-23   
gb|EMT33149.1|  hypothetical protein F775_32074                         101   4e-23   
ref|XP_009387836.1|  PREDICTED: uncharacterized protein LOC103974687    102   4e-23   
ref|XP_004305297.1|  PREDICTED: uncharacterized protein LOC101295644    102   5e-23   
gb|EYU43047.1|  hypothetical protein MIMGU_mgv1a015550mg                102   5e-23   
ref|XP_009109628.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    101   6e-23   
gb|EMT12015.1|  hypothetical protein F775_32389                         101   6e-23   
ref|XP_003579179.1|  PREDICTED: uncharacterized protein LOC100828948    103   7e-23   
ref|XP_003568523.1|  PREDICTED: uncharacterized protein LOC100831124    102   7e-23   
gb|EMS55480.1|  hypothetical protein TRIUR3_24884                       102   7e-23   
ref|XP_004982599.1|  PREDICTED: uncharacterized protein LOC101758500    102   7e-23   
gb|EAY81794.1|  hypothetical protein OsI_36966                          102   8e-23   
ref|XP_004979990.1|  PREDICTED: uncharacterized protein LOC101768894    102   8e-23   
gb|EMS57682.1|  hypothetical protein TRIUR3_00882                       101   8e-23   
gb|AEC11001.1|  hypothetical protein                                    100   1e-22   
ref|NP_001068462.2|  Os11g0683600                                       101   1e-22   
ref|XP_002442333.1|  hypothetical protein SORBIDRAFT_08g018350          102   1e-22   
ref|XP_002965522.1|  hypothetical protein SELMODRAFT_143349             100   2e-22   
dbj|BAJ86483.1|  predicted protein                                      100   2e-22   
gb|EMS57687.1|  hypothetical protein TRIUR3_00887                       102   2e-22   
gb|EMT27586.1|  hypothetical protein F775_30615                         100   2e-22   
ref|XP_009759554.1|  PREDICTED: uncharacterized protein LOC104212071  99.8    2e-22   
ref|XP_009352944.1|  PREDICTED: uncharacterized protein LOC103944241  99.8    3e-22   
ref|XP_010549570.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    100   3e-22   
gb|EMS61401.1|  hypothetical protein TRIUR3_30811                       100   3e-22   
ref|XP_007025394.1|  Uncharacterized protein TCM_029706               99.8    3e-22   
ref|XP_006657033.1|  PREDICTED: uncharacterized protein LOC102705262    100   3e-22   
ref|XP_007048680.1|  Uncharacterized protein TCM_001699                 100   4e-22   
ref|XP_009774000.1|  PREDICTED: uncharacterized protein At5g01610...  99.4    4e-22   
gb|EYU43328.1|  hypothetical protein MIMGU_mgv1a021875mg              99.0    5e-22   
ref|XP_006362444.1|  PREDICTED: uncharacterized protein LOC102602677  99.0    5e-22   
ref|XP_010925704.1|  PREDICTED: uncharacterized protein LOC105048185  99.0    5e-22   
gb|KJB68383.1|  hypothetical protein B456_010G242000                  99.0    5e-22   
dbj|BAJ85924.1|  predicted protein                                    99.4    5e-22   
gb|EPS66296.1|  hypothetical protein M569_08484                       99.0    6e-22   
gb|EMT15565.1|  hypothetical protein F775_29361                       99.4    6e-22   
ref|XP_010317431.1|  PREDICTED: uncharacterized protein LOC104646093  98.6    6e-22   
gb|EMS57688.1|  hypothetical protein TRIUR3_00888                     98.6    6e-22   
ref|XP_010267454.1|  PREDICTED: uncharacterized protein LOC104604687  98.6    7e-22   
gb|EMT12016.1|  hypothetical protein F775_32390                       98.6    7e-22   
gb|KCW76115.1|  hypothetical protein EUGRSUZ_D00492                   98.6    7e-22   
ref|XP_002449993.1|  hypothetical protein SORBIDRAFT_05g026800        99.0    9e-22   
ref|XP_006663108.1|  PREDICTED: uncharacterized protein At5g01610...  99.0    1e-21   
ref|XP_006657410.1|  PREDICTED: uncharacterized protein At5g01610...  98.2    1e-21   
ref|XP_006658232.1|  PREDICTED: uncharacterized protein LOC102719220  97.4    2e-21   
gb|EMS45585.1|  hypothetical protein TRIUR3_23886                       100   2e-21   
ref|XP_007035874.1|  Uncharacterized protein TCM_021424               98.2    2e-21   
ref|XP_006852427.1|  PREDICTED: uncharacterized protein LOC18442141   97.1    2e-21   
ref|XP_009352946.1|  PREDICTED: uncharacterized protein LOC103944242  97.1    2e-21   
gb|ADB08697.1|  hypothetical protein                                  97.8    2e-21   
ref|XP_008371715.1|  PREDICTED: uncharacterized protein LOC103435101  97.1    2e-21   
gb|EMT29418.1|  hypothetical protein F775_20164                       97.1    3e-21   
dbj|BAC10820.1|  hypothetical protein                                 96.7    3e-21   
ref|XP_007214707.1|  hypothetical protein PRUPE_ppb018577mg           96.7    3e-21   
ref|XP_001761825.1|  predicted protein                                97.1    4e-21   
ref|XP_004952314.1|  PREDICTED: uncharacterized protein At5g01610...  96.3    5e-21   
ref|XP_007213016.1|  hypothetical protein PRUPE_ppa023017mg           95.9    6e-21   
ref|NP_001058775.1|  Os07g0120100                                     96.3    6e-21   
gb|KJB33220.1|  hypothetical protein B456_006G001600                  95.9    6e-21   
ref|XP_008246275.1|  PREDICTED: uncharacterized protein LOC103344478  94.7    8e-21   
dbj|BAC15899.1|  hypothetical protein                                 95.9    9e-21   
ref|XP_002436871.1|  hypothetical protein SORBIDRAFT_10g010380        95.5    9e-21   
ref|NP_001058773.1|  Os07g0119800                                     95.5    1e-20   
ref|XP_010070407.1|  PREDICTED: uncharacterized protein LOC104457155  95.5    1e-20   
gb|KHN03264.1|  hypothetical protein glysoja_004290                   95.9    1e-20   
ref|XP_008225330.1|  PREDICTED: uncharacterized protein LOC103324985  95.1    1e-20   
ref|NP_001057800.1|  Os06g0538900                                     95.9    1e-20   
ref|XP_006657407.1|  PREDICTED: uncharacterized protein At5g01610...  95.1    1e-20   
ref|XP_006658233.1|  PREDICTED: uncharacterized protein At5g01610...  95.1    1e-20   
ref|XP_003550931.1|  PREDICTED: uncharacterized protein LOC100816575  95.9    1e-20   
ref|XP_008228969.1|  PREDICTED: uncharacterized protein LOC103328354  94.7    1e-20   
gb|KJB28774.1|  hypothetical protein B456_005G068800                  95.9    1e-20   
ref|XP_002447713.1|  hypothetical protein SORBIDRAFT_06g014330        94.7    2e-20   
ref|XP_006446778.1|  hypothetical protein CICLE_v10018346mg           94.4    3e-20   
gb|KHN03925.1|  hypothetical protein glysoja_022611                   94.0    3e-20   
ref|XP_008358705.1|  PREDICTED: uncharacterized protein LOC103422420  94.0    3e-20   
gb|EAZ38523.1|  hypothetical protein OsJ_22910                        95.5    3e-20   
ref|XP_008383878.1|  PREDICTED: uncharacterized protein LOC103446520  93.6    4e-20   
gb|ACU18707.1|  unknown                                               94.4    4e-20   
ref|XP_007213973.1|  hypothetical protein PRUPE_ppa013162mg           93.6    4e-20   
gb|KHN02866.1|  hypothetical protein glysoja_009732                   94.0    5e-20   
ref|XP_003528606.1|  PREDICTED: uncharacterized protein LOC100784975  94.0    5e-20   
dbj|BAC10818.1|  hypothetical protein                                 93.6    6e-20   
gb|ACL51747.1|  unknown                                               92.4    6e-20   
ref|NP_001175027.1|  Os07g0120600                                     93.2    7e-20   
gb|EAZ01248.1|  hypothetical protein OsI_23273                        93.6    8e-20   



>ref|XP_009616644.1| PREDICTED: uncharacterized protein LOC104109132 [Nicotiana tomentosiformis]
Length=140

 Score =   193 bits (491),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 101/135 (75%), Positives = 123/135 (91%), Gaps = 0/135 (0%)
 Frame = +2

Query  80   SQQTAVNHRENAEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVWMkq  259
            S Q + NHRENAEVFTDPA+CKQKSLELLE+I+MP+GLLPLD+ +EVGRN +TGFVW+KQ
Sbjct  2    SSQVSENHRENAEVFTDPAICKQKSLELLEQINMPKGLLPLDDLIEVGRNHQTGFVWLKQ  61

Query  260  kkakehkfkkigkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPDPDAGKI  439
            KKAKEH+FKKIGKLVWYDTEVTAF+EDRR+K LTGVKSKE+L+WVT++ ISI DP+  KI
Sbjct  62   KKAKEHRFKKIGKLVWYDTEVTAFIEDRRMKKLTGVKSKEILIWVTISDISIQDPEFQKI  121

Query  440  NFSTPAGLSRSYPVS  484
             F+TP G+S+++PVS
Sbjct  122  TFATPTGISKAFPVS  136



>ref|XP_009617920.1| PREDICTED: uncharacterized protein LOC104110180 [Nicotiana tomentosiformis]
Length=147

 Score =   193 bits (490),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 106/137 (77%), Positives = 123/137 (90%), Gaps = 0/137 (0%)
 Frame = +2

Query  74   MSSQQTAVNHRENAEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVWM  253
            M+++Q   N RENAEV+TDP +CKQKSLELL+EI+MP GLLPLD+ +EVGRN+ETGFVW+
Sbjct  1    MATRQVIENQRENAEVYTDPVMCKQKSLELLKEINMPNGLLPLDDILEVGRNKETGFVWL  60

Query  254  kqkkakehkfkkigkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPDPDAG  433
            KQKKAKEHKFKKIGKLVWYDTEVTA VEDRR+K LTGVKSKELL+WVTL+ ISI DP+  
Sbjct  61   KQKKAKEHKFKKIGKLVWYDTEVTAIVEDRRMKKLTGVKSKELLIWVTLSDISIQDPEFK  120

Query  434  KINFSTPAGLSRSYPVS  484
            KI F+TPAGLSR+YPVS
Sbjct  121  KITFATPAGLSRAYPVS  137



>ref|XP_009780123.1| PREDICTED: uncharacterized protein LOC104229222 [Nicotiana sylvestris]
Length=153

 Score =   193 bits (490),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 105/137 (77%), Positives = 122/137 (89%), Gaps = 0/137 (0%)
 Frame = +2

Query  74   MSSQQTAVNHRENAEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVWM  253
            M++Q    N RENAEV+TDP +CKQKSLELL+EI+MP GLLPLD+ +EVGRN+ETGFVW+
Sbjct  1    MATQLVIENQRENAEVYTDPVICKQKSLELLKEINMPNGLLPLDDILEVGRNKETGFVWL  60

Query  254  kqkkakehkfkkigkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPDPDAG  433
            KQKKAKEHKFKKIGKLVWYDTEVTA V+DRR+K LTGVKSKELL+WVTL+ ISI DP+  
Sbjct  61   KQKKAKEHKFKKIGKLVWYDTEVTAIVQDRRMKKLTGVKSKELLIWVTLSDISIQDPECK  120

Query  434  KINFSTPAGLSRSYPVS  484
            KI F+TPAGLSR+YPVS
Sbjct  121  KITFATPAGLSRAYPVS  137



>ref|XP_004233121.2| PREDICTED: uncharacterized protein LOC101247392 [Solanum lycopersicum]
Length=176

 Score =   192 bits (487),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 102/133 (77%), Positives = 120/133 (90%), Gaps = 0/133 (0%)
 Frame = +2

Query  86   QTAVNHRENAEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVWMkqkk  265
            Q   +HRENAE++TDP VCKQKSLELL+EI+MP GLLPL++ VEVGRN ETGFVW+KQKK
Sbjct  32   QVIASHRENAEIYTDPVVCKQKSLELLKEINMPNGLLPLEDIVEVGRNAETGFVWLKQKK  91

Query  266  akehkfkkigkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPDPDAGKINF  445
            AKEHK+KKIGKLVWYDTEVTAFVE+RR+K LTGVKSKE+L+WVT++ ISI DP+  KINF
Sbjct  92   AKEHKYKKIGKLVWYDTEVTAFVENRRMKKLTGVKSKEILIWVTISDISISDPECKKINF  151

Query  446  STPAGLSRSYPVS  484
            +TP GLSRS+PVS
Sbjct  152  ATPTGLSRSFPVS  164



>ref|XP_009770732.1| PREDICTED: uncharacterized protein LOC104221363 [Nicotiana sylvestris]
Length=171

 Score =   190 bits (483),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 106/152 (70%), Positives = 128/152 (84%), Gaps = 4/152 (3%)
 Frame = +2

Query  38   NLFPLQSTIKL---KMSSQQTAVNHRENAEVFTDPAVCKQKSLELLEEIHMPRGLLPLDE  208
            NL P+         KMSSQ T  NHRENAEVFTDPA+CKQKSLELLE+ +MP+GLLPLD+
Sbjct  17   NLIPISFPFSFAFTKMSSQVTE-NHRENAEVFTDPAICKQKSLELLEQNNMPKGLLPLDD  75

Query  209  YVEVGRNRETGFVWMkqkkakehkfkkigkLVWYDTEVTAFVEDRRLKHLTGVKSKELLL  388
             +EVGRN +TGFVW+KQKKAKEH+FKKIGKLVWYDTEVTAF+EDRR+K LTGVKSKE+L+
Sbjct  76   LIEVGRNHQTGFVWLKQKKAKEHRFKKIGKLVWYDTEVTAFIEDRRMKKLTGVKSKEILI  135

Query  389  WVTLTHISIPDPDAGKINFSTPAGLSRSYPVS  484
            WVT++ I I DP+  KI F+TP G+S+++PVS
Sbjct  136  WVTISDIYIQDPEFQKITFATPTGISKAFPVS  167



>ref|XP_006352968.1| PREDICTED: uncharacterized protein LOC102584190 [Solanum tuberosum]
Length=146

 Score =   187 bits (476),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 101/133 (76%), Positives = 119/133 (89%), Gaps = 0/133 (0%)
 Frame = +2

Query  86   QTAVNHRENAEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVWMkqkk  265
            Q   +HRENAEV+TDP VCKQKSLELL+EI+MP GLLPL++ VEVGRN ETGFVW+KQKK
Sbjct  3    QVIASHRENAEVYTDPVVCKQKSLELLKEINMPNGLLPLEDIVEVGRNAETGFVWLKQKK  62

Query  266  akehkfkkigkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPDPDAGKINF  445
            AKEHK+KKIGKLVWYDTEVTAFVE+RR+K LTGVKSKE+L+WVT++ I+I DP+  KINF
Sbjct  63   AKEHKYKKIGKLVWYDTEVTAFVENRRMKKLTGVKSKEILIWVTISDITISDPECKKINF  122

Query  446  STPAGLSRSYPVS  484
            +TP GLSRS+P S
Sbjct  123  ATPTGLSRSFPAS  135



>ref|XP_011096558.1| PREDICTED: uncharacterized protein LOC105175709 [Sesamum indicum]
Length=148

 Score =   179 bits (453),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 90/135 (67%), Positives = 113/135 (84%), Gaps = 0/135 (0%)
 Frame = +2

Query  80   SQQTAVNHRENAEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVWMkq  259
            S Q   +HRENAE++T  A+CKQKSLELL++I++P+GLLPLD+ +EVG N  TGFVW++Q
Sbjct  2    SSQIIESHRENAEIYTGDAICKQKSLELLQKINLPKGLLPLDDIIEVGHNESTGFVWLRQ  61

Query  260  kkakehkfkkigkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPDPDAGKI  439
            KK+K H F+ IG+ VWYDTEVTAFVEDRR+K L GVKSKELL+WVT++ ISI DP +GKI
Sbjct  62   KKSKTHVFRAIGRSVWYDTEVTAFVEDRRMKRLKGVKSKELLIWVTISDISIQDPSSGKI  121

Query  440  NFSTPAGLSRSYPVS  484
             F TP G+SRS+PVS
Sbjct  122  TFGTPTGISRSFPVS  136



>ref|XP_004244804.1| PREDICTED: uncharacterized protein LOC101267040 [Solanum lycopersicum]
Length=140

 Score =   176 bits (447),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 94/137 (69%), Positives = 119/137 (87%), Gaps = 1/137 (1%)
 Frame = +2

Query  74   MSSQQTAVNHRENAEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVWM  253
            MSSQ T  N RENAE+FT P +CKQKS +LLE+I+MP+GLLPLD+ +E+G N++TGFVW+
Sbjct  1    MSSQVTE-NQRENAEIFTGPTICKQKSQQLLEQINMPKGLLPLDDLIEIGHNKQTGFVWL  59

Query  254  kqkkakehkfkkigkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPDPDAG  433
            KQKKAKE++FKKIGKLVWYDTEVT F+EDRR+K LTGVKSKELL+WVT++ ISI   D  
Sbjct  60   KQKKAKENRFKKIGKLVWYDTEVTGFLEDRRMKKLTGVKSKELLIWVTISDISIQVSDLE  119

Query  434  KINFSTPAGLSRSYPVS  484
            KI F+TP+G+S+++PVS
Sbjct  120  KITFATPSGISKAFPVS  136



>emb|CDP19745.1| unnamed protein product [Coffea canephora]
Length=147

 Score =   174 bits (442),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 88/137 (64%), Positives = 112/137 (82%), Gaps = 0/137 (0%)
 Frame = +2

Query  74   MSSQQTAVNHRENAEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVWM  253
            MSSQQ    H+ENA+++TDP++CK KS ELLE+I++PRGLLPLD+ VEVG N  TGFVW+
Sbjct  1    MSSQQLVETHKENAQIYTDPSLCKVKSKELLEKINLPRGLLPLDDVVEVGYNESTGFVWL  60

Query  254  kqkkakehkfkkigkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPDPDAG  433
            KQKK K+H+F  I + V YDT +TAF+EDRR+K LTGVKSKEL +WVT++ ISI DP + 
Sbjct  61   KQKKQKQHRFSAISRNVSYDTNITAFIEDRRMKRLTGVKSKELFIWVTISEISIQDPSSQ  120

Query  434  KINFSTPAGLSRSYPVS  484
            KI F+TP G+SRS+PVS
Sbjct  121  KITFATPTGISRSFPVS  137



>ref|XP_002519688.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF42661.1| conserved hypothetical protein [Ricinus communis]
Length=145

 Score =   162 bits (409),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 86/137 (63%), Positives = 112/137 (82%), Gaps = 1/137 (1%)
 Frame = +2

Query  74   MSSQQTAVNHRENAEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVWM  253
            M+SQ+ A NHR+ AE++   ++CKQKS+ELLEEI +P+GLLPLD+ VEVG NR TGFVW+
Sbjct  1    MASQRIA-NHRDEAEIYLGESLCKQKSIELLEEIRLPKGLLPLDDIVEVGYNRTTGFVWL  59

Query  254  kqkkakehkfkkigkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPDPDAG  433
            KQK +K H+F++IG+ V YDTEVTAFVEDRR+K LTGVKSKELL+WVT++ I +   D  
Sbjct  60   KQKNSKNHRFREIGRNVNYDTEVTAFVEDRRMKRLTGVKSKELLIWVTISDIYVDHNDNS  119

Query  434  KINFSTPAGLSRSYPVS  484
            KI F  P+G+SR++PVS
Sbjct  120  KITFGNPSGISRTFPVS  136



>emb|CDP04230.1| unnamed protein product [Coffea canephora]
Length=147

 Score =   162 bits (409),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 83/134 (62%), Positives = 107/134 (80%), Gaps = 0/134 (0%)
 Frame = +2

Query  80   SQQTAVNHRENAEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVWMkq  259
            S Q   NHRENAE+++DPA+CK+KS ELL+ +++P+GLLPLDE +E G N  TGFVW+KQ
Sbjct  2    SSQLIENHRENAEMYSDPALCKEKSRELLQNMNLPKGLLPLDELIEAGYNESTGFVWLKQ  61

Query  260  kkakehkfkkigkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPDPDAGKI  439
            K  KEHKF+ IG+ V YDTEVTAFVEDRR+K LTGVKSKEL +WVT++ I I DP++ K+
Sbjct  62   KNKKEHKFRSIGRTVAYDTEVTAFVEDRRMKKLTGVKSKELFIWVTVSDIYIEDPNSEKV  121

Query  440  NFSTPAGLSRSYPV  481
             F  PAG S+++P 
Sbjct  122  TFKNPAGFSKTFPT  135



>gb|EYU33362.1| hypothetical protein MIMGU_mgv11b0121611mg, partial [Erythranthe 
guttata]
Length=144

 Score =   160 bits (405),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 87/122 (71%), Positives = 106/122 (87%), Gaps = 1/122 (1%)
 Frame = +2

Query  74   MSSQQTAVNHRENAEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVWM  253
            MSSQQ A +HRENAEV+T  AVCKQKSLELLE+I+MP+GLLPL++ +EVG N  TGFVW+
Sbjct  1    MSSQQIA-SHRENAEVYTGDAVCKQKSLELLEKINMPKGLLPLEDLIEVGHNEATGFVWL  59

Query  254  kqkkakehkfkkigkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPDPDAG  433
            KQKK+K H F+ IG+ VWYDTEVTAFVEDRR+K LTGVKSKE+L+WVT++ ISI DP +G
Sbjct  60   KQKKSKTHVFRAIGRSVWYDTEVTAFVEDRRMKRLTGVKSKEILIWVTISDISIQDPASG  119

Query  434  KI  439
            K+
Sbjct  120  KL  121



>ref|XP_010279635.1| PREDICTED: uncharacterized protein LOC104613500 [Nelumbo nucifera]
Length=153

 Score =   159 bits (403),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 87/137 (64%), Positives = 110/137 (80%), Gaps = 1/137 (1%)
 Frame = +2

Query  74   MSSQQTAVNHRENAEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVWM  253
            M+SQ  A N+RE AE++   ++CK+KSL+LLEEI +P+GLLPLD   EVG NRE GFVW+
Sbjct  1    MASQAIA-NYREKAEIYHGDSLCKEKSLQLLEEISLPKGLLPLDGMEEVGYNREAGFVWL  59

Query  254  kqkkakehkfkkigkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPDPDAG  433
            KQ+K  +H FK+IGK V Y  E+TAFVE+ R+K LTGVKSKELL+WVTL+ I I DP +G
Sbjct  60   KQRKGTQHTFKRIGKQVSYANEITAFVENHRMKKLTGVKSKELLIWVTLSDIYIDDPASG  119

Query  434  KINFSTPAGLSRSYPVS  484
            KI+F TPAG+SRS+PVS
Sbjct  120  KISFKTPAGISRSFPVS  136



>ref|XP_010674249.1| PREDICTED: uncharacterized protein LOC104890449 [Beta vulgaris 
subsp. vulgaris]
Length=143

 Score =   159 bits (402),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 85/135 (63%), Positives = 104/135 (77%), Gaps = 0/135 (0%)
 Frame = +2

Query  80   SQQTAVNHRENAEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVWMkq  259
            S Q    HRE AE++T   +CKQKSLELL EI+MP GLLP+D++ EVG NR TGFVW+ Q
Sbjct  2    SAQFIEKHREGAEIYTGAQICKQKSLELLLEINMPNGLLPMDDFEEVGYNRSTGFVWLTQ  61

Query  260  kkakehkfkkigkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPDPDAGKI  439
            KK  +HKF KIGK V YDT VTAFVE++R+K L GVK+KELL+W++L  I I DP +GKI
Sbjct  62   KKPVQHKFTKIGKQVSYDTHVTAFVENQRMKKLHGVKAKELLIWISLNEIYIDDPASGKI  121

Query  440  NFSTPAGLSRSYPVS  484
             F TP G+SRSYP+S
Sbjct  122  TFGTPTGISRSYPIS  136



>ref|XP_002275796.1| PREDICTED: uncharacterized protein LOC100265752 [Vitis vinifera]
 emb|CBI30872.3| unnamed protein product [Vitis vinifera]
Length=149

 Score =   158 bits (400),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 89/136 (65%), Positives = 110/136 (81%), Gaps = 1/136 (1%)
 Frame = +2

Query  80   SQQTAVNHRENAEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVWMkq  259
            S Q    HRENAEV+T  A+CKQKS ELLEEI +P+GLLPL++  EVG NR TGFVW+KQ
Sbjct  2    SSQVVAGHRENAEVYTGEALCKQKSRELLEEICLPKGLLPLEDLEEVGYNRSTGFVWLKQ  61

Query  260  kkakehkfkkigkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPDPDAGKI  439
            KK K+HKF++IG+ V YDTEVTAFVE +R+K LTGVKSKELL+WVT++ I I DP +GKI
Sbjct  62   KKRKQHKFQRIGRNVSYDTEVTAFVEKQRMKKLTGVKSKELLIWVTISDIYIDDPSSGKI  121

Query  440  NF-STPAGLSRSYPVS  484
             F ++  G+SRS+PVS
Sbjct  122  AFGNSTTGISRSFPVS  137



>ref|XP_002305706.1| hypothetical protein POPTR_0004s06350g [Populus trichocarpa]
 gb|EEE86217.1| hypothetical protein POPTR_0004s06350g [Populus trichocarpa]
Length=145

 Score =   158 bits (399),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 87/137 (64%), Positives = 109/137 (80%), Gaps = 1/137 (1%)
 Frame = +2

Query  74   MSSQQTAVNHRENAEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVWM  253
            M+SQ  A  HRE AE+ T  ++CKQKSLELLEEIH+P GLLPLD+ VEVG NR TGFVW+
Sbjct  1    MTSQHIA-THREKAEIHTGESLCKQKSLELLEEIHLPMGLLPLDDIVEVGYNRTTGFVWL  59

Query  254  kqkkakehkfkkigkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPDPDAG  433
            KQKK K+H+F KIG+ V YDTEVTAFVE+RR++ LTGVK+KELL WV+++ I + + D  
Sbjct  60   KQKKRKDHRFLKIGRQVSYDTEVTAFVENRRMRRLTGVKTKELLFWVSISDIYVDEKDLE  119

Query  434  KINFSTPAGLSRSYPVS  484
            KI F  P G+SR++PVS
Sbjct  120  KITFGNPTGISRTFPVS  136



>ref|XP_010110973.1| hypothetical protein L484_021667 [Morus notabilis]
 gb|EXC29359.1| hypothetical protein L484_021667 [Morus notabilis]
Length=142

 Score =   155 bits (393),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 87/137 (64%), Positives = 108/137 (79%), Gaps = 1/137 (1%)
 Frame = +2

Query  74   MSSQQTAVNHRENAEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVWM  253
            MSSQQ A NH+E+AE+F   AVCKQK+ +LLEE+ +PRGLLPLD+ +EVG NR TGFVW+
Sbjct  1    MSSQQIA-NHQEDAEIFHGDAVCKQKAGQLLEEMSLPRGLLPLDDLIEVGYNRITGFVWL  59

Query  254  kqkkakehkfkkigkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPDPDAG  433
            KQ+K KEH+F  IG+ V YD EVTAFVE+ R+  LTGVKSKELL+W T++ I I D D  
Sbjct  60   KQRKCKEHQFTAIGRTVSYDNEVTAFVEEHRMWRLTGVKSKELLIWFTISEIFIDDSDPD  119

Query  434  KINFSTPAGLSRSYPVS  484
            KI F+ P G+SRS+PVS
Sbjct  120  KITFTNPTGISRSFPVS  136



>ref|XP_011035462.1| PREDICTED: uncharacterized protein LOC105133252 [Populus euphratica]
Length=145

 Score =   155 bits (393),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 84/137 (61%), Positives = 109/137 (80%), Gaps = 1/137 (1%)
 Frame = +2

Query  74   MSSQQTAVNHRENAEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVWM  253
            M+SQ  A  HRE AE+ T  ++CKQ+SLELLEEIH+P GLLPLD  +EVG NR TGFVW+
Sbjct  1    MTSQHIAT-HREKAEIHTGESLCKQQSLELLEEIHLPMGLLPLDNIIEVGYNRTTGFVWL  59

Query  254  kqkkakehkfkkigkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPDPDAG  433
            +QKK K+H+F KIG+ V YDTEVTAFVE+RR++ LTGVK+KELL+WV+++ I + + D  
Sbjct  60   RQKKRKDHRFLKIGRQVSYDTEVTAFVENRRMRRLTGVKTKELLIWVSISDIYVDEKDLE  119

Query  434  KINFSTPAGLSRSYPVS  484
            KI F  P G+SR++PVS
Sbjct  120  KITFGNPTGISRTFPVS  136



>ref|XP_010529156.1| PREDICTED: uncharacterized protein LOC104806126 [Tarenaya hassleriana]
Length=143

 Score =   155 bits (393),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 74/137 (54%), Positives = 108/137 (79%), Gaps = 0/137 (0%)
 Frame = +2

Query  74   MSSQQTAVNHRENAEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVWM  253
            M+SQQT  +HRE AEV+   + CKQK+ ELL  +++P+GLLPLD+  E+G N+ TGFVW+
Sbjct  1    MASQQTISDHREGAEVYNGGSTCKQKAQELLSSMNLPKGLLPLDDMTELGHNKSTGFVWI  60

Query  254  kqkkakehkfkkigkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPDPDAG  433
            K K   +H+F+ IG++V YD+EVTAF+E+RR++ ++GVKSKELL+W+T++ I + D D  
Sbjct  61   KTKNKVQHRFRAIGRMVSYDSEVTAFIENRRMRKVSGVKSKELLIWITISEIFVNDQDPS  120

Query  434  KINFSTPAGLSRSYPVS  484
            KI F+TPAGLSR++P +
Sbjct  121  KITFATPAGLSRTFPFT  137



>ref|XP_010274785.1| PREDICTED: uncharacterized protein LOC104610025 [Nelumbo nucifera]
Length=154

 Score =   155 bits (393),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 83/135 (61%), Positives = 107/135 (79%), Gaps = 0/135 (0%)
 Frame = +2

Query  80   SQQTAVNHRENAEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVWMkq  259
            + Q    +RENAE++   A+CK+KS +LLEEI +P+GLLPL++  EVG NRE GFVW+KQ
Sbjct  2    AAQAIEKYRENAEIYNGKALCKEKSRQLLEEIALPKGLLPLEDMEEVGYNREAGFVWLKQ  61

Query  260  kkakehkfkkigkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPDPDAGKI  439
            KK+ +H FK+IGK V Y T+VTAFVE+RR+K LTGVKSKELL+WVT+  I I DP + KI
Sbjct  62   KKSTQHSFKRIGKNVSYGTDVTAFVENRRMKKLTGVKSKELLIWVTIAEIYIDDPASDKI  121

Query  440  NFSTPAGLSRSYPVS  484
             F TPAG+SRS+P+S
Sbjct  122  TFKTPAGISRSFPIS  136



>ref|XP_006449687.1| hypothetical protein CICLE_v10017099mg [Citrus clementina]
 gb|ESR62927.1| hypothetical protein CICLE_v10017099mg [Citrus clementina]
Length=144

 Score =   154 bits (390),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 82/137 (60%), Positives = 108/137 (79%), Gaps = 0/137 (0%)
 Frame = +2

Query  74   MSSQQTAVNHRENAEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVWM  253
            M+ QQ   N++E AE++   ++CKQKS ELL EI++P+GLLPL++ VEVG NR TGFVW+
Sbjct  1    MAQQQLIANNQEGAEIYHGESICKQKSHELLAEINLPKGLLPLNDLVEVGYNRATGFVWL  60

Query  254  kqkkakehkfkkigkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPDPDAG  433
            KQKK  EHKF+ IG+ V YDTEVTAFVEDRR++ LTGVKSKELL+WV+++ I    PD+ 
Sbjct  61   KQKKRTEHKFRSIGRNVSYDTEVTAFVEDRRMRRLTGVKSKELLIWVSISDIYTDAPDSK  120

Query  434  KINFSTPAGLSRSYPVS  484
            KI F+   GL+RS+P+S
Sbjct  121  KITFANSTGLARSFPIS  137



>ref|XP_006845351.1| PREDICTED: uncharacterized protein LOC18435238 [Amborella trichopoda]
 gb|ERN07026.1| hypothetical protein AMTR_s00141p00112420 [Amborella trichopoda]
Length=145

 Score =   153 bits (387),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 85/137 (62%), Positives = 108/137 (79%), Gaps = 0/137 (0%)
 Frame = +2

Query  74   MSSQQTAVNHRENAEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVWM  253
            M+SQ T  N RENAEV+     CK+KSLELL  +++P GLLPL++  EVG N+E GFVW+
Sbjct  1    MASQATIQNIRENAEVYHGDGKCKEKSLELLRTLNLPEGLLPLEDLAEVGYNKEKGFVWL  60

Query  254  kqkkakehkfkkigkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPDPDAG  433
            KQ+K KEH FKKIG+LV Y  EV+AFVEDRR+K+LTGVKSKELLLW++++ I I D D+ 
Sbjct  61   KQQKKKEHYFKKIGRLVSYAPEVSAFVEDRRMKNLTGVKSKELLLWISISEIYIDDSDSS  120

Query  434  KINFSTPAGLSRSYPVS  484
            KI F + AGLSR++PVS
Sbjct  121  KITFKSSAGLSRTFPVS  137



>ref|XP_006467471.1| PREDICTED: uncharacterized protein At5g01610-like [Citrus sinensis]
 gb|KDO78167.1| hypothetical protein CISIN_1g032270mg [Citrus sinensis]
Length=144

 Score =   153 bits (386),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 81/137 (59%), Positives = 107/137 (78%), Gaps = 0/137 (0%)
 Frame = +2

Query  74   MSSQQTAVNHRENAEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVWM  253
            M+ QQ   N++E AE++   ++CKQKS ELL EI++P+GLLPL++ VEVG NR TGFVW+
Sbjct  1    MAQQQLIANNQEGAEIYHGESICKQKSHELLAEINLPKGLLPLNDLVEVGYNRATGFVWL  60

Query  254  kqkkakehkfkkigkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPDPDAG  433
            KQKK  EHKF+ IG+ V YDTEVT FVEDRR++ LTGVKSKELL+WV+++ I    PD+ 
Sbjct  61   KQKKRTEHKFRSIGRNVSYDTEVTGFVEDRRMRRLTGVKSKELLIWVSISDIYTDAPDSK  120

Query  434  KINFSTPAGLSRSYPVS  484
            KI F+   GL+RS+P+S
Sbjct  121  KITFANSTGLARSFPIS  137



>ref|XP_008783947.1| PREDICTED: uncharacterized protein LOC103703026 [Phoenix dactylifera]
Length=155

 Score =   152 bits (385),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 84/137 (61%), Positives = 102/137 (74%), Gaps = 0/137 (0%)
 Frame = +2

Query  74   MSSQQTAVNHRENAEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVWM  253
            MS+ Q     RE AEVF    +CK++S +LLEE+H+PRGLLPL    EVG NRETGFVWM
Sbjct  1    MSAMQAIERQREGAEVFHGAEICKKRSTDLLEELHLPRGLLPLSGLDEVGFNRETGFVWM  60

Query  254  kqkkakehkfkkigkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPDPDAG  433
            KQ K  +H FKKIGK V+Y TEVTAFVEDRR+K +TGVKSKE LLWV+L+ + I + D  
Sbjct  61   KQNKGSQHVFKKIGKTVFYGTEVTAFVEDRRMKRMTGVKSKEFLLWVSLSDMYIDERDPT  120

Query  434  KINFSTPAGLSRSYPVS  484
            KI F + AG+ RS+PVS
Sbjct  121  KITFKSAAGIGRSFPVS  137



>ref|XP_010915560.1| PREDICTED: uncharacterized protein LOC105040638 [Elaeis guineensis]
Length=156

 Score =   151 bits (381),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 86/137 (63%), Positives = 102/137 (74%), Gaps = 0/137 (0%)
 Frame = +2

Query  74   MSSQQTAVNHRENAEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVWM  253
            MS+ Q      E AEVF    +CK+KS ELLEE+H+P+GLLPL    EVG NR TGFVWM
Sbjct  1    MSAMQAIERRSEGAEVFHGAEMCKKKSKELLEELHLPKGLLPLSGLDEVGYNRGTGFVWM  60

Query  254  kqkkakehkfkkigkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPDPDAG  433
            KQKK  +H FKKIGK V Y TEVTAFVEDRR+K +TGVKSKE L+WV+L+ +SI + D  
Sbjct  61   KQKKGSQHVFKKIGKTVSYATEVTAFVEDRRMKRMTGVKSKEFLIWVSLSDMSIDERDPT  120

Query  434  KINFSTPAGLSRSYPVS  484
            KI F TPAG+ RS+PVS
Sbjct  121  KITFKTPAGIGRSFPVS  137



>emb|CDY62357.1| BnaCnng40070D [Brassica napus]
Length=144

 Score =   150 bits (379),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 74/137 (54%), Positives = 101/137 (74%), Gaps = 0/137 (0%)
 Frame = +2

Query  74   MSSQQTAVNHRENAEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVWM  253
            M+SQ+T  N RE AE+    ++CKQK+ E+L  +++P+GLLPLD   E+G N+ TG++W+
Sbjct  1    MASQETITNQREGAEIVNGASMCKQKANEMLSSMNLPKGLLPLDNMTEIGYNKSTGYIWI  60

Query  254  kqkkakehkfkkigkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPDPDAG  433
            K     +H+FK IGK V YD EVTAFVE+RR++ LTG+KSKEL +WVT+T I I D D  
Sbjct  61   KMNNNVQHQFKAIGKNVSYDAEVTAFVENRRMRGLTGIKSKELFIWVTITEIYIDDQDTS  120

Query  434  KINFSTPAGLSRSYPVS  484
            KI F+  +GLSRS+PVS
Sbjct  121  KITFAGRSGLSRSFPVS  137



>ref|XP_010494795.1| PREDICTED: uncharacterized protein LOC104771887 [Camelina sativa]
Length=145

 Score =   150 bits (378),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 73/137 (53%), Positives = 105/137 (77%), Gaps = 0/137 (0%)
 Frame = +2

Query  74   MSSQQTAVNHRENAEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVWM  253
            MSSQ+T  + RE AE+    ++CKQK+ E+L  +++P+GLLPLD+  E+G N+ TG+VW+
Sbjct  1    MSSQETKTDQREGAEICNGGSICKQKANEILSTMNLPKGLLPLDDMTEIGHNKSTGYVWI  60

Query  254  kqkkakehkfkkigkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPDPDAG  433
            K K   +H+FK IG+ V YD+EVTAFVE+RR++ LTG+KSKELL+WVT++ I + D D  
Sbjct  61   KIKNKVQHRFKAIGRNVSYDSEVTAFVENRRMRQLTGIKSKELLIWVTISEIFVNDQDPS  120

Query  434  KINFSTPAGLSRSYPVS  484
            KI F+ P GLSR++PV+
Sbjct  121  KITFANPTGLSRTFPVT  137



>ref|XP_009101531.1| PREDICTED: uncharacterized protein LOC103827744 [Brassica rapa]
Length=144

 Score =   149 bits (377),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 74/137 (54%), Positives = 101/137 (74%), Gaps = 0/137 (0%)
 Frame = +2

Query  74   MSSQQTAVNHRENAEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVWM  253
            M+SQ+T  N RE AE+    ++CKQK+ E+L  +++P+GLLPLD   E+G N+ TG++W+
Sbjct  1    MASQETMTNQREGAEIVNGASMCKQKANEMLSSMNLPKGLLPLDNMTEIGYNKSTGYIWI  60

Query  254  kqkkakehkfkkigkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPDPDAG  433
            K     +H+FK IGK V YD EVTAFVE+RR++ LTG+KSKEL +WVT+T I I D D  
Sbjct  61   KMNNNVQHQFKAIGKNVSYDAEVTAFVENRRMRGLTGIKSKELFIWVTITEIYIDDQDTT  120

Query  434  KINFSTPAGLSRSYPVS  484
            KI F+  +GLSRS+PVS
Sbjct  121  KITFAGRSGLSRSFPVS  137



>ref|XP_009128852.1| PREDICTED: uncharacterized protein LOC103853695 [Brassica rapa]
 emb|CDY43960.1| BnaA02g24380D [Brassica napus]
Length=141

 Score =   149 bits (377),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 77/137 (56%), Positives = 105/137 (77%), Gaps = 0/137 (0%)
 Frame = +2

Query  74   MSSQQTAVNHRENAEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVWM  253
            MSSQ+T  + R+ AE+F   ++CKQK+ E+L  +++P+GLLPLD   E+G N+ TG+ W+
Sbjct  1    MSSQETKSDQRKGAEIFNGVSICKQKAHEILSNMNLPKGLLPLDTMTEIGFNKSTGYFWI  60

Query  254  kqkkakehkfkkigkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPDPDAG  433
            K K   +HKFK IGK V YD+EVTAFVE+RR++ LTGVKSKELL+WVT++ I + D D  
Sbjct  61   KMKNKVQHKFKSIGKNVSYDSEVTAFVENRRMRSLTGVKSKELLIWVTISEIFVDDQDPT  120

Query  434  KINFSTPAGLSRSYPVS  484
            KI F+ P+GLSRS+PVS
Sbjct  121  KITFAGPSGLSRSFPVS  137



>emb|CDY33463.1| BnaA06g36100D [Brassica napus]
Length=144

 Score =   149 bits (377),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 74/137 (54%), Positives = 101/137 (74%), Gaps = 0/137 (0%)
 Frame = +2

Query  74   MSSQQTAVNHRENAEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVWM  253
            M+SQ+T  N RE AE+    ++CKQK+ E+L  +++P+GLLPLD   E+G N+ TG++W+
Sbjct  1    MASQETITNQREGAEIVNGASMCKQKANEMLSSMNLPKGLLPLDNMTEIGYNKSTGYIWI  60

Query  254  kqkkakehkfkkigkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPDPDAG  433
            K     +H+FK IGK V YD EVTAFVE+RR++ LTG+KSKEL +WVT+T I I D D  
Sbjct  61   KMNNNVQHQFKAIGKNVSYDAEVTAFVENRRMRGLTGIKSKELFIWVTITEIYIDDQDTT  120

Query  434  KINFSTPAGLSRSYPVS  484
            KI F+  +GLSRS+PVS
Sbjct  121  KITFAGRSGLSRSFPVS  137



>ref|XP_006281138.1| hypothetical protein CARUB_v10027170mg [Capsella rubella]
 gb|EOA14036.1| hypothetical protein CARUB_v10027170mg [Capsella rubella]
Length=197

 Score =   150 bits (380),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 74/140 (53%), Positives = 107/140 (76%), Gaps = 0/140 (0%)
 Frame = +2

Query  65   KLKMSSQQTAVNHRENAEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGF  244
            K KMSSQ+T  + RE AE+    ++CKQK+ E+L  +++P+GLLPLD+  E+G N+ TG+
Sbjct  53   KSKMSSQETKKDQREGAEICNGGSICKQKANEILSTMNLPKGLLPLDDMTEIGHNKSTGY  112

Query  245  VWMkqkkakehkfkkigkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPDP  424
            VW+K K   +H+FK IG+ V YD+EVTAFVE+RR++ LTG+KSKE+L+WVT++ I + D 
Sbjct  113  VWIKIKNKVQHRFKAIGRNVSYDSEVTAFVENRRMRQLTGIKSKEILIWVTISEIFVNDQ  172

Query  425  DAGKINFSTPAGLSRSYPVS  484
            D  KI F+ P GLSR++PV+
Sbjct  173  DPTKITFANPTGLSRTFPVT  192



>ref|XP_007025085.1| Uncharacterized protein TCM_029489 [Theobroma cacao]
 gb|EOY27707.1| Uncharacterized protein TCM_029489 [Theobroma cacao]
Length=146

 Score =   148 bits (374),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 81/137 (59%), Positives = 106/137 (77%), Gaps = 1/137 (1%)
 Frame = +2

Query  74   MSSQQTAVNHRENAEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVWM  253
            M+ QQ A N RE AE++   A+CKQKS+ELL E H+P+GL+PLD  VEVG NR TGFVW+
Sbjct  1    MALQQIATN-REAAEIYQGAALCKQKSMELLGEFHLPKGLMPLDNLVEVGYNRTTGFVWL  59

Query  254  kqkkakehkfkkigkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPDPDAG  433
            KQ+K+ E++FK IGK V Y+ E+TAFVEDRR++ LTGVKSKELL+WV+++ I I   +  
Sbjct  60   KQQKSLEYRFKAIGKTVSYEPEMTAFVEDRRMRRLTGVKSKELLIWVSVSDIFIDKSNPS  119

Query  434  KINFSTPAGLSRSYPVS  484
            KI F+   GLSRS+PV+
Sbjct  120  KITFANSTGLSRSFPVA  136



>ref|XP_010441609.1| PREDICTED: uncharacterized protein LOC104724761 [Camelina sativa]
 ref|XP_010481479.1| PREDICTED: uncharacterized protein LOC104760276 [Camelina sativa]
Length=145

 Score =   148 bits (373),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 73/137 (53%), Positives = 104/137 (76%), Gaps = 0/137 (0%)
 Frame = +2

Query  74   MSSQQTAVNHRENAEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVWM  253
            MSSQ+T  + RE AE+    + CKQK+ E+L  +++P+GLLPLD+  E+G N+ TG+VW+
Sbjct  1    MSSQETKTDQREGAEICNGGSNCKQKANEILSTMNLPKGLLPLDDMTEIGHNKSTGYVWI  60

Query  254  kqkkakehkfkkigkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPDPDAG  433
            K K   +H+FK IG+ V YD+EVTAFVE+RR++ LTG+KSKELL+WVT++ I + D D  
Sbjct  61   KIKNKVQHRFKAIGRNVSYDSEVTAFVENRRMRQLTGIKSKELLIWVTISEIFVNDQDPS  120

Query  434  KINFSTPAGLSRSYPVS  484
            KI F+ P GLSR++PV+
Sbjct  121  KITFANPTGLSRTFPVT  137



>ref|XP_009419764.1| PREDICTED: uncharacterized protein LOC103999676 [Musa acuminata 
subsp. malaccensis]
Length=156

 Score =   147 bits (371),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 77/137 (56%), Positives = 102/137 (74%), Gaps = 0/137 (0%)
 Frame = +2

Query  74   MSSQQTAVNHRENAEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVWM  253
            MS Q    +HRE AEV     +CK++S++LL E+H+P+ LLPL    EVG NR TGFVW+
Sbjct  1    MSKQAMIESHREGAEVHRGADLCKKQSMDLLAELHLPKALLPLAAVEEVGYNRATGFVWL  60

Query  254  kqkkakehkfkkigkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPDPDAG  433
            +Q K+  H FK IGK V Y +EVTAFVEDRR+K +TGVKS+ELL+WV++T + I DP++ 
Sbjct  61   RQNKSTTHVFKAIGKTVSYASEVTAFVEDRRMKRMTGVKSRELLIWVSITDMYIDDPESK  120

Query  434  KINFSTPAGLSRSYPVS  484
            +I F TPAG+ RS+PVS
Sbjct  121  RITFKTPAGIGRSFPVS  137



>ref|XP_010056893.1| PREDICTED: uncharacterized protein LOC104444837 [Eucalyptus grandis]
 gb|KCW73806.1| hypothetical protein EUGRSUZ_E02409 [Eucalyptus grandis]
 gb|KCW73807.1| hypothetical protein EUGRSUZ_E02409 [Eucalyptus grandis]
Length=151

 Score =   147 bits (370),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 76/128 (59%), Positives = 98/128 (77%), Gaps = 0/128 (0%)
 Frame = +2

Query  101  HRENAEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVWMkqkkakehk  280
            HR+NAEV+   ++CK KS ELL  I++P+GLLPLD+ VEVG NR TGFVW++Q+K K H+
Sbjct  9    HRDNAEVYKGDSLCKLKSRELLSAINLPKGLLPLDDIVEVGYNRSTGFVWVQQRKPKVHR  68

Query  281  fkkigkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPDPDAGKINFSTPAG  460
            F+ + + V YD E+TAFV DRR+K LTGVKSKELL WVT++ I I   D  K+ F+ P G
Sbjct  69   FRAVSRSVSYDAEITAFVGDRRMKRLTGVKSKELLFWVTISDIYIDGNDPAKVAFANPTG  128

Query  461  LSRSYPVS  484
            LSRS+PVS
Sbjct  129  LSRSFPVS  136



>ref|XP_006398313.1| hypothetical protein EUTSA_v10001128mg [Eutrema salsugineum]
 gb|ESQ39766.1| hypothetical protein EUTSA_v10001128mg [Eutrema salsugineum]
Length=141

 Score =   146 bits (369),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 71/137 (52%), Positives = 103/137 (75%), Gaps = 0/137 (0%)
 Frame = +2

Query  74   MSSQQTAVNHRENAEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVWM  253
            MSSQ+T  + RE AE+    ++CK+K+ E+L  +++P+GLLPLD   E+G N+ TG+VW+
Sbjct  1    MSSQETISDQREGAEICNGGSICKKKADEILSTMNLPKGLLPLDNMTEIGHNKSTGYVWI  60

Query  254  kqkkakehkfkkigkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPDPDAG  433
            K     +H+F+ IG+ V YD+EVTAFVE+RR++ LTG+KSKELLLWVT++ I + D D  
Sbjct  61   KMNNKVQHRFQAIGRNVSYDSEVTAFVENRRMRRLTGIKSKELLLWVTISEIFVNDQDPT  120

Query  434  KINFSTPAGLSRSYPVS  484
            KI F+ P GLSR++PV+
Sbjct  121  KITFANPTGLSRTFPVN  137



>emb|CDX87732.1| BnaC02g32170D [Brassica napus]
Length=143

 Score =   145 bits (367),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 75/137 (55%), Positives = 103/137 (75%), Gaps = 0/137 (0%)
 Frame = +2

Query  74   MSSQQTAVNHRENAEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVWM  253
            MSSQ+T  + R+ AE+     +CKQK+ E+L  +++P+GLLPLD   E+G N+ TG++W+
Sbjct  1    MSSQETNQDQRKGAEIVNGVLICKQKAHEILSTMNLPKGLLPLDTMTEIGFNKSTGYIWI  60

Query  254  kqkkakehkfkkigkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPDPDAG  433
            K K   +HKFK IGK V YD+EVTAFVE RR++ LTG+KSKELL+WVT++ I + D D  
Sbjct  61   KMKNKVQHKFKAIGKNVSYDSEVTAFVEKRRMRSLTGIKSKELLIWVTISEIYVDDQDTT  120

Query  434  KINFSTPAGLSRSYPVS  484
            KI F+ P+GLSRS+PVS
Sbjct  121  KITFAGPSGLSRSFPVS  137



>gb|EAY72987.1| hypothetical protein OsI_00860 [Oryza sativa Indica Group]
Length=167

 Score =   146 bits (369),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 81/136 (60%), Positives = 98/136 (72%), Gaps = 1/136 (1%)
 Frame = +2

Query  74   MSSQQTAVNHRENAEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVWM  253
            M SQ     HRE AEV+   A+C +K++ELL EIHMP GLLPL E  EVG NR TGFVW+
Sbjct  1    MGSQAIEA-HREGAEVYHGAALCAEKAVELLAEIHMPLGLLPLAEMEEVGYNRATGFVWL  59

Query  254  kqkkakehkfkkigkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPDPDAG  433
            +QKKA  H FK+I + V Y  EVTAFVEDRR+K +TG K+KELL+WV+L+ + I   DA 
Sbjct  60   RQKKAITHTFKQISRQVSYAAEVTAFVEDRRMKRVTGAKTKELLIWVSLSDMFIDKDDAS  119

Query  434  KINFSTPAGLSRSYPV  481
            KI F TP GL R+YPV
Sbjct  120  KITFKTPTGLGRTYPV  135



>ref|XP_009114368.1| PREDICTED: uncharacterized protein LOC103839621 [Brassica rapa]
Length=144

 Score =   144 bits (364),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 71/137 (52%), Positives = 103/137 (75%), Gaps = 0/137 (0%)
 Frame = +2

Query  74   MSSQQTAVNHRENAEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVWM  253
            MSS +T  + R+ AE+F   + CKQK+ E+L  +++P+GLLPLD   E+G N+ TG++W+
Sbjct  1    MSSLETKPDQRQGAEIFNGGSTCKQKANEILSTMNLPKGLLPLDNMTEIGHNKTTGYIWI  60

Query  254  kqkkakehkfkkigkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPDPDAG  433
            K  K  +H+FK IG+ V YD+EVTAFVE+RR++ LTG+KSKELLLWVT++ I + D D  
Sbjct  61   KINKNVQHRFKAIGRNVSYDSEVTAFVENRRMRSLTGIKSKELLLWVTISEIFVNDQDQT  120

Query  434  KINFSTPAGLSRSYPVS  484
            KI F+ P GLSR++P++
Sbjct  121  KITFANPTGLSRTFPIT  137



>emb|CDY03234.1| BnaC09g19220D [Brassica napus]
Length=176

 Score =   145 bits (365),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 73/137 (53%), Positives = 103/137 (75%), Gaps = 0/137 (0%)
 Frame = +2

Query  74   MSSQQTAVNHRENAEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVWM  253
            MSS +T  + RE AE+F   + CKQK+ E+L  +++P+GLLPLD   E+G N+ TG++W+
Sbjct  33   MSSLETKPDQREGAEIFNVGSTCKQKANEILSTMNLPKGLLPLDNMTEIGHNKTTGYIWI  92

Query  254  kqkkakehkfkkigkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPDPDAG  433
            K  K  +H+FK IG+ V YD+EVTAFVE+RR++ LTG+KSKELLLWVT++ I + D D  
Sbjct  93   KINKNVQHRFKAIGRNVSYDSEVTAFVENRRMRSLTGIKSKELLLWVTISEIFVNDQDQT  152

Query  434  KINFSTPAGLSRSYPVS  484
            KI F+ P GLSR++PV+
Sbjct  153  KITFANPTGLSRTFPVT  169



>gb|KFK31484.1| hypothetical protein AALP_AA6G118200 [Arabis alpina]
Length=143

 Score =   144 bits (362),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 74/138 (54%), Positives = 102/138 (74%), Gaps = 1/138 (1%)
 Frame = +2

Query  74   MSSQQTAVNHRENAEVFTDPA-VCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVW  250
            MSSQ+T  + RE AE++     +CKQK+ E+L  +++P+GLLPLD   E+G N+ TG+VW
Sbjct  1    MSSQETKTDQREGAEIYNGGGTICKQKANEILSTMNLPKGLLPLDNMTEIGYNKSTGYVW  60

Query  251  MkqkkakehkfkkigkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPDPDA  430
            +K K    HKFK IG+ V YD+EVTAFVE+RR++ L+GVKS+EL LWVT+  I+I D D 
Sbjct  61   IKIKNKITHKFKAIGQNVSYDSEVTAFVENRRMRKLSGVKSRELFLWVTIADIAINDQDP  120

Query  431  GKINFSTPAGLSRSYPVS  484
             KI F+T  GLSR++PV+
Sbjct  121  TKITFATSTGLSRTFPVT  138



>emb|CDY35153.1| BnaA09g17900D [Brassica napus]
Length=144

 Score =   143 bits (361),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 71/137 (52%), Positives = 102/137 (74%), Gaps = 0/137 (0%)
 Frame = +2

Query  74   MSSQQTAVNHRENAEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVWM  253
            MSS +T  + R+ AE+F   + CKQK+ E+L  +++P+GLLPLD   E+G N+ TG++W+
Sbjct  1    MSSLETKPDQRQGAEIFNGGSTCKQKANEILSTMNLPKGLLPLDNMTEIGHNKTTGYIWI  60

Query  254  kqkkakehkfkkigkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPDPDAG  433
            K  K  +H+FK IG+ V YD+EVTAFVE+RR++ LTG+KSKELLLW T++ I + D D  
Sbjct  61   KINKNVQHRFKAIGRNVSYDSEVTAFVENRRMRSLTGIKSKELLLWATISEIFVNDQDQT  120

Query  434  KINFSTPAGLSRSYPVS  484
            KI F+ P GLSR++PV+
Sbjct  121  KITFANPTGLSRTFPVT  137



>ref|NP_001042369.1| Os01g0210600 [Oryza sativa Japonica Group]
 dbj|BAA96147.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAA96189.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF04283.1| Os01g0210600 [Oryza sativa Japonica Group]
 dbj|BAG99781.1| unnamed protein product [Oryza sativa Japonica Group]
Length=167

 Score =   144 bits (363),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 80/136 (59%), Positives = 98/136 (72%), Gaps = 1/136 (1%)
 Frame = +2

Query  74   MSSQQTAVNHRENAEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVWM  253
            M SQ     HRE AEV+   A+C +K++ELL EIHMP GLLPL E  EVG NR TGFVW+
Sbjct  1    MGSQAIEA-HREGAEVYHGAALCAEKAVELLAEIHMPLGLLPLAEMEEVGYNRATGFVWL  59

Query  254  kqkkakehkfkkigkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPDPDAG  433
            +QKKA  H FK+I + V +  EVTAFVEDRR+K +TG K+KELL+WV+L+ + I   DA 
Sbjct  60   RQKKAITHTFKQISRQVSFAAEVTAFVEDRRMKRVTGAKTKELLIWVSLSDMFIDKDDAS  119

Query  434  KINFSTPAGLSRSYPV  481
            KI F TP GL R+YPV
Sbjct  120  KITFKTPTGLGRTYPV  135



>ref|XP_006643896.1| PREDICTED: uncharacterized protein LOC102710914 [Oryza brachyantha]
Length=169

 Score =   144 bits (363),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 79/136 (58%), Positives = 97/136 (71%), Gaps = 1/136 (1%)
 Frame = +2

Query  74   MSSQQTAVNHRENAEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVWM  253
            M SQ     HRE AEV+   A+C +K++ELL    MPRGLLPL E  EVG NR TGFVW+
Sbjct  1    MGSQAIEA-HREGAEVYRGAALCAEKAVELLGGTQMPRGLLPLAEMEEVGYNRATGFVWL  59

Query  254  kqkkakehkfkkigkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPDPDAG  433
            +QKK+  H FK+I + V Y  EVTAFVEDRR+K +TGVK+KELL+WV+L+ + I   D  
Sbjct  60   RQKKSITHTFKQISRQVSYAAEVTAFVEDRRMKRMTGVKTKELLIWVSLSDMYIDKDDPS  119

Query  434  KINFSTPAGLSRSYPV  481
            KINF TP GL R+YPV
Sbjct  120  KINFKTPTGLGRTYPV  135



>ref|XP_010925673.1| PREDICTED: uncharacterized protein LOC105048158 [Elaeis guineensis]
Length=149

 Score =   143 bits (361),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 81/137 (59%), Positives = 101/137 (74%), Gaps = 0/137 (0%)
 Frame = +2

Query  74   MSSQQTAVNHRENAEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVWM  253
            M+++Q     RE AEV+    +CK+KSLELL EIH+P+GLLPL    EVG NR TGFVWM
Sbjct  1    MAARQGIDRQREGAEVYHGVELCKKKSLELLGEIHLPKGLLPLSGLEEVGYNRATGFVWM  60

Query  254  kqkkakehkfkkigkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPDPDAG  433
            KQ+K  +H FKKIG+ V Y TEVTAFVED R+K +TGVK+KELL+WV+L+ + I D D  
Sbjct  61   KQRKGSQHVFKKIGRTVSYATEVTAFVEDWRMKRVTGVKTKELLIWVSLSDMYIDDGDHT  120

Query  434  KINFSTPAGLSRSYPVS  484
            KI F T  G+ RSYPV+
Sbjct  121  KITFKTTTGIGRSYPVA  137



>gb|ACL51746.1| unknown, partial [Picea abies]
Length=145

 Score =   143 bits (360),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 77/133 (58%), Positives = 100/133 (75%), Gaps = 0/133 (0%)
 Frame = +2

Query  86   QTAVNHRENAEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVWMkqkk  265
            Q A + R  AEV+    +CKQKS+ELL +I +P GLLPLDE  E G  +ETGFVW+KQKK
Sbjct  3    QVANDQRAGAEVYHGSEICKQKSMELLADIGLPTGLLPLDELEETGYVKETGFVWLKQKK  62

Query  266  akehkfkkigkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPDPDAGKINF  445
              EH+FKKIGK+V Y TE+TA+VE R++K LTGVKSKEL LW+T++ ISI DP +GKI F
Sbjct  63   KTEHQFKKIGKMVQYGTEITAYVEQRKMKKLTGVKSKELFLWITISEISIDDPSSGKIYF  122

Query  446  STPAGLSRSYPVS  484
             +  G+ +++P S
Sbjct  123  KSSTGIGKAFPAS  135



>ref|XP_009380497.1| PREDICTED: uncharacterized protein LOC103968879 [Musa acuminata 
subsp. malaccensis]
Length=152

 Score =   143 bits (360),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 79/137 (58%), Positives = 102/137 (74%), Gaps = 0/137 (0%)
 Frame = +2

Query  74   MSSQQTAVNHRENAEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVWM  253
            MS+Q    + RE AEV+    +CK++S++LL+EIH+PRGLLPL    EVG NR TGFVW+
Sbjct  1    MSTQAMIDSQREGAEVYHGAGLCKEQSMKLLDEIHLPRGLLPLPALEEVGYNRATGFVWL  60

Query  254  kqkkakehkfkkigkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPDPDAG  433
            KQKKA  H FK IGK V Y  +VTAFVEDRR+K L GVKS+ELL+WV+L+ + I DP++ 
Sbjct  61   KQKKAATHVFKAIGKTVSYAPQVTAFVEDRRMKRLCGVKSRELLIWVSLSDMCIDDPESK  120

Query  434  KINFSTPAGLSRSYPVS  484
            +I F T AG+  S+PVS
Sbjct  121  RITFKTQAGIGLSFPVS  137



>emb|CDM81056.1| unnamed protein product [Triticum aestivum]
Length=150

 Score =   143 bits (360),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 81/137 (59%), Positives = 103/137 (75%), Gaps = 1/137 (1%)
 Frame = +2

Query  74   MSSQQTAVNHRENAEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVWM  253
            M+SQ   VN RE AEV+   A+C +K++ELL E +MP GLLPL + VEVG NR TGF+W+
Sbjct  1    MASQAIEVN-REGAEVYHGAALCAEKAVELLAETNMPLGLLPLADIVEVGYNRSTGFLWL  59

Query  254  kqkkakehkfkkigkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPDPDAG  433
             QKKA  H FK+IG+LV Y TEVTAFVEDR++K +TGVKS ELL+WVT++ + I   D  
Sbjct  60   LQKKALTHTFKQIGRLVSYATEVTAFVEDRKMKRITGVKSTELLIWVTVSDMYIDKNDHS  119

Query  434  KINFSTPAGLSRSYPVS  484
            KI+F TP GL R++PVS
Sbjct  120  KISFKTPTGLRRTFPVS  136



>ref|XP_002454956.1| hypothetical protein SORBIDRAFT_03g002080 [Sorghum bicolor]
 gb|EES00076.1| hypothetical protein SORBIDRAFT_03g002080 [Sorghum bicolor]
Length=171

 Score =   143 bits (361),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 79/137 (58%), Positives = 99/137 (72%), Gaps = 1/137 (1%)
 Frame = +2

Query  74   MSSQQTAVNHRENAEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVWM  253
            M SQ     HR  AEV+T  A+C +KS ELL E+H+P GLLPL +  EVG NR TGFVW+
Sbjct  1    MGSQAIEA-HRAGAEVYTGAALCAEKSTELLSEVHLPLGLLPLADMEEVGYNRATGFVWL  59

Query  254  kqkkakehkfkkigkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPDPDAG  433
            +QKKA  H F++IG+ V Y  EVTAFVEDRR+K +TGVK+KELL+WVTL+ + +   D  
Sbjct  60   RQKKALTHTFRQIGRQVSYAAEVTAFVEDRRMKRMTGVKTKELLIWVTLSDMFLDKDDQS  119

Query  434  KINFSTPAGLSRSYPVS  484
            KI F TP GL R++PVS
Sbjct  120  KITFKTPTGLGRTFPVS  136



>ref|XP_009409406.1| PREDICTED: uncharacterized protein LOC103991625 [Musa acuminata 
subsp. malaccensis]
Length=183

 Score =   143 bits (361),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 77/137 (56%), Positives = 101/137 (74%), Gaps = 0/137 (0%)
 Frame = +2

Query  74   MSSQQTAVNHRENAEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVWM  253
            MS+Q    + RE AEV     +CK++S+ LLE IH+P+GLLPL    EVG NR TGFVW+
Sbjct  27   MSTQALIESQREGAEVSYGADICKEQSMSLLEGIHLPKGLLPLAAIEEVGYNRATGFVWL  86

Query  254  kqkkakehkfkkigkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPDPDAG  433
            KQKK+  H FK IGK V Y  EVTAFVEDRR+K +TGVKS+E L+W++++ + I DP++ 
Sbjct  87   KQKKSTTHVFKAIGKTVSYAQEVTAFVEDRRMKRMTGVKSREFLIWISVSDMYIDDPESK  146

Query  434  KINFSTPAGLSRSYPVS  484
            +I F TPAG+ RS+PVS
Sbjct  147  RITFKTPAGIGRSFPVS  163



>gb|AHG95251.1| hypothetical protein, partial [Pinus mugo]
Length=143

 Score =   141 bits (356),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 77/133 (58%), Positives = 100/133 (75%), Gaps = 0/133 (0%)
 Frame = +2

Query  86   QTAVNHRENAEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVWMkqkk  265
            Q A + R  AE+F    +CKQKS+ELL E+ +P+GLLPL++  E G  +ETGFVW+KQKK
Sbjct  3    QVANDQRSGAEIFHGSEICKQKSMELLAEMGLPKGLLPLEDLEESGYVKETGFVWLKQKK  62

Query  266  akehkfkkigkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPDPDAGKINF  445
              EH FKKIGK+V Y TE+TA+VE  ++K LTGVKSKELLLWVT++ ISI DP +GKI F
Sbjct  63   KTEHYFKKIGKMVQYGTEITAYVEQNKMKKLTGVKSKELLLWVTISEISIDDPSSGKIYF  122

Query  446  STPAGLSRSYPVS  484
             +  G+ +S+P S
Sbjct  123  KSVTGIGKSFPTS  135



>ref|XP_007147904.1| hypothetical protein PHAVU_006G164700g [Phaseolus vulgaris]
 gb|ESW19898.1| hypothetical protein PHAVU_006G164700g [Phaseolus vulgaris]
Length=160

 Score =   142 bits (357),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 79/137 (58%), Positives = 103/137 (75%), Gaps = 1/137 (1%)
 Frame = +2

Query  74   MSSQQTAVNHRENAEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVWM  253
            M S Q A +HRE AE++   A+C QKS  LL+EI +PRGLLPLD  VE+G NR +GFVW+
Sbjct  1    MVSTQIA-HHREAAEIYEGEAICSQKSRLLLDEILLPRGLLPLDNIVEMGYNRTSGFVWL  59

Query  254  kqkkakehkfkkigkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPDPDAG  433
            KQK  KEH+F  IG+ V YDTEVTAFVE+ R+  +TGVK+KEL LWVT++ I + DP   
Sbjct  60   KQKHKKEHRFNAIGRTVSYDTEVTAFVEEHRMWRVTGVKTKELFLWVTISEIFVDDPSCS  119

Query  434  KINFSTPAGLSRSYPVS  484
            KI+F+  +G+SRS+P+S
Sbjct  120  KISFANSSGISRSFPLS  136



>ref|XP_003565415.1| PREDICTED: uncharacterized protein LOC100822009 [Brachypodium 
distachyon]
Length=164

 Score =   142 bits (357),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 80/137 (58%), Positives = 100/137 (73%), Gaps = 1/137 (1%)
 Frame = +2

Query  74   MSSQQTAVNHRENAEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVWM  253
            M SQ    N RE AEV+   A+C++KS+ELL E +MP GLLPL E  EVG NR TGFVW+
Sbjct  1    MGSQAIEAN-REGAEVYRGAALCQEKSVELLAETNMPLGLLPLAEMEEVGYNRATGFVWL  59

Query  254  kqkkakehkfkkigkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPDPDAG  433
            +QKKA  H FK+IG+ V Y  EVTA+VEDR++K +TGVK+KELL+WV+L  + I   D  
Sbjct  60   RQKKALTHTFKQIGRQVSYAAEVTAYVEDRKMKRMTGVKTKELLIWVSLCDMYIDKDDRS  119

Query  434  KINFSTPAGLSRSYPVS  484
            KI F TP+GL R+YPVS
Sbjct  120  KITFKTPSGLGRTYPVS  136



>emb|CDM86991.1| unnamed protein product [Triticum aestivum]
Length=150

 Score =   141 bits (356),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 82/137 (60%), Positives = 101/137 (74%), Gaps = 1/137 (1%)
 Frame = +2

Query  74   MSSQQTAVNHRENAEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVWM  253
            M+SQ   VN RE AEV+   A C +K++ELL E +MP GLLPL +  EVG NR TGFVW+
Sbjct  1    MASQVIGVN-REGAEVYHGAAQCAEKAVELLAETNMPLGLLPLADIEEVGYNRSTGFVWL  59

Query  254  kqkkakehkfkkigkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPDPDAG  433
            +QKKA  H FK+IG+LV Y TEVTAFVEDR++K +TGVKSKELL+WVT+  + I   D  
Sbjct  60   RQKKALTHTFKQIGRLVSYATEVTAFVEDRKMKCITGVKSKELLIWVTVCDMYIDKNDHS  119

Query  434  KINFSTPAGLSRSYPVS  484
            KI F TP GL R++PVS
Sbjct  120  KITFKTPTGLGRTFPVS  136



>emb|CDM82139.1| unnamed protein product [Triticum aestivum]
Length=150

 Score =   141 bits (356),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 81/137 (59%), Positives = 101/137 (74%), Gaps = 1/137 (1%)
 Frame = +2

Query  74   MSSQQTAVNHRENAEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVWM  253
            M+SQ   VN RE AEV+   A+C +K+ ELL E +MP GLLPL +  EVG NR TGFVW+
Sbjct  1    MASQAIEVN-REGAEVYHGAALCAEKATELLAETNMPLGLLPLADIEEVGYNRSTGFVWL  59

Query  254  kqkkakehkfkkigkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPDPDAG  433
            +QKKA  H FK+IG+LV Y TEVTAFV+DR++K +TGVKSKELL+WVT+  + I   D  
Sbjct  60   RQKKALTHTFKQIGRLVSYATEVTAFVQDRKMKRITGVKSKELLIWVTVCDMYIDKNDHS  119

Query  434  KINFSTPAGLSRSYPVS  484
            KI F TP GL R++PVS
Sbjct  120  KITFKTPTGLGRTFPVS  136



>gb|ACL51738.1| unknown, partial [Pinus contorta]
 gb|ACL51743.1| unknown, partial [Pinus ponderosa]
Length=145

 Score =   140 bits (354),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 76/133 (57%), Positives = 100/133 (75%), Gaps = 0/133 (0%)
 Frame = +2

Query  86   QTAVNHRENAEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVWMkqkk  265
            Q A + R  AE+F    +CKQKS+ELL E+ +P+GLLPL++  E G  +ETGFVW+KQKK
Sbjct  3    QVANDQRSGAEIFHGSEICKQKSMELLAEMGLPKGLLPLEDLEESGYVKETGFVWLKQKK  62

Query  266  akehkfkkigkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPDPDAGKINF  445
              EH FKKIGK+V Y TE+TA+VE  ++K LTGVKSKELLLW+T++ ISI DP +GKI F
Sbjct  63   KTEHYFKKIGKMVQYGTEITAYVEQNKMKKLTGVKSKELLLWITISEISIDDPSSGKIYF  122

Query  446  STPAGLSRSYPVS  484
             +  G+ +S+P S
Sbjct  123  KSVTGIGKSFPTS  135



>ref|XP_007025086.1| Uncharacterized protein TCM_029490 [Theobroma cacao]
 gb|EOY27708.1| Uncharacterized protein TCM_029490 [Theobroma cacao]
Length=154

 Score =   140 bits (354),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 75/137 (55%), Positives = 103/137 (75%), Gaps = 1/137 (1%)
 Frame = +2

Query  74   MSSQQTAVNHRENAEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVWM  253
            M+S +   +HRENAE++    +CKQK LELLEEI +P+G++P+ E VE GR+R TGFVWM
Sbjct  1    MASSKVTESHRENAEIYYGEDICKQKCLELLEEISLPKGIIPV-EIVEFGRDRSTGFVWM  59

Query  254  kqkkakehkfkkigkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPDPDAG  433
            K K  KEHKFK+I K+V YDTE+T F E+ R+K LTG+KSKELL WV+++ + I DP +G
Sbjct  60   KLKSKKEHKFKRINKVVSYDTEITFFAENGRVKKLTGIKSKELLFWVSISDMFIEDPSSG  119

Query  434  KINFSTPAGLSRSYPVS  484
            KI F+  +G+   +P+S
Sbjct  120  KIFFAVRSGVRAHFPIS  136



>gb|AHG95244.1| hypothetical protein, partial [Pinus mugo]
Length=143

 Score =   140 bits (353),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 76/133 (57%), Positives = 100/133 (75%), Gaps = 0/133 (0%)
 Frame = +2

Query  86   QTAVNHRENAEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVWMkqkk  265
            Q A + R  AE+F    +CKQKS++LL E+ +P+GLLPL++  E G  +ETGFVW+KQKK
Sbjct  3    QVANDQRSGAEIFRGSEICKQKSMDLLAEMGLPKGLLPLEDLEESGYVKETGFVWLKQKK  62

Query  266  akehkfkkigkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPDPDAGKINF  445
              EH FKKIGK+V Y TE+TA+VE  ++K LTGVKSKELLLWVT++ ISI DP +GKI F
Sbjct  63   KTEHYFKKIGKMVQYGTEITAYVEQNKMKKLTGVKSKELLLWVTISEISIDDPSSGKIYF  122

Query  446  STPAGLSRSYPVS  484
             +  G+ +S+P S
Sbjct  123  KSVTGIGKSFPTS  135



>ref|XP_002863416.1| hypothetical protein ARALYDRAFT_494351 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH39675.1| hypothetical protein ARALYDRAFT_494351 [Arabidopsis lyrata subsp. 
lyrata]
Length=143

 Score =   140 bits (353),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 71/137 (52%), Positives = 101/137 (74%), Gaps = 0/137 (0%)
 Frame = +2

Query  74   MSSQQTAVNHRENAEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVWM  253
            MSSQ+T  + RE AE+    + CKQK+ E+L  +++P+GLLPLD   E+G N+ TG+VW+
Sbjct  1    MSSQETKSDQREGAEICNGESNCKQKAKEILSTMNLPKGLLPLDNMTEIGHNKSTGYVWI  60

Query  254  kqkkakehkfkkigkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPDPDAG  433
            K K   +H+FK IGK V YD+EVTA VE+RR++ LTG+KSKE+L+WVT++ I + D D  
Sbjct  61   KIKNKVQHRFKAIGKNVSYDSEVTAIVENRRMRQLTGIKSKEILIWVTISEIFVNDQDPT  120

Query  434  KINFSTPAGLSRSYPVS  484
             I F+ P GLSR++PV+
Sbjct  121  IITFANPTGLSRTFPVT  137



>gb|ACJ70255.1| unknown, partial [Pinus sylvestris]
 gb|ACJ70256.1| unknown, partial [Pinus sylvestris]
 gb|ACJ70257.1| unknown, partial [Pinus sylvestris]
 gb|ACJ70258.1| unknown, partial [Pinus sylvestris]
 gb|ACJ70259.1| unknown, partial [Pinus sylvestris]
 gb|ACJ70260.1| unknown, partial [Pinus sylvestris]
 gb|ACJ70261.1| unknown, partial [Pinus sylvestris]
 gb|ACJ70262.1| unknown, partial [Pinus sylvestris]
 gb|ACJ70264.1| unknown, partial [Pinus sylvestris]
 gb|ACJ70265.1| unknown, partial [Pinus sylvestris]
 gb|ACJ70266.1| unknown, partial [Pinus sylvestris]
 gb|ACJ70267.1| unknown, partial [Pinus sylvestris]
 gb|ACJ70268.1| unknown, partial [Pinus sylvestris]
 gb|ACJ70269.1| unknown, partial [Pinus sylvestris]
 gb|ACJ70270.1| unknown, partial [Pinus sylvestris]
 gb|ACJ70271.1| unknown, partial [Pinus sylvestris]
 gb|ACJ70272.1| unknown, partial [Pinus sylvestris]
 gb|ACJ70273.1| unknown, partial [Pinus sylvestris]
 gb|ACJ70274.1| unknown, partial [Pinus sylvestris]
 gb|ACJ70275.1| unknown, partial [Pinus sylvestris]
 gb|ACJ70276.1| unknown, partial [Pinus sylvestris]
 gb|ACJ70277.1| unknown, partial [Pinus sylvestris]
 gb|ACJ70278.1| unknown, partial [Pinus sylvestris]
 gb|ACJ70279.1| unknown, partial [Pinus sylvestris]
 gb|ACJ70280.1| unknown, partial [Pinus sylvestris]
 gb|ACJ70281.1| unknown, partial [Pinus sylvestris]
 gb|ACJ70282.1| unknown, partial [Pinus sylvestris]
 gb|ACJ70283.1| unknown, partial [Pinus sylvestris]
 gb|ACJ70284.1| unknown, partial [Pinus sylvestris]
 gb|ACJ70285.1| unknown, partial [Pinus sylvestris]
 gb|ACJ70286.1| unknown, partial [Pinus sylvestris]
 gb|ACJ70287.1| unknown, partial [Pinus sylvestris]
 gb|ACJ70288.1| unknown, partial [Pinus sylvestris]
 gb|ACJ70289.1| unknown, partial [Pinus sylvestris]
 gb|ACJ70290.1| unknown, partial [Pinus sylvestris]
 gb|ACJ70291.1| unknown, partial [Pinus sylvestris]
 gb|ACJ70295.1| unknown, partial [Pinus sylvestris]
 gb|ACJ70296.1| unknown, partial [Pinus sylvestris]
 gb|ADV18882.1| unknown [Pinus mugo]
 gb|ADV18883.1| unknown [Pinus mugo]
 gb|ADV18884.1| unknown [Pinus mugo]
 gb|ADV18885.1| unknown [Pinus mugo]
 gb|ADV18886.1| unknown [Pinus mugo]
 gb|ADV18887.1| unknown [Pinus mugo]
 gb|ADV18888.1| unknown [Pinus mugo subsp. x rotundata]
 gb|ADV18889.1| unknown [Pinus mugo subsp. x rotundata]
 gb|ADV18890.1| unknown [Pinus mugo subsp. x rotundata]
 gb|ADV18891.1| unknown [Pinus mugo subsp. x rotundata]
 gb|ADV18892.1| unknown [Pinus mugo subsp. x rotundata]
 gb|ADV18893.1| unknown [Pinus mugo subsp. x rotundata]
 gb|ADV18894.1| unknown [Pinus mugo subsp. x rotundata]
 gb|ADV18895.1| unknown [Pinus mugo subsp. x rotundata]
 gb|ADV18896.1| unknown [Pinus mugo subsp. x rotundata]
 gb|ADV18897.1| unknown [Pinus mugo subsp. x rotundata]
 gb|ADV18898.1| unknown [Pinus mugo subsp. x rotundata]
 gb|ADV18899.1| unknown [Pinus mugo subsp. x rotundata]
 gb|ADV18900.1| unknown [Pinus mugo subsp. x rotundata]
 gb|ADV18901.1| unknown [Pinus mugo subsp. x rotundata]
 gb|ADV18902.1| unknown [Pinus mugo subsp. x rotundata]
 gb|ADV18903.1| unknown [Pinus mugo subsp. x rotundata]
Length=145

 Score =   140 bits (352),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 76/133 (57%), Positives = 100/133 (75%), Gaps = 0/133 (0%)
 Frame = +2

Query  86   QTAVNHRENAEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVWMkqkk  265
            Q A + R  AE+F    +CKQKS++LL E+ +P+GLLPL++  E G  +ETGFVW+KQKK
Sbjct  3    QVANDQRSGAEIFHGSEICKQKSMDLLAEMGLPKGLLPLEDLEESGYVKETGFVWLKQKK  62

Query  266  akehkfkkigkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPDPDAGKINF  445
              EH FKKIGK+V Y TE+TA+VE  ++K LTGVKSKELLLWVT++ ISI DP +GKI F
Sbjct  63   KTEHYFKKIGKMVQYGTEITAYVEQNKMKKLTGVKSKELLLWVTISEISIDDPSSGKIYF  122

Query  446  STPAGLSRSYPVS  484
             +  G+ +S+P S
Sbjct  123  KSVTGIGKSFPTS  135



>gb|AHG95265.1| hypothetical protein, partial [Pinus mugo subsp. x rotundata]
Length=143

 Score =   140 bits (352),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 76/133 (57%), Positives = 100/133 (75%), Gaps = 0/133 (0%)
 Frame = +2

Query  86   QTAVNHRENAEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVWMkqkk  265
            Q A + R  AE+F    +CKQKS++LL E+ +P+GLLPL++  E G  +ETGFVW+KQKK
Sbjct  3    QVANDQRSGAEIFHGSEICKQKSMDLLAEMGLPKGLLPLEDLEESGYVKETGFVWLKQKK  62

Query  266  akehkfkkigkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPDPDAGKINF  445
              EH FKKIGK+V Y TE+TA+VE  ++K LTGVKSKELLLWVT++ ISI DP +GKI F
Sbjct  63   KSEHYFKKIGKMVQYGTEITAYVEQNKMKKLTGVKSKELLLWVTISEISIDDPSSGKIYF  122

Query  446  STPAGLSRSYPVS  484
             +  G+ +S+P S
Sbjct  123  KSVTGIGKSFPTS  135



>gb|AHG95259.1| hypothetical protein, partial [Pinus sylvestris]
Length=143

 Score =   140 bits (352),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 76/133 (57%), Positives = 100/133 (75%), Gaps = 0/133 (0%)
 Frame = +2

Query  86   QTAVNHRENAEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVWMkqkk  265
            Q A + R  AE+F    +CKQKS++LL E+ +P+GLLPL++  E G  +ETGFVW+KQKK
Sbjct  3    QVANDQRSGAEIFHGSEICKQKSMDLLAEMGLPKGLLPLEDLEESGYVKETGFVWLKQKK  62

Query  266  akehkfkkigkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPDPDAGKINF  445
              EH FKKIGK+V Y TE+TA+VE  ++K LTGVKSKELLLWVT++ ISI DP +GKI F
Sbjct  63   KAEHYFKKIGKMVQYGTEITAYVEQNKMKKLTGVKSKELLLWVTISEISIDDPSSGKIYF  122

Query  446  STPAGLSRSYPVS  484
             +  G+ +S+P S
Sbjct  123  KSVTGIGKSFPTS  135



>gb|ACJ70263.1| unknown, partial [Pinus sylvestris]
Length=145

 Score =   140 bits (352),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 76/133 (57%), Positives = 99/133 (74%), Gaps = 0/133 (0%)
 Frame = +2

Query  86   QTAVNHRENAEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVWMkqkk  265
            Q A + R  AE+F    +CKQKS++LL E+ +P+GLLPL++  E G  +ETGFVW+KQKK
Sbjct  3    QVANDQRSGAEIFHGSEICKQKSMDLLAEMGLPKGLLPLEDLEESGYVKETGFVWLKQKK  62

Query  266  akehkfkkigkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPDPDAGKINF  445
              EH FKKIGK+V Y TE+TA+VE  ++K LTGVKSKELLLWVT++ ISI DP  GKI F
Sbjct  63   KTEHYFKKIGKMVQYGTEITAYVEQNKMKKLTGVKSKELLLWVTISEISIDDPSGGKIYF  122

Query  446  STPAGLSRSYPVS  484
             +  G+ +S+P S
Sbjct  123  KSVTGIGKSFPTS  135



>gb|AHG95242.1| hypothetical protein, partial [Pinus mugo]
 gb|AHG95243.1| hypothetical protein, partial [Pinus mugo]
 gb|AHG95245.1| hypothetical protein, partial [Pinus mugo]
 gb|AHG95252.1| hypothetical protein, partial [Pinus mugo]
 gb|AHG95254.1| hypothetical protein, partial [Pinus mugo]
 gb|AHG95255.1| hypothetical protein, partial [Pinus sylvestris]
 gb|AHG95256.1| hypothetical protein, partial [Pinus sylvestris]
 gb|AHG95257.1| hypothetical protein, partial [Pinus sylvestris]
 gb|AHG95258.1| hypothetical protein, partial [Pinus sylvestris]
 gb|AHG95260.1| hypothetical protein, partial [Pinus sylvestris]
 gb|AHG95263.1| hypothetical protein, partial [Pinus sylvestris]
 gb|AHG95264.1| hypothetical protein, partial [Pinus sylvestris]
Length=143

 Score =   139 bits (351),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 76/133 (57%), Positives = 100/133 (75%), Gaps = 0/133 (0%)
 Frame = +2

Query  86   QTAVNHRENAEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVWMkqkk  265
            Q A + R  AE+F    +CKQKS++LL E+ +P+GLLPL++  E G  +ETGFVW+KQKK
Sbjct  3    QVANDQRSGAEIFHGSEICKQKSMDLLAEMGLPKGLLPLEDLEESGYVKETGFVWLKQKK  62

Query  266  akehkfkkigkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPDPDAGKINF  445
              EH FKKIGK+V Y TE+TA+VE  ++K LTGVKSKELLLWVT++ ISI DP +GKI F
Sbjct  63   KTEHYFKKIGKMVQYGTEITAYVEQNKMKKLTGVKSKELLLWVTISEISIDDPSSGKIYF  122

Query  446  STPAGLSRSYPVS  484
             +  G+ +S+P S
Sbjct  123  KSVTGIGKSFPTS  135



>emb|CDM86616.1| unnamed protein product [Triticum aestivum]
Length=149

 Score =   140 bits (352),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 80/137 (58%), Positives = 101/137 (74%), Gaps = 1/137 (1%)
 Frame = +2

Query  74   MSSQQTAVNHRENAEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVWM  253
            M+SQ   VN RE AEV+   A+C +K++ELL E +MP GLLPL +  EVG NR TGFVW+
Sbjct  1    MASQVIEVN-REGAEVYHGAALCAEKAVELLAETNMPLGLLPLADIEEVGYNRSTGFVWL  59

Query  254  kqkkakehkfkkigkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPDPDAG  433
            +QKKA  H FK+IG+LV Y TEV AFVEDR++K +TGVKSKELL+WVT+  + I   D  
Sbjct  60   RQKKALTHTFKQIGRLVSYATEVMAFVEDRKMKRITGVKSKELLIWVTVCDMYIDKNDHS  119

Query  434  KINFSTPAGLSRSYPVS  484
            KI F TP GL R++P+S
Sbjct  120  KITFKTPTGLGRTFPIS  136



>gb|ACL51742.1| unknown, partial [Pinus pinaster]
Length=145

 Score =   139 bits (351),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 76/133 (57%), Positives = 100/133 (75%), Gaps = 0/133 (0%)
 Frame = +2

Query  86   QTAVNHRENAEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVWMkqkk  265
            Q A + R  AE+F    +CKQKS++LL E+ +P+GLLPL++  E G  +ETGFVW+KQKK
Sbjct  3    QVANDQRSGAEIFHGSEICKQKSMDLLAEMGLPKGLLPLEDLEESGYVKETGFVWLKQKK  62

Query  266  akehkfkkigkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPDPDAGKINF  445
              EH FKKIGK+V Y TE+TA+VE  ++K LTGVKSKELLLWVT++ ISI DP +GKI F
Sbjct  63   KTEHYFKKIGKMVQYGTEITAYVEQHKMKKLTGVKSKELLLWVTISEISIDDPSSGKIYF  122

Query  446  STPAGLSRSYPVS  484
             +  G+ +S+P S
Sbjct  123  KSVTGIGKSFPTS  135



>gb|ABK22777.1| unknown [Picea sitchensis]
Length=146

 Score =   139 bits (351),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 76/133 (57%), Positives = 98/133 (74%), Gaps = 0/133 (0%)
 Frame = +2

Query  86   QTAVNHRENAEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVWMkqkk  265
            Q A + R  AE++    +CKQKS ELL +I +P GLLPLDE  E G  +ETGFVW+KQKK
Sbjct  4    QVANDQRAGAEIYHGSEICKQKSKELLADIGLPTGLLPLDELEETGYVKETGFVWLKQKK  63

Query  266  akehkfkkigkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPDPDAGKINF  445
              EH+FKKIGK+V Y TE+TA+VE R++K LTGVKSKEL LW+T+  ISI DP +GKI F
Sbjct  64   KTEHQFKKIGKMVQYGTEITAYVEQRKMKKLTGVKSKELFLWITICEISIDDPSSGKIYF  123

Query  446  STPAGLSRSYPVS  484
             +  G+ +++P S
Sbjct  124  KSSTGVGKTFPAS  136



>gb|AHG95267.1| hypothetical protein, partial [Pinus mugo subsp. uncinata]
Length=143

 Score =   139 bits (351),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 76/133 (57%), Positives = 100/133 (75%), Gaps = 0/133 (0%)
 Frame = +2

Query  86   QTAVNHRENAEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVWMkqkk  265
            Q A + R  AE+F    +CKQKS++LL E+ +P+GLLPL++  E G  +ETGFVW+KQKK
Sbjct  3    QVANDQRSGAEIFHGSEICKQKSMDLLAEMGLPKGLLPLEDLDESGYVKETGFVWLKQKK  62

Query  266  akehkfkkigkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPDPDAGKINF  445
              EH FKKIGK+V Y TE+TA+VE  ++K LTGVKSKELLLWVT++ ISI DP +GKI F
Sbjct  63   KTEHYFKKIGKMVQYGTEITAYVEQNKMKKLTGVKSKELLLWVTISEISIDDPSSGKIYF  122

Query  446  STPAGLSRSYPVS  484
             +  G+ +S+P S
Sbjct  123  KSVTGIGKSFPTS  135



>gb|ACJ70297.1| unknown, partial [Pinus sylvestris]
 gb|ACL51740.1| unknown, partial [Pinus nigra]
 gb|ACL51744.1| unknown, partial [Pinus resinosa]
Length=145

 Score =   139 bits (351),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 75/133 (56%), Positives = 100/133 (75%), Gaps = 0/133 (0%)
 Frame = +2

Query  86   QTAVNHRENAEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVWMkqkk  265
            Q A + R  AE+F    +CKQKS++LL E+ +P+GLLPL++  E G  +ETGFVW+KQKK
Sbjct  3    QVANDQRSGAEIFHGSEICKQKSMDLLAEMGLPKGLLPLEDLEESGYVKETGFVWLKQKK  62

Query  266  akehkfkkigkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPDPDAGKINF  445
              EH FKKIGK+V Y TE+TA+VE  ++K LTGVKSKELLLW+T++ ISI DP +GKI F
Sbjct  63   KTEHYFKKIGKMVQYGTEITAYVEQNKMKKLTGVKSKELLLWITISEISIDDPSSGKIYF  122

Query  446  STPAGLSRSYPVS  484
             +  G+ +S+P S
Sbjct  123  KSVTGIGKSFPTS  135



>gb|AHG95266.1| hypothetical protein, partial [Pinus mugo subsp. uncinata]
Length=143

 Score =   139 bits (351),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 76/133 (57%), Positives = 100/133 (75%), Gaps = 0/133 (0%)
 Frame = +2

Query  86   QTAVNHRENAEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVWMkqkk  265
            Q A + R  AE+F    +CKQKS++LL E+ +P+GLLPL++  E G  +ETGFVW+KQKK
Sbjct  3    QVANDQRSGAEIFHGSEICKQKSMDLLAEMGLPKGLLPLEDLEESGYVKETGFVWLKQKK  62

Query  266  akehkfkkigkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPDPDAGKINF  445
              EH FKKIGK+V Y TE+TA+VE  ++K LTGVKSKELLLWVT++ ISI DP +GKI F
Sbjct  63   KTEHYFKKIGKMVQYGTEITAYVEQNKMKMLTGVKSKELLLWVTISEISIDDPSSGKIYF  122

Query  446  STPAGLSRSYPVS  484
             +  G+ +S+P S
Sbjct  123  KSVTGIGKSFPTS  135



>gb|AHG95249.1| hypothetical protein, partial [Pinus mugo]
Length=143

 Score =   139 bits (351),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 75/133 (56%), Positives = 100/133 (75%), Gaps = 0/133 (0%)
 Frame = +2

Query  86   QTAVNHRENAEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVWMkqkk  265
            Q A + R  AE+F    +CKQKS++LL E+ +P+GLLPL++  E G  +ETGFVW+KQKK
Sbjct  3    QVANDQRSGAEIFHGSEICKQKSMDLLAEMGLPKGLLPLEDLEESGYVKETGFVWLKQKK  62

Query  266  akehkfkkigkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPDPDAGKINF  445
              EH FKKIGK+V Y TE+TA+VE  ++K LTGVKSKELLLW+T++ ISI DP +GKI F
Sbjct  63   KTEHYFKKIGKMVQYGTEITAYVEQNKMKKLTGVKSKELLLWITISEISIDDPSSGKIYF  122

Query  446  STPAGLSRSYPVS  484
             +  G+ +S+P S
Sbjct  123  KSVTGIGKSFPTS  135



>ref|XP_004968604.1| PREDICTED: uncharacterized protein LOC101768810 [Setaria italica]
Length=172

 Score =   140 bits (353),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 77/135 (57%), Positives = 96/135 (71%), Gaps = 0/135 (0%)
 Frame = +2

Query  80   SQQTAVNHRENAEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVWMkq  259
              Q    HR  AEV+   A+C +KS ELL E+H+P GLLPL +  EVG NR TGFVW++Q
Sbjct  2    GSQAIEEHRAGAEVYHGAALCAEKSTELLSEVHLPLGLLPLADMEEVGYNRSTGFVWLRQ  61

Query  260  kkakehkfkkigkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPDPDAGKI  439
            KKA  H FK+IG+ V Y +EVTAFVEDRR+K +TGVK+KELL+WVTL+ + +   D  KI
Sbjct  62   KKALTHTFKQIGRQVSYASEVTAFVEDRRMKRMTGVKTKELLIWVTLSDMFLDKDDPSKI  121

Query  440  NFSTPAGLSRSYPVS  484
             F TP GL R+YP S
Sbjct  122  TFKTPTGLGRTYPAS  136



>gb|AHG95246.1| hypothetical protein, partial [Pinus mugo]
Length=143

 Score =   139 bits (350),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 76/133 (57%), Positives = 100/133 (75%), Gaps = 0/133 (0%)
 Frame = +2

Query  86   QTAVNHRENAEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVWMkqkk  265
            Q A + R  AE+F    +CKQKS++LL E+ +P+GLLPL++  E G  +ETGFVW+KQKK
Sbjct  3    QFANDQRSGAEIFHGSEICKQKSMDLLAEMGLPKGLLPLEDLEESGYVKETGFVWLKQKK  62

Query  266  akehkfkkigkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPDPDAGKINF  445
              EH FKKIGK+V Y TE+TA+VE  ++K LTGVKSKELLLWVT++ ISI DP +GKI F
Sbjct  63   KTEHYFKKIGKMVQYGTEITAYVEQNKMKKLTGVKSKELLLWVTISEISIDDPSSGKIYF  122

Query  446  STPAGLSRSYPVS  484
             +  G+ +S+P S
Sbjct  123  KSVTGIGKSFPTS  135



>ref|XP_006398312.1| hypothetical protein EUTSA_v10001064mg [Eutrema salsugineum]
 gb|ESQ39765.1| hypothetical protein EUTSA_v10001064mg [Eutrema salsugineum]
Length=143

 Score =   139 bits (349),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 70/137 (51%), Positives = 103/137 (75%), Gaps = 0/137 (0%)
 Frame = +2

Query  74   MSSQQTAVNHRENAEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVWM  253
            MS+Q+T  + RE AE+F   +VCKQK+ E+L  +++P+GLLPLD   E+G N+ TG+ W+
Sbjct  1    MSTQETKQDQREGAEIFNGGSVCKQKADEILSTMNLPKGLLPLDTMTEIGFNKSTGYFWI  60

Query  254  kqkkakehkfkkigkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPDPDAG  433
            K K   +H+FK IGK V YD+EVTAFVE+RR++ +TG+KSKELL+W T++ I + + D  
Sbjct  61   KMKNKVQHRFKGIGKTVSYDSEVTAFVENRRMRTITGIKSKELLIWFTVSEIFVDEQDPK  120

Query  434  KINFSTPAGLSRSYPVS  484
            +I+F+ P GL+RS+ VS
Sbjct  121  QISFANPTGLARSFLVS  137



>gb|ACJ70294.1| unknown, partial [Pinus sylvestris]
Length=145

 Score =   139 bits (349),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 75/133 (56%), Positives = 100/133 (75%), Gaps = 0/133 (0%)
 Frame = +2

Query  86   QTAVNHRENAEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVWMkqkk  265
            Q A + +  AE+F    +CKQKS++LL E+ +P+GLLPL++  E G  +ETGFVW+KQKK
Sbjct  3    QVANDQKSGAEIFHGSEICKQKSMDLLAEMGLPKGLLPLEDLEESGYVKETGFVWLKQKK  62

Query  266  akehkfkkigkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPDPDAGKINF  445
              EH FKKIGK+V Y TE+TA+VE  ++K LTGVKSKELLLWVT++ ISI DP +GKI F
Sbjct  63   KTEHYFKKIGKMVQYGTEITAYVEQNKMKKLTGVKSKELLLWVTISEISIDDPSSGKIYF  122

Query  446  STPAGLSRSYPVS  484
             +  G+ +S+P S
Sbjct  123  KSVTGIGKSFPTS  135



>gb|AHG95261.1| hypothetical protein, partial [Pinus sylvestris]
Length=143

 Score =   139 bits (349),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 75/133 (56%), Positives = 100/133 (75%), Gaps = 0/133 (0%)
 Frame = +2

Query  86   QTAVNHRENAEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVWMkqkk  265
            Q A + +  AE+F    +CKQKS++LL E+ +P+GLLPL++  E G  +ETGFVW+KQKK
Sbjct  3    QVANDQKSGAEIFHGSEICKQKSMDLLAEMGLPKGLLPLEDLEESGYVKETGFVWLKQKK  62

Query  266  akehkfkkigkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPDPDAGKINF  445
              EH FKKIGK+V Y TE+TA+VE  ++K LTGVKSKELLLWVT++ ISI DP +GKI F
Sbjct  63   KTEHYFKKIGKMVQYGTEITAYVEQNKMKKLTGVKSKELLLWVTISEISIDDPSSGKIYF  122

Query  446  STPAGLSRSYPVS  484
             +  G+ +S+P S
Sbjct  123  KSVTGIGKSFPTS  135



>ref|XP_003547206.1| PREDICTED: uncharacterized protein LOC100810285 [Glycine max]
Length=162

 Score =   139 bits (350),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 72/129 (56%), Positives = 100/129 (78%), Gaps = 0/129 (0%)
 Frame = +2

Query  98   NHRENAEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVWMkqkkakeh  277
            +HRE AE++   AVC QKS  LL+EI +PRGLLPL+  VE+G NR TGFVW+KQ+  KEH
Sbjct  8    HHREEAEIYEGEAVCTQKSRLLLDEILLPRGLLPLENIVEMGYNRTTGFVWLKQRHKKEH  67

Query  278  kfkkigkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPDPDAGKINFSTPA  457
            +F  IG+ V Y TEVTAFVE+ R++ +TGVK+KEL +WV+++ I + DP +GKI F+  +
Sbjct  68   RFATIGRTVSYATEVTAFVEEHRMRRVTGVKTKELFIWVSISEIFVDDPASGKITFANSS  127

Query  458  GLSRSYPVS  484
            G++RS+P+S
Sbjct  128  GIARSFPLS  136



>emb|CDM86928.1| unnamed protein product [Triticum aestivum]
Length=150

 Score =   139 bits (349),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 80/137 (58%), Positives = 101/137 (74%), Gaps = 1/137 (1%)
 Frame = +2

Query  74   MSSQQTAVNHRENAEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVWM  253
            M+SQ   VN RE AEV+   A+C +K++ELL E +MP GLLPL +  EVG  R TGFVW+
Sbjct  1    MASQAIEVN-REGAEVYHGAALCAEKAVELLAETNMPLGLLPLADIEEVGYIRSTGFVWL  59

Query  254  kqkkakehkfkkigkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPDPDAG  433
            +QKKA  H FK+IG+LV Y TEVTAFV+DR++K +TGVKSKELL+WVT+  + I   D  
Sbjct  60   RQKKALTHTFKQIGRLVSYATEVTAFVQDRKMKRITGVKSKELLIWVTVCDMYIDKNDHS  119

Query  434  KINFSTPAGLSRSYPVS  484
            KI F TP GL R++PVS
Sbjct  120  KITFKTPTGLGRTFPVS  136



>gb|ACG32637.1| hypothetical protein [Zea mays]
Length=169

 Score =   139 bits (350),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 77/137 (56%), Positives = 95/137 (69%), Gaps = 1/137 (1%)
 Frame = +2

Query  74   MSSQQTAVNHRENAEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVWM  253
            M SQ     HR  AEV+   A+C +KS ELL E H+P GLLPL +  EVG NR TGFVW+
Sbjct  1    MGSQAIEA-HRAGAEVYRGAALCAEKSTELLAEAHLPLGLLPLADMEEVGYNRATGFVWL  59

Query  254  kqkkakehkfkkigkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPDPDAG  433
            +Q+KA  H F+ I + V Y  EVTAFVEDRR+K +TGVK+KELL+WVTL+ + +   D  
Sbjct  60   RQRKALTHTFRPIARQVSYAAEVTAFVEDRRMKRMTGVKTKELLIWVTLSDMFVDRDDPS  119

Query  434  KINFSTPAGLSRSYPVS  484
            KI F TP GL R+YPVS
Sbjct  120  KITFKTPTGLGRTYPVS  136



>gb|AHG95248.1| hypothetical protein, partial [Pinus mugo]
Length=143

 Score =   138 bits (348),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 75/133 (56%), Positives = 100/133 (75%), Gaps = 0/133 (0%)
 Frame = +2

Query  86   QTAVNHRENAEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVWMkqkk  265
            Q A + R  AE+F    +CKQKS++LL E+ +P+GLLPL++  E G  +ETGFVW+KQKK
Sbjct  3    QVANDQRSGAEIFHGSEICKQKSMDLLAEMGLPKGLLPLEDLEESGYVKETGFVWLKQKK  62

Query  266  akehkfkkigkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPDPDAGKINF  445
              EH FKKIGK+V Y TE+TA+VE  ++K LTGVKSKELLLWVT++ ISI DP +GKI F
Sbjct  63   KTEHYFKKIGKMVQYGTEITAYVEQNKMKKLTGVKSKELLLWVTISEISIDDPSSGKIYF  122

Query  446  STPAGLSRSYPVS  484
             +  G+ +S+P +
Sbjct  123  KSVTGIGKSFPTN  135



>gb|KHN33145.1| hypothetical protein glysoja_010136 [Glycine soja]
Length=162

 Score =   139 bits (349),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 72/129 (56%), Positives = 100/129 (78%), Gaps = 0/129 (0%)
 Frame = +2

Query  98   NHRENAEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVWMkqkkakeh  277
            +HRE AE++   AVC QKS  LL+EI +PRGLLPL+  VE+G NR TGFVW+KQ+  KEH
Sbjct  8    HHREEAEIYEGEAVCTQKSRLLLDEILLPRGLLPLENIVEMGYNRTTGFVWLKQRHKKEH  67

Query  278  kfkkigkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPDPDAGKINFSTPA  457
            +F  IG+ V Y TEVTAFVE+ R++ +TGVK+KEL +WV+++ I + DP +GKI F+  +
Sbjct  68   RFATIGRTVSYATEVTAFVEEHRMRRVTGVKTKELFIWVSISEIFVDDPASGKITFANSS  127

Query  458  GLSRSYPVS  484
            G++RS+P+S
Sbjct  128  GIARSFPLS  136



>gb|ACG48493.1| hypothetical protein [Zea mays]
Length=169

 Score =   139 bits (349),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 73/128 (57%), Positives = 92/128 (72%), Gaps = 0/128 (0%)
 Frame = +2

Query  101  HRENAEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVWMkqkkakehk  280
            HR  AEV+   A+C +KS ELL E H+P GLLPL +  EVG NR TGFVW++Q+K+  H 
Sbjct  9    HRAGAEVYRGAALCAEKSTELLAEAHLPLGLLPLADMEEVGYNRATGFVWLRQRKSLTHT  68

Query  281  fkkigkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPDPDAGKINFSTPAG  460
            F+ I + V Y  EVTAFVEDRR+K +TGVK+KELL+WVTL+ + +   D  KI F TP G
Sbjct  69   FRPIARQVSYAAEVTAFVEDRRMKRMTGVKTKELLIWVTLSDMFVDRDDPSKITFKTPTG  128

Query  461  LSRSYPVS  484
            L R+YPVS
Sbjct  129  LGRTYPVS  136



>gb|ACF85015.1| unknown [Zea mays]
 gb|ACG33668.1| hypothetical protein [Zea mays]
 tpg|DAA52882.1| TPA: hypothetical protein ZEAMMB73_173148 [Zea mays]
Length=169

 Score =   138 bits (347),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 75/137 (55%), Positives = 95/137 (69%), Gaps = 1/137 (1%)
 Frame = +2

Query  74   MSSQQTAVNHRENAEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVWM  253
            M SQ     HR  AEV+   A+C +KS ELL E H+P GLLPL +  EVG NR TGFVW+
Sbjct  1    MGSQAIEA-HRAGAEVYRGAALCAEKSTELLAEAHLPLGLLPLADMEEVGYNRATGFVWL  59

Query  254  kqkkakehkfkkigkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPDPDAG  433
            +Q+K+  H F+ I + V Y  EVTAFVEDRR++ +TGVK+KELL+WVTL+ + +   D  
Sbjct  60   RQRKSLTHTFRPIARQVSYAAEVTAFVEDRRMRRMTGVKTKELLIWVTLSDMFVDRDDPS  119

Query  434  KINFSTPAGLSRSYPVS  484
            KI F TP GL R+YPVS
Sbjct  120  KITFKTPTGLGRTYPVS  136



>emb|CDM86613.1| unnamed protein product [Triticum aestivum]
Length=150

 Score =   137 bits (346),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 80/137 (58%), Positives = 100/137 (73%), Gaps = 1/137 (1%)
 Frame = +2

Query  74   MSSQQTAVNHRENAEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVWM  253
            M+SQ   VN R  AEV+   A+C  K++ELL E +MP GLLPL +  EVG NR TGFVW+
Sbjct  1    MASQVIEVN-RNGAEVYHGAALCADKAVELLAETNMPLGLLPLADIEEVGYNRSTGFVWL  59

Query  254  kqkkakehkfkkigkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPDPDAG  433
            +QKKA  H FK+IG+LV Y TEVTAFVEDR++K +TGVKSKELL+WVT+  + I      
Sbjct  60   RQKKALTHTFKQIGRLVSYATEVTAFVEDRKMKRITGVKSKELLIWVTVCDMYIDKNKHS  119

Query  434  KINFSTPAGLSRSYPVS  484
            KI+F TP GL R++PVS
Sbjct  120  KISFKTPTGLGRTFPVS  136



>ref|XP_004134915.1| PREDICTED: uncharacterized protein LOC101215500 [Cucumis sativus]
Length=147

 Score =   137 bits (345),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 68/130 (52%), Positives = 98/130 (75%), Gaps = 0/130 (0%)
 Frame = +2

Query  95   VNHRENAEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVWMkqkkake  274
              HR +AE++   A+CKQKS +LL++  +PRGLLPL++ +EVG NR +GF+W+KQ+K KE
Sbjct  6    ATHRADAEIYYGDAICKQKSQDLLDQFFLPRGLLPLNDILEVGYNRTSGFIWLKQQKKKE  65

Query  275  hkfkkigkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPDPDAGKINFSTP  454
            H+F  IG+ V YDTEV+AF+E+RR + LTGVKSKE  LW+T++ I +   +  KI F T 
Sbjct  66   HRFPAIGRTVLYDTEVSAFIEERRFRRLTGVKSKEFFLWITVSEIYVDQQNTSKITFGTS  125

Query  455  AGLSRSYPVS  484
             G+++S+PVS
Sbjct  126  TGIAKSFPVS  135



>dbj|BAK01617.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ87217.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK03502.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=159

 Score =   137 bits (346),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 77/133 (58%), Positives = 96/133 (72%), Gaps = 0/133 (0%)
 Frame = +2

Query  86   QTAVNHRENAEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVWMkqkk  265
            Q     RE AEV+   A+C +K++ELL E +MP GLLPL +  EVG NR TGFVW++QKK
Sbjct  3    QAIEAQREGAEVYHGAALCAEKAVELLAETNMPLGLLPLADMEEVGYNRATGFVWLRQKK  62

Query  266  akehkfkkigkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPDPDAGKINF  445
            A  H FK+IG+ V Y TEVTAFVEDR++K +TGVKSKELL+W+TL  + I   D  KI F
Sbjct  63   ALTHTFKQIGRQVSYATEVTAFVEDRKMKRMTGVKSKELLIWITLCDMFIDKDDPSKITF  122

Query  446  STPAGLSRSYPVS  484
             TP GL R++PVS
Sbjct  123  KTPTGLGRTFPVS  135



>ref|XP_009360970.1| PREDICTED: uncharacterized protein LOC103951344 [Pyrus x bretschneideri]
Length=145

 Score =   137 bits (345),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 77/138 (56%), Positives = 105/138 (76%), Gaps = 2/138 (1%)
 Frame = +2

Query  74   MSSQQTAVNHRENAEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVWM  253
            MS+QQ A +HRE+AE++   A+C+QKS ELL ++ +PRGLLPLD+ VE G N  +GFVW+
Sbjct  1    MSAQQIA-SHREDAEIYHGEALCRQKSRELLNKMCLPRGLLPLDDVVEFGYNHTSGFVWL  59

Query  254  kqkkakehkfkkigkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISI-PDPDA  430
            KQKK KEH+F+ I K V YDTEV  FVE+ R++ L+GVKSKELL+WV+++ I + P+ D 
Sbjct  60   KQKKRKEHRFRAISKTVSYDTEVMGFVEEHRMRRLSGVKSKELLIWVSISDIYVDPNSDL  119

Query  431  GKINFSTPAGLSRSYPVS  484
             KI F+   GLSRS+P +
Sbjct  120  DKITFTNGTGLSRSFPAT  137



>ref|XP_008439638.1| PREDICTED: uncharacterized protein LOC103484371 [Cucumis melo]
Length=147

 Score =   137 bits (345),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 69/125 (55%), Positives = 96/125 (77%), Gaps = 0/125 (0%)
 Frame = +2

Query  110  NAEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVWMkqkkakehkfkk  289
            +AE++   A+CKQKS ELL++  +PRGLLPLD+ +EVG NR +GF+W+KQ+K KEH+F  
Sbjct  11   DAEIYNGDAICKQKSQELLDQFFLPRGLLPLDDILEVGYNRTSGFIWLKQQKKKEHRFPA  70

Query  290  igkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPDPDAGKINFSTPAGLSR  469
            IG+ V YDTEVTAF+E+RR + LTGVKSKE   W+T++ I I + +  KI F T  G+++
Sbjct  71   IGRTVLYDTEVTAFIEERRFRRLTGVKSKEFFFWITVSDIYIDEQNTSKITFGTSTGIAK  130

Query  470  SYPVS  484
            S+PVS
Sbjct  131  SFPVS  135



>gb|ACJ70292.1| unknown, partial [Pinus sylvestris]
Length=145

 Score =   137 bits (344),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 75/133 (56%), Positives = 99/133 (74%), Gaps = 0/133 (0%)
 Frame = +2

Query  86   QTAVNHRENAEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVWMkqkk  265
            Q A + R  AE+     +CKQKS++LL E+ +P+GLLPL++  E G  +ETGFVW+KQKK
Sbjct  3    QVANDQRSGAEIVHGSEICKQKSMDLLAEMGLPKGLLPLEDLEESGYVKETGFVWLKQKK  62

Query  266  akehkfkkigkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPDPDAGKINF  445
              EH FKKIGK+V Y TE+TA+VE  ++K LTGVKSKELLLWVT++ ISI DP +GKI F
Sbjct  63   KTEHYFKKIGKMVQYGTEITAYVEQNKMKKLTGVKSKELLLWVTISEISIDDPSSGKIYF  122

Query  446  STPAGLSRSYPVS  484
             +  G+ +S+P S
Sbjct  123  KSVTGIGKSFPTS  135



>gb|AHG95250.1| hypothetical protein, partial [Pinus mugo]
 gb|AHG95262.1| hypothetical protein, partial [Pinus sylvestris]
Length=143

 Score =   137 bits (344),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 75/133 (56%), Positives = 99/133 (74%), Gaps = 0/133 (0%)
 Frame = +2

Query  86   QTAVNHRENAEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVWMkqkk  265
            Q A + R  AE+     +CKQKS++LL E+ +P+GLLPL++  E G  +ETGFVW+KQKK
Sbjct  3    QVANDQRSGAEIVHGSEICKQKSMDLLAEMGLPKGLLPLEDLEESGYVKETGFVWLKQKK  62

Query  266  akehkfkkigkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPDPDAGKINF  445
              EH FKKIGK+V Y TE+TA+VE  ++K LTGVKSKELLLWVT++ ISI DP +GKI F
Sbjct  63   KTEHYFKKIGKMVQYGTEITAYVEQNKMKKLTGVKSKELLLWVTISEISIDDPSSGKIYF  122

Query  446  STPAGLSRSYPVS  484
             +  G+ +S+P S
Sbjct  123  KSVTGIGKSFPTS  135



>gb|AHG95247.1| hypothetical protein, partial [Pinus mugo]
Length=143

 Score =   137 bits (344),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 75/133 (56%), Positives = 99/133 (74%), Gaps = 0/133 (0%)
 Frame = +2

Query  86   QTAVNHRENAEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVWMkqkk  265
            Q A + R  AE+     +CKQKS++LL E+ +P+GLLPL++  E G  +ETGFVW+KQKK
Sbjct  3    QVANDQRSGAEIVHGSEICKQKSMDLLAEMGLPKGLLPLEDLEESGYVKETGFVWLKQKK  62

Query  266  akehkfkkigkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPDPDAGKINF  445
              EH FKKIGK+V Y TE+TA+VE  ++K LTGVKSKELLLWVT++ ISI DP +GKI F
Sbjct  63   KTEHYFKKIGKMVQYGTEITAYVEQNKMKKLTGVKSKELLLWVTISEISIDDPSSGKIYF  122

Query  446  STPAGLSRSYPVS  484
             +  G+ +S+P S
Sbjct  123  KSVTGIGKSFPTS  135



>gb|AHG95253.1| hypothetical protein, partial [Pinus mugo]
Length=143

 Score =   136 bits (343),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 75/133 (56%), Positives = 99/133 (74%), Gaps = 0/133 (0%)
 Frame = +2

Query  86   QTAVNHRENAEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVWMkqkk  265
            Q A + R  AE+F    +CKQKS++LL E+ +P+GLLPL++  E G  +ETGFVW+KQKK
Sbjct  3    QVANDQRSGAEIFHGSEICKQKSMDLLAEMGLPKGLLPLEDLEESGYVKETGFVWLKQKK  62

Query  266  akehkfkkigkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPDPDAGKINF  445
              EH FKKIGK+V Y TE+TA+VE  ++K LTGVKSKELLLWVT++ ISI D  +GKI F
Sbjct  63   KTEHYFKKIGKMVQYGTEITAYVEQNKMKKLTGVKSKELLLWVTISEISIDDRSSGKIYF  122

Query  446  STPAGLSRSYPVS  484
             +  G+ +S+P S
Sbjct  123  KSVTGIGKSFPTS  135



>emb|CDM86617.1| unnamed protein product [Triticum aestivum]
Length=150

 Score =   137 bits (344),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 80/137 (58%), Positives = 100/137 (73%), Gaps = 1/137 (1%)
 Frame = +2

Query  74   MSSQQTAVNHRENAEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVWM  253
            M+SQ   VN R +AEV+   A+C  K++ELL E +MP GLLPL    EVG NR TGFVW+
Sbjct  1    MASQVIEVN-RNDAEVYHGAALCADKAVELLAETNMPLGLLPLAGIEEVGYNRSTGFVWL  59

Query  254  kqkkakehkfkkigkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPDPDAG  433
            +QKKA  H FK+IG+LV Y TEVTAFVEDR++K +TGVKSKELL+WVT+  + I      
Sbjct  60   RQKKALTHTFKQIGRLVSYATEVTAFVEDRKMKRITGVKSKELLIWVTVCDMYIDKNKHS  119

Query  434  KINFSTPAGLSRSYPVS  484
            KI+F TP GL R++PVS
Sbjct  120  KISFKTPTGLGRTFPVS  136



>gb|AHG95268.1| hypothetical protein, partial [Pinus mugo subsp. uncinata]
Length=143

 Score =   136 bits (343),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 75/133 (56%), Positives = 99/133 (74%), Gaps = 0/133 (0%)
 Frame = +2

Query  86   QTAVNHRENAEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVWMkqkk  265
            Q A + R  AE+F    +CKQKS++LL E+ +P+GLLPL++  E G  +ET FVW+KQKK
Sbjct  3    QVANDQRSGAEIFHGSEICKQKSMDLLAEMGLPKGLLPLEDLEESGYVKETDFVWLKQKK  62

Query  266  akehkfkkigkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPDPDAGKINF  445
              EH FKKIGK+V Y TE+TA+VE  ++K LTGVKSKELLLWVT++ ISI DP +GKI F
Sbjct  63   KTEHYFKKIGKMVQYGTEITAYVEQNKMKKLTGVKSKELLLWVTISEISIDDPSSGKIYF  122

Query  446  STPAGLSRSYPVS  484
             +  G+ +S+P S
Sbjct  123  KSVTGIGKSFPTS  135



>ref|NP_568659.1| uncharacterized protein [Arabidopsis thaliana]
 dbj|BAB11078.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAM62731.1| unknown [Arabidopsis thaliana]
 gb|ABH04448.1| At5g46230 [Arabidopsis thaliana]
 gb|AED95355.1| uncharacterized protein AT5G46230 [Arabidopsis thaliana]
Length=143

 Score =   136 bits (343),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 68/137 (50%), Positives = 100/137 (73%), Gaps = 0/137 (0%)
 Frame = +2

Query  74   MSSQQTAVNHRENAEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVWM  253
            MSSQ+T  + RE AE+    + CKQK+ E+L  +++P+GLLPLD   E+G N+ TG+VW+
Sbjct  1    MSSQETKSDQREGAEICNGESNCKQKAKEILSTMNLPKGLLPLDNMTEIGHNKSTGYVWI  60

Query  254  kqkkakehkfkkigkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPDPDAG  433
            K K   +H+FK IG+ V YD+EVTA +E+RR+  LTG+KSKE+L+WVT++ I +   D  
Sbjct  61   KIKNKVQHRFKAIGRNVSYDSEVTAILENRRMSQLTGIKSKEILIWVTISEIFVNHQDPT  120

Query  434  KINFSTPAGLSRSYPVS  484
            +I F+ P GLSR++PV+
Sbjct  121  QITFANPTGLSRTFPVT  137



>ref|XP_007212828.1| hypothetical protein PRUPE_ppa020725mg [Prunus persica]
 gb|EMJ14027.1| hypothetical protein PRUPE_ppa020725mg [Prunus persica]
Length=152

 Score =   136 bits (343),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 81/153 (53%), Positives = 114/153 (75%), Gaps = 2/153 (1%)
 Frame = +2

Query  74   MSSQQTAVNHRENAEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVWM  253
            MS QQ   +HRE+AE++   A+CKQKS ELL+++ +PR LLPLD+ +E G N  +GFVW+
Sbjct  1    MSGQQID-SHREDAEIYHGEALCKQKSHELLDKMSLPRALLPLDDVLEFGYNHTSGFVWL  59

Query  254  kqkkakehkfkkigkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISI-PDPDA  430
            KQKK KEH+F+ IGK+V YDTEVT FVE+ R++ L+GVKSKELL+WV+++ I + P+ + 
Sbjct  60   KQKKKKEHRFQAIGKMVSYDTEVTGFVEEHRMRRLSGVKSKELLIWVSISDIYVDPNSNP  119

Query  431  GKINFSTPAGLSRSYPVSafeedaaaadGDQKK  529
             KI F+   G+SRS+PV+AF  +    + D KK
Sbjct  120  DKITFANGTGISRSFPVTAFGLEEEEKNADGKK  152



>gb|KGN49395.1| hypothetical protein Csa_6G523360 [Cucumis sativus]
Length=189

 Score =   137 bits (345),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 68/128 (53%), Positives = 98/128 (77%), Gaps = 0/128 (0%)
 Frame = +2

Query  101  HRENAEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVWMkqkkakehk  280
            HR +AE++   A+CKQKS +LL++  +PRGLLPL++ +EVG NR +GF+W+KQ+K KEH+
Sbjct  50   HRADAEIYYGDAICKQKSQDLLDQFFLPRGLLPLNDILEVGYNRTSGFIWLKQQKKKEHR  109

Query  281  fkkigkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPDPDAGKINFSTPAG  460
            F  IG+ V YDTEV+AF+E+RR + LTGVKSKE  LW+T++ I +   +  KI F T  G
Sbjct  110  FPAIGRTVLYDTEVSAFIEERRFRRLTGVKSKEFFLWITVSEIYVDQQNTSKITFGTSTG  169

Query  461  LSRSYPVS  484
            +++S+PVS
Sbjct  170  IAKSFPVS  177



>dbj|BAJ89761.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=162

 Score =   136 bits (342),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 75/128 (59%), Positives = 95/128 (74%), Gaps = 0/128 (0%)
 Frame = +2

Query  101  HRENAEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVWMkqkkakehk  280
             RE AEV+   A+C +K++ELL E ++P GLLPL +  EVG NR TGFVW++QKKA  H 
Sbjct  8    QREGAEVYHGAALCAEKAVELLAETNLPLGLLPLADIEEVGYNRATGFVWLRQKKALTHT  67

Query  281  fkkigkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPDPDAGKINFSTPAG  460
            FK+IG+ V Y TEVTAFVEDR++K +TGVKSKELL+W+TL  + I   D  KI F TP G
Sbjct  68   FKQIGRQVSYATEVTAFVEDRKMKRMTGVKSKELLIWITLCDMYIDKDDPSKITFKTPTG  127

Query  461  LSRSYPVS  484
            L R++PVS
Sbjct  128  LRRTFPVS  135



>dbj|BAD43334.1| unknown protein [Arabidopsis thaliana]
Length=143

 Score =   135 bits (340),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 67/137 (49%), Positives = 100/137 (73%), Gaps = 0/137 (0%)
 Frame = +2

Query  74   MSSQQTAVNHRENAEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVWM  253
            MSSQ+T  + RE AE+    + CKQ++ E+L  +++P+GLLPLD   E+G N+ TG+VW+
Sbjct  1    MSSQETKSDQREGAEICNGESNCKQRAKEILSTMNLPKGLLPLDNMTEIGHNKSTGYVWI  60

Query  254  kqkkakehkfkkigkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPDPDAG  433
            K K   +H+FK IG+ V YD+EVTA +E+RR+  LTG+KSKE+L+WVT++ I +   D  
Sbjct  61   KIKNKVQHRFKAIGRNVSYDSEVTAILENRRMSQLTGIKSKEILIWVTISEIFVNHQDPT  120

Query  434  KINFSTPAGLSRSYPVS  484
            +I F+ P GLSR++PV+
Sbjct  121  QITFANPTGLSRTFPVT  137



>gb|KJB66926.1| hypothetical protein B456_010G166300 [Gossypium raimondii]
Length=147

 Score =   135 bits (340),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 67/128 (52%), Positives = 100/128 (78%), Gaps = 0/128 (0%)
 Frame = +2

Query  98   NHRENAEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVWMkqkkakeh  277
            +HRE AE++   A+C QK+ EL ++  +P+GLLP+++  E+G N  TGF+W++Q+K  E 
Sbjct  10   SHREQAEIYNGEALCNQKARELFDKFRLPKGLLPMNDLNEMGFNSITGFLWLRQQKKSEF  69

Query  278  kfkkigkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPDPDAGKINFSTPA  457
            KFK IGK V Y+TEVTAFVEDRR++ LTG+K+KE+++W+T++ ISI D D  KI FS+ +
Sbjct  70   KFKSIGKTVAYETEVTAFVEDRRMRRLTGIKTKEMMIWITISDISIDDNDPTKITFSSSS  129

Query  458  GLSRSYPV  481
            GLS+++PV
Sbjct  130  GLSKTFPV  137



>gb|ACJ70293.1| unknown, partial [Pinus sylvestris]
Length=145

 Score =   134 bits (337),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 74/133 (56%), Positives = 98/133 (74%), Gaps = 0/133 (0%)
 Frame = +2

Query  86   QTAVNHRENAEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVWMkqkk  265
            Q A + R  AE+     +C QKS++LL E+ +P+GLLPL++  E G  +ETGFVW+KQKK
Sbjct  3    QVANDQRSGAEIVHGSEICMQKSMDLLAEMGLPKGLLPLEDLEESGYVKETGFVWLKQKK  62

Query  266  akehkfkkigkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPDPDAGKINF  445
              EH FKKIGK+V Y TE+TA+VE  ++K LTGVKSKELLLWVT++ ISI DP +GKI F
Sbjct  63   KTEHYFKKIGKMVQYGTEITAYVEQNKMKKLTGVKSKELLLWVTISEISIDDPSSGKIYF  122

Query  446  STPAGLSRSYPVS  484
             +  G+ +S+P S
Sbjct  123  KSVTGIGKSFPTS  135



>ref|XP_009411053.1| PREDICTED: uncharacterized protein LOC103992884 [Musa acuminata 
subsp. malaccensis]
Length=142

 Score =   134 bits (337),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 70/133 (53%), Positives = 95/133 (71%), Gaps = 0/133 (0%)
 Frame = +2

Query  86   QTAVNHRENAEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVWMkqkk  265
             T  +HR  AEVFT  A+C++KS++LL+E+ +PRGL PL++  E G NR  GF+W+ QKK
Sbjct  4    HTIESHRHGAEVFTGDALCRKKSIQLLQELELPRGLFPLEDIQEFGYNRAAGFIWLIQKK  63

Query  266  akehkfkkigkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPDPDAGKINF  445
              +H FKKI + V Y  EVTAFVE R++  +TGVK+KELLLW+++  + + DP  GKI F
Sbjct  64   KHDHTFKKIKRAVSYAPEVTAFVEKRKMHKMTGVKTKELLLWLSVVEMRVEDPSTGKITF  123

Query  446  STPAGLSRSYPVS  484
             T  GLS S+PVS
Sbjct  124  KTGTGLSDSFPVS  136



>ref|XP_009411054.1| PREDICTED: uncharacterized protein LOC103992885 [Musa acuminata 
subsp. malaccensis]
Length=142

 Score =   134 bits (337),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 70/133 (53%), Positives = 95/133 (71%), Gaps = 0/133 (0%)
 Frame = +2

Query  86   QTAVNHRENAEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVWMkqkk  265
             T  +HR  AEVFT  A+C++KS++LL+E+ +PRGL PL++  E G NR  GF+W+ QKK
Sbjct  4    HTIESHRHGAEVFTGDALCRKKSIQLLQELELPRGLFPLEDIQEFGYNRAAGFIWLIQKK  63

Query  266  akehkfkkigkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPDPDAGKINF  445
              +H FKKI + V Y  EVTAFVE R++  +TGVK+KELLLW+++  + + DP  GKI F
Sbjct  64   KNDHTFKKIKRAVSYAPEVTAFVEKRKMHRMTGVKTKELLLWLSVVEMRVEDPSTGKITF  123

Query  446  STPAGLSRSYPVS  484
             T  GLS S+PVS
Sbjct  124  KTGTGLSDSFPVS  136



>ref|XP_010942813.1| PREDICTED: uncharacterized protein LOC105060703 [Elaeis guineensis]
Length=140

 Score =   134 bits (336),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 72/135 (53%), Positives = 98/135 (73%), Gaps = 0/135 (0%)
 Frame = +2

Query  80   SQQTAVNHRENAEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVWMkq  259
            + QT  N+RE AE +   A+CK+KS++LLEE+ +P+GL PL++  E G N   GF+W+ Q
Sbjct  2    ASQTIENYREGAETYQGNALCKKKSIQLLEELGLPKGLFPLEDMEEFGYNHAAGFIWLIQ  61

Query  260  kkakehkfkkigkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPDPDAGKI  439
            KK KEH FKKI + V Y TEVTAFVE R++K +TGVK+KELLLW+++  + I DP + KI
Sbjct  62   KKKKEHMFKKIKQTVSYATEVTAFVEQRKMKKITGVKTKELLLWLSVVEVYIDDPSSEKI  121

Query  440  NFSTPAGLSRSYPVS  484
             F T  GLS S+P+S
Sbjct  122  TFKTGTGLSDSFPLS  136



>ref|XP_009411055.1| PREDICTED: uncharacterized protein LOC103992886 [Musa acuminata 
subsp. malaccensis]
Length=142

 Score =   133 bits (335),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 69/128 (54%), Positives = 93/128 (73%), Gaps = 0/128 (0%)
 Frame = +2

Query  101  HRENAEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVWMkqkkakehk  280
            HR  AEVFT  A+C++KS++LL+E+ +PRGL PL++  E G NR  GF+W+ QKK  +H 
Sbjct  9    HRHGAEVFTGDALCRKKSIQLLQELELPRGLFPLEDIQEFGYNRAAGFIWLIQKKKNDHT  68

Query  281  fkkigkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPDPDAGKINFSTPAG  460
            FKKI + V Y  EVTAFVE R++  +TGVK+KELLLW+++  + + DP  GKI F T  G
Sbjct  69   FKKIKRAVSYAPEVTAFVEKRKMHKMTGVKTKELLLWLSVVEMRVEDPSTGKITFKTGTG  128

Query  461  LSRSYPVS  484
            LS S+PVS
Sbjct  129  LSDSFPVS  136



>gb|KJB81128.1| hypothetical protein B456_013G130500 [Gossypium raimondii]
Length=150

 Score =   134 bits (336),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 78/124 (63%), Positives = 93/124 (75%), Gaps = 0/124 (0%)
 Frame = +2

Query  113  AEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVWMkqkkakehkfkki  292
            +EV+    +C+ KS  LLEE+ MPRGLLPL +  E G  +ETGFVW+KQKK+  HKF+KI
Sbjct  13   SEVYRGDEICQVKSKSLLEEMGMPRGLLPLKDIEECGYVKETGFVWLKQKKSITHKFEKI  72

Query  293  gkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPDPDAGKINFSTPAGLSRS  472
            GK V Y TEVTA +E  R+K L GVKSKELL+WVTL+ I + DP  GKI F TPAGLSRS
Sbjct  73   GKPVSYATEVTAVIEKNRIKKLNGVKSKELLIWVTLSDIYVDDPATGKITFKTPAGLSRS  132

Query  473  YPVS  484
            YPVS
Sbjct  133  YPVS  136



>ref|XP_008812280.1| PREDICTED: uncharacterized protein LOC103723209 [Phoenix dactylifera]
Length=141

 Score =   133 bits (335),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 75/135 (56%), Positives = 95/135 (70%), Gaps = 0/135 (0%)
 Frame = +2

Query  80   SQQTAVNHRENAEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVWMkq  259
            S QT  +HRE AEV+    +CK+ S++LLEE+ +PRGL PL+   E G NR  GF+W+ Q
Sbjct  2    SSQTIESHREGAEVYRGDDLCKKNSIQLLEEVGLPRGLFPLENVEEFGYNRAAGFMWLIQ  61

Query  260  kkakehkfkkigkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPDPDAGKI  439
            KK KEH FKKI + V Y TEVTAFVE R+LK +TGVK+KELLLW+++  + I D    KI
Sbjct  62   KKKKEHTFKKIKQTVAYATEVTAFVEQRKLKKITGVKTKELLLWLSVVEVYIDDASTEKI  121

Query  440  NFSTPAGLSRSYPVS  484
             F T  GLS S+PVS
Sbjct  122  TFKTGTGLSDSFPVS  136



>ref|XP_008225480.1| PREDICTED: uncharacterized protein LOC103325123 [Prunus mume]
Length=152

 Score =   133 bits (335),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 75/138 (54%), Positives = 106/138 (77%), Gaps = 2/138 (1%)
 Frame = +2

Query  74   MSSQQTAVNHRENAEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVWM  253
            MS QQ   +H+E+AE++   A+CKQKS ELL+++ +PR LLPLD+ +E G N  +GFVW+
Sbjct  1    MSGQQID-SHKEDAEIYHGEALCKQKSHELLDKMSLPRALLPLDDVLEFGYNHTSGFVWL  59

Query  254  kqkkakehkfkkigkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISI-PDPDA  430
            KQKK KEH+F  IGK+V YDTEVT FVE+ R++ L+GVKSKELL+WV+++ I + P+ + 
Sbjct  60   KQKKKKEHRFHAIGKMVSYDTEVTGFVEEHRMRRLSGVKSKELLIWVSISDIYVDPNSNP  119

Query  431  GKINFSTPAGLSRSYPVS  484
             KI F+   G+SRS+PV+
Sbjct  120  DKITFANGTGISRSFPVT  137



>ref|XP_004486287.1| PREDICTED: uncharacterized protein LOC101492346 [Cicer arietinum]
Length=152

 Score =   133 bits (335),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 69/139 (50%), Positives = 100/139 (72%), Gaps = 2/139 (1%)
 Frame = +2

Query  74   MSSQQTAV--NHRENAEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFV  247
            M+S+Q  +    R+ AE++   A+CKQKS  LL+EI  P+GLLPLD  VE+G NR TGFV
Sbjct  1    MASEQHQIIEQQRDEAEIYEGEAMCKQKSQLLLDEILFPKGLLPLDNIVEMGYNRVTGFV  60

Query  248  WMkqkkakehkfkkigkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPDPD  427
            W+KQ+  K H+F  IG+ V++DTE+TAFVE+  ++ +TGVK+KE  +W T+T I + DP 
Sbjct  61   WLKQRHEKVHRFNSIGRTVFFDTEITAFVEEHHMRRITGVKTKEFFVWFTITEIFVNDPS  120

Query  428  AGKINFSTPAGLSRSYPVS  484
            + KI F+  +G++RS+P S
Sbjct  121  SDKITFANSSGIARSFPFS  139



>ref|XP_006841476.1| PREDICTED: uncharacterized protein LOC18431288 [Amborella trichopoda]
 gb|ERN03151.1| hypothetical protein AMTR_s00003p00107900 [Amborella trichopoda]
Length=165

 Score =   134 bits (336),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 74/137 (54%), Positives = 100/137 (73%), Gaps = 0/137 (0%)
 Frame = +2

Query  74   MSSQQTAVNHRENAEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVWM  253
            MSSQ +    +E AE++    +C+ K LELL+E+ MP GLLPL++ +E G   ETG+VW+
Sbjct  1    MSSQLSQERLQEKAEIYHGHEICRSKYLELLKEVGMPNGLLPLEDILECGYIEETGYVWL  60

Query  254  kqkkakehkfkkigkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPDPDAG  433
            KQKK+ +H F KIGKLV Y  EVTA+V+  R+K +TGVK+KE L W++L+ I + DP  G
Sbjct  61   KQKKSTQHYFDKIGKLVSYAPEVTAYVDKFRMKKVTGVKAKEFLFWISLSEICVDDPPTG  120

Query  434  KINFSTPAGLSRSYPVS  484
            K+ F TPAGLSRS+PVS
Sbjct  121  KLTFKTPAGLSRSFPVS  137



>ref|XP_008383560.1| PREDICTED: uncharacterized protein LOC103446249 [Malus domestica]
Length=145

 Score =   132 bits (332),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 75/138 (54%), Positives = 104/138 (75%), Gaps = 2/138 (1%)
 Frame = +2

Query  74   MSSQQTAVNHRENAEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVWM  253
            MS+QQ A +H E+AE++   A+C+QKS ELL+++ +PRGLLPLD+ VE G N  +GFVW+
Sbjct  1    MSAQQIA-SHIEDAEIYHGEALCRQKSRELLDKMCLPRGLLPLDDVVEFGYNHTSGFVWL  59

Query  254  kqkkakehkfkkigkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISI-PDPDA  430
            KQKK KEH+F+ I K V YDTEV  FVE+ R++ L+GVKSKELL+WV+++ I + P+ D 
Sbjct  60   KQKKRKEHRFRAISKTVSYDTEVMGFVEEHRMRRLSGVKSKELLIWVSISDIYVDPNSDL  119

Query  431  GKINFSTPAGLSRSYPVS  484
             KI F+   G SRS+P +
Sbjct  120  DKITFANGTGXSRSFPAT  137



>gb|ACJ83877.1| unknown [Medicago truncatula]
 gb|AFK48680.1| unknown [Medicago truncatula]
 gb|KEH24470.1| plant/F25P12-18 protein [Medicago truncatula]
Length=170

 Score =   133 bits (334),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 77/127 (61%), Positives = 96/127 (76%), Gaps = 0/127 (0%)
 Frame = +2

Query  104  RENAEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVWMkqkkakehkf  283
            +  +EV+    +C+ KS ELL+EI +P GLLPL +  EVG NRETGFVW+KQKK+  HKF
Sbjct  9    KSKSEVYHGDEMCQVKSKELLKEISLPNGLLPLKDITEVGYNRETGFVWLKQKKSITHKF  68

Query  284  kkigkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPDPDAGKINFSTPAGL  463
            +KIGK V Y TEVTA+VE+ ++K L GVK+KELL+WVTL  I I DP  GKI F TP+GL
Sbjct  69   EKIGKPVSYATEVTAYVENGKIKKLNGVKTKELLIWVTLCDIYIDDPPTGKITFKTPSGL  128

Query  464  SRSYPVS  484
             RS+PVS
Sbjct  129  FRSFPVS  135



>ref|XP_011460196.1| PREDICTED: uncharacterized protein LOC105350248 [Fragaria vesca 
subsp. vesca]
Length=154

 Score =   132 bits (332),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 74/153 (48%), Positives = 108/153 (71%), Gaps = 1/153 (1%)
 Frame = +2

Query  74   MSSQQTAVNHRENAEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVWM  253
            MS Q+    HR+ AE+     +CKQKS +LL+++H+PRGLLPLD+ VE G N  +GFVW+
Sbjct  1    MSGQKLIATHRDGAEIHHGEDICKQKSHQLLDKMHLPRGLLPLDDLVEFGYNPTSGFVWL  60

Query  254  kqkkakehkfkkigkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISI-PDPDA  430
            KQKK KEH+F  +G+ V YD EV  FVE+ R++ L+GVKSKE+L+WV+++ I + P  D 
Sbjct  61   KQKKRKEHRFHAVGRTVSYDAEVMGFVEEHRMRRLSGVKSKEILIWVSISDIYVDPSTDP  120

Query  431  GKINFSTPAGLSRSYPVSafeedaaaadGDQKK  529
             KI F+  +G+SRS+P++AF+ +     G  +K
Sbjct  121  DKITFANGSGISRSFPITAFQLEGGDGSGSNEK  153



>ref|XP_010942816.1| PREDICTED: uncharacterized protein LOC105060705 [Elaeis guineensis]
Length=140

 Score =   131 bits (329),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 69/135 (51%), Positives = 96/135 (71%), Gaps = 0/135 (0%)
 Frame = +2

Query  80   SQQTAVNHRENAEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVWMkq  259
            + QT  N+R+ AE++   A+CK+KS++LLEE+ +P+GL PLD   E G N   GF+W+ Q
Sbjct  2    ASQTIENYRKGAEIYQGNALCKKKSVQLLEELGLPKGLFPLDNMEEFGYNHAAGFIWLIQ  61

Query  260  kkakehkfkkigkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPDPDAGKI  439
            KK KE  FKKI + V Y TEVTAFVE  ++K +TGVK+KELLLW+++  + I DP + K+
Sbjct  62   KKKKERTFKKIKQTVLYATEVTAFVEQHKMKKITGVKTKELLLWLSIVEMYIDDPSSEKV  121

Query  440  NFSTPAGLSRSYPVS  484
             F T  GLS S+P+S
Sbjct  122  TFKTGTGLSDSFPMS  136



>gb|ABK21416.1| unknown [Picea sitchensis]
Length=147

 Score =   131 bits (329),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 68/134 (51%), Positives = 100/134 (75%), Gaps = 1/134 (1%)
 Frame = +2

Query  86   QTAVNHRENAEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVWMkqkk  265
            Q A + +  AE++    VCK+K +ELLE++ +P+GL+ LDE  E G  RETGFVWMK+ K
Sbjct  4    QLASDQQAGAEIYHGSEVCKKKCMELLEQVGLPKGLILLDELEECGYIRETGFVWMKRNK  63

Query  266  akehkfkkigkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPDPDAGKINF  445
              EH+FK IG+L+ Y +E++A+VE R++K ++GVKSKELL+W+T++ ISI +P +GKI F
Sbjct  64   KIEHQFKTIGRLIQYGSEISAYVEQRKMKKVSGVKSKELLVWITISEISIDEPSSGKICF  123

Query  446  -STPAGLSRSYPVS  484
             S  AG+ +S+PV 
Sbjct  124  KSNVAGIKKSFPVG  137



>ref|XP_002281636.1| PREDICTED: uncharacterized protein LOC100245914 [Vitis vinifera]
Length=166

 Score =   131 bits (330),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 75/127 (59%), Positives = 95/127 (75%), Gaps = 0/127 (0%)
 Frame = +2

Query  104  RENAEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVWMkqkkakehkf  283
            + NAEV+    +C++KS  LL E+ +P GLLPL +  E G  RETGFVW+KQKK   HKF
Sbjct  9    KANAEVYHGDEICQEKSKLLLTEVGLPNGLLPLQDIEECGYVRETGFVWLKQKKKTIHKF  68

Query  284  kkigkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPDPDAGKINFSTPAGL  463
            +KIGKLV Y+ E+TA+VE  ++K LTGVK+KELLLW+TL+ I + DP  GKI F TPAGL
Sbjct  69   EKIGKLVSYEPEITAYVEQNKIKKLTGVKTKELLLWITLSDIYVDDPPTGKITFKTPAGL  128

Query  464  SRSYPVS  484
             RS+PVS
Sbjct  129  FRSFPVS  135



>gb|EMS45819.1| hypothetical protein TRIUR3_21435 [Triticum urartu]
Length=260

 Score =   134 bits (337),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 75/128 (59%), Positives = 96/128 (75%), Gaps = 0/128 (0%)
 Frame = +2

Query  101  HRENAEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVWMkqkkakehk  280
            +RE AEV+   A+C +K++ELL E +MP GLLPL +  EVG NR TGFVW++QKKA  H 
Sbjct  119  NREGAEVYHGAALCAEKAVELLAETNMPLGLLPLADIEEVGYNRTTGFVWLRQKKALTHT  178

Query  281  fkkigkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPDPDAGKINFSTPAG  460
            FK+IG+LV Y TEVTA VEDR++K +TGVKSKELL+WVT+  + I   D  KI F TP G
Sbjct  179  FKQIGRLVSYATEVTALVEDRKMKRITGVKSKELLIWVTVCDMYIDKNDHSKITFKTPTG  238

Query  461  LSRSYPVS  484
            L R++PV+
Sbjct  239  LGRTFPVT  246



>ref|XP_012072105.1| PREDICTED: uncharacterized protein LOC105633990 [Jatropha curcas]
 gb|KDP37972.1| hypothetical protein JCGZ_04615 [Jatropha curcas]
Length=147

 Score =   130 bits (328),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 81/135 (60%), Positives = 106/135 (79%), Gaps = 1/135 (1%)
 Frame = +2

Query  80   SQQTAVNHRENAEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVWMkq  259
            +QQ A NHRE AE++ + ++CKQKS++LL E+ +P+GLLPLD+ VEVG NR TGFVW+KQ
Sbjct  2    AQQIA-NHREQAEIYNEGSLCKQKSIQLLGELGLPKGLLPLDDIVEVGYNRTTGFVWLKQ  60

Query  260  kkakehkfkkigkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPDPDAGKI  439
            KK  EHKF+ IG+ V YDTEVTA V+DR+++ +TGVKSKE LLWVT++ I I   D  KI
Sbjct  61   KKRTEHKFRAIGRNVSYDTEVTAIVKDRQMRRVTGVKSKEFLLWVTISDIYIDSGDLTKI  120

Query  440  NFSTPAGLSRSYPVS  484
             F  P G+SR++PVS
Sbjct  121  TFGNPTGISRTFPVS  135



>ref|XP_010092963.1| hypothetical protein L484_018900 [Morus notabilis]
 gb|EXB53016.1| hypothetical protein L484_018900 [Morus notabilis]
Length=171

 Score =   131 bits (330),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 76/127 (60%), Positives = 93/127 (73%), Gaps = 0/127 (0%)
 Frame = +2

Query  104  RENAEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVWMkqkkakehkf  283
            +  AEV+    +CK+KS ELL E+ +P GLLPL + +E G  RETGFVW+KQKK+  HKF
Sbjct  9    KAKAEVYHGDEICKEKSQELLTEVGLPNGLLPLTDILECGIVRETGFVWLKQKKSITHKF  68

Query  284  kkigkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPDPDAGKINFSTPAGL  463
             KIGKLV Y TEVTA  E  ++K LTGVK+KELLLW+TL+ I + DP  GKI F TP GL
Sbjct  69   NKIGKLVSYATEVTAVAEKNKIKKLTGVKTKELLLWITLSDIFVDDPPTGKITFKTPTGL  128

Query  464  SRSYPVS  484
             RS+PVS
Sbjct  129  FRSFPVS  135



>ref|XP_006433560.1| hypothetical protein CICLE_v10002714mg [Citrus clementina]
 gb|ESR46800.1| hypothetical protein CICLE_v10002714mg [Citrus clementina]
Length=165

 Score =   131 bits (329),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 77/127 (61%), Positives = 95/127 (75%), Gaps = 0/127 (0%)
 Frame = +2

Query  104  RENAEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVWMkqkkakehkf  283
            R  AE++    +C++KS  LL EI +P GLLPL +  E G  +ETGFVW+KQKK+  HKF
Sbjct  9    RAKAELYRGDEICQEKSKFLLTEIGLPNGLLPLHDIEECGYVKETGFVWLKQKKSITHKF  68

Query  284  kkigkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPDPDAGKINFSTPAGL  463
            +KIGKLV Y TEVTA VE  R+K LTGVKSKELL+W+T++ I + DP  GKI F TPAGL
Sbjct  69   EKIGKLVSYATEVTAVVEPNRIKKLTGVKSKELLIWITMSDIYVDDPPTGKITFQTPAGL  128

Query  464  SRSYPVS  484
            SRS+PVS
Sbjct  129  SRSFPVS  135



>ref|XP_006472233.1| PREDICTED: uncharacterized protein LOC102631030 [Citrus sinensis]
Length=165

 Score =   131 bits (329),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 77/127 (61%), Positives = 95/127 (75%), Gaps = 0/127 (0%)
 Frame = +2

Query  104  RENAEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVWMkqkkakehkf  283
            R  AE++    +C++KS  LL EI +P GLLPL +  E G  +ETGFVW+KQKK+  HKF
Sbjct  9    RAKAELYRGDEICQEKSKFLLTEIGLPNGLLPLHDIEECGYVKETGFVWLKQKKSITHKF  68

Query  284  kkigkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPDPDAGKINFSTPAGL  463
            +KIGKLV Y TEVTA VE  R+K LTGVKSKELL+W+T++ I + DP  GKI F TPAGL
Sbjct  69   EKIGKLVSYATEVTAVVEPNRIKKLTGVKSKELLIWITMSDIYVDDPPTGKITFQTPAGL  128

Query  464  SRSYPVS  484
            SRS+PVS
Sbjct  129  SRSFPVS  135



>ref|XP_008792572.1| PREDICTED: uncharacterized protein LOC103709140 [Phoenix dactylifera]
Length=142

 Score =   130 bits (327),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 70/135 (52%), Positives = 95/135 (70%), Gaps = 0/135 (0%)
 Frame = +2

Query  80   SQQTAVNHRENAEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVWMkq  259
            + QT  +HR  AEV    A+CK+KS++LLEE+ +PRGL PL++  E G NR  GF+W+ Q
Sbjct  2    ASQTIESHRAGAEVINGDALCKKKSIQLLEELGLPRGLFPLEDISEFGYNRAAGFIWLIQ  61

Query  260  kkakehkfkkigkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPDPDAGKI  439
            KK K+H FKKI + V Y  EVTAFVE  ++K +TGVK+KEL+LW+++  + I DP +GKI
Sbjct  62   KKKKDHTFKKIKRAVSYAPEVTAFVEKGKMKKMTGVKTKELMLWLSVVEMYIEDPSSGKI  121

Query  440  NFSTPAGLSRSYPVS  484
             F T  GLS S+  S
Sbjct  122  TFKTGTGLSDSFAAS  136



>ref|XP_006846887.1| PREDICTED: uncharacterized protein LOC18436599 [Amborella trichopoda]
 gb|ERN08468.1| hypothetical protein AMTR_s05043p00002670 [Amborella trichopoda]
Length=163

 Score =   130 bits (326),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 73/127 (57%), Positives = 94/127 (74%), Gaps = 0/127 (0%)
 Frame = +2

Query  104  RENAEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVWMkqkkakehkf  283
            +E A++F    +C+ KSLELL E+ MP  LLPL++  E G   ETGFVW+KQKK+K+H F
Sbjct  10   KEKAQIFHGDEICQAKSLELLREVGMPNCLLPLEDVFECGYIEETGFVWLKQKKSKQHHF  69

Query  284  kkigkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPDPDAGKINFSTPAGL  463
             K+GKLV Y  EVTA+VE  ++K +TGVK KEL+LW+TL+ I + DP  GK  F TPAGL
Sbjct  70   DKVGKLVSYAPEVTAYVEKFKMKKVTGVKVKELMLWITLSEIYVDDPPTGKFTFKTPAGL  129

Query  464  SRSYPVS  484
            SRS+PVS
Sbjct  130  SRSFPVS  136



>ref|XP_002519164.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF43375.1| conserved hypothetical protein [Ricinus communis]
Length=154

 Score =   129 bits (325),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 68/137 (50%), Positives = 92/137 (67%), Gaps = 0/137 (0%)
 Frame = +2

Query  74   MSSQQTAVNHRENAEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVWM  253
            M+   +    R  AE+   P  C + S+ELLEE+  P+G+LPL + VE GR RETGFVWM
Sbjct  1    MTKTGSVEGERAGAEIVYGPEECFRHSVELLEELGFPKGVLPLKDLVECGRVRETGFVWM  60

Query  254  kqkkakehkfkkigkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPDPDAG  433
            KQK   EH F K    V YD EVTA+VE  ++K +TG+KSK++LLWV ++ +SI +P + 
Sbjct  61   KQKAPYEHFFVKTNSKVSYDIEVTAYVEKLKMKKMTGIKSKQMLLWVPISEMSIENPSSK  120

Query  434  KINFSTPAGLSRSYPVS  484
            KI F TP G+ +SYP+S
Sbjct  121  KITFKTPMGIGKSYPIS  137



>ref|XP_008792571.1| PREDICTED: uncharacterized protein LOC103709139 [Phoenix dactylifera]
Length=142

 Score =   129 bits (324),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 68/135 (50%), Positives = 98/135 (73%), Gaps = 0/135 (0%)
 Frame = +2

Query  80   SQQTAVNHRENAEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVWMkq  259
            + QT  N+R+ AE+F   AVCK+KS++LLEE+ +P+GL PL++  E G N+   F+W+ Q
Sbjct  2    ASQTIDNYRDGAEIFHGDAVCKKKSIQLLEELGLPKGLFPLEDIEEFGYNQAMEFIWLIQ  61

Query  260  kkakehkfkkigkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPDPDAGKI  439
            KK ++H FKKI ++V Y  EVTAFVE  ++K +TGVK+KEL+LW+++  + I DP +GKI
Sbjct  62   KKKRDHTFKKIKRVVSYAPEVTAFVEKGKMKKMTGVKTKELILWLSVVEMYIEDPSSGKI  121

Query  440  NFSTPAGLSRSYPVS  484
             F T  GLS S+P S
Sbjct  122  TFKTGTGLSDSFPAS  136



>ref|XP_011038970.1| PREDICTED: uncharacterized protein LOC105135674 [Populus euphratica]
Length=181

 Score =   130 bits (327),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 77/127 (61%), Positives = 94/127 (74%), Gaps = 0/127 (0%)
 Frame = +2

Query  104  RENAEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVWMkqkkakehkf  283
            +  AEV+    V K+KS ELL E+ +P GLLPL + VE G  RETGFVW+KQKK+  HKF
Sbjct  9    KAKAEVYYGDEVGKEKSQELLREVGLPNGLLPLHDIVECGIVRETGFVWLKQKKSTTHKF  68

Query  284  kkigkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPDPDAGKINFSTPAGL  463
            +KIGKL  Y TEVTA+VE  ++K LTGVK+KELLLWVTL+ I + DP  GKI F TP GL
Sbjct  69   EKIGKLASYGTEVTAYVEQHKIKKLTGVKTKELLLWVTLSDIYLDDPPTGKITFQTPTGL  128

Query  464  SRSYPVS  484
             R++PVS
Sbjct  129  YRTFPVS  135



>ref|XP_007031193.1| Uncharacterized protein TCM_026789 [Theobroma cacao]
 gb|EOY11695.1| Uncharacterized protein TCM_026789 [Theobroma cacao]
Length=166

 Score =   129 bits (325),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 75/124 (60%), Positives = 95/124 (77%), Gaps = 0/124 (0%)
 Frame = +2

Query  113  AEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVWMkqkkakehkfkki  292
            +E++    +C++KS  LLEE+ MPRGLLPL +  E G  ++TGFVW+KQKK+  HKF+KI
Sbjct  13   SEIYHGDEICQEKSKFLLEEVGMPRGLLPLRDIEECGYVKDTGFVWLKQKKSITHKFEKI  72

Query  293  gkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPDPDAGKINFSTPAGLSRS  472
            GKLV Y  EVTA VE  ++K LTGVK+KELLLW+TL+ I + DP  GKI F TPAGLSRS
Sbjct  73   GKLVSYAPEVTAVVEQSKIKKLTGVKTKELLLWITLSDIYVDDPPTGKITFKTPAGLSRS  132

Query  473  YPVS  484
            +PVS
Sbjct  133  FPVS  136



>ref|XP_011023804.1| PREDICTED: uncharacterized protein LOC105125175 [Populus euphratica]
 ref|XP_011023810.1| PREDICTED: uncharacterized protein LOC105125178 [Populus euphratica]
Length=162

 Score =   129 bits (324),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 75/127 (59%), Positives = 96/127 (76%), Gaps = 0/127 (0%)
 Frame = +2

Query  104  RENAEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVWMkqkkakehkf  283
            +  AEV+    + K+KS ELL E+ +P GLLPL + +E G  RETGFVW+KQKK+  HKF
Sbjct  9    KSKAEVYYGDEMGKEKSQELLREVGLPNGLLPLHDIIECGIVRETGFVWLKQKKSINHKF  68

Query  284  kkigkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPDPDAGKINFSTPAGL  463
            +KIGKLV Y TEVTA+VE +++K LTGVK+KELL+W+TL  IS+ DP  GKI F TP GL
Sbjct  69   EKIGKLVSYATEVTAYVEPKKIKKLTGVKTKELLVWITLCDISLDDPPTGKITFKTPTGL  128

Query  464  SRSYPVS  484
             R++PVS
Sbjct  129  FRTFPVS  135



>ref|XP_008812285.1| PREDICTED: uncharacterized protein LOC103723212 [Phoenix dactylifera]
Length=141

 Score =   129 bits (323),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 72/135 (53%), Positives = 95/135 (70%), Gaps = 0/135 (0%)
 Frame = +2

Query  80   SQQTAVNHRENAEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVWMkq  259
            + QT  ++R+ AEV     +CK KS++LLEE+ +PRGL PL+   E G NR TGF+W+  
Sbjct  2    ASQTIESYRQGAEVHRGDDLCKTKSIQLLEELGLPRGLFPLENVEEFGYNRATGFMWLVH  61

Query  260  kkakehkfkkigkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPDPDAGKI  439
            KK KEH FKKI + V Y TEVTAFVE R++K +TGVK+KELLLW+++  + I D  + KI
Sbjct  62   KKKKEHTFKKIKQTVSYATEVTAFVEQRKMKKMTGVKTKELLLWLSVVEVYIDDSSSDKI  121

Query  440  NFSTPAGLSRSYPVS  484
             F T  GLS S+PVS
Sbjct  122  TFKTGTGLSDSFPVS  136



>ref|XP_008464314.1| PREDICTED: uncharacterized protein LOC103502227 [Cucumis melo]
Length=163

 Score =   129 bits (324),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 80/138 (58%), Positives = 101/138 (73%), Gaps = 0/138 (0%)
 Frame = +2

Query  116  EVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVWMkqkkakehkfkkig  295
            EV+    +C++KS ELL+EI +P GLLPL +  E G  RETGFVW+KQKK+  HKF+KIG
Sbjct  14   EVYHGDEICQEKSKELLKEIGLPNGLLPLKDIEECGIIRETGFVWLKQKKSTTHKFEKIG  73

Query  296  kLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPDPDAGKINFSTPAGLSRSY  475
            KLV Y TEVTA VE  ++K LTGVK+KELLLWV+L+ I + DP  GKI F TPAGL R++
Sbjct  74   KLVSYATEVTATVEKNKIKKLTGVKTKELLLWVSLSDIYVDDPPTGKITFQTPAGLFRTF  133

Query  476  PVSafeedaaaadGDQKK  529
            PVSAF+ +       +KK
Sbjct  134  PVSAFQVEEPVKAASEKK  151



>ref|XP_004139521.2| PREDICTED: uncharacterized protein LOC101214389 [Cucumis sativus]
Length=163

 Score =   128 bits (322),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 75/123 (61%), Positives = 94/123 (76%), Gaps = 0/123 (0%)
 Frame = +2

Query  116  EVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVWMkqkkakehkfkkig  295
            EV+    +C++KS ELL+EI +P GLLPL +  E G  RETGFVW+KQKK+  HKF+KIG
Sbjct  14   EVYHGDEICQEKSKELLKEIGLPNGLLPLKDIEECGIIRETGFVWLKQKKSTTHKFEKIG  73

Query  296  kLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPDPDAGKINFSTPAGLSRSY  475
            KLV Y TEVTA VE  ++K LTGVK+KELL+WV+L+ I + DP  GKI F TPAGL R++
Sbjct  74   KLVSYATEVTATVEKNKIKKLTGVKTKELLIWVSLSDIYVDDPPTGKITFQTPAGLYRTF  133

Query  476  PVS  484
            PVS
Sbjct  134  PVS  136



>ref|XP_008787182.1| PREDICTED: uncharacterized protein LOC103705299 [Phoenix dactylifera]
Length=141

 Score =   128 bits (321),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 72/135 (53%), Positives = 94/135 (70%), Gaps = 0/135 (0%)
 Frame = +2

Query  80   SQQTAVNHRENAEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVWMkq  259
            + QT  ++R+ AEV     +C+ KS++LLEE+ +PRGL PL+   E G NR  GF+W+  
Sbjct  2    ASQTIESYRQGAEVHRGDDLCRTKSIQLLEELGLPRGLFPLENVEEFGYNRAAGFMWLVH  61

Query  260  kkakehkfkkigkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPDPDAGKI  439
            KK KEH FKKI + V Y TEVTAFVE R+LK +TGVK+KELLLW+++  + I DP   KI
Sbjct  62   KKKKEHTFKKIKQTVSYATEVTAFVEQRKLKKITGVKTKELLLWLSVVEVYIDDPSTEKI  121

Query  440  NFSTPAGLSRSYPVS  484
             F T  GLS S+PVS
Sbjct  122  TFKTGTGLSDSFPVS  136



>ref|XP_002307069.2| hypothetical protein POPTR_0005s01470g [Populus trichocarpa]
 gb|ABK94207.1| unknown [Populus trichocarpa]
 gb|EEE94065.2| hypothetical protein POPTR_0005s01470g [Populus trichocarpa]
Length=175

 Score =   129 bits (323),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 76/127 (60%), Positives = 94/127 (74%), Gaps = 0/127 (0%)
 Frame = +2

Query  104  RENAEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVWMkqkkakehkf  283
            +  AEV+    + K+KS ELL E+ +P GLLPL + VE G  RETGFVW+KQKK+  HKF
Sbjct  9    KAKAEVYYGDEMGKEKSQELLREVGLPNGLLPLHDIVECGIVRETGFVWLKQKKSITHKF  68

Query  284  kkigkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPDPDAGKINFSTPAGL  463
            +KIGKL  Y TEVTA+VE  ++K LTGVK+KELLLWVTL+ I + DP  GKI F TP GL
Sbjct  69   EKIGKLASYGTEVTAYVEQNKIKKLTGVKTKELLLWVTLSDIYLDDPPTGKITFQTPTGL  128

Query  464  SRSYPVS  484
             R++PVS
Sbjct  129  YRTFPVS  135



>ref|XP_006415521.1| hypothetical protein EUTSA_v10009038mg [Eutrema salsugineum]
 gb|ESQ33874.1| hypothetical protein EUTSA_v10009038mg [Eutrema salsugineum]
Length=143

 Score =   127 bits (320),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 68/137 (50%), Positives = 96/137 (70%), Gaps = 0/137 (0%)
 Frame = +2

Query  74   MSSQQTAVNHRENAEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVWM  253
            M+ Q   V+  ++ E +++P++C  K+ ELL  I++P GLLPL +  EVG N+  GFVWM
Sbjct  1    MALQAMIVDESDDIESYSEPSLCLDKAKELLALINLPTGLLPLKDMTEVGYNKTKGFVWM  60

Query  254  kqkkakehkfkkigkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPDPDAG  433
            + +   EH F++IG+ V YDTE+TAFVEDRR+K LTGVKSKEL++WV +  I I + D  
Sbjct  61   RMRSKIEHTFREIGRKVIYDTEITAFVEDRRMKRLTGVKSKELMIWVPVNDIFIKEKDPE  120

Query  434  KINFSTPAGLSRSYPVS  484
            KI F+   GLSR++ VS
Sbjct  121  KITFANSTGLSRTFKVS  137



>ref|XP_006392412.1| hypothetical protein EUTSA_v10023729mg [Eutrema salsugineum]
 gb|ESQ29698.1| hypothetical protein EUTSA_v10023729mg [Eutrema salsugineum]
Length=163

 Score =   128 bits (321),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 74/128 (58%), Positives = 96/128 (75%), Gaps = 1/128 (1%)
 Frame = +2

Query  104  RENAEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVWMkqkkakehkf  283
            R  AE +T   +C++K+ E L+E+ MP GLLPL +  EVG +RETG VW+KQKK+  HKF
Sbjct  9    RARAEKYTGDELCREKTKEFLKEVSMPNGLLPLKDIEEVGYDRETGVVWLKQKKSITHKF  68

Query  284  kkigkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPDP-DAGKINFSTPAG  460
            + IGKLV Y TEVTA VE  ++K LTGVK+KELL+WVTL  +++  P  +GKINF TP G
Sbjct  69   EAIGKLVSYGTEVTAVVEVGKIKKLTGVKAKELLIWVTLNELALEQPISSGKINFRTPTG  128

Query  461  LSRSYPVS  484
            LSR++PVS
Sbjct  129  LSRTFPVS  136



>gb|KGN65013.1| hypothetical protein Csa_1G181260 [Cucumis sativus]
Length=196

 Score =   129 bits (324),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 80/145 (55%), Positives = 103/145 (71%), Gaps = 1/145 (1%)
 Frame = +2

Query  50   LQSTIKLKMSSQQTAVNHRENAEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRN  229
            L+S  + KMS     +  +   EV+    +C++KS ELL+EI +P GLLPL +  E G  
Sbjct  26   LRSKKQEKMSVVTEEIKGK-TEEVYHGDEICQEKSKELLKEIGLPNGLLPLKDIEECGII  84

Query  230  RETGFVWMkqkkakehkfkkigkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHI  409
            RETGFVW+KQKK+  HKF+KIGKLV Y TEVTA VE  ++K LTGVK+KELL+WV+L+ I
Sbjct  85   RETGFVWLKQKKSTTHKFEKIGKLVSYATEVTATVEKNKIKKLTGVKTKELLIWVSLSDI  144

Query  410  SIPDPDAGKINFSTPAGLSRSYPVS  484
             + DP  GKI F TPAGL R++PVS
Sbjct  145  YVDDPPTGKITFQTPAGLYRTFPVS  169



>ref|XP_002319476.1| hypothetical protein POPTR_0013s00850g [Populus trichocarpa]
 gb|ABK94967.1| unknown [Populus trichocarpa]
 gb|ABK95739.1| unknown [Populus trichocarpa]
 gb|EEE95399.1| hypothetical protein POPTR_0013s00850g [Populus trichocarpa]
Length=162

 Score =   128 bits (321),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 74/127 (58%), Positives = 97/127 (76%), Gaps = 0/127 (0%)
 Frame = +2

Query  104  RENAEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVWMkqkkakehkf  283
            +  AEV+    + K+KS ELL+E+ +P GLLPL + +E G  RETGFVW+KQKK+  HKF
Sbjct  9    KSKAEVYYGDEMGKEKSQELLKEVGLPNGLLPLHDILECGIVRETGFVWLKQKKSINHKF  68

Query  284  kkigkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPDPDAGKINFSTPAGL  463
            +KIGKLV Y TEVTA+VE +++K LTGVK+KELL+W+TL  IS+ DP  GK+ F TP GL
Sbjct  69   EKIGKLVSYATEVTAYVEPKKIKKLTGVKTKELLVWITLCDISLDDPPTGKMTFKTPTGL  128

Query  464  SRSYPVS  484
             R++PVS
Sbjct  129  FRTFPVS  135



>ref|XP_006302926.1| hypothetical protein CARUB_v10021064mg [Capsella rubella]
 gb|EOA35824.1| hypothetical protein CARUB_v10021064mg [Capsella rubella]
Length=162

 Score =   127 bits (320),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 74/128 (58%), Positives = 96/128 (75%), Gaps = 1/128 (1%)
 Frame = +2

Query  104  RENAEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVWMkqkkakehkf  283
            R  AE +T   +C++K+ E L+E+ MP GLLPL +  EVG +RETG VW+KQKK+  HKF
Sbjct  9    RARAEKYTGDEICREKTREFLKEVSMPNGLLPLKDIEEVGYDRETGIVWLKQKKSIIHKF  68

Query  284  kkigkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPDP-DAGKINFSTPAG  460
            + IGKLV Y TEVTA VE  ++K LTGVK+KELL+WVTL  +++  P  +GKINF TP G
Sbjct  69   EAIGKLVSYATEVTAQVEVGKIKKLTGVKAKELLIWVTLNELALEQPITSGKINFRTPTG  128

Query  461  LSRSYPVS  484
            LSR++PVS
Sbjct  129  LSRTFPVS  136



>ref|XP_002894658.1| hypothetical protein ARALYDRAFT_892851 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH70917.1| hypothetical protein ARALYDRAFT_892851 [Arabidopsis lyrata subsp. 
lyrata]
Length=166

 Score =   128 bits (321),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 74/128 (58%), Positives = 96/128 (75%), Gaps = 1/128 (1%)
 Frame = +2

Query  104  RENAEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVWMkqkkakehkf  283
            R  AE +T   +C++K+ E L+E+ MP GLLPL +  EVG +RETG VW+KQKK+  HKF
Sbjct  9    RARAEKYTGDEICREKTKEFLKEVSMPNGLLPLKDIEEVGYDRETGIVWLKQKKSITHKF  68

Query  284  kkigkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPDP-DAGKINFSTPAG  460
             +IGKLV Y TEVTA VE  ++K LTGVK+KELL+WVTL  +++  P  +GKINF TP G
Sbjct  69   LEIGKLVSYATEVTAQVEVGKIKKLTGVKAKELLIWVTLNELTLEQPISSGKINFRTPTG  128

Query  461  LSRSYPVS  484
            LSR++PVS
Sbjct  129  LSRTFPVS  136



>ref|XP_010942811.1| PREDICTED: uncharacterized protein LOC105060700 [Elaeis guineensis]
Length=141

 Score =   126 bits (317),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 73/135 (54%), Positives = 94/135 (70%), Gaps = 0/135 (0%)
 Frame = +2

Query  80   SQQTAVNHRENAEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVWMkq  259
            + QT  +HRE AEV     +CK++S++LL E+ +PRGL PL+   E G NR  GF+W+ Q
Sbjct  2    ATQTIESHREGAEVHHGDDLCKKQSIQLLGELGLPRGLFPLENIEEFGYNRAAGFMWLIQ  61

Query  260  kkakehkfkkigkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPDPDAGKI  439
            KK KEH FKKI + V Y TEVTAFVE R+LK + GVK+KELLLW+++  + I DP   KI
Sbjct  62   KKKKEHTFKKIKQTVSYATEVTAFVEQRKLKKIMGVKTKELLLWLSVVEVYIDDPTTEKI  121

Query  440  NFSTPAGLSRSYPVS  484
             F T  GLS S+PVS
Sbjct  122  TFKTGTGLSDSFPVS  136



>ref|XP_007163314.1| hypothetical protein PHAVU_001G224400g [Phaseolus vulgaris]
 gb|AGV54813.1| hypothetical protein [Phaseolus vulgaris]
 gb|AGV54814.1| hypothetical protein [Phaseolus vulgaris]
 gb|ESW35308.1| hypothetical protein PHAVU_001G224400g [Phaseolus vulgaris]
Length=161

 Score =   127 bits (319),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 75/125 (60%), Positives = 93/125 (74%), Gaps = 0/125 (0%)
 Frame = +2

Query  110  NAEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVWMkqkkakehkfkk  289
             +EV+    +C+ KS ELL+EI +P GLLPL +  E G +R+TGFVW+KQKK+  HKF+K
Sbjct  11   RSEVYHGDEICQVKSKELLKEIALPNGLLPLKDIEECGYDRQTGFVWLKQKKSYTHKFEK  70

Query  290  igkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPDPDAGKINFSTPAGLSR  469
            IGKLV Y  EVTA VE  R+  LTGVK+KELLLW+TL+ I + DP  GKI F TPAGL R
Sbjct  71   IGKLVSYAPEVTAHVEQGRISKLTGVKTKELLLWITLSDIYVDDPPTGKITFKTPAGLYR  130

Query  470  SYPVS  484
            S+PVS
Sbjct  131  SFPVS  135



>gb|KEH24076.1| plant/F25P12-18 protein [Medicago truncatula]
Length=152

 Score =   127 bits (318),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 71/127 (56%), Positives = 94/127 (74%), Gaps = 0/127 (0%)
 Frame = +2

Query  104  RENAEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVWMkqkkakehkf  283
            +  +EV     +C+ KS ELL+EI +P GLLPL + +EVG NRETGFVW+KQK +  HKF
Sbjct  9    KSKSEVHHGDELCQVKSKELLKEISLPNGLLPLKDIIEVGYNRETGFVWLKQKNSITHKF  68

Query  284  kkigkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPDPDAGKINFSTPAGL  463
            +KIGKLV Y TEVTA+VE+ ++K L GVK+KELL+W+ +  I + DP  GKI F   +GL
Sbjct  69   EKIGKLVSYATEVTAYVENGKIKKLNGVKAKELLIWLNVADIYVDDPPTGKITFKATSGL  128

Query  464  SRSYPVS  484
            SR++PVS
Sbjct  129  SRTFPVS  135



>gb|KJB82664.1| hypothetical protein B456_013G208000 [Gossypium raimondii]
Length=166

 Score =   127 bits (319),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 77/139 (55%), Positives = 102/139 (73%), Gaps = 0/139 (0%)
 Frame = +2

Query  113  AEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVWMkqkkakehkfkki  292
            +E++    +C++KS  LLEE+ MPRGLLPL +  E G  ++TGFVW+KQKK+  HKF+KI
Sbjct  13   SEIYHGDEICQEKSKFLLEEVGMPRGLLPLRDIEECGYVKDTGFVWLKQKKSITHKFEKI  72

Query  293  gkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPDPDAGKINFSTPAGLSRS  472
            GKLV Y TEVTA VE  ++K LTGVK+KELL+W+TL+ I + DP  GKI F TP+GL R+
Sbjct  73   GKLVSYATEVTAVVEKGKIKKLTGVKTKELLVWITLSDIQVDDPPTGKITFKTPSGLFRT  132

Query  473  YPVSafeedaaaadGDQKK  529
            +PVSAFE +     G + K
Sbjct  133  FPVSAFEIEGEQVKGSKGK  151



>gb|ACL51741.1| unknown, partial [Pinus peuce]
Length=145

 Score =   126 bits (316),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 74/133 (56%), Positives = 100/133 (75%), Gaps = 0/133 (0%)
 Frame = +2

Query  86   QTAVNHRENAEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVWMkqkk  265
            Q A + R  AE+F    +CKQKS++LL ++ +P+GLLPL++  E G  +ETGFVW+KQKK
Sbjct  3    QVANDQRSGAEIFHGSEICKQKSMDLLADMGLPKGLLPLEDLEETGYVKETGFVWLKQKK  62

Query  266  akehkfkkigkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPDPDAGKINF  445
              EH FKKIGK+V Y TE+TA+VE R++K LTGVKSKELLLW+T++ ISI D  +GKI F
Sbjct  63   KTEHYFKKIGKMVQYGTEITAYVEQRKMKKLTGVKSKELLLWITISEISIDDSSSGKIYF  122

Query  446  STPAGLSRSYPVS  484
             +  G+ +S+P S
Sbjct  123  KSATGIGKSFPAS  135



>ref|XP_009337639.1| PREDICTED: uncharacterized protein LOC103930074 [Pyrus x bretschneideri]
Length=165

 Score =   126 bits (317),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 78/137 (57%), Positives = 97/137 (71%), Gaps = 0/137 (0%)
 Frame = +2

Query  74   MSSQQTAVNHRENAEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVWM  253
            MSS  TA    +  E++    +C+QKS +LL EI +P GLLPL +  E G  RETGFVW+
Sbjct  1    MSSVITAEIKSKADELYHGDEICQQKSKQLLSEIFLPNGLLPLKDIEECGIIRETGFVWL  60

Query  254  kqkkakehkfkkigkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPDPDAG  433
            KQKK+  HKF+KIGKLV Y  EVTA VE  ++K LTGVK+KELL+WV L+ I + DP  G
Sbjct  61   KQKKSYTHKFEKIGKLVSYAPEVTAIVEKGKIKKLTGVKTKELLVWVQLSDIYVDDPPTG  120

Query  434  KINFSTPAGLSRSYPVS  484
            KI F TPAGL R++PVS
Sbjct  121  KITFKTPAGLFRTFPVS  137



>ref|XP_004494532.1| PREDICTED: uncharacterized protein LOC101506609 [Cicer arietinum]
Length=152

 Score =   126 bits (316),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 71/127 (56%), Positives = 96/127 (76%), Gaps = 0/127 (0%)
 Frame = +2

Query  104  RENAEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVWMkqkkakehkf  283
            +  +EV+    +C++KS E L+EI +P GLLPL +  EVG NRETGFVW+KQKK+  HKF
Sbjct  9    KAKSEVYHGDLLCQEKSKEFLKEISLPNGLLPLKDIEEVGYNRETGFVWLKQKKSITHKF  68

Query  284  kkigkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPDPDAGKINFSTPAGL  463
            +K+GKLV Y TEVTA VE  ++K L GVK+KE+L+W+TL+ I I +P  GKI F TP+GL
Sbjct  69   EKVGKLVSYATEVTAHVEHGKIKKLNGVKTKEILVWITLSDIYIDNPPTGKITFKTPSGL  128

Query  464  SRSYPVS  484
             +++PVS
Sbjct  129  YKTFPVS  135



>gb|ACL51745.1| unknown, partial [Pinus strobiformis]
Length=145

 Score =   126 bits (316),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 74/133 (56%), Positives = 100/133 (75%), Gaps = 0/133 (0%)
 Frame = +2

Query  86   QTAVNHRENAEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVWMkqkk  265
            Q A + R  AE+F    +CKQKS++LL ++ +P+GLLPL++  E G  +ETGFVW+KQKK
Sbjct  3    QVANDQRSGAEIFHGSEICKQKSMDLLADMGLPKGLLPLEDLEETGYVKETGFVWLKQKK  62

Query  266  akehkfkkigkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPDPDAGKINF  445
              EH FKKIGK+V Y TE+TA+VE R++K LTGVKSKELLLW+T++ ISI D  +GKI F
Sbjct  63   KTEHYFKKIGKMVQYGTEITAYVEQRKMKKLTGVKSKELLLWITISEISIDDSSSGKIYF  122

Query  446  STPAGLSRSYPVS  484
             +  G+ +S+P S
Sbjct  123  KSATGIGKSFPTS  135



>gb|ACL51739.1| unknown, partial [Pinus lambertiana]
Length=145

 Score =   126 bits (316),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 74/133 (56%), Positives = 100/133 (75%), Gaps = 0/133 (0%)
 Frame = +2

Query  86   QTAVNHRENAEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVWMkqkk  265
            Q A + R  AE+F    +CKQKS++LL ++ +P+GLLPL++  E G  +ETGFVW+KQKK
Sbjct  3    QVANDQRSGAEIFHGSEICKQKSMDLLADMGLPKGLLPLEDLEETGYVKETGFVWLKQKK  62

Query  266  akehkfkkigkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPDPDAGKINF  445
              EH FKKIGK+V Y TE+TA+VE R++K LTGVKSKELLLW+T++ ISI D  +GKI F
Sbjct  63   KTEHYFKKIGKMVQYGTEITAYVEQRKMKKLTGVKSKELLLWITISEISIDDSSSGKIYF  122

Query  446  STPAGLSRSYPVS  484
             +  G+ +S+P S
Sbjct  123  KSATGIGKSFPTS  135



>emb|CDM82254.1| unnamed protein product [Triticum aestivum]
Length=166

 Score =   126 bits (317),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 73/132 (55%), Positives = 89/132 (67%), Gaps = 0/132 (0%)
 Frame = +2

Query  86   QTAVNHRENAEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVWMkqkk  265
            Q     RE AEV+    +C +K+LELL E +MP GLLPL +  EVG NR TGFVW++QKK
Sbjct  3    QAIEAQREGAEVYHGAVLCAEKALELLAETNMPLGLLPLADIEEVGYNRATGFVWLRQKK  62

Query  266  akehkfkkigkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPDPDAGKINF  445
            A  H FK+IG+ V Y TEVTAFVEDR++K +TGVKSKELL+W+TL  + I   D  KI F
Sbjct  63   ALTHTFKQIGRQVSYATEVTAFVEDRKMKRMTGVKSKELLIWITLCDMYIDKGDPSKITF  122

Query  446  STPAGLSRSYPV  481
             TP G     P 
Sbjct  123  KTPTGAGEDLPC  134



>ref|XP_008246159.1| PREDICTED: uncharacterized protein LOC103344327 [Prunus mume]
Length=204

 Score =   127 bits (320),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 76/144 (53%), Positives = 103/144 (72%), Gaps = 1/144 (1%)
 Frame = +2

Query  53   QSTIKLKMSSQQTAVNHRENAEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNR  232
            Q + K+KMS     +  + + E++    +C++KS +LL EI MP GLLPL +  E G  +
Sbjct  35   QGSKKIKMSLVTAEIKSKAD-ELYHGDEICQEKSQKLLTEISMPNGLLPLKDMEECGYVK  93

Query  233  ETGFVWMkqkkakehkfkkigkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHIS  412
            ETGFVW+KQKK+  HKF+KIGKLV Y  EVTA+VE  ++K LTGVK+KELL+WV+L+ I 
Sbjct  94   ETGFVWLKQKKSTTHKFEKIGKLVSYAPEVTAYVEKGKIKKLTGVKTKELLVWVSLSDIY  153

Query  413  IPDPDAGKINFSTPAGLSRSYPVS  484
            + DP  GKI F TP+GL R++PVS
Sbjct  154  VDDPPTGKITFKTPSGLFRTFPVS  177



>ref|XP_008787183.1| PREDICTED: uncharacterized protein LOC103705300 [Phoenix dactylifera]
Length=141

 Score =   125 bits (315),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 70/133 (53%), Positives = 92/133 (69%), Gaps = 0/133 (0%)
 Frame = +2

Query  86   QTAVNHRENAEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVWMkqkk  265
            QT  N+RE AEV+   A C++K  +LLEE  +P+GL PL++  E G NR  GF+W+ QKK
Sbjct  4    QTIENYREAAEVYQGDAPCREKFTQLLEEHGLPKGLFPLEDIKEFGYNRAAGFMWLVQKK  63

Query  266  akehkfkkigkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPDPDAGKINF  445
              EH FKKI + V + TEVTAFVE R++K +TG K K+LLLW++L  I I DP + KI F
Sbjct  64   KNEHTFKKIKQTVSFATEVTAFVEQRKMKKITGAKGKQLLLWLSLVEIYIDDPSSEKITF  123

Query  446  STPAGLSRSYPVS  484
             +  GLS S+PVS
Sbjct  124  KSGTGLSDSFPVS  136



>ref|XP_003593930.1| hypothetical protein MTR_2g019480 [Medicago truncatula]
 gb|AES64181.1| DUF538 family protein [Medicago truncatula]
Length=162

 Score =   126 bits (317),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 66/124 (53%), Positives = 95/124 (77%), Gaps = 0/124 (0%)
 Frame = +2

Query  113  AEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVWMkqkkakehkfkki  292
            AE+F   A+CKQKS  LL+E+ +PRGLLPLD  VE+G NR TGFVW++Q++ K H+F  I
Sbjct  16   AEIFKGEAICKQKSRLLLDEMLLPRGLLPLDNIVEMGINRVTGFVWLRQRQKKVHRFNAI  75

Query  293  gkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPDPDAGKINFSTPAGLSRS  472
            G+ V +DTEVTAFVE+  ++ +TGVK+KEL +W+ ++ I I DP + KI F+  +G++RS
Sbjct  76   GRTVSFDTEVTAFVEEHVMRRITGVKTKELFVWLPVSTIFIDDPSSNKILFANSSGIARS  135

Query  473  YPVS  484
            +P+S
Sbjct  136  FPLS  139



>emb|CDX95276.1| BnaC09g15940D [Brassica napus]
Length=155

 Score =   126 bits (316),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 74/128 (58%), Positives = 95/128 (74%), Gaps = 1/128 (1%)
 Frame = +2

Query  104  RENAEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVWMkqkkakehkf  283
            R  AE +T   +C++K+ E L+E+ MP GLLPL +  EVG +RETG VW+KQKK+  HKF
Sbjct  9    RARAEKYTGDELCREKTKEFLKEVDMPNGLLPLKDIEEVGYDRETGVVWLKQKKSITHKF  68

Query  284  kkigkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPDP-DAGKINFSTPAG  460
            + IGKLV Y TEVTA VE  ++K LTGVK+KELL+WVTL  + +  P  +GKINF TP G
Sbjct  69   ESIGKLVSYGTEVTAVVEVGKIKKLTGVKAKELLIWVTLNELVLEQPTSSGKINFRTPTG  128

Query  461  LSRSYPVS  484
            LSR++PVS
Sbjct  129  LSRTFPVS  136



>emb|CDY57268.1| BnaA03g59570D [Brassica napus]
Length=144

 Score =   125 bits (315),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 73/128 (57%), Positives = 96/128 (75%), Gaps = 1/128 (1%)
 Frame = +2

Query  104  RENAEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVWMkqkkakehkf  283
            R  AE++T   +C+QK+ E+L+EI MP GLLPL +  EVG +RETG VW+KQKK+  HKF
Sbjct  9    RARAEIYTGDELCRQKTKEVLKEIDMPNGLLPLKDIEEVGYDRETGVVWLKQKKSITHKF  68

Query  284  kkigkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPDP-DAGKINFSTPAG  460
            + IGKLV Y TEVTA VE  ++K LTGVK+KE+ +WVTL  +++  P  +GKINF T  G
Sbjct  69   EAIGKLVSYGTEVTAVVEVGKIKKLTGVKAKEVFIWVTLNELALDQPTSSGKINFRTLTG  128

Query  461  LSRSYPVS  484
            LSR++PVS
Sbjct  129  LSRTFPVS  136



>ref|XP_009387207.1| PREDICTED: uncharacterized protein LOC103974170 [Musa acuminata 
subsp. malaccensis]
Length=142

 Score =   125 bits (314),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 68/133 (51%), Positives = 94/133 (71%), Gaps = 0/133 (0%)
 Frame = +2

Query  80   SQQTAVNHRENAEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVWMkq  259
            +  T   +R+ AEV+   ++CK+KS+ELL E+ +P+GL PLD   E G NRE GFVW+ Q
Sbjct  2    ASATIDRYRKGAEVYKGDSICKKKSIELLAELRLPKGLFPLDNVEEFGHNREAGFVWLIQ  61

Query  260  kkakehkfkkigkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPDPDAGKI  439
            KK K+H FKKI + V Y  EVTAFVE+ ++K +TGVK+KELLLW+++  + + DP + KI
Sbjct  62   KKKKDHTFKKIKRQVSYAPEVTAFVEEGKMKKMTGVKTKELLLWLSIVEMYVDDPSSEKI  121

Query  440  NFSTPAGLSRSYP  478
             F T  GLS S+P
Sbjct  122  TFKTGTGLSDSFP  134



>gb|EEE54097.1| hypothetical protein OsJ_00845 [Oryza sativa Japonica Group]
Length=161

 Score =   126 bits (316),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 67/136 (49%), Positives = 85/136 (63%), Gaps = 7/136 (5%)
 Frame = +2

Query  74   MSSQQTAVNHRENAEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVWM  253
            M SQ     HRE AEV+   A+C + ++ELL EIHMP GLLPL +  EVG NR TG   +
Sbjct  1    MGSQAIEA-HREGAEVYHGAALCAENAVELLAEIHMPLGLLPLADMEEVGYNRATGRRAI  59

Query  254  kqkkakehkfkkigkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPDPDAG  433
                 +  +       V +  EVTAFVEDRR+K +TG K+KELL+WV+L+ + I   DA 
Sbjct  60   THTFKQISRQ------VSFAAEVTAFVEDRRMKRVTGAKTKELLIWVSLSDMFIDKDDAS  113

Query  434  KINFSTPAGLSRSYPV  481
            KI F TP GL R+YPV
Sbjct  114  KITFKTPTGLGRTYPV  129



>emb|CDY41704.1| BnaA09g15320D [Brassica napus]
Length=155

 Score =   125 bits (314),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 74/128 (58%), Positives = 95/128 (74%), Gaps = 1/128 (1%)
 Frame = +2

Query  104  RENAEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVWMkqkkakehkf  283
            R  AE +T   +C++K+ E L+E+ MP GLLPL +  EVG +RETG VW+KQKK+  HKF
Sbjct  9    RARAEKYTGDELCREKTKEFLKEVDMPNGLLPLKDIEEVGYDRETGVVWLKQKKSITHKF  68

Query  284  kkigkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPDPDA-GKINFSTPAG  460
            + IGKLV Y TEVTA VE  ++K LTGVK+KELL+WVTL  + +  P + GKINF TP G
Sbjct  69   ESIGKLVSYGTEVTAVVEVGKIKKLTGVKAKELLIWVTLNELVLEQPTSLGKINFRTPTG  128

Query  461  LSRSYPVS  484
            LSR++PVS
Sbjct  129  LSRTFPVS  136



>ref|XP_008370369.1| PREDICTED: uncharacterized protein LOC103433861 [Malus domestica]
 ref|XP_008345587.1| PREDICTED: uncharacterized protein LOC103408523 [Malus domestica]
Length=165

 Score =   125 bits (315),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 77/137 (56%), Positives = 97/137 (71%), Gaps = 0/137 (0%)
 Frame = +2

Query  74   MSSQQTAVNHRENAEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVWM  253
            MSS  TA    +  E++    +C+QK+ +LL EI +P GLLPL +  E G  RETGFVW+
Sbjct  1    MSSLITAEIKSKADELYHGDEICQQKAKQLLSEISLPNGLLPLKDIEECGIIRETGFVWL  60

Query  254  kqkkakehkfkkigkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPDPDAG  433
            KQKK+  HKF+KIGKLV Y  EVTA VE  ++K LTGVK+KELL+WV L+ I + DP  G
Sbjct  61   KQKKSYTHKFEKIGKLVSYAPEVTAIVEKGKIKKLTGVKTKELLVWVQLSDIYVDDPPTG  120

Query  434  KINFSTPAGLSRSYPVS  484
            KI F TPAGL R++PVS
Sbjct  121  KITFKTPAGLFRTFPVS  137



>gb|EMT25031.1| hypothetical protein F775_27196 [Aegilops tauschii]
Length=179

 Score =   125 bits (315),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 75/148 (51%), Positives = 93/148 (63%), Gaps = 20/148 (14%)
 Frame = +2

Query  101  HRENAEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVWM---------  253
             RE AEV+   A+C +K++ELL E +MP GLLPL    EVG NR TGFVW+         
Sbjct  8    QREGAEVYHGAALCAEKAVELLAETNMPLGLLPLAGIQEVGYNRATGFVWLRQKKALTHT  67

Query  254  -----------kqkkakehkfkkigkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTL  400
                        +KKA  H FK+IG+ V Y TEVTAFVEDR++K +TGVKSKELL+W+TL
Sbjct  68   FKQIGRQVSYATEKKALTHTFKQIGRQVSYATEVTAFVEDRKMKRMTGVKSKELLIWITL  127

Query  401  THISIPDPDAGKINFSTPAGLSRSYPVS  484
              + I   D  KI F TP GL R++PVS
Sbjct  128  CDMYIEKDDPSKITFKTPTGLGRTFPVS  155



>emb|CDY04373.1| BnaC04g18200D [Brassica napus]
Length=144

 Score =   124 bits (312),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 73/128 (57%), Positives = 96/128 (75%), Gaps = 1/128 (1%)
 Frame = +2

Query  104  RENAEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVWMkqkkakehkf  283
            R  AE +T   +C+QK+ E+L+EI MP GLLPL +  EVG +RETG +W+KQKK+  HKF
Sbjct  9    RARAEKYTGDELCRQKTKEVLKEIDMPNGLLPLKDIEEVGYDRETGVMWLKQKKSITHKF  68

Query  284  kkigkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPDP-DAGKINFSTPAG  460
            + IGKLV Y TEVTA VE  ++K LTGVK+KELL+WVTL  +++  P  +GKINF T  G
Sbjct  69   EAIGKLVSYGTEVTAVVEVGKIKKLTGVKAKELLIWVTLNELALEQPTSSGKINFRTLTG  128

Query  461  LSRSYPVS  484
            LSR++P+S
Sbjct  129  LSRTFPIS  136



>ref|XP_010939039.1| PREDICTED: uncharacterized protein LOC105057984 [Elaeis guineensis]
Length=152

 Score =   125 bits (313),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 71/133 (53%), Positives = 95/133 (71%), Gaps = 0/133 (0%)
 Frame = +2

Query  86   QTAVNHRENAEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVWMkqkk  265
            Q   ++RE AEV+    +CK+KS++LLEE+ +P+ LLPL +  E G NR  GF+W+ QKK
Sbjct  15   QEGWSYREGAEVYRGDDICKKKSIQLLEELSLPKDLLPLVDIEEFGYNRAAGFMWLIQKK  74

Query  266  akehkfkkigkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPDPDAGKINF  445
             KEH FKKI + V Y TEVTAFVE  ++K +TGVK+KELLLW+++  + I DP + KI F
Sbjct  75   KKEHTFKKIKQTVSYATEVTAFVEHHKMKKITGVKTKELLLWLSVVEVYIDDPSSEKITF  134

Query  446  STPAGLSRSYPVS  484
             T  GLS S+PVS
Sbjct  135  KTGTGLSDSFPVS  147



>ref|XP_009359546.1| PREDICTED: uncharacterized protein LOC103950122 [Pyrus x bretschneideri]
Length=157

 Score =   125 bits (313),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 65/138 (47%), Positives = 93/138 (67%), Gaps = 2/138 (1%)
 Frame = +2

Query  77   SSQQTAV--NHRENAEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVW  250
            S +Q  V    R  AE+   P  C ++S+++L+E+  P+G+LPL + VE GR RETGFVW
Sbjct  3    SGKQLVVEDKQRAGAEIVYGPEDCYRQSIDMLQELGFPKGVLPLQDLVECGRVRETGFVW  62

Query  251  MkqkkakehkfkkigkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPDPDA  430
            MKQK+  EH F+     V Y TEVT +VE  R+K +TG+KSK++ LWVT++ +S+ DP  
Sbjct  63   MKQKQPYEHFFEGSNTRVSYATEVTGYVEKCRMKKMTGIKSKQVFLWVTISEMSVEDPAG  122

Query  431  GKINFSTPAGLSRSYPVS  484
             KI F TP G+ +S+PV+
Sbjct  123  KKIVFKTPMGIGKSFPVT  140



>ref|XP_010511299.1| PREDICTED: uncharacterized protein LOC104787419 isoform X1 [Camelina 
sativa]
 ref|XP_010511300.1| PREDICTED: uncharacterized protein LOC104787419 isoform X2 [Camelina 
sativa]
 ref|XP_010415006.1| PREDICTED: uncharacterized protein LOC104701072 [Camelina sativa]
 ref|XP_010480272.1| PREDICTED: uncharacterized protein LOC104758993 [Camelina sativa]
Length=162

 Score =   125 bits (313),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 71/128 (55%), Positives = 95/128 (74%), Gaps = 1/128 (1%)
 Frame = +2

Query  104  RENAEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVWMkqkkakehkf  283
            R  AE +T   +C++K+ E L+E+ MP GLLPL +  EVG +R+TG VW+KQKK+  HKF
Sbjct  9    RARAEKYTGDELCREKTKEFLKEVSMPNGLLPLKDIEEVGYDRQTGIVWLKQKKSITHKF  68

Query  284  kkigkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPDP-DAGKINFSTPAG  460
            + I KLV Y TEVTA VE  ++K L+GVK+KELL+WVTL  + + +P  +GKINF TP G
Sbjct  69   EAISKLVSYATEVTAQVEVGKIKKLSGVKAKELLIWVTLNELVLEEPISSGKINFKTPTG  128

Query  461  LSRSYPVS  484
            LSR++PVS
Sbjct  129  LSRTFPVS  136



>gb|KFK44826.1| hypothetical protein AALP_AA1G307800 [Arabis alpina]
Length=143

 Score =   124 bits (311),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 65/137 (47%), Positives = 95/137 (69%), Gaps = 0/137 (0%)
 Frame = +2

Query  74   MSSQQTAVNHRENAEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVWM  253
            M+  +  ++  ++ E +++ ++C  K+ ELL +I++P GLLPL +  EVG N+  GFVWM
Sbjct  1    MAIGEMILDESDDIESYSEESLCLDKAKELLAQINLPTGLLPLKDMTEVGYNKTKGFVWM  60

Query  254  kqkkakehkfkkigkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPDPDAG  433
            + +   EH F+ IG+ V YDTE+TAFVEDRR+K LTGVKSKEL++WV +  I I + D  
Sbjct  61   RMRSKIEHTFRAIGRRVLYDTEITAFVEDRRMKRLTGVKSKELMIWVPVNDIFIKEKDPE  120

Query  434  KINFSTPAGLSRSYPVS  484
            KI F+   GLSR++ VS
Sbjct  121  KITFANTTGLSRTFKVS  137



>emb|CDP12223.1| unnamed protein product [Coffea canephora]
Length=157

 Score =   124 bits (312),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 68/138 (49%), Positives = 91/138 (66%), Gaps = 2/138 (1%)
 Frame = +2

Query  77   SSQQTAVNH--RENAEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVW  250
            S + +A +   RE AEV      C Q S++LLEE+  P+G+LPL    E GR R TGFVW
Sbjct  3    SGRSSAADQERREGAEVVYGAEACYQHSIQLLEELGFPKGVLPLQNLEECGRVRATGFVW  62

Query  251  MkqkkakehkfkkigkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPDPDA  430
            MKQKK  +H F     LV Y TEVTA+VE  ++K +TGVKSK+LLLW+ +  +SI DPD 
Sbjct  63   MKQKKPYQHFFTGSNTLVSYATEVTAYVEKFKMKKMTGVKSKQLLLWIPIAEMSIDDPDH  122

Query  431  GKINFSTPAGLSRSYPVS  484
             KI F+TP G+ + +P++
Sbjct  123  KKIYFNTPLGIGKFFPIT  140



>ref|XP_008388456.1| PREDICTED: uncharacterized protein At5g01610-like [Malus domestica]
Length=166

 Score =   125 bits (313),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 78/137 (57%), Positives = 96/137 (70%), Gaps = 0/137 (0%)
 Frame = +2

Query  74   MSSQQTAVNHRENAEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVWM  253
            MSS  TA    +  E++    +C+QKS ELL EI +P GLLPL +  E G  RETGFVW+
Sbjct  1    MSSLITAEIKSKADELYHGDEICQQKSKELLSEICLPNGLLPLKDIEECGIVRETGFVWL  60

Query  254  kqkkakehkfkkigkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPDPDAG  433
            KQKK+  HKF+KIGKLV Y  EVTA VE  ++K LTGVK+KELL+WV L+ I   DP  G
Sbjct  61   KQKKSCTHKFEKIGKLVSYAPEVTAVVEKGKIKKLTGVKTKELLIWVQLSDIYTDDPPTG  120

Query  434  KINFSTPAGLSRSYPVS  484
            KI F TP+GL R++PVS
Sbjct  121  KITFKTPSGLFRTFPVS  137



>ref|XP_008239225.1| PREDICTED: uncharacterized protein LOC103337838 [Prunus mume]
Length=154

 Score =   124 bits (312),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 64/137 (47%), Positives = 92/137 (67%), Gaps = 0/137 (0%)
 Frame = +2

Query  74   MSSQQTAVNHRENAEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVWM  253
            M+S +   + R  AE+   P  C + S++LLEE+  P+G+LPL + VE GR RETGFVWM
Sbjct  1    MASNKQLEDKRAGAEIVYGPEDCYRHSIDLLEELGFPKGVLPLQDLVECGRVRETGFVWM  60

Query  254  kqkkakehkfkkigkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPDPDAG  433
            KQK+  EH F      V Y TEVT +VE  ++K +TG+KSK++ LWV ++ +SI DP + 
Sbjct  61   KQKQPYEHFFVGSNTRVSYATEVTGYVEKLKMKKMTGIKSKQVFLWVPISDMSIDDPSSK  120

Query  434  KINFSTPAGLSRSYPVS  484
            KI F TP G+ +S+P++
Sbjct  121  KIVFKTPVGIGKSFPIT  137



>gb|KFK22546.1| hypothetical protein AALP_AAs68488U000700 [Arabis alpina]
Length=166

 Score =   125 bits (313),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 70/128 (55%), Positives = 96/128 (75%), Gaps = 1/128 (1%)
 Frame = +2

Query  104  RENAEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVWMkqkkakehkf  283
            R  AE +T   +C++K+ E L+E+ MP G+LPL +  EVG +RE+G VW++QKK+  HKF
Sbjct  9    RARAEKYTGDEICREKTKEFLKEVSMPNGILPLKDIEEVGYDRESGVVWLRQKKSITHKF  68

Query  284  kkigkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPDP-DAGKINFSTPAG  460
            + IGKLV Y T+VTA VE  ++K LTGVK+KELL+WVTL  +++  P  +GKINF TP G
Sbjct  69   ETIGKLVSYGTDVTAVVEIGKIKKLTGVKAKELLIWVTLNELALEQPTSSGKINFRTPTG  128

Query  461  LSRSYPVS  484
            LSR++PVS
Sbjct  129  LSRTFPVS  136



>ref|NP_564720.1| protein SMALLER WITH VARIABLE BRANCHES [Arabidopsis thaliana]
 gb|AAG09105.1|AC009323_16 Unknown protein [Arabidopsis thaliana]
 gb|AAL25527.1| At1g56580/F25P12_18 [Arabidopsis thaliana]
 gb|AAM26655.1| At1g56580/F25P12_18 [Arabidopsis thaliana]
 gb|AEE33411.1| protein SMALLER WITH VARIABLE BRANCHES [Arabidopsis thaliana]
Length=166

 Score =   125 bits (313),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 73/128 (57%), Positives = 94/128 (73%), Gaps = 1/128 (1%)
 Frame = +2

Query  104  RENAEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVWMkqkkakehkf  283
            R  AE +T   +C++K+ E L+E+ MP GLLPL +  EVG +RETG VW+KQKK+  HKF
Sbjct  9    RARAEKYTGDEICREKTKEFLKEVSMPNGLLPLKDIEEVGYDRETGIVWLKQKKSITHKF  68

Query  284  kkigkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPDP-DAGKINFSTPAG  460
            + IGKLV Y TEV A VE  ++K LTGVK+KELL+WVTL  + +  P  +GKINF TP G
Sbjct  69   EAIGKLVSYATEVIAQVEVGKIKKLTGVKAKELLIWVTLNELVLEQPTSSGKINFRTPTG  128

Query  461  LSRSYPVS  484
            LSR++PVS
Sbjct  129  LSRTFPVS  136



>ref|XP_009113380.1| PREDICTED: uncharacterized protein LOC103838680 [Brassica rapa]
Length=155

 Score =   124 bits (312),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 73/128 (57%), Positives = 94/128 (73%), Gaps = 1/128 (1%)
 Frame = +2

Query  104  RENAEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVWMkqkkakehkf  283
            R  AE +T   +C++K+ E L+E+ MP GLLPL +  EVG +RETG VW+KQKK+  HKF
Sbjct  9    RARAEKYTGDELCREKTKEFLKEVDMPNGLLPLKDIEEVGYDRETGVVWLKQKKSITHKF  68

Query  284  kkigkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPDP-DAGKINFSTPAG  460
            + IGKL  Y TEVTA VE  ++K LTGVK+KELL+WVTL  + +  P  +GKINF TP G
Sbjct  69   ESIGKLGSYGTEVTAVVEGGKIKKLTGVKAKELLIWVTLNELVLEQPTSSGKINFRTPTG  128

Query  461  LSRSYPVS  484
            LSR++PVS
Sbjct  129  LSRTFPVS  136



>ref|XP_008791617.1| PREDICTED: uncharacterized protein LOC103708464 [Phoenix dactylifera]
Length=154

 Score =   124 bits (311),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 67/127 (53%), Positives = 85/127 (67%), Gaps = 0/127 (0%)
 Frame = +2

Query  104  RENAEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVWMkqkkakehkf  283
            RE AE+   P  C + S+ELLEE+  P G+LPL +  E GR RETGFVWMKQK   EH F
Sbjct  12   REGAEIVYGPEECHRHSMELLEELGFPPGVLPLKDLEECGRARETGFVWMKQKGPYEHFF  71

Query  284  kkigkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPDPDAGKINFSTPAGL  463
                  V Y+T VTA+VE  R+K +TGV+SK++LLWV +T +SI DP   KI F +  G+
Sbjct  72   TGTNTRVRYETVVTAYVEKNRMKKMTGVRSKQMLLWVPITEMSIDDPAGKKIYFKSAVGI  131

Query  464  SRSYPVS  484
             RS+PVS
Sbjct  132  GRSFPVS  138



>ref|NP_001238325.1| uncharacterized protein LOC100306660 [Glycine max]
 gb|ACU14949.1| unknown [Glycine max]
Length=165

 Score =   124 bits (311),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 74/131 (56%), Positives = 95/131 (73%), Gaps = 0/131 (0%)
 Frame = +2

Query  92   AVNHRENAEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVWMkqkkak  271
            A + +  +EV+    +C+ KS ELL+EI +P GLLPL +  E G +R+TGFVW+KQKK+ 
Sbjct  6    AEDVKSRSEVYHGDEMCQVKSKELLKEIALPNGLLPLKDMEECGYDRQTGFVWLKQKKSY  65

Query  272  ehkfkkigkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPDPDAGKINFST  451
             HKF KIGKLV Y  EVTA V+  ++  LTGVK+KELLLW+TL+ I + DP  GKI F T
Sbjct  66   THKFDKIGKLVSYAPEVTAHVQQGKITKLTGVKTKELLLWITLSDIYVDDPPTGKITFKT  125

Query  452  PAGLSRSYPVS  484
            PAGL RS+PVS
Sbjct  126  PAGLFRSFPVS  136



>ref|XP_007209730.1| hypothetical protein PRUPE_ppa012800mg [Prunus persica]
 gb|EMJ10929.1| hypothetical protein PRUPE_ppa012800mg [Prunus persica]
Length=154

 Score =   124 bits (310),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 64/137 (47%), Positives = 92/137 (67%), Gaps = 0/137 (0%)
 Frame = +2

Query  74   MSSQQTAVNHRENAEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVWM  253
            M+S +   + R  AE+   P  C + S++LLEE+  P+G+LPL + VE GR RETGFVWM
Sbjct  1    MASNKQLEDKRAGAEIVYGPEDCYRHSIDLLEELGFPKGVLPLQDLVECGRVRETGFVWM  60

Query  254  kqkkakehkfkkigkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPDPDAG  433
            KQK+  EH F      V Y TEVT +VE  ++K +TG+KSK++ LWV ++ +SI DP + 
Sbjct  61   KQKRPYEHFFVGSNTRVSYATEVTGYVEKLKMKKMTGIKSKQVFLWVPISEMSIDDPASK  120

Query  434  KINFSTPAGLSRSYPVS  484
            KI F TP G+ +S+P++
Sbjct  121  KIVFKTPMGIGKSFPIT  137



>ref|XP_009373308.1| PREDICTED: uncharacterized protein LOC103962334 [Pyrus x bretschneideri]
Length=166

 Score =   124 bits (311),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 77/137 (56%), Positives = 96/137 (70%), Gaps = 0/137 (0%)
 Frame = +2

Query  74   MSSQQTAVNHRENAEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVWM  253
            MSS  TA    +  E++    +C+QK+ ELL EI +P GLLPL +  E G  RETGFVW+
Sbjct  1    MSSLITAEIKSKADELYHGDEICQQKTKELLSEISLPNGLLPLKDIEECGIVRETGFVWL  60

Query  254  kqkkakehkfkkigkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPDPDAG  433
            KQKK+  HKF+KIGKLV Y  EVTA VE  ++K LTGVK+KELL+WV L+ I   DP  G
Sbjct  61   KQKKSCTHKFEKIGKLVTYAPEVTAIVEKGKIKKLTGVKTKELLVWVQLSDIYTDDPPTG  120

Query  434  KINFSTPAGLSRSYPVS  484
            KI F TP+GL R++PVS
Sbjct  121  KITFKTPSGLFRTFPVS  137



>ref|XP_008374117.1| PREDICTED: uncharacterized protein LOC103437424 [Malus domestica]
Length=157

 Score =   124 bits (310),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 63/129 (49%), Positives = 88/129 (68%), Gaps = 0/129 (0%)
 Frame = +2

Query  98   NHRENAEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVWMkqkkakeh  277
              R  AE+   P  C ++S++LLEE+  P+G+LPL + VE GR RETGFVWMKQK+  EH
Sbjct  12   KQRAGAEIVYGPEDCYRQSIDLLEELGFPKGVLPLQDLVECGRVRETGFVWMKQKQPYEH  71

Query  278  kfkkigkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPDPDAGKINFSTPA  457
             F+     V Y TEVT +VE  R+K +TG+KSK++ LWV ++ +S+ DP   KI F TP 
Sbjct  72   FFEGSNTRVSYATEVTGYVEKCRMKKMTGIKSKQVFLWVPISEMSVEDPXGKKIVFKTPM  131

Query  458  GLSRSYPVS  484
            G+ +S+PV+
Sbjct  132  GIGKSFPVT  140



>ref|XP_010100195.1| hypothetical protein L484_015340 [Morus notabilis]
 gb|EXB81866.1| hypothetical protein L484_015340 [Morus notabilis]
Length=171

 Score =   124 bits (311),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 66/129 (51%), Positives = 87/129 (67%), Gaps = 0/129 (0%)
 Frame = +2

Query  98   NHRENAEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVWMkqkkakeh  277
            + R  AE+      C +KS ELLEE+  P G+LPL +  E GR RETGFVWMKQ+   EH
Sbjct  5    DERAGAEIVHGAEECYRKSAELLEELGFPTGVLPLKDLEECGRVRETGFVWMKQRAPYEH  64

Query  278  kfkkigkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPDPDAGKINFSTPA  457
             F+K    V Y TEVTA+VE RR+K +TGVKSK++ LWV ++ +SI DP   +I F TP 
Sbjct  65   YFEKSKTRVSYATEVTAYVERRRMKRMTGVKSKQVFLWVPISEMSIEDPAGKRITFRTPM  124

Query  458  GLSRSYPVS  484
            G+ +S+PV+
Sbjct  125  GIGKSFPVT  133



>gb|ERM99857.1| hypothetical protein AMTR_s00098p00138460 [Amborella trichopoda]
Length=167

 Score =   124 bits (311),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 70/127 (55%), Positives = 94/127 (74%), Gaps = 0/127 (0%)
 Frame = +2

Query  104  RENAEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVWMkqkkakehkf  283
            +E A+++    +CK KSLELL E+ MP GLLPL++ +E G   ET FVW+KQKK+K+H F
Sbjct  10   KEKAQIYLGDEICKAKSLELLREVGMPNGLLPLEDVLECGYIEETCFVWLKQKKSKQHHF  69

Query  284  kkigkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPDPDAGKINFSTPAGL  463
             K+GKLV Y  EVTA+VE+ R+K +TGVK KEL+LW+TL+ I + +P  GK  F   AGL
Sbjct  70   DKVGKLVSYAPEVTAYVENSRMKKVTGVKVKELMLWITLSEIYVNNPPTGKFTFKMLAGL  129

Query  464  SRSYPVS  484
            S+S+PVS
Sbjct  130  SKSFPVS  136



>gb|KCW77320.1| hypothetical protein EUGRSUZ_D01682 [Eucalyptus grandis]
Length=155

 Score =   123 bits (309),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 62/136 (46%), Positives = 91/136 (67%), Gaps = 0/136 (0%)
 Frame = +2

Query  77   SSQQTAVNHRENAEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVWMk  256
            ++ ++A + R  AE+      C ++S+ELL+E+  P+G++PL    E GR RETGFVWMK
Sbjct  3    TTNKSAADERAGAEIVYGAEECHRQSVELLQELGFPKGVMPLQNLEECGRVRETGFVWMK  62

Query  257  qkkakehkfkkigkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPDPDAGK  436
            QK   EH F   G  V Y TEVTA+VE  R+K +TG+KS+++ LWV +  +S+ +P A K
Sbjct  63   QKAPYEHFFANTGTRVSYATEVTAYVEKSRMKRMTGIKSRQMFLWVPIAEMSLEEPAASK  122

Query  437  INFSTPAGLSRSYPVS  484
            I F TP G+ +S+PV+
Sbjct  123  ITFKTPMGIGKSFPVT  138



>ref|XP_010676901.1| PREDICTED: uncharacterized protein LOC104892619 [Beta vulgaris 
subsp. vulgaris]
Length=158

 Score =   124 bits (310),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 63/127 (50%), Positives = 89/127 (70%), Gaps = 0/127 (0%)
 Frame = +2

Query  104  RENAEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVWMkqkkakehkf  283
            RE AE+      C++ S  LLEE+  P+G++PL + VE GR RETGFVWMKQK   EH F
Sbjct  15   REGAEIVYGAEECQKSSFALLEELGFPKGVMPLKDLVECGRVRETGFVWMKQKAPSEHTF  74

Query  284  kkigkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPDPDAGKINFSTPAGL  463
            + I   V Y TEVT +VE  ++K +TGVKSK+LLLWV +T +S+ +P +GKI+F +  G+
Sbjct  75   ESIKTEVSYATEVTCYVEKGKMKKMTGVKSKQLLLWVAITEMSVDEPCSGKIHFKSVVGI  134

Query  464  SRSYPVS  484
             +S+P++
Sbjct  135  GKSFPIT  141



>emb|CDY48399.1| BnaAnng09680D [Brassica napus]
Length=166

 Score =   124 bits (310),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 73/128 (57%), Positives = 95/128 (74%), Gaps = 1/128 (1%)
 Frame = +2

Query  104  RENAEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVWMkqkkakehkf  283
            R  AE +T   +C++K+   L+E +MP GLLPL +  EVG +RETG VW+KQKK+  HKF
Sbjct  9    RARAEKYTGDELCREKTKVFLKEANMPNGLLPLKDIEEVGYDRETGVVWLKQKKSITHKF  68

Query  284  kkigkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPDP-DAGKINFSTPAG  460
            + IGKLV Y TEVTA VE  ++K LTGVK+KELL+WVTL+ + +  P  +GKINF TP G
Sbjct  69   ETIGKLVSYGTEVTAVVEVGKIKKLTGVKAKELLIWVTLSELVLEQPTSSGKINFRTPTG  128

Query  461  LSRSYPVS  484
            LSR++PVS
Sbjct  129  LSRTFPVS  136



>ref|XP_004230326.1| PREDICTED: uncharacterized protein LOC101254945 [Solanum lycopersicum]
Length=164

 Score =   124 bits (310),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 68/123 (55%), Positives = 94/123 (76%), Gaps = 0/123 (0%)
 Frame = +2

Query  116  EVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVWMkqkkakehkfkkig  295
            E +T   +C++KS  LL E+++P GLLPL + +E G  ++TGFVW+K KK  EHKF+KIG
Sbjct  14   EFYTGNDICQEKSKFLLTEMNLPNGLLPLQDMLECGYVKDTGFVWLKSKKKTEHKFEKIG  73

Query  296  kLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPDPDAGKINFSTPAGLSRSY  475
            + V Y TEVTA+VE  ++K LTGVK+KELL+W+TL  IS+ +P  GKI+F TP GL+R++
Sbjct  74   RSVQYATEVTAYVEPNKIKKLTGVKAKELLMWLTLNEISVDEPSTGKIHFKTPTGLARTF  133

Query  476  PVS  484
            PVS
Sbjct  134  PVS  136



>gb|KJB66925.1| hypothetical protein B456_010G166200 [Gossypium raimondii]
Length=146

 Score =   123 bits (308),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 66/128 (52%), Positives = 93/128 (73%), Gaps = 1/128 (1%)
 Frame = +2

Query  101  HRENAEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVWMkqkkakehk  280
            H  NAE ++   VCKQK LELLEEI +P+G+ P+ E +E GRNR TG VWMK K  KEHK
Sbjct  9    HGANAETYSGEDVCKQKFLELLEEISLPKGIEPV-EIIEFGRNRSTGLVWMKLKNKKEHK  67

Query  281  fkkigkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPDPDAGKINFSTPAG  460
            FK+I K+V Y+ E+  F+++  +K LTG+K KEL +W+T++ + I DP +GKI+F+ P+G
Sbjct  68   FKRINKVVSYNREINFFIDNGGIKKLTGIKCKELFIWITISGMFIEDPSSGKISFTIPSG  127

Query  461  LSRSYPVS  484
            L   +P+S
Sbjct  128  LKAHFPIS  135



>ref|XP_004309540.1| PREDICTED: uncharacterized protein LOC101304828 [Fragaria vesca 
subsp. vesca]
Length=153

 Score =   123 bits (308),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 64/129 (50%), Positives = 86/129 (67%), Gaps = 0/129 (0%)
 Frame = +2

Query  98   NHRENAEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVWMkqkkakeh  277
            + R  AE+      C Q+S++LLEE+  P+G+LPL + VE GR RETGFVWMKQK   EH
Sbjct  7    DKRAGAEIVHGAEECYQQSIDLLEELGFPKGVLPLKDLVECGRVRETGFVWMKQKAPYEH  66

Query  278  kfkkigkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPDPDAGKINFSTPA  457
             F      V Y TEVTA+VE  R+K +TG+KSK++ LWV +T + + +P   KI F TP 
Sbjct  67   FFVGANTRVSYATEVTAYVEKGRMKKMTGIKSKQVFLWVPITEMIMEEPSTKKITFKTPM  126

Query  458  GLSRSYPVS  484
            G+ RS+PV+
Sbjct  127  GIGRSFPVT  135



>ref|XP_008381148.1| PREDICTED: uncharacterized protein LOC103444018 [Malus domestica]
Length=240

 Score =   125 bits (315),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 71/135 (53%), Positives = 101/135 (75%), Gaps = 2/135 (1%)
 Frame = +2

Query  74   MSSQQTAVNHRENAEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVWM  253
            MS+QQ A  HRE A+++   A+C+QK  ELL+++ +PRGLLPLD+ VE G N  +GFVW+
Sbjct  1    MSAQQIA-GHREGADIYHGEALCRQKFHELLDKMCLPRGLLPLDDVVEFGYNSTSGFVWL  59

Query  254  kqkkakehkfkkigkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISI-PDPDA  430
            KQKK KEH+F+ I K V YDTEV  F+E+ R++ L+GVKSKELL+WV+++ I + P+ D 
Sbjct  60   KQKKRKEHRFRAISKTVSYDTEVMGFLEEHRMRRLSGVKSKELLVWVSISDIYVDPNSDL  119

Query  431  GKINFSTPAGLSRSY  475
             KI F+  +G+SR +
Sbjct  120  NKITFANGSGISRMF  134


 Score = 49.3 bits (116),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 21/56 (38%), Positives = 34/56 (61%), Gaps = 0/56 (0%)
 Frame = +2

Query  317  EVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPDPDAGKINFSTPAGLSRSYPVS  484
            ++T  VE  R+  LTGV SKE+ +W+++  I   D  + K+ F  PA L+ ++P S
Sbjct  172  QLTMLVEKGRITKLTGVASKEVFVWISVCEIYFDDLSSDKLTFKVPASLTATFPAS  227



>ref|XP_011022420.1| PREDICTED: uncharacterized protein LOC105124204 [Populus euphratica]
Length=158

 Score =   123 bits (308),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 64/129 (50%), Positives = 87/129 (67%), Gaps = 0/129 (0%)
 Frame = +2

Query  98   NHRENAEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVWMkqkkakeh  277
            + R  AE+   P  C + S+ELLEE+  P+G+LPL +  E GR +ETGFVWMKQK   EH
Sbjct  10   DERAGAEIVYGPEECHRHSIELLEELGFPKGVLPLKDLEECGRVKETGFVWMKQKAPYEH  69

Query  278  kfkkigkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPDPDAGKINFSTPA  457
             F      V Y TEVTA+VE  ++K +TG+KSK++ LWV ++ +SI DP + KI F TP 
Sbjct  70   FFVGSNTRVSYATEVTAYVEKFKMKKMTGIKSKQMFLWVPISEMSIEDPSSKKILFKTPM  129

Query  458  GLSRSYPVS  484
            G+ +S+PVS
Sbjct  130  GIGKSFPVS  138



>ref|XP_007154458.1| hypothetical protein PHAVU_003G120900g [Phaseolus vulgaris]
 gb|ESW26452.1| hypothetical protein PHAVU_003G120900g [Phaseolus vulgaris]
Length=155

 Score =   123 bits (308),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 64/130 (49%), Positives = 86/130 (66%), Gaps = 0/130 (0%)
 Frame = +2

Query  92   AVNHRENAEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVWMkqkkak  271
             V  RE AE+      C + S+ELLEE+  P+G+LPL + VE GR RE+GFVWMKQK   
Sbjct  4    VVKEREGAEIVYGSEECYRHSIELLEELGFPKGVLPLQDLVECGRVRESGFVWMKQKAPY  63

Query  272  ehkfkkigkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPDPDAGKINFST  451
            EH F+     V Y  EVT +VE  R+K +TG+KSK++LLWV ++ +SI DP   KI F T
Sbjct  64   EHLFEGTNTRVSYAVEVTGYVEKSRMKKMTGIKSKQMLLWVPISEMSIEDPKGKKILFKT  123

Query  452  PAGLSRSYPV  481
            P G+ +S+P+
Sbjct  124  PLGIGKSFPI  133



>ref|XP_008450533.1| PREDICTED: uncharacterized protein LOC103492107 [Cucumis melo]
Length=146

 Score =   122 bits (307),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 70/127 (55%), Positives = 95/127 (75%), Gaps = 0/127 (0%)
 Frame = +2

Query  104  RENAEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVWMkqkkakehkf  283
            +  AEV+    +C++KS E+L+E+ +P GLLPL +  E G  RETGFVW++QKK+  HKF
Sbjct  9    KGKAEVYQGDELCQEKSKEILKEMGLPNGLLPLKDIEECGILRETGFVWIRQKKSTTHKF  68

Query  284  kkigkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPDPDAGKINFSTPAGL  463
            +KIGKLV Y  EVTA VE  ++K L+GVK+KELL+WVTL+ I + +P +GKI F TP GL
Sbjct  69   EKIGKLVSYANEVTAIVEKNKIKKLSGVKTKELLVWVTLSDIYVDEPPSGKITFQTPTGL  128

Query  464  SRSYPVS  484
             R++PVS
Sbjct  129  FRTFPVS  135



>ref|XP_010053069.1| PREDICTED: uncharacterized protein LOC104441615 [Eucalyptus grandis]
Length=183

 Score =   124 bits (310),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 65/139 (47%), Positives = 93/139 (67%), Gaps = 1/139 (1%)
 Frame = +2

Query  71   KMSS-QQTAVNHRENAEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFV  247
            KMS+  ++A + R  AE+      C ++S+ELL+E+  P+G++PL    E GR RETGFV
Sbjct  28   KMSTTNKSAADERAGAEIVYGAEECHRQSVELLQELGFPKGVMPLQNLEECGRVRETGFV  87

Query  248  WMkqkkakehkfkkigkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPDPD  427
            WMKQK   EH F   G  V Y TEVTA+VE  R+K +TG+KS+++ LWV +  +S+ +P 
Sbjct  88   WMKQKAPYEHFFANTGTRVSYATEVTAYVEKSRMKRMTGIKSRQMFLWVPIAEMSLEEPA  147

Query  428  AGKINFSTPAGLSRSYPVS  484
            A KI F TP G+ +S+PV+
Sbjct  148  ASKITFKTPMGIGKSFPVT  166



>ref|XP_007206043.1| hypothetical protein PRUPE_ppa012574mg [Prunus persica]
 gb|EMJ07242.1| hypothetical protein PRUPE_ppa012574mg [Prunus persica]
Length=163

 Score =   123 bits (308),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 70/123 (57%), Positives = 94/123 (76%), Gaps = 0/123 (0%)
 Frame = +2

Query  116  EVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVWMkqkkakehkfkkig  295
            E++    +C++KS +LL EI +P GLLPL +  E G  +ETGFVW+KQKK+  HKF+KIG
Sbjct  14   ELYHGDGICQEKSKKLLTEISLPNGLLPLKDMEECGYVKETGFVWLKQKKSTTHKFEKIG  73

Query  296  kLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPDPDAGKINFSTPAGLSRSY  475
            KLV Y  EVTA+VE+ ++K LTGVK+KELL+WV+L+ I + DP  GKI F TP+GL R++
Sbjct  74   KLVSYAPEVTAYVENGKIKKLTGVKTKELLVWVSLSDIYVDDPPTGKITFKTPSGLFRTF  133

Query  476  PVS  484
            PVS
Sbjct  134  PVS  136



>ref|XP_002893596.1| hypothetical protein ARALYDRAFT_473221 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69855.1| hypothetical protein ARALYDRAFT_473221 [Arabidopsis lyrata subsp. 
lyrata]
Length=156

 Score =   123 bits (308),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 67/151 (44%), Positives = 100/151 (66%), Gaps = 0/151 (0%)
 Frame = +2

Query  74   MSSQQTAVNHRENAEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVWM  253
            M+ ++  ++  ++ E ++D ++C  K+ ELL  I +P GLLPL +  EVG N+  GFVWM
Sbjct  1    MALREMIIDESDDIESYSDQSLCLDKAKELLALIKLPTGLLPLKDMTEVGYNKTKGFVWM  60

Query  254  kqkkakehkfkkigkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPDPDAG  433
            + +   EH F++IG+ V YDTE+TAFVEDRR++ LTGVKSKEL++WV +  I I + D  
Sbjct  61   RMRSKIEHTFREIGRKVLYDTEITAFVEDRRMRRLTGVKSKELMIWVPVNDIFIKEKDPE  120

Query  434  KINFSTPAGLSRSYPVSafeedaaaadGDQK  526
            KI F+   GLSR++  S      +A + +QK
Sbjct  121  KITFANTTGLSRTFKRSNQTSLMSATNKEQK  151



>ref|XP_010251568.1| PREDICTED: uncharacterized protein LOC104593432 [Nelumbo nucifera]
Length=161

 Score =   123 bits (308),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 64/137 (47%), Positives = 91/137 (66%), Gaps = 0/137 (0%)
 Frame = +2

Query  68   LKMSSQQTAVNHRENAEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFV  247
            ++M+S +T  + R  AE+      C + S+E+L+E+  P+G+LPL +  E GR RETGFV
Sbjct  9    IEMASGKTREDERAGAEIVYGSEACYRHSIEMLQELGFPKGVLPLQDLEECGRVRETGFV  68

Query  248  WMkqkkakehkfkkigkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPDPD  427
            WMKQK   EH F      V Y TEVTA++E  ++K +TG+KSK++LLWV +T +SI DP 
Sbjct  69   WMKQKAPYEHFFVGTNTRVSYATEVTAYIEKFKMKKMTGIKSKQVLLWVPITEMSIEDPA  128

Query  428  AGKINFSTPAGLSRSYP  478
            + KI F T  G+ RS+P
Sbjct  129  SKKIYFKTSVGIGRSFP  145



>ref|XP_006597916.1| PREDICTED: uncharacterized protein LOC100790662 [Glycine max]
Length=160

 Score =   123 bits (308),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 62/137 (45%), Positives = 88/137 (64%), Gaps = 0/137 (0%)
 Frame = +2

Query  74   MSSQQTAVNHRENAEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVWM  253
            M+S  T V+ R  AE+      C + S+ELLEE+  P+G++PL + VE GR RETGF+WM
Sbjct  1    MASNTTMVDERAGAEIVYGAEECHRSSMELLEELGFPKGVMPLKDLVECGRVRETGFIWM  60

Query  254  kqkkakehkfkkigkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPDPDAG  433
            KQK   +H F+    LV Y  EVTA+VE  ++K + G+KSK++ +WV +  +SI   +  
Sbjct  61   KQKAPSQHFFEATKTLVSYAAEVTAYVEKFKMKKMNGIKSKQVFIWVPIAEMSIDGDNGK  120

Query  434  KINFSTPAGLSRSYPVS  484
            KI F TP GL +SYP +
Sbjct  121  KILFKTPMGLGKSYPAT  137



>ref|XP_011621057.1| PREDICTED: uncharacterized protein LOC18427898 [Amborella trichopoda]
Length=193

 Score =   124 bits (310),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 81/180 (45%), Positives = 115/180 (64%), Gaps = 5/180 (3%)
 Frame = +2

Query  104  RENAEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVWMkqkkakehkf  283
            +E A+++    +CK KSLELL E+ MP GLLPL++ +E G   ET FVW+KQKK+K+H F
Sbjct  10   KEKAQIYLGDEICKAKSLELLREVGMPNGLLPLEDVLECGYIEETCFVWLKQKKSKQHHF  69

Query  284  kkigkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPDPDAGKINFSTPAGL  463
             K+GKLV Y  EVTA+VE+ R+K +TGVK KEL+LW+TL+ I + +P  GK  F   AGL
Sbjct  70   DKVGKLVSYAPEVTAYVENSRMKKVTGVKVKELMLWITLSEIYVNNPPTGKFTFKMLAGL  129

Query  464  SRSYPVSafeedaaaadGDQKK*TLSPGCLQKPIS*KNNTFSFYCNIVIFSVFFEVLLNF  643
            S+S+PVSAFE        ++K   +  G  +K +  +  +   Y  ++    F  + LNF
Sbjct  130  SKSFPVSAFEVPE-----EKKAEKIVGGSQEKELWRRLRSIHIYIYLLSLCYFLYIDLNF  184



>gb|KJB27384.1| hypothetical protein B456_004G235700 [Gossypium raimondii]
Length=169

 Score =   123 bits (308),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 71/124 (57%), Positives = 92/124 (74%), Gaps = 0/124 (0%)
 Frame = +2

Query  113  AEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVWMkqkkakehkfkki  292
            +E++    +C++KS  LLEE+ MP GLLPL +  E G  ++TGFVW+KQKK+  HKF KI
Sbjct  13   SEIYHGDEICQEKSKFLLEEMGMPSGLLPLKDIEECGYVKDTGFVWLKQKKSITHKFDKI  72

Query  293  gkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPDPDAGKINFSTPAGLSRS  472
            GKLV Y TEVTA VE  ++K LTGVK+KELL+W+TL+ I + DP  G I F TPAGL R+
Sbjct  73   GKLVSYATEVTAVVEKNKIKKLTGVKTKELLVWITLSDIYVDDPPTGNITFKTPAGLFRT  132

Query  473  YPVS  484
            +PVS
Sbjct  133  FPVS  136



>ref|XP_009590351.1| PREDICTED: uncharacterized protein LOC104087549, partial [Nicotiana 
tomentosiformis]
Length=105

 Score =   121 bits (303),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 66/108 (61%), Positives = 82/108 (76%), Gaps = 5/108 (5%)
 Frame = +2

Query  74   MSSQQTAV--NHRENAEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFV  247
            M S Q  V  NHRENAE++TD  +C +KS ELLEEI+MPRGLLPL++ VEVGRN ETGFV
Sbjct  1    MLSAQLEVIENHRENAEIYTDQLLCLKKSFELLEEINMPRGLLPLEDIVEVGRNHETGFV  60

Query  248  WMkqkkakehkfkkigkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLW  391
            W+K+  A + + KK    V Y  EV+AFVEDRR+K++TGVK+KEL  W
Sbjct  61   WLKRITASKQQKKKT---VTYAAEVSAFVEDRRMKNITGVKTKELSFW  105



>ref|NP_001145528.1| uncharacterized protein LOC100278952 [Zea mays]
 ref|XP_008668766.1| PREDICTED: uncharacterized protein At5g01610-like [Zea mays]
 gb|ACG48232.1| hypothetical protein [Zea mays]
 tpg|DAA35614.1| TPA: hypothetical protein ZEAMMB73_652181 [Zea mays]
 tpg|DAA35617.1| TPA: hypothetical protein ZEAMMB73_235499 [Zea mays]
Length=143

 Score =   122 bits (306),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 64/136 (47%), Positives = 92/136 (68%), Gaps = 1/136 (1%)
 Frame = +2

Query  80   SQQTAVNHRENAEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVWMkq  259
            + Q   NHR  AEV T  A+C++KS+ELLEE+ +P+G LPL +  E G NRETGF+W+ Q
Sbjct  2    ASQAIENHRAGAEVVTGDAICRKKSIELLEELGLPKGFLPLVDIQEFGYNRETGFMWLVQ  61

Query  260  kkakeh-kfkkigkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPDPDAGK  436
             K K    FK+I + V Y TEVTAF E  +L+ +TGVK+KEL+LW+++  + +P+  + K
Sbjct  62   GKKKVEHTFKRIKQTVSYATEVTAFAEKGKLRKITGVKTKELMLWLSVVEVYVPEASSEK  121

Query  437  INFSTPAGLSRSYPVS  484
            + F T  GLS ++  S
Sbjct  122  VTFKTGTGLSDTFDAS  137



>ref|XP_008806722.1| PREDICTED: uncharacterized protein LOC103719312 [Phoenix dactylifera]
Length=141

 Score =   122 bits (305),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 67/127 (53%), Positives = 91/127 (72%), Gaps = 0/127 (0%)
 Frame = +2

Query  104  RENAEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVWMkqkkakehkf  283
            +  AEV+    +C++KS  LL+E+ +PRGLLPL + +E G   ETGFVW+KQ+K  EH F
Sbjct  9    KAKAEVYYGDEICQEKSKFLLQEVSLPRGLLPLKDIIECGYVEETGFVWLKQRKKIEHCF  68

Query  284  kkigkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPDPDAGKINFSTPAGL  463
             KIG+LV Y  E+TA+VE  ++K+LTGVK+KELL+WV+L  IS+ DP  GK+    PAG 
Sbjct  69   GKIGRLVSYGPEITAYVEKCKIKNLTGVKAKELLIWVSLNEISVNDPPTGKLTCKGPAGF  128

Query  464  SRSYPVS  484
             R+YP S
Sbjct  129  FRTYPTS  135



>ref|XP_004135756.2| PREDICTED: uncharacterized protein LOC101222618 [Cucumis sativus]
 gb|KGN65977.1| hypothetical protein Csa_1G555620 [Cucumis sativus]
Length=146

 Score =   122 bits (305),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 70/127 (55%), Positives = 96/127 (76%), Gaps = 0/127 (0%)
 Frame = +2

Query  104  RENAEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVWMkqkkakehkf  283
            +  AEV+    +C++KS ++L+E+ +P GLLPL +  E G  RETGFVW+KQKK+  HKF
Sbjct  9    KGKAEVYHGDELCQEKSKQILKEVGLPNGLLPLKDIEECGILRETGFVWIKQKKSTTHKF  68

Query  284  kkigkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPDPDAGKINFSTPAGL  463
            +KIGKLV Y  EVTA VE  ++K LTGVK+KELL+WV+L+ I + +P +GKI+F TP GL
Sbjct  69   EKIGKLVSYANEVTAIVEKNKIKKLTGVKTKELLVWVSLSDIYVDEPPSGKISFQTPTGL  128

Query  464  SRSYPVS  484
             R++PVS
Sbjct  129  FRTFPVS  135



>ref|XP_009587678.1| PREDICTED: uncharacterized protein LOC104085371 [Nicotiana tomentosiformis]
Length=155

 Score =   122 bits (306),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 64/136 (47%), Positives = 86/136 (63%), Gaps = 0/136 (0%)
 Frame = +2

Query  77   SSQQTAVNHRENAEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVWMk  256
            S +++  + R  AE+      C   SLELL+E+  P+G LPL +  E G  RETGFVWMK
Sbjct  3    SDKKSCQDERAGAEIVYGAEECYSNSLELLKELGFPKGTLPLKDLEECGYVRETGFVWMK  62

Query  257  qkkakehkfkkigkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPDPDAGK  436
            QK   EH F     LV Y TEVTA+VE  R+K +TG+KSK+L LWV +  +SI DP   K
Sbjct  63   QKAPYEHYFVATKTLVSYATEVTAYVEKNRMKKMTGIKSKQLFLWVPIVEMSIEDPSQNK  122

Query  437  INFSTPAGLSRSYPVS  484
            + F TP G+ +S+P++
Sbjct  123  VYFKTPYGIGKSFPLA  138



>gb|KJB76944.1| hypothetical protein B456_012G113800 [Gossypium raimondii]
Length=146

 Score =   122 bits (305),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 62/137 (45%), Positives = 90/137 (66%), Gaps = 3/137 (2%)
 Frame = +2

Query  74   MSSQQTAVNHRENAEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVWM  253
            M+S+  A +HRE AE++    +CKQK+ ELL+  H+P+GL+PL    E G N+ TGF+W+
Sbjct  1    MASKLIA-SHREGAEIYHGTTLCKQKTQELLDHFHLPKGLMPLSHINEFGYNKITGFIWL  59

Query  254  kqkkakehkfkkigkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPDPDA-  430
              ++       K   L  Y  E+TAF+ DR+LK LTGVKSKE+++W+T++ IS+ D    
Sbjct  60   -NQEKTVKYLFKELGLSSYGAEITAFIGDRQLKKLTGVKSKEMMIWITVSDISVDDTKVP  118

Query  431  GKINFSTPAGLSRSYPV  481
             KI F+   GLS+SYPV
Sbjct  119  SKICFANSMGLSKSYPV  135



>ref|XP_006344788.1| PREDICTED: uncharacterized protein LOC102588001 [Solanum tuberosum]
Length=175

 Score =   122 bits (307),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 66/123 (54%), Positives = 93/123 (76%), Gaps = 0/123 (0%)
 Frame = +2

Query  116  EVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVWMkqkkakehkfkkig  295
            E +T   +C++KS  LL E+++P G+LP+ + +E G  ++TGFVW+K K   EHKF+KIG
Sbjct  14   EFYTGNDICQEKSKFLLTEMNLPNGVLPMQDMLECGYVKDTGFVWLKSKNKTEHKFEKIG  73

Query  296  kLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPDPDAGKINFSTPAGLSRSY  475
            + V Y TEVTA+VE  ++K LTGVK+KELL+W+TLT I + +P  GKI+F TP GLSR++
Sbjct  74   RSVQYATEVTAYVEPNKIKKLTGVKAKELLMWLTLTEICVDEPSTGKIHFKTPTGLSRTF  133

Query  476  PVS  484
            PVS
Sbjct  134  PVS  136



>ref|XP_009358708.1| PREDICTED: uncharacterized protein LOC103949313 [Pyrus x bretschneideri]
Length=157

 Score =   122 bits (305),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 62/129 (48%), Positives = 87/129 (67%), Gaps = 0/129 (0%)
 Frame = +2

Query  98   NHRENAEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVWMkqkkakeh  277
              R  AE+   P  C ++S++LLEE+  P+G+LPL + VE GR RETGFVWMKQK+  EH
Sbjct  12   KQRAGAEIVYGPEDCYRQSIDLLEELGFPKGVLPLQDLVECGRVRETGFVWMKQKQPYEH  71

Query  278  kfkkigkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPDPDAGKINFSTPA  457
             F+     V Y  EVT +VE  R+K +TG+KSK++ LWV ++ +S+ DP   KI F TP 
Sbjct  72   FFEGSNTRVSYAIEVTGYVEKCRMKKMTGIKSKQVFLWVPISEMSVEDPAGKKIVFKTPM  131

Query  458  GLSRSYPVS  484
            G+ +S+PV+
Sbjct  132  GIGKSFPVT  140



>ref|XP_006305687.1| hypothetical protein CARUB_v10010410mg [Capsella rubella]
 gb|EOA38585.1| hypothetical protein CARUB_v10010410mg [Capsella rubella]
Length=181

 Score =   122 bits (307),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 71/128 (55%), Positives = 91/128 (71%), Gaps = 1/128 (1%)
 Frame = +2

Query  104  RENAEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVWMkqkkakehkf  283
            R  AE++T   +C++K+   L+EI MP GLLPL +  EVG +RE+G VW+KQKK+  HKF
Sbjct  9    RAKAEMYTGDEICREKTKCFLKEISMPNGLLPLQDIEEVGYDRESGVVWLKQKKSITHKF  68

Query  284  kkigkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPD-PDAGKINFSTPAG  460
             +I KLV Y TEVTA VE  ++K LTGVK+KELL+WVT+  I   D P  GKI F TP  
Sbjct  69   AEIDKLVSYGTEVTAVVETGKIKKLTGVKAKELLIWVTINEIYTEDPPTTGKITFKTPTT  128

Query  461  LSRSYPVS  484
            LSR++PVS
Sbjct  129  LSRTFPVS  136



>ref|XP_009762642.1| PREDICTED: uncharacterized protein LOC104214639 [Nicotiana sylvestris]
Length=155

 Score =   122 bits (305),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 64/136 (47%), Positives = 86/136 (63%), Gaps = 0/136 (0%)
 Frame = +2

Query  77   SSQQTAVNHRENAEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVWMk  256
            S +++  + R  AE+      C   SLELL+E+  P+G LPL +  E G  RETGFVWMK
Sbjct  3    SDKKSCQDERAGAEIVYGAEECYSNSLELLKELGFPQGTLPLKDLEECGYVRETGFVWMK  62

Query  257  qkkakehkfkkigkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPDPDAGK  436
            QK   EH F     LV Y TEVTA+VE  R+K +TG+KSK+L LWV +  +SI DP   K
Sbjct  63   QKAPYEHYFVATKTLVSYATEVTAYVEKNRMKKMTGIKSKQLFLWVPIVEMSIEDPSQNK  122

Query  437  INFSTPAGLSRSYPVS  484
            + F TP G+ +S+P++
Sbjct  123  VYFKTPVGIGKSFPLT  138



>ref|NP_001240904.1| uncharacterized protein LOC100800384 [Glycine max]
 gb|ACU19280.1| unknown [Glycine max]
Length=157

 Score =   122 bits (305),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 63/131 (48%), Positives = 86/131 (66%), Gaps = 0/131 (0%)
 Frame = +2

Query  89   TAVNHRENAEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVWMkqkka  268
            + V  R  AE+      C + S+ELLEE+  P+G+LPL + VE GR RETGFVWMKQK  
Sbjct  3    SVVKERSGAEIVYGSEECYRHSIELLEELGFPKGVLPLQDLVECGRVRETGFVWMKQKAP  62

Query  269  kehkfkkigkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPDPDAGKINFS  448
             EH F+     V Y  EVT +VE  R+K ++G+KSK+++LWV +T +SI DP   KI F 
Sbjct  63   YEHFFEGTNTRVSYAVEVTGYVEKFRMKKMSGIKSKQMMLWVPITEMSIEDPKGQKILFK  122

Query  449  TPAGLSRSYPV  481
            TP G+ +S+P+
Sbjct  123  TPMGIGKSFPI  133



>ref|XP_012088865.1| PREDICTED: uncharacterized protein LOC105647410 [Jatropha curcas]
 gb|KDP23368.1| hypothetical protein JCGZ_23201 [Jatropha curcas]
Length=162

 Score =   122 bits (305),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 72/127 (57%), Positives = 92/127 (72%), Gaps = 0/127 (0%)
 Frame = +2

Query  104  RENAEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVWMkqkkakehkf  283
            +  AEV+    +C+ K+  LL E+ +P GLLPL + +E G  RETGFVW+KQKK+  HKF
Sbjct  9    KAKAEVYHGDEICQDKTKLLLAEVGLPNGLLPLHDILECGIVRETGFVWLKQKKSITHKF  68

Query  284  kkigkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPDPDAGKINFSTPAGL  463
            +KIG+L  Y  EVTA VE  ++K LTGVK+KELLLWVTL+ I + DP  GKI F TPAGL
Sbjct  69   EKIGRLTTYAPEVTAVVEKGKIKKLTGVKTKELLLWVTLSDIYLDDPPTGKITFQTPAGL  128

Query  464  SRSYPVS  484
             R++PVS
Sbjct  129  YRTFPVS  135



>gb|KHN03236.1| hypothetical protein glysoja_004262 [Glycine soja]
Length=157

 Score =   122 bits (305),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 63/131 (48%), Positives = 86/131 (66%), Gaps = 0/131 (0%)
 Frame = +2

Query  89   TAVNHRENAEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVWMkqkka  268
            + V  R  AE+      C + S+ELLEE+  P+G+LPL + VE GR RETGFVWMKQK  
Sbjct  3    SVVKERSGAEIVYGSEECYRHSIELLEELGFPKGVLPLQDLVECGRVRETGFVWMKQKAP  62

Query  269  kehkfkkigkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPDPDAGKINFS  448
             EH F+     V Y  EVT +VE  R+K ++G+KSK+++LWV +T +SI DP   KI F 
Sbjct  63   YEHFFEGTNTRVSYAVEVTGYVEKFRMKKMSGIKSKQMMLWVPITEMSIEDPKGQKILFK  122

Query  449  TPAGLSRSYPV  481
            TP G+ +S+P+
Sbjct  123  TPMGIGKSFPI  133



>ref|NP_001235186.1| uncharacterized protein LOC100527887 [Glycine max]
 gb|ACU17090.1| unknown [Glycine max]
 gb|KHN28181.1| hypothetical protein glysoja_023999 [Glycine soja]
Length=157

 Score =   122 bits (305),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 62/128 (48%), Positives = 85/128 (66%), Gaps = 0/128 (0%)
 Frame = +2

Query  98   NHRENAEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVWMkqkkakeh  277
              R  AE+      C ++S+ELLEE+  P+G+LPL + VE GR RETGFVWMKQK   EH
Sbjct  6    KERAGAEIVYGSEECYRQSIELLEELGFPKGVLPLQDLVECGRVRETGFVWMKQKAPYEH  65

Query  278  kfkkigkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPDPDAGKINFSTPA  457
             F+     V Y  EVT +VE  R+K +TG+KSK+++LWV +  +SI DP   KI+F TP 
Sbjct  66   FFEGTNTRVSYAVEVTGYVEKFRMKKMTGIKSKQMMLWVPIAEMSIEDPKGQKIHFKTPM  125

Query  458  GLSRSYPV  481
            G+ +S+P+
Sbjct  126  GIGKSFPI  133



>ref|XP_008390274.1| PREDICTED: uncharacterized protein LOC103452555 [Malus domestica]
Length=157

 Score =   122 bits (305),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 65/138 (47%), Positives = 91/138 (66%), Gaps = 2/138 (1%)
 Frame = +2

Query  77   SSQQTAV--NHRENAEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVW  250
            S +Q  V    R  AE+   P  C ++S++LL E+  P+G+LPL + VE GR RETGFVW
Sbjct  3    SGKQLVVEDKQRAGAEIVYGPEDCYRQSIDLLHELGFPKGVLPLQDLVECGRVRETGFVW  62

Query  251  MkqkkakehkfkkigkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPDPDA  430
            MKQK+  EH F+     V Y TEVT +VE  R+K +TG+KSK++ LWV ++ +S+ DP  
Sbjct  63   MKQKQPYEHFFEGSNTRVSYATEVTGYVEKCRMKKMTGIKSKQVFLWVPISEMSVEDPAG  122

Query  431  GKINFSTPAGLSRSYPVS  484
             KI F TP G+ +S+PV+
Sbjct  123  KKIVFKTPMGIGKSFPVT  140



>ref|XP_011087501.1| PREDICTED: uncharacterized protein LOC105168965 [Sesamum indicum]
Length=163

 Score =   122 bits (305),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 70/123 (57%), Positives = 92/123 (75%), Gaps = 0/123 (0%)
 Frame = +2

Query  113  AEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVWMkqkkakehkfkki  292
            +E++   A+C++KS  LL E+ +P GLLPL +  E G  +ETGFVW+ QKK  EHKF+KI
Sbjct  13   SEMYRGDAICQEKSRFLLTEMGLPNGLLPLKDMEECGYVKETGFVWLIQKKKSEHKFEKI  72

Query  293  gkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPDPDAGKINFSTPAGLSRS  472
            G+ V Y  EVTA+VE +R+K LTGVK+KELL+WV+L+ I + DP  GKI F TP GLSRS
Sbjct  73   GRPVQYAREVTAYVEPKRIKKLTGVKTKELLMWVSLSDIYLDDPPTGKITFKTPTGLSRS  132

Query  473  YPV  481
            +PV
Sbjct  133  FPV  135



>ref|XP_009592625.1| PREDICTED: uncharacterized protein LOC104089434 [Nicotiana tomentosiformis]
Length=173

 Score =   122 bits (305),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 68/124 (55%), Positives = 92/124 (74%), Gaps = 0/124 (0%)
 Frame = +2

Query  113  AEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVWMkqkkakehkfkki  292
            +E +T   +C++KS  LL E+ +P GLLP+ + +E G  ++TGFVW+K KK  EHKF+KI
Sbjct  13   SEFYTGNDICQEKSKFLLTEVGLPNGLLPMQDMLECGYVKDTGFVWLKSKKKTEHKFEKI  72

Query  293  gkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPDPDAGKINFSTPAGLSRS  472
            G+ V Y TEVTA VE  ++K LTGVK+KELL+W+TLT I + DP  GKI+F T  GLSR+
Sbjct  73   GRQVQYGTEVTAIVEQNKIKKLTGVKAKELLMWLTLTEICVDDPPTGKIHFKTTTGLSRT  132

Query  473  YPVS  484
            +PVS
Sbjct  133  FPVS  136



>ref|XP_002512532.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF49984.1| conserved hypothetical protein [Ricinus communis]
Length=168

 Score =   121 bits (304),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 71/127 (56%), Positives = 94/127 (74%), Gaps = 0/127 (0%)
 Frame = +2

Query  104  RENAEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVWMkqkkakehkf  283
            +  AEV+    +C++K+  LL+E+ +P GLLPL +  E G  +E+G VW+KQKK+  HKF
Sbjct  9    KAKAEVYHGDEICQEKTKLLLKEVGLPNGLLPLHDIEECGYEKESGIVWLKQKKSINHKF  68

Query  284  kkigkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPDPDAGKINFSTPAGL  463
            +KIGKLV Y TEVTA VE  ++K LTGVK+KELL+WV+L+ I + DP  GKI F TPAGL
Sbjct  69   EKIGKLVSYATEVTAVVEKFKIKKLTGVKTKELLVWVSLSDIYLDDPPTGKITFQTPAGL  128

Query  464  SRSYPVS  484
             RS+PVS
Sbjct  129  YRSFPVS  135



>gb|EAY93117.1| hypothetical protein OsI_14920 [Oryza sativa Indica Group]
Length=142

 Score =   120 bits (302),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 69/137 (50%), Positives = 93/137 (68%), Gaps = 1/137 (1%)
 Frame = +2

Query  74   MSSQQTAVNHRENAEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVWM  253
            M+SQ    N R  AEV    A  K+KS+ELL+E+++P+GL PLD+  E G NR  GF+W+
Sbjct  1    MASQIIETN-RVGAEVINGDAASKKKSIELLQELNLPKGLFPLDDIEEFGYNRANGFMWI  59

Query  254  kqkkakehkfkkigkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPDPDAG  433
              +K KEH FKKI + V Y TEVTAFVE  +LK +TGVK+KEL+LW+++  + + +  AG
Sbjct  60   LHRKKKEHTFKKIKQTVSYATEVTAFVEKGKLKKITGVKTKELMLWLSVVEVYVEESSAG  119

Query  434  KINFSTPAGLSRSYPVS  484
            KI F T  GLS S+  S
Sbjct  120  KITFKTGTGLSDSFDAS  136



>ref|XP_008370600.1| PREDICTED: uncharacterized protein LOC103434068 [Malus domestica]
Length=142

 Score =   120 bits (302),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 74/137 (54%), Positives = 94/137 (69%), Gaps = 0/137 (0%)
 Frame = +2

Query  74   MSSQQTAVNHRENAEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVWM  253
            MSS  TA    +  E++    +C+QK+ +LL EI +P GLLPL +  E G  RETGFVW+
Sbjct  1    MSSLITAQIKSKADELYHGDEICQQKARQLLSEISLPNGLLPLKDVEECGIIRETGFVWL  60

Query  254  kqkkakehkfkkigkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPDPDAG  433
            KQKK+  HK +KIGKLV Y  E TA VE  ++K LTGVK+KELL+WV L+ I + DP  G
Sbjct  61   KQKKSYTHKXEKIGKLVSYAPEXTAIVEKGKIKKLTGVKTKELLVWVQLSDIYVDDPPTG  120

Query  434  KINFSTPAGLSRSYPVS  484
            KI F TPAGL R++ VS
Sbjct  121  KITFKTPAGLFRTFXVS  137



>gb|AFK47875.1| unknown [Lotus japonicus]
Length=167

 Score =   121 bits (304),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 73/127 (57%), Positives = 92/127 (72%), Gaps = 0/127 (0%)
 Frame = +2

Query  104  RENAEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVWMkqkkakehkf  283
            R  +E++    +C+ KS +LL+EI +P GLLPL +  E G NRE+G VW+KQKK+  HKF
Sbjct  9    RGRSEIYHGDELCQVKSKDLLKEIALPNGLLPLKDMEECGINRESGLVWLKQKKSTTHKF  68

Query  284  kkigkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPDPDAGKINFSTPAGL  463
             KIGKLV Y  EVTA VE  ++K LTGVK+KELLLWV+L+ I   +P  GKI F TPAGL
Sbjct  69   DKIGKLVSYGPEVTAQVEKGKIKKLTGVKTKELLLWVSLSDIYTDEPPTGKITFKTPAGL  128

Query  464  SRSYPVS  484
             RS+PVS
Sbjct  129  YRSFPVS  135



>ref|XP_012075841.1| PREDICTED: uncharacterized protein LOC105637055 [Jatropha curcas]
Length=155

 Score =   121 bits (303),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 62/137 (45%), Positives = 89/137 (65%), Gaps = 0/137 (0%)
 Frame = +2

Query  74   MSSQQTAVNHRENAEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVWM  253
            M+S ++  + R  AEV      C + SLELLEE+  P+G+LPL +  E GR RETG+VWM
Sbjct  1    MASTRSTEDERAGAEVVYGAENCYRHSLELLEELGFPKGVLPLKDLEECGRVRETGYVWM  60

Query  254  kqkkakehkfkkigkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPDPDAG  433
            K K   EH F      V Y  EVTA++E  ++K +TG+KSK+L LWV ++ +S+ DP + 
Sbjct  61   KLKAPYEHFFAATNTKVSYAIEVTAYIEKLKMKKMTGIKSKQLFLWVPISEMSMEDPKSN  120

Query  434  KINFSTPAGLSRSYPVS  484
            KI F TP G+ +S+P++
Sbjct  121  KIIFKTPMGIGKSFPIT  137



>gb|KDP31592.1| hypothetical protein JCGZ_14817 [Jatropha curcas]
Length=155

 Score =   121 bits (303),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 62/137 (45%), Positives = 88/137 (64%), Gaps = 0/137 (0%)
 Frame = +2

Query  74   MSSQQTAVNHRENAEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVWM  253
            M+S +   + R  AEV      C + SLELLEE+  P+G+LPL +  E GR RETG+VWM
Sbjct  1    MASTRPTEDERAGAEVVYGAENCYRHSLELLEELGFPKGVLPLKDLEECGRVRETGYVWM  60

Query  254  kqkkakehkfkkigkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPDPDAG  433
            K K   EH F      V Y  EVTA++E  ++K +TG+KSK+L LWV ++ +S+ DP + 
Sbjct  61   KLKAPYEHFFAATNTKVSYAIEVTAYIEKLKMKKMTGIKSKQLFLWVPISEMSMEDPKSN  120

Query  434  KINFSTPAGLSRSYPVS  484
            KI F TP G+ +S+P++
Sbjct  121  KITFKTPMGIGKSFPIT  137



>ref|XP_004230325.1| PREDICTED: uncharacterized protein LOC101254641 [Solanum lycopersicum]
Length=163

 Score =   121 bits (303),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 67/123 (54%), Positives = 92/123 (75%), Gaps = 0/123 (0%)
 Frame = +2

Query  116  EVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVWMkqkkakehkfkkig  295
            E +T   +C++KS  LL E+ +P GLLP+ + +E G  ++TGFVW+K KK  EHKF+KIG
Sbjct  14   EFYTGNDICQEKSKLLLTEVGLPNGLLPMQDMLECGYVKDTGFVWLKSKKKTEHKFEKIG  73

Query  296  kLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPDPDAGKINFSTPAGLSRSY  475
            K V Y TEVTA+VE  ++K LTGVK+KELL+W+TL  I + +P  GKI+F TP GLSR++
Sbjct  74   KSVQYATEVTAYVEPNKIKKLTGVKAKELLMWLTLNEICVDEPSTGKIHFKTPTGLSRTF  133

Query  476  PVS  484
            PV+
Sbjct  134  PVA  136



>ref|XP_009391989.1| PREDICTED: uncharacterized protein LOC103978016 [Musa acuminata 
subsp. malaccensis]
Length=163

 Score =   121 bits (303),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 69/127 (54%), Positives = 91/127 (72%), Gaps = 0/127 (0%)
 Frame = +2

Query  104  RENAEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVWMkqkkakehkf  283
            +  AE++    +C++KS  LL+E+ +PRGLLPL + VE G   ETGFVW+KQK+  EH F
Sbjct  9    KAKAEIYHGDEICQEKSKFLLQEVGLPRGLLPLRDIVECGYVEETGFVWLKQKQKVEHCF  68

Query  284  kkigkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPDPDAGKINFSTPAGL  463
            +KIGK V Y  E+TA VE  ++K LTGVK+KELL+W+TL  IS   P AGK+ F TPAGL
Sbjct  69   EKIGKRVSYSPEITAVVEKSKIKKLTGVKAKELLVWITLDEISADGPPAGKLTFKTPAGL  128

Query  464  SRSYPVS  484
             R++P S
Sbjct  129  FRTFPAS  135



>ref|XP_012079750.1| PREDICTED: uncharacterized protein LOC105640135 [Jatropha curcas]
Length=158

 Score =   120 bits (302),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 62/137 (45%), Positives = 88/137 (64%), Gaps = 0/137 (0%)
 Frame = +2

Query  74   MSSQQTAVNHRENAEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVWM  253
            M+S +   + R  AEV      C + SLELLEE+  P+G+LPL +  E GR RETG+VWM
Sbjct  1    MASTRPTEDERAGAEVVYGAENCYRHSLELLEELGFPKGVLPLKDLEECGRVRETGYVWM  60

Query  254  kqkkakehkfkkigkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPDPDAG  433
            K K   EH F      V Y  EVTA++E  ++K +TG+KSK+L LWV ++ +S+ DP + 
Sbjct  61   KLKAPYEHFFAATNTKVSYAIEVTAYIEKLKMKKMTGIKSKQLFLWVPISEMSMEDPKSN  120

Query  434  KINFSTPAGLSRSYPVS  484
            KI F TP G+ +S+P++
Sbjct  121  KITFKTPMGIGKSFPIT  137



>ref|XP_006439228.1| hypothetical protein CICLE_v10022654mg [Citrus clementina]
 gb|ESR52468.1| hypothetical protein CICLE_v10022654mg [Citrus clementina]
Length=155

 Score =   120 bits (302),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 63/137 (46%), Positives = 90/137 (66%), Gaps = 0/137 (0%)
 Frame = +2

Query  74   MSSQQTAVNHRENAEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVWM  253
            MSS +   + R  AE+      C + S+ELLEE+  P+G+LPL +  E GR RETGFVWM
Sbjct  1    MSSIKAREDERAGAEIVYGAEECYRHSIELLEELGFPKGVLPLQDLEECGRVRETGFVWM  60

Query  254  kqkkakehkfkkigkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPDPDAG  433
            KQ+   EH F+     V Y  EVTA+VE  ++K +TGVKSK++ LWV ++ +SI D  + 
Sbjct  61   KQRAPYEHFFEGTNTRVSYAAEVTAYVEKFKMKKMTGVKSKQMFLWVPISEMSIEDASSN  120

Query  434  KINFSTPAGLSRSYPVS  484
            KI+F TP G+ +S+P++
Sbjct  121  KIHFKTPMGIGKSFPIT  137



>ref|XP_007039397.1| Uncharacterized protein TCM_015652 [Theobroma cacao]
 gb|EOY23898.1| Uncharacterized protein TCM_015652 [Theobroma cacao]
Length=156

 Score =   120 bits (302),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 64/136 (47%), Positives = 89/136 (65%), Gaps = 0/136 (0%)
 Frame = +2

Query  77   SSQQTAVNHRENAEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVWMk  256
            S++    + R  AE+      C + S+ELLEE+  P+G+LPL +  E GR RETGFVWMK
Sbjct  3    SNKSREDDERAGAEIVYGAEECYRHSIELLEELGFPKGVLPLQDLEECGRVRETGFVWMK  62

Query  257  qkkakehkfkkigkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPDPDAGK  436
            QK   EH F      V Y TEVT++VE  ++K +TGVKSK++ LWV +T +SI DP + K
Sbjct  63   QKAPYEHFFAGTNTRVSYATEVTSYVEKFKMKKMTGVKSKQVFLWVPITEMSIEDPASNK  122

Query  437  INFSTPAGLSRSYPVS  484
            I F TP G+ +S+P++
Sbjct  123  IYFKTPMGIGKSFPIT  138



>ref|NP_001237907.1| uncharacterized protein LOC100500427 [Glycine max]
 gb|ACU15513.1| unknown [Glycine max]
Length=187

 Score =   121 bits (304),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 69/127 (54%), Positives = 95/127 (75%), Gaps = 0/127 (0%)
 Frame = +2

Query  104  RENAEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVWMkqkkakehkf  283
            +  AEV+    +C++KS  LL+E+ +P GLLPL +  E G  R++GFVW+KQKK+  HKF
Sbjct  9    KAKAEVYHGDELCQEKSKLLLKEVGLPNGLLPLKDIEECGYERDSGFVWLKQKKSTNHKF  68

Query  284  kkigkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPDPDAGKINFSTPAGL  463
            +KIGKLV Y  E+TA+VE  ++K LTGVK+KELL+W+TL+ I + DP  GKI F TP+GL
Sbjct  69   EKIGKLVSYAPEITAYVEVGKIKKLTGVKTKELLVWITLSEIFVDDPPTGKITFKTPSGL  128

Query  464  SRSYPVS  484
             R++PVS
Sbjct  129  FRTFPVS  135



>ref|XP_006476294.1| PREDICTED: uncharacterized protein LOC102610275 [Citrus sinensis]
Length=155

 Score =   120 bits (301),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 63/137 (46%), Positives = 90/137 (66%), Gaps = 0/137 (0%)
 Frame = +2

Query  74   MSSQQTAVNHRENAEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVWM  253
            MSS +   + R  AE+      C + S+ELLEE+  P+G+LPL +  E GR RETGFVWM
Sbjct  1    MSSIRAREDERAGAEIVYGAEECYRHSIELLEELGFPKGVLPLQDLEECGRVRETGFVWM  60

Query  254  kqkkakehkfkkigkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPDPDAG  433
            KQ+   EH F+     V Y  EVTA+VE  ++K +TGVKSK++ LWV ++ +SI D  + 
Sbjct  61   KQRAPYEHFFEGTNTRVSYAAEVTAYVEKFKMKKMTGVKSKQMFLWVPISEMSIEDASSN  120

Query  434  KINFSTPAGLSRSYPVS  484
            KI+F TP G+ +S+P++
Sbjct  121  KIHFKTPMGIGKSFPIT  137



>gb|KHN16045.1| hypothetical protein glysoja_012021 [Glycine soja]
Length=178

 Score =   121 bits (303),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 69/127 (54%), Positives = 95/127 (75%), Gaps = 0/127 (0%)
 Frame = +2

Query  104  RENAEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVWMkqkkakehkf  283
            +  AEV+    +C++KS  LL+E+ +P GLLPL +  E G  R++GFVW+KQKK+  HKF
Sbjct  9    KAKAEVYHGDELCQEKSKLLLKEVGLPNGLLPLKDIEECGYERDSGFVWLKQKKSTNHKF  68

Query  284  kkigkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPDPDAGKINFSTPAGL  463
            +KIGKLV Y  E+TA+VE  ++K LTGVK+KELL+W+TL+ I + DP  GKI F TP+GL
Sbjct  69   EKIGKLVSYAPEITAYVEVGKIKKLTGVKTKELLVWITLSEIFVDDPPTGKITFKTPSGL  128

Query  464  SRSYPVS  484
             R++PVS
Sbjct  129  FRTFPVS  135



>gb|EPS61878.1| hypothetical protein M569_12921 [Genlisea aurea]
Length=180

 Score =   121 bits (303),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 66/123 (54%), Positives = 91/123 (74%), Gaps = 0/123 (0%)
 Frame = +2

Query  113  AEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVWMkqkkakehkfkki  292
            +E++     C++K+  LL E+ +P GLLPL +  E G  ++TGFVW+ QK+  +H+F KI
Sbjct  15   SEIYHGDDACQEKAKFLLTEMGLPNGLLPLKDMEEAGYVKDTGFVWLIQKEKSQHRFDKI  74

Query  293  gkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPDPDAGKINFSTPAGLSRS  472
            G+LV Y  EVTA+VE ++++ LTGVK+KELLLWVTL+ IS+ DP  GKI F TPAGL RS
Sbjct  75   GRLVQYAREVTAYVEPKKIRKLTGVKTKELLLWVTLSDISLDDPPTGKITFKTPAGLYRS  134

Query  473  YPV  481
            +PV
Sbjct  135  FPV  137



>ref|XP_010919343.1| PREDICTED: uncharacterized protein LOC105043480 [Elaeis guineensis]
Length=153

 Score =   120 bits (301),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 66/137 (48%), Positives = 87/137 (64%), Gaps = 0/137 (0%)
 Frame = +2

Query  74   MSSQQTAVNHRENAEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVWM  253
            M S       RE AE+   P  C + S+ELL E+  PRG+LPL++  E GR +ETGFVWM
Sbjct  1    MGSLAMTDKEREGAEIVYGPEECYRHSMELLGELGFPRGVLPLEDLEECGRVKETGFVWM  60

Query  254  kqkkakehkfkkigkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPDPDAG  433
            KQK   EH F      V Y+  VTA+VE  R+K +TGV+SK++LLWV +T +SI +P   
Sbjct  61   KQKGPYEHFFTWTNTRVRYEAVVTAYVEKNRMKKMTGVRSKQMLLWVPITEMSIDEPTGQ  120

Query  434  KINFSTPAGLSRSYPVS  484
            KI F +  G+ RS+PVS
Sbjct  121  KIYFKSAVGIGRSFPVS  137



>emb|CDY35265.1| BnaC03g59580D [Brassica napus]
Length=140

 Score =   120 bits (300),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 64/126 (51%), Positives = 89/126 (71%), Gaps = 0/126 (0%)
 Frame = +2

Query  107  ENAEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVWMkqkkakehkfk  286
            ++ E +++P++C  K+ ELL  +++P GLLPL +  EVG N+  GFVWM+ +   EH F 
Sbjct  9    DDIESYSEPSLCLDKAKELLALLNLPTGLLPLKDMTEVGHNKTKGFVWMRMRSKIEHTFA  68

Query  287  kigkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPDPDAGKINFSTPAGLS  466
             IG+ V YDTE+TAFVEDRRLK LTGVKSKEL++WV +  I I + +  KI F+   GLS
Sbjct  69   AIGRKVIYDTEITAFVEDRRLKRLTGVKSKELMIWVPVHDIFIKEKEPEKITFANNTGLS  128

Query  467  RSYPVS  484
            R++ VS
Sbjct  129  RTFKVS  134



>ref|XP_010931782.1| PREDICTED: uncharacterized protein LOC105052617 [Elaeis guineensis]
Length=142

 Score =   120 bits (300),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 67/127 (53%), Positives = 93/127 (73%), Gaps = 0/127 (0%)
 Frame = +2

Query  104  RENAEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVWMkqkkakehkf  283
            +  AEV+    +C++KS  LL+E+ +PRGLLPL + +E G   ETGFVW+KQKK  EH+F
Sbjct  9    KAKAEVYHGDEICQEKSKFLLQEVGLPRGLLPLKDIIECGHVEETGFVWLKQKKKIEHRF  68

Query  284  kkigkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPDPDAGKINFSTPAGL  463
            +KIG+LV Y  E+TA+VE  ++K+LTGVK+KELL+WV+L  IS+ DP  GK+    PAG 
Sbjct  69   EKIGRLVSYAPEITAYVEKCKIKNLTGVKAKELLIWVSLNEISVDDPPTGKLACKGPAGF  128

Query  464  SRSYPVS  484
             R++P S
Sbjct  129  FRTFPTS  135



>ref|XP_010458213.1| PREDICTED: uncharacterized protein LOC104739524 [Camelina sativa]
Length=176

 Score =   120 bits (302),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 69/128 (54%), Positives = 90/128 (70%), Gaps = 1/128 (1%)
 Frame = +2

Query  104  RENAEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVWMkqkkakehkf  283
            R  AE ++   +C++K+   L+EI MP GLLPL +  EVG +RE+G VW+KQK++  HKF
Sbjct  9    RAKAEKYSGDEICREKTKTFLKEISMPNGLLPLKDIEEVGYDRESGVVWLKQKQSITHKF  68

Query  284  kkigkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPD-PDAGKINFSTPAG  460
             +I KLV Y TEVTA VE  ++K LTGVK+KELL+WVT+  I   D P  GKI F TP  
Sbjct  69   AEIDKLVSYGTEVTAVVETGKIKKLTGVKAKELLIWVTINEIYTEDPPTKGKITFKTPTT  128

Query  461  LSRSYPVS  484
            LSR++PVS
Sbjct  129  LSRTFPVS  136



>gb|KFK43228.1| hypothetical protein AALP_AA1G096900 [Arabis alpina]
Length=175

 Score =   120 bits (302),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 69/127 (54%), Positives = 92/127 (72%), Gaps = 2/127 (2%)
 Frame = +2

Query  104  RENAEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVWMkqkkakehkf  283
            R  AE++T   +C++K+   L+EI MP GLLPL +  EVG +RE+G VW+KQK++  HKF
Sbjct  9    RAKAEMYTGDEICREKTKCFLKEISMPNGLLPLKDIEEVGYDRESGVVWLKQKQSITHKF  68

Query  284  kkigkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPDPDAGKINFSTPAGL  463
            ++I KLV Y TEVTA VE  R+K LTGVK+KELL+W+T+  I     D+GKI F TP  L
Sbjct  69   EEIDKLVSYGTEVTAIVETGRIKKLTGVKAKELLIWITINEIYT--EDSGKITFKTPTTL  126

Query  464  SRSYPVS  484
            SR++PVS
Sbjct  127  SRTFPVS  133



>ref|XP_004230327.1| PREDICTED: uncharacterized protein LOC101255245 [Solanum lycopersicum]
Length=164

 Score =   120 bits (301),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 64/123 (52%), Positives = 92/123 (75%), Gaps = 0/123 (0%)
 Frame = +2

Query  116  EVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVWMkqkkakehkfkkig  295
            E +T   +C++KS  LL E+++P GLLP+ + +E G  ++TGFVW+K KK  EHKF+KI 
Sbjct  14   EFYTGNDICQEKSKFLLTEMNLPNGLLPMQDMLECGYVKDTGFVWLKSKKKTEHKFEKID  73

Query  296  kLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPDPDAGKINFSTPAGLSRSY  475
            + V Y TEVTA+VE  ++K LTGVK+KELL+W+TL  I + +P  GKI+F +P GL+R++
Sbjct  74   RSVQYATEVTAYVEPNKIKKLTGVKAKELLMWLTLNEICVDEPSTGKIHFKSPTGLARTF  133

Query  476  PVS  484
            PVS
Sbjct  134  PVS  136



>ref|XP_002299430.1| hypothetical protein POPTR_0001s11330g [Populus trichocarpa]
 gb|EEE84235.1| hypothetical protein POPTR_0001s11330g [Populus trichocarpa]
Length=155

 Score =   120 bits (300),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 62/129 (48%), Positives = 85/129 (66%), Gaps = 0/129 (0%)
 Frame = +2

Query  98   NHRENAEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVWMkqkkakeh  277
            + R  AE+   P  C + S+ELLEE+  P+G+LPL +  E GR +ETGFVWMKQK   EH
Sbjct  10   DERAGAEIVYGPEECHRHSIELLEELGFPKGVLPLKDLEECGRVKETGFVWMKQKAPCEH  69

Query  278  kfkkigkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPDPDAGKINFSTPA  457
             F      V Y TEVT +VE  ++K +TG+KSK++ LWV ++ +SI DP + KI F TP 
Sbjct  70   FFVGSNSKVSYATEVTGYVEKFKMKKMTGIKSKQMFLWVPISEMSIGDPSSKKILFKTPM  129

Query  458  GLSRSYPVS  484
            G+ +S+P S
Sbjct  130  GIGKSFPFS  138



>emb|CDP15235.1| unnamed protein product [Coffea canephora]
Length=191

 Score =   121 bits (303),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 64/123 (52%), Positives = 92/123 (75%), Gaps = 0/123 (0%)
 Frame = +2

Query  113  AEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVWMkqkkakehkfkki  292
            +E++    +C++KS  LL E+ +P GLLP+++  E G  ++TGFVW++ KK  EHKF+KI
Sbjct  13   SEMYNGNELCQEKSKFLLTEVGLPNGLLPMEDMEECGYVKDTGFVWLRSKKKTEHKFQKI  72

Query  293  gkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPDPDAGKINFSTPAGLSRS  472
             KLV Y  EVTA+VE  R+K LTGVK+KELL+WVT+  I + +P  G+I+F TPAGLSR+
Sbjct  73   SKLVQYAPEVTAYVEQNRIKKLTGVKAKELLMWVTINEIYVDEPSTGQIHFKTPAGLSRN  132

Query  473  YPV  481
            +P+
Sbjct  133  FPI  135



>ref|XP_010489912.1| PREDICTED: uncharacterized protein LOC104767609 [Camelina sativa]
Length=176

 Score =   120 bits (301),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 69/128 (54%), Positives = 90/128 (70%), Gaps = 1/128 (1%)
 Frame = +2

Query  104  RENAEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVWMkqkkakehkf  283
            R  AE +T   +C++K+   L+EI MP GLLPL +  EVG +R++G VW+KQK++  HKF
Sbjct  9    RAKAEKYTGDEICREKTKTFLKEISMPNGLLPLKDIEEVGYDRKSGVVWLKQKQSITHKF  68

Query  284  kkigkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPD-PDAGKINFSTPAG  460
             +I KLV Y TEVTA VE  ++K LTGVK+KELL+WVT+  I   D P  GKI F TP  
Sbjct  69   AEIDKLVSYGTEVTAVVETGKIKKLTGVKAKELLIWVTINEIYTEDPPTKGKITFKTPTT  128

Query  461  LSRSYPVS  484
            LSR++PVS
Sbjct  129  LSRTFPVS  136



>ref|XP_010475761.1| PREDICTED: uncharacterized protein LOC104755121 [Camelina sativa]
Length=176

 Score =   120 bits (301),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 69/128 (54%), Positives = 90/128 (70%), Gaps = 1/128 (1%)
 Frame = +2

Query  104  RENAEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVWMkqkkakehkf  283
            R  AE ++   +C++K+   L+EI MP GLLPL +  EVG +RE+G VW+KQK++  HKF
Sbjct  9    RAKAEKYSGDEICREKTKTFLKEISMPNGLLPLKDIEEVGYDRESGVVWLKQKQSITHKF  68

Query  284  kkigkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPD-PDAGKINFSTPAG  460
             +I KLV Y TEVTA VE  ++K LTGVK+KELL+WVT+  I   D P  GKI F TP  
Sbjct  69   AEIDKLVSYGTEVTAVVETGKIKKLTGVKAKELLIWVTINEIYTEDPPTKGKITFKTPTT  128

Query  461  LSRSYPVS  484
            LSR++PVS
Sbjct  129  LSRTFPVS  136



>emb|CBI34584.3| unnamed protein product [Vitis vinifera]
Length=155

 Score =   119 bits (299),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 62/135 (46%), Positives = 88/135 (65%), Gaps = 0/135 (0%)
 Frame = +2

Query  77   SSQQTAVNHRENAEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVWMk  256
            S+ ++  + R  AE+      C   S+ LLEE+  P+G+LPL + VE GR RETGFVWMK
Sbjct  3    STIRSQEDQRAGAEIVYGSEACFNHSISLLEELGFPKGVLPLQDLVECGRVRETGFVWMK  62

Query  257  qkkakehkfkkigkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPDPDAGK  436
            QK   EH F      V Y  EVTA+VE  ++K +TG+KSK++ LWV +T +SI DP + K
Sbjct  63   QKAPYEHFFTGTNTRVSYSMEVTAYVEKFKMKKMTGIKSKQVFLWVPITEMSIDDPASQK  122

Query  437  INFSTPAGLSRSYPV  481
            I+F TP G+ +++P+
Sbjct  123  IHFKTPVGIGKAFPL  137



>ref|XP_006849141.1| PREDICTED: uncharacterized protein LOC18438902 [Amborella trichopoda]
 gb|ERN10722.1| hypothetical protein AMTR_s00027p00086650 [Amborella trichopoda]
Length=142

 Score =   119 bits (298),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 64/129 (50%), Positives = 90/129 (70%), Gaps = 0/129 (0%)
 Frame = +2

Query  98   NHRENAEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVWMkqkkakeh  277
            N R  AEV      C Q S++LL+E+  P+G+LPL +  E GR RETGF+WMK K   EH
Sbjct  8    NERAGAEVVYGAEACYQHSVDLLQELGFPKGVLPLKDLEECGRVRETGFIWMKLKVPYEH  67

Query  278  kfkkigkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPDPDAGKINFSTPA  457
             FK+IG  V Y TE TA+VE  ++K +TGVKSK+L++WV +T +S+ +P++ KI+F +  
Sbjct  68   LFKEIGSRVSYGTEFTAYVERLKMKKMTGVKSKQLMVWVPITEMSMDEPESSKIHFKSSF  127

Query  458  GLSRSYPVS  484
            G+ RS+PVS
Sbjct  128  GMGRSFPVS  136



>ref|XP_006494161.1| PREDICTED: uncharacterized protein LOC102611559 [Citrus sinensis]
Length=142

 Score =   119 bits (297),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 63/137 (46%), Positives = 89/137 (65%), Gaps = 0/137 (0%)
 Frame = +2

Query  74   MSSQQTAVNHRENAEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVWM  253
            MSS +   + R  AE+      C + S+ELLEE+  P+G+LPL +  E GR RETGFVWM
Sbjct  1    MSSIRAREDERAGAEIVYGAEECYRHSIELLEELGFPKGVLPLQDLEECGRVRETGFVWM  60

Query  254  kqkkakehkfkkigkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPDPDAG  433
            KQ+   EH F+     V Y  EVTA+VE  ++K +TGVKSK++ LWV +  +SI D  + 
Sbjct  61   KQRAPYEHFFEGTNTRVSYAAEVTAYVEKFKMKKMTGVKSKQMFLWVPIPEMSIEDASSN  120

Query  434  KINFSTPAGLSRSYPVS  484
            KI+F TP G+ +S+P++
Sbjct  121  KIHFKTPMGIGKSFPIT  137



>ref|XP_002436868.1| hypothetical protein SORBIDRAFT_10g010350 [Sorghum bicolor]
 gb|EER88235.1| hypothetical protein SORBIDRAFT_10g010350 [Sorghum bicolor]
Length=143

 Score =   119 bits (297),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 64/135 (47%), Positives = 93/135 (69%), Gaps = 2/135 (1%)
 Frame = +2

Query  74   MSSQQTAVNHRENAEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVWM  253
            M+SQ    +HR  AE+ T  A C++KS+ELLEE+ +P+GL P+++  E G NRETGF+W+
Sbjct  1    MASQDIK-SHRAGAEIITGDAACRKKSVELLEELGLPKGLFPMEDIKEFGYNRETGFMWL  59

Query  254  kqkkakeh-kfkkigkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPDPDA  430
             Q K K    FKKI + V Y TEVTAFVE  +L+ +TGVK+KEL+LW+++  + +P+   
Sbjct  60   IQGKKKVEHTFKKIKQTVSYATEVTAFVETGKLRKITGVKTKELMLWLSVVEVYVPEASL  119

Query  431  GKINFSTPAGLSRSY  475
             K+ F T  GLS ++
Sbjct  120  DKVTFKTGTGLSDTF  134



>ref|XP_006344787.1| PREDICTED: uncharacterized protein LOC102587682 [Solanum tuberosum]
Length=167

 Score =   119 bits (298),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 66/123 (54%), Positives = 91/123 (74%), Gaps = 0/123 (0%)
 Frame = +2

Query  116  EVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVWMkqkkakehkfkkig  295
            E +T   +C++KS  LL E+ +P GLLP+ + +E G  ++TGFVW+K KK  EHKF+KIG
Sbjct  14   EFYTGNDICQEKSKLLLTEVGLPNGLLPMQDMLECGYVKDTGFVWLKSKKKTEHKFEKIG  73

Query  296  kLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPDPDAGKINFSTPAGLSRSY  475
            K V Y  EVTA+VE  ++K LTGVK+KELL+W+TL  I + +P  GKI+F TP GLSR++
Sbjct  74   KSVQYAAEVTAYVEPNKIKKLTGVKAKELLMWLTLNEICVDEPSTGKIHFKTPTGLSRTF  133

Query  476  PVS  484
            PV+
Sbjct  134  PVA  136



>ref|XP_006663024.1| PREDICTED: uncharacterized protein At5g01610-like [Oryza brachyantha]
Length=142

 Score =   118 bits (296),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 65/135 (48%), Positives = 91/135 (67%), Gaps = 0/135 (0%)
 Frame = +2

Query  80   SQQTAVNHRENAEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVWMkq  259
            + QT  +HR  A+V    A  K++ +ELL+E+ +P+GL PLD+  E G NR  GF+W+  
Sbjct  2    ASQTIESHRAGADVINGDASGKKRCIELLQELGIPKGLFPLDDIEEFGYNRANGFMWILH  61

Query  260  kkakehkfkkigkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPDPDAGKI  439
            +K KEH FKKI + V Y TEVTAFVE  +LK + GVK+KEL+LW+++  + + +  AGKI
Sbjct  62   RKKKEHTFKKIKQTVSYATEVTAFVEKGKLKKIAGVKTKELMLWLSVVEVYVEESSAGKI  121

Query  440  NFSTPAGLSRSYPVS  484
             F T  GLS S+ VS
Sbjct  122  TFKTGTGLSDSFDVS  136



>ref|XP_002280209.2| PREDICTED: uncharacterized protein LOC100242761 [Vitis vinifera]
Length=179

 Score =   119 bits (299),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 64/138 (46%), Positives = 90/138 (65%), Gaps = 1/138 (1%)
 Frame = +2

Query  71   KMSSQ-QTAVNHRENAEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFV  247
            KM+S  ++  + R  AE+      C   S+ LLEE+  P+G+LPL + VE GR RETGFV
Sbjct  24   KMASTIRSQEDQRAGAEIVYGSEACFNHSISLLEELGFPKGVLPLQDLVECGRVRETGFV  83

Query  248  WMkqkkakehkfkkigkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPDPD  427
            WMKQK   EH F      V Y  EVTA+VE  ++K +TG+KSK++ LWV +T +SI DP 
Sbjct  84   WMKQKAPYEHFFTGTNTRVSYSMEVTAYVEKFKMKKMTGIKSKQVFLWVPITEMSIDDPA  143

Query  428  AGKINFSTPAGLSRSYPV  481
            + KI+F TP G+ +++P+
Sbjct  144  SQKIHFKTPVGIGKAFPL  161



>ref|XP_011016768.1| PREDICTED: uncharacterized protein LOC105120295 [Populus euphratica]
Length=155

 Score =   119 bits (297),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 61/129 (47%), Positives = 85/129 (66%), Gaps = 0/129 (0%)
 Frame = +2

Query  98   NHRENAEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVWMkqkkakeh  277
            + R  AE+   P  C + S+ELLEE+  P+G+LPL +  E GR +ETGFVWMKQK   EH
Sbjct  10   DERAGAEIVYGPEECHRHSIELLEELGFPKGVLPLKDLEECGRVKETGFVWMKQKAPCEH  69

Query  278  kfkkigkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPDPDAGKINFSTPA  457
             F      V Y TEVT +VE  ++K +TG+KSK++ LWV ++ +SI DP + KI F TP 
Sbjct  70   FFIGSNTKVSYATEVTGYVEKFKMKKMTGIKSKQMFLWVPISEMSIGDPSSKKILFKTPM  129

Query  458  GLSRSYPVS  484
            G+ + +P+S
Sbjct  130  GIGKFFPIS  138



>gb|AFK38639.1| unknown [Lotus japonicus]
Length=161

 Score =   119 bits (297),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 62/137 (45%), Positives = 88/137 (64%), Gaps = 0/137 (0%)
 Frame = +2

Query  74   MSSQQTAVNHRENAEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVWM  253
            M+S  +  + R  AE+      C + S+EL+EE+  P G+LPL + VE GR RETGFVWM
Sbjct  1    MASSNSGSDERAGAEIVHGSENCYRHSIELIEELGFPTGVLPLQDLVECGRVRETGFVWM  60

Query  254  kqkkakehkfkkigkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPDPDAG  433
            KQK   EH F+    LV Y  EVT +VE  ++K ++G+KSK+  LWV ++ +S+  P A 
Sbjct  61   KQKAPIEHFFEGTKTLVSYAVEVTCYVEKFKMKKMSGIKSKQAFLWVPISEMSMDGPGAK  120

Query  434  KINFSTPAGLSRSYPVS  484
            KI F TP G+ +S+PV+
Sbjct  121  KIVFKTPLGIGKSFPVT  137



>ref|XP_010549370.1| PREDICTED: uncharacterized protein LOC104820575 [Tarenaya hassleriana]
Length=164

 Score =   118 bits (296),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 71/127 (56%), Positives = 92/127 (72%), Gaps = 2/127 (2%)
 Frame = +2

Query  104  RENAEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVWMkqkkakehkf  283
            R  AE++   A+C++K+ E L+E+ MP GLLPL +  EVG +RE+G VW+KQKK+  HKF
Sbjct  9    RAKAEIYHGDAICQEKTKEFLKEVAMPNGLLPLKDIEEVGYDRESGTVWLKQKKSINHKF  68

Query  284  kkigkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPDPDAGKINFSTPAGL  463
            +KIGKLV Y TEVTA  E  +++ LTGVK+KELL+WVTL  I   +    KI F TPAGL
Sbjct  69   EKIGKLVSYATEVTAVAETGKIRKLTGVKAKELLVWVTLNEIVAEETK--KITFKTPAGL  126

Query  464  SRSYPVS  484
            SRS+P S
Sbjct  127  SRSFPYS  133



>ref|XP_009779474.1| PREDICTED: uncharacterized protein LOC104228662 [Nicotiana sylvestris]
Length=173

 Score =   118 bits (296),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 66/124 (53%), Positives = 91/124 (73%), Gaps = 0/124 (0%)
 Frame = +2

Query  113  AEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVWMkqkkakehkfkki  292
            +E +T   +C++KS  LL E+ +P GLLP+ + +E G  ++TGFVW+K KK  EHKF+KI
Sbjct  13   SEFYTGNDICQEKSKFLLTEMGLPNGLLPMQDMLECGYVKDTGFVWLKSKKKTEHKFEKI  72

Query  293  gkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPDPDAGKINFSTPAGLSRS  472
            G+ V Y  EVTA VE  ++K LTGVK+KELL+W+TLT I + DP  GKI+F   +GLSR+
Sbjct  73   GRQVQYGAEVTAIVEQNKIKKLTGVKAKELLMWLTLTEICVDDPPTGKIHFKATSGLSRT  132

Query  473  YPVS  484
            +PVS
Sbjct  133  FPVS  136



>ref|XP_004495638.1| PREDICTED: uncharacterized protein LOC101504472 [Cicer arietinum]
Length=224

 Score =   119 bits (299),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 72/127 (57%), Positives = 94/127 (74%), Gaps = 0/127 (0%)
 Frame = +2

Query  104  RENAEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVWMkqkkakehkf  283
            +  +EV+    +C+ KS ELL+EI +P GLLPL E  E G +RE+GFVW+KQKK++ HKF
Sbjct  64   KAKSEVYHGDEICQVKSKELLKEISLPNGLLPLKEIEECGYHRESGFVWLKQKKSRTHKF  123

Query  284  kkigkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPDPDAGKINFSTPAGL  463
            +KIGKLV Y TEVTA VE  ++K LTGVK KELL+W++L+ I   +P   KI F TPAGL
Sbjct  124  EKIGKLVSYGTEVTATVEVGKIKKLTGVKVKELLVWLSLSDIYADNPPTDKITFKTPAGL  183

Query  464  SRSYPVS  484
             R++PVS
Sbjct  184  FRTFPVS  190



>ref|XP_006417585.1| hypothetical protein EUTSA_v10008903mg [Eutrema salsugineum]
 gb|ESQ35938.1| hypothetical protein EUTSA_v10008903mg [Eutrema salsugineum]
Length=175

 Score =   118 bits (295),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 69/127 (54%), Positives = 90/127 (71%), Gaps = 2/127 (2%)
 Frame = +2

Query  104  RENAEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVWMkqkkakehkf  283
            R  AE++T   +C++K+   L+EI MP GLLPL +  EVG +RE+G VW+KQK +  HKF
Sbjct  9    RAKAEMYTGDEICREKTKVFLKEISMPNGLLPLKDIEEVGYDRESGVVWLKQKHSITHKF  68

Query  284  kkigkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPDPDAGKINFSTPAGL  463
            ++I KLV Y TEVTA VE  ++K LTGVK+KELL+WVT+  I     D GKI F TP  L
Sbjct  69   QEIDKLVSYGTEVTAVVETGKIKKLTGVKAKELLIWVTVNEIFT--EDKGKITFKTPTTL  126

Query  464  SRSYPVS  484
            SR++PVS
Sbjct  127  SRTFPVS  133



>ref|XP_006343785.1| PREDICTED: uncharacterized protein LOC102590070 [Solanum tuberosum]
Length=155

 Score =   117 bits (293),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 67/138 (49%), Positives = 88/138 (64%), Gaps = 1/138 (1%)
 Frame = +2

Query  74   MSSQQTAV-NHRENAEVFTDPAVCKQKSLELLEEIHMPRGLLPLDEYVEVGRNRETGFVW  250
            M+S +T+  + R  AE+      C   SLELL+E+  P G+L L +  E G  RETGFVW
Sbjct  1    MASDKTSCQDERAGAEIVYGVEDCYSHSLELLKELGFPMGVLALKDLEECGCVRETGFVW  60

Query  251  MkqkkakehkfkkigkLVWYDTEVTAFVEDRRLKHLTGVKSKELLLWVTLTHISIPDPDA  430
            MKQK   EH F     LV Y TEVTA+VE  R+K +TGVKSK+L LWV +  +SI DP  
Sbjct  61   MKQKAPYEHYFVATKTLVSYATEVTAYVEKGRMKKMTGVKSKQLFLWVPIVEMSIEDPAQ  120

Query  431  GKINFSTPAGLSRSYPVS  484
             KI+F TP G+ +S+P++
Sbjct  121  NKIHFKTPIGIGKSFPLT  138



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1358489737150