BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig213

Length=648
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

dbj|BAO51842.1|  UDP-glycosyltransferase 85A32                          345   1e-113   Ipomoea batatas [batate]
ref|XP_006473006.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       314   1e-104   Citrus sinensis [apfelsine]
ref|XP_006360268.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       321   5e-104   Solanum tuberosum [potatoes]
ref|XP_004252531.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    318   5e-103   Solanum lycopersicum
ref|XP_009775754.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    317   2e-102   Nicotiana sylvestris
gb|ADG65641.1|  glycosyltransferase                                     316   3e-102   Withania somnifera [ashwagandha]
dbj|BAG80542.1|  glycosyltransferase                                    315   1e-101   Lycium barbarum [Duke of Argyll's teatree]
ref|XP_006433961.1|  hypothetical protein CICLE_v10000958mg             314   2e-101   Citrus clementina [clementine]
dbj|BAD93690.1|  glycosyltransferase                                    313   7e-101   Nicotiana tabacum [American tobacco]
ref|XP_009590778.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    313   7e-101   Nicotiana tomentosiformis
ref|XP_007018744.1|  UDP-glucosyl transferase 85A2                      311   2e-100   
ref|XP_009612691.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    311   3e-100   Nicotiana tomentosiformis
ref|XP_004252533.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    310   9e-100   Solanum lycopersicum
ref|XP_009612740.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    308   4e-99    Nicotiana tomentosiformis
emb|CDP01076.1|  unnamed protein product                                304   1e-97    Coffea canephora [robusta coffee]
ref|XP_006363269.1|  PREDICTED: UDP-glycosyltransferase 85A3-like       304   2e-97    Solanum tuberosum [potatoes]
ref|XP_004237928.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    303   2e-97    Solanum lycopersicum
ref|XP_004252532.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    303   3e-97    Solanum lycopersicum
ref|XP_009791953.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    303   3e-97    Nicotiana sylvestris
ref|XP_004237927.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    303   4e-97    Solanum lycopersicum
gb|KJB59011.1|  hypothetical protein B456_009G235700                    302   1e-96    Gossypium raimondii
sp|F8WKW1.1|UGT2_GARJA  RecName: Full=7-deoxyloganetin glucosyltr...    301   3e-96    Gardenia jasminoides
sp|F8WLS6.1|UGT6_CATRO  RecName: Full=7-deoxyloganetin glucosyltr...    301   3e-96    Catharanthus roseus [chatas]
ref|NP_001277170.1|  UDP-glycosyltransferase 85A2-like                  300   5e-96    Vitis vinifera
emb|CDP21827.1|  unnamed protein product                                297   8e-96    Coffea canephora [robusta coffee]
ref|XP_006363270.1|  PREDICTED: UDP-glycosyltransferase 85A3-like       299   1e-95    Solanum tuberosum [potatoes]
ref|XP_007042920.1|  UDP-glucosyl transferase 85A2                      300   1e-95    
ref|XP_004237929.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    299   2e-95    Solanum lycopersicum
ref|XP_011016634.1|  PREDICTED: 7-deoxyloganetin glucosyltransferase    298   3e-95    Populus euphratica
ref|XP_004299647.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    297   8e-95    Fragaria vesca subsp. vesca
ref|XP_008219318.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       296   1e-94    Prunus mume [ume]
gb|AIL51400.1|  glycosyltransferase                                     296   2e-94    Actinidia deliciosa [Chinese gooseberry]
ref|XP_008219317.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       295   3e-94    Prunus mume [ume]
ref|XP_002285767.1|  PREDICTED: 7-deoxyloganetin glucosyltransferase    295   3e-94    Vitis vinifera
dbj|BAG80547.1|  glycosyltransferase                                    295   5e-94    Lycium barbarum [Duke of Argyll's teatree]
ref|XP_010248035.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    295   5e-94    Nelumbo nucifera [Indian lotus]
emb|CDP01078.1|  unnamed protein product                                295   9e-94    Coffea canephora [robusta coffee]
ref|XP_002513938.1|  UDP-glucuronosyltransferase, putative              294   2e-93    Ricinus communis
ref|XP_012067890.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    294   2e-93    Jatropha curcas
ref|XP_004299648.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    293   2e-93    Fragaria vesca subsp. vesca
ref|XP_002285771.1|  PREDICTED: 7-deoxyloganetin glucosyltransferase    293   3e-93    Vitis vinifera
ref|XP_002302305.1|  UDP-glucuronosyltransferase family protein         293   3e-93    Populus trichocarpa [western balsam poplar]
ref|XP_008219313.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       292   5e-93    Prunus mume [ume]
ref|XP_011069754.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    292   5e-93    
ref|XP_010060016.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    292   7e-93    Eucalyptus grandis [rose gum]
ref|XP_009592743.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    292   9e-93    Nicotiana tomentosiformis
ref|XP_010534080.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       291   1e-92    Tarenaya hassleriana [spider flower]
ref|XP_002285778.2|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    291   1e-92    
gb|AID16086.1|  flavonol-3-O-glucoside L-rhamnosyltransferase           290   2e-92    Morus alba
ref|XP_004237926.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    291   3e-92    Solanum lycopersicum
ref|XP_006363268.1|  PREDICTED: UDP-glycosyltransferase 85A1-like       290   4e-92    
ref|XP_007224069.1|  hypothetical protein PRUPE_ppa015357mg             290   4e-92    Prunus persica
ref|XP_010060020.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    290   4e-92    Eucalyptus grandis [rose gum]
ref|XP_007222804.1|  hypothetical protein PRUPE_ppa005043mg             290   4e-92    Prunus persica
emb|CAN65645.1|  hypothetical protein VITISV_012510                     292   8e-92    Vitis vinifera
ref|XP_012067889.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    289   8e-92    Jatropha curcas
ref|XP_008466222.1|  PREDICTED: UDP-glycosyltransferase 85A2            289   1e-91    Cucumis melo [Oriental melon]
emb|CBI19181.3|  unnamed protein product                                293   1e-91    Vitis vinifera
ref|XP_010060023.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    288   2e-91    Eucalyptus grandis [rose gum]
gb|KCW66541.1|  hypothetical protein EUGRSUZ_F00338                     288   2e-91    Eucalyptus grandis [rose gum]
ref|XP_010040274.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    288   2e-91    Eucalyptus grandis [rose gum]
emb|CDO97426.1|  unnamed protein product                                288   3e-91    Coffea canephora [robusta coffee]
ref|XP_010060017.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    288   3e-91    Eucalyptus grandis [rose gum]
dbj|BAO51844.1|  UDP-glycosyltransferase 85A28                          287   3e-91    Vitis vinifera
ref|XP_002513937.1|  UDP-glucuronosyltransferase, putative              288   5e-91    Ricinus communis
ref|XP_007227225.1|  hypothetical protein PRUPE_ppa018697mg             286   9e-91    Prunus persica
ref|XP_008219315.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       286   1e-90    
ref|XP_002285770.1|  PREDICTED: 7-deoxyloganetin glucosyltransferase    286   1e-90    Vitis vinifera
gb|KCW66553.1|  hypothetical protein EUGRSUZ_F00351                     285   1e-90    Eucalyptus grandis [rose gum]
gb|KCW66555.1|  hypothetical protein EUGRSUZ_F00353                     285   2e-90    Eucalyptus grandis [rose gum]
ref|XP_010060024.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    285   3e-90    Eucalyptus grandis [rose gum]
ref|XP_003542333.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       285   3e-90    Glycine max [soybeans]
ref|XP_002301060.1|  hypothetical protein POPTR_0002s09850g             286   4e-90    
ref|XP_004136284.1|  PREDICTED: 7-deoxyloganetin glucosyltransferase    285   5e-90    Cucumis sativus [cucumbers]
ref|XP_010060018.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    285   5e-90    Eucalyptus grandis [rose gum]
ref|XP_009391314.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    284   9e-90    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011016624.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    284   1e-89    Populus euphratica
ref|XP_003544800.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       283   1e-89    Glycine max [soybeans]
gb|KHN42553.1|  UDP-glycosyltransferase 85A2                            283   2e-89    Glycine soja [wild soybean]
gb|KJB79650.1|  hypothetical protein B456_013G060700                    282   4e-89    Gossypium raimondii
ref|XP_003526577.1|  PREDICTED: UDP-glycosyltransferase 85A3-like       282   4e-89    
gb|KJB79644.1|  hypothetical protein B456_013G060400                    282   5e-89    Gossypium raimondii
ref|XP_002285779.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    281   1e-88    Vitis vinifera
ref|XP_010273031.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    281   1e-88    Nelumbo nucifera [Indian lotus]
gb|EYU19971.1|  hypothetical protein MIMGU_mgv1a024760mg                280   4e-88    Erythranthe guttata [common monkey flower]
gb|KCW66556.1|  hypothetical protein EUGRSUZ_F00355                     279   4e-88    Eucalyptus grandis [rose gum]
ref|XP_008219322.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       280   4e-88    Prunus mume [ume]
gb|AFK34769.1|  unknown                                                 280   4e-88    Lotus japonicus
ref|XP_008219319.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       280   4e-88    Prunus mume [ume]
ref|XP_010056398.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    280   5e-88    Eucalyptus grandis [rose gum]
gb|EYU19972.1|  hypothetical protein MIMGU_mgv1a018325mg                276   6e-88    Erythranthe guttata [common monkey flower]
emb|CDP01079.1|  unnamed protein product                                279   6e-88    Coffea canephora [robusta coffee]
ref|XP_010056400.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    279   6e-88    Eucalyptus grandis [rose gum]
ref|XP_010647463.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    275   8e-88    Vitis vinifera
gb|KEH28097.1|  UDP-glucosyltransferase family protein                  279   1e-87    Medicago truncatula
ref|XP_009341756.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    279   1e-87    Pyrus x bretschneideri [bai li]
gb|ABW96222.1|  glucosyltransferase                                     279   1e-87    Linum usitatissimum
ref|XP_010064217.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    278   1e-87    Eucalyptus grandis [rose gum]
gb|KJB79645.1|  hypothetical protein B456_013G060500                    278   1e-87    Gossypium raimondii
emb|CDP01087.1|  unnamed protein product                                278   3e-87    Coffea canephora [robusta coffee]
ref|XP_007222658.1|  hypothetical protein PRUPE_ppa004956mg             278   3e-87    Prunus persica
ref|XP_011009481.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    277   3e-87    Populus euphratica
ref|XP_004299646.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    276   8e-87    Fragaria vesca subsp. vesca
gb|AKA44599.1|  UGTPg32                                                 276   8e-87    Panax ginseng [Asiatic ginseng]
ref|XP_002323758.2|  hypothetical protein POPTR_0017s07930g             276   8e-87    
emb|CBI23550.3|  unnamed protein product                                274   9e-87    Vitis vinifera
gb|AFJ52992.1|  UDP-glycosyltransferase 1                               276   1e-86    Linum usitatissimum
ref|XP_010056397.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    276   1e-86    Eucalyptus grandis [rose gum]
ref|XP_010477495.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       275   3e-86    Camelina sativa [gold-of-pleasure]
gb|KCW73111.1|  hypothetical protein EUGRSUZ_E01562                     273   3e-86    Eucalyptus grandis [rose gum]
gb|EYU19973.1|  hypothetical protein MIMGU_mgv1a005383mg                275   4e-86    Erythranthe guttata [common monkey flower]
ref|XP_009341754.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    275   4e-86    Pyrus x bretschneideri [bai li]
ref|XP_011092429.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    274   4e-86    Sesamum indicum [beniseed]
ref|XP_008359320.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       275   5e-86    
ref|XP_010459988.1|  PREDICTED: UDP-glycosyltransferase 85A2            274   5e-86    Camelina sativa [gold-of-pleasure]
emb|CDP01073.1|  unnamed protein product                                274   6e-86    Coffea canephora [robusta coffee]
ref|XP_003635298.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    274   7e-86    Vitis vinifera
gb|KFK44335.1|  hypothetical protein AALP_AA1G244700                    273   1e-85    Arabis alpina [alpine rockcress]
ref|XP_010498706.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       273   1e-85    Camelina sativa [gold-of-pleasure]
ref|XP_008808008.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       273   1e-85    Phoenix dactylifera
gb|ADV71371.1|  glycosyltransferase GT14M03                             273   2e-85    Pueraria montana var. lobata [kudzu]
emb|CDP01072.1|  unnamed protein product                                271   2e-85    Coffea canephora [robusta coffee]
ref|XP_010039907.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    273   2e-85    Eucalyptus grandis [rose gum]
ref|XP_007141200.1|  hypothetical protein PHAVU_008G175500g             273   2e-85    Phaseolus vulgaris [French bean]
emb|CDO97432.1|  unnamed protein product                                272   3e-85    Coffea canephora [robusta coffee]
gb|ACU19718.1|  unknown                                                 264   3e-85    Glycine max [soybeans]
gb|AID16084.1|  flavonoid 3-O-glucosyltransferase                       268   3e-85    Morus alba
ref|XP_007222664.1|  hypothetical protein PRUPE_ppa004979mg             272   4e-85    Prunus persica
ref|XP_003544799.1|  PREDICTED: UDP-glycosyltransferase 85A3-like       271   4e-85    Glycine max [soybeans]
ref|XP_002513939.1|  UDP-glucuronosyltransferase, putative              269   5e-85    
ref|XP_008219468.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       275   5e-85    Prunus mume [ume]
ref|XP_003615138.1|  Cytokinin-O-glucosyltransferase                    271   5e-85    Medicago truncatula
gb|AFK33787.1|  unknown                                                 271   6e-85    Medicago truncatula
gb|ACJ84649.1|  unknown                                                 271   6e-85    Medicago truncatula
ref|XP_003544213.2|  PREDICTED: UDP-glycosyltransferase 85A2-like       271   7e-85    Glycine max [soybeans]
ref|XP_007222427.1|  hypothetical protein PRUPE_ppa004909mg             271   7e-85    Prunus persica
gb|AFK37311.1|  unknown                                                 271   7e-85    Medicago truncatula
ref|XP_010035387.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    271   8e-85    Eucalyptus grandis [rose gum]
gb|KHN24339.1|  UDP-glycosyltransferase 85A2                            271   1e-84    Glycine soja [wild soybean]
ref|XP_006433960.1|  hypothetical protein CICLE_v10000925mg             271   1e-84    Citrus clementina [clementine]
ref|XP_006472583.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       271   1e-84    Citrus sinensis [apfelsine]
ref|XP_006472584.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       271   1e-84    Citrus sinensis [apfelsine]
ref|XP_003544801.1|  PREDICTED: UDP-glycosyltransferase 85A3-like       271   1e-84    Glycine max [soybeans]
ref|XP_010676160.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    271   1e-84    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010477496.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       271   1e-84    Camelina sativa [gold-of-pleasure]
ref|XP_007226586.1|  hypothetical protein PRUPE_ppa023851mg             270   2e-84    
emb|CBI34065.3|  unnamed protein product                                261   2e-84    Vitis vinifera
ref|XP_008219316.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       270   2e-84    Prunus mume [ume]
ref|XP_010937416.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    270   3e-84    Elaeis guineensis
ref|XP_002263158.1|  PREDICTED: 7-deoxyloganetin glucosyltransferase    270   3e-84    Vitis vinifera
ref|XP_008219456.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       270   3e-84    Prunus mume [ume]
ref|XP_006433964.1|  hypothetical protein CICLE_v10004031mg             272   4e-84    
dbj|BAH56949.1|  AT1G22360                                              268   5e-84    Arabidopsis thaliana [mouse-ear cress]
ref|XP_007047909.1|  UDP-glucosyl transferase 85A2                      269   5e-84    Theobroma cacao [chocolate]
ref|XP_008386105.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       269   7e-84    Malus domestica [apple tree]
gb|AHL38933.1|  glycosyltransferase                                     269   8e-84    Arabidopsis thaliana [mouse-ear cress]
emb|CDP01082.1|  unnamed protein product                                273   8e-84    Coffea canephora [robusta coffee]
ref|NP_173653.1|  UDP-glucosyl transferase 85A2                         268   9e-84    Arabidopsis thaliana [mouse-ear cress]
gb|AAL32657.1|  UDP-glucose glucosyltransferase                         268   1e-83    Arabidopsis thaliana [mouse-ear cress]
ref|NP_001031078.1|  UDP-glucosyl transferase 85A2                      268   1e-83    Arabidopsis thaliana [mouse-ear cress]
ref|XP_008234165.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       268   1e-83    Prunus mume [ume]
dbj|BAO51839.1|  UDP-glycosyltransferase 85A34                          268   1e-83    Humulus lupulus [common hop]
ref|XP_009341757.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    268   2e-83    Pyrus x bretschneideri [bai li]
ref|XP_010040275.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    268   2e-83    
ref|XP_006307366.1|  hypothetical protein CARUB_v10008992mg             268   2e-83    Capsella rubella
ref|XP_010267412.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    268   2e-83    Nelumbo nucifera [Indian lotus]
ref|XP_002885822.1|  hypothetical protein ARALYDRAFT_319356             268   2e-83    
ref|XP_008219459.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       267   3e-83    Prunus mume [ume]
gb|KEH17174.1|  UDP-glucosyltransferase family protein                  267   3e-83    Medicago truncatula
ref|XP_010498707.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       267   3e-83    Camelina sativa [gold-of-pleasure]
dbj|BAO51841.1|  UDP-glycosyltransferase 85A35                          267   4e-83    Humulus lupulus [common hop]
gb|EYU43443.1|  hypothetical protein MIMGU_mgv1a018722mg                266   4e-83    Erythranthe guttata [common monkey flower]
ref|XP_002525850.1|  UDP-glucuronosyltransferase, putative              267   4e-83    
dbj|BAO51838.1|  UDP-glycosyltransferase 85A36                          267   5e-83    Humulus lupulus [common hop]
ref|XP_010535401.1|  PREDICTED: UDP-glycosyltransferase 85A1-like...    267   5e-83    Tarenaya hassleriana [spider flower]
ref|XP_006307682.1|  hypothetical protein CARUB_v10009316mg             264   6e-83    
ref|XP_007207189.1|  hypothetical protein PRUPE_ppa017055mg             266   7e-83    Prunus persica
emb|CDY21359.1|  BnaA09g30680D                                          264   7e-83    Brassica napus [oilseed rape]
ref|XP_007208223.1|  hypothetical protein PRUPE_ppa018343mg             266   8e-83    Prunus persica
ref|XP_009145347.1|  PREDICTED: UDP-glycosyltransferase 85A2 isof...    266   8e-83    Brassica rapa
ref|XP_007141201.1|  hypothetical protein PHAVU_008G175600g             266   1e-82    Phaseolus vulgaris [French bean]
emb|CDY46643.1|  BnaA07g10530D                                          266   1e-82    Brassica napus [oilseed rape]
dbj|BAG80552.1|  UDP-glucose:glucosyltransferase                        266   1e-82    Lycium barbarum [Duke of Argyll's teatree]
ref|XP_010060021.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    266   1e-82    
ref|XP_009103242.1|  PREDICTED: UDP-glycosyltransferase 85A3-like       266   1e-82    Brassica rapa
gb|KFK44331.1|  hypothetical protein AALP_AA1G244300                    265   2e-82    Arabis alpina [alpine rockcress]
ref|XP_009387949.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       258   2e-82    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009145349.1|  PREDICTED: UDP-glycosyltransferase 85A7 isof...    265   2e-82    Brassica rapa
ref|XP_010040276.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    267   2e-82    
ref|XP_002525851.1|  UDP-glucuronosyltransferase, putative              265   2e-82    Ricinus communis
ref|XP_007207648.1|  hypothetical protein PRUPE_ppa021414mg             265   2e-82    Prunus persica
emb|CDY46644.1|  BnaA07g10520D                                          259   2e-82    Brassica napus [oilseed rape]
dbj|BAO51840.1|  UDP-glycosyltransferase 85K12                          265   2e-82    Humulus lupulus [common hop]
ref|XP_011465456.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    264   4e-82    Fragaria vesca subsp. vesca
ref|XP_009413654.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    256   7e-82    Musa acuminata subsp. malaccensis [pisang utan]
gb|KFK44336.1|  hypothetical protein AALP_AA1G244800                    264   8e-82    Arabis alpina [alpine rockcress]
gb|KFK44329.1|  hypothetical protein AALP_AA1G244100                    263   8e-82    Arabis alpina [alpine rockcress]
ref|XP_012068368.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    264   8e-82    
emb|CDY38225.1|  BnaC05g17420D                                          263   1e-81    Brassica napus [oilseed rape]
ref|XP_010039828.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    263   2e-81    
ref|XP_002525852.1|  UDP-glucuronosyltransferase, putative              262   2e-81    
ref|XP_010030028.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    263   2e-81    Eucalyptus grandis [rose gum]
gb|AAR06913.1|  UDP-glycosyltransferase 85A8                            262   2e-81    Stevia rebaudiana
ref|XP_002298702.2|  hypothetical protein POPTR_0001s32000g             262   2e-81    Populus trichocarpa [western balsam poplar]
ref|XP_010060022.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    263   2e-81    Eucalyptus grandis [rose gum]
ref|XP_002893221.1|  UDP-glycosyltransferase                            262   2e-81    
ref|XP_010041627.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    262   2e-81    Eucalyptus grandis [rose gum]
ref|NP_001277168.1|  UDP-glycosyltransferase 85A2-like                  262   3e-81    Vitis vinifera
ref|XP_006351765.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       262   4e-81    Solanum tuberosum [potatoes]
ref|XP_006416203.1|  hypothetical protein EUTSA_v10009957mg             268   4e-81    
ref|XP_008380053.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       261   4e-81    Malus domestica [apple tree]
gb|KDP41398.1|  hypothetical protein JCGZ_15805                         262   5e-81    Jatropha curcas
ref|XP_009145346.1|  PREDICTED: UDP-glycosyltransferase 85A2 isof...    261   5e-81    Brassica rapa
ref|XP_009334337.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    261   5e-81    Pyrus x bretschneideri [bai li]
gb|KFK44333.1|  hypothetical protein AALP_AA1G244500                    261   6e-81    Arabis alpina [alpine rockcress]
ref|XP_002532877.1|  UDP-glucuronosyltransferase, putative              261   6e-81    
gb|KCW45339.1|  hypothetical protein EUGRSUZ_L009911                    251   6e-81    Eucalyptus grandis [rose gum]
ref|XP_008386313.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       261   9e-81    
gb|KFK44334.1|  hypothetical protein AALP_AA1G244600                    260   1e-80    Arabis alpina [alpine rockcress]
gb|KDP41396.1|  hypothetical protein JCGZ_15803                         260   1e-80    Jatropha curcas
ref|XP_008234175.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       260   1e-80    Prunus mume [ume]
ref|XP_009145345.1|  PREDICTED: UDP-glycosyltransferase 85A2 isof...    260   2e-80    Brassica rapa
ref|XP_010098615.1|  UDP-glycosyltransferase 85A1                       260   2e-80    Morus notabilis
ref|XP_009380209.1|  PREDICTED: LOW QUALITY PROTEIN: 7-deoxylogan...    260   2e-80    
ref|XP_011045673.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    259   3e-80    Populus euphratica
ref|XP_002268845.1|  PREDICTED: 7-deoxyloganetin glucosyltransferase    259   3e-80    Vitis vinifera
ref|XP_006304665.1|  hypothetical protein CARUB_v10011877mg             259   3e-80    Capsella rubella
ref|XP_010910271.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    259   3e-80    Elaeis guineensis
dbj|BAB86928.1|  glucosyltransferase-10                                 259   3e-80    Vigna angularis [azuki bean]
gb|ABK95289.1|  unknown                                                 259   4e-80    Populus trichocarpa [western balsam poplar]
ref|XP_007225655.1|  hypothetical protein PRUPE_ppa004945mg             259   5e-80    Prunus persica
dbj|BAO51833.1|  UDP-glycosyltransferase 85K10                          259   5e-80    Camellia sinensis [black tea]
ref|XP_011045674.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    259   6e-80    Populus euphratica
gb|EYU18467.1|  hypothetical protein MIMGU_mgv1a005587mg                258   6e-80    Erythranthe guttata [common monkey flower]
ref|XP_007224375.1|  hypothetical protein PRUPE_ppa021058mg             258   9e-80    Prunus persica
ref|XP_007141191.1|  hypothetical protein PHAVU_008G174700g             258   1e-79    Phaseolus vulgaris [French bean]
ref|XP_011626565.1|  PREDICTED: 7-deoxyloganetin glucosyltransferase    258   1e-79    Amborella trichopoda
gb|ERN14686.1|  hypothetical protein AMTR_s00038p00218410               258   1e-79    Amborella trichopoda
emb|CDY46645.1|  BnaA07g10510D                                          257   1e-79    Brassica napus [oilseed rape]
ref|NP_173652.1|  UDP-glucosyl transferase 85A7                         258   2e-79    Arabidopsis thaliana [mouse-ear cress]
ref|XP_011087901.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    257   2e-79    Sesamum indicum [beniseed]
ref|XP_007227474.1|  hypothetical protein PRUPE_ppa004968mg             257   2e-79    Prunus persica
ref|XP_002893224.1|  UDP-glucosyl transferase 85A1                      257   2e-79    
ref|XP_010098617.1|  UDP-glycosyltransferase 85A2                       257   2e-79    
ref|XP_006304493.1|  hypothetical protein CARUB_v10011262mg             257   2e-79    Capsella rubella
gb|ABV68925.1|  mandelonitrile glucosyltransferase UGT85A19             257   2e-79    Prunus dulcis [sweet almond]
ref|XP_008811180.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       257   2e-79    Phoenix dactylifera
ref|XP_006303659.1|  hypothetical protein CARUB_v10011698mg             257   3e-79    Capsella rubella
ref|XP_011008563.1|  PREDICTED: uncharacterized protein LOC105113904    267   3e-79    Populus euphratica
ref|XP_006388801.1|  hypothetical protein POPTR_0098s002901g            253   5e-79    
emb|CDY62992.1|  BnaC07g48400D                                          256   5e-79    Brassica napus [oilseed rape]
emb|CDP01479.1|  unnamed protein product                                256   5e-79    Coffea canephora [robusta coffee]
ref|XP_002306303.2|  hypothetical protein POPTR_0005s07500g             256   5e-79    
ref|XP_004230580.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    256   5e-79    Solanum lycopersicum
ref|XP_008219457.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       256   6e-79    Prunus mume [ume]
ref|XP_004308659.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    256   6e-79    Fragaria vesca subsp. vesca
ref|XP_008234196.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       256   6e-79    Prunus mume [ume]
gb|KCW66540.1|  hypothetical protein EUGRSUZ_F00337                     255   6e-79    Eucalyptus grandis [rose gum]
ref|XP_008386170.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       256   7e-79    
ref|XP_009370709.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    255   1e-78    
ref|XP_008455179.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       256   1e-78    Cucumis melo [Oriental melon]
ref|XP_002893223.1|  transcription factor/ transferase, transferr...    256   1e-78    Arabidopsis lyrata subsp. lyrata
gb|KCW45706.1|  hypothetical protein EUGRSUZ_L00512                     255   1e-78    Eucalyptus grandis [rose gum]
ref|XP_011031048.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    256   1e-78    Populus euphratica
ref|XP_010025433.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    255   1e-78    
ref|XP_010087621.1|  UDP-glycosyltransferase 85A1                       256   1e-78    
ref|XP_007141198.1|  hypothetical protein PHAVU_008G175300g             255   2e-78    Phaseolus vulgaris [French bean]
ref|XP_010025432.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    255   2e-78    Eucalyptus grandis [rose gum]
ref|XP_009103240.1|  PREDICTED: UDP-glycosyltransferase 85A1-like       255   2e-78    Brassica rapa
ref|XP_011658802.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    254   2e-78    Cucumis sativus [cucumbers]
gb|KCW62086.1|  hypothetical protein EUGRSUZ_H04754                     254   2e-78    Eucalyptus grandis [rose gum]
ref|XP_010025429.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    254   3e-78    
ref|XP_008359346.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       249   3e-78    
ref|XP_006426368.1|  hypothetical protein CICLE_v10025476mg             254   3e-78    Citrus clementina [clementine]
gb|KCW73114.1|  hypothetical protein EUGRSUZ_E01567                     252   3e-78    Eucalyptus grandis [rose gum]
ref|XP_002300186.1|  hypothetical protein POPTR_0001s31950g             254   3e-78    
ref|XP_007042919.1|  UDP-glycosyltransferase 85A1                       254   4e-78    
emb|CBI38430.3|  unnamed protein product                                259   4e-78    Vitis vinifera
ref|XP_011003867.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    254   5e-78    Populus euphratica
emb|CDY62991.1|  BnaC07g48390D                                          253   5e-78    
ref|XP_009350108.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    254   5e-78    
ref|XP_003579871.2|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    256   5e-78    
ref|NP_173656.1|  UDP-glycosyltransferase 85A1                          253   7e-78    
ref|XP_009341609.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    253   7e-78    
emb|CDP01085.1|  unnamed protein product                                252   7e-78    
ref|XP_009103241.1|  PREDICTED: UDP-glycosyltransferase 85A1-like       253   9e-78    
gb|EMT29523.1|  Cytokinin-O-glucosyltransferase 2                       251   9e-78    
ref|XP_010459992.1|  PREDICTED: UDP-glycosyltransferase 85A5            253   1e-77    
ref|XP_007047908.1|  UDP-glucosyl transferase 85A2                      253   1e-77    
ref|XP_006416205.1|  hypothetical protein EUTSA_v10007502mg             253   1e-77    
gb|KHN34757.1|  UDP-glycosyltransferase 85A2                            252   1e-77    
gb|KGN43728.1|  hypothetical protein Csa_7G063920                       246   1e-77    
gb|EYU18465.1|  hypothetical protein MIMGU_mgv1a006002mg                252   2e-77    
ref|XP_002893219.1|  UDP-glucoronosyl/UDP-glucosyl transferase fa...    252   2e-77    
ref|XP_008229743.1|  PREDICTED: UDP-glycosyltransferase 85A1-like       253   2e-77    
ref|XP_009348490.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    252   2e-77    
ref|XP_009364608.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    251   3e-77    
ref|XP_003575222.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    252   3e-77    
ref|XP_002308831.2|  hypothetical protein POPTR_0006s02390g             251   3e-77    
ref|XP_010937418.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    252   3e-77    
ref|NP_173655.2|  UDP-glucosyl transferase 85A3                         252   3e-77    
dbj|BAJ90289.1|  predicted protein                                      251   4e-77    
ref|XP_007146161.1|  hypothetical protein PHAVU_006G017500g             251   4e-77    
ref|XP_010027911.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    251   4e-77    
ref|NP_973885.1|  UDP-glucosyl transferase 85A5                         251   4e-77    
ref|XP_008789348.1|  PREDICTED: UDP-glycosyltransferase 85A2-like...    251   4e-77    
ref|XP_008229481.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       251   4e-77    
ref|XP_010477498.1|  PREDICTED: LOW QUALITY PROTEIN: UDP-glycosyl...    253   5e-77    
ref|XP_010025434.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    251   8e-77    
ref|XP_011031049.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    251   1e-76    
ref|XP_011468341.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    250   1e-76    
tpg|DAA37525.1|  TPA: cytokinin-O-glucosyltransferase 2                 250   1e-76    
emb|CDX91674.1|  BnaC08g05930D                                          250   1e-76    
ref|XP_008386293.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       258   1e-76    
emb|CAN68409.1|  hypothetical protein VITISV_022913                     249   1e-76    
ref|XP_002323188.2|  hypothetical protein POPTR_0016s02200g             250   2e-76    
gb|KCW62089.1|  hypothetical protein EUGRSUZ_H04760                     249   2e-76    
ref|XP_010027305.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    249   2e-76    
gb|EYU18464.1|  hypothetical protein MIMGU_mgv1a005689mg                249   2e-76    
gb|EYU18466.1|  hypothetical protein MIMGU_mgv1a005711mg                249   2e-76    
ref|NP_001148091.1|  cytokinin-O-glucosyltransferase 2                  249   2e-76    
gb|EMT26410.1|  Cytokinin-O-glucosyltransferase 2                       246   2e-76    
ref|XP_010459994.1|  PREDICTED: UDP-glycosyltransferase 85A1-like       250   3e-76    
ref|XP_006466245.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       249   3e-76    
ref|XP_012081719.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    249   3e-76    
ref|XP_006380939.1|  hypothetical protein POPTR_0006s02350g             249   4e-76    
emb|CDY41486.1|  BnaA08g20880D                                          249   4e-76    
ref|XP_008219458.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       248   4e-76    
gb|KHN33502.1|  UDP-glycosyltransferase 85A2                            249   4e-76    
ref|XP_003547073.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       248   5e-76    
dbj|BAO51834.1|  UDP-glycosyltransferase 85K11                          249   5e-76    
ref|XP_008229795.1|  PREDICTED: UDP-glycosyltransferase 85A1-like       249   5e-76    
ref|XP_002268162.1|  PREDICTED: 7-deoxyloganetin glucosyltransferase    248   5e-76    
ref|XP_008455196.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       248   5e-76    
ref|XP_010498708.1|  PREDICTED: UDP-glycosyltransferase 85A1-like       249   6e-76    
gb|KCW66542.1|  hypothetical protein EUGRSUZ_F00339                     248   6e-76    
ref|XP_006652346.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       249   6e-76    
ref|XP_011014886.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    248   6e-76    
ref|XP_011008540.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    248   6e-76    
ref|XP_010676178.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    248   6e-76    
ref|XP_004305878.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    248   7e-76    
ref|XP_006853218.1|  PREDICTED: 7-deoxyloganetin glucosyltransferase    248   7e-76    
ref|XP_011014889.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    248   8e-76    
ref|XP_002310553.1|  hypothetical protein POPTR_0007s05230g             248   8e-76    
ref|XP_008391265.1|  PREDICTED: UDP-glycosyltransferase 85A3-like       248   9e-76    
ref|XP_004237925.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    248   9e-76    
ref|XP_007047907.1|  UDP-glucosyl transferase 85A2                      248   9e-76    
ref|XP_011658801.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    246   1e-75    
ref|XP_011014888.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    248   1e-75    
gb|AAF87258.1|AC068562_5  Strong similarity to UDP-glucose glucos...    247   1e-75    
ref|XP_010676201.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    248   1e-75    
ref|XP_008224049.1|  PREDICTED: UDP-glycosyltransferase 85A2-like...    247   1e-75    
gb|AFW64428.1|  hypothetical protein ZEAMMB73_964153                    248   1e-75    
ref|XP_008373175.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       243   1e-75    
ref|XP_008679294.1|  PREDICTED: UDP-glycosyltransferase 85A3-like       248   1e-75    
ref|XP_008224048.1|  PREDICTED: UDP-glycosyltransferase 85A2-like...    247   1e-75    
ref|XP_010039829.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    247   2e-75    
ref|XP_002513010.1|  UDP-glucuronosyltransferase, putative              247   2e-75    
gb|AAV32497.1|  UDP-glucuronosyltransferase                             247   2e-75    
gb|KCW66543.1|  hypothetical protein EUGRSUZ_F00340                     245   2e-75    
ref|XP_008229739.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       247   2e-75    
ref|XP_010477499.1|  PREDICTED: LOW QUALITY PROTEIN: UDP-glycosyl...    247   2e-75    
ref|NP_177950.1|  UDP-glucosyl transferase 85A4                         247   2e-75    
gb|EMT15334.1|  Cytokinin-O-glucosyltransferase 2                       244   2e-75    
ref|XP_006416206.1|  hypothetical protein EUTSA_v100074991mg            237   2e-75    
emb|CBI38429.3|  unnamed protein product                                242   2e-75    
ref|XP_004305885.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    246   2e-75    
gb|KCW66544.1|  hypothetical protein EUGRSUZ_F00340                     246   2e-75    
emb|CAD27851.2|  glucosyltransferase                                    238   3e-75    
ref|XP_007148402.1|  hypothetical protein PHAVU_006G205500g             247   3e-75    
ref|XP_006304973.1|  hypothetical protein CARUB_v10011467mg             246   3e-75    
ref|XP_011100190.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    246   3e-75    
ref|XP_011658777.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    247   3e-75    
ref|XP_002323976.2|  hypothetical protein POPTR_0017s07920g             246   3e-75    
ref|XP_002452530.1|  hypothetical protein SORBIDRAFT_04g027470          246   3e-75    
ref|XP_012077758.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    246   3e-75    
ref|XP_008224050.1|  PREDICTED: UDP-glycosyltransferase 85A1-like       246   3e-75    
ref|XP_008350015.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       244   3e-75    
ref|XP_012077776.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    246   4e-75    
ref|XP_002271368.1|  PREDICTED: 7-deoxyloganetin glucosyltransferase    246   4e-75    
ref|XP_008789349.1|  PREDICTED: UDP-glycosyltransferase 85A2-like...    246   4e-75    
ref|XP_007215295.1|  hypothetical protein PRUPE_ppa004989mg             246   4e-75    
ref|XP_008789350.1|  PREDICTED: UDP-glycosyltransferase 85A2-like...    246   4e-75    
gb|KCW66549.1|  hypothetical protein EUGRSUZ_F003461                    236   4e-75    
gb|AFJ52995.1|  UDP-glycosyltransferase 1                               246   5e-75    
ref|XP_008229792.1|  PREDICTED: UDP-glycosyltransferase 85A7-like       246   5e-75    
ref|XP_007047910.1|  UDP-glucosyl transferase 85A2                      246   5e-75    
ref|XP_006466241.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       246   6e-75    
ref|XP_010477497.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       246   6e-75    
ref|XP_010676190.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    246   6e-75    
ref|XP_006416204.1|  hypothetical protein EUTSA_v10007489mg             246   7e-75    
ref|XP_009413574.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    245   7e-75    
gb|KCW45698.1|  hypothetical protein EUGRSUZ_L00502                     245   7e-75    
gb|KDP40913.1|  hypothetical protein JCGZ_24912                         241   7e-75    
ref|XP_008343335.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       236   8e-75    
ref|XP_010459993.1|  PREDICTED: UDP-glycosyltransferase 85A3            246   8e-75    
ref|XP_008386104.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       245   9e-75    
ref|XP_008779905.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       245   9e-75    
ref|XP_006426369.1|  hypothetical protein CICLE_v10025504mg             245   9e-75    
ref|XP_010039816.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    245   9e-75    
ref|XP_012072922.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    245   9e-75    
ref|XP_002308828.2|  hypothetical protein POPTR_0006s02330g             245   9e-75    
ref|XP_008372493.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       245   1e-74    
ref|XP_008229471.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       242   1e-74    
ref|XP_003545683.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       245   1e-74    
ref|XP_003570607.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    245   1e-74    
ref|XP_008229473.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       245   1e-74    
ref|XP_008804762.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       244   2e-74    
gb|KFK44332.1|  hypothetical protein AALP_AA1G244400                    244   2e-74    
ref|XP_002308830.2|  hypothetical protein POPTR_0006s02380g             244   2e-74    
ref|XP_006852717.1|  PREDICTED: 7-deoxyloganetin glucosyltransferase    244   2e-74    
ref|XP_002893222.1|  UDP-glucoronosyl/UDP-glucosyl transferase fa...    244   3e-74    
ref|XP_012069147.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    244   3e-74    
ref|XP_010676225.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    244   3e-74    
ref|XP_008347720.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       244   3e-74    
dbj|BAJ94765.1|  predicted protein                                      244   3e-74    
gb|ACU24374.1|  unknown                                                 244   3e-74    
ref|XP_004975806.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       244   3e-74    
ref|XP_004485548.1|  PREDICTED: UDP-glycosyltransferase 85A7-like       244   3e-74    
ref|XP_002268637.1|  PREDICTED: 7-deoxyloganetin glucosyltransferase    244   3e-74    
ref|XP_008229477.1|  PREDICTED: UDP-glycosyltransferase 85A5-like...    244   4e-74    
ref|XP_006380941.1|  hypothetical protein POPTR_0006s02370g             242   4e-74    
gb|EMS58460.1|  UDP-glycosyltransferase 85A2                            244   4e-74    
ref|XP_002308829.1|  hypothetical protein POPTR_0006s02310g             243   5e-74    
gb|EMT15333.1|  Cytokinin-O-glucosyltransferase 2                       244   5e-74    
gb|AFJ52993.1|  UDP-glycosyltransferase 1                               244   5e-74    
ref|XP_009377931.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    243   5e-74    
ref|XP_004953967.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       243   6e-74    
ref|XP_010521179.1|  PREDICTED: UDP-glycosyltransferase 85A3-like       243   6e-74    
ref|XP_002530116.1|  UDP-glucuronosyltransferase, putative              240   7e-74    
ref|XP_008224051.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       243   7e-74    
ref|XP_011009478.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    243   7e-74    
gb|KDP37429.1|  hypothetical protein JCGZ_07956                         243   7e-74    
ref|XP_009350671.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    243   8e-74    
gb|KHN33534.1|  UDP-glycosyltransferase 85A2                            243   9e-74    
ref|XP_008245955.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       234   1e-73    
ref|XP_012085929.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    242   1e-73    
ref|XP_008455233.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       243   1e-73    
ref|XP_002323977.2|  hypothetical protein POPTR_0017s07900g             242   1e-73    
ref|XP_006366324.1|  PREDICTED: UDP-glycosyltransferase 85A1-like       242   1e-73    
ref|XP_002323974.2|  hypothetical protein POPTR_0017s07880g             242   1e-73    
gb|KCW73112.1|  hypothetical protein EUGRSUZ_E01563                     234   1e-73    
ref|XP_008378324.1|  PREDICTED: UDP-glycosyltransferase 85A3-like       242   2e-73    
ref|XP_002889182.1|  hypothetical protein ARALYDRAFT_476994             242   2e-73    
emb|CDP13142.1|  unnamed protein product                                242   2e-73    
ref|XP_008229475.1|  PREDICTED: UDP-glycosyltransferase 85A5-like...    242   2e-73    
ref|XP_009349617.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    242   2e-73    
ref|XP_010025430.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    242   2e-73    
ref|XP_012077778.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    241   2e-73    
ref|XP_004300654.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    241   2e-73    
ref|XP_009145352.1|  PREDICTED: UDP-glycosyltransferase 85A7 isof...    240   2e-73    
ref|XP_009377940.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    242   2e-73    
ref|XP_009350672.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    241   2e-73    
emb|CDY67802.1|  BnaC05g50340D                                          241   2e-73    
ref|XP_011087902.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    241   2e-73    
ref|XP_006853259.1|  PREDICTED: 7-deoxyloganetin glucosyltransferase    241   3e-73    
ref|XP_006373048.1|  hypothetical protein POPTR_0017s079102g            231   3e-73    
ref|XP_011023081.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    241   4e-73    
ref|XP_008455180.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       241   4e-73    
ref|XP_010676237.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    241   4e-73    
ref|XP_009349615.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    241   4e-73    
dbj|BAK00666.1|  predicted protein                                      241   5e-73    
dbj|BAJ89621.1|  predicted protein                                      241   5e-73    
ref|XP_008229476.1|  PREDICTED: UDP-glycosyltransferase 85A5-like...    241   5e-73    
gb|ACJ85365.1|  unknown                                                 233   5e-73    
ref|XP_009377951.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    241   5e-73    
ref|XP_010027304.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    241   6e-73    
ref|XP_010030926.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    248   6e-73    
ref|XP_012069281.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    241   7e-73    
ref|XP_003618643.1|  Cytokinin-O-glucosyltransferase                    240   7e-73    
gb|KDP43115.1|  hypothetical protein JCGZ_26648                         240   7e-73    
ref|XP_008378325.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       240   7e-73    
ref|XP_002323189.1|  hypothetical protein POPTR_0016s02190g             240   8e-73    
ref|XP_008799460.1|  PREDICTED: UDP-glycosyltransferase 85A7-like       240   8e-73    
gb|ERN14680.1|  hypothetical protein AMTR_s00038p00215640               234   9e-73    
ref|XP_012081602.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    240   1e-72    
ref|XP_006390003.1|  hypothetical protein EUTSA_v10019687mg             240   1e-72    
ref|XP_008224046.1|  PREDICTED: UDP-glycosyltransferase 85A3-like...    239   1e-72    
ref|XP_003598165.1|  Cytokinin-O-glucosyltransferase                    239   1e-72    
gb|EYU18463.1|  hypothetical protein MIMGU_mgv1a005662mg                239   1e-72    
gb|ACB88211.1|  UFGT2                                                   239   1e-72    
gb|KCW73113.1|  hypothetical protein EUGRSUZ_E01564                     238   2e-72    
ref|XP_002323978.2|  hypothetical protein POPTR_0017s07940g             239   2e-72    
ref|XP_009145344.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       239   2e-72    
emb|CDY21360.1|  BnaA09g30670D                                          239   2e-72    
gb|AAV32498.1|  UDP-glucuronosyltransferase                             238   2e-72    
ref|XP_002530115.1|  UDP-glucuronosyltransferase, putative              239   2e-72    
ref|XP_008229788.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       239   2e-72    
gb|EAY87578.1|  hypothetical protein OsI_08989                          239   2e-72    
ref|XP_011467662.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    239   2e-72    
ref|XP_002529831.1|  UDP-glucuronosyltransferase, putative              239   2e-72    
ref|XP_004235064.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    239   2e-72    
ref|XP_008455195.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       239   2e-72    
ref|XP_008799459.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       239   2e-72    
gb|KCW45697.1|  hypothetical protein EUGRSUZ_L00500                     229   2e-72    
ref|XP_002262743.1|  PREDICTED: 7-deoxyloganetin glucosyltransferase    239   2e-72    
ref|XP_006593894.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       239   2e-72    
ref|XP_010066660.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    239   3e-72    
ref|XP_007042950.1|  UDP-glycosyltransferase 85A1                       239   3e-72    
ref|XP_002452527.1|  hypothetical protein SORBIDRAFT_04g027460          238   4e-72    



>dbj|BAO51842.1| UDP-glycosyltransferase 85A32 [Ipomoea batatas]
Length=485

 Score =   345 bits (886),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 163/200 (82%), Positives = 179/200 (90%), Gaps = 2/200 (1%)
 Frame = +1

Query  49   MGSNNCEFEKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGP  228
            MGS + E +K PHAVC+PYPAQ HIN MLKLAK+LH+KGFHITFVNTEFNHRRL+R+RGP
Sbjct  1    MGSLSSELDK-PHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLERTRGP  59

Query  229  ESLRGLPSFRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNV  408
            ESLRGLPSFRFETIPDGLP SD D TQDIPSLC ST+ TCLGPFKDLLARLN T A +N 
Sbjct  60   ESLRGLPSFRFETIPDGLPVSDADVTQDIPSLCESTSATCLGPFKDLLARLNDT-AVSNA  118

Query  409  PPVSCIVSDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEGYL  588
            PPVSCIVSDG+MSFT+ AAEELGIP+VLFW  SA GF+G MH++QL+DKGYTPLKDE YL
Sbjct  119  PPVSCIVSDGVMSFTVDAAEELGIPEVLFWTTSACGFLGYMHFTQLLDKGYTPLKDESYL  178

Query  589  TNGYLETELDWVKGMKGIRL  648
            TNGYLETELDWVKGMKGIRL
Sbjct  179  TNGYLETELDWVKGMKGIRL  198



>ref|XP_006473006.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Citrus sinensis]
Length=240

 Score =   314 bits (804),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 146/200 (73%), Positives = 168/200 (84%), Gaps = 3/200 (2%)
 Frame = +1

Query  49   MGSNNCEFEKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGP  228
            MGS     E  PHAVC+PYPAQ HIN MLKLAK+LH+KGFHITFVNTEFNH+RL +SRGP
Sbjct  1    MGSLAAAIEM-PHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHKRLLKSRGP  59

Query  229  ESLRGLPSFRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNV  408
            +SL GLPSFRFETIPDGLPP+DVDATQDIPSLC ST  TCL PFK+LL +LN    ++NV
Sbjct  60   DSLNGLPSFRFETIPDGLPPTDVDATQDIPSLCYSTTRTCLAPFKELLHKLND--PSSNV  117

Query  409  PPVSCIVSDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEGYL  588
            PPV+CIVSDG+MSFT+ AAEELG+P+VLFW  SA GF+  +H+ QL+DKGYTPLKDE Y 
Sbjct  118  PPVTCIVSDGVMSFTVDAAEELGVPEVLFWTTSACGFLAYLHFRQLIDKGYTPLKDESYF  177

Query  589  TNGYLETELDWVKGMKGIRL  648
            TNGYL T +DW+ GMKGIRL
Sbjct  178  TNGYLNTVIDWIPGMKGIRL  197



>ref|XP_006360268.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Solanum tuberosum]
Length=486

 Score =   321 bits (822),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 149/200 (75%), Positives = 169/200 (85%), Gaps = 1/200 (1%)
 Frame = +1

Query  49   MGSNNCEFEKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGP  228
            MGSNN E   KPHAVC+PYPAQ HIN MLKLAK+LH+KGFHITFVNTEFNHRRL +SRGP
Sbjct  1    MGSNNVEL-NKPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLLKSRGP  59

Query  229  ESLRGLPSFRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNV  408
             SL GL SFRFETIPDGLP  D DATQDIPSLC ST  TCL PF+DLLA+LN T+  +NV
Sbjct  60   HSLDGLSSFRFETIPDGLPTCDADATQDIPSLCKSTTETCLAPFRDLLAKLNETSNTSNV  119

Query  409  PPVSCIVSDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEGYL  588
            PPV+CIVSDGIMSFTLAAA+E+G+P+VLFW  SA GF+G MHY+ L++KG+TPLKD  YL
Sbjct  120  PPVTCIVSDGIMSFTLAAAQEIGVPEVLFWTTSACGFLGYMHYTTLIEKGFTPLKDPSYL  179

Query  589  TNGYLETELDWVKGMKGIRL  648
            TNGYLET LD + GMK +RL
Sbjct  180  TNGYLETTLDCIPGMKDVRL  199



>ref|XP_004252531.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Solanum 
lycopersicum]
Length=486

 Score =   318 bits (815),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 149/200 (75%), Positives = 167/200 (84%), Gaps = 1/200 (1%)
 Frame = +1

Query  49   MGSNNCEFEKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGP  228
            MGSNN E   KPHAVC+PYPAQ HIN MLKLAK+LH+KGFHITFVNTEFNHRRL +SRGP
Sbjct  1    MGSNNVEL-NKPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLLKSRGP  59

Query  229  ESLRGLPSFRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNV  408
             SL GL SFRFETIPDGLP  D DATQDIPSLC ST  TCL PF+DLLA+LN T   +NV
Sbjct  60   HSLDGLSSFRFETIPDGLPTCDADATQDIPSLCKSTTETCLAPFRDLLAKLNGTNNTSNV  119

Query  409  PPVSCIVSDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEGYL  588
            PPV+CIVSDGIMSFTLAAA+E+G+P+VLFW  SA GF+G MHY+ L++KGY PLKD  YL
Sbjct  120  PPVTCIVSDGIMSFTLAAAQEIGVPEVLFWTTSACGFLGYMHYTTLIEKGYIPLKDVSYL  179

Query  589  TNGYLETELDWVKGMKGIRL  648
            TNGYLET LD + GMK +RL
Sbjct  180  TNGYLETTLDCIPGMKDVRL  199



>ref|XP_009775754.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Nicotiana 
sylvestris]
Length=485

 Score =   317 bits (812),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 148/200 (74%), Positives = 171/200 (86%), Gaps = 2/200 (1%)
 Frame = +1

Query  49   MGSNNCEFEKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGP  228
            MGS   EF  KPHAVC+PYPAQ HIN MLKLAK+LH+KGFHITFVNTEFNHRRL +SRGP
Sbjct  1    MGSIGAEF-SKPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLLKSRGP  59

Query  229  ESLRGLPSFRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNV  408
            +SL+GL SFRFETIPDGLPP D DATQDIPSLC ST  TCLGPF+DLLA+LN+T   +NV
Sbjct  60   DSLKGLSSFRFETIPDGLPPCDADATQDIPSLCESTTNTCLGPFRDLLAKLNNT-NTSNV  118

Query  409  PPVSCIVSDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEGYL  588
            PPVSCIVSDG+MSFTLAAA+ELG+P++LFW  SA GF+G MHY ++++KGY PLKD   L
Sbjct  119  PPVSCIVSDGVMSFTLAAAQELGVPEILFWTTSACGFLGYMHYYKVIEKGYAPLKDAADL  178

Query  589  TNGYLETELDWVKGMKGIRL  648
            TNGYLET LD++ GMK +RL
Sbjct  179  TNGYLETTLDFIPGMKDVRL  198



>gb|ADG65641.1| glycosyltransferase [Withania somnifera]
Length=485

 Score =   316 bits (810),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 148/200 (74%), Positives = 170/200 (85%), Gaps = 2/200 (1%)
 Frame = +1

Query  49   MGSNNCEFEKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGP  228
            MGS + E  +KPHAVC+PYPAQ HIN ML+LAK+LH KGFHITFVNTEFNHRRL +SRGP
Sbjct  1    MGSISAE-SQKPHAVCIPYPAQGHINPMLELAKILHQKGFHITFVNTEFNHRRLLKSRGP  59

Query  229  ESLRGLPSFRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNV  408
             +L GL SFRFETIPDGLPPSD DATQDIPSLC ST  TCLGPF+DLLA+LN+T  + NV
Sbjct  60   HALDGLSSFRFETIPDGLPPSDADATQDIPSLCESTTKTCLGPFRDLLAKLNNTYTS-NV  118

Query  409  PPVSCIVSDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEGYL  588
            PPVSCIVSDG+M+FTLAAA+ELG+P+VLFW  SA GF+G MHYS + +KGY PLKD  YL
Sbjct  119  PPVSCIVSDGVMTFTLAAAQELGVPEVLFWTTSACGFLGYMHYSTVTEKGYVPLKDASYL  178

Query  589  TNGYLETELDWVKGMKGIRL  648
            +NGYLET LD + GMKG+RL
Sbjct  179  SNGYLETTLDCIPGMKGVRL  198



>dbj|BAG80542.1| glycosyltransferase [Lycium barbarum]
Length=484

 Score =   315 bits (806),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 148/200 (74%), Positives = 169/200 (85%), Gaps = 4/200 (2%)
 Frame = +1

Query  49   MGSNNCEFEKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGP  228
            MGS + E  KKPHAVC+P+PAQ HIN MLKLAK+LH+KGFHITFVNTE+NHRRL +SRGP
Sbjct  1    MGSISAEL-KKPHAVCIPFPAQGHINPMLKLAKILHHKGFHITFVNTEYNHRRLLKSRGP  59

Query  229  ESLRGLPSFRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNV  408
             +L GL SFR+ETIPDGLPP D DATQDIPSLC ST TTCLGPFKDLLA+LN+T     V
Sbjct  60   NALNGLSSFRYETIPDGLPPCDADATQDIPSLCESTTTTCLGPFKDLLAKLNNTL---EV  116

Query  409  PPVSCIVSDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEGYL  588
            PPVSCIVSDG+MSFT AAA+ELG+P+VLFW  SA GF+G MHYS +++KGYTPLKD  YL
Sbjct  117  PPVSCIVSDGVMSFTFAAAQELGVPEVLFWTTSACGFLGYMHYSTIIEKGYTPLKDASYL  176

Query  589  TNGYLETELDWVKGMKGIRL  648
            TNGYLET LD + GM+ IRL
Sbjct  177  TNGYLETTLDCIPGMENIRL  196



>ref|XP_006433961.1| hypothetical protein CICLE_v10000958mg [Citrus clementina]
 gb|ESR47201.1| hypothetical protein CICLE_v10000958mg [Citrus clementina]
Length=489

 Score =   314 bits (805),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 146/200 (73%), Positives = 168/200 (84%), Gaps = 3/200 (2%)
 Frame = +1

Query  49   MGSNNCEFEKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGP  228
            MGS     E  PHAVC+PYPAQ HIN MLKLAK+LH+KGFHITFVNTEFNH+RL +SRGP
Sbjct  1    MGSVAAAIEM-PHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHKRLLKSRGP  59

Query  229  ESLRGLPSFRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNV  408
            +SL GLPSFRFETIPDGLPP+DVDATQDIPSLC ST  TCL PFK+LL +LN    ++NV
Sbjct  60   DSLNGLPSFRFETIPDGLPPTDVDATQDIPSLCYSTTRTCLAPFKELLHKLND--PSSNV  117

Query  409  PPVSCIVSDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEGYL  588
            PPV+CIVSDG+MSFT+ AAEELG+P+VLFW  SA GF+  +H+ QL+DKGYTPLKDE Y 
Sbjct  118  PPVTCIVSDGVMSFTVDAAEELGVPEVLFWTTSACGFLAYLHFRQLIDKGYTPLKDESYF  177

Query  589  TNGYLETELDWVKGMKGIRL  648
            TNGYL T +DW+ GMKGIRL
Sbjct  178  TNGYLNTVIDWIPGMKGIRL  197



>dbj|BAD93690.1| glycosyltransferase [Nicotiana tabacum]
Length=485

 Score =   313 bits (801),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 147/200 (74%), Positives = 169/200 (85%), Gaps = 2/200 (1%)
 Frame = +1

Query  49   MGSNNCEFEKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGP  228
            MGS   EF  KPHAVC+PYPAQ HIN MLKLAK+LH+KGFHITFVNTEFNHRRL +SRGP
Sbjct  1    MGSIGAEF-TKPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLLKSRGP  59

Query  229  ESLRGLPSFRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNV  408
            +SL+GL SFRFETIPDGLPP D DATQDIPSLC ST  TCLGPF+DLLA+LN T   +NV
Sbjct  60   DSLKGLSSFRFETIPDGLPPCDADATQDIPSLCESTTNTCLGPFRDLLAKLNDT-NTSNV  118

Query  409  PPVSCIVSDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEGYL  588
            PPVSCI+SDG+MSFTLAAA+ELG+P+VLFW  SA GF+G MHY ++++KGY PLKD   L
Sbjct  119  PPVSCIISDGVMSFTLAAAQELGVPEVLFWTTSACGFLGYMHYYKVIEKGYAPLKDASDL  178

Query  589  TNGYLETELDWVKGMKGIRL  648
            TNGYLET LD++  MK +RL
Sbjct  179  TNGYLETTLDFIPCMKDVRL  198



>ref|XP_009590778.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Nicotiana 
tomentosiformis]
Length=485

 Score =   313 bits (801),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 147/200 (74%), Positives = 169/200 (85%), Gaps = 2/200 (1%)
 Frame = +1

Query  49   MGSNNCEFEKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGP  228
            MGS   EF  KPHAVC+PYPAQ HIN MLKLAK+LH+KGFHITFVNTEFNHRRL +SRGP
Sbjct  1    MGSIGAEF-TKPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLLKSRGP  59

Query  229  ESLRGLPSFRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNV  408
            +SL+GL SFRFETIPDGLPP D DATQDIPSLC ST  TCLGPF+DLLA+LN T   +NV
Sbjct  60   DSLKGLSSFRFETIPDGLPPCDADATQDIPSLCESTTNTCLGPFRDLLAKLNDT-NTSNV  118

Query  409  PPVSCIVSDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEGYL  588
            PPVSCI+SDG+MSFTLAAA+ELG+P+VLFW  SA GF+G MHY ++++KGY PLKD   L
Sbjct  119  PPVSCIISDGVMSFTLAAAQELGVPEVLFWTTSACGFLGYMHYYKVIEKGYAPLKDASDL  178

Query  589  TNGYLETELDWVKGMKGIRL  648
            TNGYLET LD++  MK +RL
Sbjct  179  TNGYLETTLDFIPCMKDVRL  198



>ref|XP_007018744.1| UDP-glucosyl transferase 85A2 [Theobroma cacao]
 gb|EOY15969.1| UDP-glucosyl transferase 85A2 [Theobroma cacao]
Length=487

 Score =   311 bits (798),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 143/193 (74%), Positives = 168/193 (87%), Gaps = 1/193 (1%)
 Frame = +1

Query  70   FEKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLP  249
            F  KPHAVC+PYPAQ HIN MLKLAK+LH++GFHITFVNTEFNH+RL ++RGP++L GLP
Sbjct  6    FADKPHAVCIPYPAQGHINPMLKLAKILHHRGFHITFVNTEFNHKRLLKARGPDALNGLP  65

Query  250  SFRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIV  429
            SFRFETIPDGLPP+DVDATQDIPSLC ST  TCL  FK LL +LN +++A NVPPVSCIV
Sbjct  66   SFRFETIPDGLPPTDVDATQDIPSLCESTRKTCLPHFKQLLHKLNDSSSA-NVPPVSCIV  124

Query  430  SDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEGYLTNGYLET  609
            SDG+MSFTL AAEELG+P+VLFW  SA GF+G +HY QL++KGYTPLKDE YLTNGYL+T
Sbjct  125  SDGVMSFTLDAAEELGVPEVLFWTTSACGFLGYVHYRQLMEKGYTPLKDESYLTNGYLDT  184

Query  610  ELDWVKGMKGIRL  648
             +DW+  M+GIRL
Sbjct  185  VIDWIPAMEGIRL  197



>ref|XP_009612691.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Nicotiana 
tomentosiformis]
 dbj|BAD93689.1| glycosyltransferase [Nicotiana tabacum]
Length=485

 Score =   311 bits (797),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 146/200 (73%), Positives = 168/200 (84%), Gaps = 2/200 (1%)
 Frame = +1

Query  49   MGSNNCEFEKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGP  228
            MGS   E   KPHAVC+PYPAQ HIN MLKLAK+LH+KGFHITFVNTEFNHRRL +SRGP
Sbjct  1    MGSIGAEL-TKPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLLKSRGP  59

Query  229  ESLRGLPSFRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNV  408
            +SL+GL SFRFETIPDGLPP + DATQDIPSLC ST  TCL PF+DLLA+LN T   +NV
Sbjct  60   DSLKGLSSFRFETIPDGLPPCEADATQDIPSLCESTTNTCLAPFRDLLAKLNDT-NTSNV  118

Query  409  PPVSCIVSDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEGYL  588
            PPVSCIVSDG+MSFTLAAA+ELG+P+VLFW  SA GF+G MHY ++++KGY PLKD   L
Sbjct  119  PPVSCIVSDGVMSFTLAAAQELGVPEVLFWTTSACGFLGYMHYCKVIEKGYAPLKDASDL  178

Query  589  TNGYLETELDWVKGMKGIRL  648
            TNGYLET LD++ GMK +RL
Sbjct  179  TNGYLETTLDFIPGMKDVRL  198



>ref|XP_004252533.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Solanum 
lycopersicum]
Length=486

 Score =   310 bits (794),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 143/200 (72%), Positives = 167/200 (84%), Gaps = 1/200 (1%)
 Frame = +1

Query  49   MGSNNCEFEKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGP  228
            MGS + E   KPHAVC+PYPAQ HIN MLKLAK+LH+KGFHITFVNTEFNHRRL +SRGP
Sbjct  1    MGSISTEI-NKPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLLKSRGP  59

Query  229  ESLRGLPSFRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNV  408
             SL GL SFRFETIPDGLP  D DATQDIPSLC ST  TCL PF+DLLA+LN T+  +NV
Sbjct  60   HSLDGLSSFRFETIPDGLPTCDADATQDIPSLCKSTTETCLAPFRDLLAKLNGTSNTSNV  119

Query  409  PPVSCIVSDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEGYL  588
            PPV+CIVSDG+MSFTLAAA+E+G+P+VLFW  SA GF+G MHYS +++KGY PLKDE Y 
Sbjct  120  PPVTCIVSDGVMSFTLAAAQEIGVPEVLFWTTSACGFLGYMHYSTVIEKGYAPLKDESYF  179

Query  589  TNGYLETELDWVKGMKGIRL  648
            TNG++E  LD++ GMK +RL
Sbjct  180  TNGHVEKPLDFIPGMKDVRL  199



>ref|XP_009612740.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Nicotiana 
tomentosiformis]
Length=484

 Score =   308 bits (789),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 147/200 (74%), Positives = 164/200 (82%), Gaps = 1/200 (1%)
 Frame = +1

Query  49   MGSNNCEFEKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGP  228
            MGS     + KPHAVC+PYP Q HIN MLKLAK+LH+KGFHITFVNTE+NHRRL +SRGP
Sbjct  1    MGSIKTHGQAKPHAVCIPYPCQGHINPMLKLAKILHHKGFHITFVNTEYNHRRLLKSRGP  60

Query  229  ESLRGLPSFRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNV  408
            +SL G PSFRFETIPDGLPP D DATQDIPSLC ST TTCL PFK+LLA+LN T +++NV
Sbjct  61   DSLNGFPSFRFETIPDGLPPCDADATQDIPSLCESTTTTCLRPFKELLAKLN-TISSSNV  119

Query  409  PPVSCIVSDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEGYL  588
            P VSCIVSDG MSFTL AA++LGIP+VLFW  SA G +G MHY  L DKGY PLKD   L
Sbjct  120  PRVSCIVSDGCMSFTLDAAQDLGIPEVLFWTPSACGLLGYMHYRDLSDKGYFPLKDASNL  179

Query  589  TNGYLETELDWVKGMKGIRL  648
            TNGYLET LDW+ GMKGIRL
Sbjct  180  TNGYLETALDWIPGMKGIRL  199



>emb|CDP01076.1| unnamed protein product [Coffea canephora]
Length=481

 Score =   304 bits (779),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 138/191 (72%), Positives = 164/191 (86%), Gaps = 1/191 (1%)
 Frame = +1

Query  76   KKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPSF  255
            +KPHAVC+PYPAQ HIN MLKLAKLLH+KGFHITFVNTEFNH+RL +SRGP++L GLP F
Sbjct  8    EKPHAVCIPYPAQGHINPMLKLAKLLHHKGFHITFVNTEFNHKRLLKSRGPDALNGLPDF  67

Query  256  RFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIVSD  435
            +F+ IPDGLPPSDVDATQD+PSLC ST T CLGPF+DLLA LN T +++ VPPVSCIVSD
Sbjct  68   QFKAIPDGLPPSDVDATQDVPSLCESTTTHCLGPFRDLLAELNDT-SSSQVPPVSCIVSD  126

Query  436  GIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEGYLTNGYLETEL  615
            G+MSFTL AA ELG+P++LFW  SA GF+G MHY++L++KG TPLKD   L+NGYLE  +
Sbjct  127  GVMSFTLEAAAELGVPEILFWTPSACGFLGYMHYAKLIEKGLTPLKDASCLSNGYLEQAI  186

Query  616  DWVKGMKGIRL  648
            DW+ GMK IRL
Sbjct  187  DWIPGMKDIRL  197



>ref|XP_006363269.1| PREDICTED: UDP-glycosyltransferase 85A3-like [Solanum tuberosum]
Length=485

 Score =   304 bits (778),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 142/190 (75%), Positives = 162/190 (85%), Gaps = 1/190 (1%)
 Frame = +1

Query  79   KPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPSFR  258
            KPHAVC+PYPAQ HIN MLKLAK+ ++KGFHITFVNTE+NHRRL +SRGP+SL+GLPSFR
Sbjct  12   KPHAVCIPYPAQGHINPMLKLAKIFNHKGFHITFVNTEYNHRRLLKSRGPDSLKGLPSFR  71

Query  259  FETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIVSDG  438
            FETIPDGLPPSD D+TQDI SL  ST  TCLGPFK+LLA+LN+T ++ NVPPVSCIVSDG
Sbjct  72   FETIPDGLPPSDADSTQDIVSLGKSTTNTCLGPFKELLAKLNNTCSS-NVPPVSCIVSDG  130

Query  439  IMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEGYLTNGYLETELD  618
             MSFTLAAA+ELGIP++ FW  SA G +G MHY  L +KGY PLKD   LTNGYLET LD
Sbjct  131  CMSFTLAAAQELGIPEIFFWTPSACGLLGYMHYRDLAEKGYFPLKDASDLTNGYLETALD  190

Query  619  WVKGMKGIRL  648
            W+ GMKGIRL
Sbjct  191  WIPGMKGIRL  200



>ref|XP_004237928.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Solanum 
lycopersicum]
Length=482

 Score =   303 bits (777),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 141/190 (74%), Positives = 161/190 (85%), Gaps = 1/190 (1%)
 Frame = +1

Query  79   KPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPSFR  258
            KPHAVC+PYPAQ HIN MLKLAK+L+ KGFHITFVN E+NHRRL +SRGP+SL+GLPSF+
Sbjct  9    KPHAVCIPYPAQGHINPMLKLAKILNYKGFHITFVNNEYNHRRLLKSRGPDSLKGLPSFQ  68

Query  259  FETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIVSDG  438
            FETIPDGLPP D D+TQDIP+LC ST  TCLGPFK+LLA+LN T  ++NVPPVSCI+SDG
Sbjct  69   FETIPDGLPPCDADSTQDIPALCESTTKTCLGPFKELLAKLNDT-CSSNVPPVSCIISDG  127

Query  439  IMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEGYLTNGYLETELD  618
             MSFTLAAA+ELGIP+V FW  SA GF+G MHY +L  KGY PLKD   LTNGYLET LD
Sbjct  128  CMSFTLAAAQELGIPEVFFWTPSACGFLGYMHYHELAKKGYFPLKDASDLTNGYLETALD  187

Query  619  WVKGMKGIRL  648
            W+ GMK IRL
Sbjct  188  WIPGMKDIRL  197



>ref|XP_004252532.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Solanum 
lycopersicum]
Length=484

 Score =   303 bits (777),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 143/200 (72%), Positives = 162/200 (81%), Gaps = 1/200 (1%)
 Frame = +1

Query  49   MGSNNCEFEKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGP  228
            M SNN E   KPHAVCVPYPAQ HIN MLKLAK+LH+KGFHITFVNTEF HRRL +SRGP
Sbjct  1    MSSNNVEI-NKPHAVCVPYPAQGHINPMLKLAKILHHKGFHITFVNTEFIHRRLLKSRGP  59

Query  229  ESLRGLPSFRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNV  408
             SL  L SFRFETIPDGLP  D DATQDIPS+C ST  TCL PF+DLLA+LN T+  +NV
Sbjct  60   HSLECLSSFRFETIPDGLPTCDADATQDIPSVCKSTTETCLAPFRDLLAKLNGTSNTSNV  119

Query  409  PPVSCIVSDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEGYL  588
            PPV+CIVSDGIMSFTLAAA+EL +P+V  W  SA GF+G MHY+ L++KGY PLKD  YL
Sbjct  120  PPVTCIVSDGIMSFTLAAAQELAVPEVQLWTTSACGFLGYMHYTTLIEKGYIPLKDVSYL  179

Query  589  TNGYLETELDWVKGMKGIRL  648
            T+GYLET LD + GMK +RL
Sbjct  180  TDGYLETTLDCIPGMKDVRL  199



>ref|XP_009791953.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Nicotiana 
sylvestris]
Length=484

 Score =   303 bits (776),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 145/200 (73%), Positives = 163/200 (82%), Gaps = 1/200 (1%)
 Frame = +1

Query  49   MGSNNCEFEKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGP  228
            M S     + KPHAVC+PYP Q HIN MLKLAK+LH+KGFHITFVNTE+NHRRL +SRGP
Sbjct  1    MDSIRIHGQDKPHAVCIPYPCQGHINPMLKLAKILHHKGFHITFVNTEYNHRRLLKSRGP  60

Query  229  ESLRGLPSFRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNV  408
            +SL G PSFRFETIPDGLPP D DATQDIPSLC ST TTCLGPFK+LLA+LN T +++NV
Sbjct  61   DSLNGFPSFRFETIPDGLPPCDADATQDIPSLCESTTTTCLGPFKELLAKLN-TTSSSNV  119

Query  409  PPVSCIVSDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEGYL  588
            P VSCIVSDG MSFTL AA++LGIP+VLFW  SA G +G MHY  L +KGY PLKD   L
Sbjct  120  PRVSCIVSDGCMSFTLDAAQDLGIPEVLFWTPSACGSLGYMHYRDLSEKGYFPLKDASDL  179

Query  589  TNGYLETELDWVKGMKGIRL  648
            TNGYLET LDW+  MKGIRL
Sbjct  180  TNGYLETALDWIPSMKGIRL  199



>ref|XP_004237927.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Solanum 
lycopersicum]
Length=488

 Score =   303 bits (776),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 146/200 (73%), Positives = 163/200 (82%), Gaps = 4/200 (2%)
 Frame = +1

Query  49   MGSNNCEFEKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGP  228
            M S N E   KPHAVC+PYPAQ HI+ MLKLAK+L+ KGFHITFVNTE NH+RL +SRGP
Sbjct  1    MCSINAEISDKPHAVCLPYPAQGHISPMLKLAKILNRKGFHITFVNTEHNHKRLLKSRGP  60

Query  229  ESLRGLPSFRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNV  408
            +SL GLPSFRFE IPDGLPP D DATQDI SLC ST TTCLGPFK+LLA+L +    TNV
Sbjct  61   DSLNGLPSFRFEAIPDGLPPCDPDATQDISSLCKSTTTTCLGPFKELLAKLKN----TNV  116

Query  409  PPVSCIVSDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEGYL  588
            P VSCIVSDG MSFTL+AA++LGIP VLFW  SA G +  M+Y  LV+KGYTPLKDE YL
Sbjct  117  PRVSCIVSDGSMSFTLSAAQDLGIPQVLFWTPSACGLLCYMYYRDLVEKGYTPLKDESYL  176

Query  589  TNGYLETELDWVKGMKGIRL  648
            TNGYLET LDW+ GMKGIRL
Sbjct  177  TNGYLETSLDWIPGMKGIRL  196



>gb|KJB59011.1| hypothetical protein B456_009G235700 [Gossypium raimondii]
Length=483

 Score =   302 bits (773),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 139/188 (74%), Positives = 161/188 (86%), Gaps = 0/188 (0%)
 Frame = +1

Query  85   HAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPSFRFE  264
            HAVC+P+PAQ HIN MLKLAK+LH KGF+ITFVNTEFNH+RL +SRGP++L GLPSFRFE
Sbjct  9    HAVCIPFPAQGHINPMLKLAKILHQKGFYITFVNTEFNHKRLLKSRGPDALNGLPSFRFE  68

Query  265  TIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIVSDGIM  444
            TIPDGLPP+DVDATQDIPSLC ST+ TCL  FK LL +LN  A+ + VP VSCIVSDG+M
Sbjct  69   TIPDGLPPTDVDATQDIPSLCDSTSKTCLPHFKQLLRKLNDFASTSKVPHVSCIVSDGVM  128

Query  445  SFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEGYLTNGYLETELDWV  624
            SFTL AAEELGIP+VLFW  SA GF+G +HY QL++KGYTPLKDE YLTNGYL T +DW+
Sbjct  129  SFTLDAAEELGIPEVLFWTTSACGFLGYVHYRQLMEKGYTPLKDESYLTNGYLNTVIDWI  188

Query  625  KGMKGIRL  648
              M+GIRL
Sbjct  189  PTMEGIRL  196



>sp|F8WKW1.1|UGT2_GARJA RecName: Full=7-deoxyloganetin glucosyltransferase; AltName: 
Full=Genipin glucosyltransferase; AltName: Full=UDP-glucose 
glucosyltransferase 2; Short=GjUGT2; AltName: Full=UDP-glycosyltransferase 
85A24 [Gardenia jasminoides]
 dbj|BAK55737.1| UDP-glucose glucosyltransferase [Gardenia jasminoides]
Length=481

 Score =   301 bits (770),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 137/191 (72%), Positives = 163/191 (85%), Gaps = 1/191 (1%)
 Frame = +1

Query  76   KKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPSF  255
            +K HAVC+PYPAQ HIN MLKLAK+LH+KGFHITFVNTEFNH+RL +SRGP++L GLP F
Sbjct  8    EKHHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHKRLLKSRGPDALNGLPDF  67

Query  256  RFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIVSD  435
            +F+TIPDGLPPSDVDATQDIPSLC ST T CL PF++LLA LN   +++ VPPVSCIVSD
Sbjct  68   QFKTIPDGLPPSDVDATQDIPSLCESTTTRCLDPFRNLLAELN-GPSSSQVPPVSCIVSD  126

Query  436  GIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEGYLTNGYLETEL  615
            G+MSFTL AA ELG+P++LFW  SA GF+G MHY++L++KG TPLKD  YL+NGYLE  L
Sbjct  127  GVMSFTLEAAAELGVPEILFWTTSACGFLGYMHYAKLIEKGLTPLKDASYLSNGYLEQSL  186

Query  616  DWVKGMKGIRL  648
            DW+ GMK IRL
Sbjct  187  DWIPGMKDIRL  197



>sp|F8WLS6.1|UGT6_CATRO RecName: Full=7-deoxyloganetin glucosyltransferase; AltName: 
Full=Iridoid 1-O-glucosyltransferase; AltName: Full=UDP-glucose 
glucosyltransferase 6; Short=CrUGT6; AltName: Full=UDP-glycosyltransferase 
85A23 [Catharanthus roseus]
 dbj|BAK55749.1| UDP-glucose iridoid glucosyltransferase [Catharanthus roseus]
Length=487

 Score =   301 bits (770),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 140/201 (70%), Positives = 169/201 (84%), Gaps = 2/201 (1%)
 Frame = +1

Query  49   MGS-NNCEFEKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRG  225
            MGS ++ ++ KKPHAVC+PYPAQ HIN MLKLAKLLH KGFHITFVNTEFNH+RL +SRG
Sbjct  1    MGSLSSSDYSKKPHAVCIPYPAQGHINPMLKLAKLLHYKGFHITFVNTEFNHKRLLKSRG  60

Query  226  PESLRGLPSFRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATN  405
             +SL+GL SF+F+TIPDGLPPSDVDATQDIPSLC ST T CL PFK LL +LN T+++  
Sbjct  61   SDSLKGLHSFQFKTIPDGLPPSDVDATQDIPSLCESTTTHCLVPFKQLLQKLNDTSSS-E  119

Query  406  VPPVSCIVSDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEGY  585
            VPPVSC+VSD +MSFT++AA+EL IP+VLFW  SA G +G MHY+QL+DKG TPLKD  Y
Sbjct  120  VPPVSCVVSDAVMSFTISAAQELDIPEVLFWTPSACGVLGYMHYAQLIDKGLTPLKDASY  179

Query  586  LTNGYLETELDWVKGMKGIRL  648
             +NG+L+  LDW+ GM+GIRL
Sbjct  180  FSNGFLDQVLDWIPGMEGIRL  200



>ref|NP_001277170.1| UDP-glycosyltransferase 85A2-like [Vitis vinifera]
 dbj|BAO51845.1| UDP-glycosyltransferase 85A30 [Vitis vinifera]
Length=484

 Score =   300 bits (768),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 137/190 (72%), Positives = 162/190 (85%), Gaps = 1/190 (1%)
 Frame = +1

Query  79   KPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPSFR  258
            +PHAVCVP+PAQ HIN M+KLAKLLH+KGFHITFVNTEFNH+RL +SRGP SLRGLPSF+
Sbjct  8    RPHAVCVPFPAQGHINPMMKLAKLLHHKGFHITFVNTEFNHQRLLKSRGPNSLRGLPSFQ  67

Query  259  FETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIVSDG  438
            FETI DGLPPSD+DATQD+PSLC ST   CL PF+DLLA+LN T +++ VPPV+CIVSDG
Sbjct  68   FETIADGLPPSDIDATQDVPSLCASTHNDCLAPFRDLLAKLNDT-SSSKVPPVTCIVSDG  126

Query  439  IMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEGYLTNGYLETELD  618
            IMSFTL AAEELGIP+V FW  SA GFMG + Y  L+D+G+ PLKDE  LTNG+L+T +D
Sbjct  127  IMSFTLKAAEELGIPEVFFWTTSACGFMGYVQYRHLIDRGFFPLKDESCLTNGHLDTVVD  186

Query  619  WVKGMKGIRL  648
            W+  MKG+RL
Sbjct  187  WIPAMKGVRL  196



>emb|CDP21827.1| unnamed protein product [Coffea canephora]
Length=405

 Score =   297 bits (760),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 136/191 (71%), Positives = 161/191 (84%), Gaps = 1/191 (1%)
 Frame = +1

Query  76   KKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPSF  255
            +KPHAVC+PYPAQ HIN MLKLAKLLH+KGFHITFVNTEFNH+RL +SRGP++L GLP F
Sbjct  8    EKPHAVCIPYPAQGHINPMLKLAKLLHHKGFHITFVNTEFNHKRLLKSRGPDALNGLPDF  67

Query  256  RFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIVSD  435
            +F+ IPDGLPP+DVDATQD+PSL  ST T CLGPF+DLLA LN   +++ VPPVSCIVSD
Sbjct  68   QFKAIPDGLPPADVDATQDVPSLSESTTTHCLGPFRDLLAELND-PSSSQVPPVSCIVSD  126

Query  436  GIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEGYLTNGYLETEL  615
            G MSFTL AA ELG+P++LFW  SA GF+G MHY++L++KG  PLKD  YL+NGYLE  L
Sbjct  127  GAMSFTLEAAAELGVPEILFWTPSACGFLGYMHYAKLIEKGLIPLKDASYLSNGYLEQAL  186

Query  616  DWVKGMKGIRL  648
            DW+ GMK IRL
Sbjct  187  DWIPGMKDIRL  197



>ref|XP_006363270.1| PREDICTED: UDP-glycosyltransferase 85A3-like [Solanum tuberosum]
Length=482

 Score =   299 bits (766),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 139/190 (73%), Positives = 160/190 (84%), Gaps = 1/190 (1%)
 Frame = +1

Query  79   KPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPSFR  258
            KPHAVC+PYPAQ HIN MLKLAK+L++KGFHITFVN E+NHRRL +SRGP+SL+GLPSF+
Sbjct  9    KPHAVCIPYPAQGHINPMLKLAKILNHKGFHITFVNNEYNHRRLLKSRGPDSLKGLPSFQ  68

Query  259  FETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIVSDG  438
            FETIPDGLPP D D+TQDI +LC ST  TCLGPFK+LLA+LN T  ++NVPPVSCI+SDG
Sbjct  69   FETIPDGLPPCDADSTQDIAALCESTTKTCLGPFKELLAKLNDT-CSSNVPPVSCIISDG  127

Query  439  IMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEGYLTNGYLETELD  618
             MSFTLAAA+ELGIP+V FW  SA G +G MHY +L  KGY PLKD   LTNGYLET LD
Sbjct  128  CMSFTLAAAQELGIPEVFFWTPSACGLLGYMHYHELAKKGYFPLKDASDLTNGYLETALD  187

Query  619  WVKGMKGIRL  648
            W+ GMK IRL
Sbjct  188  WIPGMKDIRL  197



>ref|XP_007042920.1| UDP-glucosyl transferase 85A2 [Theobroma cacao]
 gb|EOX98751.1| UDP-glucosyl transferase 85A2 [Theobroma cacao]
Length=519

 Score =   300 bits (769),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 134/190 (71%), Positives = 162/190 (85%), Gaps = 4/190 (2%)
 Frame = +1

Query  79   KPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPSFR  258
            KPHAVC+PYPAQ H+N MLK+AKLLH KGFHITFVNTE+NH+RL +SRGP +L G+P FR
Sbjct  9    KPHAVCLPYPAQGHVNPMLKVAKLLHFKGFHITFVNTEYNHKRLLKSRGPNALDGVPDFR  68

Query  259  FETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIVSDG  438
            FETIPDGLPP D+DATQDIP+LC ST+  CL PF+ LLA+LN    ++ VPPV+CIVSDG
Sbjct  69   FETIPDGLPPPDIDATQDIPALCDSTSKNCLAPFRQLLAKLN----SSGVPPVTCIVSDG  124

Query  439  IMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEGYLTNGYLETELD  618
            +MSFTL AAEELGIP+VLFW  SA GF+G MHY +L+++G+TPLKDE YLTNGYL+T +D
Sbjct  125  VMSFTLKAAEELGIPEVLFWTTSACGFLGYMHYPRLIERGFTPLKDETYLTNGYLDTVID  184

Query  619  WVKGMKGIRL  648
            W+ GMK IR+
Sbjct  185  WIPGMKNIRI  194



>ref|XP_004237929.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Solanum 
lycopersicum]
Length=482

 Score =   299 bits (765),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 140/190 (74%), Positives = 160/190 (84%), Gaps = 1/190 (1%)
 Frame = +1

Query  79   KPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPSFR  258
            KPHAVC+PYPAQ HIN MLKLAK+L+ KGFHITFVN E+NHRRL +SRGP+SL+GLPSFR
Sbjct  9    KPHAVCIPYPAQGHINPMLKLAKILNYKGFHITFVNNEYNHRRLLKSRGPDSLKGLPSFR  68

Query  259  FETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIVSDG  438
            FETIPDGLPP D D+TQDIP+LC ST  TCLGPFK+LLA+LN T  ++NVP VSCI+SDG
Sbjct  69   FETIPDGLPPCDADSTQDIPALCESTTKTCLGPFKELLAKLNDT-CSSNVPTVSCIISDG  127

Query  439  IMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEGYLTNGYLETELD  618
             MSFTLAAA+ELGIP+V FW  SA G +G +HY +L  KGY PLKD   LTNGYLET LD
Sbjct  128  CMSFTLAAAQELGIPEVFFWTPSACGSLGYLHYHELAKKGYFPLKDVTDLTNGYLETALD  187

Query  619  WVKGMKGIRL  648
            W+ GMKGIRL
Sbjct  188  WIPGMKGIRL  197



>ref|XP_011016634.1| PREDICTED: 7-deoxyloganetin glucosyltransferase [Populus euphratica]
Length=483

 Score =   298 bits (763),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 135/193 (70%), Positives = 163/193 (84%), Gaps = 1/193 (1%)
 Frame = +1

Query  70   FEKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLP  249
            F + PHAVC+PYPAQ HIN MLKLAKLLH++GFHITFVNTE+NH+R+ RSRGP SL GLP
Sbjct  6    FLENPHAVCIPYPAQGHINPMLKLAKLLHHRGFHITFVNTEYNHKRILRSRGPNSLDGLP  65

Query  250  SFRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIV  429
            SF+F+ IPDGLPP+  D TQDIPSLC ST+ TCL PFK+L+  LN T+++ NVPPV+CIV
Sbjct  66   SFQFKAIPDGLPPTSNDVTQDIPSLCESTSKTCLVPFKNLITNLNDTSSS-NVPPVTCIV  124

Query  430  SDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEGYLTNGYLET  609
            SDG+MSFTL AA+ELGIP+VLFW  SA GF+   HY QL++KG TPLKDE YL+NGYL++
Sbjct  125  SDGVMSFTLEAAQELGIPEVLFWTTSACGFLAYAHYHQLIEKGLTPLKDESYLSNGYLDS  184

Query  610  ELDWVKGMKGIRL  648
             +DW+ GMKGIRL
Sbjct  185  VIDWIPGMKGIRL  197



>ref|XP_004299647.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Fragaria 
vesca subsp. vesca]
Length=483

 Score =   297 bits (760),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 137/191 (72%), Positives = 162/191 (85%), Gaps = 3/191 (2%)
 Frame = +1

Query  76   KKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPSF  255
            +KPHAVC+P+PAQ HIN MLKLAKLLH+KGFHITFVNTE+NH+RL +SRGP SL GLPSF
Sbjct  6    EKPHAVCIPFPAQGHINPMLKLAKLLHHKGFHITFVNTEYNHKRLLKSRGPNSLDGLPSF  65

Query  256  RFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIVSD  435
             FETIPDGLPP+D +ATQDI SLCVST T CL  F+DLL++LN   +++N+PPVSCIVSD
Sbjct  66   TFETIPDGLPPTDANATQDILSLCVSTRTKCLPHFRDLLSKLN---SSSNIPPVSCIVSD  122

Query  436  GIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEGYLTNGYLETEL  615
            G+MSFT+ AA+ELGIP+VLFW  SA GFMG M Y  L+D+G  PLKD   LTNGYLETE+
Sbjct  123  GVMSFTVEAAQELGIPEVLFWTTSACGFMGYMQYQNLIDEGLIPLKDASCLTNGYLETEI  182

Query  616  DWVKGMKGIRL  648
            DW+ GM+GIRL
Sbjct  183  DWLPGMRGIRL  193



>ref|XP_008219318.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Prunus mume]
Length=480

 Score =   296 bits (758),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 141/198 (71%), Positives = 164/198 (83%), Gaps = 4/198 (2%)
 Frame = +1

Query  55   SNNCEFEKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPES  234
            S+NC  EK PHAVC+P+PAQ HIN ML+LAKLLH KGFHITFVNTEFNH+RL +SRGP S
Sbjct  2    SSNCLIEK-PHAVCIPFPAQGHINPMLELAKLLHYKGFHITFVNTEFNHKRLLKSRGPNS  60

Query  235  LRGLPSFRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPP  414
            L GLPSFRFETIPDGLPP+D +ATQDIPSLC ST    L  F+DLL++LN   ++T  PP
Sbjct  61   LDGLPSFRFETIPDGLPPTDANATQDIPSLCESTRKHSLPYFRDLLSKLN---SSTGCPP  117

Query  415  VSCIVSDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEGYLTN  594
            VSCIVSDG+MSFTL AA ELGIP+VLFW  SA GF+  +HY +L++KG TPLKD  YLTN
Sbjct  118  VSCIVSDGVMSFTLDAAHELGIPEVLFWTTSACGFLAYVHYHRLIEKGLTPLKDASYLTN  177

Query  595  GYLETELDWVKGMKGIRL  648
            GYLETE+DW+ GM+GIRL
Sbjct  178  GYLETEIDWIPGMRGIRL  195



>gb|AIL51400.1| glycosyltransferase [Actinidia deliciosa]
Length=484

 Score =   296 bits (758),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 136/191 (71%), Positives = 160/191 (84%), Gaps = 1/191 (1%)
 Frame = +1

Query  76   KKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPSF  255
            +KPHAVC+PYPAQ HI  MLKLAKLLH+KGFH+TFVNTEFNH+RL +SRGP+SL GL SF
Sbjct  8    EKPHAVCLPYPAQGHITPMLKLAKLLHSKGFHVTFVNTEFNHKRLLKSRGPDSLTGLSSF  67

Query  256  RFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIVSD  435
            RFETIPDGLP SD+DATQ IPSLC ST   CLGPF+ LL +LN+T  ++ VPPVSC+VSD
Sbjct  68   RFETIPDGLPESDLDATQFIPSLCESTRKNCLGPFRQLLGKLNNT-VSSGVPPVSCVVSD  126

Query  436  GIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEGYLTNGYLETEL  615
            G+MSF+L AAEELGIP VLFW  S  GFM  +HY  L++KGYTPLKD  Y+TNGYL+T +
Sbjct  127  GVMSFSLDAAEELGIPQVLFWTTSVCGFMAYVHYRNLIEKGYTPLKDVSYVTNGYLDTVI  186

Query  616  DWVKGMKGIRL  648
            DW+ GM+GIRL
Sbjct  187  DWIPGMEGIRL  197



>ref|XP_008219317.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Prunus mume]
Length=482

 Score =   295 bits (756),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 141/200 (71%), Positives = 164/200 (82%), Gaps = 5/200 (3%)
 Frame = +1

Query  49   MGSNNCEFEKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGP  228
            MGSN     +KPHAVC+P+PAQ HIN MLKLAKLLH KGFHITFVNTEFNH+RL +SRGP
Sbjct  1    MGSNG--LIEKPHAVCIPFPAQGHINPMLKLAKLLHYKGFHITFVNTEFNHKRLLKSRGP  58

Query  229  ESLRGLPSFRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNV  408
             SL GLPSFRFETIPDGLPP+D +ATQDIPSLC ST    L  F+DLL++LN   ++T  
Sbjct  59   NSLDGLPSFRFETIPDGLPPTDANATQDIPSLCESTRKHSLPYFRDLLSKLN---SSTGC  115

Query  409  PPVSCIVSDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEGYL  588
            PPVSCIVSDG+MSFTL AA ELGIP+VLFW  SA GF+  +HY +L++KG TPLKD  YL
Sbjct  116  PPVSCIVSDGVMSFTLDAAHELGIPEVLFWTTSACGFLAYVHYHRLIEKGLTPLKDANYL  175

Query  589  TNGYLETELDWVKGMKGIRL  648
            TNGYLET++DW+ GM+GIRL
Sbjct  176  TNGYLETQIDWIPGMRGIRL  195



>ref|XP_002285767.1| PREDICTED: 7-deoxyloganetin glucosyltransferase [Vitis vinifera]
Length=476

 Score =   295 bits (755),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 135/191 (71%), Positives = 158/191 (83%), Gaps = 5/191 (3%)
 Frame = +1

Query  76   KKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPSF  255
            +KPHAVC+PYPAQ HIN MLKLAK LH +GFHITFVNTE+NH RL +SRGP+SL+G+PSF
Sbjct  8    EKPHAVCIPYPAQGHINPMLKLAKFLHFRGFHITFVNTEYNHNRLLKSRGPDSLKGIPSF  67

Query  256  RFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIVSD  435
            +F+TIPDGLPPS+VDATQD P+LCVST   CL PF+DLL+ LNH       PPV+CIVSD
Sbjct  68   QFKTIPDGLPPSNVDATQDTPALCVSTTKHCLPPFRDLLSNLNHDG-----PPVTCIVSD  122

Query  436  GIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEGYLTNGYLETEL  615
            G MSFTL AA+ELG+P+VLFW  SA GFMG + Y  L+DKG  PLKDE YLTNGYL+T +
Sbjct  123  GAMSFTLDAAQELGVPEVLFWTTSACGFMGYVQYRNLIDKGLAPLKDESYLTNGYLDTVI  182

Query  616  DWVKGMKGIRL  648
            DW+ GMKGIRL
Sbjct  183  DWIPGMKGIRL  193



>dbj|BAG80547.1| glycosyltransferase [Lycium barbarum]
Length=490

 Score =   295 bits (756),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 140/200 (70%), Positives = 163/200 (82%), Gaps = 1/200 (1%)
 Frame = +1

Query  49   MGSNNCEFEKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGP  228
            M S + E   KPHAVC+PYPAQ HI+ MLKLAK+LH+ GFHITFVNTE NH+RL +SRGP
Sbjct  1    MYSISAEDLDKPHAVCIPYPAQGHISPMLKLAKILHHNGFHITFVNTEHNHKRLLKSRGP  60

Query  229  ESLRGLPSFRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNV  408
            +S++GLPSF+FETIPDGLPP D D TQDI SL  ST  +C GPFK+LL +LN+T+ + NV
Sbjct  61   DSVKGLPSFQFETIPDGLPPCDPDTTQDIFSLSESTTNSCSGPFKELLTKLNNTSLS-NV  119

Query  409  PPVSCIVSDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEGYL  588
            PPVSCIVSDG MSFTLAAA++LGIP V FW  SA G +  MHY  LV+KGYTPLKDE YL
Sbjct  120  PPVSCIVSDGAMSFTLAAAQDLGIPQVFFWTPSACGLLSYMHYRDLVEKGYTPLKDESYL  179

Query  589  TNGYLETELDWVKGMKGIRL  648
            TNGYLET LDW+ GMKG+RL
Sbjct  180  TNGYLETTLDWIPGMKGVRL  199



>ref|XP_010248035.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Nelumbo 
nucifera]
Length=488

 Score =   295 bits (755),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 134/192 (70%), Positives = 162/192 (84%), Gaps = 1/192 (1%)
 Frame = +1

Query  76   KKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPSF  255
            +KPHAVC+PYPAQ HIN MLKLAKLLH KGFH+TFV+TE+N RR+ +SRGP+S++GLP F
Sbjct  8    EKPHAVCIPYPAQGHINPMLKLAKLLHYKGFHVTFVHTEYNLRRMVKSRGPDSIKGLPGF  67

Query  256  RFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIVSD  435
            RFETIPDGLPPSDVDATQDIPSLC ST  TCL PF  LL+RLN ++ + N+P V+CIVSD
Sbjct  68   RFETIPDGLPPSDVDATQDIPSLCDSTRNTCLVPFXSLLSRLNDSSNSDNIPLVTCIVSD  127

Query  436  GIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEGYLTNGYLETEL  615
            G+MSFTL AA+ELGIP+VL WP SA  FM  +HYS L+++G TPL+DE YLTNGYL+T +
Sbjct  128  GVMSFTLDAAQELGIPEVLLWPTSACSFMSFLHYSHLIERGLTPLRDESYLTNGYLDTTI  187

Query  616  DWVKGM-KGIRL  648
            DW+ G+ K IRL
Sbjct  188  DWIPGLIKDIRL  199



>emb|CDP01078.1| unnamed protein product [Coffea canephora]
Length=501

 Score =   295 bits (755),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 140/201 (70%), Positives = 168/201 (84%), Gaps = 3/201 (1%)
 Frame = +1

Query  49   MGSNNCEFEKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGP  228
            MGS +   EKKPHAVC+P+PAQ HIN ML+LAKLLH+KGFHITFVN+EFNH+RL +SRGP
Sbjct  1    MGSISL-LEKKPHAVCIPFPAQGHINPMLELAKLLHHKGFHITFVNSEFNHKRLLKSRGP  59

Query  229  ESLRGLPSFRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNV  408
            +SL GLP F+F+TIPDGLPPSDVDATQDI SLC ST    LGPF++LLARLN T +++NV
Sbjct  60   DSLNGLPDFQFQTIPDGLPPSDVDATQDIASLCESTDKHGLGPFRELLARLNDT-SSSNV  118

Query  409  PPVSCIVSDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEGYL  588
            PPVSCI+SD  MSFTLAAAEELGIP++  W  SA  ++ + H+SQL+DKG TPLKD  YL
Sbjct  119  PPVSCIISDAAMSFTLAAAEELGIPEIYLWTASACSYLAIFHFSQLIDKGITPLKDASYL  178

Query  589  TNGYLETELDW-VKGMKGIRL  648
            TNGYL+T L+W + GM+GIRL
Sbjct  179  TNGYLDTVLEWIIPGMEGIRL  199



>ref|XP_002513938.1| UDP-glucuronosyltransferase, putative [Ricinus communis]
 gb|EEF48521.1| UDP-glucuronosyltransferase, putative [Ricinus communis]
Length=482

 Score =   294 bits (752),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 136/193 (70%), Positives = 161/193 (83%), Gaps = 2/193 (1%)
 Frame = +1

Query  70   FEKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLP  249
            F +K HAVC+PYPAQ HIN MLKLAK L++KGFHITFVN+E+NHRRL +SRGP+SL GL 
Sbjct  6    FLEKSHAVCIPYPAQGHINPMLKLAKFLYHKGFHITFVNSEYNHRRLLKSRGPDSLDGLS  65

Query  250  SFRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIV  429
            SFRFETIPDGLPP+D DATQDIPSLCVST   CL  FK++L++LN T ++  VPPVSCI+
Sbjct  66   SFRFETIPDGLPPTDTDATQDIPSLCVSTKNACLPHFKNVLSKLNDTPSS--VPPVSCII  123

Query  430  SDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEGYLTNGYLET  609
            SDG+MSFTL AA+ELGIP+VLFW  SA GF+  +HY QL+ KGYTPLKDE  LTNGYL+T
Sbjct  124  SDGVMSFTLDAAQELGIPEVLFWTTSACGFLAYLHYHQLIKKGYTPLKDESSLTNGYLDT  183

Query  610  ELDWVKGMKGIRL  648
             +DW+ G K IRL
Sbjct  184  VIDWIPGTKDIRL  196



>ref|XP_012067890.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Jatropha 
curcas]
 gb|KDP41399.1| hypothetical protein JCGZ_15806 [Jatropha curcas]
Length=487

 Score =   294 bits (752),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 135/191 (71%), Positives = 162/191 (85%), Gaps = 1/191 (1%)
 Frame = +1

Query  76   KKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPSF  255
            +KPHAVC+PYPAQ HIN MLKLAKLLH+KGFHITFV+TE+NH+RL RSRG +S+ GLPSF
Sbjct  8    EKPHAVCIPYPAQGHINPMLKLAKLLHHKGFHITFVHTEYNHKRLLRSRGSDSVIGLPSF  67

Query  256  RFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIVSD  435
            +F TIPDGLPP+D D TQDIPSLC ST+  CL PFK+LL+ LN T+++ NVPPVSCIVSD
Sbjct  68   QFRTIPDGLPPTDSDVTQDIPSLCQSTSKYCLAPFKNLLSELNDTSSS-NVPPVSCIVSD  126

Query  436  GIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEGYLTNGYLETEL  615
            G+MSFT+ AA+EL IP VLFW  SA GFMG + Y QL+++G +PLKDE YLTNGYL+T +
Sbjct  127  GVMSFTVDAAQELCIPLVLFWTTSACGFMGYVQYRQLIERGLSPLKDESYLTNGYLDTVI  186

Query  616  DWVKGMKGIRL  648
            DW+ GMK IRL
Sbjct  187  DWIPGMKNIRL  197



>ref|XP_004299648.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Fragaria 
vesca subsp. vesca]
Length=488

 Score =   293 bits (751),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 138/201 (69%), Positives = 161/201 (80%), Gaps = 4/201 (2%)
 Frame = +1

Query  49   MGSNNCEFE-KKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRG  225
            MGSN    E  KPHAVC+PYPAQ HIN MLKLAKLLH+KGFH+TFVN+E+NHRRL  SRG
Sbjct  1    MGSNALMVETNKPHAVCIPYPAQGHINPMLKLAKLLHHKGFHVTFVNSEYNHRRLLNSRG  60

Query  226  PESLRGLPSFRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATN  405
            P +L GLPSF+F+TIPDGLPP+D +ATQDIPSLC ST   CL  F+ LL  +N   +  N
Sbjct  61   PNALDGLPSFQFKTIPDGLPPTDTNATQDIPSLCESTRKYCLPHFRKLLEEVN---SEEN  117

Query  406  VPPVSCIVSDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEGY  585
             PPVSC+VSDG+MSFTL AAEELG+P+VLFW  SA GFM  +HY  L++KGYTPLKD  Y
Sbjct  118  SPPVSCVVSDGVMSFTLDAAEELGVPEVLFWTTSACGFMAYVHYKHLIEKGYTPLKDASY  177

Query  586  LTNGYLETELDWVKGMKGIRL  648
            LTNGYL+T +DW+ GMKGIRL
Sbjct  178  LTNGYLDTVIDWIPGMKGIRL  198



>ref|XP_002285771.1| PREDICTED: 7-deoxyloganetin glucosyltransferase [Vitis vinifera]
Length=476

 Score =   293 bits (750),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 135/191 (71%), Positives = 158/191 (83%), Gaps = 5/191 (3%)
 Frame = +1

Query  76   KKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPSF  255
            +KPHAVC+PYPAQ HIN MLKLAK LH +GFHITFVNTE+NH RL +SRGP+SL+G+PSF
Sbjct  8    EKPHAVCIPYPAQGHINPMLKLAKFLHFRGFHITFVNTEYNHNRLLKSRGPDSLKGIPSF  67

Query  256  RFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIVSD  435
            +F+TIPDGL PS+VDATQDIP+LCVST   CL PF+DLL+ LNH       PPV+CIVSD
Sbjct  68   QFKTIPDGLLPSNVDATQDIPALCVSTRKHCLPPFRDLLSNLNHDG-----PPVTCIVSD  122

Query  436  GIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEGYLTNGYLETEL  615
            G MSFTL AA+ELG+P+VLFW  SA GFMG + Y  L+DKG  PLKDE YLTNGYL+T +
Sbjct  123  GAMSFTLDAAQELGVPEVLFWTTSACGFMGYVQYRNLIDKGLAPLKDESYLTNGYLDTVI  182

Query  616  DWVKGMKGIRL  648
            DW+ GMKGIRL
Sbjct  183  DWIPGMKGIRL  193



>ref|XP_002302305.1| UDP-glucuronosyltransferase family protein [Populus trichocarpa]
 gb|EEE81578.1| UDP-glucuronosyltransferase family protein [Populus trichocarpa]
Length=483

 Score =   293 bits (750),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 134/193 (69%), Positives = 161/193 (83%), Gaps = 1/193 (1%)
 Frame = +1

Query  70   FEKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLP  249
            F + PHAVC+PYPAQ HIN MLKLAKLLH+KGFHITFVNTE+NH+R+ RSRG  SL GLP
Sbjct  6    FLENPHAVCIPYPAQGHINPMLKLAKLLHHKGFHITFVNTEYNHKRILRSRGLNSLDGLP  65

Query  250  SFRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIV  429
            SF+F+ IPDGLPP+  D TQDIPSLC ST+ TC+ PFKDL+  LN T +++NVPPV+CIV
Sbjct  66   SFQFKAIPDGLPPTSNDVTQDIPSLCESTSKTCMVPFKDLITNLNDT-SSSNVPPVTCIV  124

Query  430  SDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEGYLTNGYLET  609
            SDG+MSFTL AA+ELGIP+VLFW  SA GF+   H  QL++KG TPLKDE YL+NGYL++
Sbjct  125  SDGVMSFTLEAAQELGIPEVLFWTTSACGFLAYAHCRQLIEKGLTPLKDESYLSNGYLDS  184

Query  610  ELDWVKGMKGIRL  648
             +DW+ GMKGIRL
Sbjct  185  VIDWIPGMKGIRL  197



>ref|XP_008219313.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Prunus mume]
Length=482

 Score =   292 bits (748),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 140/200 (70%), Positives = 163/200 (82%), Gaps = 5/200 (3%)
 Frame = +1

Query  49   MGSNNCEFEKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGP  228
            MGSN     +KPHAVC+P+PAQ HIN MLKLAKLLH KGF+ITFVNTEFNH+RL +SRGP
Sbjct  1    MGSNG--LIEKPHAVCIPFPAQGHINPMLKLAKLLHYKGFYITFVNTEFNHKRLLKSRGP  58

Query  229  ESLRGLPSFRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNV  408
             SL GLPSFRFETIPDGLPP+D +ATQDIPSLC ST    L  F+DLL++LN   ++T  
Sbjct  59   NSLDGLPSFRFETIPDGLPPTDANATQDIPSLCESTRKHSLPYFRDLLSKLN---SSTGC  115

Query  409  PPVSCIVSDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEGYL  588
            PPVSCIVSDG+MSFTL AA ELGIP+VLFW  SA G +  +HY +L++KG TPLKD  YL
Sbjct  116  PPVSCIVSDGVMSFTLDAAHELGIPEVLFWTTSACGLLAYVHYHRLIEKGLTPLKDASYL  175

Query  589  TNGYLETELDWVKGMKGIRL  648
            TNGYLETE+DW+ GM+GIRL
Sbjct  176  TNGYLETEIDWIPGMRGIRL  195



>ref|XP_011069754.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Sesamum 
indicum]
Length=485

 Score =   292 bits (748),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 137/192 (71%), Positives = 160/192 (83%), Gaps = 2/192 (1%)
 Frame = +1

Query  76   KKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPSF  255
            +KPHAVC+P+PAQ HIN MLKLAKLLH+ GFHITFVNTE+NH+RL +SRGP SL GLPSF
Sbjct  8    EKPHAVCIPFPAQGHINPMLKLAKLLHHNGFHITFVNTEYNHQRLLKSRGPSSLEGLPSF  67

Query  256  RFETIPDGLPPSD-VDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIVS  432
            RFETIPDGLPPSD  DATQDIPSLC ST TTCL PF+DLLA+LN T  ++NVPPVSCIVS
Sbjct  68   RFETIPDGLPPSDAADATQDIPSLCQSTTTTCLAPFRDLLAKLNDT-GSSNVPPVSCIVS  126

Query  433  DGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEGYLTNGYLETE  612
            DG+MSFT+ AAEELGIP++ FW  SA GF     Y +L++KGY+PL D  +LTNGYL+T 
Sbjct  127  DGVMSFTVEAAEELGIPEIFFWTPSACGFFAYTQYEKLIEKGYSPLPDASFLTNGYLDTI  186

Query  613  LDWVKGMKGIRL  648
            +D +  MKGIRL
Sbjct  187  IDEIPSMKGIRL  198



>ref|XP_010060016.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Eucalyptus 
grandis]
Length=480

 Score =   292 bits (747),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 132/191 (69%), Positives = 156/191 (82%), Gaps = 0/191 (0%)
 Frame = +1

Query  76   KKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPSF  255
            +KPHAVC+P+PAQSHINAML LAKLLH++GFH+TFVNTE+NH RL RSRGP SL GLPSF
Sbjct  3    QKPHAVCIPFPAQSHINAMLNLAKLLHHRGFHVTFVNTEYNHNRLLRSRGPSSLDGLPSF  62

Query  256  RFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIVSD  435
            RF TIPDGLPPSD DATQD+P+LC ST   CL  F+DLL RLN  +A +  PPVSC+VSD
Sbjct  63   RFRTIPDGLPPSDDDATQDVPALCQSTQKCCLPYFQDLLKRLNEESATSGSPPVSCVVSD  122

Query  436  GIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEGYLTNGYLETEL  615
            G  +FTL AAE +G+P+VLFWPISA  FMG +H+  LVD+G  PLKD  YLTNGYL+T +
Sbjct  123  GWTTFTLDAAEAVGVPEVLFWPISACAFMGFLHFRSLVDEGRAPLKDASYLTNGYLDTII  182

Query  616  DWVKGMKGIRL  648
            DW+ GM+ IRL
Sbjct  183  DWIPGMRNIRL  193



>ref|XP_009592743.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Nicotiana 
tomentosiformis]
Length=483

 Score =   292 bits (747),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 138/200 (69%), Positives = 161/200 (81%), Gaps = 2/200 (1%)
 Frame = +1

Query  49   MGSNNCEFEKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGP  228
            M SN  + +  PHA+CVP P Q HIN MLKLAK LH +GFHITFVNTE+NHRRL +SRGP
Sbjct  1    MASNYAQLDV-PHAICVPAPTQGHINPMLKLAKFLHFRGFHITFVNTEYNHRRLLKSRGP  59

Query  229  ESLRGLPSFRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNV  408
            +SL+GL SFRFETIPDGLPPSD D+TQDI SL  S  TT L PFK+LLA+LNHT +++NV
Sbjct  60   DSLKGLHSFRFETIPDGLPPSDADSTQDIASLSKSLTTTGLVPFKELLAKLNHT-SSSNV  118

Query  409  PPVSCIVSDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEGYL  588
            PP SCI+SDG+MSFTLAAA++LGIP V FW + A G +G MHY  L++K YTPLKDE YL
Sbjct  119  PPASCIISDGVMSFTLAAAQDLGIPLVFFWTLCACGLLGYMHYCNLIEKDYTPLKDESYL  178

Query  589  TNGYLETELDWVKGMKGIRL  648
            TNGYLE  LDW+ GMK IRL
Sbjct  179  TNGYLEKTLDWIPGMKDIRL  198



>ref|XP_010534080.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Tarenaya hassleriana]
Length=486

 Score =   291 bits (746),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 136/191 (71%), Positives = 155/191 (81%), Gaps = 2/191 (1%)
 Frame = +1

Query  76   KKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPSF  255
            +KPHAVCVPYPAQ HIN MLK+AKLLH +GFH+TFVNTEFNHRRL RSRGP +L  LPSF
Sbjct  10   QKPHAVCVPYPAQGHINPMLKVAKLLHARGFHVTFVNTEFNHRRLLRSRGPHALDKLPSF  69

Query  256  RFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIVSD  435
            RFETIPDGLP ++VDATQDIP+LC ST   CL PFK+LL R+N   A   +PPVSC+VSD
Sbjct  70   RFETIPDGLPETEVDATQDIPALCDSTRKNCLAPFKELLRRIN--LAGGEIPPVSCVVSD  127

Query  436  GIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEGYLTNGYLETEL  615
            G MSFTL AAEELG+P+VLFW  SA GF   +HY QLV+KG  PLKDE YLTNGYL+TE+
Sbjct  128  GCMSFTLDAAEELGVPEVLFWTTSACGFWAYLHYYQLVEKGLVPLKDESYLTNGYLDTEI  187

Query  616  DWVKGMKGIRL  648
            DWV  +K  RL
Sbjct  188  DWVPSLKNFRL  198



>ref|XP_002285778.2| PREDICTED: 7-deoxyloganetin glucosyltransferase isoform X1 [Vitis 
vinifera]
Length=492

 Score =   291 bits (746),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 136/191 (71%), Positives = 154/191 (81%), Gaps = 5/191 (3%)
 Frame = +1

Query  76   KKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPSF  255
            +KPHAVC+PYPAQ HIN MLKLAKLLH +GF ITFVNTEFNH RL  ++GP  L GLP+F
Sbjct  24   EKPHAVCIPYPAQGHINPMLKLAKLLHCRGFRITFVNTEFNHTRLLNAQGPNCLSGLPTF  83

Query  256  RFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIVSD  435
            +FETIPDGLPPSDVDATQDIPSLCVST   CL PF+ LLA+LNH       PPV+CI SD
Sbjct  84   QFETIPDGLPPSDVDATQDIPSLCVSTKKNCLAPFRRLLAKLNHDG-----PPVTCIFSD  138

Query  436  GIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEGYLTNGYLETEL  615
             IMSFTL AA+ELGIPD+L W  SA GFM  + Y  L+DKG+TPLKDE YLTNGYL+T +
Sbjct  139  AIMSFTLDAAQELGIPDLLLWTASACGFMAYVQYRSLIDKGFTPLKDESYLTNGYLDTVV  198

Query  616  DWVKGMKGIRL  648
            DW+ GMKGIRL
Sbjct  199  DWIPGMKGIRL  209



>gb|AID16086.1| flavonol-3-O-glucoside L-rhamnosyltransferase, partial [Morus 
alba]
Length=447

 Score =   290 bits (741),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 138/200 (69%), Positives = 160/200 (80%), Gaps = 5/200 (3%)
 Frame = +1

Query  49   MGSNNCEFEKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGP  228
            MGS    F +KPHAVC+P+PAQ H+N MLKLAKLLH+KGFHITFVNTEFNH+RL +SRG 
Sbjct  1    MGS--LSFLEKPHAVCIPFPAQGHVNPMLKLAKLLHSKGFHITFVNTEFNHKRLLKSRGA  58

Query  229  ESLRGLPSFRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNV  408
             +L GLPSFRFE IPDGLPP+D DATQ IP++C ST    L PF+DLL +LN   ++  V
Sbjct  59   HALDGLPSFRFEAIPDGLPPTDADATQSIPAICESTPKHSLAPFRDLLLKLN---SSPEV  115

Query  409  PPVSCIVSDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEGYL  588
            PPVSC+VSDG MSFTL AAEELGIP+VLFW  SA GF+G +HY  LV+KGYTPLKDE YL
Sbjct  116  PPVSCVVSDGAMSFTLDAAEELGIPEVLFWTTSACGFLGYLHYRALVEKGYTPLKDESYL  175

Query  589  TNGYLETELDWVKGMKGIRL  648
            TN YL T +DW+ GMK IRL
Sbjct  176  TNEYLNTVIDWIPGMKDIRL  195



>ref|XP_004237926.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Solanum 
lycopersicum]
Length=491

 Score =   291 bits (744),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 140/201 (70%), Positives = 160/201 (80%), Gaps = 3/201 (1%)
 Frame = +1

Query  49   MGSNNCEFEKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGP  228
            M S   E +K PHAVCVPYPAQ HIN MLKLAK+L++KGFHITFVNTE+NHRRL +SRGP
Sbjct  1    MASTGAELDK-PHAVCVPYPAQGHINPMLKLAKILNHKGFHITFVNTEYNHRRLLKSRGP  59

Query  229  ESLRGLPSFRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNV  408
               + LPSFRFE IPDGLPP D DATQDI +LC ST TTCLGPF++LLA+LN+T  ++ V
Sbjct  60   HGFKNLPSFRFEAIPDGLPPCDADATQDIIALCKSTDTTCLGPFRELLAKLNNT-CSSKV  118

Query  409  PPVSCIVSDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEGYL  588
            PPVSCIVSDG  S+TL AA+ELGIP V FW  +A G +  MHY  LVDKGY PLKDE YL
Sbjct  119  PPVSCIVSDGSNSYTLTAAQELGIPQVHFWTFAACGTLSYMHYCNLVDKGYIPLKDESYL  178

Query  589  TNGYLE-TELDWVKGMKGIRL  648
            TNGYLE T LDW+ GMK +RL
Sbjct  179  TNGYLEKTTLDWIPGMKDVRL  199



>ref|XP_006363268.1| PREDICTED: UDP-glycosyltransferase 85A1-like [Solanum tuberosum]
Length=492

 Score =   290 bits (743),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 139/201 (69%), Positives = 161/201 (80%), Gaps = 2/201 (1%)
 Frame = +1

Query  49   MGSNNCEFEKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGP  228
            M S N E   KPHAVC+PYPAQ HI+ MLKLAK+L++KGFHITFVNTE N +RL +SRGP
Sbjct  1    MCSINAENSDKPHAVCLPYPAQGHISPMLKLAKILNHKGFHITFVNTEHNQKRLLKSRGP  60

Query  229  ESLRGLPSFRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNV  408
            + L+ LPSFRFE IPDGLPP D DATQDI +LC ST TTCLGPF++LLA+LN+T  ++ V
Sbjct  61   DGLKNLPSFRFEAIPDGLPPCDADATQDIIALCKSTDTTCLGPFRELLAKLNNT-CSSKV  119

Query  409  PPVSCIVSDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEGYL  588
            PPVSCIVSDG +SFTL AA+ELGIP V FW  +A G +  MHY  LVDKGY PLKDE YL
Sbjct  120  PPVSCIVSDGSISFTLTAAQELGIPQVFFWTFAACGTLSYMHYCNLVDKGYIPLKDESYL  179

Query  589  TNGYLE-TELDWVKGMKGIRL  648
            TNGYLE T LDW+ GMK +RL
Sbjct  180  TNGYLEKTTLDWIPGMKDVRL  200



>ref|XP_007224069.1| hypothetical protein PRUPE_ppa015357mg [Prunus persica]
 gb|EMJ25268.1| hypothetical protein PRUPE_ppa015357mg [Prunus persica]
Length=482

 Score =   290 bits (742),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 139/200 (70%), Positives = 162/200 (81%), Gaps = 5/200 (3%)
 Frame = +1

Query  49   MGSNNCEFEKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGP  228
            MGSN     +KPHAVC+P+PAQ HIN MLKLAKLLH KGFHITFVNTEFNH+RL +SRGP
Sbjct  1    MGSNG--LIEKPHAVCIPFPAQGHINPMLKLAKLLHYKGFHITFVNTEFNHKRLLKSRGP  58

Query  229  ESLRGLPSFRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNV  408
             SL GLPSFRFETIPDGLP +D +ATQDIPSLC ST    L  F+DLL++LN   ++T  
Sbjct  59   NSLDGLPSFRFETIPDGLPLTDANATQDIPSLCESTRKHSLPYFRDLLSKLN---SSTGC  115

Query  409  PPVSCIVSDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEGYL  588
            PPVSCIVSDG+MSFTL AA ELGIP+VLFW  SA GF+  +HY +L++ G TPLKD  YL
Sbjct  116  PPVSCIVSDGVMSFTLDAAHELGIPEVLFWTTSACGFLAYVHYHRLIENGLTPLKDASYL  175

Query  589  TNGYLETELDWVKGMKGIRL  648
            TNGYLET++DW+ GM+GIRL
Sbjct  176  TNGYLETQIDWIPGMRGIRL  195



>ref|XP_010060020.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Eucalyptus 
grandis]
Length=486

 Score =   290 bits (742),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 138/201 (69%), Positives = 159/201 (79%), Gaps = 3/201 (1%)
 Frame = +1

Query  49   MGSNNCEFEKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGP  228
            MGS   +  +KPHAVC+PYPAQ HIN ML LAKLLH++GFH+TFVNTE+NH RL RSRGP
Sbjct  1    MGS--IDMIQKPHAVCIPYPAQGHINPMLNLAKLLHHRGFHVTFVNTEYNHSRLLRSRGP  58

Query  229  ESLRGLPSFRFETIPDGLPPSDV-DATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATN  405
             SL GLPSFRF TIPDGLPPSDV DATQDIP+LC ST+  CL  F+DLL RLN  +  + 
Sbjct  59   SSLDGLPSFRFRTIPDGLPPSDVADATQDIPALCQSTSKFCLPYFRDLLERLNEESTTSG  118

Query  406  VPPVSCIVSDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEGY  585
             PPVSC+VSDG MSFTL AAE +G+P+VLFW  SA GFMG + Y  LVDKG TPLKD  Y
Sbjct  119  SPPVSCVVSDGAMSFTLDAAEAIGVPEVLFWTTSACGFMGYVQYRNLVDKGLTPLKDASY  178

Query  586  LTNGYLETELDWVKGMKGIRL  648
            LTNGYL+T +DW+ GM+ IRL
Sbjct  179  LTNGYLDTIIDWIPGMRNIRL  199



>ref|XP_007222804.1| hypothetical protein PRUPE_ppa005043mg [Prunus persica]
 gb|EMJ24003.1| hypothetical protein PRUPE_ppa005043mg [Prunus persica]
Length=480

 Score =   290 bits (742),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 137/198 (69%), Positives = 162/198 (82%), Gaps = 4/198 (2%)
 Frame = +1

Query  55   SNNCEFEKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPES  234
            S+NC  EK PHAVC+P+PAQ HIN MLKLAKLLH KGFHITFVNTEFNH+RL +SRGP S
Sbjct  2    SSNCLIEK-PHAVCIPFPAQGHINPMLKLAKLLHYKGFHITFVNTEFNHKRLLKSRGPNS  60

Query  235  LRGLPSFRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPP  414
            L G PSFRFETIPDGLPP+D +ATQDIPSLC ST    L  F+DLL++LN   ++ + PP
Sbjct  61   LDGFPSFRFETIPDGLPPTDANATQDIPSLCDSTRKRGLPYFRDLLSKLN---SSPDCPP  117

Query  415  VSCIVSDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEGYLTN  594
            VSC+VSDG M FTL AA+ELG+P+VLFW  SA GF+  +HY +L++KG TPLKD  YLTN
Sbjct  118  VSCVVSDGAMGFTLDAAQELGLPEVLFWTTSACGFLAYVHYHRLIEKGLTPLKDASYLTN  177

Query  595  GYLETELDWVKGMKGIRL  648
            GYLETE+DW+ GM+GIRL
Sbjct  178  GYLETEIDWIPGMRGIRL  195



>emb|CAN65645.1| hypothetical protein VITISV_012510 [Vitis vinifera]
Length=582

 Score =   292 bits (748),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 136/191 (71%), Positives = 154/191 (81%), Gaps = 5/191 (3%)
 Frame = +1

Query  76   KKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPSF  255
            +KPHAVC+PYPAQ HIN MLKLAKLLH +GF ITFVNTEFNH RL  ++GP  L GLP+F
Sbjct  4    EKPHAVCIPYPAQGHINPMLKLAKLLHCRGFRITFVNTEFNHTRLLNAQGPNCLSGLPTF  63

Query  256  RFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIVSD  435
            +FETIPDGLPPSDVDATQDIPSLCVST   CL PF+ LLA+LNH       PPV+CI SD
Sbjct  64   QFETIPDGLPPSDVDATQDIPSLCVSTKKNCLAPFRRLLAKLNHDG-----PPVTCIFSD  118

Query  436  GIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEGYLTNGYLETEL  615
             IMSFTL AA+ELGIPD+L W  SA GFM  + Y  L+DKG+TPLKDE YLTNGYL+T +
Sbjct  119  AIMSFTLDAAQELGIPDLLLWTASACGFMAYVQYRSLIDKGFTPLKDESYLTNGYLDTVV  178

Query  616  DWVKGMKGIRL  648
            DW+ GMKGIRL
Sbjct  179  DWIPGMKGIRL  189



>ref|XP_012067889.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Jatropha 
curcas]
 gb|KDP41397.1| hypothetical protein JCGZ_15804 [Jatropha curcas]
Length=487

 Score =   289 bits (740),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 134/191 (70%), Positives = 160/191 (84%), Gaps = 1/191 (1%)
 Frame = +1

Query  76   KKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPSF  255
            +KPHAVC+ YPAQ HIN MLKLAKLLH+KGFHITFV+TE+NH+RL RSRG +S+ GLPSF
Sbjct  8    EKPHAVCISYPAQGHINPMLKLAKLLHHKGFHITFVHTEYNHKRLLRSRGSDSVIGLPSF  67

Query  256  RFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIVSD  435
            +F TIPDGLPP+D D TQDIPSLC ST+  CL PFK+LL+ LN T+++ NVPPVSCIVSD
Sbjct  68   QFRTIPDGLPPTDSDVTQDIPSLCQSTSKYCLAPFKNLLSELNDTSSS-NVPPVSCIVSD  126

Query  436  GIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEGYLTNGYLETEL  615
            G+MSFT+ AA+EL IP VLFW  SA GFMG + Y QL+++G +PLKDE YLTNGYL+T  
Sbjct  127  GVMSFTVDAAQELCIPLVLFWTTSACGFMGYVQYRQLIERGLSPLKDESYLTNGYLDTVK  186

Query  616  DWVKGMKGIRL  648
            DW+ GMK IRL
Sbjct  187  DWIPGMKNIRL  197



>ref|XP_008466222.1| PREDICTED: UDP-glycosyltransferase 85A2 [Cucumis melo]
Length=487

 Score =   289 bits (740),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 133/193 (69%), Positives = 162/193 (84%), Gaps = 4/193 (2%)
 Frame = +1

Query  73   EKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPS  252
            E++PHAVC+PYPAQ HIN MLKLAKLLH+ GFHITFVNT+FNHRRL +SRGP++L GL S
Sbjct  8    EQQPHAVCIPYPAQGHINPMLKLAKLLHSFGFHITFVNTDFNHRRLLKSRGPKALDGLSS  67

Query  253  FRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIVS  432
            FRFE+IPDGLPP+DVDATQDIPSLC ST   CL PFK+L+++LN      NVP VSCIVS
Sbjct  68   FRFESIPDGLPPTDVDATQDIPSLCQSTRQFCLQPFKELVSKLN---CDPNVPQVSCIVS  124

Query  433  DGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEGYLTNG-YLET  609
            DG+MSFT+ AA+ELG+P VLFW  SA GF+G +HY QLV++GYTP KDE YL+N  YL+T
Sbjct  125  DGVMSFTIDAADELGVPVVLFWTTSACGFLGYLHYQQLVERGYTPFKDESYLSNKQYLDT  184

Query  610  ELDWVKGMKGIRL  648
            ++DW+ GMK +R+
Sbjct  185  KIDWIPGMKDVRI  197



>emb|CBI19181.3| unnamed protein product [Vitis vinifera]
Length=654

 Score =   293 bits (751),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 135/191 (71%), Positives = 158/191 (83%), Gaps = 5/191 (3%)
 Frame = +1

Query  76   KKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPSF  255
            +KPHAVC+PYPAQ HIN MLKLAK LH +GFHITFVNTE+NH RL +SRGP+SL+G+PSF
Sbjct  8    EKPHAVCIPYPAQGHINPMLKLAKFLHFRGFHITFVNTEYNHNRLLKSRGPDSLKGIPSF  67

Query  256  RFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIVSD  435
            +F+TIPDGLPPS+VDATQD P+LCVST   CL PF+DLL+ LNH       PPV+CIVSD
Sbjct  68   QFKTIPDGLPPSNVDATQDTPALCVSTTKHCLPPFRDLLSNLNHDG-----PPVTCIVSD  122

Query  436  GIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEGYLTNGYLETEL  615
            G MSFTL AA+ELG+P+VLFW  SA GFMG + Y  L+DKG  PLKDE YLTNGYL+T +
Sbjct  123  GAMSFTLDAAQELGVPEVLFWTTSACGFMGYVQYRNLIDKGLAPLKDESYLTNGYLDTVI  182

Query  616  DWVKGMKGIRL  648
            DW+ GMKGIRL
Sbjct  183  DWIPGMKGIRL  193


 Score =   249 bits (637),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 125/206 (61%), Positives = 145/206 (70%), Gaps = 30/206 (15%)
 Frame = +1

Query  31   RERKREMGSNNCEFEKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRL  210
            RER   + S      +KPHAVC+PYPAQ HIN MLKLAK LH +GFHITF          
Sbjct  387  RERMGSLAS-----AEKPHAVCIPYPAQGHINPMLKLAKFLHFRGFHITF----------  431

Query  211  QRSRGPESLRGLPSFRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHT  390
                      G+PSF+F+TIPDGL PS+VDATQDIP+LCVST   CL PF+DLL+ LNH 
Sbjct  432  ----------GIPSFQFKTIPDGLLPSNVDATQDIPALCVSTRKHCLPPFRDLLSNLNHD  481

Query  391  AAATNVPPVSCIVSDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPL  570
                  PPV+CIVSDG MSFTL AA+ELG+P+VLFW  SA GFMG + Y  L+DKG  PL
Sbjct  482  G-----PPVTCIVSDGAMSFTLDAAQELGVPEVLFWTTSACGFMGYVQYRNLIDKGLAPL  536

Query  571  KDEGYLTNGYLETELDWVKGMKGIRL  648
            KDE YLTNGYL+T +DW+ GMKGIRL
Sbjct  537  KDESYLTNGYLDTVIDWIPGMKGIRL  562



>ref|XP_010060023.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Eucalyptus 
grandis]
 gb|KCW66547.1| hypothetical protein EUGRSUZ_F00343 [Eucalyptus grandis]
Length=486

 Score =   288 bits (738),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 133/192 (69%), Positives = 155/192 (81%), Gaps = 1/192 (1%)
 Frame = +1

Query  76   KKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPSF  255
            +KPHAVC+PYPAQ HIN ML LAKLLH++GFH+TFVNTE+NH RL RSRGP SL GLPSF
Sbjct  8    QKPHAVCIPYPAQGHINPMLNLAKLLHHRGFHVTFVNTEYNHSRLLRSRGPSSLDGLPSF  67

Query  256  RFETIPDGLPPSDV-DATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIVS  432
            RF TIPDGLPPSDV DATQDIP+LC ST+  CL  F+DLL RLN  +     PPVSC+VS
Sbjct  68   RFRTIPDGLPPSDVADATQDIPALCQSTSKFCLPYFRDLLERLNEESTTLGSPPVSCVVS  127

Query  433  DGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEGYLTNGYLETE  612
            DG+MSFTL AAE +G+P+VLFW  SA GFMG + Y  L+DKG TPLKD  YLTNGYL+T 
Sbjct  128  DGVMSFTLDAAEAIGVPEVLFWTTSACGFMGYVQYRNLIDKGLTPLKDASYLTNGYLDTI  187

Query  613  LDWVKGMKGIRL  648
            +DW+ GM+ I+L
Sbjct  188  IDWIPGMRNIQL  199



>gb|KCW66541.1| hypothetical protein EUGRSUZ_F00338, partial [Eucalyptus grandis]
Length=478

 Score =   288 bits (737),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 136/201 (68%), Positives = 159/201 (79%), Gaps = 3/201 (1%)
 Frame = +1

Query  49   MGSNNCEFEKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGP  228
            MGS   +  +KPHAVC+P PAQ HIN ML LAKLLH++GFH+TFVNTE+NH RL RSRGP
Sbjct  1    MGS--IDMIQKPHAVCIPAPAQGHINPMLNLAKLLHHRGFHVTFVNTEYNHSRLLRSRGP  58

Query  229  ESLRGLPSFRFETIPDGLPPSDV-DATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATN  405
             SL GLPSFRF TIPDGLPPSD  D TQDIP+LC ST+  CL  F+DLL RLN  +AA+ 
Sbjct  59   SSLDGLPSFRFRTIPDGLPPSDAADVTQDIPALCQSTSKLCLPYFRDLLQRLNEESAASG  118

Query  406  VPPVSCIVSDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEGY  585
             PPVSC+VSDG+M+FTL AAE +G+P+VLFW  SA GFMG + Y  LVDKG TPLKD  Y
Sbjct  119  SPPVSCVVSDGMMTFTLDAAEAIGVPEVLFWTASACGFMGYVQYRSLVDKGLTPLKDASY  178

Query  586  LTNGYLETELDWVKGMKGIRL  648
            LTNGYL+T +DW+ GM+ IRL
Sbjct  179  LTNGYLDTTIDWIPGMRNIRL  199



>ref|XP_010040274.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Eucalyptus 
grandis]
Length=486

 Score =   288 bits (737),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 135/201 (67%), Positives = 159/201 (79%), Gaps = 3/201 (1%)
 Frame = +1

Query  49   MGSNNCEFEKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGP  228
            MGS   +  +KPHA+C+PYPAQ HIN ML LAKLLH++GFH+TFVNTE+NH RL RSRGP
Sbjct  1    MGS--IDMIQKPHALCIPYPAQGHINPMLNLAKLLHHRGFHVTFVNTEYNHSRLLRSRGP  58

Query  229  ESLRGLPSFRFETIPDGLPPSDV-DATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATN  405
             SL GLPSFRF TIPDGLPPSDV DATQDIP+LC ST+  CL  F+DLL RLN  +  + 
Sbjct  59   SSLDGLPSFRFRTIPDGLPPSDVADATQDIPALCQSTSKFCLPYFRDLLERLNEESTTSG  118

Query  406  VPPVSCIVSDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEGY  585
             PPVSC+VSDG+MSFTL AAE +G+P+VLFW  SA GFMG + Y  L+DKG TPLKD  Y
Sbjct  119  SPPVSCVVSDGVMSFTLDAAEAIGVPEVLFWTTSACGFMGYVQYRNLIDKGLTPLKDASY  178

Query  586  LTNGYLETELDWVKGMKGIRL  648
            LTN YL+T +DW+ GM+ IRL
Sbjct  179  LTNAYLDTIIDWIPGMRNIRL  199



>emb|CDO97426.1| unnamed protein product [Coffea canephora]
Length=487

 Score =   288 bits (737),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 136/191 (71%), Positives = 157/191 (82%), Gaps = 3/191 (2%)
 Frame = +1

Query  79   KPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPSFR  258
            KPHAVCVPYPAQ HIN MLKLAKLLH+KGFHITFVNTE+NH RL +SRGP SL GLP FR
Sbjct  10   KPHAVCVPYPAQGHINPMLKLAKLLHHKGFHITFVNTEYNHNRLLKSRGPNSLDGLPDFR  69

Query  259  FETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIVSDG  438
            FETIPDGLPP+D D+TQDIPSLC ST+ TCL PF  LL+RLN+  AA +VPPV+CIVSDG
Sbjct  70   FETIPDGLPPNDADSTQDIPSLCDSTSKTCLAPFSSLLSRLNN--AAPDVPPVTCIVSDG  127

Query  439  IMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEGYLTNGYLETELD  618
             MSFT+ AA + G+P+ LFW  SA G +G   YS LV++GYTPLKD  Y+TNGYLET+LD
Sbjct  128  CMSFTVEAAHQFGLPEALFWTPSACGLLGYTQYSHLVERGYTPLKDMSYVTNGYLETKLD  187

Query  619  WVKGMKG-IRL  648
            W+ GM+  IRL
Sbjct  188  WIPGMRNDIRL  198



>ref|XP_010060017.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Eucalyptus 
grandis]
Length=486

 Score =   288 bits (737),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 136/201 (68%), Positives = 159/201 (79%), Gaps = 3/201 (1%)
 Frame = +1

Query  49   MGSNNCEFEKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGP  228
            MGS   +  +KPHAVC+P PAQ HIN ML LAKLLH++GFH+TFVNTE+NH RL RSRGP
Sbjct  1    MGS--IDMIQKPHAVCIPAPAQGHINPMLNLAKLLHHRGFHVTFVNTEYNHSRLLRSRGP  58

Query  229  ESLRGLPSFRFETIPDGLPPSDV-DATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATN  405
             SL GLPSFRF TIPDGLPPSD  D TQDIP+LC ST+  CL  F+DLL RLN  +AA+ 
Sbjct  59   SSLDGLPSFRFRTIPDGLPPSDAADVTQDIPALCQSTSKLCLPYFRDLLQRLNEESAASG  118

Query  406  VPPVSCIVSDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEGY  585
             PPVSC+VSDG+M+FTL AAE +G+P+VLFW  SA GFMG + Y  LVDKG TPLKD  Y
Sbjct  119  SPPVSCVVSDGMMTFTLDAAEAIGVPEVLFWTASACGFMGYVQYRSLVDKGLTPLKDASY  178

Query  586  LTNGYLETELDWVKGMKGIRL  648
            LTNGYL+T +DW+ GM+ IRL
Sbjct  179  LTNGYLDTTIDWIPGMRNIRL  199



>dbj|BAO51844.1| UDP-glycosyltransferase 85A28 [Vitis vinifera]
Length=473

 Score =   287 bits (735),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 133/191 (70%), Positives = 154/191 (81%), Gaps = 5/191 (3%)
 Frame = +1

Query  76   KKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPSF  255
            +KPHAVC+PYPAQ HIN MLKLAKLLH +GF ITFVNTEFNH RL +++GP SL GLP+F
Sbjct  5    EKPHAVCIPYPAQGHINPMLKLAKLLHFRGFRITFVNTEFNHTRLLKAQGPNSLNGLPTF  64

Query  256  RFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIVSD  435
            +FETIPDGLPPS+VDATQDIPSLC ST   CL PF+ LLA+LN        PPV+CI SD
Sbjct  65   QFETIPDGLPPSNVDATQDIPSLCASTKKNCLAPFRRLLAKLNDRG-----PPVTCIFSD  119

Query  436  GIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEGYLTNGYLETEL  615
             +MSFTL AA+ELGIPD+L W  SA GFM  + Y  L+DKG+TPLKDE YLTNGYL+T +
Sbjct  120  AVMSFTLDAAQELGIPDLLLWTASACGFMAYVQYRSLIDKGFTPLKDESYLTNGYLDTVV  179

Query  616  DWVKGMKGIRL  648
            DW+ GMKGIRL
Sbjct  180  DWIPGMKGIRL  190



>ref|XP_002513937.1| UDP-glucuronosyltransferase, putative [Ricinus communis]
 gb|EEF48520.1| UDP-glucuronosyltransferase, putative [Ricinus communis]
Length=492

 Score =   288 bits (736),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 135/209 (65%), Positives = 169/209 (81%), Gaps = 3/209 (1%)
 Frame = +1

Query  25   RSRERKREMGSNNCEFEKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHR  204
            ++++++R+MGS  C     PHAVCVP+PAQ HIN MLKLAKLLH KGFHITFVNTE+NH+
Sbjct  2    QAKQKERQMGSL-CPENLPPHAVCVPFPAQGHINPMLKLAKLLHQKGFHITFVNTEYNHQ  60

Query  205  RLQRSRGPESLRGLPSFRFETIPDGLPPSD-VDATQDIPSLCVSTATTCLGPFKDLLARL  381
            RL +SRGP+SL GLPSFRFETIPDGLP S+  ++TQD+PSLC ST   CL PF+ LL++L
Sbjct  61   RLLKSRGPDSLNGLPSFRFETIPDGLPSSENANSTQDVPSLCYSTKRNCLAPFRYLLSKL  120

Query  382  NHTAAATNVPPVSCIVSDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGY  561
            N++ A++NVPPV+CIV D IMSFTL A +ELG+P VLFW  S  GFM  +HY  LV+KG+
Sbjct  121  NNS-ASSNVPPVTCIVFDCIMSFTLQAGQELGVPVVLFWTASVCGFMAYLHYRPLVEKGF  179

Query  562  TPLKDEGYLTNGYLETELDWVKGMKGIRL  648
             PLKD  YLTNGYL+T ++W+ GM+GIRL
Sbjct  180  VPLKDASYLTNGYLDTLINWIPGMEGIRL  208



>ref|XP_007227225.1| hypothetical protein PRUPE_ppa018697mg [Prunus persica]
 gb|EMJ28424.1| hypothetical protein PRUPE_ppa018697mg [Prunus persica]
Length=483

 Score =   286 bits (733),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 135/191 (71%), Positives = 156/191 (82%), Gaps = 3/191 (2%)
 Frame = +1

Query  76   KKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPSF  255
            +KPHAVC+PYPAQ HIN MLK+AKLLH KGFHITFVNTEFNH+RL +SRGP SL GLPSF
Sbjct  8    EKPHAVCIPYPAQGHINPMLKVAKLLHYKGFHITFVNTEFNHKRLLKSRGPNSLDGLPSF  67

Query  256  RFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIVSD  435
            RFE IPDGLPP+D   TQDIPSLC ST   CL  F++LL++LN   ++ + PPVSCIVSD
Sbjct  68   RFENIPDGLPPTDASVTQDIPSLCYSTRRHCLPHFRELLSKLN---SSPDSPPVSCIVSD  124

Query  436  GIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEGYLTNGYLETEL  615
            G+MSFTL AAEELGIP+VLFW  SA GFM  + Y +L++KG TPLKD  YLTNGYLET +
Sbjct  125  GVMSFTLDAAEELGIPEVLFWTTSACGFMSYVQYHRLIEKGLTPLKDASYLTNGYLETVI  184

Query  616  DWVKGMKGIRL  648
            DW+ GMK IRL
Sbjct  185  DWIPGMKDIRL  195



>ref|XP_008219315.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Prunus mume]
Length=482

 Score =   286 bits (733),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 134/198 (68%), Positives = 160/198 (81%), Gaps = 4/198 (2%)
 Frame = +1

Query  55   SNNCEFEKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPES  234
            S+NC  EK PHAVC+P+PAQ HIN +LKLAKLLH KGFHITFVNTEFNH+RL +SRGP S
Sbjct  2    SSNCLIEK-PHAVCIPFPAQGHINPLLKLAKLLHYKGFHITFVNTEFNHKRLLKSRGPNS  60

Query  235  LRGLPSFRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPP  414
            L G PSFRFETIPDGLPP+D +ATQDIPSLC ST    L  F+DLL++LN   ++ + PP
Sbjct  61   LDGFPSFRFETIPDGLPPTDANATQDIPSLCDSTRKRSLPYFRDLLSKLN---SSPDCPP  117

Query  415  VSCIVSDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEGYLTN  594
            VSC+VSDG M FTL AA+E G+P+VLFW  SA GF+  +HY + ++KG TPLKD  YLTN
Sbjct  118  VSCVVSDGAMGFTLDAAQEFGLPEVLFWTTSACGFLAYVHYHRFIEKGLTPLKDASYLTN  177

Query  595  GYLETELDWVKGMKGIRL  648
            GYLETE+DW+ GM+GIRL
Sbjct  178  GYLETEIDWIPGMRGIRL  195



>ref|XP_002285770.1| PREDICTED: 7-deoxyloganetin glucosyltransferase [Vitis vinifera]
Length=473

 Score =   286 bits (732),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 132/191 (69%), Positives = 154/191 (81%), Gaps = 5/191 (3%)
 Frame = +1

Query  76   KKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPSF  255
            +KPHAVC+PYPAQ HIN MLK+AKLLH +GF ITFVNTEFNH RL +++GP SL GLP+F
Sbjct  5    EKPHAVCIPYPAQGHINPMLKVAKLLHFRGFRITFVNTEFNHTRLLKAQGPNSLNGLPTF  64

Query  256  RFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIVSD  435
            +FETIPDGLPPS+VDATQDIPSLC ST   CL PF+ LLA+LN        PPV+CI SD
Sbjct  65   QFETIPDGLPPSNVDATQDIPSLCASTKKNCLAPFRRLLAKLNDRG-----PPVTCIFSD  119

Query  436  GIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEGYLTNGYLETEL  615
             +MSFTL AA+ELGIPD+L W  SA GFM  + Y  L+DKG+TPLKDE YLTNGYL+T +
Sbjct  120  AVMSFTLDAAQELGIPDLLLWTASACGFMAYVQYRSLIDKGFTPLKDESYLTNGYLDTVV  179

Query  616  DWVKGMKGIRL  648
            DW+ GMKGIRL
Sbjct  180  DWIPGMKGIRL  190



>gb|KCW66553.1| hypothetical protein EUGRSUZ_F00351 [Eucalyptus grandis]
Length=440

 Score =   285 bits (728),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 130/200 (65%), Positives = 155/200 (78%), Gaps = 2/200 (1%)
 Frame = +1

Query  49   MGSNNCEFEKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGP  228
            MGS +    + PHAVC+PYPAQ HIN ML LAKLLH++GFH+TFVNTE+NH RL RSRGP
Sbjct  1    MGSTD--MTQMPHAVCIPYPAQGHINPMLNLAKLLHHRGFHVTFVNTEYNHSRLLRSRGP  58

Query  229  ESLRGLPSFRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNV  408
             SL GLPSF+F TIPDGLPPSD DATQD+P+LC ST  +CL  F+DLL RLN  +A +  
Sbjct  59   SSLNGLPSFQFRTIPDGLPPSDADATQDVPALCQSTQKSCLPYFRDLLERLNEESARSGS  118

Query  409  PPVSCIVSDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEGYL  588
            PPVSC+VSDG+MSFTL AAE + +P+VLFW  S  GFMG + Y  L+D+G  PLKD  YL
Sbjct  119  PPVSCVVSDGVMSFTLDAAEAVSVPEVLFWTTSLCGFMGYVQYRSLIDRGLAPLKDASYL  178

Query  589  TNGYLETELDWVKGMKGIRL  648
            TNGYL+T +DW+ GM  IRL
Sbjct  179  TNGYLDTVVDWIPGMTNIRL  198



>gb|KCW66555.1| hypothetical protein EUGRSUZ_F00353, partial [Eucalyptus grandis]
Length=477

 Score =   285 bits (730),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 130/200 (65%), Positives = 155/200 (78%), Gaps = 2/200 (1%)
 Frame = +1

Query  49   MGSNNCEFEKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGP  228
            MGS +    + PHAVC+PYPAQ HIN ML LAKLLH++GFH+TFVNTE+NH RL RSRGP
Sbjct  1    MGSTD--MTQMPHAVCIPYPAQGHINPMLNLAKLLHHRGFHVTFVNTEYNHSRLLRSRGP  58

Query  229  ESLRGLPSFRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNV  408
             SL GLPSFRF TIPDGLPPSD DATQD+P+LC ST  +CL  F+DLL +LN  +A +  
Sbjct  59   SSLDGLPSFRFRTIPDGLPPSDADATQDVPALCQSTQKSCLPYFRDLLEKLNEESAMSGS  118

Query  409  PPVSCIVSDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEGYL  588
            PPVSC+VSDG+MSFTL AAE + +P+VLFW  S  GFMG + Y  L+D+G  PLKD  YL
Sbjct  119  PPVSCVVSDGVMSFTLDAAEAVSVPEVLFWTTSLCGFMGYVQYRSLIDRGLAPLKDASYL  178

Query  589  TNGYLETELDWVKGMKGIRL  648
            TNGYL+T +DW+ GM  IRL
Sbjct  179  TNGYLDTAVDWIPGMTNIRL  198



>ref|XP_010060024.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Eucalyptus 
grandis]
Length=485

 Score =   285 bits (730),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 130/200 (65%), Positives = 155/200 (78%), Gaps = 2/200 (1%)
 Frame = +1

Query  49   MGSNNCEFEKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGP  228
            MGS +    + PHAVC+PYPAQ HIN ML LAKLLH++GFH+TFVNTE+NH RL RSRGP
Sbjct  1    MGSTD--MTQMPHAVCIPYPAQGHINPMLNLAKLLHHRGFHVTFVNTEYNHSRLLRSRGP  58

Query  229  ESLRGLPSFRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNV  408
             SL GLPSFRF TIPDGLPPSD DATQD+P+LC ST  +CL  F+DLL +LN  +A +  
Sbjct  59   SSLDGLPSFRFRTIPDGLPPSDADATQDVPALCQSTQKSCLPYFRDLLEKLNEESAMSGS  118

Query  409  PPVSCIVSDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEGYL  588
            PPVSC+VSDG+MSFTL AAE + +P+VLFW  S  GFMG + Y  L+D+G  PLKD  YL
Sbjct  119  PPVSCVVSDGVMSFTLDAAEAVSVPEVLFWTTSLCGFMGYVQYRSLIDRGLAPLKDASYL  178

Query  589  TNGYLETELDWVKGMKGIRL  648
            TNGYL+T +DW+ GM  IRL
Sbjct  179  TNGYLDTAVDWIPGMTNIRL  198



>ref|XP_003542333.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Glycine max]
Length=485

 Score =   285 bits (730),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 133/190 (70%), Positives = 157/190 (83%), Gaps = 4/190 (2%)
 Frame = +1

Query  79   KPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPSFR  258
            KPHAVC+PYPAQ HIN MLKLAKLLH KGFHITFVNTE+NH+RL ++RGP+SL GL SFR
Sbjct  10   KPHAVCIPYPAQGHINPMLKLAKLLHFKGFHITFVNTEYNHKRLLKARGPDSLNGLSSFR  69

Query  259  FETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIVSDG  438
            FETIPDGLP +D+DATQDIPSLC +T  TC   FK+LL ++N++ A    PPVSCIVSDG
Sbjct  70   FETIPDGLPETDLDATQDIPSLCEATRRTCSPHFKNLLTKINNSDA----PPVSCIVSDG  125

Query  439  IMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEGYLTNGYLETELD  618
            +MSFTL AAEELG+P+VLFW  SA GFM  + Y QL++KG TPLKD  Y+TNGYLET +D
Sbjct  126  VMSFTLDAAEELGLPEVLFWTTSACGFMCYVQYEQLIEKGLTPLKDSSYITNGYLETTID  185

Query  619  WVKGMKGIRL  648
            W+ G+K IRL
Sbjct  186  WIPGIKEIRL  195



>ref|XP_002301060.1| hypothetical protein POPTR_0002s09850g [Populus trichocarpa]
 gb|EEE80333.1| hypothetical protein POPTR_0002s09850g [Populus trichocarpa]
Length=505

 Score =   286 bits (731),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 133/192 (69%), Positives = 157/192 (82%), Gaps = 1/192 (1%)
 Frame = +1

Query  73   EKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPS  252
            E  PHAVC+P+PAQ HIN MLKLAK+LH K FHITFVNTEFNHRRL +SRG  SL GLP+
Sbjct  8    EFPPHAVCLPFPAQGHINPMLKLAKILHRKDFHITFVNTEFNHRRLLKSRGLGSLDGLPT  67

Query  253  FRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIVS  432
            FRFETIPDGLPPSD D+TQ +PSLC ST   CL PF+DLL+RLN+T +++ VPPV+CIVS
Sbjct  68   FRFETIPDGLPPSDADSTQHVPSLCDSTKKNCLAPFRDLLSRLNNT-SSSKVPPVTCIVS  126

Query  433  DGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEGYLTNGYLETE  612
            D IMSFTL AA+ELGIP+VLFW  S  GFM  + Y  L++KG+ PLKDE YLTNGYL+T 
Sbjct  127  DCIMSFTLKAAQELGIPNVLFWTASVCGFMSYLQYRPLIEKGFVPLKDESYLTNGYLDTV  186

Query  613  LDWVKGMKGIRL  648
            +DW+ GM+GI L
Sbjct  187  IDWIPGMEGISL  198



>ref|XP_004136284.1| PREDICTED: 7-deoxyloganetin glucosyltransferase [Cucumis sativus]
 gb|KGN60220.1| hypothetical protein Csa_3G889760 [Cucumis sativus]
Length=486

 Score =   285 bits (728),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 131/193 (68%), Positives = 160/193 (83%), Gaps = 4/193 (2%)
 Frame = +1

Query  73   EKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPS  252
            +++PHAVC+PYPAQ HIN MLKLAKLLH+ GFHITFVNT+FNHRRL +SRGP +L G+ S
Sbjct  8    QQQPHAVCIPYPAQGHINPMLKLAKLLHSFGFHITFVNTDFNHRRLLKSRGPTALDGISS  67

Query  253  FRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIVS  432
            F+FE+IPDGLPP+DVDATQDIPSLC ST   CL PFK+L+++LN      NVP VSCIVS
Sbjct  68   FQFESIPDGLPPTDVDATQDIPSLCQSTRRLCLQPFKELVSKLN---CDPNVPQVSCIVS  124

Query  433  DGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEGYLTN-GYLET  609
            DG+MSFT+ AAEELG+P VLFW  SA GF+  +HY QLV++GYTP KDE YL+N  YL+T
Sbjct  125  DGVMSFTVDAAEELGVPVVLFWTTSACGFLAYLHYQQLVERGYTPFKDESYLSNEQYLDT  184

Query  610  ELDWVKGMKGIRL  648
            ++DW+ GMK +RL
Sbjct  185  KIDWIPGMKDVRL  197



>ref|XP_010060018.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Eucalyptus 
grandis]
Length=485

 Score =   285 bits (728),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 129/194 (66%), Positives = 154/194 (79%), Gaps = 0/194 (0%)
 Frame = +1

Query  67   EFEKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGL  246
            E  +KPHAVC+P+PAQSHINAML LAKLLH++GFH+TFVNTE+NH RL RSRGP SL  L
Sbjct  5    EMTQKPHAVCIPFPAQSHINAMLNLAKLLHDRGFHVTFVNTEYNHNRLLRSRGPSSLDSL  64

Query  247  PSFRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCI  426
            PSFRF TIPDGLPPSD DATQDIP+LC ST   CL  F+DLL RL+  +A +  PPVSC+
Sbjct  65   PSFRFRTIPDGLPPSDGDATQDIPALCQSTQERCLPYFQDLLKRLDEESATSGSPPVSCV  124

Query  427  VSDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEGYLTNGYLE  606
            VSD   +FTL AAE +G+P+VLFWPISA  FMG + +  L+D+G  PLKD  YLTNGYL+
Sbjct  125  VSDVSTTFTLDAAEAVGVPEVLFWPISACAFMGFLQFRSLIDEGLAPLKDASYLTNGYLD  184

Query  607  TELDWVKGMKGIRL  648
            T +DW+ GM+ IRL
Sbjct  185  TIIDWIPGMRNIRL  198



>ref|XP_009391314.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Musa acuminata 
subsp. malaccensis]
Length=482

 Score =   284 bits (726),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 135/189 (71%), Positives = 153/189 (81%), Gaps = 2/189 (1%)
 Frame = +1

Query  82   PHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPSFRF  261
            PHAVC+PYPAQ HI  MLKLAKLLH+KGF ITFVNTE+NHRRL  +RGP +L GLP FRF
Sbjct  9    PHAVCIPYPAQGHITPMLKLAKLLHSKGFRITFVNTEYNHRRLLNARGPSALDGLPDFRF  68

Query  262  ETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIVSDGI  441
            ETIPDGLPPSD DATQDIP+LC ST TTCL PF DLL+ LN    ++  PPVSCIVSDG+
Sbjct  69   ETIPDGLPPSDDDATQDIPALCRSTMTTCLPPFLDLLSELND--PSSERPPVSCIVSDGV  126

Query  442  MSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEGYLTNGYLETELDW  621
            MSFTL AA +LGIP+VLFW  SA GFMG +HY  LV++G TPLKD   LTNGYL+T +DW
Sbjct  127  MSFTLDAARQLGIPEVLFWTTSACGFMGYIHYRHLVERGLTPLKDVDELTNGYLDTPVDW  186

Query  622  VKGMKGIRL  648
            V GMK +RL
Sbjct  187  VPGMKNMRL  195



>ref|XP_011016624.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Populus 
euphratica]
Length=505

 Score =   284 bits (727),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 131/189 (69%), Positives = 154/189 (81%), Gaps = 1/189 (1%)
 Frame = +1

Query  82   PHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPSFRF  261
            PH VC+P+PAQ HIN MLKLAK+LH K FHITFVNTEFNHRRL RSRG +SL GL +FRF
Sbjct  11   PHVVCLPFPAQGHINPMLKLAKILHQKDFHITFVNTEFNHRRLLRSRGLDSLDGLSTFRF  70

Query  262  ETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIVSDGI  441
            ETIPDGLPPSD D+TQ +PSLC ST   CL PF+DLL+RLN+T +++ VPPV+CIVSD I
Sbjct  71   ETIPDGLPPSDADSTQHVPSLCDSTKKNCLAPFRDLLSRLNNT-SSSKVPPVTCIVSDCI  129

Query  442  MSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEGYLTNGYLETELDW  621
            MSFTL AA+ELGIP+V FW  S  GFM  + Y  L++KGY PLKDE YLTNGYL+T +DW
Sbjct  130  MSFTLKAAQELGIPNVFFWTASVCGFMSYLQYRPLIEKGYVPLKDESYLTNGYLDTVIDW  189

Query  622  VKGMKGIRL  648
            + GM+GI L
Sbjct  190  IPGMEGISL  198



>ref|XP_003544800.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Glycine max]
Length=482

 Score =   283 bits (725),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 132/190 (69%), Positives = 156/190 (82%), Gaps = 4/190 (2%)
 Frame = +1

Query  79   KPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPSFR  258
            KPHAVC+PYPAQ HIN MLKLAKLLH KGFHITFVNTE+NH+RL ++RGP+SL GL SFR
Sbjct  9    KPHAVCIPYPAQGHINPMLKLAKLLHFKGFHITFVNTEYNHKRLLKARGPDSLNGLSSFR  68

Query  259  FETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIVSDG  438
            FETIPDGLP +D+DATQDIPSLC +T  TC   FK+LLA++N + A    PPVSCIVSDG
Sbjct  69   FETIPDGLPETDLDATQDIPSLCEATRRTCSPHFKNLLAKINDSDA----PPVSCIVSDG  124

Query  439  IMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEGYLTNGYLETELD  618
            +M+FTL AAEELG+P+VLFW  SA GFM  + Y QL++K  TPLKD  Y+TNGYLET +D
Sbjct  125  VMTFTLDAAEELGVPEVLFWTTSACGFMCYVQYQQLIEKDLTPLKDSSYITNGYLETTID  184

Query  619  WVKGMKGIRL  648
            W+ G+K IRL
Sbjct  185  WIPGIKEIRL  194



>gb|KHN42553.1| UDP-glycosyltransferase 85A2 [Glycine soja]
Length=482

 Score =   283 bits (725),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 132/190 (69%), Positives = 156/190 (82%), Gaps = 4/190 (2%)
 Frame = +1

Query  79   KPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPSFR  258
            KPHAVC+PYPAQ HIN MLKLAKLLH KGFHITFVNTE+NH+RL ++RGP+SL GL SFR
Sbjct  9    KPHAVCIPYPAQGHINPMLKLAKLLHFKGFHITFVNTEYNHKRLLKARGPDSLNGLSSFR  68

Query  259  FETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIVSDG  438
            FETIPDGLP +D+DATQDIPSLC +T  TC   FK+LLA++N + A    PPVSCIVSDG
Sbjct  69   FETIPDGLPETDLDATQDIPSLCEATRRTCSPHFKNLLAKINDSDA----PPVSCIVSDG  124

Query  439  IMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEGYLTNGYLETELD  618
            +M+FTL AAEELG+P+VLFW  SA GFM  + Y QL++K  TPLKD  Y+TNGYLET +D
Sbjct  125  VMTFTLDAAEELGVPEVLFWTTSACGFMCYVQYQQLIEKDLTPLKDSSYITNGYLETTID  184

Query  619  WVKGMKGIRL  648
            W+ G+K IRL
Sbjct  185  WIPGIKEIRL  194



>gb|KJB79650.1| hypothetical protein B456_013G060700 [Gossypium raimondii]
Length=478

 Score =   282 bits (722),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 126/190 (66%), Positives = 154/190 (81%), Gaps = 3/190 (2%)
 Frame = +1

Query  79   KPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPSFR  258
            KPHAVC+PYPAQ H+N ML +AKLLH KGFHITFVNTE+NH RL +SR P +L  LP FR
Sbjct  9    KPHAVCIPYPAQGHVNPMLMVAKLLHFKGFHITFVNTEYNHERLLKSRAPHALNSLPDFR  68

Query  259  FETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIVSDG  438
            FET+PDGLPP D++ATQDIP+LC ST+  CL PF+ LLARLN    ++ +PPV+CIVSDG
Sbjct  69   FETVPDGLPPPDINATQDIPTLCDSTSKHCLTPFRQLLARLN---VSSGIPPVTCIVSDG  125

Query  439  IMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEGYLTNGYLETELD  618
             MSFTL AA+E+GIPDVL W  SA GF+   HY +L++KG+TPLKDE Y+TNGYL+T +D
Sbjct  126  CMSFTLEAAQEVGIPDVLLWTPSACGFLAYCHYRRLIEKGFTPLKDETYMTNGYLDTIID  185

Query  619  WVKGMKGIRL  648
            W+ GMK IR+
Sbjct  186  WIPGMKNIRI  195



>ref|XP_003526577.1| PREDICTED: UDP-glycosyltransferase 85A3-like [Glycine max]
 gb|KHN08945.1| UDP-glycosyltransferase 85A3 [Glycine soja]
Length=486

 Score =   282 bits (722),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 135/200 (68%), Positives = 157/200 (79%), Gaps = 3/200 (2%)
 Frame = +1

Query  49   MGSNNCEFEKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGP  228
            M S +    +KPHAVC+PYPAQ HI  MLKLAK+LH KGFHITFVNTEFNH+RL +SRG 
Sbjct  1    MNSLDITTVEKPHAVCIPYPAQGHITPMLKLAKVLHFKGFHITFVNTEFNHKRLLKSRGA  60

Query  229  ESLRGLPSFRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNV  408
            +SL G PSFRFETIPDGLP SDVDATQD P+LC S   TCL PF++LLA+LNH   + +V
Sbjct  61   DSLNGFPSFRFETIPDGLPESDVDATQDTPTLCESLRKTCLVPFRNLLAKLNH---SRHV  117

Query  409  PPVSCIVSDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEGYL  588
            PPVSCIVSDG+MSFTL A+EELGIP+V FW ISA G +  +H  QLV KG  PLKD  Y+
Sbjct  118  PPVSCIVSDGVMSFTLIASEELGIPEVFFWTISACGLLCYLHNGQLVKKGLVPLKDSSYM  177

Query  589  TNGYLETELDWVKGMKGIRL  648
            TNGYLET +DW+ G+K I L
Sbjct  178  TNGYLETAIDWLPGIKEILL  197



>gb|KJB79644.1| hypothetical protein B456_013G060400 [Gossypium raimondii]
Length=482

 Score =   282 bits (721),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 129/190 (68%), Positives = 155/190 (82%), Gaps = 3/190 (2%)
 Frame = +1

Query  79   KPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPSFR  258
            KPHAVC+PYPAQ H+N MLK+AKLLH KGFHITFVNTE+NH+RL +SRGP +L GLP FR
Sbjct  9    KPHAVCIPYPAQGHVNPMLKVAKLLHFKGFHITFVNTEYNHKRLLKSRGPHALDGLPDFR  68

Query  259  FETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIVSDG  438
            F TIPDGLPP D+DATQDIP+L  ST+  CL PF+ LL +LN   A + VPPV+CIV+DG
Sbjct  69   FGTIPDGLPPPDIDATQDIPALSDSTSKHCLAPFRRLLVKLN---ATSGVPPVTCIVADG  125

Query  439  IMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEGYLTNGYLETELD  618
             MSFTL AA+ELGIP VLFW  SA GF+   HY +L+D+G+TPLKDE Y+TNGYL+T +D
Sbjct  126  CMSFTLEAAKELGIPGVLFWTPSACGFLAYCHYRRLIDEGFTPLKDESYMTNGYLDTVID  185

Query  619  WVKGMKGIRL  648
            W+ GMK IR+
Sbjct  186  WIPGMKNIRI  195



>ref|XP_002285779.1| PREDICTED: 7-deoxyloganetin glucosyltransferase isoform X2 [Vitis 
vinifera]
Length=474

 Score =   281 bits (718),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 134/192 (70%), Positives = 154/192 (80%), Gaps = 5/192 (3%)
 Frame = +1

Query  73   EKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPS  252
            EKKPHAVC+P+PAQ HI  ML LAKLLH +GFHITFVNTEFNHRRL ++RGP SL GLPS
Sbjct  5    EKKPHAVCIPFPAQGHIKPMLNLAKLLHFRGFHITFVNTEFNHRRLLKARGPNSLDGLPS  64

Query  253  FRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIVS  432
            F+FETIPDGL PSDV+ATQDIPSLCVST    L PF+ LL++LNH     N PPV+CIVS
Sbjct  65   FQFETIPDGLQPSDVNATQDIPSLCVSTKNNLLPPFRCLLSKLNH-----NGPPVTCIVS  119

Query  433  DGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEGYLTNGYLETE  612
            D  ++ TL AA+ELGIP +LFW  SA GFMG  HY  LV+KG+ PLKD  YLTNGYL+T 
Sbjct  120  DSSLTSTLDAAQELGIPGLLFWTASACGFMGYAHYRTLVNKGFIPLKDASYLTNGYLDTV  179

Query  613  LDWVKGMKGIRL  648
            +DW+ GMKGIRL
Sbjct  180  IDWIPGMKGIRL  191



>ref|XP_010273031.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Nelumbo 
nucifera]
Length=483

 Score =   281 bits (719),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 132/193 (68%), Positives = 160/193 (83%), Gaps = 3/193 (2%)
 Frame = +1

Query  76   KKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPSF  255
            KKPH VC+PYPAQ HIN MLKLAKLLH KGFH+TFVNTE+NHRRL +SRGP+S++GLP F
Sbjct  8    KKPHVVCIPYPAQGHINPMLKLAKLLHYKGFHVTFVNTEYNHRRLVKSRGPDSVKGLPGF  67

Query  256  RFETIPDGLPPS-DVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIVS  432
            RFETIPDGLP S D++ATQ IPSLC ST  TCL PF++LL++LN  +++++ PPVSCIVS
Sbjct  68   RFETIPDGLPHSDDIEATQHIPSLCDSTRKTCLSPFRNLLSKLND-SSSSDTPPVSCIVS  126

Query  433  DGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEGYLTNGYLETE  612
            DG+MSFTL AA+E GIP+VLFW  SA GFM  +HY  L+ +G TPLKD  YLTNGYL+T 
Sbjct  127  DGVMSFTLTAAQECGIPEVLFWTTSACGFMSYVHYPHLIHRGLTPLKDINYLTNGYLDTT  186

Query  613  LDWVKGM-KGIRL  648
            +DW+ G+ K IRL
Sbjct  187  IDWIPGLVKDIRL  199



>gb|EYU19971.1| hypothetical protein MIMGU_mgv1a024760mg [Erythranthe guttata]
Length=483

 Score =   280 bits (716),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 133/193 (69%), Positives = 151/193 (78%), Gaps = 4/193 (2%)
 Frame = +1

Query  79   KPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPSFR  258
            KPHAVC+P+PAQ HIN MLKLAKLLHN GFHITFVNTE+NH RL +SRGP+SL GLPSFR
Sbjct  8    KPHAVCIPFPAQGHINPMLKLAKLLHNNGFHITFVNTEYNHHRLLKSRGPDSLTGLPSFR  67

Query  259  FETIPDGLPP---SDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIV  429
            FETIPDGLPP    D DATQDIPSLC ST  TCL PF+DLLA+LN T A++ VPPVSCIV
Sbjct  68   FETIPDGLPPPSEDDADATQDIPSLCESTTNTCLAPFRDLLAKLNDT-ASSEVPPVSCIV  126

Query  430  SDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEGYLTNGYLET  609
            SDG+MSFT  AAEELGIP++LFW  SA GF     Y  +  KGY PL D    TNGYLET
Sbjct  127  SDGVMSFTADAAEELGIPEILFWTTSACGFYAYTQYEYVFQKGYAPLADTSCFTNGYLET  186

Query  610  ELDWVKGMKGIRL  648
             ++ +  M+GIR+
Sbjct  187  VIEGIPSMEGIRM  199



>gb|KCW66556.1| hypothetical protein EUGRSUZ_F00355 [Eucalyptus grandis]
Length=444

 Score =   279 bits (713),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 126/194 (65%), Positives = 151/194 (78%), Gaps = 0/194 (0%)
 Frame = +1

Query  58   NNCEFEKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESL  237
            ++ E  + PHAVC+PYPAQ HIN ML LAKLLH++GFH+TFVNTE+NH RL RSRGP SL
Sbjct  2    SSIEMTQMPHAVCIPYPAQGHINPMLNLAKLLHHRGFHVTFVNTEYNHSRLLRSRGPSSL  61

Query  238  RGLPSFRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPV  417
             GLPSF+F  IPDGLPPSD DATQDIP+LC ST  +C   F+DLL RLN  +A +  PPV
Sbjct  62   DGLPSFQFHAIPDGLPPSDADATQDIPALCQSTQKSCSPYFRDLLERLNEESATSGSPPV  121

Query  418  SCIVSDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEGYLTNG  597
            SC+VSDG MSFTL AAE +G+P+VLFW  SA GFMG +HY  L+D+G TPLKD  YLTNG
Sbjct  122  SCVVSDGAMSFTLDAAEAVGVPEVLFWTTSACGFMGYVHYRSLIDRGLTPLKDASYLTNG  181

Query  598  YLETELDWVKGMKG  639
            YL+T +DW+   + 
Sbjct  182  YLDTVVDWIPAKRA  195



>ref|XP_008219322.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Prunus mume]
Length=483

 Score =   280 bits (715),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 133/191 (70%), Positives = 154/191 (81%), Gaps = 3/191 (2%)
 Frame = +1

Query  76   KKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPSF  255
            +KPHAVC+P+PAQ HIN MLK+AKLLH KGFHITFVNTEFNH+RL +SRGP S  GLPSF
Sbjct  8    EKPHAVCIPFPAQGHINPMLKVAKLLHCKGFHITFVNTEFNHKRLLKSRGPNSHDGLPSF  67

Query  256  RFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIVSD  435
            RFE IPDGLPP++   TQDIPSLC ST   CL  F++LL++LN + A+   PPVSCIVSD
Sbjct  68   RFENIPDGLPPTNASVTQDIPSLCYSTRRHCLPHFRELLSKLNSSPAS---PPVSCIVSD  124

Query  436  GIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEGYLTNGYLETEL  615
            G MSFTL AAEELGIP+VLFW  SA GFM  + Y +L++KG TPLKD  YLTNGYLET +
Sbjct  125  GAMSFTLDAAEELGIPEVLFWTTSACGFMSYVQYHRLIEKGLTPLKDVSYLTNGYLETVI  184

Query  616  DWVKGMKGIRL  648
            DW+ GMK IRL
Sbjct  185  DWIPGMKDIRL  195



>gb|AFK34769.1| unknown [Lotus japonicus]
Length=484

 Score =   280 bits (715),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 133/192 (69%), Positives = 156/192 (81%), Gaps = 3/192 (2%)
 Frame = +1

Query  76   KKPHAVCVPYPAQSHINAMLKLAKLLHNKG-FHITFVNTEFNHRRLQRSRGPESLRGLPS  252
            KKPH VC+PYPAQ HIN MLKLAKLLH KG FH+TFVNTE+NH+RL +SRGP+SL GLPS
Sbjct  9    KKPHVVCIPYPAQGHINPMLKLAKLLHFKGGFHVTFVNTEYNHKRLLKSRGPDSLNGLPS  68

Query  253  FRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIVS  432
            FRFETIPDGLP +DVD TQDIPSLC+ST  TCL  FK LL++LN    +++VPPV+CIVS
Sbjct  69   FRFETIPDGLPETDVDVTQDIPSLCISTRKTCLPHFKKLLSKLND--VSSDVPPVTCIVS  126

Query  433  DGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEGYLTNGYLETE  612
            DG MSFTL AA EL IP+VLFW  SA GFMG + Y +L++KG  PLKD   +TNGYLET 
Sbjct  127  DGCMSFTLDAAIELNIPEVLFWTTSACGFMGYVQYRELIEKGIIPLKDSSDITNGYLETT  186

Query  613  LDWVKGMKGIRL  648
            ++W+ GMK IRL
Sbjct  187  IEWLPGMKNIRL  198



>ref|XP_008219319.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Prunus mume]
Length=490

 Score =   280 bits (716),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 129/191 (68%), Positives = 155/191 (81%), Gaps = 3/191 (2%)
 Frame = +1

Query  76   KKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPSF  255
            +KPHAVC+P+PAQ HI+ MLKLAKLLH KGFHITFVNTEFNH+RL +SRGP SL G PSF
Sbjct  8    EKPHAVCIPFPAQGHIDPMLKLAKLLHYKGFHITFVNTEFNHKRLLKSRGPNSLDGFPSF  67

Query  256  RFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIVSD  435
            RFETIPDGLPP+D  ATQDIPSLC ST    L  F++LL++LN   ++ + PPVSC+VSD
Sbjct  68   RFETIPDGLPPTDAIATQDIPSLCDSTRKHSLPYFRELLSKLN---SSPDCPPVSCVVSD  124

Query  436  GIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEGYLTNGYLETEL  615
            G M FTL AA+E G+P+VLFW  SA GF+  +HY + ++KG TPLKD  YLTNGYLETE+
Sbjct  125  GAMGFTLDAAQEFGLPEVLFWTTSACGFLAYVHYHRFIEKGLTPLKDASYLTNGYLETEI  184

Query  616  DWVKGMKGIRL  648
            DW+ GM+GIRL
Sbjct  185  DWIPGMRGIRL  195



>ref|XP_010056398.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Eucalyptus 
grandis]
Length=485

 Score =   280 bits (715),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 132/200 (66%), Positives = 155/200 (78%), Gaps = 2/200 (1%)
 Frame = +1

Query  49   MGSNNCEFEKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGP  228
            M SN  E  +KPHAVCVP+PAQ HI  ML LAKLLH++GFHITFVNTE+NH+RL RSRGP
Sbjct  1    MSSN--EMTQKPHAVCVPFPAQGHIKPMLCLAKLLHHRGFHITFVNTEYNHKRLLRSRGP  58

Query  229  ESLRGLPSFRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNV  408
             +L GLPSFRF TIPDGLPPSD DATQDIP+LC S+   CL  F+DLL  L+  +A +  
Sbjct  59   SALDGLPSFRFRTIPDGLPPSDADATQDIPTLCRSSRDLCLPYFRDLLRTLDEESATSGS  118

Query  409  PPVSCIVSDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEGYL  588
            PPVSC+VSDG+MSFTL AAE  G+P VLFW  SA GFMG + Y  LVDKG +PL+D  YL
Sbjct  119  PPVSCVVSDGVMSFTLDAAEAAGVPLVLFWTTSACGFMGYVQYRSLVDKGLSPLRDASYL  178

Query  589  TNGYLETELDWVKGMKGIRL  648
            TNGYL+T +DW+ GM+ I L
Sbjct  179  TNGYLDTIIDWIPGMRSISL  198



>gb|EYU19972.1| hypothetical protein MIMGU_mgv1a018325mg [Erythranthe guttata]
Length=394

 Score =   276 bits (707),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 132/193 (68%), Positives = 150/193 (78%), Gaps = 4/193 (2%)
 Frame = +1

Query  79   KPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPSFR  258
            KPHAVC+P+PAQ HIN MLKLAKLLHN GFHITFVNT +NH RL +SRGP+SL GLPSFR
Sbjct  9    KPHAVCIPFPAQGHINPMLKLAKLLHNNGFHITFVNTVYNHHRLLKSRGPDSLTGLPSFR  68

Query  259  FETIPDGLPP---SDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIV  429
            FETIPDGLPP    D DATQDIPSLC ST  TCL PF+DLLA+LN T A++ VPPVSC+V
Sbjct  69   FETIPDGLPPPSEDDADATQDIPSLCESTTNTCLAPFRDLLAKLNDT-ASSEVPPVSCVV  127

Query  430  SDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEGYLTNGYLET  609
            SDG+MSFT  AAEELGIP+VLFW  SA GF     Y  +  KGY PL D    TNGYLET
Sbjct  128  SDGVMSFTADAAEELGIPEVLFWTTSACGFYAYTQYEYVFRKGYAPLADTSCFTNGYLET  187

Query  610  ELDWVKGMKGIRL  648
             ++ +  M+GIR+
Sbjct  188  VIEGIPSMEGIRM  200



>emb|CDP01079.1| unnamed protein product [Coffea canephora]
Length=481

 Score =   279 bits (714),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 129/192 (67%), Positives = 154/192 (80%), Gaps = 1/192 (1%)
 Frame = +1

Query  73   EKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPS  252
            EKKPHAVC+P+PAQ HI  MLKLAKLLH KGFHITFVNTEFNHRRL +SRGP++L GLP 
Sbjct  8    EKKPHAVCIPFPAQGHIKPMLKLAKLLHQKGFHITFVNTEFNHRRLLKSRGPDALNGLPD  67

Query  253  FRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIVS  432
            F+F+ IPDGLPPSDVDATQDI SLC S    CLGPF++LLA LN T +++ V PVSCIVS
Sbjct  68   FQFKAIPDGLPPSDVDATQDILSLCESIDRNCLGPFRELLAELNDT-SSSEVAPVSCIVS  126

Query  433  DGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEGYLTNGYLETE  612
            DG  +FTLAAA+ELGIP+VL W  SA  ++    + + ++KG  PLKD  YLTNGYL+T 
Sbjct  127  DGATTFTLAAAQELGIPEVLLWTSSAPSYLAFFQFDKFIEKGIIPLKDASYLTNGYLDTV  186

Query  613  LDWVKGMKGIRL  648
            LDW+ G++GIRL
Sbjct  187  LDWIPGLEGIRL  198



>ref|XP_010056400.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Eucalyptus 
grandis]
Length=485

 Score =   279 bits (714),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 130/200 (65%), Positives = 155/200 (78%), Gaps = 2/200 (1%)
 Frame = +1

Query  49   MGSNNCEFEKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGP  228
            M SN  E  +KPHAVC+P+PAQ HI  ML LAKLLH++GFHITFVNTE+NH+RL RSRGP
Sbjct  1    MSSN--EMTQKPHAVCMPFPAQGHIKPMLSLAKLLHHRGFHITFVNTEYNHKRLLRSRGP  58

Query  229  ESLRGLPSFRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNV  408
             +L GLPSFRF TIPDGLPPSD DATQD+P+LC S+   CL  F+DLL  L+  +A +  
Sbjct  59   SALDGLPSFRFRTIPDGLPPSDADATQDVPTLCRSSRDLCLPYFRDLLRTLDEESATSGS  118

Query  409  PPVSCIVSDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEGYL  588
            PPVSC+VSDG+MSFTL AAE  G+P VLFW  SA GFMG + Y  LVDKG +PL+D  YL
Sbjct  119  PPVSCVVSDGVMSFTLDAAEAAGVPLVLFWTTSACGFMGYVQYRSLVDKGLSPLRDASYL  178

Query  589  TNGYLETELDWVKGMKGIRL  648
            TNGYL+T +DW+ GM+ I L
Sbjct  179  TNGYLDTIIDWIPGMRSISL  198



>ref|XP_010647463.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Vitis vinifera]
Length=371

 Score =   275 bits (704),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 121/191 (63%), Positives = 154/191 (81%), Gaps = 3/191 (2%)
 Frame = +1

Query  76   KKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPSF  255
            +KPHAVCVPYP+Q H+  +++LAKL+H++GFHITFVNTEFNHRRL RS GP+S+RGL  F
Sbjct  7    RKPHAVCVPYPSQGHVTPLMQLAKLVHSRGFHITFVNTEFNHRRLIRSAGPDSVRGLVDF  66

Query  256  RFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIVSD  435
            RFE IPDGLPPSD+DATQD+P+LC ST   CL PF+DLLARLN   ++++VPPVSCI+SD
Sbjct  67   RFEAIPDGLPPSDLDATQDVPALCDSTRKNCLAPFRDLLARLN---SSSDVPPVSCIISD  123

Query  436  GIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEGYLTNGYLETEL  615
            G+MSF + AAEELGIP+V FW  SA  FMG +HY + + +G  P KDE + ++G L+T +
Sbjct  124  GVMSFAIQAAEELGIPEVQFWTASACSFMGYLHYREFIRRGIFPFKDESFRSDGTLDTPI  183

Query  616  DWVKGMKGIRL  648
            DW+ GM  IRL
Sbjct  184  DWIPGMPNIRL  194



>gb|KEH28097.1| UDP-glucosyltransferase family protein [Medicago truncatula]
Length=483

 Score =   279 bits (713),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 132/193 (68%), Positives = 155/193 (80%), Gaps = 4/193 (2%)
 Frame = +1

Query  73   EKKPHAVCVPYPAQSHINAMLKLAKLLHNKG-FHITFVNTEFNHRRLQRSRGPESLRGLP  249
            E KPH VCVP+PAQ HIN MLKLAKLLH K  FH+TFVNTE+NH+RL ++RGP SL GLP
Sbjct  8    ENKPHVVCVPFPAQGHINPMLKLAKLLHFKSDFHVTFVNTEYNHKRLLKARGPNSLNGLP  67

Query  250  SFRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIV  429
            SFRFETIPDGLP SD+D+TQDIPSLC ST+ TCL  FK L+++LN+   A + PPV+CI+
Sbjct  68   SFRFETIPDGLPESDLDSTQDIPSLCESTSKTCLPHFKKLISKLNN---AIDTPPVTCII  124

Query  430  SDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEGYLTNGYLET  609
             DG+MSFT+ AAEEL IP VLFW  SA GFM  M + QL++KG TPLKD  YLTNGYLET
Sbjct  125  GDGVMSFTIDAAEELNIPAVLFWTTSACGFMCYMQFRQLIEKGLTPLKDSSYLTNGYLET  184

Query  610  ELDWVKGMKGIRL  648
             +DWV G+K IRL
Sbjct  185  TIDWVPGIKEIRL  197



>ref|XP_009341756.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Pyrus x 
bretschneideri]
Length=485

 Score =   279 bits (713),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 129/191 (68%), Positives = 157/191 (82%), Gaps = 3/191 (2%)
 Frame = +1

Query  76   KKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPSF  255
            +KPHAVC+P+PAQ HIN ML +AKLLH KGFHITFVNTEFNH+RL +SRG  SL GLPSF
Sbjct  8    EKPHAVCIPFPAQGHINPMLNVAKLLHFKGFHITFVNTEFNHKRLLKSRGSNSLDGLPSF  67

Query  256  RFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIVSD  435
            +FETIPDGLPP+  + TQDIPSLC ST  TCL  F++LL++LN   ++ + PPVSCIVSD
Sbjct  68   QFETIPDGLPPTKANVTQDIPSLCHSTKKTCLPHFRELLSKLN---SSPDSPPVSCIVSD  124

Query  436  GIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEGYLTNGYLETEL  615
            G+MSFTL AA+ELGIP+VLFW  SA GF+  M + +L++KG+TPLKD  YLTNGYL+T +
Sbjct  125  GVMSFTLDAAQELGIPEVLFWTTSACGFLAYMQFYRLIEKGHTPLKDASYLTNGYLDTVI  184

Query  616  DWVKGMKGIRL  648
            DW+ GMK IRL
Sbjct  185  DWIPGMKDIRL  195



>gb|ABW96222.1| glucosyltransferase [Linum usitatissimum]
Length=491

 Score =   279 bits (713),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 131/201 (65%), Positives = 158/201 (79%), Gaps = 4/201 (2%)
 Frame = +1

Query  49   MGSNNCEFEKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGP  228
            MGS     + KPHAVC+PYPAQ HI  MLKLAKLLH++GFH+TFVNTE+NH RL++S   
Sbjct  1    MGSMGHSEKPKPHAVCIPYPAQGHITPMLKLAKLLHHRGFHVTFVNTEYNHNRLRKS---  57

Query  229  ESLRGLPSFRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATN-  405
            +++  LPSFRF TIPDGLPP+D D TQDIPSLC ST  TCL  FK+LLA+LN  A+  + 
Sbjct  58   QAVSDLPSFRFATIPDGLPPTDSDVTQDIPSLCESTRRTCLPHFKELLAKLNDVASFEDG  117

Query  406  VPPVSCIVSDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEGY  585
            VPPVSC+VSDG+MSFTL AAEELG+P+VLFW  SA GF+G MHY  L+D+G  PLKDE Y
Sbjct  118  VPPVSCVVSDGVMSFTLDAAEELGVPEVLFWTTSACGFLGYMHYRDLIDRGIVPLKDESY  177

Query  586  LTNGYLETELDWVKGMKGIRL  648
            LTNGYL+T +DW+  M  I+L
Sbjct  178  LTNGYLDTVIDWIPAMSNIKL  198



>ref|XP_010064217.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Eucalyptus 
grandis]
Length=485

 Score =   278 bits (712),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 131/200 (66%), Positives = 153/200 (77%), Gaps = 2/200 (1%)
 Frame = +1

Query  49   MGSNNCEFEKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGP  228
            MGS   +  +KPHAVC+P PAQ HIN ML LAKLLH +GFH+TFVNTE+NH RL RSRGP
Sbjct  1    MGS--IDMIQKPHAVCIPAPAQGHINPMLNLAKLLHCRGFHVTFVNTEYNHSRLLRSRGP  58

Query  229  ESLRGLPSFRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNV  408
             SL GLPSFRF TIPDGLPPSD D TQDIP+LC ST   CL  F+DLL RLN  +A +  
Sbjct  59   SSLDGLPSFRFRTIPDGLPPSDGDTTQDIPALCQSTQRCCLPYFQDLLKRLNEESATSGS  118

Query  409  PPVSCIVSDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEGYL  588
            PPVSC+VSD  M+FTL AAE +G+P+VLFWPISA  FMG + +  L+DKG  PLKD  YL
Sbjct  119  PPVSCVVSDITMTFTLDAAEAIGVPEVLFWPISACAFMGFLQFRSLIDKGLVPLKDASYL  178

Query  589  TNGYLETELDWVKGMKGIRL  648
            TNG L+T +DW+ GM+ IRL
Sbjct  179  TNGNLDTVIDWIPGMRNIRL  198



>gb|KJB79645.1| hypothetical protein B456_013G060500 [Gossypium raimondii]
Length=482

 Score =   278 bits (712),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 128/189 (68%), Positives = 150/189 (79%), Gaps = 3/189 (2%)
 Frame = +1

Query  82   PHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPSFRF  261
            PHAVC+PYPAQ H+N MLK+AKLLH KGFHITFVNTE+NH+RL  SRGP +L GLP FRF
Sbjct  10   PHAVCIPYPAQGHVNPMLKVAKLLHFKGFHITFVNTEYNHKRLLESRGPHALDGLPDFRF  69

Query  262  ETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIVSDGI  441
             TIPDGLPP D+DATQDIP+LC ST+  CL PF+ LL  LN  A    VPPV+CIV+DG 
Sbjct  70   GTIPDGLPPPDIDATQDIPALCDSTSKHCLAPFRRLLVELNANAG---VPPVTCIVADGS  126

Query  442  MSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEGYLTNGYLETELDW  621
            MSFTL AA+ELGIP VL W  SA GF+   HY +L+D G+TPLKDE Y+TNGYL+T +DW
Sbjct  127  MSFTLEAAKELGIPSVLLWTPSACGFLAYCHYRRLIDDGFTPLKDESYMTNGYLDTVIDW  186

Query  622  VKGMKGIRL  648
            + GMK IR+
Sbjct  187  IPGMKNIRI  195



>emb|CDP01087.1| unnamed protein product [Coffea canephora]
Length=481

 Score =   278 bits (710),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 129/193 (67%), Positives = 154/193 (80%), Gaps = 1/193 (1%)
 Frame = +1

Query  70   FEKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLP  249
             EKKPHAVC+P  AQ HIN MLKLAKLLH+ GFHITFVNTEFNHRR  +SRGP++L GLP
Sbjct  7    LEKKPHAVCIPAAAQGHINPMLKLAKLLHHNGFHITFVNTEFNHRRWLKSRGPDALNGLP  66

Query  250  SFRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIV  429
             F+F+ IPDGLPPSD DATQD  +LC S   TCLGPF++LLA LN T +++ VPPVSCIV
Sbjct  67   DFQFKAIPDGLPPSDADATQDPAALCESVDRTCLGPFRELLAELNDT-SSSKVPPVSCIV  125

Query  430  SDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEGYLTNGYLET  609
            SD I +FTLAAAEEL IP+VLFW  SA  ++G   Y++L++KG  PLKD  YLTNGYL+ 
Sbjct  126  SDAITAFTLAAAEELCIPEVLFWTASACSYLGYFQYAKLMEKGIIPLKDASYLTNGYLDA  185

Query  610  ELDWVKGMKGIRL  648
             LDW+ G++GIRL
Sbjct  186  VLDWIPGLEGIRL  198



>ref|XP_007222658.1| hypothetical protein PRUPE_ppa004956mg [Prunus persica]
 gb|EMJ23857.1| hypothetical protein PRUPE_ppa004956mg [Prunus persica]
Length=483

 Score =   278 bits (710),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 128/191 (67%), Positives = 156/191 (82%), Gaps = 3/191 (2%)
 Frame = +1

Query  76   KKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPSF  255
            KKPHAVC+PYPAQ HI  ML+L KLLH KGFHITFVNTEFNHRRL +SRGP SL GLPSF
Sbjct  8    KKPHAVCIPYPAQGHITPMLQLTKLLHYKGFHITFVNTEFNHRRLLKSRGPNSLDGLPSF  67

Query  256  RFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIVSD  435
            RFETIPDGLPP+D++ATQD+ +LCVST+  CL PF+DLL++LN   +  + PPV+CIVSD
Sbjct  68   RFETIPDGLPPTDINATQDVTALCVSTSKNCLAPFRDLLSKLN---SLPDSPPVTCIVSD  124

Query  436  GIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEGYLTNGYLETEL  615
            G M+FTL AA+ELGIP+V+   +SA GFM  +    L++KG  PL+D  YLTNGYL+TE+
Sbjct  125  GGMTFTLDAAQELGIPEVILQTLSACGFMCYLQCRPLIEKGLIPLRDASYLTNGYLDTEI  184

Query  616  DWVKGMKGIRL  648
            DW+ GM+GIRL
Sbjct  185  DWIPGMRGIRL  195



>ref|XP_011009481.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Populus 
euphratica]
Length=482

 Score =   277 bits (709),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 131/195 (67%), Positives = 154/195 (79%), Gaps = 4/195 (2%)
 Frame = +1

Query  67   EFEKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGL  246
            +   KPHAVC+P+PAQ HIN MLKLAKLLH KGFHITFVNTE+NH+RL +SRG  SL GL
Sbjct  5    DLANKPHAVCIPFPAQGHINPMLKLAKLLHFKGFHITFVNTEYNHKRLLKSRGSSSLDGL  64

Query  247  PSFRFETIPDGLPPSDV-DATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSC  423
            P F F+TIPDGLPPSD+ DATQDIPSLC ST+TTCL PF+DL+A+LN ++    VP V+C
Sbjct  65   PDFEFKTIPDGLPPSDIADATQDIPSLCDSTSTTCLAPFRDLIAKLNSSSI---VPQVTC  121

Query  424  IVSDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEGYLTNGYL  603
            I+SD  MSFTL AAEE GIP+ LFW  SA G +G   Y  L+++G TPLKDE  LTNGYL
Sbjct  122  IISDACMSFTLDAAEEFGIPEALFWTPSACGVLGYAQYRSLIERGLTPLKDETDLTNGYL  181

Query  604  ETELDWVKGMKGIRL  648
            ET +DW+ GMK IRL
Sbjct  182  ETSIDWIPGMKNIRL  196



>ref|XP_004299646.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Fragaria 
vesca subsp. vesca]
Length=486

 Score =   276 bits (707),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 128/192 (67%), Positives = 157/192 (82%), Gaps = 4/192 (2%)
 Frame = +1

Query  76   KKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPSF  255
            +KPHAVC+P+PAQ HIN MLK+AKLLH KGF+ITFVNTEF H+RL +SRGP SL G PSF
Sbjct  9    EKPHAVCIPFPAQGHINPMLKVAKLLHYKGFYITFVNTEFIHKRLLKSRGPNSLDGFPSF  68

Query  256  RFETIPDGLPPSDVD-ATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIVS  432
            RFETIPDGLPP+D + ATQ +PSLC ST   CL PF+DLL +LN   ++ N PPV+CIV+
Sbjct  69   RFETIPDGLPPTDANVATQHMPSLCESTRKNCLAPFRDLLLKLN---SSPNSPPVTCIVA  125

Query  433  DGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEGYLTNGYLETE  612
            DGIM+FTL AA+ELG+P+V+FW  SA GFMG + Y  L++KG  PLKD+ YLTNGYL+T 
Sbjct  126  DGIMNFTLDAAQELGLPEVIFWTTSACGFMGYLQYYNLIEKGLVPLKDDSYLTNGYLDTV  185

Query  613  LDWVKGMKGIRL  648
            +DW+ GMKGI+L
Sbjct  186  IDWIPGMKGIQL  197



>gb|AKA44599.1| UGTPg32 [Panax ginseng]
Length=484

 Score =   276 bits (707),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 126/190 (66%), Positives = 152/190 (80%), Gaps = 0/190 (0%)
 Frame = +1

Query  79   KPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPSFR  258
            KPHAVC+P+PAQ HIN MLKLAKLLH KGFHI+FVNTEFNH RL RSRGP +L  LP FR
Sbjct  9    KPHAVCIPFPAQGHINPMLKLAKLLHRKGFHISFVNTEFNHNRLLRSRGPAALDSLPDFR  68

Query  259  FETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIVSDG  438
            F  IPDGLPPSD D+TQDIPSLC  T T  L PF  L+++LN T+ + +VPPV+CIVSDG
Sbjct  69   FYAIPDGLPPSDPDSTQDIPSLCKYTPTHSLLPFCSLISKLNDTSVSHDVPPVTCIVSDG  128

Query  439  IMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEGYLTNGYLETELD  618
            +MSFTL AAE+  +P+VLFW  SA G +G + Y  LV++GYTPLKD  Y+TNGYL+T+++
Sbjct  129  VMSFTLKAAEKFSLPEVLFWTTSACGLLGYLQYRHLVERGYTPLKDMSYVTNGYLDTKIE  188

Query  619  WVKGMKGIRL  648
            WV GMK I+L
Sbjct  189  WVPGMKDIKL  198



>ref|XP_002323758.2| hypothetical protein POPTR_0017s07930g [Populus trichocarpa]
 gb|EEF03891.2| hypothetical protein POPTR_0017s07930g [Populus trichocarpa]
Length=482

 Score =   276 bits (707),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 131/195 (67%), Positives = 153/195 (78%), Gaps = 4/195 (2%)
 Frame = +1

Query  67   EFEKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGL  246
            E   KPHAVC+P+PAQ HIN MLKLAKLLH KGFHITFVNTE+NHRRL +SRG  SL GL
Sbjct  5    ELANKPHAVCIPFPAQGHINPMLKLAKLLHFKGFHITFVNTEYNHRRLLKSRGSSSLDGL  64

Query  247  PSFRFETIPDGLPPSDV-DATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSC  423
            P F+F+TIPDGLPPSD+ DATQDIPSLC  T+TTCL PF+DL+A+LN ++    VP V+C
Sbjct  65   PEFQFKTIPDGLPPSDIADATQDIPSLCDCTSTTCLAPFRDLIAKLNSSSI---VPQVTC  121

Query  424  IVSDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEGYLTNGYL  603
            I+SD  MSFTL AAEE GIP+ LFW  SA G +G   Y  L+++G TPLKD   LTNGYL
Sbjct  122  IISDACMSFTLDAAEEFGIPEALFWTPSACGVLGYAQYRSLIERGLTPLKDATDLTNGYL  181

Query  604  ETELDWVKGMKGIRL  648
            ET +DW+ GMK IRL
Sbjct  182  ETSIDWIPGMKNIRL  196



>emb|CBI23550.3| unnamed protein product [Vitis vinifera]
Length=414

 Score =   274 bits (701),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 121/191 (63%), Positives = 154/191 (81%), Gaps = 3/191 (2%)
 Frame = +1

Query  76   KKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPSF  255
            +KPHAVCVPYP+Q H+  +++LAKL+H++GFHITFVNTEFNHRRL RS GP+S+RGL  F
Sbjct  7    RKPHAVCVPYPSQGHVTPLMQLAKLVHSRGFHITFVNTEFNHRRLIRSAGPDSVRGLVDF  66

Query  256  RFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIVSD  435
            RFE IPDGLPPSD+DATQD+P+LC ST   CL PF+DLLARLN   ++++VPPVSCI+SD
Sbjct  67   RFEAIPDGLPPSDLDATQDVPALCDSTRKNCLAPFRDLLARLN---SSSDVPPVSCIISD  123

Query  436  GIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEGYLTNGYLETEL  615
            G+MSF + AAEELGIP+V FW  SA  FMG +HY + + +G  P KDE + ++G L+T +
Sbjct  124  GVMSFAIQAAEELGIPEVQFWTASACSFMGYLHYREFIRRGIFPFKDESFRSDGTLDTPI  183

Query  616  DWVKGMKGIRL  648
            DW+ GM  IRL
Sbjct  184  DWIPGMPNIRL  194



>gb|AFJ52992.1| UDP-glycosyltransferase 1 [Linum usitatissimum]
Length=491

 Score =   276 bits (706),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 130/201 (65%), Positives = 157/201 (78%), Gaps = 4/201 (2%)
 Frame = +1

Query  49   MGSNNCEFEKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGP  228
            MGS     + KPHAVC+PYPAQ H   MLKLAKLLH++GFH+TFVNTE+NH RL++S   
Sbjct  1    MGSMGHSEKPKPHAVCIPYPAQGHKTPMLKLAKLLHHRGFHVTFVNTEYNHNRLRKS---  57

Query  229  ESLRGLPSFRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATN-  405
            +++  LPSFRF TIPDGLPP+D D TQDIPSLC ST  TCL  FK+LLA+LN  A+  + 
Sbjct  58   QAVSDLPSFRFATIPDGLPPTDSDVTQDIPSLCESTRRTCLPHFKELLAKLNDVASFEDG  117

Query  406  VPPVSCIVSDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEGY  585
            VPPVSC+VSDG+MSFTL AAEELG+P+VLFW  SA GF+G MHY  L+D+G  PLKDE Y
Sbjct  118  VPPVSCVVSDGVMSFTLDAAEELGVPEVLFWTTSACGFLGYMHYRDLIDRGIVPLKDESY  177

Query  586  LTNGYLETELDWVKGMKGIRL  648
            LTNGYL+T +DW+  M  I+L
Sbjct  178  LTNGYLDTVIDWIPAMSNIKL  198



>ref|XP_010056397.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Eucalyptus 
grandis]
Length=485

 Score =   276 bits (705),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 129/200 (65%), Positives = 153/200 (77%), Gaps = 2/200 (1%)
 Frame = +1

Query  49   MGSNNCEFEKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGP  228
            M SN  E  +KPHAVC+P+PAQ HI  ML LAKLLH++GFHITFVNTE+NH+RL RSRGP
Sbjct  1    MSSN--EMTQKPHAVCIPFPAQGHIKPMLCLAKLLHHRGFHITFVNTEYNHKRLLRSRGP  58

Query  229  ESLRGLPSFRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNV  408
             +L GLPSFRF TIPDGLPP D D TQDIP+LC S+   CL  F+DLL  L+  +A +  
Sbjct  59   SALDGLPSFRFRTIPDGLPPPDADVTQDIPTLCRSSRDLCLPYFRDLLQTLDEESATSGS  118

Query  409  PPVSCIVSDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEGYL  588
            PPVSC+VSDG+MSFTL AAE  G+P VLFW  SA GFMG + Y  LVDKG +PL+D  YL
Sbjct  119  PPVSCVVSDGVMSFTLDAAEAAGVPLVLFWTTSACGFMGYVQYRSLVDKGLSPLRDASYL  178

Query  589  TNGYLETELDWVKGMKGIRL  648
            TNGYL+T +DW+ GM+ I L
Sbjct  179  TNGYLDTIIDWIPGMRSISL  198



>ref|XP_010477495.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Camelina sativa]
Length=484

 Score =   275 bits (703),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 127/200 (64%), Positives = 156/200 (78%), Gaps = 3/200 (2%)
 Frame = +1

Query  49   MGSNNCEFEKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGP  228
            MGS+     +KPH VCVPYPAQ HIN M+K+AKLL  KGFH+TF NT +NH RL RSRGP
Sbjct  1    MGSHVVPNAQKPHVVCVPYPAQGHINPMMKMAKLLDAKGFHVTFCNTVYNHNRLLRSRGP  60

Query  229  ESLRGLPSFRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNV  408
             ++ GLPSFRFE+IPDGLP +DVD TQDIPSLC ST+  CL PFK+LL ++N   A  +V
Sbjct  61   NAVDGLPSFRFESIPDGLPETDVDVTQDIPSLCESTSKHCLAPFKELLRQIN---AKDDV  117

Query  409  PPVSCIVSDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEGYL  588
            PPVSCI+SDG MSFTL AAEELG+P+VLFW  SA GF+  ++Y + ++KG +PLKDE YL
Sbjct  118  PPVSCILSDGCMSFTLDAAEELGVPEVLFWTTSACGFLAYLYYYRFIEKGLSPLKDESYL  177

Query  589  TNGYLETELDWVKGMKGIRL  648
            T  YL+TE+DW+  MK +RL
Sbjct  178  TKEYLDTEIDWIPMMKNLRL  197



>gb|KCW73111.1| hypothetical protein EUGRSUZ_E01562, partial [Eucalyptus grandis]
Length=428

 Score =   273 bits (698),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 125/191 (65%), Positives = 149/191 (78%), Gaps = 0/191 (0%)
 Frame = +1

Query  76   KKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPSF  255
            +KPHAVC+P+PAQ HI  ML LAKLLH++GFHITFVNTE+NH+RL RSRGP +L GLPSF
Sbjct  3    QKPHAVCIPFPAQGHIKPMLCLAKLLHHRGFHITFVNTEYNHKRLLRSRGPSALDGLPSF  62

Query  256  RFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIVSD  435
            RF TIPDGLPP D D TQDIP+LC S+   CL  F+DLL  L+  +A +  PPVSC+VSD
Sbjct  63   RFRTIPDGLPPPDADVTQDIPTLCRSSRDLCLPYFRDLLQTLDEESATSGSPPVSCVVSD  122

Query  436  GIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEGYLTNGYLETEL  615
            G+MSFTL AAE  G+P VLFW  SA GFMG + Y  LVDKG +PL+D  YLTNGYL+T +
Sbjct  123  GVMSFTLDAAEAAGVPLVLFWTTSACGFMGYVQYRSLVDKGLSPLRDASYLTNGYLDTII  182

Query  616  DWVKGMKGIRL  648
            DW+ GM+ I L
Sbjct  183  DWIPGMRSISL  193



>gb|EYU19973.1| hypothetical protein MIMGU_mgv1a005383mg [Erythranthe guttata]
Length=486

 Score =   275 bits (702),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 131/193 (68%), Positives = 152/193 (79%), Gaps = 4/193 (2%)
 Frame = +1

Query  79   KPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPSFR  258
            KPHAVC+P+PAQ HIN MLKLAKLLHN GFHITFVNTE+NH RL +SRGP+SL GLPSFR
Sbjct  10   KPHAVCIPFPAQGHINPMLKLAKLLHNNGFHITFVNTEYNHHRLLKSRGPDSLTGLPSFR  69

Query  259  FETIPDGLPP---SDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIV  429
            FETIPDGLPP    D DATQDIPSLC ST  TCL PF+DLLA+LN T A++ VP VSC+V
Sbjct  70   FETIPDGLPPPSEDDADATQDIPSLCESTTNTCLAPFRDLLAKLNDT-ASSEVPHVSCVV  128

Query  430  SDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEGYLTNGYLET  609
            SDG+MSFT  AAEELGIP+VLFW  SA GF     Y  +++KGY  L D   LTNGYLET
Sbjct  129  SDGVMSFTADAAEELGIPEVLFWTTSACGFYCYTQYGNVIEKGYASLADTSCLTNGYLET  188

Query  610  ELDWVKGMKGIRL  648
             ++ +  M+G+R+
Sbjct  189  VIEGIPNMEGMRI  201



>ref|XP_009341754.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Pyrus x 
bretschneideri]
Length=485

 Score =   275 bits (702),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 131/200 (66%), Positives = 159/200 (80%), Gaps = 5/200 (3%)
 Frame = +1

Query  49   MGSNNCEFEKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGP  228
            MGS    F +KPHAVC+P+PAQ HIN ML +AKLLH KGFHITFVNTEFNH+RL +SRG 
Sbjct  1    MGS--ISFAEKPHAVCIPFPAQGHINPMLNVAKLLHFKGFHITFVNTEFNHKRLLKSRGS  58

Query  229  ESLRGLPSFRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNV  408
             SL GLPSF+FETIPDGLPP++ + TQDIPSLC ST  TCL  F++LL++LN   ++ + 
Sbjct  59   NSLDGLPSFQFETIPDGLPPTNANVTQDIPSLCHSTKKTCLPHFRELLSKLN---SSPDS  115

Query  409  PPVSCIVSDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEGYL  588
            PPVSCIVSDG+MSFTL AA+ELGIP+VLFW  SA G +  M + +L++KG TP KD  YL
Sbjct  116  PPVSCIVSDGVMSFTLDAAQELGIPEVLFWTTSACGLLAYMQFYRLIEKGLTPHKDASYL  175

Query  589  TNGYLETELDWVKGMKGIRL  648
            TNGYL+T +DW+ GMK IRL
Sbjct  176  TNGYLDTVIDWLPGMKDIRL  195



>ref|XP_011092429.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Sesamum 
indicum]
Length=478

 Score =   274 bits (701),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 130/193 (67%), Positives = 152/193 (79%), Gaps = 6/193 (3%)
 Frame = +1

Query  73   EKKPHAVCVPYPAQSHINAMLKLAKLLHNKG-FHITFVNTEFNHRRLQRSRGPESLRGLP  249
            E KPHAVC+PYPAQ H+N MLKLAKLLH+ G FHITFVNTE+NHRRL +S GP ++ GL 
Sbjct  8    ESKPHAVCIPYPAQGHVNPMLKLAKLLHHHGGFHITFVNTEYNHRRLIKSGGPSAVEGLS  67

Query  250  SFRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIV  429
             FRF TIPDGLPPSD D TQD+PSLCVST TTCL PF DLL++LN  A     PPVSCIV
Sbjct  68   DFRFHTIPDGLPPSDADTTQDVPSLCVSTTTTCLEPFCDLLSKLNSEA-----PPVSCIV  122

Query  430  SDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEGYLTNGYLET  609
            SDG+MSFTL AAE  G+P+VLFW  SA GF+G   Y +LV++G+TPL+D   +TNG+ ET
Sbjct  123  SDGVMSFTLKAAERFGLPEVLFWTTSACGFLGYRQYRRLVEEGHTPLRDMSQVTNGHFET  182

Query  610  ELDWVKGMKGIRL  648
             +DWV GMK IRL
Sbjct  183  VIDWVPGMKDIRL  195



>ref|XP_008359320.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Malus domestica]
Length=484

 Score =   275 bits (702),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 130/200 (65%), Positives = 159/200 (80%), Gaps = 5/200 (3%)
 Frame = +1

Query  49   MGSNNCEFEKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGP  228
            MGS      +KPHAVC+P+PAQ HIN ML +AKLLH KGFHITFVNT+FNH+RL +SRG 
Sbjct  1    MGS--ISLAEKPHAVCIPFPAQGHINPMLNVAKLLHFKGFHITFVNTQFNHKRLLKSRGS  58

Query  229  ESLRGLPSFRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNV  408
             SL GLPSF+FETIPDGLPP++ + TQDIPSLC ST  TCL  F++LL++LN   ++ + 
Sbjct  59   NSLDGLPSFQFETIPDGLPPTNANVTQDIPSLCHSTKKTCLPHFRELLSKLN---SSRDS  115

Query  409  PPVSCIVSDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEGYL  588
            P VSCIVSDG+MSFTL AA+ELGIP+VLFW  SA GF+  M + +L++KG TPLKD  YL
Sbjct  116  PSVSCIVSDGVMSFTLDAAQELGIPEVLFWTTSACGFLAYMQFYRLIEKGLTPLKDASYL  175

Query  589  TNGYLETELDWVKGMKGIRL  648
            TNGYL+T +DW+ GMK IRL
Sbjct  176  TNGYLDTVVDWIPGMKDIRL  195



>ref|XP_010459988.1| PREDICTED: UDP-glycosyltransferase 85A2 [Camelina sativa]
Length=484

 Score =   274 bits (701),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 127/200 (64%), Positives = 156/200 (78%), Gaps = 3/200 (2%)
 Frame = +1

Query  49   MGSNNCEFEKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGP  228
            MGS+     +KPH VCVPYPAQ HIN M+K+AKLL+ KGFH+TF NT +NH RL+RSRGP
Sbjct  1    MGSHVVPNAQKPHVVCVPYPAQGHINPMMKMAKLLYAKGFHVTFCNTVYNHNRLRRSRGP  60

Query  229  ESLRGLPSFRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNV  408
             ++ GLPSFRFE+IPDGLP +DVD TQDIPSLC STA  CL PFK+LL ++N      +V
Sbjct  61   NAVDGLPSFRFESIPDGLPETDVDVTQDIPSLCESTAKHCLAPFKELLRQIN---TNDDV  117

Query  409  PPVSCIVSDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEGYL  588
            PPVSCI+SDG MSFTL AA+ELGIP+VLFW  SA GF+  ++Y + ++KG  PLKDE YL
Sbjct  118  PPVSCILSDGCMSFTLDAAKELGIPEVLFWTTSACGFLAYLNYYRFIEKGLAPLKDESYL  177

Query  589  TNGYLETELDWVKGMKGIRL  648
            T  YL+TE+DW+  MK +RL
Sbjct  178  TKEYLDTEIDWIPMMKNLRL  197



>emb|CDP01073.1| unnamed protein product [Coffea canephora]
Length=486

 Score =   274 bits (701),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 130/200 (65%), Positives = 154/200 (77%), Gaps = 3/200 (2%)
 Frame = +1

Query  49   MGSNNCEFEKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGP  228
            MGS     + KPHA+ +P+PAQ  IN M KLAK+LH+KGFHITFV++EFN RRL +SRG 
Sbjct  1    MGSTETATKPKPHAIFIPFPAQGRINPMFKLAKILHHKGFHITFVHSEFNQRRLLKSRGK  60

Query  229  ESLRGLPSFRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNV  408
             +L GLPSF+FETIPDGLP SD DATQD+PSLC ST+  CL PF+ L+ RLN   ++  V
Sbjct  61   NALDGLPSFQFETIPDGLPFSDADATQDVPSLCDSTSKNCLAPFRQLVTRLN---SSPGV  117

Query  409  PPVSCIVSDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEGYL  588
            PPVSCIVSDGIMSFTL  A ELGIPDV FW   A G M  ++Y  LV+KGYTPLKD  YL
Sbjct  118  PPVSCIVSDGIMSFTLEVARELGIPDVFFWTNGAGGVMAYLNYRNLVEKGYTPLKDWSYL  177

Query  589  TNGYLETELDWVKGMKGIRL  648
            T+GYL+T +DW+ GMKGIRL
Sbjct  178  TDGYLDTVIDWIPGMKGIRL  197



>ref|XP_003635298.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Vitis vinifera]
Length=478

 Score =   274 bits (700),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 121/191 (63%), Positives = 154/191 (81%), Gaps = 3/191 (2%)
 Frame = +1

Query  76   KKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPSF  255
            +KPHAVCVPYP+Q H+  +++LAKL+H++GFHITFVNTEFNHRRL RS GP+S+RGL  F
Sbjct  7    RKPHAVCVPYPSQGHVTPLMQLAKLVHSRGFHITFVNTEFNHRRLIRSAGPDSVRGLVDF  66

Query  256  RFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIVSD  435
            RFE IPDGLPPSD+DATQD+P+LC ST   CL PF+DLLARLN   ++++VPPVSCI+SD
Sbjct  67   RFEAIPDGLPPSDLDATQDVPALCDSTRKNCLAPFRDLLARLN---SSSDVPPVSCIISD  123

Query  436  GIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEGYLTNGYLETEL  615
            G+MSF + AAEELGIP+V FW  SA  FMG +HY + + +G  P KDE + ++G L+T +
Sbjct  124  GVMSFAIEAAEELGIPEVQFWTASACSFMGYLHYREFIRRGIFPFKDESFRSDGTLDTPI  183

Query  616  DWVKGMKGIRL  648
            DW+ GM  IRL
Sbjct  184  DWIPGMPNIRL  194



>gb|KFK44335.1| hypothetical protein AALP_AA1G244700 [Arabis alpina]
Length=485

 Score =   273 bits (699),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 126/200 (63%), Positives = 156/200 (78%), Gaps = 3/200 (2%)
 Frame = +1

Query  49   MGSNNCEFEKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGP  228
            MGS      +KPHAVCVPYPAQ HIN MLK+AKLLH +GFH+TFVNT +NH RL RSRG 
Sbjct  1    MGSAAVSGAQKPHAVCVPYPAQGHINPMLKVAKLLHARGFHVTFVNTIYNHNRLLRSRGA  60

Query  229  ESLRGLPSFRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNV  408
             +L GLPSF+FE+IPDGLP +D +ATQDIP+LC ST   CL PFKDLL ++N   A  +V
Sbjct  61   NALDGLPSFQFESIPDGLPETDAEATQDIPALCESTMKNCLTPFKDLLQQIN---ARDDV  117

Query  409  PPVSCIVSDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEGYL  588
            PPVSCIVSDG MSFTL AA+ELG+P+VLFW  SA GF+  +H+ + ++KG +PLKDE YL
Sbjct  118  PPVSCIVSDGCMSFTLDAADELGVPEVLFWTTSACGFLAYLHFYRFIEKGLSPLKDESYL  177

Query  589  TNGYLETELDWVKGMKGIRL  648
            T  +L+T++DW+  MK +RL
Sbjct  178  TEEHLDTKIDWIPSMKNLRL  197



>ref|XP_010498706.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Camelina sativa]
Length=484

 Score =   273 bits (699),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 126/191 (66%), Positives = 153/191 (80%), Gaps = 3/191 (2%)
 Frame = +1

Query  76   KKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPSF  255
            +KPH VCVPYPAQ HIN M+K+AKLL+ KGFH+TFVNT +NH RL RSRGP+++ GL SF
Sbjct  10   QKPHVVCVPYPAQGHINPMMKMAKLLYAKGFHVTFVNTVYNHNRLLRSRGPKAVDGLASF  69

Query  256  RFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIVSD  435
            RFE+IPDGLP +DVD TQDIPSLC STA  CL PFK+LL ++N   A  +VPPVSCI+SD
Sbjct  70   RFESIPDGLPETDVDVTQDIPSLCESTAKHCLAPFKELLRQIN---ANDDVPPVSCILSD  126

Query  436  GIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEGYLTNGYLETEL  615
            G MSFTL AAEELGIP+VLFW  SA GF+  ++Y + ++KG  PLKDE YLT  YL+TE+
Sbjct  127  GCMSFTLDAAEELGIPEVLFWTTSACGFLAYLNYYRFIEKGLAPLKDESYLTKEYLDTEI  186

Query  616  DWVKGMKGIRL  648
            DW+  MK +RL
Sbjct  187  DWIPVMKNLRL  197



>ref|XP_008808008.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Phoenix dactylifera]
Length=477

 Score =   273 bits (698),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 127/191 (66%), Positives = 150/191 (79%), Gaps = 7/191 (4%)
 Frame = +1

Query  76   KKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPSF  255
            +KPH VC+PYPAQ H+  MLKLAKLLH+KGFHITFVNTEFNH RL +SRGP +L GLP F
Sbjct  7    EKPHVVCIPYPAQGHVTPMLKLAKLLHSKGFHITFVNTEFNHCRLLKSRGPSALDGLPDF  66

Query  256  RFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIVSD  435
            RF TIPDGLPPSD DATQDIPSLC ST TTCL  F+ LL+ L+        PP++CI+SD
Sbjct  67   RFATIPDGLPPSDADATQDIPSLCYSTMTTCLPHFRRLLSMLDG-------PPLTCIISD  119

Query  436  GIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEGYLTNGYLETEL  615
            G+MSFTL AA+ELG+P+VLFW  SA GFM  +HY  L++KG  PLKD   LTNGYL+T L
Sbjct  120  GVMSFTLDAAKELGVPEVLFWTTSACGFMSYLHYRHLIEKGLVPLKDASDLTNGYLDTPL  179

Query  616  DWVKGMKGIRL  648
            DW+ G+K +RL
Sbjct  180  DWIPGLKNMRL  190



>gb|ADV71371.1| glycosyltransferase GT14M03 [Pueraria montana var. lobata]
Length=485

 Score =   273 bits (698),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 132/200 (66%), Positives = 158/200 (79%), Gaps = 5/200 (3%)
 Frame = +1

Query  49   MGSNNCEFEKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGP  228
            MGS   E   KPHAVCVP+PAQ HIN MLKLAKLLH KGFHITFVNTE+NH+RL +SRGP
Sbjct  1    MGS--LEAISKPHAVCVPFPAQGHINPMLKLAKLLHFKGFHITFVNTEYNHKRLLKSRGP  58

Query  229  ESLRGLPSFRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNV  408
            +SL+GL SFRFETIPDGLP  DV+ TQ +PSLC  T  TCL  F+++L++L  + +   V
Sbjct  59   DSLKGLSSFRFETIPDGLPEPDVEVTQHVPSLCDYTRRTCLPHFRNVLSKLRDSPS---V  115

Query  409  PPVSCIVSDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEGYL  588
            PPVSCIVSDGIMSFTL AA+E G+P+VLFW  SA GFM  + Y QL+++G TPLKD  YL
Sbjct  116  PPVSCIVSDGIMSFTLDAAQEFGVPNVLFWTTSACGFMCYVQYQQLIERGLTPLKDASYL  175

Query  589  TNGYLETELDWVKGMKGIRL  648
            TNGYLET +DW+ G+K I+L
Sbjct  176  TNGYLETAIDWIPGIKEIQL  195



>emb|CDP01072.1| unnamed protein product [Coffea canephora]
Length=412

 Score =   271 bits (692),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 126/190 (66%), Positives = 150/190 (79%), Gaps = 3/190 (2%)
 Frame = +1

Query  79   KPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPSFR  258
            KPHA+ +P+PAQ  IN M KLAK+LH+KGFHITFV++EFN RRL +SRG  +L GLP+F+
Sbjct  11   KPHAIFIPFPAQGRINPMFKLAKILHHKGFHITFVHSEFNQRRLLKSRGKNALDGLPAFQ  70

Query  259  FETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIVSDG  438
            FETIPDGLP SD DATQD+PSLC ST+  CL PF+ L+ RLN   ++  VPPVSCIVSDG
Sbjct  71   FETIPDGLPFSDADATQDVPSLCDSTSKNCLAPFRQLVTRLN---SSPGVPPVSCIVSDG  127

Query  439  IMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEGYLTNGYLETELD  618
            IMSFTL  A ELGIPDV FW   A G M  ++Y  LV+KGYTPLKD  YLT+GYL+T +D
Sbjct  128  IMSFTLEVARELGIPDVFFWTNGAGGVMAYLNYRNLVEKGYTPLKDWSYLTDGYLDTVID  187

Query  619  WVKGMKGIRL  648
            W+ GMKGIRL
Sbjct  188  WIPGMKGIRL  197



>ref|XP_010039907.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Eucalyptus 
grandis]
 gb|KCW45644.1| hypothetical protein EUGRSUZ_L00599 [Eucalyptus grandis]
Length=487

 Score =   273 bits (697),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 126/193 (65%), Positives = 149/193 (77%), Gaps = 2/193 (1%)
 Frame = +1

Query  76   KKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPSF  255
            +KPHAVC+PYPAQ HIN ML LAKLLH++GFH+TFVNTE+NH RL RSRGP SL GLPSF
Sbjct  8    QKPHAVCIPYPAQGHINPMLNLAKLLHHRGFHVTFVNTEYNHSRLLRSRGPSSLDGLPSF  67

Query  256  RFETIPDGLPPSDV--DATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIV  429
            +F TIPDGLPPSD   D TQD  +LC ST+  CL  F+DLL RLN  +A +  PPVSC+V
Sbjct  68   QFRTIPDGLPPSDAAADTTQDTLALCQSTSKFCLPYFRDLLHRLNEESATSGSPPVSCVV  127

Query  430  SDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEGYLTNGYLET  609
            SDG M+FTL AAE +G+P+VL W  SA  FMG + Y  L+DKG  PLKD  YLTNGYL+T
Sbjct  128  SDGAMTFTLDAAEAIGVPEVLLWTASACSFMGYVQYRSLIDKGLAPLKDASYLTNGYLDT  187

Query  610  ELDWVKGMKGIRL  648
             +DW+ GM+ IRL
Sbjct  188  TIDWIPGMRNIRL  200



>ref|XP_007141200.1| hypothetical protein PHAVU_008G175500g [Phaseolus vulgaris]
 gb|ESW13194.1| hypothetical protein PHAVU_008G175500g [Phaseolus vulgaris]
Length=484

 Score =   273 bits (697),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 130/191 (68%), Positives = 151/191 (79%), Gaps = 4/191 (2%)
 Frame = +1

Query  76   KKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPSF  255
            KKPHAVC+PYPAQ HIN MLKLAKLLH KGFHITFVN+E+N +RL +SRG  SL  L SF
Sbjct  8    KKPHAVCIPYPAQGHINPMLKLAKLLHFKGFHITFVNSEYNQKRLLKSRGSSSLHALSSF  67

Query  256  RFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIVSD  435
            RFETIPDGLP SDVDATQDIPSLC ST  TCL  F+ LLA+LN++      PPVSCIVSD
Sbjct  68   RFETIPDGLPDSDVDATQDIPSLCESTRRTCLPHFRKLLAKLNNSDG----PPVSCIVSD  123

Query  436  GIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEGYLTNGYLETEL  615
            G+M+FTL AA+ELG+P+VLFW  SA GFM  + Y QL  KG TPLKD   +T+GYLET +
Sbjct  124  GVMTFTLDAAQELGLPEVLFWTTSACGFMCYLQYEQLFRKGITPLKDSSLVTSGYLETTI  183

Query  616  DWVKGMKGIRL  648
            DW+ G++ IRL
Sbjct  184  DWIPGIEKIRL  194



>emb|CDO97432.1| unnamed protein product [Coffea canephora]
Length=477

 Score =   272 bits (696),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 125/190 (66%), Positives = 156/190 (82%), Gaps = 3/190 (2%)
 Frame = +1

Query  79   KPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPSFR  258
            KPHA+ +PYPAQ HI  +LKLAK+LH++GF+ITFVNTEFNHRRL R+ GP+S++GL  F+
Sbjct  2    KPHALVIPYPAQGHIRPILKLAKILHSQGFYITFVNTEFNHRRLIRAHGPDSVKGLDDFQ  61

Query  259  FETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIVSDG  438
            F+TIPDGL PSD +ATQDIPSLC S   TCL PF +L+  LN ++ +   P VSCIVSDG
Sbjct  62   FKTIPDGLSPSDTNATQDIPSLCNSIQNTCLVPFLNLVKNLNESSDS---PRVSCIVSDG  118

Query  439  IMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEGYLTNGYLETELD  618
            +MSFTL AAEEL IP+V+F+ ISA GFMG +HY++LV +GY PLKDE +LTNGYL+T +D
Sbjct  119  VMSFTLQAAEELNIPEVVFFTISACGFMGYLHYAELVARGYVPLKDESWLTNGYLDTTID  178

Query  619  WVKGMKGIRL  648
            W+ GMKGIRL
Sbjct  179  WIPGMKGIRL  188



>gb|ACU19718.1| unknown [Glycine max]
Length=231

 Score =   264 bits (674),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 124/178 (70%), Positives = 147/178 (83%), Gaps = 4/178 (2%)
 Frame = +1

Query  79   KPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPSFR  258
            KPHAVC+P+PAQ HIN MLKLAKLLH KGFHITFVNTE+NH+RL ++RGP+SL GL SFR
Sbjct  10   KPHAVCIPHPAQGHINPMLKLAKLLHFKGFHITFVNTEYNHKRLLKARGPDSLNGLSSFR  69

Query  259  FETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIVSDG  438
            FETIPDGLP +D+DATQDIPSLC +T  TC   FK+LL ++N++ A    PPVSCIVSDG
Sbjct  70   FETIPDGLPETDLDATQDIPSLCEATRRTCSPHFKNLLTKINNSDA----PPVSCIVSDG  125

Query  439  IMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEGYLTNGYLETE  612
            +MSFTL AAEELG+P+VLFW  SA GFM  + Y QL++KG TPLKD  Y+TNGYL+ E
Sbjct  126  VMSFTLDAAEELGLPEVLFWTTSACGFMCYVQYEQLIEKGLTPLKDSSYITNGYLDGE  183



>gb|AID16084.1| flavonoid 3-O-glucosyltransferase, partial [Morus alba]
Length=333

 Score =   268 bits (684),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 117/190 (62%), Positives = 150/190 (79%), Gaps = 1/190 (1%)
 Frame = +1

Query  79   KPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPSFR  258
            KPH VCVPYP+Q H+N M++LAKLLH++GFH+TFVNTEFNH RL RSRG +S++GLP FR
Sbjct  8    KPHVVCVPYPSQGHVNPMMQLAKLLHSRGFHVTFVNTEFNHNRLIRSRGADSVKGLPDFR  67

Query  259  FETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIVSDG  438
            FE IP+GLPPSD DATQD+P+LC ST   CL PFK+LL +LN + A   VPPV+CI+SDG
Sbjct  68   FEAIPEGLPPSDRDATQDVPALCDSTRKNCLAPFKELLLKLN-SLAPEKVPPVTCIISDG  126

Query  439  IMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEGYLTNGYLETELD  618
            +MSF + A EELGIP+V FW  SA  FMG +H+ +L+++G  P KDE ++ +G L+T  D
Sbjct  127  VMSFAIKAGEELGIPEVQFWTASACSFMGYLHFDELINRGIIPFKDESFMEDGTLDTPAD  186

Query  619  WVKGMKGIRL  648
            W+ GMK +RL
Sbjct  187  WIPGMKNVRL  196



>ref|XP_007222664.1| hypothetical protein PRUPE_ppa004979mg [Prunus persica]
 gb|EMJ23863.1| hypothetical protein PRUPE_ppa004979mg [Prunus persica]
Length=483

 Score =   272 bits (695),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 129/200 (65%), Positives = 160/200 (80%), Gaps = 5/200 (3%)
 Frame = +1

Query  49   MGSNNCEFEKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGP  228
            MGS   +  +KPHAVC+PYPAQ HI  ML+LAKLLH KGFHITFV+TEFNHRRL +SRGP
Sbjct  1    MGS--IDLTEKPHAVCIPYPAQGHITPMLQLAKLLHYKGFHITFVHTEFNHRRLLKSRGP  58

Query  229  ESLRGLPSFRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNV  408
             SL GLPSF+FETIPDGLPP+D +ATQDI +LC+ST+  CL PF+DLL+++N   +  + 
Sbjct  59   NSLDGLPSFQFETIPDGLPPTDPNATQDITALCLSTSKNCLAPFRDLLSKVN---SVPDS  115

Query  409  PPVSCIVSDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEGYL  588
            PPV+CIVSDG M+FTL AA+ELGIP+V+F  +SA G M  + Y  L++KG  P KD  YL
Sbjct  116  PPVTCIVSDGGMTFTLDAAQELGIPEVIFETLSACGLMCYLQYRPLIEKGLMPPKDPSYL  175

Query  589  TNGYLETELDWVKGMKGIRL  648
            TNGYL+TE+DW+ GM+GIRL
Sbjct  176  TNGYLDTEIDWIPGMRGIRL  195



>ref|XP_003544799.1| PREDICTED: UDP-glycosyltransferase 85A3-like [Glycine max]
Length=472

 Score =   271 bits (694),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 133/200 (67%), Positives = 158/200 (79%), Gaps = 6/200 (3%)
 Frame = +1

Query  49   MGSNNCEFEKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGP  228
            MGS+  E    PHAVC+PYPAQ HIN MLKLAKLLH KGFHITFVNTE+NH+R+ ++RGP
Sbjct  1    MGSS--ETINMPHAVCIPYPAQGHINPMLKLAKLLHFKGFHITFVNTEYNHKRILKARGP  58

Query  229  ESLRGLPSFRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNV  408
             SL GLPSFRFETIPDGLP   V+ATQDIPSLC ST  TCL  F++LLA++N+    ++V
Sbjct  59   YSLNGLPSFRFETIPDGLPEPVVEATQDIPSLCDSTRRTCLPHFRNLLAKINN----SDV  114

Query  409  PPVSCIVSDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEGYL  588
            PPV+CIVSDG MSFTL AAEELG+P VLFW  SA GFM  + Y +L++KG  PL D  Y+
Sbjct  115  PPVTCIVSDGGMSFTLDAAEELGVPQVLFWTPSACGFMCYLQYEKLIEKGLMPLIDSSYV  174

Query  589  TNGYLETELDWVKGMKGIRL  648
            TNGYLET ++WV G+K IRL
Sbjct  175  TNGYLETTINWVPGIKEIRL  194



>ref|XP_002513939.1| UDP-glucuronosyltransferase, putative [Ricinus communis]
 gb|EEF48522.1| UDP-glucuronosyltransferase, putative [Ricinus communis]
Length=385

 Score =   269 bits (687),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 126/189 (67%), Positives = 153/189 (81%), Gaps = 15/189 (8%)
 Frame = +1

Query  70   FEKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLP  249
            F +KPHAVC+PYPAQ HIN MLKLAKLLH+KGFHITFVNTE+N+RRL +SRGP+SL GL 
Sbjct  6    FLEKPHAVCIPYPAQGHINPMLKLAKLLHHKGFHITFVNTEYNYRRLLKSRGPDSLNGLS  65

Query  250  SFRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIV  429
            SFRFETIPDGLPP+D DATQDIPSLCVST +TCL  FK++L++LN+T++  NVPPVSCI+
Sbjct  66   SFRFETIPDGLPPTDTDATQDIPSLCVSTKSTCLPHFKNILSKLNNTSS--NVPPVSCII  123

Query  430  SDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEGYLTNGYLET  609
            SDG+MSFTL AA+ELGIP+VLFW  SA GF+  +HY Q + +G+TPLK            
Sbjct  124  SDGVMSFTLDAAQELGIPEVLFWTTSACGFLAYVHYHQFIKRGFTPLK------------  171

Query  610  ELDWVKGMK  636
             +DW+K  K
Sbjct  172  -VDWIKLWK  179



>ref|XP_008219468.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Prunus mume]
Length=577

 Score =   275 bits (702),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 130/200 (65%), Positives = 156/200 (78%), Gaps = 5/200 (3%)
 Frame = +1

Query  49   MGSNNCEFEKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGP  228
            MGS      +KPHAVC+PYPAQ HI  ML+L KLLH KGFHITFVNTEFNHRRL +SRGP
Sbjct  1    MGSTG--LTEKPHAVCIPYPAQGHITPMLQLTKLLHYKGFHITFVNTEFNHRRLLKSRGP  58

Query  229  ESLRGLPSFRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNV  408
             SL GLPSFRFETIPDGLPP+D +ATQD+ +LCVST   CL PF+DLL++LN   +  + 
Sbjct  59   NSLDGLPSFRFETIPDGLPPTDTNATQDVTALCVSTRKNCLAPFRDLLSKLN---SLPDS  115

Query  409  PPVSCIVSDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEGYL  588
            PPV+CIVS+G M+FT  AA+ELGIP+V+F   SA G M  + Y  L++KG  PLKD  YL
Sbjct  116  PPVTCIVSNGGMAFTFYAAQELGIPEVIFETPSACGLMCYLQYRPLIEKGLVPLKDASYL  175

Query  589  TNGYLETELDWVKGMKGIRL  648
            TNGYL+TE+DW+ GM+GIRL
Sbjct  176  TNGYLDTEIDWIPGMRGIRL  195



>ref|XP_003615138.1| Cytokinin-O-glucosyltransferase [Medicago truncatula]
 gb|AES98096.1| UDP-glucosyltransferase family protein [Medicago truncatula]
 gb|KEH28099.1| UDP-glucosyltransferase family protein [Medicago truncatula]
Length=480

 Score =   271 bits (694),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 130/189 (69%), Positives = 151/189 (80%), Gaps = 4/189 (2%)
 Frame = +1

Query  85   HAVCVPYPAQSHINAMLKLAKLLHNKG-FHITFVNTEFNHRRLQRSRGPESLRGLPSFRF  261
            H VC+P+PAQ HIN MLKLAKLLH KG FH+TFVNTE+NH+RL ++RGP SL GLPSFRF
Sbjct  12   HVVCIPFPAQGHINPMLKLAKLLHFKGGFHVTFVNTEYNHKRLLKARGPNSLNGLPSFRF  71

Query  262  ETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIVSDGI  441
            ETIPDGLP SDVD TQDIPSLC ST  TC   FK LL++LN+   A + PPV+CIVSDG 
Sbjct  72   ETIPDGLPESDVDVTQDIPSLCESTRATCSPHFKKLLSKLNN---AIDTPPVTCIVSDGC  128

Query  442  MSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEGYLTNGYLETELDW  621
            MSFTL AA+EL IP+VLFW  SA GFM  M Y +L+++G TPLKD  Y+TNGYLET +DW
Sbjct  129  MSFTLDAAQELNIPEVLFWTTSACGFMCYMQYRKLIEEGLTPLKDSSYITNGYLETTIDW  188

Query  622  VKGMKGIRL  648
            V G+K IRL
Sbjct  189  VPGIKEIRL  197



>gb|AFK33787.1| unknown [Medicago truncatula]
Length=480

 Score =   271 bits (694),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 130/189 (69%), Positives = 151/189 (80%), Gaps = 4/189 (2%)
 Frame = +1

Query  85   HAVCVPYPAQSHINAMLKLAKLLHNKG-FHITFVNTEFNHRRLQRSRGPESLRGLPSFRF  261
            H VC+P+PAQ HIN MLKLAKLLH KG FH+TFVNTE+NH+RL ++RGP SL GLPSFRF
Sbjct  12   HVVCIPFPAQGHINPMLKLAKLLHFKGGFHVTFVNTEYNHKRLLKARGPNSLNGLPSFRF  71

Query  262  ETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIVSDGI  441
            ETIPDGLP SDVD TQDIPSLC ST  TC   FK LL++LN+   A + PPV+CIVSDG 
Sbjct  72   ETIPDGLPESDVDVTQDIPSLCESTRATCSPHFKKLLSKLNN---AIDTPPVTCIVSDGC  128

Query  442  MSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEGYLTNGYLETELDW  621
            MSFTL AA+EL IP+VLFW  SA GFM  M Y +L+++G TPLKD  Y+TNGYLET +DW
Sbjct  129  MSFTLDAAQELNIPEVLFWTTSACGFMCYMQYRKLIEEGLTPLKDSSYITNGYLETTIDW  188

Query  622  VKGMKGIRL  648
            V G+K IRL
Sbjct  189  VPGIKEIRL  197



>gb|ACJ84649.1| unknown [Medicago truncatula]
Length=480

 Score =   271 bits (694),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 135/202 (67%), Positives = 157/202 (78%), Gaps = 7/202 (3%)
 Frame = +1

Query  49   MGSNNCEFEKKP-HAVCVPYPAQSHINAMLKLAKLLHNKG-FHITFVNTEFNHRRLQRSR  222
            MGS   +  K P H VC+P+PAQ HIN MLKLAKLLH KG FH+TFVNTE+NH+RL ++R
Sbjct  1    MGS--LDITKNPSHVVCIPFPAQGHINPMLKLAKLLHFKGGFHVTFVNTEYNHKRLLKAR  58

Query  223  GPESLRGLPSFRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAAT  402
            GP SL GLPSFRFETIPDGLP SDVD TQDIPSLC ST  TC   FK LL++LN+   A 
Sbjct  59   GPNSLNGLPSFRFETIPDGLPESDVDVTQDIPSLCESTRATCSPHFKKLLSKLNN---AI  115

Query  403  NVPPVSCIVSDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEG  582
            + PPV+CIVSDG MSFTL AA+EL IP+VLFW  SA GFM  M Y +L+++G TPLKD  
Sbjct  116  DTPPVTCIVSDGCMSFTLDAAQELNIPEVLFWTTSACGFMCYMQYRKLIEEGLTPLKDSS  175

Query  583  YLTNGYLETELDWVKGMKGIRL  648
            Y+TNGYLET +DWV G+K IRL
Sbjct  176  YITNGYLETTIDWVPGIKEIRL  197



>ref|XP_003544213.2| PREDICTED: UDP-glycosyltransferase 85A2-like [Glycine max]
Length=488

 Score =   271 bits (694),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 134/208 (64%), Positives = 158/208 (76%), Gaps = 6/208 (3%)
 Frame = +1

Query  25   RSRERKREMGSNNCEFEKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHR  204
            +S+E  R M S       KPHAVCVP+P Q HIN MLKLAKLLH KGFHITFVNTE+ H+
Sbjct  2    QSKEETRNMSSLGTIL--KPHAVCVPHPTQGHINPMLKLAKLLHFKGFHITFVNTEYTHK  59

Query  205  RLQRSRGPESLRGLPSFRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLN  384
            RL +SRGP+S++GLPSFRFETIPDGLP   VDATQ IPSLC ST  TCL  F++LL ++N
Sbjct  60   RLLKSRGPDSIKGLPSFRFETIPDGLPEPLVDATQHIPSLCDSTRRTCLPHFRNLLTKIN  119

Query  385  HTAAATNVPPVSCIVSDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYT  564
             + A    PPVSCIVSDG+MSFTL AAEELG+P +LFW  SA GFM  + + QLV+KG  
Sbjct  120  DSDA----PPVSCIVSDGVMSFTLDAAEELGVPQLLFWTPSACGFMCYVQFGQLVEKGLV  175

Query  565  PLKDEGYLTNGYLETELDWVKGMKGIRL  648
            PLKD   +TNGYLET +DW+ G+K IRL
Sbjct  176  PLKDSSCITNGYLETTIDWIPGIKEIRL  203



>ref|XP_007222427.1| hypothetical protein PRUPE_ppa004909mg [Prunus persica]
 gb|EMJ23626.1| hypothetical protein PRUPE_ppa004909mg [Prunus persica]
Length=486

 Score =   271 bits (694),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 132/200 (66%), Positives = 157/200 (79%), Gaps = 5/200 (3%)
 Frame = +1

Query  49   MGSNNCEFEKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGP  228
            MGS      KKPHAVC+PYPAQ HI  MLKLAKLLH KGFHITFVNTEFNH+RL +SRGP
Sbjct  1    MGS--VALTKKPHAVCIPYPAQGHITPMLKLAKLLHYKGFHITFVNTEFNHKRLLKSRGP  58

Query  229  ESLRGLPSFRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNV  408
             SL GLPSF+FETIPDGLPPSD +ATQDIPSLC+ST+  CL PF+DLL++LN   +  + 
Sbjct  59   NSLDGLPSFQFETIPDGLPPSDDNATQDIPSLCLSTSKNCLAPFRDLLSKLN---SLPHS  115

Query  409  PPVSCIVSDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEGYL  588
            PPV+C+VSDG M+F+L AA+E GIP VLF   SA G +G + Y  L++KG  PLKD  YL
Sbjct  116  PPVTCLVSDGGMTFSLDAAQEFGIPCVLFETTSACGSLGYLQYLPLMEKGLIPLKDASYL  175

Query  589  TNGYLETELDWVKGMKGIRL  648
            TNGYL+T +DW+ GM+ IRL
Sbjct  176  TNGYLDTVIDWIPGMRHIRL  195



>gb|AFK37311.1| unknown [Medicago truncatula]
Length=480

 Score =   271 bits (693),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 135/202 (67%), Positives = 157/202 (78%), Gaps = 7/202 (3%)
 Frame = +1

Query  49   MGSNNCEFEKKP-HAVCVPYPAQSHINAMLKLAKLLHNKG-FHITFVNTEFNHRRLQRSR  222
            MGS   +  K P H VC+P+PAQ HIN MLKLAKLLH KG FH+TFVNTE+NH+RL ++R
Sbjct  1    MGS--LDITKNPSHVVCIPFPAQGHINPMLKLAKLLHFKGGFHVTFVNTEYNHKRLLKAR  58

Query  223  GPESLRGLPSFRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAAT  402
            GP SL GLPSFRFETIPDGLP SDVD TQDIPSLC ST  TC   FK LL++LN+   A 
Sbjct  59   GPNSLNGLPSFRFETIPDGLPESDVDVTQDIPSLCESTRATCSPHFKKLLSKLNN---AI  115

Query  403  NVPPVSCIVSDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEG  582
            + PPV+CIVSDG MSFTL AA+EL IP+VLFW  SA GFM  M Y +L+++G TPLKD  
Sbjct  116  DTPPVTCIVSDGCMSFTLDAAQELNIPEVLFWTTSACGFMCYMQYRKLIEEGLTPLKDSS  175

Query  583  YLTNGYLETELDWVKGMKGIRL  648
            Y+TNGYLET +DWV G+K IRL
Sbjct  176  YITNGYLETTIDWVPGIKEIRL  197



>ref|XP_010035387.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Eucalyptus 
grandis]
 gb|KCW84253.1| hypothetical protein EUGRSUZ_B01109 [Eucalyptus grandis]
Length=488

 Score =   271 bits (694),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 128/194 (66%), Positives = 151/194 (78%), Gaps = 3/194 (2%)
 Frame = +1

Query  76   KKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPSF  255
            +KPHAVC+PYPAQ HIN ML LAKLLH++GFH+TFVNTE+NH RL RSRGP SL GLPSF
Sbjct  8    QKPHAVCIPYPAQGHINPMLNLAKLLHHRGFHVTFVNTEYNHSRLLRSRGPSSLDGLPSF  67

Query  256  RFETIPDGLPPSDV--DATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATN-VPPVSCI  426
            +F TIPDGLPPSD   DATQD  +LC ST+  CL  F+DLL RLN  +A T+  PPVSC+
Sbjct  68   QFRTIPDGLPPSDAASDATQDTLALCQSTSKFCLPYFRDLLQRLNEESATTSGSPPVSCV  127

Query  427  VSDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEGYLTNGYLE  606
            VSDG M+FTL AAE + +P+VL W  SA  FMG + Y  L+DKG TPLKD  YLTNGYL+
Sbjct  128  VSDGAMTFTLDAAEAINVPEVLLWTASACSFMGYVQYRSLIDKGLTPLKDASYLTNGYLD  187

Query  607  TELDWVKGMKGIRL  648
            T +DW+ GM+ IRL
Sbjct  188  TTIDWIPGMRNIRL  201



>gb|KHN24339.1| UDP-glycosyltransferase 85A2 [Glycine soja]
Length=488

 Score =   271 bits (693),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 134/208 (64%), Positives = 158/208 (76%), Gaps = 6/208 (3%)
 Frame = +1

Query  25   RSRERKREMGSNNCEFEKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHR  204
            +S+E  R M S       KPHAVCVP+P Q HIN MLKLAKLLH KGFHITFVNTE+ H+
Sbjct  2    QSKEETRNMSSLGTI--HKPHAVCVPHPTQGHINPMLKLAKLLHFKGFHITFVNTEYTHK  59

Query  205  RLQRSRGPESLRGLPSFRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLN  384
            RL +SRGP+S++GLPSFRFETIPDGLP   VDATQ IPSLC ST  TCL  F++LL ++N
Sbjct  60   RLLKSRGPDSIKGLPSFRFETIPDGLPEPLVDATQHIPSLCDSTRRTCLPHFRNLLTKIN  119

Query  385  HTAAATNVPPVSCIVSDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYT  564
             + A    PPVSCIVSDG+MSFTL AAEELG+P +LFW  SA GFM  + + QLV+KG  
Sbjct  120  DSDA----PPVSCIVSDGVMSFTLDAAEELGVPQLLFWTPSACGFMCYVQFGQLVEKGLV  175

Query  565  PLKDEGYLTNGYLETELDWVKGMKGIRL  648
            PLKD   +TNGYLET +DW+ G+K IRL
Sbjct  176  PLKDSSCITNGYLETTIDWIPGIKEIRL  203



>ref|XP_006433960.1| hypothetical protein CICLE_v10000925mg [Citrus clementina]
 gb|ESR47200.1| hypothetical protein CICLE_v10000925mg [Citrus clementina]
Length=504

 Score =   271 bits (694),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 125/191 (65%), Positives = 154/191 (81%), Gaps = 0/191 (0%)
 Frame = +1

Query  76   KKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPSF  255
            ++PHAVCVPYPAQ HIN M +LAKLLH+KGFHITFVNTEFN RRL +S+GP+SL  +P+F
Sbjct  11   RRPHAVCVPYPAQGHINPMFQLAKLLHHKGFHITFVNTEFNQRRLLKSQGPDSLNAVPTF  70

Query  256  RFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIVSD  435
            RFETIPDGLPPSD DATQDIPSLC ST  TC  PF++LL RLN++A +   PPV+CIVSD
Sbjct  71   RFETIPDGLPPSDSDATQDIPSLCDSTRRTCSAPFQELLTRLNNSALSNVNPPVTCIVSD  130

Query  436  GIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEGYLTNGYLETEL  615
              M FTL A+++L IP+VLF+  SA GFMG +HY  LV+K   PLKD  YLTNGY+++ +
Sbjct  131  WSMGFTLKASKQLNIPNVLFFTASACGFMGYVHYRHLVEKCIFPLKDLSYLTNGYMDSVI  190

Query  616  DWVKGMKGIRL  648
            DW+  M+GI+L
Sbjct  191  DWIPVMEGIQL  201



>ref|XP_006472583.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Citrus sinensis]
Length=503

 Score =   271 bits (694),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 125/191 (65%), Positives = 152/191 (80%), Gaps = 0/191 (0%)
 Frame = +1

Query  76   KKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPSF  255
            ++PHAVCVPYPAQ HIN M +LAKLLH+KGFHITFVNTEFN RRL +S+GP+SL  +P+F
Sbjct  11   RRPHAVCVPYPAQGHINPMFQLAKLLHHKGFHITFVNTEFNQRRLLKSQGPDSLNAVPTF  70

Query  256  RFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIVSD  435
            RFETIPDGLPPSD DATQDIPSLC ST  TC  PF+ LL  LN++A +   PPV+CIVSD
Sbjct  71   RFETIPDGLPPSDADATQDIPSLCDSTRRTCSAPFQALLTTLNNSALSNANPPVTCIVSD  130

Query  436  GIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEGYLTNGYLETEL  615
              M FTL A+++L IP+VLF+  SA GFMG +HY  L +K   PLKD  YLTNGY++T +
Sbjct  131  WSMGFTLKASKQLNIPNVLFFTASACGFMGYVHYRHLAEKCIFPLKDLSYLTNGYMDTVI  190

Query  616  DWVKGMKGIRL  648
            DW+ GM+GI+L
Sbjct  191  DWIPGMEGIQL  201



>ref|XP_006472584.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Citrus sinensis]
Length=503

 Score =   271 bits (694),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 124/191 (65%), Positives = 154/191 (81%), Gaps = 0/191 (0%)
 Frame = +1

Query  76   KKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPSF  255
            ++PHAVCVP+PAQ HIN M +LAKLLH+KGFHITFVNTEFN RRL +S+GP+SL  +P+F
Sbjct  11   RRPHAVCVPHPAQGHINPMFQLAKLLHHKGFHITFVNTEFNQRRLLKSQGPDSLNAVPTF  70

Query  256  RFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIVSD  435
            RFETIPDGLPPSD DATQDIPSLC ST  TC  PF++LL RLN++A +   PPV+CIVSD
Sbjct  71   RFETIPDGLPPSDADATQDIPSLCDSTKRTCSAPFQELLTRLNNSALSNVNPPVTCIVSD  130

Query  436  GIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEGYLTNGYLETEL  615
              M FTL A+++L IP+VLF+  SA GF G +HY  LV+K   PLKD  YLTNGY+++ +
Sbjct  131  WAMGFTLKASKQLNIPNVLFFTASACGFTGYVHYRHLVEKCIFPLKDLSYLTNGYMDSVI  190

Query  616  DWVKGMKGIRL  648
            DW+ GM+GI+L
Sbjct  191  DWIPGMEGIQL  201



>ref|XP_003544801.1| PREDICTED: UDP-glycosyltransferase 85A3-like [Glycine max]
Length=479

 Score =   271 bits (692),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 131/200 (66%), Positives = 157/200 (79%), Gaps = 5/200 (3%)
 Frame = +1

Query  49   MGSNNCEFEKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGP  228
            MGS   E  KKPHAVCVP+PAQ HIN MLKLAKLLH KGFHITFVNTE+NH+RL ++RGP
Sbjct  1    MGS--LEAIKKPHAVCVPFPAQGHINPMLKLAKLLHFKGFHITFVNTEYNHKRLLKARGP  58

Query  229  ESLRGLPSFRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNV  408
            +SL GL SFRFET+ DGLP  D++ TQ +PSLC  T  TCL  F++LL++LN +    +V
Sbjct  59   DSLNGLSSFRFETLADGLPQPDIEGTQHVPSLCDYTKRTCLPHFRNLLSKLNDSP---DV  115

Query  409  PPVSCIVSDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEGYL  588
            P VSC+VSDGIMSFTL AA+ELG+P+VLFW  SA GFM  + Y QLV++  TPLKD  YL
Sbjct  116  PSVSCVVSDGIMSFTLDAAQELGVPNVLFWTTSACGFMCYVQYQQLVERDLTPLKDASYL  175

Query  589  TNGYLETELDWVKGMKGIRL  648
            TNGYLET +DW+ G+K IRL
Sbjct  176  TNGYLETSIDWIPGIKEIRL  195



>ref|XP_010676160.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Beta vulgaris 
subsp. vulgaris]
Length=483

 Score =   271 bits (692),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 130/193 (67%), Positives = 151/193 (78%), Gaps = 4/193 (2%)
 Frame = +1

Query  73   EKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPS  252
            ++KPHAVCVPYPAQ HIN ML+LAKLLH+KGFHITFVNTE+NH RL RSRGP ++   PS
Sbjct  7    QQKPHAVCVPYPAQGHINPMLQLAKLLHSKGFHITFVNTEYNHNRLVRSRGPGAVANRPS  66

Query  253  FRFETIPDGLPPS-DVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIV  429
            FRFETI DG+PPS DVD+TQDIPSLC+ST   CLGPFK LLARLN    A +VPPVSC+V
Sbjct  67   FRFETITDGMPPSDDVDSTQDIPSLCISTEKHCLGPFKRLLARLNE---AGDVPPVSCVV  123

Query  430  SDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEGYLTNGYLET  609
            SDG M FT+ AA+ELGIP+VL W  SA GF+G   + +L++ G  P KD  + TNG LE 
Sbjct  124  SDGAMFFTIDAAQELGIPEVLLWTASACGFLGYAQFGKLIELGLAPFKDANFSTNGDLEA  183

Query  610  ELDWVKGMKGIRL  648
             LDWV GMK IRL
Sbjct  184  VLDWVPGMKNIRL  196



>ref|XP_010477496.1| PREDICTED: UDP-glycosyltransferase 85A5-like [Camelina sativa]
Length=508

 Score =   271 bits (694),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 122/203 (60%), Positives = 156/203 (77%), Gaps = 3/203 (1%)
 Frame = +1

Query  40   KREMGSNNCEFEKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRS  219
            K++M S      +KPH VCVP+PAQ HIN MLK+AKLLH +GFH+TFVNT +NH+RL RS
Sbjct  20   KKKMASQTVSRGQKPHVVCVPFPAQGHINPMLKVAKLLHTRGFHVTFVNTIYNHKRLLRS  79

Query  220  RGPESLRGLPSFRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAA  399
            RGP +L G+PSFR+E+IPDGLP ++ DATQD+P LC ST   CL PFK+LL R+N    A
Sbjct  80   RGPNALNGIPSFRYESIPDGLPETNKDATQDVPPLCASTKKNCLAPFKELLRRIN---TA  136

Query  400  TNVPPVSCIVSDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDE  579
             +VPPVS IVSDGIMSFTL AAEELG+PDV+FW  SA GF+  +++   ++KG +PLKDE
Sbjct  137  DDVPPVSSIVSDGIMSFTLDAAEELGVPDVVFWTTSACGFLAYLYFYSFIEKGLSPLKDE  196

Query  580  GYLTNGYLETELDWVKGMKGIRL  648
             YLT   L+T++DW+  M+ +RL
Sbjct  197  SYLTKENLDTKIDWIPSMRNLRL  219



>ref|XP_007226586.1| hypothetical protein PRUPE_ppa023851mg [Prunus persica]
 gb|EMJ27785.1| hypothetical protein PRUPE_ppa023851mg [Prunus persica]
Length=474

 Score =   270 bits (690),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 131/198 (66%), Positives = 156/198 (79%), Gaps = 10/198 (5%)
 Frame = +1

Query  55   SNNCEFEKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPES  234
            S+NC  EK PHAVC+PYPAQ HIN MLKLAKLLH KGFHIT+VN+EFN +RL +SRGP S
Sbjct  2    SSNCLIEK-PHAVCIPYPAQGHINPMLKLAKLLHYKGFHITYVNSEFNLKRLLKSRGPNS  60

Query  235  LRGLPSFRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPP  414
            L GLPSFRFETIPDGLPP+D +ATQDIPSLC ST    L  F+DLL++LN   ++ + PP
Sbjct  61   LDGLPSFRFETIPDGLPPTDANATQDIPSLCDSTRKRSLPYFRDLLSKLN---SSPDCPP  117

Query  415  VSCIVSDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEGYLTN  594
            VSCIVSDG M FTL AA+E G+P+VLFW  SA GF+  +HY +L++      KD  YLTN
Sbjct  118  VSCIVSDGAMGFTLDAAQEFGLPEVLFWTTSACGFLAYVHYHRLIE------KDASYLTN  171

Query  595  GYLETELDWVKGMKGIRL  648
            GYLETE+DW+ GM+GIRL
Sbjct  172  GYLETEIDWIPGMRGIRL  189



>emb|CBI34065.3| unnamed protein product [Vitis vinifera]
Length=202

 Score =   261 bits (667),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 122/186 (66%), Positives = 145/186 (78%), Gaps = 1/186 (1%)
 Frame = +1

Query  79   KPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPSFR  258
            KPH V +PYPAQ H+N MLKLAKLLHNKGF ++FVNTE+NH+RL RSRGP SL GL  FR
Sbjct  9    KPHVVLIPYPAQGHVNPMLKLAKLLHNKGFFVSFVNTEYNHKRLLRSRGPNSLDGLSDFR  68

Query  259  FETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIVSDG  438
            FETIPDGLPPSD DATQDIPSLCVST   CL PF  L+ +LN  + +   PPVSCIVSDG
Sbjct  69   FETIPDGLPPSDADATQDIPSLCVSTTKNCLAPFCALITKLNDPSYSPG-PPVSCIVSDG  127

Query  439  IMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEGYLTNGYLETELD  618
            +MSFTL AAE+ G+P+V+FW  SA GF+G  HY  L+ +G  PL+DE  L+NGYL+T +D
Sbjct  128  VMSFTLDAAEKFGVPEVVFWTTSACGFLGYRHYRNLIRRGLIPLQDESCLSNGYLDTVVD  187

Query  619  WVKGMK  636
            +V G K
Sbjct  188  FVPGKK  193



>ref|XP_008219316.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Prunus mume]
Length=483

 Score =   270 bits (691),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 129/200 (65%), Positives = 155/200 (78%), Gaps = 5/200 (3%)
 Frame = +1

Query  49   MGSNNCEFEKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGP  228
            MGS      +KPHAVC+PYPAQ HI  ML+L KLLH KGFHITFVNTEFNHRRL +SRGP
Sbjct  1    MGSTG--LTEKPHAVCIPYPAQGHITPMLQLTKLLHYKGFHITFVNTEFNHRRLLKSRGP  58

Query  229  ESLRGLPSFRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNV  408
             SL GLPSFRFETIPDGLPP+D +ATQD+ +LCVST   CL PF+DLL++LN   +  + 
Sbjct  59   NSLDGLPSFRFETIPDGLPPTDTNATQDVTALCVSTRKNCLAPFRDLLSKLN---SLPDS  115

Query  409  PPVSCIVSDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEGYL  588
            PPV+CIVSDG M FTL AA+ELGIP+V+F   SA G M  +    L+++G  PL+D  YL
Sbjct  116  PPVTCIVSDGGMIFTLDAAQELGIPEVIFQTPSACGLMCYLQCRPLIERGLIPLRDASYL  175

Query  589  TNGYLETELDWVKGMKGIRL  648
            TNGYL+TE+DW+ GM+GIRL
Sbjct  176  TNGYLDTEIDWIPGMRGIRL  195



>ref|XP_010937416.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Elaeis 
guineensis]
Length=477

 Score =   270 bits (689),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 124/191 (65%), Positives = 151/191 (79%), Gaps = 7/191 (4%)
 Frame = +1

Query  76   KKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPSF  255
            +KPH VCVPYPAQ H+  MLKLAKLLH+KGF+ITFVNTEFNHRRL +S+GP SL GLP F
Sbjct  7    EKPHVVCVPYPAQGHVTPMLKLAKLLHSKGFYITFVNTEFNHRRLLKSQGPSSLDGLPDF  66

Query  256  RFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIVSD  435
            RF TIPDGLPPSD +ATQD+PSLC ST TTCL  F+ LL+ L+        PP++CI+SD
Sbjct  67   RFSTIPDGLPPSDANATQDVPSLCYSTMTTCLPHFRRLLSMLDG-------PPLTCIISD  119

Query  436  GIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEGYLTNGYLETEL  615
            G+MSFTL AA+ELG+P+VLFW  SA GFM  +HY  L+D+G  PLKD   L+NGYL+T +
Sbjct  120  GVMSFTLDAAKELGVPEVLFWTTSACGFMAYLHYRHLMDRGLVPLKDASDLSNGYLDTHV  179

Query  616  DWVKGMKGIRL  648
            DW+ G+K +RL
Sbjct  180  DWIPGLKNMRL  190



>ref|XP_002263158.1| PREDICTED: 7-deoxyloganetin glucosyltransferase [Vitis vinifera]
Length=475

 Score =   270 bits (689),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 128/190 (67%), Positives = 148/190 (78%), Gaps = 1/190 (1%)
 Frame = +1

Query  79   KPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPSFR  258
            KPH VC+P+PAQ HI  MLKLAKLLH +GFHITFVNTEFNH+RL RSRGP +L G+P F 
Sbjct  4    KPHVVCIPFPAQGHIKPMLKLAKLLHYRGFHITFVNTEFNHKRLLRSRGPHALDGMPGFC  63

Query  259  FETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIVSDG  438
            FE+IPDGLPP D DATQ IPSLC ST  +CL PF+ L+A+LN  A ++NVPPV+CIVSDG
Sbjct  64   FESIPDGLPPVDADATQHIPSLCESTPKSCLIPFQQLIAKLND-APSSNVPPVTCIVSDG  122

Query  439  IMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEGYLTNGYLETELD  618
             M FTL A+EELGIP+VLFW  SA GFM    +  L+D    PLKD  YLTNGYLET +D
Sbjct  123  SMCFTLKASEELGIPNVLFWTTSACGFMAYKQFRPLIDGVLVPLKDLSYLTNGYLETIID  182

Query  619  WVKGMKGIRL  648
            WV GMK +RL
Sbjct  183  WVPGMKNMRL  192



>ref|XP_008219456.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Prunus mume]
Length=486

 Score =   270 bits (690),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 128/191 (67%), Positives = 154/191 (81%), Gaps = 3/191 (2%)
 Frame = +1

Query  76   KKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPSF  255
            KKPHAVC+PYPAQ HI  MLKLAKLLH KGFHITFVNTEFNH+RL +SRGP SL GLPSF
Sbjct  8    KKPHAVCIPYPAQGHITPMLKLAKLLHYKGFHITFVNTEFNHKRLLKSRGPNSLDGLPSF  67

Query  256  RFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIVSD  435
            +FETIPDGLPPSD +ATQDIPSLC+ST+  CL PF DLL++LN   +  + PPV+C+VSD
Sbjct  68   QFETIPDGLPPSDDNATQDIPSLCLSTSKNCLAPFGDLLSKLN---SLPHSPPVTCLVSD  124

Query  436  GIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEGYLTNGYLETEL  615
            G M+F+L AA+E GIP VLF  +SA G +G + Y  L++KG  PLKD  Y+TNGYL+T +
Sbjct  125  GGMTFSLDAAQEFGIPCVLFETMSACGSLGYLQYLPLMEKGLIPLKDASYMTNGYLDTVI  184

Query  616  DWVKGMKGIRL  648
            DW+ GM+ IRL
Sbjct  185  DWIPGMRHIRL  195



>ref|XP_006433964.1| hypothetical protein CICLE_v10004031mg [Citrus clementina]
 gb|ESR47204.1| hypothetical protein CICLE_v10004031mg [Citrus clementina]
Length=561

 Score =   272 bits (695),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 127/206 (62%), Positives = 162/206 (79%), Gaps = 1/206 (0%)
 Frame = +1

Query  34   ERKREMGS-NNCEFEKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRL  210
            +++ EM S  + +  ++PHAVCVP+PAQ HIN M +LAKLLH+KGFHITFVNTEFN RRL
Sbjct  53   KQRAEMASLIDTQHPRRPHAVCVPHPAQGHINPMFQLAKLLHHKGFHITFVNTEFNQRRL  112

Query  211  QRSRGPESLRGLPSFRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHT  390
             +S+GP+SL  +P+FRFETIPDGLPPSD DATQDIPSLC ST  TC  PF++LL RLN++
Sbjct  113  LKSQGPDSLNAVPTFRFETIPDGLPPSDADATQDIPSLCDSTRRTCSAPFQELLTRLNNS  172

Query  391  AAATNVPPVSCIVSDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPL  570
            A +   PPV+CIVSD  M FTL A+++L IP+VLF+  SA GF G +HY  LV+K   PL
Sbjct  173  ALSNVNPPVTCIVSDWAMGFTLKASKQLNIPNVLFFTASACGFTGYVHYRHLVEKCIFPL  232

Query  571  KDEGYLTNGYLETELDWVKGMKGIRL  648
            KD  YLTNGY+++ +DW+ GM+GI+L
Sbjct  233  KDLSYLTNGYMDSVIDWIPGMEGIQL  258



>dbj|BAH56949.1| AT1G22360 [Arabidopsis thaliana]
Length=427

 Score =   268 bits (684),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 125/200 (63%), Positives = 156/200 (78%), Gaps = 6/200 (3%)
 Frame = +1

Query  49   MGSNNCEFEKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGP  228
            MGS+     +K H VCVPYPAQ HIN M+K+AKLL+ KGFHITFVNT +NH RL RSRGP
Sbjct  1    MGSH---VAQKQHVVCVPYPAQGHINPMMKVAKLLYAKGFHITFVNTVYNHNRLLRSRGP  57

Query  229  ESLRGLPSFRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNV  408
             ++ GLPSFRFE+IPDGLP +DVD TQDIP+LC ST   CL PFK+LL ++N   A  +V
Sbjct  58   NAVDGLPSFRFESIPDGLPETDVDVTQDIPTLCESTMKHCLAPFKELLRQIN---ARDDV  114

Query  409  PPVSCIVSDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEGYL  588
            PPVSCIVSDG MSFTL AAEELG+P+VLFW  SA GF+  ++Y + ++KG +P+KDE YL
Sbjct  115  PPVSCIVSDGCMSFTLDAAEELGVPEVLFWTTSACGFLAYLYYYRFIEKGLSPIKDESYL  174

Query  589  TNGYLETELDWVKGMKGIRL  648
            T  +L+T++DW+  MK +RL
Sbjct  175  TKEHLDTKIDWIPSMKNLRL  194



>ref|XP_007047909.1| UDP-glucosyl transferase 85A2 [Theobroma cacao]
 gb|EOX92066.1| UDP-glucosyl transferase 85A2 [Theobroma cacao]
Length=478

 Score =   269 bits (688),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 118/191 (62%), Positives = 155/191 (81%), Gaps = 3/191 (2%)
 Frame = +1

Query  76   KKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPSF  255
            +KPHAVC+PYP+Q H+  M++LAKLLH++GFHITFVNTEFNHRRL RS+GP+S++GLP F
Sbjct  7    RKPHAVCIPYPSQGHVTPMMQLAKLLHSRGFHITFVNTEFNHRRLIRSKGPDSVKGLPDF  66

Query  256  RFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIVSD  435
            RFETIP+GLPPSD DATQD+P+LC ST   CL PF +LL++LN +A    VPPV+CI+SD
Sbjct  67   RFETIPEGLPPSDRDATQDVPALCDSTRKNCLAPFLELLSKLNSSA---QVPPVTCIISD  123

Query  436  GIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEGYLTNGYLETEL  615
            G+MSF + AAE LGIP+V FW  SA  FMG + +S+L+++G  P K+E +L++G L+T +
Sbjct  124  GVMSFAIKAAEVLGIPEVQFWTASACSFMGYLQFSELLERGIIPFKNENFLSDGTLDTPI  183

Query  616  DWVKGMKGIRL  648
            DW+ GM  IRL
Sbjct  184  DWIPGMSNIRL  194



>ref|XP_008386105.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Malus domestica]
Length=483

 Score =   269 bits (687),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 129/191 (68%), Positives = 152/191 (80%), Gaps = 3/191 (2%)
 Frame = +1

Query  76   KKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPSF  255
            +KPHAV +PYPAQ HIN ML+LAKLL+ KGFHITFVNTEFNHRRL ++RGP SL GLPSF
Sbjct  8    EKPHAVFIPYPAQGHINPMLQLAKLLNYKGFHITFVNTEFNHRRLLKARGPNSLDGLPSF  67

Query  256  RFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIVSD  435
            RFETIPDGLP +DV+ATQDI +LC ST   CL PFKDLL++LN   +  N PPV+CIVSD
Sbjct  68   RFETIPDGLPTTDVNATQDITALCFSTRKNCLEPFKDLLSKLN---SLPNSPPVTCIVSD  124

Query  436  GIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEGYLTNGYLETEL  615
            G M+FTL AA+ELGIP V+F   SA G MG +    L++KG  PLKD  YLTNGYL+T +
Sbjct  125  GGMTFTLEAAQELGIPVVIFATASACGLMGYLQLRPLIEKGLIPLKDASYLTNGYLDTVI  184

Query  616  DWVKGMKGIRL  648
            DW+ GM+GIRL
Sbjct  185  DWIPGMRGIRL  195



>gb|AHL38933.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=481

 Score =   269 bits (687),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 125/200 (63%), Positives = 156/200 (78%), Gaps = 6/200 (3%)
 Frame = +1

Query  49   MGSNNCEFEKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGP  228
            MGS+     +K H VCVPYPAQ HIN M+K+AKLL+ KGFHITFVNT +NH RL RSRGP
Sbjct  1    MGSH---VAQKQHVVCVPYPAQGHINPMMKVAKLLYAKGFHITFVNTVYNHNRLLRSRGP  57

Query  229  ESLRGLPSFRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNV  408
             ++ GLPSFRFE+IPDGLP +DVD TQDIP+LC ST   CL PFK+LL ++N   A  +V
Sbjct  58   NAVDGLPSFRFESIPDGLPETDVDVTQDIPTLCESTMKHCLAPFKELLRQIN---ARDDV  114

Query  409  PPVSCIVSDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEGYL  588
            PPVSCIVSDG MSFTL AAEELG+P+VLFW  SA GF+  ++Y + ++KG +P+KDE YL
Sbjct  115  PPVSCIVSDGCMSFTLDAAEELGVPEVLFWTTSACGFLAYLYYYRFIEKGLSPIKDESYL  174

Query  589  TNGYLETELDWVKGMKGIRL  648
            T  +L+T++DW+  MK +RL
Sbjct  175  TKEHLDTKIDWIPSMKNLRL  194



>emb|CDP01082.1| unnamed protein product [Coffea canephora]
Length=652

 Score =   273 bits (698),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 129/193 (67%), Positives = 153/193 (79%), Gaps = 1/193 (1%)
 Frame = +1

Query  70   FEKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLP  249
             EKKPHAVC+P  AQ HI  ML LAKLLH+ GFHITFVNTEFNHRRL +SRGP++L GLP
Sbjct  7    LEKKPHAVCIPAAAQGHIGPMLNLAKLLHHNGFHITFVNTEFNHRRLLKSRGPDALNGLP  66

Query  250  SFRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIV  429
             F+F+ IPDGLPPSDVDATQDIP+L  S   TCLGPF++LLA LN T +++ VPPVSCIV
Sbjct  67   DFQFKAIPDGLPPSDVDATQDIPTLFESMDRTCLGPFRELLAELNDT-SSSKVPPVSCIV  125

Query  430  SDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEGYLTNGYLET  609
            SD    FTLAAAEEL IP+VLFW  SA  ++G   Y++L++KG  PLKD  YLTNGYL+T
Sbjct  126  SDAATGFTLAAAEELSIPEVLFWTSSACSYLGYFQYAKLMEKGIIPLKDASYLTNGYLDT  185

Query  610  ELDWVKGMKGIRL  648
             LDW+  ++GIRL
Sbjct  186  VLDWIPELEGIRL  198



>ref|NP_173653.1| UDP-glucosyl transferase 85A2 [Arabidopsis thaliana]
 sp|Q9ZWJ3.1|U85A2_ARATH RecName: Full=UDP-glycosyltransferase 85A2 [Arabidopsis thaliana]
 gb|AAF87256.1|AC068562_3 Identical to UDP-glucose glucosyltransferase from Arabidopsis 
thaliana gb|AB016819 and contains a UDP-glucosyl transferase 
PF|00201 domain. ESTs gb|T46254, gb|R83990, gb|H37246, gb|W43072, 
gb|R90721, gb|R90712, gb|AA712612, gb|AA404770 come 
from this gene [Arabidopsis thaliana]
 gb|AAG48781.1|AF332418_1 putative UDP-glucose glucosyltransferase [Arabidopsis thaliana]
 dbj|BAA34687.1| UDP-glucose glucosyltransferase [Arabidopsis thaliana]
 gb|AEE30232.1| UDP-glucosyl transferase 85A2 [Arabidopsis thaliana]
Length=481

 Score =   268 bits (686),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 125/200 (63%), Positives = 156/200 (78%), Gaps = 6/200 (3%)
 Frame = +1

Query  49   MGSNNCEFEKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGP  228
            MGS+     +K H VCVPYPAQ HIN M+K+AKLL+ KGFHITFVNT +NH RL RSRGP
Sbjct  1    MGSH---VAQKQHVVCVPYPAQGHINPMMKVAKLLYAKGFHITFVNTVYNHNRLLRSRGP  57

Query  229  ESLRGLPSFRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNV  408
             ++ GLPSFRFE+IPDGLP +DVD TQDIP+LC ST   CL PFK+LL ++N   A  +V
Sbjct  58   NAVDGLPSFRFESIPDGLPETDVDVTQDIPTLCESTMKHCLAPFKELLRQIN---ARDDV  114

Query  409  PPVSCIVSDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEGYL  588
            PPVSCIVSDG MSFTL AAEELG+P+VLFW  SA GF+  ++Y + ++KG +P+KDE YL
Sbjct  115  PPVSCIVSDGCMSFTLDAAEELGVPEVLFWTTSACGFLAYLYYYRFIEKGLSPIKDESYL  174

Query  589  TNGYLETELDWVKGMKGIRL  648
            T  +L+T++DW+  MK +RL
Sbjct  175  TKEHLDTKIDWIPSMKNLRL  194



>gb|AAL32657.1| UDP-glucose glucosyltransferase [Arabidopsis thaliana]
 gb|AAM13356.1| UDP-glucose glucosyltransferase [Arabidopsis thaliana]
Length=481

 Score =   268 bits (685),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 125/200 (63%), Positives = 156/200 (78%), Gaps = 6/200 (3%)
 Frame = +1

Query  49   MGSNNCEFEKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGP  228
            MGS+     +K H VCVPYPAQ HIN M+K+AKLL+ KGFHITFVNT +NH RL RSRGP
Sbjct  1    MGSH---VAQKQHVVCVPYPAQGHINPMMKVAKLLYAKGFHITFVNTVYNHNRLLRSRGP  57

Query  229  ESLRGLPSFRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNV  408
             ++ GLPSFRFE+IPDGLP +DVD TQDIP+LC ST   CL PFK+LL ++N   A  +V
Sbjct  58   NAVDGLPSFRFESIPDGLPETDVDVTQDIPTLCESTMKHCLAPFKELLRQIN---ARDDV  114

Query  409  PPVSCIVSDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEGYL  588
            PPVSCIVSDG MSFTL AAEELG+P+VLFW  SA GF+  ++Y + ++KG +P+KDE YL
Sbjct  115  PPVSCIVSDGCMSFTLDAAEELGVPEVLFWTTSACGFLAYLYYYRFIEKGLSPIKDESYL  174

Query  589  TNGYLETELDWVKGMKGIRL  648
            T  +L+T++DW+  MK +RL
Sbjct  175  TKEHLDTKIDWIPSMKDLRL  194



>ref|NP_001031078.1| UDP-glucosyl transferase 85A2 [Arabidopsis thaliana]
 gb|AEE30233.1| UDP-glucosyl transferase 85A2 [Arabidopsis thaliana]
Length=469

 Score =   268 bits (684),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 125/200 (63%), Positives = 156/200 (78%), Gaps = 6/200 (3%)
 Frame = +1

Query  49   MGSNNCEFEKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGP  228
            MGS+     +K H VCVPYPAQ HIN M+K+AKLL+ KGFHITFVNT +NH RL RSRGP
Sbjct  1    MGSH---VAQKQHVVCVPYPAQGHINPMMKVAKLLYAKGFHITFVNTVYNHNRLLRSRGP  57

Query  229  ESLRGLPSFRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNV  408
             ++ GLPSFRFE+IPDGLP +DVD TQDIP+LC ST   CL PFK+LL ++N   A  +V
Sbjct  58   NAVDGLPSFRFESIPDGLPETDVDVTQDIPTLCESTMKHCLAPFKELLRQIN---ARDDV  114

Query  409  PPVSCIVSDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEGYL  588
            PPVSCIVSDG MSFTL AAEELG+P+VLFW  SA GF+  ++Y + ++KG +P+KDE YL
Sbjct  115  PPVSCIVSDGCMSFTLDAAEELGVPEVLFWTTSACGFLAYLYYYRFIEKGLSPIKDESYL  174

Query  589  TNGYLETELDWVKGMKGIRL  648
            T  +L+T++DW+  MK +RL
Sbjct  175  TKEHLDTKIDWIPSMKNLRL  194



>ref|XP_008234165.1| PREDICTED: UDP-glycosyltransferase 85A5-like [Prunus mume]
Length=480

 Score =   268 bits (685),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 125/200 (63%), Positives = 158/200 (79%), Gaps = 4/200 (2%)
 Frame = +1

Query  49   MGSNNCEFEKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGP  228
            MGS   E  KK HAVCVP+PAQ H+N M++LAKLLH++GFHITFVNTEFNHRRL RS+GP
Sbjct  1    MGSIG-EAPKKLHAVCVPFPAQGHVNPMMQLAKLLHSRGFHITFVNTEFNHRRLIRSKGP  59

Query  229  ESLRGLPSFRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNV  408
            +S++GLP F+FETIPDGLPPSD DATQD+P+LC ST  TCLGPFK+L+ ++N   +++ V
Sbjct  60   DSVKGLPDFQFETIPDGLPPSDKDATQDVPALCDSTRKTCLGPFKELVTKIN---SSSQV  116

Query  409  PPVSCIVSDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEGYL  588
            P V+CIV+DG+  F   AA+ELGIP+V FW  SA GF+G + YS+LV +G  P KDE +L
Sbjct  117  PQVTCIVADGVTGFGRQAAQELGIPEVQFWTASACGFVGYLQYSELVKRGVVPFKDETFL  176

Query  589  TNGYLETELDWVKGMKGIRL  648
             +G L+T +DWV GMK  RL
Sbjct  177  HDGTLDTPIDWVPGMKNARL  196



>dbj|BAO51839.1| UDP-glycosyltransferase 85A34 [Humulus lupulus]
Length=487

 Score =   268 bits (685),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 127/196 (65%), Positives = 147/196 (75%), Gaps = 4/196 (2%)
 Frame = +1

Query  73   EKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPS  252
            E KPHAVC+PYPAQ HIN MLKLAKLLH +GFHITFVNT FNH RL +SRGP SL GLP 
Sbjct  4    ETKPHAVCIPYPAQGHINPMLKLAKLLHQRGFHITFVNTHFNHNRLLKSRGPNSLDGLPD  63

Query  253  FRFETIPDGLPPSD--VDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATN--VPPVS  420
            FRFE+IPDGLPP++   DATQDIPSLC ST  TCL PF+ LL +LN  ++++   VPPVS
Sbjct  64   FRFESIPDGLPPTENKADATQDIPSLCESTEKTCLDPFRKLLFQLNDASSSSGGAVPPVS  123

Query  421  CIVSDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEGYLTNGY  600
            C+VSD  M FTL A EE GIP  LFW ISA G +G   Y  LV+KG+TP KDE   TNGY
Sbjct  124  CVVSDPAMPFTLTAGEEFGIPVALFWTISACGLLGYTQYENLVNKGFTPFKDESSFTNGY  183

Query  601  LETELDWVKGMKGIRL  648
            L+T +DW+  +  IRL
Sbjct  184  LDTLIDWIPAVNDIRL  199



>ref|XP_009341757.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Pyrus x 
bretschneideri]
Length=483

 Score =   268 bits (685),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 125/191 (65%), Positives = 153/191 (80%), Gaps = 3/191 (2%)
 Frame = +1

Query  76   KKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPSF  255
            +KPHAVC+P+PAQ HIN ML +AKLL+ KGFHITFVNTEFNH+RL +SRG  SL GLPSF
Sbjct  8    EKPHAVCIPFPAQGHINPMLNVAKLLYLKGFHITFVNTEFNHKRLLKSRGSNSLDGLPSF  67

Query  256  RFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIVSD  435
            +FETIPDGLPP++ + TQDIPSLC ST  TCL  F +LL++LN   ++ + PPVSCIVSD
Sbjct  68   QFETIPDGLPPTNANVTQDIPSLCHSTTKTCLPHFSELLSKLN---SSPDSPPVSCIVSD  124

Query  436  GIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEGYLTNGYLETEL  615
            GIMSFTL AA++LGIP+VL W  SA GF+  + +  L++ G TPLKD  YLTNGYL+T +
Sbjct  125  GIMSFTLDAAQKLGIPEVLLWTTSACGFLAYVQFHHLIENGLTPLKDASYLTNGYLDTVI  184

Query  616  DWVKGMKGIRL  648
            DW+ GMK IRL
Sbjct  185  DWIPGMKDIRL  195



>ref|XP_010040275.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Eucalyptus 
grandis]
Length=486

 Score =   268 bits (685),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 125/198 (63%), Positives = 150/198 (76%), Gaps = 1/198 (1%)
 Frame = +1

Query  58   NNCEFEKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESL  237
            ++ +  +KPH VC+PYPAQ HIN ML LAKLLH++GFH+TFVNTE+NH RL RSRGP SL
Sbjct  2    DSIDMIQKPHVVCIPYPAQGHINPMLNLAKLLHHRGFHVTFVNTEYNHGRLLRSRGPSSL  61

Query  238  RGLPSFRFETIPDGLPPSDV-DATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPP  414
             GLPSF+F TIPDGLPPSD  DATQDIP+LC ST+  CL  F+DLL RLN  +     P 
Sbjct  62   DGLPSFQFRTIPDGLPPSDATDATQDIPALCQSTSKFCLPYFRDLLQRLNEESTTLGSPL  121

Query  415  VSCIVSDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEGYLTN  594
            VSC+VSDG M+FTL AAE +G+P+VL W  SA  FMG + Y  L+DKG TPLKD  Y TN
Sbjct  122  VSCVVSDGGMTFTLDAAEAIGVPEVLIWTASACSFMGYVQYRSLIDKGLTPLKDANYFTN  181

Query  595  GYLETELDWVKGMKGIRL  648
            G L+T +DW+ GM+ IRL
Sbjct  182  GCLDTTIDWIPGMRNIRL  199



>ref|XP_006307366.1| hypothetical protein CARUB_v10008992mg [Capsella rubella]
 gb|EOA40264.1| hypothetical protein CARUB_v10008992mg [Capsella rubella]
Length=484

 Score =   268 bits (684),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 124/200 (62%), Positives = 153/200 (77%), Gaps = 3/200 (2%)
 Frame = +1

Query  49   MGSNNCEFEKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGP  228
            MGS      +KPH VCVPYPAQ HIN M+K+AKLL+ KGFH+TFVNT +NH RL +SRGP
Sbjct  1    MGSQAIPSVQKPHVVCVPYPAQGHINPMMKVAKLLYAKGFHVTFVNTIYNHNRLLKSRGP  60

Query  229  ESLRGLPSFRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNV  408
             ++ GLPSFRFE+IPDGLP +DVD TQDIPSLC ST    L PFK LL  +N   A  +V
Sbjct  61   NAVDGLPSFRFESIPDGLPETDVDVTQDIPSLCESTVKHSLAPFKKLLREIN---AKDDV  117

Query  409  PPVSCIVSDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEGYL  588
            PPVSCIVSDG MSFTL AAEELG+P+VLFW  SA GF+  +++ + ++KG +P+KDE YL
Sbjct  118  PPVSCIVSDGCMSFTLDAAEELGVPEVLFWTTSACGFLAYLYFYRFIEKGLSPVKDESYL  177

Query  589  TNGYLETELDWVKGMKGIRL  648
            T  YL+TE+DW+  MK ++L
Sbjct  178  TKEYLDTEIDWIPMMKNLKL  197



>ref|XP_010267412.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Nelumbo 
nucifera]
Length=492

 Score =   268 bits (685),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 128/191 (67%), Positives = 155/191 (81%), Gaps = 2/191 (1%)
 Frame = +1

Query  79   KPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPSFR  258
            KPHAVC+PYPAQ HIN MLKLAKLL+++GFHITFVNT +N+RRL +SRGP SL GL  FR
Sbjct  9    KPHAVCIPYPAQGHINPMLKLAKLLNSRGFHITFVNTXYNYRRLLKSRGPNSLSGLVDFR  68

Query  259  FETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIVSDG  438
            FETIPDGLPPSD DATQDIP+LC ST  +CL PF+  L    + ++++N+PP++CI+SDG
Sbjct  69   FETIPDGLPPSDTDATQDIPTLCNSTKNSCLLPFRT-LLSKLNNSSSSNIPPITCIISDG  127

Query  439  IMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEGYLTNGYLETELD  618
            +MSFTL AAEELGIP+VLFW  SA GFM  +HY  L+++  TPLKD  YLTNGYLET +D
Sbjct  128  VMSFTLDAAEELGIPEVLFWTTSACGFMSYVHYPYLIERCLTPLKDASYLTNGYLETTID  187

Query  619  WVKG-MKGIRL  648
            W+ G MK IRL
Sbjct  188  WIPGLMKDIRL  198



>ref|XP_002885822.1| hypothetical protein ARALYDRAFT_319356 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH62081.1| hypothetical protein ARALYDRAFT_319356 [Arabidopsis lyrata subsp. 
lyrata]
Length=507

 Score =   268 bits (686),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 124/192 (65%), Positives = 149/192 (78%), Gaps = 3/192 (2%)
 Frame = +1

Query  73   EKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPS  252
            E+KPH VCVPYPAQ HIN MLKLAK+L+ +GFH+TFVNT +NH RL RSRGP +L GLPS
Sbjct  9    EQKPHVVCVPYPAQGHINPMLKLAKILYVRGFHVTFVNTIYNHNRLLRSRGPNALDGLPS  68

Query  253  FRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIVS  432
            FRFE+IPDGLP ++VDATQDI +LC +    CL PFK+LL R+N   +  NVPPVSCIVS
Sbjct  69   FRFESIPDGLPETNVDATQDISALCDAVKKNCLTPFKELLRRIN---SQQNVPPVSCIVS  125

Query  433  DGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEGYLTNGYLETE  612
            DG MSFTL AAEELG+P+VLFW  SA GFM  +H+   ++KG  PLKDE YLT  YL+T 
Sbjct  126  DGTMSFTLDAAEELGVPEVLFWTTSACGFMAYLHFHLFIEKGLCPLKDESYLTKEYLDTV  185

Query  613  LDWVKGMKGIRL  648
            +DW+  MK + L
Sbjct  186  IDWIPSMKNLTL  197



>ref|XP_008219459.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Prunus mume]
Length=483

 Score =   267 bits (683),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 124/191 (65%), Positives = 154/191 (81%), Gaps = 3/191 (2%)
 Frame = +1

Query  76   KKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPSF  255
            +KPHAVC+PYPAQ H+  ML+LAKLLH KGFHITFV+TEFNHRRL +SRGP SL GLP F
Sbjct  8    EKPHAVCIPYPAQGHVTPMLQLAKLLHYKGFHITFVHTEFNHRRLLKSRGPNSLDGLPFF  67

Query  256  RFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIVSD  435
            RFETIPDGLPP+D +ATQDI +LC+ST+  CL PF+DLL+++N   +  + PPV+ IVSD
Sbjct  68   RFETIPDGLPPTDANATQDITALCLSTSKNCLAPFRDLLSKVN---SVPDSPPVTSIVSD  124

Query  436  GIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEGYLTNGYLETEL  615
            G M+FTL AA+ELGIP+V+   +SA G M  + Y  L++KG  PLKD  YLTNGYL+TE+
Sbjct  125  GGMTFTLDAAQELGIPEVILETLSACGLMCYLQYRPLIEKGLMPLKDPSYLTNGYLDTEI  184

Query  616  DWVKGMKGIRL  648
            DW+ GM+GIRL
Sbjct  185  DWIPGMRGIRL  195



>gb|KEH17174.1| UDP-glucosyltransferase family protein [Medicago truncatula]
Length=479

 Score =   267 bits (682),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 129/190 (68%), Positives = 151/190 (79%), Gaps = 4/190 (2%)
 Frame = +1

Query  82   PHAVCVPYPAQSHINAMLKLAKLLHNKG-FHITFVNTEFNHRRLQRSRGPESLRGLPSFR  258
            PH VCVPYPAQ HIN ML +AKLLH KG FH+TFVNTE+NH+R  ++RGP+SL GLP+FR
Sbjct  11   PHVVCVPYPAQGHINPMLNIAKLLHFKGGFHVTFVNTEYNHKRHLKARGPDSLNGLPTFR  70

Query  259  FETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIVSDG  438
            FETIPDGLP S+VD+TQDIPSLC ST  TCL  FK+LL++LN    A + PPV+CIVSDG
Sbjct  71   FETIPDGLPESNVDSTQDIPSLCESTRKTCLPHFKNLLSKLND---ALDTPPVTCIVSDG  127

Query  439  IMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEGYLTNGYLETELD  618
            +MSFTL AA+EL IP VLFW  SA GFM    Y QL++KG TPLKD   +TNGYLET +D
Sbjct  128  VMSFTLDAAQELNIPQVLFWTTSACGFMCYAQYRQLMEKGLTPLKDWSDMTNGYLETPID  187

Query  619  WVKGMKGIRL  648
            WV G+K IRL
Sbjct  188  WVPGIKEIRL  197



>ref|XP_010498707.1| PREDICTED: UDP-glycosyltransferase 85A5-like [Camelina sativa]
Length=486

 Score =   267 bits (683),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 119/191 (62%), Positives = 152/191 (80%), Gaps = 3/191 (2%)
 Frame = +1

Query  76   KKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPSF  255
            +KPH VCVP+ AQ HIN MLK+AK+LH KGFH+TFVNT +NHRRL RSRGP++L GLPSF
Sbjct  10   QKPHVVCVPFAAQGHINPMLKVAKILHAKGFHVTFVNTNYNHRRLLRSRGPKALNGLPSF  69

Query  256  RFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIVSD  435
            ++E+IPDGLP ++ DATQDIP LC ST   CL PFK+LL R+N    A +VPPVSCIVSD
Sbjct  70   QYESIPDGLPETNEDATQDIPLLCASTKKNCLAPFKELLRRIN---TAEDVPPVSCIVSD  126

Query  436  GIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEGYLTNGYLETEL  615
            G MSFTL AAEELG+P+V  W  SA GF+  +H+ ++++KG +PLKDE YLT  +L+T++
Sbjct  127  GTMSFTLDAAEELGVPNVALWTTSACGFLAYLHFHRIIEKGLSPLKDESYLTKEHLDTKI  186

Query  616  DWVKGMKGIRL  648
            DW+  M+ +RL
Sbjct  187  DWIPSMRNLRL  197



>dbj|BAO51841.1| UDP-glycosyltransferase 85A35 [Humulus lupulus]
Length=487

 Score =   267 bits (682),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 126/196 (64%), Positives = 147/196 (75%), Gaps = 4/196 (2%)
 Frame = +1

Query  73   EKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPS  252
            E KPHAVC+PYPAQ HIN MLKLAKLLH +GFHITFVNT FNH R+ +SRGP SL GLP 
Sbjct  4    ETKPHAVCIPYPAQGHINPMLKLAKLLHQRGFHITFVNTHFNHNRILKSRGPNSLDGLPD  63

Query  253  FRFETIPDGLPPSD--VDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATN--VPPVS  420
            FRFE+IPDGLPP++   DATQDIPSLC ST  TCL PF+ LL +LN  ++++   VPPVS
Sbjct  64   FRFESIPDGLPPTENKADATQDIPSLCESTEKTCLDPFRKLLFQLNDASSSSGGAVPPVS  123

Query  421  CIVSDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEGYLTNGY  600
            C+VSD  M FTL A EE GIP  LFW ISA G +G   Y  LV+KG+TP KDE   TNGY
Sbjct  124  CVVSDAAMPFTLKAGEEFGIPVALFWTISACGLLGYTQYENLVNKGFTPFKDESSFTNGY  183

Query  601  LETELDWVKGMKGIRL  648
            L+T +DW+  +  IRL
Sbjct  184  LDTLIDWIPVVNDIRL  199



>gb|EYU43443.1| hypothetical protein MIMGU_mgv1a018722mg [Erythranthe guttata]
Length=475

 Score =   266 bits (681),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 132/195 (68%), Positives = 151/195 (77%), Gaps = 6/195 (3%)
 Frame = +1

Query  79   KPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPSFR  258
            KPHAVC+P+PAQ HIN MLKLAKLLHN GFHITFVNTE+NH RL +SRGP+SL GLPSFR
Sbjct  9    KPHAVCIPFPAQGHINPMLKLAKLLHNNGFHITFVNTEYNHHRLLKSRGPDSLTGLPSFR  68

Query  259  FETIPDGLPP-----SDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSC  423
            FETIPDGLPP     +D DATQDIPSLC ST TTCL PF++LLA+LN T A++ VPPVSC
Sbjct  69   FETIPDGLPPPSEDDADADATQDIPSLCESTTTTCLAPFRNLLAKLNDT-ASSEVPPVSC  127

Query  424  IVSDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEGYLTNGYL  603
            IVSDG+MSFT  AAEEL IP+VLFW  SA GF     Y  +  K Y PL D    TNGYL
Sbjct  128  IVSDGVMSFTADAAEELAIPEVLFWTTSACGFYAYTQYEYVFQKEYAPLADASCFTNGYL  187

Query  604  ETELDWVKGMKGIRL  648
            ET ++ +  M+GIR+
Sbjct  188  ETVIEGIPSMEGIRM  202



>ref|XP_002525850.1| UDP-glucuronosyltransferase, putative [Ricinus communis]
 gb|EEF36544.1| UDP-glucuronosyltransferase, putative [Ricinus communis]
Length=480

 Score =   267 bits (682),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 125/191 (65%), Positives = 152/191 (80%), Gaps = 4/191 (2%)
 Frame = +1

Query  79   KPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPSFR  258
            KPHAVC+PYPAQ HIN MLKLAKLLH +GF+ITF+NTE   RRL +SRGP++L GLP F+
Sbjct  7    KPHAVCIPYPAQGHINPMLKLAKLLHQRGFYITFINTEHMQRRLLKSRGPDALNGLPDFQ  66

Query  259  FETIPDGLPPS-DVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIVSD  435
            FETIPDGLPPS D+D+TQDI +L  S    C  PF++LLA+L    ++ NVPP++CIVSD
Sbjct  67   FETIPDGLPPSPDLDSTQDILALAQSVTNNCPVPFRNLLAKLE---SSPNVPPITCIVSD  123

Query  436  GIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEGYLTNGYLETEL  615
            GIMSFTL AAEE+G+P VLFW  SA GF+   +  QLV++G  PLKDE YLTNGYL+T +
Sbjct  124  GIMSFTLDAAEEIGVPGVLFWTASACGFLAYAYNKQLVERGLIPLKDESYLTNGYLDTTV  183

Query  616  DWVKGMKGIRL  648
            DW+ GMKGIRL
Sbjct  184  DWIPGMKGIRL  194



>dbj|BAO51838.1| UDP-glycosyltransferase 85A36 [Humulus lupulus]
Length=487

 Score =   267 bits (682),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 126/196 (64%), Positives = 147/196 (75%), Gaps = 4/196 (2%)
 Frame = +1

Query  73   EKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPS  252
            E KPHAVC+PYPAQ HI+ MLKLAKLLH +GFHITFVNT FNH RL +SRGP SL GLP 
Sbjct  4    ETKPHAVCIPYPAQGHISPMLKLAKLLHQRGFHITFVNTHFNHNRLLKSRGPNSLDGLPD  63

Query  253  FRFETIPDGLPPSD--VDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATN--VPPVS  420
            FRFE+IPDGLPP++   DATQDIPSLC ST  TCL PF+ LL +LN  ++++   VPPVS
Sbjct  64   FRFESIPDGLPPTENKADATQDIPSLCESTEKTCLDPFRKLLFQLNDASSSSGGAVPPVS  123

Query  421  CIVSDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEGYLTNGY  600
            C+VSD  M FTL A EE GIP  LFW ISA G +G   Y  LV+KG+TP KDE   TNGY
Sbjct  124  CVVSDASMPFTLKAGEEFGIPVALFWTISACGLLGYTQYENLVNKGFTPFKDESSFTNGY  183

Query  601  LETELDWVKGMKGIRL  648
            L+T +DW+  +  IRL
Sbjct  184  LDTLIDWIPAVNDIRL  199



>ref|XP_010535401.1| PREDICTED: UDP-glycosyltransferase 85A1-like isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010535409.1| PREDICTED: UDP-glycosyltransferase 85A1-like isoform X2 [Tarenaya 
hassleriana]
Length=487

 Score =   267 bits (682),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 123/200 (62%), Positives = 150/200 (75%), Gaps = 2/200 (1%)
 Frame = +1

Query  49   MGSNNCEFEKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGP  228
            MG +     +KPHAVC+PYPAQ HIN M+K+AKLLH +GFH+TFVNTEFNHRR  RSRGP
Sbjct  1    MGKHADSGSQKPHAVCIPYPAQGHINPMMKVAKLLHARGFHVTFVNTEFNHRRFLRSRGP  60

Query  229  ESLRGLPSFRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNV  408
             +L GL SFRFETIPDGLP SD+DATQDIP+LC ST   CL PF++LL RLN T    ++
Sbjct  61   HALDGLRSFRFETIPDGLPESDLDATQDIPALCQSTMKNCLSPFRELLQRLNATGG--DI  118

Query  409  PPVSCIVSDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEGYL  588
            P VSC+V DG MSF + AA E GIP V+ W  SAS  M   +Y QL+ KG  PLKDE Y+
Sbjct  119  PSVSCVVYDGAMSFAVDAAAEFGIPAVMLWTFSASVSMLYFYYRQLIQKGLIPLKDESYM  178

Query  589  TNGYLETELDWVKGMKGIRL  648
            TNGYL+TE++W+  ++ IR+
Sbjct  179  TNGYLDTEIEWIPSIRNIRV  198



>ref|XP_006307682.1| hypothetical protein CARUB_v10009316mg [Capsella rubella]
 gb|EOA40580.1| hypothetical protein CARUB_v10009316mg [Capsella rubella]
Length=406

 Score =   264 bits (675),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 122/200 (61%), Positives = 152/200 (76%), Gaps = 3/200 (2%)
 Frame = +1

Query  49   MGSNNCEFEKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGP  228
            MGS      +KPH VCVPYPAQ HIN MLK+AKLL+ KGFH+TFVNT +NH RL RSRGP
Sbjct  1    MGSPAVSSGQKPHVVCVPYPAQGHINPMLKVAKLLYAKGFHVTFVNTVYNHNRLLRSRGP  60

Query  229  ESLRGLPSFRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNV  408
             +L GLPSFRFE+IPDGLP +D D TQD PS+CVST   CL PFK LL R+N+     +V
Sbjct  61   NALDGLPSFRFESIPDGLPETDGDRTQDTPSVCVSTEKNCLAPFKKLLRRINN---GDDV  117

Query  409  PPVSCIVSDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEGYL  588
            PPVSCIVSDG+MSFTL AAEELG+P+V+FW  SA GF+  +H+   ++KG +P +DE Y+
Sbjct  118  PPVSCIVSDGVMSFTLDAAEELGVPEVIFWTNSACGFITFLHFHLFIEKGLSPFRDESYM  177

Query  589  TNGYLETELDWVKGMKGIRL  648
            +  +L+T +DW+  MK +RL
Sbjct  178  SKEHLDTIIDWIPSMKNLRL  197



>ref|XP_007207189.1| hypothetical protein PRUPE_ppa017055mg [Prunus persica]
 gb|EMJ08388.1| hypothetical protein PRUPE_ppa017055mg [Prunus persica]
Length=482

 Score =   266 bits (680),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 120/191 (63%), Positives = 153/191 (80%), Gaps = 2/191 (1%)
 Frame = +1

Query  76   KKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPSF  255
            KK HAV VPYPAQ H++ M++LAKLLH++ FHITFVNTEFNH RL RS+GP+S++GLP F
Sbjct  9    KKLHAVFVPYPAQGHVSPMMQLAKLLHSRDFHITFVNTEFNHMRLVRSKGPDSIKGLPDF  68

Query  256  RFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIVSD  435
            RFETIPDGLPPSD DATQDIP+LC ST  TCLGPFK+L+ +LN++++ T  PPV+C+V+D
Sbjct  69   RFETIPDGLPPSDKDATQDIPALCDSTRKTCLGPFKELVIKLNNSSSET--PPVTCVVTD  126

Query  436  GIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEGYLTNGYLETEL  615
            G+M F   AA+ELGIP+V FW  SA GFM  + Y +LV +G  P KDE ++ NG L+T +
Sbjct  127  GLMGFGSKAAKELGIPEVQFWTASACGFMAYLQYGELVKRGIVPFKDENFMHNGTLDTPI  186

Query  616  DWVKGMKGIRL  648
            DW+ GMK +RL
Sbjct  187  DWIPGMKDVRL  197



>emb|CDY21359.1| BnaA09g30680D [Brassica napus]
Length=418

 Score =   264 bits (675),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 123/191 (64%), Positives = 149/191 (78%), Gaps = 3/191 (2%)
 Frame = +1

Query  76   KKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPSF  255
            +K H VCVPYPAQ HIN M+K+AKLLH KGF++TFVNT +NH+RL RSRG  +L GLPSF
Sbjct  10   RKQHVVCVPYPAQGHINPMMKVAKLLHAKGFYVTFVNTIYNHKRLLRSRGSNALDGLPSF  69

Query  256  RFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIVSD  435
            RFE+IPDGLP +DVD TQDIPSLC ST    L PFK+LL R+N   A   VPPV+CIVSD
Sbjct  70   RFESIPDGLPETDVDVTQDIPSLCESTPKYSLAPFKELLRRIN---AQDEVPPVNCIVSD  126

Query  436  GIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEGYLTNGYLETEL  615
            G MSFTL AAEELG+P+VLFW  SA GF+  +HY + ++KG +PLKDE YLT  +L+T +
Sbjct  127  GCMSFTLDAAEELGVPEVLFWTTSACGFLAYLHYHKFIEKGLSPLKDESYLTKEHLDTII  186

Query  616  DWVKGMKGIRL  648
            DW+  MK +RL
Sbjct  187  DWIPSMKNLRL  197



>ref|XP_007208223.1| hypothetical protein PRUPE_ppa018343mg [Prunus persica]
 gb|EMJ09422.1| hypothetical protein PRUPE_ppa018343mg [Prunus persica]
Length=480

 Score =   266 bits (680),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 122/200 (61%), Positives = 159/200 (80%), Gaps = 4/200 (2%)
 Frame = +1

Query  49   MGSNNCEFEKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGP  228
            MGS   E  KK HAVCVP+PAQ H++ +++LAKLLH++GFHITFVNTEFNHRRL RS+GP
Sbjct  1    MGSVR-EATKKLHAVCVPFPAQGHVSPVMQLAKLLHSRGFHITFVNTEFNHRRLIRSKGP  59

Query  229  ESLRGLPSFRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNV  408
            +S++GLP F+FETIPDGLPPSD DATQD+P+LC ST  TCLGPFK+L+ ++N   +++ V
Sbjct  60   DSVKGLPDFQFETIPDGLPPSDKDATQDVPALCDSTRKTCLGPFKELVTKIN---SSSQV  116

Query  409  PPVSCIVSDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEGYL  588
            P V+CIV+DGI  F   AA+ELGIP+V FW  SA GF+G + YS+LV +G  P K+E +L
Sbjct  117  PQVTCIVADGITGFGRQAAQELGIPEVQFWTASACGFLGYLQYSELVKRGIVPFKEETFL  176

Query  589  TNGYLETELDWVKGMKGIRL  648
             +G L+T +DW+ GMK +RL
Sbjct  177  HDGTLDTPIDWIPGMKNVRL  196



>ref|XP_009145347.1| PREDICTED: UDP-glycosyltransferase 85A2 isoform X3 [Brassica 
rapa]
Length=483

 Score =   266 bits (680),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 123/191 (64%), Positives = 149/191 (78%), Gaps = 3/191 (2%)
 Frame = +1

Query  76   KKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPSF  255
            +K H VCVPYPAQ HIN M+K+AKLLH KGF++TFVNT +NH+RL RSRG  +L GLPSF
Sbjct  10   RKQHVVCVPYPAQGHINPMMKVAKLLHAKGFYVTFVNTIYNHKRLLRSRGSNALDGLPSF  69

Query  256  RFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIVSD  435
            RFE+IPDGLP +DVD TQDIPSLC ST    L PFK+LL R+N   A   VPPV+CIVSD
Sbjct  70   RFESIPDGLPETDVDVTQDIPSLCESTPKYSLAPFKELLRRIN---AQDEVPPVNCIVSD  126

Query  436  GIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEGYLTNGYLETEL  615
            G MSFTL AAEELG+P+VLFW  SA GF+  +HY + ++KG +PLKDE YLT  +L+T +
Sbjct  127  GCMSFTLDAAEELGVPEVLFWTTSACGFLAYLHYHKFIEKGLSPLKDESYLTKEHLDTII  186

Query  616  DWVKGMKGIRL  648
            DW+  MK +RL
Sbjct  187  DWIPSMKNLRL  197



>ref|XP_007141201.1| hypothetical protein PHAVU_008G175600g [Phaseolus vulgaris]
 gb|ESW13195.1| hypothetical protein PHAVU_008G175600g [Phaseolus vulgaris]
Length=479

 Score =   266 bits (679),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 126/190 (66%), Positives = 150/190 (79%), Gaps = 2/190 (1%)
 Frame = +1

Query  79   KPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPSFR  258
            KPHAVCVP+PAQ HIN MLKLAKLLH+ GFHITFVNTE NH+RL +SRG +SL GLPSFR
Sbjct  9    KPHAVCVPFPAQGHINPMLKLAKLLHSNGFHITFVNTECNHKRLLKSRGLDSLNGLPSFR  68

Query  259  FETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIVSDG  438
            F+TIPDGLP  D + T  +PSLC ST  TCL  F++LL++LN+      VP VSCIVSDG
Sbjct  69   FQTIPDGLPEPDDEGTHQVPSLCDSTRATCLPHFRNLLSKLNNDCPG--VPAVSCIVSDG  126

Query  439  IMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEGYLTNGYLETELD  618
            +MSFTL A++ELGIP+VLFW  SA GFM  +HY+QLV +G  PLKD  YL NGYL+T +D
Sbjct  127  VMSFTLDASQELGIPNVLFWTSSACGFMCYVHYNQLVQRGIVPLKDASYLKNGYLDTTID  186

Query  619  WVKGMKGIRL  648
            W+ G+K IRL
Sbjct  187  WIAGIKEIRL  196



>emb|CDY46643.1| BnaA07g10530D [Brassica napus]
Length=491

 Score =   266 bits (679),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 124/200 (62%), Positives = 154/200 (77%), Gaps = 3/200 (2%)
 Frame = +1

Query  49   MGSNNCEFEKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGP  228
            MGS+     +KPH VC+PYPAQ HIN MLK+AKLLH KGFH+TFVNT +NH+RL RSRGP
Sbjct  1    MGSHVVCNVQKPHVVCIPYPAQGHINPMLKVAKLLHAKGFHVTFVNTIYNHKRLLRSRGP  60

Query  229  ESLRGLPSFRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNV  408
             +L GLPSF+FE IPDGLP ++VDATQDIP+LC ST   CL PFK+LL ++N   A  +V
Sbjct  61   NALDGLPSFQFEAIPDGLPETEVDATQDIPTLCESTMKNCLTPFKELLRQIN---ARKDV  117

Query  409  PPVSCIVSDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEGYL  588
            PPVSCIVSDG+MSFTL AAEELG+P+VLFW  SASG M  +H+   ++KG  P +DE  L
Sbjct  118  PPVSCIVSDGVMSFTLDAAEELGLPEVLFWTPSASGVMAYLHFYLFIEKGLFPFEDESCL  177

Query  589  TNGYLETELDWVKGMKGIRL  648
            TN +L+T +DW+  M  ++L
Sbjct  178  TNEHLDTSIDWIPSMNNLKL  197



>dbj|BAG80552.1| UDP-glucose:glucosyltransferase [Lycium barbarum]
Length=490

 Score =   266 bits (679),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 122/190 (64%), Positives = 148/190 (78%), Gaps = 3/190 (2%)
 Frame = +1

Query  79   KPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPSFR  258
            KPHAVC+P+PAQ HIN MLKLAKLLH +GFHITFVNTEFNHRRL +SRGP SL GL SFR
Sbjct  11   KPHAVCIPFPAQGHINPMLKLAKLLHIRGFHITFVNTEFNHRRLLKSRGPYSLNGLSSFR  70

Query  259  FETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIVSDG  438
            F++IPDGLPPS+ DATQD+PSLC +  T CL PF+DL+ RLN  ++    PP+SCI+SD 
Sbjct  71   FQSIPDGLPPSNEDATQDVPSLCEACKTVCLAPFRDLVTRLNDNSS---FPPISCIISDA  127

Query  439  IMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEGYLTNGYLETELD  618
             MSFTL  +EELGIP + FW  S      ++ Y +LV+ GY PLKDE YL NG+L+T +D
Sbjct  128  AMSFTLQVSEELGIPYLGFWTGSGCSLWALIQYPKLVEGGYFPLKDESYLINGHLDTIID  187

Query  619  WVKGMKGIRL  648
            W+ GM+GIRL
Sbjct  188  WIPGMEGIRL  197



>ref|XP_010060021.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like isoform 
X1 [Eucalyptus grandis]
Length=499

 Score =   266 bits (680),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 120/195 (62%), Positives = 149/195 (76%), Gaps = 0/195 (0%)
 Frame = +1

Query  58   NNCEFEKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESL  237
            ++ E  + PHAVC+PYPAQ HIN ML L KLLH++GFH+TFVNTE+NH RL RSR P SL
Sbjct  2    SSIEMTQMPHAVCIPYPAQGHINPMLNLPKLLHHRGFHVTFVNTEYNHSRLLRSRDPSSL  61

Query  238  RGLPSFRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPV  417
             GLPSF+F TIPDGLPPSD DATQD+P+LC ST  +CL   +DLL RLN  +A +  P V
Sbjct  62   DGLPSFQFRTIPDGLPPSDADATQDVPALCQSTQKSCLPYLRDLLERLNEESATSGSPSV  121

Query  418  SCIVSDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEGYLTNG  597
            SC+VSDG+MSFTL AA+ + +P+VLFW +SA GFMG + Y  L+DKG  PLKD  YLTN 
Sbjct  122  SCVVSDGVMSFTLDAAKAVSMPEVLFWTMSACGFMGYVQYRSLIDKGLAPLKDASYLTNV  181

Query  598  YLETELDWVKGMKGI  642
            YL+T +DW+  ++ I
Sbjct  182  YLDTIVDWIPSIRNI  196



>ref|XP_009103242.1| PREDICTED: UDP-glycosyltransferase 85A3-like [Brassica rapa]
Length=491

 Score =   266 bits (679),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 123/200 (62%), Positives = 154/200 (77%), Gaps = 3/200 (2%)
 Frame = +1

Query  49   MGSNNCEFEKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGP  228
            MGS+     +KPH VC+PYPAQ HIN MLK+AKLLH KGFH+TFVNT +NH+RL RSRGP
Sbjct  1    MGSHVVCNVQKPHVVCIPYPAQGHINPMLKVAKLLHAKGFHVTFVNTIYNHKRLLRSRGP  60

Query  229  ESLRGLPSFRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNV  408
             +L GLPSF+FE IPDGLP ++VDATQDIP+LC ST   CL PFK+LL ++N   A  +V
Sbjct  61   NALDGLPSFQFEAIPDGLPETEVDATQDIPTLCESTMKNCLTPFKELLRQIN---ARKDV  117

Query  409  PPVSCIVSDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEGYL  588
            PP+SCIVSDG+MSFTL AAEELG+P+VLFW  SASG M  +H+   ++KG  P +DE  L
Sbjct  118  PPISCIVSDGVMSFTLDAAEELGLPEVLFWTPSASGVMAYLHFYLFIEKGLFPFEDESCL  177

Query  589  TNGYLETELDWVKGMKGIRL  648
            TN +L+T +DW+  M  ++L
Sbjct  178  TNEHLDTSIDWIPSMNNLKL  197



>gb|KFK44331.1| hypothetical protein AALP_AA1G244300 [Arabis alpina]
Length=483

 Score =   265 bits (678),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 122/200 (61%), Positives = 149/200 (75%), Gaps = 3/200 (2%)
 Frame = +1

Query  49   MGSNNCEFEKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGP  228
            M S      +KPH VCVP+PAQ HIN MLK+AKLLH KGFH+TFVNT +NH RL RSRGP
Sbjct  1    MASPAVPSSRKPHVVCVPHPAQGHINPMLKVAKLLHAKGFHVTFVNTIYNHNRLLRSRGP  60

Query  229  ESLRGLPSFRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNV  408
            ++L GLPSFRFE+IPDGLP SD D TQDIP+LCVST   CL PF +LL R+N      +V
Sbjct  61   DALDGLPSFRFESIPDGLPESDGDTTQDIPALCVSTTKNCLAPFMELLRRIN---TRDDV  117

Query  409  PPVSCIVSDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEGYL  588
            PPVSCI+SDG+MSFTL AAEELG+PDV FW  SA GFM ++ +   ++KG  P KDE Y+
Sbjct  118  PPVSCIISDGVMSFTLDAAEELGVPDVFFWTPSACGFMALLQFPHFIEKGVAPFKDESYM  177

Query  589  TNGYLETELDWVKGMKGIRL  648
            +  +L+T +DW+  M  +RL
Sbjct  178  SKEHLDTVIDWIPSMNNLRL  197



>ref|XP_009387949.1| PREDICTED: UDP-glycosyltransferase 85A2-like, partial [Musa acuminata 
subsp. malaccensis]
Length=249

 Score =   258 bits (658),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 120/195 (62%), Positives = 146/195 (75%), Gaps = 5/195 (3%)
 Frame = +1

Query  64   CEFEKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRG  243
            C   +KPH VC+PYPAQ H+  M+ LAKLLH+ GFHITFVNT++NHRRL RS+   S   
Sbjct  3    CMTTRKPHVVCIPYPAQGHVTPMMMLAKLLHSHGFHITFVNTQYNHRRLLRSKALSSDDV  62

Query  244  LPSFRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSC  423
            LP FRFE+IPDGLPPSD DATQDIPSLC S     L PF DLL +LN  +     PPVSC
Sbjct  63   LPDFRFESIPDGLPPSDKDATQDIPSLCESIQNNALPPFLDLLRQLNEGS-----PPVSC  117

Query  424  IVSDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEGYLTNGYL  603
            +VSDGIMSFTL AA+EL IP+V+FW  SA GFMG +HY  L+++G TPLKDE  +TNGYL
Sbjct  118  VVSDGIMSFTLDAAKELSIPEVMFWTPSACGFMGYLHYKHLLERGLTPLKDESDITNGYL  177

Query  604  ETELDWVKGMKGIRL  648
            +  ++W+ G+K +RL
Sbjct  178  DMAVEWIPGLKNMRL  192



>ref|XP_009145349.1| PREDICTED: UDP-glycosyltransferase 85A7 isoform X1 [Brassica 
rapa]
 ref|XP_009145350.1| PREDICTED: UDP-glycosyltransferase 85A7 isoform X1 [Brassica 
rapa]
Length=482

 Score =   265 bits (678),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 122/192 (64%), Positives = 148/192 (77%), Gaps = 4/192 (2%)
 Frame = +1

Query  76   KKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPSF  255
            +KPH VCVP+PAQ HIN MLK+AKLLH KGFH+TFVNT +NH+RL RSRGP +L G PSF
Sbjct  10   QKPHVVCVPHPAQGHINPMLKVAKLLHAKGFHVTFVNTVYNHKRLLRSRGPNALDGFPSF  69

Query  256  RFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIVSD  435
            RFE+IPDGLP +D + TQDIPSLCVST   CL PFKDLL ++N      +VPPVSCIVSD
Sbjct  70   RFESIPDGLPETDGNTTQDIPSLCVSTMNNCLSPFKDLLRKIN---TGDDVPPVSCIVSD  126

Query  436  GIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEGYLTNG-YLETE  612
             +MSFTL AAEELG+PDV+FW  SA G M  + + + ++KG TP KDE Y++N  +LET 
Sbjct  127  AVMSFTLDAAEELGVPDVVFWTASACGLMAFLQFQRFIEKGLTPFKDESYISNKEHLETV  186

Query  613  LDWVKGMKGIRL  648
            +DW+  MK  RL
Sbjct  187  IDWIPSMKNFRL  198



>ref|XP_010040276.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Eucalyptus 
grandis]
Length=554

 Score =   267 bits (683),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 121/190 (64%), Positives = 145/190 (76%), Gaps = 0/190 (0%)
 Frame = +1

Query  79   KPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPSFR  258
            KPHAVC+P+PAQSHI+AML LAKLLH++GFH+TFVNTE+NH RL RSRGP SL GLPSFR
Sbjct  4    KPHAVCIPFPAQSHISAMLNLAKLLHHRGFHVTFVNTEYNHNRLMRSRGPSSLDGLPSFR  63

Query  259  FETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIVSDG  438
            F TIPDGLPPS+ D TQDI SLC ST   CL  F+DL+ RLN  +  +  PPVSC+VSD 
Sbjct  64   FRTIPDGLPPSNGDVTQDILSLCQSTQKCCLPHFQDLIERLNEESVMSGSPPVSCVVSDS  123

Query  439  IMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEGYLTNGYLETELD  618
             M+FTL  AE + +P+VLFWP+S   FM    +  L+DKG  PLKD  YLTNGYL+T +D
Sbjct  124  SMTFTLDTAEAVSVPEVLFWPMSVCAFMAYAQFRSLIDKGLAPLKDVSYLTNGYLDTVID  183

Query  619  WVKGMKGIRL  648
            W+ GM+ I L
Sbjct  184  WIPGMRNIHL  193



>ref|XP_002525851.1| UDP-glucuronosyltransferase, putative [Ricinus communis]
 gb|EEF36545.1| UDP-glucuronosyltransferase, putative [Ricinus communis]
Length=482

 Score =   265 bits (677),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 123/190 (65%), Positives = 145/190 (76%), Gaps = 3/190 (2%)
 Frame = +1

Query  79   KPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPSFR  258
            KPH VCVPYPAQ H+N M+KLAKLLH   FH+TFVNTE+NHRRL  SRGP SL GLP FR
Sbjct  10   KPHVVCVPYPAQGHVNPMVKLAKLLHYNDFHVTFVNTEYNHRRLLNSRGPSSLDGLPDFR  69

Query  259  FETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIVSDG  438
            FE I DGLPPSD +ATQDIPSLC ST+   L PF++LL +L    ++ ++PPV+CI+SD 
Sbjct  70   FEAISDGLPPSDANATQDIPSLCDSTSKNSLAPFRNLLLKLK---SSDSLPPVTCIISDA  126

Query  439  IMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEGYLTNGYLETELD  618
             MSFTL AAEE GIP++LFW  S+ G +G   Y  L++KG TPLKD  YLTNGYLET LD
Sbjct  127  CMSFTLDAAEEFGIPEILFWTPSSCGVLGYSQYHTLIEKGLTPLKDASYLTNGYLETTLD  186

Query  619  WVKGMKGIRL  648
            W+ GMK IR 
Sbjct  187  WIPGMKDIRF  196



>ref|XP_007207648.1| hypothetical protein PRUPE_ppa021414mg [Prunus persica]
 gb|EMJ08847.1| hypothetical protein PRUPE_ppa021414mg [Prunus persica]
Length=480

 Score =   265 bits (677),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 123/200 (62%), Positives = 158/200 (79%), Gaps = 4/200 (2%)
 Frame = +1

Query  49   MGSNNCEFEKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGP  228
            MGS   E  KK HAVCVP+PAQ H++ +++LAKLLH++GFHITFVNTEFNHRRL RS+GP
Sbjct  1    MGSVR-EATKKLHAVCVPFPAQGHVSPVMQLAKLLHSRGFHITFVNTEFNHRRLIRSKGP  59

Query  229  ESLRGLPSFRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNV  408
            +S++GLP F+FETIPDGLPPSD DATQD+P+LC ST  TCLGPFK+L+ ++N   +++ V
Sbjct  60   DSVKGLPDFQFETIPDGLPPSDKDATQDVPALCDSTRKTCLGPFKELVTKIN---SSSQV  116

Query  409  PPVSCIVSDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEGYL  588
            P V+CIV+DGI  F   AA+ELGIP+V FW  SA GF+G + YS+LV +G  P +DE +L
Sbjct  117  PQVTCIVADGITGFGRQAAQELGIPEVQFWTASACGFLGYLQYSELVKRGIVPFQDETFL  176

Query  589  TNGYLETELDWVKGMKGIRL  648
             +G L+T +DWV GMK  RL
Sbjct  177  HDGTLDTPIDWVPGMKNARL  196



>emb|CDY46644.1| BnaA07g10520D [Brassica napus]
Length=301

 Score =   259 bits (662),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 122/200 (61%), Positives = 147/200 (74%), Gaps = 3/200 (2%)
 Frame = +1

Query  49   MGSNNCEFEKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGP  228
            M S+  +  +KPH   VPYPAQ HIN MLKLAKLLH KG H+TFVNT +NH RL RSRGP
Sbjct  1    MESHAIDNRQKPHVAFVPYPAQGHINPMLKLAKLLHAKGIHVTFVNTVYNHNRLLRSRGP  60

Query  229  ESLRGLPSFRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNV  408
             +L GLPSFRFETIPDGLP +DVDATQDI +LC ST   CL PF++LL R+N   A  +V
Sbjct  61   NALDGLPSFRFETIPDGLPETDVDATQDITALCESTMKNCLAPFEELLWRIN---ARDDV  117

Query  409  PPVSCIVSDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEGYL  588
            PPVSCI+SD  MSFTL AAE+L IP VLFW  SA G M  +H+   ++KG  P+KDE +L
Sbjct  118  PPVSCIISDDCMSFTLDAAEKLCIPHVLFWSTSACGLMAYLHFYHFIEKGLCPVKDESFL  177

Query  589  TNGYLETELDWVKGMKGIRL  648
            T  YL+T +DW+  MK ++L
Sbjct  178  TKEYLDTPIDWIPSMKNLKL  197



>dbj|BAO51840.1| UDP-glycosyltransferase 85K12 [Humulus lupulus]
Length=484

 Score =   265 bits (677),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 115/190 (61%), Positives = 152/190 (80%), Gaps = 3/190 (2%)
 Frame = +1

Query  79   KPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPSFR  258
            KPHAVCVP+PAQ H+N M++LAKLLH++GFHIT+VNTEFNHRRL RSRGP+S++GLP F+
Sbjct  9    KPHAVCVPFPAQGHVNPMMQLAKLLHSRGFHITYVNTEFNHRRLIRSRGPDSVKGLPDFQ  68

Query  259  FETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIVSDG  438
            FETIPDGLPPSD DATQ++P LC +T   CLGPFK+LL +L    + + VPPV+CI++DG
Sbjct  69   FETIPDGLPPSDRDATQEVPPLCDATRKNCLGPFKELLHKLR---SCSEVPPVTCIITDG  125

Query  439  IMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEGYLTNGYLETELD  618
            IM+F + AA E GIP+V+FW  SA  FMG + Y +LV +G  P KDE ++ +G L+T +D
Sbjct  126  IMTFGIKAAREFGIPEVVFWTASACSFMGYLQYDELVRRGIVPFKDESFMLDGTLDTPID  185

Query  619  WVKGMKGIRL  648
            W+ G++ +RL
Sbjct  186  WIPGIRDVRL  195



>ref|XP_011465456.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Fragaria 
vesca subsp. vesca]
Length=479

 Score =   264 bits (675),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 120/191 (63%), Positives = 148/191 (77%), Gaps = 3/191 (2%)
 Frame = +1

Query  76   KKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPSF  255
            KK HAVCVP+PAQ H+N M++LAKLLH++GFHITFVNTEFNHRRL RSRGP+S++GLP F
Sbjct  9    KKLHAVCVPFPAQGHVNPMMQLAKLLHSRGFHITFVNTEFNHRRLIRSRGPDSIKGLPDF  68

Query  256  RFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIVSD  435
            +F TIPDGLPPSD DATQD+P LC ST  TC GPFK+L+  LN    ++ VP ++CIVSD
Sbjct  69   QFATIPDGLPPSDKDATQDVPPLCDSTRKTCRGPFKELVTNLN---CSSEVPQITCIVSD  125

Query  436  GIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEGYLTNGYLETEL  615
            GIM F    A+ELGIP+V FW  SA GFM  + YS+LV +G  P KDE +L +G L+  +
Sbjct  126  GIMGFGREVAKELGIPEVQFWTASACGFMAYLQYSELVKRGIVPFKDESFLQDGTLDKPV  185

Query  616  DWVKGMKGIRL  648
            DW+ GMK +RL
Sbjct  186  DWIPGMKNVRL  196



>ref|XP_009413654.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like, partial 
[Musa acuminata subsp. malaccensis]
Length=250

 Score =   256 bits (654),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 119/195 (61%), Positives = 145/195 (74%), Gaps = 5/195 (3%)
 Frame = +1

Query  64   CEFEKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRG  243
            C   +KPHAVC+PYPAQ H+  M+ LAKLLH+ GFHITFVNT++NHRRL RS+   S   
Sbjct  3    CMSTRKPHAVCIPYPAQGHVTPMMMLAKLLHSHGFHITFVNTQYNHRRLLRSKALSSADV  62

Query  244  LPSFRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSC  423
            LP FRFETIPDGLPPSD DATQDIPSLC S     L PF DLL +LN  +     PPVSC
Sbjct  63   LPDFRFETIPDGLPPSDEDATQDIPSLCESIQNNALPPFLDLLRQLNEGS-----PPVSC  117

Query  424  IVSDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEGYLTNGYL  603
            +VSDG+MSFT+ AA EL IP+V+FW  SA GFMG + Y  L+++G TPLKDE  +TNGYL
Sbjct  118  VVSDGVMSFTVDAATELSIPEVMFWTPSACGFMGYLQYKHLLERGLTPLKDESDITNGYL  177

Query  604  ETELDWVKGMKGIRL  648
            +  ++W+ G+K +RL
Sbjct  178  DMAVEWIPGLKNMRL  192



>gb|KFK44336.1| hypothetical protein AALP_AA1G244800 [Arabis alpina]
Length=491

 Score =   264 bits (674),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 122/200 (61%), Positives = 152/200 (76%), Gaps = 3/200 (2%)
 Frame = +1

Query  49   MGSNNCEFEKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGP  228
            MGS+     +KPH VCVPYPAQ HIN M+K+AKL H +GFH+TFVNT +NH RL RSRG 
Sbjct  1    MGSHAVYNGQKPHVVCVPYPAQGHINPMMKVAKLFHIRGFHVTFVNTVYNHNRLLRSRGA  60

Query  229  ESLRGLPSFRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNV  408
             ++ GLPSFRFE+IPDGLP +DVD TQDI +LC ST   CL PFK+LL ++N   A  +V
Sbjct  61   HAVNGLPSFRFESIPDGLPETDVDVTQDITALCASTMKNCLTPFKELLRQIN---AGDDV  117

Query  409  PPVSCIVSDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEGYL  588
            PPVSCI+SDG MSFTL AAEELG+P+VLFW +SA GFM  +H+ + V+ G +PLKDE YL
Sbjct  118  PPVSCILSDGCMSFTLDAAEELGVPEVLFWTVSACGFMAYLHFYRFVEMGLSPLKDESYL  177

Query  589  TNGYLETELDWVKGMKGIRL  648
            T  YL+T +D +  MK ++L
Sbjct  178  TKEYLDTVIDCIPSMKNLKL  197



>gb|KFK44329.1| hypothetical protein AALP_AA1G244100 [Arabis alpina]
Length=483

 Score =   263 bits (673),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 122/192 (64%), Positives = 151/192 (79%), Gaps = 3/192 (2%)
 Frame = +1

Query  73   EKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPS  252
            E+KPH VCVPYPAQ HIN MLK+AKLLH KGFH+TFVNT +NH RL RSRGP +L GLPS
Sbjct  9    EQKPHVVCVPYPAQGHINPMLKVAKLLHAKGFHVTFVNTIYNHNRLLRSRGPHALDGLPS  68

Query  253  FRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIVS  432
            FRFE+IPDGLP +DVDAT+DIP+LC ST   CL PFK+LL R+N   A  +VPPVSCIVS
Sbjct  69   FRFESIPDGLPETDVDATRDIPALCESTVKNCLTPFKELLRRIN---AGDDVPPVSCIVS  125

Query  433  DGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEGYLTNGYLETE  612
            DG M+FT+ AAEELGIP+VLF   SA GF+  +H+ + ++KG +PLKD    T  +L+T+
Sbjct  126  DGCMTFTIDAAEELGIPEVLFRTTSACGFLAYLHFYRFIEKGLSPLKDVSCWTKEHLDTK  185

Query  613  LDWVKGMKGIRL  648
            +DW+  M+ +RL
Sbjct  186  IDWIPSMRNLRL  197



>ref|XP_012068368.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Jatropha 
curcas]
Length=493

 Score =   264 bits (674),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 125/191 (65%), Positives = 151/191 (79%), Gaps = 3/191 (2%)
 Frame = +1

Query  85   HAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPSFRFE  264
            HAVC+P+PAQ HIN MLKLAKLLH KGFHITFVNTE+NH+RL +SRG  S+  L +FRFE
Sbjct  12   HAVCIPFPAQGHINPMLKLAKLLHRKGFHITFVNTEYNHQRLLKSRGSNSIDCLSTFRFE  71

Query  265  TIPDGLPPSD-VDATQDIPSLCVSTATTCLGPFKDLLARLNH--TAAATNVPPVSCIVSD  435
            TIPDGLPPSD  D+TQD+PSLC ST   CL PF+DLL +LN   ++ ++ VPPV+CIVSD
Sbjct  72   TIPDGLPPSDHADSTQDVPSLCDSTKKNCLPPFRDLLFKLNDNTSSYSSKVPPVTCIVSD  131

Query  436  GIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEGYLTNGYLETEL  615
             +MSFT+ AA+EL IP VL W  SA GFM   HY QLV+KG+ PLKD  YLTNG+L+T +
Sbjct  132  PVMSFTIEAAKELEIPIVLSWTASACGFMAYSHYRQLVEKGFVPLKDASYLTNGFLDTVI  191

Query  616  DWVKGMKGIRL  648
            DW+ GM+GI L
Sbjct  192  DWIPGMEGISL  202



>emb|CDY38225.1| BnaC05g17420D [Brassica napus]
Length=482

 Score =   263 bits (672),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 121/191 (63%), Positives = 147/191 (77%), Gaps = 3/191 (2%)
 Frame = +1

Query  76   KKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPSF  255
            +K H VCVPYPAQ HIN M+K+AKLLH KGF++TFVNT +NH+RL RSRG  +L GLPSF
Sbjct  10   RKQHVVCVPYPAQGHINPMMKVAKLLHAKGFYVTFVNTIYNHKRLLRSRGSNALDGLPSF  69

Query  256  RFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIVSD  435
            RFE+IPDGLP +DVD TQDIP+LC ST    L PFK+LL R+N   A    PPVSCIVSD
Sbjct  70   RFESIPDGLPETDVDVTQDIPALCESTVKNSLAPFKELLRRIN---AQDESPPVSCIVSD  126

Query  436  GIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEGYLTNGYLETEL  615
            G MSFTL AAEELG+P+VLFW  SA G +  +HY + ++KG +PLKDE YLT  +L+T +
Sbjct  127  GCMSFTLDAAEELGVPEVLFWTTSACGLLAYLHYHKFIEKGLSPLKDESYLTKEHLDTII  186

Query  616  DWVKGMKGIRL  648
            DW+  MK +RL
Sbjct  187  DWIPSMKNLRL  197



>ref|XP_010039828.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Eucalyptus 
grandis]
Length=490

 Score =   263 bits (671),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 124/190 (65%), Positives = 145/190 (76%), Gaps = 0/190 (0%)
 Frame = +1

Query  79   KPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPSFR  258
            KPHAVC+PYPAQ HIN MLKLAKLLH+KGFHITFVNTE NH+RL RS+GP SL GLP FR
Sbjct  16   KPHAVCIPYPAQGHINPMLKLAKLLHHKGFHITFVNTEHNHKRLLRSQGPHSLDGLPHFR  75

Query  259  FETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIVSDG  438
            F+ IPDGLPPSD D+TQDIPSLC S +   L  F+ LL +L   +    VPPV+ IVSDG
Sbjct  76   FDMIPDGLPPSDADSTQDIPSLCASLSEHGLSAFRSLLLKLQDQSQDGVVPPVTRIVSDG  135

Query  439  IMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEGYLTNGYLETELD  618
            +M+FT+ AAEEL IP+V+FWP SA G  G   Y +LV+ G+TPLKD  Y +NGYLET + 
Sbjct  136  LMAFTVDAAEELKIPEVVFWPPSACGLFGCTKYRRLVEDGFTPLKDPTYFSNGYLETMVS  195

Query  619  WVKGMKGIRL  648
            W  GMK IRL
Sbjct  196  WTSGMKSIRL  205



>ref|XP_002525852.1| UDP-glucuronosyltransferase, putative [Ricinus communis]
 gb|EEF36546.1| UDP-glucuronosyltransferase, putative [Ricinus communis]
Length=474

 Score =   262 bits (670),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 123/191 (64%), Positives = 149/191 (78%), Gaps = 4/191 (2%)
 Frame = +1

Query  79   KPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPSFR  258
            KPHAVC+PYPAQ HIN MLKLAKLLH +GF+ITF+NTE   RRL +SRGP++L GLP F+
Sbjct  7    KPHAVCIPYPAQGHINPMLKLAKLLHQRGFYITFINTEHMQRRLLKSRGPDALNGLPDFQ  66

Query  259  FETIPDGLPPS-DVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIVSD  435
            FETIPDGLPPS D+D+TQDI +L  S    C  PF +LL +L    ++ NVPP++CIVSD
Sbjct  67   FETIPDGLPPSPDLDSTQDILTLAQSVTNNCPVPFGNLLVKLE---SSPNVPPITCIVSD  123

Query  436  GIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEGYLTNGYLETEL  615
            GIMSFTL AAEE+G+P VLFW  SA GF+   +  QLV++   PLKDE YLTNGYL+T +
Sbjct  124  GIMSFTLGAAEEIGVPGVLFWTASACGFLAYAYNKQLVERALIPLKDESYLTNGYLDTTV  183

Query  616  DWVKGMKGIRL  648
            DW+ GMKGIRL
Sbjct  184  DWIPGMKGIRL  194



>ref|XP_010030028.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Eucalyptus 
grandis]
Length=483

 Score =   263 bits (671),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 124/191 (65%), Positives = 146/191 (76%), Gaps = 0/191 (0%)
 Frame = +1

Query  76   KKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPSF  255
            +KPHAVC+P+PAQ HIN MLKLAKLLH+KGFHITFVNTE NH+RL RS+GP SL GLP F
Sbjct  8    EKPHAVCIPFPAQGHINPMLKLAKLLHHKGFHITFVNTEHNHKRLLRSQGPHSLDGLPHF  67

Query  256  RFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIVSD  435
            RF+ IPDGLPPSD D+TQDIPSLC S +   L  F+ LL +L   +    VPPV+CIVSD
Sbjct  68   RFDMIPDGLPPSDADSTQDIPSLCASLSEHGLSAFRSLLLKLREQSQDGVVPPVTCIVSD  127

Query  436  GIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEGYLTNGYLETEL  615
            G M+FT+ AAEEL IP+V+FW  SA G  G   Y +LV+ G+TPLKD  YL+NGYLET +
Sbjct  128  GGMAFTVDAAEELKIPEVVFWTPSACGVFGCTKYRRLVEDGFTPLKDPTYLSNGYLETTV  187

Query  616  DWVKGMKGIRL  648
             W  GMK IRL
Sbjct  188  SWTSGMKSIRL  198



>gb|AAR06913.1| UDP-glycosyltransferase 85A8 [Stevia rebaudiana]
Length=479

 Score =   262 bits (670),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 122/191 (64%), Positives = 143/191 (75%), Gaps = 4/191 (2%)
 Frame = +1

Query  76   KKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPSF  255
            +KPHA+C+PYPAQ HIN M++ AKLLH KGFHI+FVN  +NH+RLQRSRG  +L GLP F
Sbjct  8    QKPHAICIPYPAQGHINPMMQFAKLLHFKGFHISFVNNHYNHKRLQRSRGLSALEGLPDF  67

Query  256  RFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIVSD  435
             F +IPDGLPPS+ +ATQ IP LC S     L PF DL+A LN     ++VPPVSCI+SD
Sbjct  68   HFYSIPDGLPPSNAEATQSIPGLCESIPKHSLEPFCDLIATLN----GSDVPPVSCIISD  123

Query  436  GIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEGYLTNGYLETEL  615
            G+MSFTL AAE  G+P+VLFW  SA GF+   HY  LVDK Y PLKD   LTNGYLET L
Sbjct  124  GVMSFTLQAAERFGLPEVLFWTPSACGFLAYTHYRDLVDKEYIPLKDTNDLTNGYLETSL  183

Query  616  DWVKGMKGIRL  648
            DW+ GMK IRL
Sbjct  184  DWIPGMKNIRL  194



>ref|XP_002298702.2| hypothetical protein POPTR_0001s32000g [Populus trichocarpa]
 gb|EEE83507.2| hypothetical protein POPTR_0001s32000g [Populus trichocarpa]
Length=474

 Score =   262 bits (670),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 123/190 (65%), Positives = 147/190 (77%), Gaps = 3/190 (2%)
 Frame = +1

Query  79   KPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPSFR  258
            KPHAVCVP+PAQ HIN MLKLAK+LH  GFHITFVNTE+NHRRL RSRG  SL GLP F+
Sbjct  4    KPHAVCVPFPAQGHINPMLKLAKILHFNGFHITFVNTEYNHRRLLRSRGASSLDGLPDFQ  63

Query  259  FETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIVSDG  438
            FETIPDGLPPSD D+TQDI +LC ST+ TCL PF+DL+A+LN ++    +P V+CIVSD 
Sbjct  64   FETIPDGLPPSDADSTQDILTLCYSTSKTCLAPFRDLIAKLNSSSV---IPQVTCIVSDA  120

Query  439  IMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEGYLTNGYLETELD  618
            IM+FTL AAEE GIPD LFW  SA G +G      L ++G TP+KD  YLTN +LET ++
Sbjct  121  IMNFTLDAAEEFGIPDALFWTPSACGVLGYSKCRLLFERGLTPVKDVSYLTNEFLETAIE  180

Query  619  WVKGMKGIRL  648
            W+ G + IRL
Sbjct  181  WIPGKENIRL  190



>ref|XP_010060022.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like isoform 
X2 [Eucalyptus grandis]
Length=500

 Score =   263 bits (671),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 126/199 (63%), Positives = 150/199 (75%), Gaps = 3/199 (2%)
 Frame = +1

Query  49   MGSNNCEFEKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGP  228
            MGS   +  +KPHAVC+PYPAQ HIN ML LAKLLH++GFH+TFVNTE+NH RL  SRGP
Sbjct  1    MGS--IDMIQKPHAVCIPYPAQGHINPMLNLAKLLHHRGFHVTFVNTEYNHSRLLHSRGP  58

Query  229  ESLRGLPSFRFETIPDGLPPSDV-DATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATN  405
             SL GLPSFRF TIP+GLPPSDV DATQDIP+LC ST+  CL  F+D L RLN  +    
Sbjct  59   SSLDGLPSFRFRTIPNGLPPSDVADATQDIPALCQSTSKFCLPYFRDQLERLNEESTTLG  118

Query  406  VPPVSCIVSDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEGY  585
             PPVSC+VSDG+MSFTL AA+ +G+ +VLFW  S  GFMG + Y  LVDKG  PLKD  Y
Sbjct  119  SPPVSCVVSDGMMSFTLDAAKVIGVSEVLFWTTSVCGFMGYVQYCNLVDKGLAPLKDASY  178

Query  586  LTNGYLETELDWVKGMKGI  642
            LTN YL+T +DW+  ++ I
Sbjct  179  LTNVYLDTIVDWIPSIRNI  197



>ref|XP_002893221.1| UDP-glycosyltransferase [Arabidopsis lyrata subsp. lyrata]
 gb|EFH69480.1| UDP-glycosyltransferase [Arabidopsis lyrata subsp. lyrata]
Length=469

 Score =   262 bits (669),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 122/200 (61%), Positives = 153/200 (77%), Gaps = 6/200 (3%)
 Frame = +1

Query  49   MGSNNCEFEKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGP  228
            MGS+     +KPH VCVPYPAQ HIN M+K+AKLL+ KGFH+TFVNT +NH RL RSRG 
Sbjct  1    MGSH---VAQKPHVVCVPYPAQGHINPMMKVAKLLYAKGFHVTFVNTVYNHNRLLRSRGS  57

Query  229  ESLRGLPSFRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNV  408
             ++ GLPSFRFE+IPDGL  +DVD TQDIP+LC ST   CL PFK+LL ++N   A  +V
Sbjct  58   NAVDGLPSFRFESIPDGLSETDVDVTQDIPTLCESTMKHCLAPFKELLRQIN---AGDDV  114

Query  409  PPVSCIVSDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEGYL  588
            PPVSCIVSDG MSFTL AAEELG+P+VLFW  SA GF+  + Y + ++KG +P+KDE YL
Sbjct  115  PPVSCIVSDGCMSFTLDAAEELGVPEVLFWTTSACGFLAYLFYYRFIEKGLSPIKDESYL  174

Query  589  TNGYLETELDWVKGMKGIRL  648
               +L+T++DW+  MK +RL
Sbjct  175  NKEHLDTKIDWIPSMKNLRL  194



>ref|XP_010041627.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Eucalyptus 
grandis]
Length=489

 Score =   262 bits (670),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 124/191 (65%), Positives = 146/191 (76%), Gaps = 0/191 (0%)
 Frame = +1

Query  76   KKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPSF  255
            +KPHAVC+P+PAQ HIN MLKLAKLLH+KGFHITFVNTE NH+RL RS+GP SL GLP F
Sbjct  8    EKPHAVCIPFPAQGHINPMLKLAKLLHHKGFHITFVNTEHNHKRLLRSQGPHSLDGLPHF  67

Query  256  RFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIVSD  435
            RF+ IPDGLPPSD D+TQDIPSLC S +   L  F+ LL +L   +    VPPV+CIVSD
Sbjct  68   RFDMIPDGLPPSDADSTQDIPSLCASLSEHGLSAFRSLLLKLREQSQDGVVPPVTCIVSD  127

Query  436  GIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEGYLTNGYLETEL  615
            G M+FT+ AAEEL IP+V+FW  SA G  G   Y +LV+ G+TPLKD  YL+NGYLET +
Sbjct  128  GGMAFTVDAAEELKIPEVVFWTPSACGVFGCTKYRRLVEDGFTPLKDPTYLSNGYLETTV  187

Query  616  DWVKGMKGIRL  648
             W  GMK IRL
Sbjct  188  SWTSGMKSIRL  198



>ref|NP_001277168.1| UDP-glycosyltransferase 85A2-like [Vitis vinifera]
 dbj|BAO51843.1| UDP-glycosyltransferase 85A33 [Vitis vinifera]
Length=482

 Score =   262 bits (669),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 125/191 (65%), Positives = 148/191 (77%), Gaps = 2/191 (1%)
 Frame = +1

Query  79   KPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPSFR  258
            KPH V +PYPAQ H+N MLKLAKLLHNKGF ++FVNTE+NH+RL RSRGP SL GL  FR
Sbjct  9    KPHVVLIPYPAQGHVNPMLKLAKLLHNKGFFVSFVNTEYNHKRLLRSRGPNSLDGLSDFR  68

Query  259  FETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIVSDG  438
            FETIPDGLPPSD DATQDIPSLCVST   CL PF  L+ +LN  + +   PPVSCIVSDG
Sbjct  69   FETIPDGLPPSDADATQDIPSLCVSTTKNCLAPFCALITKLNDPSYSPG-PPVSCIVSDG  127

Query  439  IMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEGYLTNGYLETELD  618
            +MSFTL AAE+ G+P+V+FW  SA GF+G  HY  L+ +G  PL+DE  L+NGYL+T +D
Sbjct  128  VMSFTLDAAEKFGVPEVVFWTTSACGFLGYRHYRNLIRRGLIPLQDESCLSNGYLDTVVD  187

Query  619  WVKGMKG-IRL  648
            +V G K  IRL
Sbjct  188  FVPGKKKTIRL  198



>ref|XP_006351765.1| PREDICTED: UDP-glycosyltransferase 85A5-like [Solanum tuberosum]
Length=499

 Score =   262 bits (670),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 133/218 (61%), Positives = 159/218 (73%), Gaps = 6/218 (3%)
 Frame = +1

Query  4    IKVSNQSRSRERKREMGSNNCEFEKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFV  183
            + +   S  R +K +M S    F K  H VCVPYPAQ HI+ MLKLAKL+H+ GF+ITFV
Sbjct  1    MNLEQTSLDRPKKIKMASF-ANF-KSGHVVCVPYPAQGHISPMLKLAKLVHHNGFYITFV  58

Query  184  NTEFNHRRLQRSRGPESLRGLPSFRFETIPDGLPPS--DVDATQDIPSLCVSTATTCLGP  357
            NTEFNH+RL RS GP+SL GLP FRFETIPDGLP +  DVDATQ +PSLC ST+  CL P
Sbjct  59   NTEFNHKRLLRSNGPQSLDGLPGFRFETIPDGLPSTDHDVDATQHVPSLCASTSKNCLVP  118

Query  358  FKDLLARLNHTAAATNVPPVSCIVSDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHY  537
            F++L+ ++N       VPPV+CIVSD IMSFTL AAEELGIP+VLFW  SA GFM  +HY
Sbjct  119  FRNLINKINAEGNGV-VPPVTCIVSDVIMSFTLDAAEELGIPEVLFWTASACGFMCYLHY  177

Query  538  SQLVDKGYTPLKDEGYLTNGYLETELDWVKG-MKGIRL  648
              LV +GY PLKDE  + NGYLE  +DWV G +K +RL
Sbjct  178  HHLVQRGYIPLKDENDIKNGYLEKMIDWVPGILKNMRL  215



>ref|XP_006416203.1| hypothetical protein EUTSA_v10009957mg, partial [Eutrema salsugineum]
 gb|ESQ34556.1| hypothetical protein EUTSA_v10009957mg, partial [Eutrema salsugineum]
Length=759

 Score =   268 bits (686),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 127/200 (64%), Positives = 152/200 (76%), Gaps = 3/200 (2%)
 Frame = +1

Query  49   MGSNNCEFEKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGP  228
            MGS++    +KPH VCVPYPAQ HIN MLK+AKLLH KGFH+TFVNT +NH RL RSRGP
Sbjct  1    MGSHDDFNPQKPHVVCVPYPAQGHINPMLKVAKLLHAKGFHVTFVNTVYNHNRLLRSRGP  60

Query  229  ESLRGLPSFRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNV  408
             +L GLPSF+FE IPDGLP +DVDATQDIP+LC ST   CL PFK+LL ++N   A  +V
Sbjct  61   NALDGLPSFQFEAIPDGLPETDVDATQDIPALCESTMKNCLAPFKELLRQIN---ARDDV  117

Query  409  PPVSCIVSDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEGYL  588
            PPVSCIVSDG MSFTL AAEELGIP+VLFW  SA   M  +H+   ++KG +P  DE YL
Sbjct  118  PPVSCIVSDGCMSFTLDAAEELGIPEVLFWTPSACATMAYLHFYLFIEKGLSPFIDESYL  177

Query  589  TNGYLETELDWVKGMKGIRL  648
            T  YL+T +DW+  MK ++L
Sbjct  178  TKEYLDTVIDWIPSMKNLKL  197



>ref|XP_008380053.1| PREDICTED: UDP-glycosyltransferase 85A5-like [Malus domestica]
Length=486

 Score =   261 bits (668),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 123/201 (61%), Positives = 149/201 (74%), Gaps = 1/201 (0%)
 Frame = +1

Query  49   MGSNNCEFEKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGP  228
            MGS       KPHAVC+P+P Q HI  +LK AKLLH++G  ITFVNTE+NHRRL +S GP
Sbjct  1    MGSMEVAANHKPHAVCLPFPYQGHIKPLLKFAKLLHHRGIRITFVNTEYNHRRLLKSLGP  60

Query  229  ESLRGLPSFRFETIPDGLPPSD-VDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATN  405
             +L G   F FETIPDGLPPSD  D+TQDI  +C +     L PF+ LLA+LN  AA+ N
Sbjct  61   NTLDGFKDFHFETIPDGLPPSDSADSTQDIYDICDAIQNNLLAPFQSLLAKLNAVAASNN  120

Query  406  VPPVSCIVSDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEGY  585
             PPV+ IVSDG MSF++ AAEELG+P VLF+P +A GFMG  HY  L +KG+TPLKDE Y
Sbjct  121  TPPVTSIVSDGFMSFSITAAEELGLPIVLFFPTAACGFMGFKHYRALAEKGFTPLKDERY  180

Query  586  LTNGYLETELDWVKGMKGIRL  648
            L+NGYL+T +DW+ GMKGIRL
Sbjct  181  LSNGYLDTVIDWIPGMKGIRL  201



>gb|KDP41398.1| hypothetical protein JCGZ_15805 [Jatropha curcas]
Length=493

 Score =   262 bits (669),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 125/191 (65%), Positives = 150/191 (79%), Gaps = 3/191 (2%)
 Frame = +1

Query  85   HAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPSFRFE  264
            HAVC+P+PAQ HIN MLKLAKLLH KGFHITFVNTE+NH+RL +SRG  S+  L +FRFE
Sbjct  12   HAVCIPFPAQGHINPMLKLAKLLHRKGFHITFVNTEYNHQRLLKSRGSNSIDCLSTFRFE  71

Query  265  TIPDGLPPSD-VDATQDIPSLCVSTATTCLGPFKDLLARLNHTA--AATNVPPVSCIVSD  435
            TIPDGLPPSD  D+TQD+PSLC ST   CL PF+DLL +LN     +++ VPPV+CIVSD
Sbjct  72   TIPDGLPPSDHADSTQDVPSLCDSTKKNCLPPFRDLLFKLNDNTSSSSSKVPPVTCIVSD  131

Query  436  GIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEGYLTNGYLETEL  615
             +MSFT+ AA+EL IP VL W  SA GFM   HY QLV+KG+ PLKD  YLTNG+L+T +
Sbjct  132  FVMSFTIEAAKELEIPIVLSWTASACGFMAYAHYRQLVEKGFVPLKDASYLTNGFLDTVI  191

Query  616  DWVKGMKGIRL  648
            DW+ GM+GI L
Sbjct  192  DWIPGMEGISL  202



>ref|XP_009145346.1| PREDICTED: UDP-glycosyltransferase 85A2 isoform X2 [Brassica 
rapa]
Length=484

 Score =   261 bits (668),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 123/192 (64%), Positives = 149/192 (78%), Gaps = 4/192 (2%)
 Frame = +1

Query  76   KKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPSF  255
            +K H VCVPYPAQ HIN M+K+AKLLH KGF++TFVNT +NH+RL RSRG  +L GLPSF
Sbjct  10   RKQHVVCVPYPAQGHINPMMKVAKLLHAKGFYVTFVNTIYNHKRLLRSRGSNALDGLPSF  69

Query  256  RFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIVSD  435
            RFE+IPDGLP +DVD TQDIPSLC ST    L PFK+LL R+N   A   VPPV+CIVSD
Sbjct  70   RFESIPDGLPETDVDVTQDIPSLCESTPKYSLAPFKELLRRIN---AQDEVPPVNCIVSD  126

Query  436  GIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLK-DEGYLTNGYLETE  612
            G MSFTL AAEELG+P+VLFW  SA GF+  +HY + ++KG +PLK DE YLT  +L+T 
Sbjct  127  GCMSFTLDAAEELGVPEVLFWTTSACGFLAYLHYHKFIEKGLSPLKADESYLTKEHLDTI  186

Query  613  LDWVKGMKGIRL  648
            +DW+  MK +RL
Sbjct  187  IDWIPSMKNLRL  198



>ref|XP_009334337.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Pyrus x 
bretschneideri]
 ref|XP_009334338.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Pyrus x 
bretschneideri]
Length=483

 Score =   261 bits (668),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 126/191 (66%), Positives = 149/191 (78%), Gaps = 3/191 (2%)
 Frame = +1

Query  76   KKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPSF  255
            +KPHAV +PYPAQ HI  ML+LAKLL+ KGFH TFVNTEFNHRRL ++RGP SL GL SF
Sbjct  8    EKPHAVFIPYPAQGHIIPMLQLAKLLNYKGFHTTFVNTEFNHRRLLKARGPNSLDGLSSF  67

Query  256  RFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIVSD  435
            RFETIPDGLP +DV+ATQDI +LC ST   CL PFKDLL++LN   +  N PPV+CIVSD
Sbjct  68   RFETIPDGLPTTDVNATQDITALCFSTKKNCLAPFKDLLSKLN---SLPNSPPVTCIVSD  124

Query  436  GIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEGYLTNGYLETEL  615
            G M+FTL AA+ELGIP V+F   SA   MG +  S L++KG  PLKD  YLTNGYL+T +
Sbjct  125  GGMTFTLEAAQELGIPVVIFATASACSLMGYLQLSPLIEKGLIPLKDASYLTNGYLDTVI  184

Query  616  DWVKGMKGIRL  648
            DW+ GM+GIRL
Sbjct  185  DWIPGMRGIRL  195



>gb|KFK44333.1| hypothetical protein AALP_AA1G244500 [Arabis alpina]
Length=483

 Score =   261 bits (667),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 119/200 (60%), Positives = 151/200 (76%), Gaps = 3/200 (2%)
 Frame = +1

Query  49   MGSNNCEFEKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGP  228
            M S+    E+KPH VCVPYPAQ HIN MLK+AKLLH KG H+TFVNT +NH RL RSRGP
Sbjct  1    MESHGVCSEQKPHVVCVPYPAQGHINPMLKVAKLLHAKGLHVTFVNTVYNHNRLLRSRGP  60

Query  229  ESLRGLPSFRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNV  408
            ++L GLPSF+FE+IPDGLP +D D TQDIP+LCVST   CL PF +L+ R+N   +  +V
Sbjct  61   DALHGLPSFQFESIPDGLPETDGDTTQDIPALCVSTKKNCLAPFMELIRRIN---SGGDV  117

Query  409  PPVSCIVSDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEGYL  588
            PP+SCIVSDGIMSFTL AAEELG+P VLFW +SA G MG + +   ++KG  P +DE  +
Sbjct  118  PPISCIVSDGIMSFTLDAAEELGVPIVLFWTLSACGLMGFLQFHVFIEKGLAPFQDESNM  177

Query  589  TNGYLETELDWVKGMKGIRL  648
            +  +L+T +DW+  M+ +RL
Sbjct  178  SKEHLDTVIDWIPSMESLRL  197



>ref|XP_002532877.1| UDP-glucuronosyltransferase, putative [Ricinus communis]
 gb|EEF29506.1| UDP-glucuronosyltransferase, putative [Ricinus communis]
Length=471

 Score =   261 bits (667),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 118/191 (62%), Positives = 150/191 (79%), Gaps = 3/191 (2%)
 Frame = +1

Query  76   KKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPSF  255
            +KPHAVCVPYP+Q H+  M++LAKLLH++GFHITFVNT+FNH RL RSRGP+S++GLP F
Sbjct  7    RKPHAVCVPYPSQGHVTPMMQLAKLLHSRGFHITFVNTDFNHTRLIRSRGPDSVKGLPDF  66

Query  256  RFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIVSD  435
            RFETIPDGLPPS  DATQD+PSLC ST   CL PFK+L+++LN ++ +T VPPVSCI+SD
Sbjct  67   RFETIPDGLPPSTFDATQDVPSLCDSTRKNCLAPFKELVSKLN-SSPSTEVPPVSCIISD  125

Query  436  GIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEGYLTNGYLETEL  615
            G+MSF + AAE+L IP V FW  SA  FM  +HY++L  +G  P KD  +L +G  +T +
Sbjct  126  GVMSFGIKAAEDLSIPQVQFWTASACSFMAYLHYNELERRGIMPYKD--FLNDGISDTPI  183

Query  616  DWVKGMKGIRL  648
            DW+ GM  IRL
Sbjct  184  DWISGMTNIRL  194



>gb|KCW45339.1| hypothetical protein EUGRSUZ_L009911, partial [Eucalyptus grandis]
Length=174

 Score =   251 bits (641),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 120/176 (68%), Positives = 140/176 (80%), Gaps = 3/176 (2%)
 Frame = +1

Query  49   MGSNNCEFEKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGP  228
            MGS   +  +KPHA+C+PYPAQ HIN ML LAKLLH++GFH+TFVNTE+NH RL RSRGP
Sbjct  1    MGS--IDMIQKPHALCIPYPAQGHINPMLNLAKLLHHRGFHVTFVNTEYNHSRLLRSRGP  58

Query  229  ESLRGLPSFRFETIPDGLPPSDV-DATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATN  405
             SL GLPSFRF TIPDGLPPSDV DATQDIP+LC ST+  CL  F+DLL RLN  +  + 
Sbjct  59   SSLDGLPSFRFRTIPDGLPPSDVADATQDIPALCQSTSKFCLPYFRDLLERLNEESTTSG  118

Query  406  VPPVSCIVSDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLK  573
             PPVSC+VSDG+MSFTL AAE +G+P+VLFW  SA GFMG + Y  L+DKG TPLK
Sbjct  119  SPPVSCVVSDGVMSFTLDAAEAIGVPEVLFWTTSACGFMGYVQYRNLIDKGLTPLK  174



>ref|XP_008386313.1| PREDICTED: UDP-glycosyltransferase 85A5-like [Malus domestica]
Length=493

 Score =   261 bits (667),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 118/191 (62%), Positives = 150/191 (79%), Gaps = 3/191 (2%)
 Frame = +1

Query  76   KKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPSF  255
            KK HAV VPYPAQ H+N M++LAKLLH++GFHITFVNTEFNH RL RS GP+S++GLP F
Sbjct  23   KKGHAVFVPYPAQGHVNPMMQLAKLLHSRGFHITFVNTEFNHNRLIRSNGPDSVKGLPDF  82

Query  256  RFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIVSD  435
             FETIPDGLPPSD D TQDIP+LC S   TC GPFK+L+A++N   +++ VP V+CIV+D
Sbjct  83   VFETIPDGLPPSDKDGTQDIPALCDSIKKTCFGPFKELVAKIN---SSSQVPQVTCIVAD  139

Query  436  GIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEGYLTNGYLETEL  615
            GIM+F   AA ELGIP+V+ W  SA GFMG + Y++LV +G  P KDE ++ +G L+T +
Sbjct  140  GIMTFGCKAARELGIPEVVLWTASACGFMGYLQYNELVKRGXIPFKDENFMHDGTLDTPI  199

Query  616  DWVKGMKGIRL  648
            DW+ GMK +RL
Sbjct  200  DWIPGMKNVRL  210



>gb|KFK44334.1| hypothetical protein AALP_AA1G244600 [Arabis alpina]
Length=482

 Score =   260 bits (665),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 125/200 (63%), Positives = 154/200 (77%), Gaps = 4/200 (2%)
 Frame = +1

Query  49   MGSNNCEFEKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGP  228
            M S+    ++KPHAVCVPYPAQ HIN MLK+AKLLH+KGFH++FVNT +NH RL RSRGP
Sbjct  1    MESHAVGSKQKPHAVCVPYPAQGHINPMLKVAKLLHSKGFHVSFVNTIYNHNRLLRSRGP  60

Query  229  ESLRGLPSFRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNV  408
             +L GLPSF+FE+IPDGLP +DV+ATQ IP+LC ST  TCL PFKDLL R+N   A  +V
Sbjct  61   NALDGLPSFQFESIPDGLPETDVEATQHIPTLCESTMKTCLAPFKDLLGRIN---ARDDV  117

Query  409  PPVSCIVSDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEGYL  588
            PPVSCIVSDG MSFTL AAEE  +P+VLFW  SA GF   +H  + ++KG +PLKDE  L
Sbjct  118  PPVSCIVSDGCMSFTLDAAEEFEVPEVLFWTTSACGFSTYLHLYRFIEKG-SPLKDESNL  176

Query  589  TNGYLETELDWVKGMKGIRL  648
            T   L+T++DW+  MK ++L
Sbjct  177  TEEQLDTKIDWIPSMKNLKL  196



>gb|KDP41396.1| hypothetical protein JCGZ_15803 [Jatropha curcas]
Length=472

 Score =   260 bits (664),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 124/191 (65%), Positives = 149/191 (78%), Gaps = 3/191 (2%)
 Frame = +1

Query  85   HAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPSFRFE  264
            HAVC+P+PAQ HIN MLKLAKLLH KGFHITFVNTE+NH+RL +SRG  S+  L +FRFE
Sbjct  12   HAVCIPFPAQGHINPMLKLAKLLHRKGFHITFVNTEYNHQRLLKSRGSNSIDCLSTFRFE  71

Query  265  TIPDGLPPSD-VDATQDIPSLCVSTATTCLGPFKDLLARLNHTAA--ATNVPPVSCIVSD  435
            TIPDGLPPSD  D+TQD+PSLC ST   CL PF+DLL +LN   +  ++ VPPV+CIVSD
Sbjct  72   TIPDGLPPSDHADSTQDVPSLCDSTKKNCLPPFRDLLFKLNDNTSSYSSKVPPVTCIVSD  131

Query  436  GIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEGYLTNGYLETEL  615
             +MSFT+ AA+EL IP VL W  SA GFM   HY QLV+KG+ PLKD   LTNG+L+T +
Sbjct  132  PVMSFTIEAAKELEIPIVLSWTASACGFMAYSHYRQLVEKGFVPLKDASCLTNGFLDTVI  191

Query  616  DWVKGMKGIRL  648
            DW+ GM+GI L
Sbjct  192  DWIPGMEGISL  202



>ref|XP_008234175.1| PREDICTED: UDP-glycosyltransferase 85A5-like [Prunus mume]
Length=480

 Score =   260 bits (665),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 120/200 (60%), Positives = 156/200 (78%), Gaps = 4/200 (2%)
 Frame = +1

Query  49   MGSNNCEFEKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGP  228
            MGS   E  KK HAVCVP+PAQ H++  ++LAKLLH++GFHITFVNTEFNHRRL RS+GP
Sbjct  1    MGSVR-EATKKLHAVCVPFPAQGHVSPAMQLAKLLHSRGFHITFVNTEFNHRRLIRSKGP  59

Query  229  ESLRGLPSFRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNV  408
            +S++GLP F+FETIPDGLPPSD DATQD+P++C ST  TCLGPFK+L+ ++N   +++ V
Sbjct  60   DSVKGLPDFQFETIPDGLPPSDKDATQDVPAICDSTRKTCLGPFKELVTKIN---SSSQV  116

Query  409  PPVSCIVSDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEGYL  588
            P V+CIV+DG+  F   AA+ELGIP+V FW  SA  F+G + YS+LV +G  P KDE +L
Sbjct  117  PQVTCIVADGLTGFGRQAAQELGIPEVQFWTSSACSFLGYLQYSELVKRGIVPFKDETFL  176

Query  589  TNGYLETELDWVKGMKGIRL  648
             +G L+T +DW+ GMK  RL
Sbjct  177  HDGTLDTPIDWIPGMKNARL  196



>ref|XP_009145345.1| PREDICTED: UDP-glycosyltransferase 85A2 isoform X1 [Brassica 
rapa]
Length=487

 Score =   260 bits (665),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 123/195 (63%), Positives = 149/195 (76%), Gaps = 7/195 (4%)
 Frame = +1

Query  76   KKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPSF  255
            +K H VCVPYPAQ HIN M+K+AKLLH KGF++TFVNT +NH+RL RSRG  +L GLPSF
Sbjct  10   RKQHVVCVPYPAQGHINPMMKVAKLLHAKGFYVTFVNTIYNHKRLLRSRGSNALDGLPSF  69

Query  256  RFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIVSD  435
            RFE+IPDGLP +DVD TQDIPSLC ST    L PFK+LL R+N   A   VPPV+CIVSD
Sbjct  70   RFESIPDGLPETDVDVTQDIPSLCESTPKYSLAPFKELLRRIN---AQDEVPPVNCIVSD  126

Query  436  GIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLK----DEGYLTNGYL  603
            G MSFTL AAEELG+P+VLFW  SA GF+  +HY + ++KG +PLK    DE YLT  +L
Sbjct  127  GCMSFTLDAAEELGVPEVLFWTTSACGFLAYLHYHKFIEKGLSPLKVDLADESYLTKEHL  186

Query  604  ETELDWVKGMKGIRL  648
            +T +DW+  MK +RL
Sbjct  187  DTIIDWIPSMKNLRL  201



>ref|XP_010098615.1| UDP-glycosyltransferase 85A1 [Morus notabilis]
 gb|EXB75354.1| UDP-glycosyltransferase 85A1 [Morus notabilis]
Length=481

 Score =   260 bits (664),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 123/201 (61%), Positives = 155/201 (77%), Gaps = 4/201 (2%)
 Frame = +1

Query  49   MGSNNCEFEKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGP  228
            MG++       PH VC+PYPAQ H+N M  LAKLLH+KGF++TFV TEFN++RL RSRGP
Sbjct  1    MGNSLTVKTNPPHVVCIPYPAQGHVNPMTNLAKLLHHKGFYVTFVYTEFNYKRLLRSRGP  60

Query  229  ESLRGLPSFRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNV  408
             SL GLPSFRFE+IPDGLP SD DATQDIPSLC ST+  CL PF+ LL++LN   ++ ++
Sbjct  61   NSLDGLPSFRFESIPDGLPESDADATQDIPSLCESTSKNCLAPFRQLLSKLN---SSPDI  117

Query  409  PPVSCIVSDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEGYL  588
            PPVS IVSDG M+FTL AA ELG+P+V+ W  SA GF+  ++Y QL++KG TPLKD  Y+
Sbjct  118  PPVSSIVSDGAMTFTLEAARELGVPEVVLWTTSACGFLAYLNYRQLIEKGVTPLKDASYM  177

Query  589  TNGYLE-TELDWVKGMKGIRL  648
            TNGYLE T ++ + GMK +RL
Sbjct  178  TNGYLENTVINSIPGMKDMRL  198



>ref|XP_009380209.1| PREDICTED: LOW QUALITY PROTEIN: 7-deoxyloganetin glucosyltransferase-like 
[Musa acuminata subsp. malaccensis]
Length=485

 Score =   260 bits (664),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 125/200 (63%), Positives = 150/200 (75%), Gaps = 8/200 (4%)
 Frame = +1

Query  49   MGSNNCEFEKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGP  228
            MGS   E   KPHAVCVPYPAQ HI  MLKLAKLLH+ GFH+TFVNT FNH+RL RSR  
Sbjct  1    MGSIPAE---KPHAVCVPYPAQGHITPMLKLAKLLHSHGFHVTFVNTLFNHKRLIRSRAI  57

Query  229  ESLRGLPSFRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNV  408
             +L  LPSFRF +IPDGLPPSD DATQDIPSLC +   T L PF+ +L +LN  +     
Sbjct  58   SALHALPSFRFASIPDGLPPSDEDATQDIPSLCEAIPRTALPPFRHVLRQLNEES-----  112

Query  409  PPVSCIVSDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEGYL  588
            PPVSCIVSDG+M+FTL AA+ELG+P+V+FW  SA GFMG +HY  L ++G TPLKDEG +
Sbjct  113  PPVSCIVSDGVMTFTLDAAQELGVPEVVFWTTSACGFMGYLHYQHLRERGLTPLKDEGDI  172

Query  589  TNGYLETELDWVKGMKGIRL  648
            T+GYL+  +DW+ G   +RL
Sbjct  173  TSGYLDMPVDWIPGFDNMRL  192



>ref|XP_011045673.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Populus 
euphratica]
Length=474

 Score =   259 bits (662),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 119/190 (63%), Positives = 147/190 (77%), Gaps = 3/190 (2%)
 Frame = +1

Query  79   KPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPSFR  258
            KPHAVCVP+PAQ HIN MLKLAK+LH  GFHITFVNTE+NHRRL RSRG  SL GLP F+
Sbjct  4    KPHAVCVPFPAQGHINPMLKLAKILHFNGFHITFVNTEYNHRRLLRSRGVSSLDGLPDFQ  63

Query  259  FETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIVSDG  438
            FETIPDGLPPSD D+TQDI +LC ST+ TCL PF+DL+++LN ++    +P V+CIVSD 
Sbjct  64   FETIPDGLPPSDADSTQDILTLCYSTSKTCLAPFRDLISKLNSSSV---IPQVTCIVSDA  120

Query  439  IMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEGYLTNGYLETELD  618
            +M+FTL AAEE GIPD LFW  SA G +G      L ++G  P+KD  Y+TN +LET ++
Sbjct  121  VMNFTLDAAEEFGIPDALFWTPSACGVLGYSKCRSLFERGLIPVKDVSYITNEFLETAIE  180

Query  619  WVKGMKGIRL  648
            W++G + IRL
Sbjct  181  WIQGKENIRL  190



>ref|XP_002268845.1| PREDICTED: 7-deoxyloganetin glucosyltransferase [Vitis vinifera]
Length=483

 Score =   259 bits (663),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 117/191 (61%), Positives = 145/191 (76%), Gaps = 3/191 (2%)
 Frame = +1

Query  76   KKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPSF  255
            +KPHAVCVPYP Q H+  ML+L KLLH +GFHITFVNTE+NHRRL RSRGP +++GLP F
Sbjct  8    RKPHAVCVPYPTQGHVTPMLQLTKLLHTRGFHITFVNTEYNHRRLLRSRGPNAVKGLPDF  67

Query  256  RFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIVSD  435
            RFETIPDGLP SD DA+QDIPSLC ST   CL PFKDLLA++    +++ VPPV+CI+SD
Sbjct  68   RFETIPDGLPQSDRDASQDIPSLCDSTRKNCLPPFKDLLAKI---GSSSEVPPVTCIISD  124

Query  436  GIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEGYLTNGYLETEL  615
            G+MSF + AA+ELGIP    W  SA GFMG + Y +L+ +G  P KDE Y T+G L+  +
Sbjct  125  GVMSFAIKAAKELGIPGFQLWTASACGFMGYLSYRELIRRGIVPFKDESYATDGTLDAPI  184

Query  616  DWVKGMKGIRL  648
            DW+ GM  + L
Sbjct  185  DWIPGMPNMLL  195



>ref|XP_006304665.1| hypothetical protein CARUB_v10011877mg [Capsella rubella]
 gb|EOA37563.1| hypothetical protein CARUB_v10011877mg [Capsella rubella]
Length=486

 Score =   259 bits (663),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 120/200 (60%), Positives = 151/200 (76%), Gaps = 3/200 (2%)
 Frame = +1

Query  49   MGSNNCEFEKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGP  228
            MGS+    ++KPH VCVPYPAQ HIN MLK+AKLLHN+GFH+TFVNT +NH+RL RSRG 
Sbjct  1    MGSHVVCNQQKPHVVCVPYPAQGHINPMLKVAKLLHNRGFHVTFVNTVYNHKRLIRSRGT  60

Query  229  ESLRGLPSFRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNV  408
            ++L  +PSFRFE IPDGLP +DVDATQDIP+L  ST   CL PFK+L+ R+N      +V
Sbjct  61   DALGRVPSFRFEAIPDGLPETDVDATQDIPTLSESTEKNCLAPFKELIGRIN---TREDV  117

Query  409  PPVSCIVSDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEGYL  588
            PPVSCIV+DG MSFTL  AEELG+P+VLFW  S  GFM  +HY   ++KG  P++DE  L
Sbjct  118  PPVSCIVADGAMSFTLDVAEELGVPEVLFWTPSGCGFMAYLHYYLFIEKGLCPVQDESCL  177

Query  589  TNGYLETELDWVKGMKGIRL  648
            T  +L+T +DW+  MK ++L
Sbjct  178  TKEHLDTVIDWIPSMKNLKL  197



>ref|XP_010910271.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Elaeis 
guineensis]
Length=476

 Score =   259 bits (662),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 122/191 (64%), Positives = 145/191 (76%), Gaps = 2/191 (1%)
 Frame = +1

Query  76   KKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPSF  255
            +KPHAVC+PYPAQ H+  +LKLAKLLH +GF+ITFVNT FNH RL RS    SL  LP F
Sbjct  6    EKPHAVCIPYPAQGHVTPLLKLAKLLHVRGFYITFVNTHFNHNRLLRSGAISSLDSLPDF  65

Query  256  RFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIVSD  435
            RFE+IPDGLPPSD DATQD+PSLC S    CL PF+DL+ +LN  ++ T  P VSCIVSD
Sbjct  66   RFESIPDGLPPSDEDATQDVPSLCDSIPKNCLPPFRDLITKLNGPSSPT--PKVSCIVSD  123

Query  436  GIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEGYLTNGYLETEL  615
            G+MSFTL AA+EL IP+VLFW  SA G MG +HY  L ++G  PLKD   LTNGYL+T +
Sbjct  124  GVMSFTLDAAKELQIPEVLFWTTSACGMMGYLHYQHLTERGIFPLKDASDLTNGYLDTPI  183

Query  616  DWVKGMKGIRL  648
            DW+ GMK +RL
Sbjct  184  DWISGMKNVRL  194



>dbj|BAB86928.1| glucosyltransferase-10 [Vigna angularis]
Length=485

 Score =   259 bits (662),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 122/192 (64%), Positives = 151/192 (79%), Gaps = 3/192 (2%)
 Frame = +1

Query  73   EKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPS  252
            ++K HAVCVP+PAQ HIN MLKLAKLLH  GF+ITFVNT +NH+RL +SRG  SL GLPS
Sbjct  7    KEKQHAVCVPFPAQGHINPMLKLAKLLHFNGFYITFVNTHYNHKRLLKSRGLNSLNGLPS  66

Query  253  FRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIVS  432
            FRFETIPDGLP  +V+ T  +PSLC ST+TTCL  F++LL++LN+ +    VP VSCI+S
Sbjct  67   FRFETIPDGLPEPEVEGTHHVPSLCDSTSTTCLPHFRNLLSKLNNESG---VPAVSCIIS  123

Query  433  DGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEGYLTNGYLETE  612
            DG+MSFTL A++ELG+P+VLFW  SA GFM  +HY QL+ +G  P KD   LTNGYL+T 
Sbjct  124  DGVMSFTLDASQELGLPNVLFWTSSACGFMCYVHYHQLIQRGIVPFKDASDLTNGYLDTT  183

Query  613  LDWVKGMKGIRL  648
            +DWV G+K IRL
Sbjct  184  IDWVAGIKEIRL  195



>gb|ABK95289.1| unknown [Populus trichocarpa]
Length=479

 Score =   259 bits (661),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 120/193 (62%), Positives = 149/193 (77%), Gaps = 7/193 (4%)
 Frame = +1

Query  76   KKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPSF  255
            +KPHAVCVP+PAQ H+  M+ LAKLLH++GFHITFVNTEFNHRRL RSRGP+S+ GLP F
Sbjct  7    RKPHAVCVPFPAQGHVTPMMHLAKLLHSRGFHITFVNTEFNHRRLIRSRGPDSVEGLPDF  66

Query  256  RFETIPDG--LPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIV  429
            RFETIPDG  LPPSD DATQD+PSLC ST T CL PFK+LL +LN   +++ VPPV+C++
Sbjct  67   RFETIPDGLPLPPSDFDATQDVPSLCDSTRTNCLAPFKELLTKLN---SSSEVPPVTCVI  123

Query  430  SDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEGYLTNGYLET  609
            SDG MSF + AAEE  IP V FW  SA  FMG +H+S+L  +G+ P K+E  L +G  +T
Sbjct  124  SDGAMSFGIKAAEEFSIPQVQFWTASACSFMGYLHFSELTRRGFVPYKEENLLRDG--DT  181

Query  610  ELDWVKGMKGIRL  648
             +DW+ G+  IRL
Sbjct  182  PIDWIPGLSNIRL  194



>ref|XP_007225655.1| hypothetical protein PRUPE_ppa004945mg [Prunus persica]
 gb|EMJ26854.1| hypothetical protein PRUPE_ppa004945mg [Prunus persica]
Length=484

 Score =   259 bits (662),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 119/191 (62%), Positives = 152/191 (80%), Gaps = 3/191 (2%)
 Frame = +1

Query  76   KKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPSF  255
            KK HAV VP+P+Q HIN +++LAKLLH KGFHITFVNTE+NH+RL +SRGP++L GLP+F
Sbjct  9    KKSHAVFVPFPSQGHINPLMQLAKLLHYKGFHITFVNTEYNHKRLLKSRGPDALNGLPTF  68

Query  256  RFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIVSD  435
            RFETI DGLPP+D DATQDIPSLC ST+   L  F+DLL++LN   ++ + P V+C+++D
Sbjct  69   RFETISDGLPPTDADATQDIPSLCDSTSKHSLPHFRDLLSKLN---SSPDSPRVTCLITD  125

Query  436  GIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEGYLTNGYLETEL  615
            G+MSFTL AA+ELG+P V FW  SA GFMG + + QL++KG TP +D  Y TNG+L T L
Sbjct  126  GVMSFTLDAAQELGVPAVFFWTPSACGFMGYVQFHQLIEKGLTPFEDASYFTNGHLNTVL  185

Query  616  DWVKGMKGIRL  648
            DWV GM+ IRL
Sbjct  186  DWVPGMRNIRL  196



>dbj|BAO51833.1| UDP-glycosyltransferase 85K10 [Camellia sinensis]
Length=480

 Score =   259 bits (661),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 117/193 (61%), Positives = 151/193 (78%), Gaps = 5/193 (3%)
 Frame = +1

Query  76   KKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGP--ESLRGLP  249
            +KPH VCVPYP+Q H+  ++ LA+LL+++GFH+TFVNTEFNHRRL RS+GP  +S++GLP
Sbjct  8    RKPHVVCVPYPSQGHVTPLMLLAQLLYSRGFHVTFVNTEFNHRRLVRSKGPNSDSVKGLP  67

Query  250  SFRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIV  429
             FRFETIPDGLPPSD DATQD+P+LC S    CL PF DLL RLN T   + VP VSCIV
Sbjct  68   GFRFETIPDGLPPSDRDATQDVPALCDSVRKNCLVPFIDLLHRLNST---SEVPRVSCIV  124

Query  430  SDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEGYLTNGYLET  609
            SDG+MSF + AA+E+GIP+V FW  SA  FMG +HY +L+ +G  P KDE ++++G L+T
Sbjct  125  SDGVMSFAIEAAKEMGIPEVQFWTASACSFMGYLHYRELIRRGIFPFKDENFMSDGTLDT  184

Query  610  ELDWVKGMKGIRL  648
             +DW+ GM+ IRL
Sbjct  185  PIDWIPGMRNIRL  197



>ref|XP_011045674.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Populus 
euphratica]
Length=503

 Score =   259 bits (662),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 119/190 (63%), Positives = 147/190 (77%), Gaps = 3/190 (2%)
 Frame = +1

Query  79   KPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPSFR  258
            KPHAVCVP+PAQ HIN MLKLAK+LH  GFHITFVNTE+NHRRL RSRG  SL GLP F+
Sbjct  33   KPHAVCVPFPAQGHINPMLKLAKILHFNGFHITFVNTEYNHRRLLRSRGVSSLDGLPDFQ  92

Query  259  FETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIVSDG  438
            FETIPDGLPPSD D+TQDI +LC ST+ TCL PF+DL+++LN ++    +P V+CIVSD 
Sbjct  93   FETIPDGLPPSDADSTQDILTLCYSTSKTCLAPFRDLISKLNSSSV---IPQVTCIVSDA  149

Query  439  IMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEGYLTNGYLETELD  618
            +M+FTL AAEE GIPD LFW  SA G +G      L ++G  P+KD  Y+TN +LET ++
Sbjct  150  VMNFTLDAAEEFGIPDALFWTPSACGVLGYSKCRSLFERGLIPVKDVSYITNEFLETAIE  209

Query  619  WVKGMKGIRL  648
            W++G + IRL
Sbjct  210  WIQGKENIRL  219



>gb|EYU18467.1| hypothetical protein MIMGU_mgv1a005587mg [Erythranthe guttata]
Length=478

 Score =   258 bits (660),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 125/191 (65%), Positives = 151/191 (79%), Gaps = 4/191 (2%)
 Frame = +1

Query  79   KPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPSFR  258
            KPHAV +PYPAQ HI  +LKLAKLLHN GF ITFVNTEFNH RL RSRGP+S++GLP F+
Sbjct  2    KPHAVVIPYPAQGHIAPVLKLAKLLHNNGFFITFVNTEFNHNRLLRSRGPDSVKGLPDFQ  61

Query  259  FETIPDGL-PPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIVSD  435
            F+TIPDGL PPS+ DATQDIP L  S + TCL PF DL+  LN +    + P VSCIVSD
Sbjct  62   FKTIPDGLPPPSNSDATQDIPLLSQSISRTCLPPFLDLIGNLNDSP---DCPAVSCIVSD  118

Query  436  GIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEGYLTNGYLETEL  615
            G+MSFTL AA++LGIP+V+F+  SA GFM  +HYS+LV +G+ P KDE   +NGYLETE+
Sbjct  119  GVMSFTLDAADKLGIPEVVFFTTSACGFMAYLHYSELVSRGFVPFKDESCFSNGYLETEI  178

Query  616  DWVKGMKGIRL  648
            D++ GMKGIRL
Sbjct  179  DFIPGMKGIRL  189



>ref|XP_007224375.1| hypothetical protein PRUPE_ppa021058mg [Prunus persica]
 gb|EMJ25574.1| hypothetical protein PRUPE_ppa021058mg [Prunus persica]
Length=487

 Score =   258 bits (660),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 124/201 (62%), Positives = 151/201 (75%), Gaps = 4/201 (2%)
 Frame = +1

Query  49   MGSNNCEFEKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGP  228
            M   N    +KPHAVC+P+PAQ HIN MLKLAKLLH KGFHITFVNTEF H+RL +S+GP
Sbjct  1    MAFFNALTSEKPHAVCMPFPAQGHINPMLKLAKLLHFKGFHITFVNTEFIHKRLLKSQGP  60

Query  229  ESLRGLPSFRFETIPDGLPPSDVD-ATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATN  405
             SL GLP+FRF+ IPDGLPP+D + A Q +PSLC S    CL PF+ LL++L    ++ N
Sbjct  61   NSLNGLPTFRFKMIPDGLPPADANVAAQHMPSLCQSIRKHCLQPFRGLLSKLK---SSPN  117

Query  406  VPPVSCIVSDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEGY  585
             PPV+C+VSDGIM+F+L AA+ELGIP V+FW  SA  FMG + Y  L+ KG  PLKD  Y
Sbjct  118  SPPVTCLVSDGIMNFSLDAAQELGIPGVIFWTTSACAFMGYIQYGPLIQKGLVPLKDARY  177

Query  586  LTNGYLETELDWVKGMKGIRL  648
            LTNGYL+T +DW+ GMK IRL
Sbjct  178  LTNGYLDTVIDWIPGMKSIRL  198



>ref|XP_007141191.1| hypothetical protein PHAVU_008G174700g [Phaseolus vulgaris]
 gb|ESW13185.1| hypothetical protein PHAVU_008G174700g [Phaseolus vulgaris]
Length=491

 Score =   258 bits (660),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 124/191 (65%), Positives = 149/191 (78%), Gaps = 4/191 (2%)
 Frame = +1

Query  76   KKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPSF  255
            KKPHAVC+P+P Q HIN MLKLAKLLH KGFHITFVNTE+ H+RL +SRGP+SL+GL SF
Sbjct  17   KKPHAVCIPHPTQGHINPMLKLAKLLHFKGFHITFVNTEYTHKRLLKSRGPDSLKGLSSF  76

Query  256  RFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIVSD  435
            RFETIPDGLP   VDATQDIPSLC ST  TCL    +LL ++N    +++VPPV+C+V+D
Sbjct  77   RFETIPDGLPEPAVDATQDIPSLCDSTRRTCLPHLNNLLTKIN----SSDVPPVTCLVAD  132

Query  436  GIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEGYLTNGYLETEL  615
            G+MSFTL AAEELG+P  LFW  SA GFM  +   QL+ KG  PLKD   +TNGYLET++
Sbjct  133  GVMSFTLDAAEELGVPLALFWTPSACGFMCYVQLEQLIQKGLIPLKDSSSVTNGYLETKI  192

Query  616  DWVKGMKGIRL  648
            D + G+K IRL
Sbjct  193  DSIPGIKEIRL  203



>ref|XP_011626565.1| PREDICTED: 7-deoxyloganetin glucosyltransferase [Amborella trichopoda]
Length=481

 Score =   258 bits (659),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 119/200 (60%), Positives = 149/200 (75%), Gaps = 6/200 (3%)
 Frame = +1

Query  49   MGSNNCEFEKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGP  228
            MGS N   E + HAVCVPYPAQ HIN M++LAKLLH +GFHITFVN E+NH+RL +SRGP
Sbjct  1    MGSEN---ENQAHAVCVPYPAQGHINPMMQLAKLLHARGFHITFVNNEYNHKRLLKSRGP  57

Query  229  ESLRGLPSFRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNV  408
            +   G+  F FE+IPDGLPP +++ATQ IP LC  T   CL PF++L+ARLN T    ++
Sbjct  58   DPSMGVQGFAFESIPDGLPPIEIEATQSIPELCYYTRNCCLAPFRELVARLNSTE---DL  114

Query  409  PPVSCIVSDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEGYL  588
            PPVSC++SDG M+FT   A+ELGIP V FW  SA GF   +HY +LV++GYTPLKD   L
Sbjct  115  PPVSCVISDGAMNFTQTVADELGIPRVTFWTTSACGFWAYLHYPELVERGYTPLKDASQL  174

Query  589  TNGYLETELDWVKGMKGIRL  648
            TNG+LET L+W++ M  IRL
Sbjct  175  TNGHLETPLNWIQSMPSIRL  194



>gb|ERN14686.1| hypothetical protein AMTR_s00038p00218410 [Amborella trichopoda]
Length=472

 Score =   258 bits (658),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 119/200 (60%), Positives = 149/200 (75%), Gaps = 6/200 (3%)
 Frame = +1

Query  49   MGSNNCEFEKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGP  228
            MGS N   E + HAVCVPYPAQ HIN M++LAKLLH +GFHITFVN E+NH+RL +SRGP
Sbjct  1    MGSEN---ENQAHAVCVPYPAQGHINPMMQLAKLLHARGFHITFVNNEYNHKRLLKSRGP  57

Query  229  ESLRGLPSFRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNV  408
            +   G+  F FE+IPDGLPP +++ATQ IP LC  T   CL PF++L+ARLN T    ++
Sbjct  58   DPSMGVQGFAFESIPDGLPPIEIEATQSIPELCYYTRNCCLAPFRELVARLNSTE---DL  114

Query  409  PPVSCIVSDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEGYL  588
            PPVSC++SDG M+FT   A+ELGIP V FW  SA GF   +HY +LV++GYTPLKD   L
Sbjct  115  PPVSCVISDGAMNFTQTVADELGIPRVTFWTTSACGFWAYLHYPELVERGYTPLKDASQL  174

Query  589  TNGYLETELDWVKGMKGIRL  648
            TNG+LET L+W++ M  IRL
Sbjct  175  TNGHLETPLNWIQSMPSIRL  194



>emb|CDY46645.1| BnaA07g10510D [Brassica napus]
Length=458

 Score =   257 bits (656),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 118/191 (62%), Positives = 146/191 (76%), Gaps = 3/191 (2%)
 Frame = +1

Query  76   KKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPSF  255
            +KPH +CVPYPAQ HIN MLK+AKLLH +GFH+TFVNT +NH RL RSRGP ++ GLPSF
Sbjct  10   EKPHVICVPYPAQGHINPMLKVAKLLHARGFHVTFVNTVYNHNRLIRSRGPHAVEGLPSF  69

Query  256  RFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIVSD  435
            RFE+IPDGLP +DVD TQDI +LC ST   CL PFK+LL R+N   A  +VPPVSCIV+D
Sbjct  70   RFESIPDGLPETDVDVTQDITALCDSTMKNCLTPFKELLQRIN---AGDDVPPVSCIVAD  126

Query  436  GIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEGYLTNGYLETEL  615
            G MSFTL  AEELG+P+VLFW   AS FM  +H+   ++KG  P+K E YLTN YL+T +
Sbjct  127  GCMSFTLEPAEELGVPEVLFWTTGASAFMIYLHFYLFIEKGLAPIKAEDYLTNEYLDTVI  186

Query  616  DWVKGMKGIRL  648
            D++  MK ++ 
Sbjct  187  DFIPSMKNLKF  197



>ref|NP_173652.1| UDP-glucosyl transferase 85A7 [Arabidopsis thaliana]
 sp|Q9LME8.1|U85A7_ARATH RecName: Full=UDP-glycosyltransferase 85A7 [Arabidopsis thaliana]
 gb|AAF87257.1|AC068562_4 Strong similarity to UDP-glucose glucosyltransferase from Arabidopsis 
thaliana gb|AB016819 and contains a UDP-glucosyl transferase 
PF|00201 domain [Arabidopsis thaliana]
 gb|ABE65644.1| UDP-glucoronosyl/UDP-glucosyl transferase family protein [Arabidopsis 
thaliana]
 gb|AEE30231.1| UDP-glucosyl transferase 85A7 [Arabidopsis thaliana]
 gb|AHL38934.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=487

 Score =   258 bits (658),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 115/191 (60%), Positives = 147/191 (77%), Gaps = 3/191 (2%)
 Frame = +1

Query  76   KKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPSF  255
            +KPH VCVPYPAQ HIN MLK+AKLL+ KGFH+TFVNT +NH RL RSRGP +L G PSF
Sbjct  10   QKPHVVCVPYPAQGHINPMLKVAKLLYAKGFHVTFVNTLYNHNRLLRSRGPNALDGFPSF  69

Query  256  RFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIVSD  435
            RFE+IPDGLP +D D TQ  P++C+S    CL PFK++L R+N      +VPPVSCIVSD
Sbjct  70   RFESIPDGLPETDGDRTQHTPTVCMSIEKNCLAPFKEILRRIND---KDDVPPVSCIVSD  126

Query  436  GIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEGYLTNGYLETEL  615
            G+MSFTL AAEELG+P+V+FW  SA GFM ++H+   ++KG +P KDE Y++  +L+T +
Sbjct  127  GVMSFTLDAAEELGVPEVIFWTNSACGFMTILHFYLFIEKGLSPFKDESYMSKEHLDTVI  186

Query  616  DWVKGMKGIRL  648
            DW+  MK +RL
Sbjct  187  DWIPSMKNLRL  197



>ref|XP_011087901.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Sesamum 
indicum]
Length=473

 Score =   257 bits (657),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 120/190 (63%), Positives = 148/190 (78%), Gaps = 3/190 (2%)
 Frame = +1

Query  79   KPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPSFR  258
            KPHAV +PYPAQ HI  +L+LAKLLH +GF ITFVNTEFNH RL R+RGPE+++GL  F+
Sbjct  2    KPHAVVIPYPAQGHIAPVLRLAKLLHYRGFFITFVNTEFNHNRLVRARGPEAVKGLDDFQ  61

Query  259  FETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIVSDG  438
            F+TIPDGLPPS+ DATQDIP L  S +  CL PF DL+  LN +    + P VSCIVSDG
Sbjct  62   FKTIPDGLPPSESDATQDIPLLSQSMSKNCLAPFLDLINSLNDSP---DCPNVSCIVSDG  118

Query  439  IMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEGYLTNGYLETELD  618
            +MSFTL AA+++ IP+V+F+  SA GFMG +HY +LV +GY P KDE   TNGYL+TE+D
Sbjct  119  VMSFTLDAADKVNIPEVVFFTTSACGFMGYLHYGELVTRGYVPFKDESCFTNGYLDTEID  178

Query  619  WVKGMKGIRL  648
            W+ GMKGIRL
Sbjct  179  WIPGMKGIRL  188



>ref|XP_007227474.1| hypothetical protein PRUPE_ppa004968mg [Prunus persica]
 gb|EMJ28673.1| hypothetical protein PRUPE_ppa004968mg [Prunus persica]
Length=483

 Score =   257 bits (657),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 118/192 (61%), Positives = 150/192 (78%), Gaps = 3/192 (2%)
 Frame = +1

Query  73   EKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPS  252
            ++KPHAV VP+PAQ HIN ML+LAKLL+ KGFHITFVNTEFNH+R+  S+G  +L GLPS
Sbjct  7    KEKPHAVFVPFPAQGHINPMLQLAKLLNYKGFHITFVNTEFNHKRMLESQGSHALDGLPS  66

Query  253  FRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIVS  432
            FRFETIPDGLPP+D DA +++P +C ST+ TCL PF+ LL +LN   ++ + PPV+CIV+
Sbjct  67   FRFETIPDGLPPADADARRNLPLVCDSTSKTCLAPFEALLTKLN---SSPDSPPVTCIVA  123

Query  433  DGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEGYLTNGYLETE  612
            DG+ SFTL AAE  GIP+VLFW  SA G MG + Y +L++KG TP KD     NGYL+TE
Sbjct  124  DGVTSFTLDAAEHFGIPEVLFWTTSACGLMGYVQYYRLIEKGLTPFKDAKDFANGYLDTE  183

Query  613  LDWVKGMKGIRL  648
            +DW+ GMK +RL
Sbjct  184  IDWIPGMKDVRL  195



>ref|XP_002893224.1| UDP-glucosyl transferase 85A1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH69483.1| UDP-glucosyl transferase 85A1 [Arabidopsis lyrata subsp. lyrata]
Length=486

 Score =   257 bits (657),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 120/201 (60%), Positives = 149/201 (74%), Gaps = 4/201 (2%)
 Frame = +1

Query  49   MGSNNCEFEKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGP  228
            MGS      +KPH VCVPYPAQ HIN M+K+AKLLH +GFH+TFVNT +NH R  RSRG 
Sbjct  1    MGSQIVHNSQKPHVVCVPYPAQGHINPMMKVAKLLHARGFHVTFVNTVYNHNRFLRSRGS  60

Query  229  ESLRGLPSFRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNV  408
             +L GLPSFRFE+IPDGLP +D+DATQDI +LC ST   CL PF++LL ++N   A  NV
Sbjct  61   NALEGLPSFRFESIPDGLPETDMDATQDITALCESTMKNCLAPFRELLQQIN---AGDNV  117

Query  409  PPVSCIVSDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEGYL  588
            PPVSCIVSDG MSFTL  AEELG+P+VLFW  S   F+  +H+   ++KG +PLKDE YL
Sbjct  118  PPVSCIVSDGCMSFTLDVAEELGVPEVLFWTTSGCAFLAYLHFYLFIEKGLSPLKDESYL  177

Query  589  TNGYL-ETELDWVKGMKGIRL  648
            T  YL +T +D++  MK ++L
Sbjct  178  TKEYLDDTVIDFIPTMKNLKL  198



>ref|XP_010098617.1| UDP-glycosyltransferase 85A2 [Morus notabilis]
 gb|EXB75356.1| UDP-glycosyltransferase 85A2 [Morus notabilis]
Length=471

 Score =   257 bits (656),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 122/173 (71%), Positives = 140/173 (81%), Gaps = 3/173 (2%)
 Frame = +1

Query  130  MLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPSFRFETIPDGLPPSDVDATQ  309
            MLKLAKLLH+KGFHITFVNTEFNH+RL +SRG  +L GLPSFRFE IPDGLPP+D DATQ
Sbjct  1    MLKLAKLLHSKGFHITFVNTEFNHKRLLKSRGAHALDGLPSFRFEAIPDGLPPTDADATQ  60

Query  310  DIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIVSDGIMSFTLAAAEELGIPDV  489
             IP++C ST    L PF+DLL +LN   ++  VPPVSC+VSDG MSFTL AAEELGIP+V
Sbjct  61   SIPAICESTPKHSLAPFRDLLLKLN---SSPEVPPVSCVVSDGAMSFTLDAAEELGIPEV  117

Query  490  LFWPISASGFMGVMHYSQLVDKGYTPLKDEGYLTNGYLETELDWVKGMKGIRL  648
            LFW  SA GF+G +HY  LV+KGYTPLKDE YLTN YL T +DW+ GMK IRL
Sbjct  118  LFWTTSACGFLGYLHYRALVEKGYTPLKDESYLTNEYLNTVIDWIPGMKDIRL  170



>ref|XP_006304493.1| hypothetical protein CARUB_v10011262mg [Capsella rubella]
 gb|EOA37391.1| hypothetical protein CARUB_v10011262mg [Capsella rubella]
Length=488

 Score =   257 bits (657),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 117/200 (59%), Positives = 150/200 (75%), Gaps = 3/200 (2%)
 Frame = +1

Query  49   MGSNNCEFEKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGP  228
            MGS+     +KPH VCVPYPAQ HIN M+K+AKLLH +GFH+TFVNT +NH+R  RSRG 
Sbjct  1    MGSHVVGNTQKPHVVCVPYPAQGHINPMMKVAKLLHARGFHVTFVNTIYNHKRFLRSRGS  60

Query  229  ESLRGLPSFRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNV  408
             +L GLPSFRFE+IPDGLP +D+D TQDI +LC ST   CL PF++L+ R+N   A  NV
Sbjct  61   NALDGLPSFRFESIPDGLPETDMDTTQDITALCESTMKNCLAPFQELIQRIN---AGDNV  117

Query  409  PPVSCIVSDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEGYL  588
            PPVSCIVSDG MSFTL  AEELG+P+VLFW  S   F+  +H+   ++KG +P+KDE YL
Sbjct  118  PPVSCIVSDGCMSFTLDVAEELGVPEVLFWTTSGCAFLAYLHFYLFIEKGISPMKDESYL  177

Query  589  TNGYLETELDWVKGMKGIRL  648
            T  +L+T +D++  MK ++L
Sbjct  178  TKEHLDTVIDFIPSMKNLKL  197



>gb|ABV68925.1| mandelonitrile glucosyltransferase UGT85A19 [Prunus dulcis]
Length=483

 Score =   257 bits (657),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 118/192 (61%), Positives = 150/192 (78%), Gaps = 3/192 (2%)
 Frame = +1

Query  73   EKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPS  252
            ++KPHAV VP+PAQ HIN ML+LAKLL+ KGFHITFVNTEFNH+R+  S+G  +L GLPS
Sbjct  7    KEKPHAVFVPFPAQGHINPMLQLAKLLNYKGFHITFVNTEFNHKRMLESQGSHALDGLPS  66

Query  253  FRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIVS  432
            FRFETIPDGLPP+D DA +++P +C ST+ TCL PF+ LL +LN   ++ + PPV+CIV+
Sbjct  67   FRFETIPDGLPPADADARRNLPLVCDSTSKTCLAPFEALLTKLN---SSPDSPPVTCIVA  123

Query  433  DGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEGYLTNGYLETE  612
            DG+ SFTL AAE  GIP+VLFW  SA G MG + Y +L++KG TP KD     NGYL+TE
Sbjct  124  DGVSSFTLDAAEHFGIPEVLFWTTSACGLMGYVQYYRLIEKGLTPFKDAKDFANGYLDTE  183

Query  613  LDWVKGMKGIRL  648
            +DW+ GMK +RL
Sbjct  184  IDWIPGMKDVRL  195



>ref|XP_008811180.1| PREDICTED: UDP-glycosyltransferase 85A5-like [Phoenix dactylifera]
Length=484

 Score =   257 bits (657),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 115/190 (61%), Positives = 148/190 (78%), Gaps = 3/190 (2%)
 Frame = +1

Query  79   KPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPSFR  258
            +PHAV +P PAQ H+  ML+LAK+LH+KGF+IT+VN+E+NH+RL RSRGP+SL GL  FR
Sbjct  6    RPHAVLIPQPAQGHVTPMLQLAKVLHSKGFYITYVNSEYNHKRLLRSRGPDSLDGLEDFR  65

Query  259  FETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIVSDG  438
            FE IPDGLP SD D TQDI  LC+ST    L PF+DLL RLN +     VPPVSC+++DG
Sbjct  66   FEAIPDGLPQSDDDVTQDIAELCISTTKNSLVPFRDLLVRLNRSPG---VPPVSCVIADG  122

Query  439  IMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEGYLTNGYLETELD  618
            +MSF    AE++GI  ++FW  SA GFMG +H+S+L+ +GYTPL+DE YLTNGYL+T ++
Sbjct  123  VMSFAQRVAEKMGILALVFWTTSACGFMGYLHFSELIRRGYTPLEDESYLTNGYLDTPIE  182

Query  619  WVKGMKGIRL  648
            W+ GM GIRL
Sbjct  183  WIPGMTGIRL  192



>ref|XP_006303659.1| hypothetical protein CARUB_v10011698mg [Capsella rubella]
 gb|EOA36557.1| hypothetical protein CARUB_v10011698mg [Capsella rubella]
Length=483

 Score =   257 bits (656),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 120/200 (60%), Positives = 149/200 (75%), Gaps = 6/200 (3%)
 Frame = +1

Query  49   MGSNNCEFEKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGP  228
            M S      +KPH VCVP+PAQ HIN ML++AKLLH KGFH+TF NT +NH+RL RSRG 
Sbjct  1    MASQTVSSGQKPHVVCVPFPAQGHINPMLQVAKLLHAKGFHVTFANTIYNHKRLLRSRGS  60

Query  229  ESLRGLPSFRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNV  408
             +L  LPSFR+E+IPDGLP ++ DATQD+P LC ST   CL PFK+LL R+N    A +V
Sbjct  61   NALNVLPSFRYESIPDGLPETNKDATQDVPPLCASTKKNCLAPFKELLTRIN---TADDV  117

Query  409  PPVSCIVSDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEGYL  588
            PPVSCIVSDGIMSFTL AAEELG+PDV+FW  SA GF+  +H+   V+KG +P KDE   
Sbjct  118  PPVSCIVSDGIMSFTLDAAEELGVPDVVFWTTSACGFLAYLHFYCFVEKGLSPQKDE---  174

Query  589  TNGYLETELDWVKGMKGIRL  648
            +  +LET++DW+  MK +RL
Sbjct  175  SKEHLETKIDWIPSMKNLRL  194



>ref|XP_011008563.1| PREDICTED: uncharacterized protein LOC105113904 [Populus euphratica]
Length=1037

 Score =   267 bits (682),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 129/213 (61%), Positives = 157/213 (74%), Gaps = 2/213 (1%)
 Frame = +1

Query  10   VSNQSRSRERKREMGSNNCEFEKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNT  189
            +  + R +ER R+M S     + KPHAVC P PAQSHI +MLKLAKLLH KGFHITFVNT
Sbjct  544  IIQEERKKERARDMTSKILA-DHKPHAVCFPSPAQSHIKSMLKLAKLLHYKGFHITFVNT  602

Query  190  EFNHRRLQRSRGPESLRGLPSFRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDL  369
            EFNH+RL +SRG +SL+GLP F+FE+IPDGLPPSD +ATQD+P LC +     L PF DL
Sbjct  603  EFNHKRLLKSRGSDSLKGLPDFQFESIPDGLPPSDENATQDMPGLCEAAKKNLLAPFNDL  662

Query  370  LARLNHTAAATNVPPVSCIVSDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLV  549
            L +LN TA+  +VPPV+CIVSDG M   +  AE LGIP  LF+ ISA  FMG+  Y  L 
Sbjct  663  LDKLNDTASP-DVPPVTCIVSDGFMPVAITTAEMLGIPIALFFTISACSFMGLKQYKVLK  721

Query  550  DKGYTPLKDEGYLTNGYLETELDWVKGMKGIRL  648
            +KG+ PLKDE +LTNGYL+  +DW+ GMK IRL
Sbjct  722  EKGFIPLKDESFLTNGYLDRVVDWIPGMKDIRL  754


 Score =   200 bits (508),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 103/190 (54%), Positives = 125/190 (66%), Gaps = 7/190 (4%)
 Frame = +1

Query  79   KPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPSFR  258
            KPHAV +P   QSHI +ML+LAKLLH+KGFHITFVNTEFNHR L  SR P+SL GL  FR
Sbjct  4    KPHAVFIPLQLQSHIKSMLQLAKLLHHKGFHITFVNTEFNHRLLLNSRAPDSLNGLHDFR  63

Query  259  FETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIVSDG  438
            FETIPD +PPS   A+ +            L  F DLLA+L H    + VPPV+CIVSDG
Sbjct  64   FETIPDSIPPSGTLASAE------DFKKNQLASFNDLLAKL-HDTTFSGVPPVTCIVSDG  116

Query  439  IMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEGYLTNGYLETELD  618
             M F+++AAE LGIP  LF+ ISA  FM    +  L  +G  PL DE + TN + +  +D
Sbjct  117  AMPFSISAAETLGIPIALFFTISACAFMCSKQFRALKKEGLAPLDDESFQTNDFADRIID  176

Query  619  WVKGMKGIRL  648
            W+ GMK IRL
Sbjct  177  WIPGMKDIRL  186



>ref|XP_006388801.1| hypothetical protein POPTR_0098s002901g, partial [Populus trichocarpa]
 gb|ERP47715.1| hypothetical protein POPTR_0098s002901g, partial [Populus trichocarpa]
Length=360

 Score =   253 bits (645),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 121/192 (63%), Positives = 145/192 (76%), Gaps = 1/192 (1%)
 Frame = +1

Query  73   EKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPS  252
            + KPHAVC P PAQSHI +MLKLAKLLH KGFHITFVNTEFNH+RL +SRG +SL+GLP 
Sbjct  8    DHKPHAVCFPSPAQSHIKSMLKLAKLLHYKGFHITFVNTEFNHKRLLKSRGSDSLKGLPD  67

Query  253  FRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIVS  432
            F+FE+IPDGLPPSD +ATQD+P LC +     L PF DLL +LN TA+  +VPPV+CIVS
Sbjct  68   FQFESIPDGLPPSDENATQDLPGLCEAARKNLLAPFNDLLDKLNDTASP-DVPPVTCIVS  126

Query  433  DGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLKDEGYLTNGYLETE  612
            DG M   + AA +  IP  LF+ ISA  FMG   +  L +KG TPLKDE +LTNGYL+  
Sbjct  127  DGFMPVAIDAAAKREIPIALFFTISACSFMGFKQFQALKEKGLTPLKDESFLTNGYLDRV  186

Query  613  LDWVKGMKGIRL  648
            +DW+ GMK IRL
Sbjct  187  VDWIAGMKDIRL  198



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1026237057824