BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig207

Length=731
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|ABB55368.1|  Aux/IAA protein-like                                    178   5e-50   Solanum tuberosum [potatoes]
ref|NP_001275473.1|  Aux/IAA protein                                    177   2e-49   Solanum tuberosum [potatoes]
emb|CAJ13716.1|  auxin induced protein                                  171   1e-48   Capsicum chinense [bonnet pepper]
ref|XP_010320058.1|  PREDICTED: auxin-responsive protein (Aux/IAA...    174   2e-48   
ref|NP_001265888.1|  auxin-responsive protein (Aux/IAA)                 174   2e-48   
ref|XP_009789143.1|  PREDICTED: auxin-responsive protein IAA8-like      157   8e-42   Nicotiana sylvestris
ref|XP_009608764.1|  PREDICTED: auxin-responsive protein IAA8-like      156   1e-41   Nicotiana tomentosiformis
ref|XP_009366395.1|  PREDICTED: auxin-responsive protein IAA8-like      156   2e-41   Pyrus x bretschneideri [bai li]
gb|KJB58777.1|  hypothetical protein B456_009G226000                    155   6e-41   Gossypium raimondii
gb|KJB58782.1|  hypothetical protein B456_009G226000                    154   6e-41   Gossypium raimondii
ref|XP_007018336.1|  Aux/IAA protein isoform 1                          154   1e-40   
ref|XP_008219180.1|  PREDICTED: auxin-responsive protein IAA8-like      154   1e-40   Prunus mume [ume]
ref|NP_001280795.1|  auxin-responsive protein IAA8-like                 153   2e-40   Malus domestica [apple tree]
ref|XP_008378626.1|  PREDICTED: auxin-responsive protein IAA8-like      153   2e-40   
emb|CAD10639.1|  IAA9 protein                                           152   3e-40   Nicotiana tabacum [American tobacco]
ref|NP_001268170.1|  Aux/IAA protein                                    152   4e-40   Vitis vinifera
ref|XP_010664066.1|  PREDICTED: aux/IAA protein isoform X1              152   4e-40   Vitis vinifera
emb|CAN77436.1|  hypothetical protein VITISV_007399                     152   4e-40   Vitis vinifera
ref|XP_008339000.1|  PREDICTED: auxin-responsive protein IAA8-lik...    152   5e-40   
ref|XP_008338995.1|  PREDICTED: auxin-responsive protein IAA9-lik...    152   6e-40   
ref|XP_007225723.1|  hypothetical protein PRUPE_ppa006744mg             150   8e-40   
ref|XP_002509993.1|  Auxin-responsive protein IAA19, putative           151   2e-39   
gb|KJB58781.1|  hypothetical protein B456_009G226000                    150   3e-39   Gossypium raimondii
gb|AAL92850.1|  Aux/IAA protein                                         150   4e-39   Vitis vinifera
ref|XP_007225724.1|  hypothetical protein PRUPE_ppa006744mg             149   9e-39   
gb|KJB64034.1|  hypothetical protein B456_010G031600                    144   2e-37   Gossypium raimondii
gb|KHG13564.1|  Auxin-responsive IAA9 -like protein                     145   3e-37   Gossypium arboreum [tree cotton]
gb|AEI70507.1|  auxin-responsive protein                                144   3e-37   Gossypium hirsutum [American cotton]
gb|KJB64033.1|  hypothetical protein B456_010G031600                    144   4e-37   Gossypium raimondii
ref|XP_011016963.1|  PREDICTED: auxin-responsive protein IAA9-like      144   5e-37   Populus euphratica
ref|XP_007225727.1|  hypothetical protein PRUPE_ppa006744mg             144   6e-37   Prunus persica
ref|XP_012068087.1|  PREDICTED: auxin-responsive protein IAA9-like      144   8e-37   Jatropha curcas
gb|KJB64027.1|  hypothetical protein B456_010G031600                    143   9e-37   Gossypium raimondii
ref|XP_002302351.1|  auxin-responsive family protein                    142   3e-36   Populus trichocarpa [western balsam poplar]
emb|CAC84706.1|  aux/IAA protein                                        141   7e-36   Populus tremula x Populus tremuloides
gb|AFZ78618.1|  hypothetical protein                                    139   7e-35   Populus tomentosa [Chinese white poplar]
ref|XP_010104556.1|  Auxin-responsive protein IAA9                      137   2e-34   
gb|KCW68554.1|  hypothetical protein EUGRSUZ_F02172                     134   1e-33   Eucalyptus grandis [rose gum]
gb|KCW68553.1|  hypothetical protein EUGRSUZ_F02172                     134   3e-33   Eucalyptus grandis [rose gum]
ref|XP_004299829.1|  PREDICTED: auxin-responsive protein IAA8-lik...    134   4e-33   Fragaria vesca subsp. vesca
ref|XP_010061570.1|  PREDICTED: auxin-responsive protein IAA9-like      134   4e-33   Eucalyptus grandis [rose gum]
gb|KDO81312.1|  hypothetical protein CISIN_1g017824mg                   130   5e-33   Citrus sinensis [apfelsine]
emb|CDP00957.1|  unnamed protein product                                133   8e-33   Coffea canephora [robusta coffee]
ref|XP_004509715.1|  PREDICTED: auxin-responsive protein IAA9-lik...    132   1e-32   Cicer arietinum [garbanzo]
gb|KDO81311.1|  hypothetical protein CISIN_1g017824mg                   130   3e-32   Citrus sinensis [apfelsine]
ref|XP_006433732.1|  hypothetical protein CICLE_v10001479mg             130   5e-32   
ref|XP_006433736.1|  hypothetical protein CICLE_v10001479mg             130   7e-32   Citrus clementina [clementine]
ref|NP_001267710.1|  auxin-responsive protein IAA9-like                 130   9e-32   Cucumis sativus [cucumbers]
gb|KDO81310.1|  hypothetical protein CISIN_1g017824mg                   129   1e-31   Citrus sinensis [apfelsine]
gb|KDO81302.1|  hypothetical protein CISIN_1g017824mg                   129   2e-31   Citrus sinensis [apfelsine]
ref|XP_006472387.1|  PREDICTED: auxin-responsive protein IAA9-lik...    129   2e-31   Citrus sinensis [apfelsine]
ref|XP_008444965.1|  PREDICTED: auxin-responsive protein IAA9-like      129   3e-31   Cucumis melo [Oriental melon]
ref|XP_007137671.1|  hypothetical protein PHAVU_009G146000g             127   9e-31   Phaseolus vulgaris [French bean]
gb|AID60626.1|  auxin-responsive protein IAA8                           125   1e-30   Dimocarpus longan [longan]
emb|CAI77628.1|  Aux/IAA protein                                        125   2e-30   Solanum lycopersicum
ref|XP_012079519.1|  PREDICTED: auxin-responsive protein IAA9           126   3e-30   Jatropha curcas
ref|XP_011099452.1|  PREDICTED: auxin-responsive protein IAA9-like      124   1e-29   Sesamum indicum [beniseed]
ref|XP_003628839.1|  Indoleacetic acid-induced-like protein             124   2e-29   
gb|ACU23129.1|  unknown                                                 120   2e-29   Glycine max [soybeans]
gb|AFK49626.1|  unknown                                                 122   4e-29   Medicago truncatula
gb|ACJ84551.1|  unknown                                                 122   4e-29   Medicago truncatula
ref|XP_010275505.1|  PREDICTED: auxin-responsive protein IAA9 iso...    121   2e-28   Nelumbo nucifera [Indian lotus]
ref|XP_010275504.1|  PREDICTED: auxin-responsive protein IAA9 iso...    121   2e-28   Nelumbo nucifera [Indian lotus]
ref|XP_010105114.1|  Auxin-responsive protein IAA9                      121   2e-28   
ref|XP_003544843.1|  PREDICTED: auxin-responsive protein IAA9           120   5e-28   Glycine max [soybeans]
ref|XP_010275506.1|  PREDICTED: auxin-responsive protein IAA9 iso...    120   5e-28   Nelumbo nucifera [Indian lotus]
ref|XP_003519213.1|  PREDICTED: auxin-responsive protein IAA9-like      119   6e-28   Glycine max [soybeans]
gb|KHN09036.1|  Auxin-responsive protein IAA8                           119   6e-28   Glycine soja [wild soybean]
ref|XP_008236708.1|  PREDICTED: auxin-responsive protein IAA9           119   1e-27   Prunus mume [ume]
ref|XP_007047688.1|  Transcription factor, putative isoform 2           119   1e-27   Theobroma cacao [chocolate]
ref|XP_007205358.1|  hypothetical protein PRUPE_ppa007194mg             119   1e-27   Prunus persica
ref|XP_007047687.1|  Transcription factor, putative isoform 1           118   2e-27   Theobroma cacao [chocolate]
ref|XP_007047690.1|  Transcription factor, putative isoform 4           118   2e-27   
ref|XP_003517136.1|  PREDICTED: auxin-responsive protein IAA9 iso...    118   2e-27   
emb|CDP02673.1|  unnamed protein product                                117   5e-27   Coffea canephora [robusta coffee]
ref|XP_007158315.1|  hypothetical protein PHAVU_002G142500g             117   5e-27   Phaseolus vulgaris [French bean]
ref|NP_001241389.1|  uncharacterized protein LOC100783314               116   7e-27   Glycine max [soybeans]
ref|XP_011464769.1|  PREDICTED: auxin-responsive protein IAA8-lik...    115   1e-26   Fragaria vesca subsp. vesca
gb|ACU19961.1|  unknown                                                 113   1e-26   Glycine max [soybeans]
ref|XP_002528895.1|  transcription factor, putative                     115   2e-26   Ricinus communis
gb|KHN08222.1|  Auxin-responsive protein IAA8                           114   4e-26   Glycine soja [wild soybean]
ref|XP_004490496.1|  PREDICTED: auxin-responsive protein IAA9-like      114   4e-26   Cicer arietinum [garbanzo]
ref|XP_006426197.1|  hypothetical protein CICLE_v10025873mg             114   4e-26   Citrus clementina [clementine]
ref|XP_006466369.1|  PREDICTED: auxin-responsive protein IAA9-like      114   4e-26   Citrus sinensis [apfelsine]
ref|XP_003534264.1|  PREDICTED: auxin-responsive protein IAA9           114   6e-26   Glycine max [soybeans]
gb|KJB71171.1|  hypothetical protein B456_011G109000                    113   6e-26   Gossypium raimondii
gb|KJB71165.1|  hypothetical protein B456_011G109000                    113   1e-25   Gossypium raimondii
gb|KJB71172.1|  hypothetical protein B456_011G109000                    113   1e-25   Gossypium raimondii
gb|KJB71166.1|  hypothetical protein B456_011G109000                    113   1e-25   Gossypium raimondii
gb|AAM12952.1|  auxin-regulated protein                                 113   1e-25   Zinnia elegans [garden zinnia]
gb|KHG08881.1|  Auxin-responsive IAA9 -like protein                     112   2e-25   Gossypium arboreum [tree cotton]
ref|XP_004288310.1|  PREDICTED: auxin-responsive protein IAA9           110   8e-25   Fragaria vesca subsp. vesca
ref|XP_010254653.1|  PREDICTED: auxin-responsive protein IAA9-like      111   8e-25   Nelumbo nucifera [Indian lotus]
emb|CBI19314.3|  unnamed protein product                                109   1e-24   Vitis vinifera
gb|EYU44549.1|  hypothetical protein MIMGU_mgv1a010252mg                108   2e-24   Erythranthe guttata [common monkey flower]
gb|EYU44548.1|  hypothetical protein MIMGU_mgv1a010252mg                109   2e-24   Erythranthe guttata [common monkey flower]
gb|AFK43616.1|  unknown                                                 106   2e-24   Lotus japonicus
ref|XP_007156440.1|  hypothetical protein PHAVU_003G286200g             108   3e-24   Phaseolus vulgaris [French bean]
gb|KHN46011.1|  Auxin-responsive protein IAA9                           108   3e-24   Glycine soja [wild soybean]
ref|XP_009344514.1|  PREDICTED: auxin-responsive protein IAA9           108   4e-24   Pyrus x bretschneideri [bai li]
ref|XP_003531969.1|  PREDICTED: auxin-responsive protein IAA9-lik...    108   4e-24   Glycine max [soybeans]
gb|KHN22187.1|  Auxin-responsive protein IAA9                           108   5e-24   Glycine soja [wild soybean]
ref|XP_006585902.1|  PREDICTED: auxin-responsive protein IAA9-lik...    108   5e-24   
gb|ADL36578.1|  ARF domain class transcription factor                   108   6e-24   Malus domestica [apple tree]
gb|KJB18143.1|  hypothetical protein B456_003G035700                    105   3e-23   Gossypium raimondii
gb|KJB18142.1|  hypothetical protein B456_003G035700                    105   3e-23   Gossypium raimondii
ref|XP_011073641.1|  PREDICTED: auxin-responsive protein IAA9-like      106   3e-23   Sesamum indicum [beniseed]
gb|KJB18140.1|  hypothetical protein B456_003G035700                    106   3e-23   Gossypium raimondii
ref|XP_004512542.1|  PREDICTED: auxin-responsive protein IAA8-like      106   3e-23   Cicer arietinum [garbanzo]
gb|AAB70005.1|  GH1 protein                                             105   3e-23   Glycine max [soybeans]
gb|KJB18136.1|  hypothetical protein B456_003G035700                    105   5e-23   Gossypium raimondii
gb|EYU41350.1|  hypothetical protein MIMGU_mgv1a009380mg                105   5e-23   Erythranthe guttata [common monkey flower]
dbj|BAP94244.1|  auxin-responsive protein IAA homolog                 99.0    9e-23   Rubus grayanus
dbj|BAP94276.1|  auxin-responsive protein IAA homolog                 98.6    2e-22   Rubus sp. MM-2014
ref|XP_008357957.1|  PREDICTED: LOW QUALITY PROTEIN: auxin-respon...    102   2e-22   
dbj|BAP94262.1|  auxin-responsive protein IAA homolog                 98.2    2e-22   Rubus sp. MM-2014
ref|XP_004509716.1|  PREDICTED: auxin-responsive protein IAA9-lik...    102   6e-22   
ref|XP_010547581.1|  PREDICTED: auxin-responsive protein IAA9-lik...    101   1e-21   
gb|KEH28135.1|  auxin response factor                                   100   1e-21   Medicago truncatula
ref|XP_010547580.1|  PREDICTED: auxin-responsive protein IAA9-lik...    101   1e-21   Tarenaya hassleriana [spider flower]
gb|AFK38170.1|  unknown                                                 100   2e-21   Lotus japonicus
ref|XP_003615390.1|  Auxin-responsive protein IAA5                      100   2e-21   Medicago truncatula
ref|XP_010023413.1|  PREDICTED: auxin-responsive protein IAA9 iso...    100   3e-21   
ref|XP_010023411.1|  PREDICTED: auxin-responsive protein IAA9 iso...    100   3e-21   Eucalyptus grandis [rose gum]
gb|KCW59655.1|  hypothetical protein EUGRSUZ_H02407                     100   3e-21   Eucalyptus grandis [rose gum]
gb|KHG08155.1|  Auxin-responsive IAA9 -like protein                     100   5e-21   Gossypium arboreum [tree cotton]
ref|XP_010666360.1|  PREDICTED: auxin-responsive protein IAA8-like    99.4    8e-21   Beta vulgaris subsp. vulgaris [field beet]
gb|KHN04889.1|  Auxin-responsive protein IAA8                         94.0    4e-19   Glycine soja [wild soybean]
ref|XP_006394000.1|  hypothetical protein EUTSA_v10004532mg           93.2    8e-19   Eutrema salsugineum [saltwater cress]
ref|NP_001237053.1|  uncharacterized protein LOC100500373             91.7    8e-19   
ref|XP_006394001.1|  hypothetical protein EUTSA_v10004532mg           93.2    8e-19   Eutrema salsugineum [saltwater cress]
ref|XP_008440498.1|  PREDICTED: auxin-responsive protein IAA9-like    93.6    9e-19   Cucumis melo [Oriental melon]
ref|XP_007047689.1|  Transcription factor, putative isoform 3         93.2    1e-18   
ref|XP_010521481.1|  PREDICTED: auxin-responsive protein IAA8-lik...  91.7    4e-18   Tarenaya hassleriana [spider flower]
gb|AGV54485.1|  auxin-responsive protein                              90.5    9e-18   Phaseolus vulgaris [French bean]
gb|ABY48132.1|  GH1 protein                                           90.1    1e-17   Medicago truncatula
ref|XP_002862301.1|  hypothetical protein ARALYDRAFT_920936           89.4    1e-17   Arabidopsis lyrata subsp. lyrata
ref|XP_003612933.1|  Auxin-responsive protein (Aux/IAA)               90.1    1e-17   Medicago truncatula
gb|AFK38538.1|  unknown                                               89.7    1e-17   Lotus japonicus
gb|ADL70577.1|  indole-3-acetic acid inducible 9                      89.0    2e-17   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010683059.1|  PREDICTED: auxin-responsive protein IAA9         89.4    2e-17   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010521482.1|  PREDICTED: auxin-responsive protein IAA8-lik...  89.4    2e-17   Tarenaya hassleriana [spider flower]
gb|ADC29395.2|  indole-3-acetic acid inducible 9                      88.6    3e-17   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002864969.1|  auxin-induced protein IAA9                       89.0    3e-17   
gb|ABD98054.1|  auxin-regulated protein                               88.6    3e-17   Striga asiatica [witchweed]
gb|ADC29394.1|  indole-3-acetic acid inducible 9                      88.6    3e-17   Arabidopsis thaliana [mouse-ear cress]
gb|ADL70578.1|  indole-3-acetic acid inducible 9                      88.6    3e-17   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004143431.1|  PREDICTED: auxin-responsive protein IAA8-like    89.4    3e-17   Cucumis sativus [cucumbers]
gb|ADC29398.1|  indole-3-acetic acid inducible 9                      88.6    3e-17   Arabidopsis thaliana [mouse-ear cress]
gb|ADL70583.1|  indole-3-acetic acid inducible 9                      88.6    3e-17   Arabidopsis thaliana [mouse-ear cress]
gb|ADL70586.1|  indole-3-acetic acid inducible 9                      88.2    3e-17   Arabidopsis thaliana [mouse-ear cress]
dbj|BAB10673.1|  auxin-induced protein IAA9                           88.6    3e-17   Arabidopsis thaliana [mouse-ear cress]
ref|NP_569017.2|  auxin-responsive protein IAA9                       88.2    4e-17   
ref|NP_851275.1|  auxin-responsive protein IAA9                       88.2    4e-17   Arabidopsis thaliana [mouse-ear cress]
gb|AFK49555.1|  unknown                                               84.3    5e-17   Medicago truncatula
gb|ADL70579.1|  indole-3-acetic acid inducible 9                      87.8    5e-17   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010484401.1|  PREDICTED: auxin-responsive protein IAA9         88.2    5e-17   Camelina sativa [gold-of-pleasure]
ref|XP_006279648.1|  hypothetical protein CARUB_v10026736mg           87.8    7e-17   Capsella rubella
gb|AAM64650.1|  auxin-induced protein IAA9                            87.4    8e-17   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010472259.1|  PREDICTED: auxin-responsive protein IAA8-like    85.9    3e-16   Camelina sativa [gold-of-pleasure]
ref|XP_010429195.1|  PREDICTED: auxin-responsive protein IAA8         85.9    3e-16   Camelina sativa [gold-of-pleasure]
gb|ADL70574.1|  indole-3-acetic acid inducible 9                      85.1    4e-16   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010518881.1|  PREDICTED: auxin-responsive protein IAA9-like    84.7    7e-16   Tarenaya hassleriana [spider flower]
emb|CDY45607.1|  BnaCnng13150D                                        84.3    1e-15   Brassica napus [oilseed rape]
ref|XP_006294567.1|  hypothetical protein CARUB_v10023602mg           82.8    3e-15   
ref|XP_006294565.1|  hypothetical protein CARUB_v10023602mg           82.8    3e-15   
ref|XP_002878628.1|  indoleacetic acid-induced protein 8              82.4    3e-15   Arabidopsis lyrata subsp. lyrata
ref|XP_006404728.1|  hypothetical protein EUTSA_v10000236mg           81.6    8e-15   Eutrema salsugineum [saltwater cress]
gb|ADL70561.1|  indole-3-acetic acid inducible 8                      80.1    1e-14   Arabidopsis thaliana [mouse-ear cress]
gb|ADL70565.1|  indole-3-acetic acid inducible 8                      80.1    1e-14   Arabidopsis thaliana [mouse-ear cress]
gb|ADL70572.1|  indole-3-acetic acid inducible 8                      80.1    1e-14   Arabidopsis thaliana [mouse-ear cress]
gb|ADL70573.1|  indole-3-acetic acid inducible 8                      80.1    1e-14   Arabidopsis thaliana [mouse-ear cress]
gb|ADL70566.1|  indole-3-acetic acid inducible 8                      80.1    1e-14   Arabidopsis thaliana [mouse-ear cress]
gb|ADC29390.2|  indole-3-acetic acid inducible 8                      80.1    1e-14   Arabidopsis thaliana [mouse-ear cress]
gb|ADC29393.2|  indole-3-acetic acid inducible 8                      80.1    1e-14   Arabidopsis thaliana [mouse-ear cress]
gb|ADL70564.1|  indole-3-acetic acid inducible 8                      80.1    1e-14   Arabidopsis thaliana [mouse-ear cress]
gb|ADL70563.1|  indole-3-acetic acid inducible 8                      80.1    1e-14   Arabidopsis thaliana [mouse-ear cress]
gb|EPS59988.1|  auxin-regulated protein                               80.9    2e-14   Genlisea aurea
gb|ADL70567.1|  indole-3-acetic acid inducible 8                      80.1    2e-14   Arabidopsis thaliana [mouse-ear cress]
gb|ADL70569.1|  indole-3-acetic acid inducible 8                      80.1    2e-14   Arabidopsis thaliana [mouse-ear cress]
gb|ADL70571.1|  indole-3-acetic acid inducible 8                      80.1    2e-14   Arabidopsis thaliana [mouse-ear cress]
gb|ADL70570.1|  indole-3-acetic acid inducible 8                      80.1    2e-14   Arabidopsis thaliana [mouse-ear cress]
ref|NP_179852.1|  auxin-responsive protein IAA8                       79.7    3e-14   Arabidopsis thaliana [mouse-ear cress]
ref|NP_850028.1|  auxin-responsive protein IAA8                       79.7    3e-14   
ref|NP_001189579.1|  auxin-responsive protein IAA8                    80.1    4e-14   Arabidopsis thaliana [mouse-ear cress]
gb|ADL70562.1|  indole-3-acetic acid inducible 8                      78.6    4e-14   Arabidopsis thaliana [mouse-ear cress]
gb|ADC29389.2|  indole-3-acetic acid inducible 8                      78.6    4e-14   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010463449.1|  PREDICTED: auxin-responsive protein IAA9-lik...  79.7    5e-14   Camelina sativa [gold-of-pleasure]
ref|XP_006850381.1|  PREDICTED: auxin-responsive protein IAA9         80.1    5e-14   Amborella trichopoda
ref|XP_010555426.1|  PREDICTED: auxin-responsive protein IAA8-like    79.3    7e-14   Tarenaya hassleriana [spider flower]
gb|AAM76222.1|  putative IAA-responsive protein 9                     75.5    1e-13   Gossypium hirsutum [American cotton]
ref|XP_010527157.1|  PREDICTED: auxin-responsive protein IAA8         78.6    1e-13   Tarenaya hassleriana [spider flower]
gb|AAM76224.1|  putative IAA-responsive protein 9                     75.1    1e-13   Gossypioides kirkii
gb|ADL70568.1|  indole-3-acetic acid inducible 8                      77.0    1e-13   Arabidopsis thaliana [mouse-ear cress]
gb|AAM76223.1|  putative IAA-responsive protein 9                     74.7    2e-13   Gossypium hirsutum [American cotton]
gb|AAM76220.1|  putative IAA-responsive protein 9                     74.3    2e-13   Gossypium herbaceum [Arabian cotton]
gb|ADC29392.2|  indole-3-acetic acid inducible 8                      76.3    2e-13   Arabidopsis thaliana [mouse-ear cress]
gb|ADC29391.2|  indole-3-acetic acid inducible 8                      76.3    3e-13   Arabidopsis thaliana [mouse-ear cress]
gb|AAM76221.1|  putative IAA-responsive protein 9                     73.6    4e-13   Gossypium raimondii
ref|XP_010417025.1|  PREDICTED: auxin-responsive protein IAA8-like    76.6    5e-13   Camelina sativa [gold-of-pleasure]
ref|XP_010444576.1|  PREDICTED: auxin-responsive protein IAA9-like    75.5    1e-12   
emb|CDY68170.1|  BnaCnng57860D                                        74.7    2e-12   Brassica napus [oilseed rape]
ref|XP_009150656.1|  PREDICTED: auxin-responsive protein IAA9-lik...  74.7    3e-12   Brassica rapa
emb|CDY08767.1|  BnaA06g24570D                                        74.7    3e-12   Brassica napus [oilseed rape]
ref|XP_009150655.1|  PREDICTED: auxin-responsive protein IAA9-lik...  74.7    3e-12   Brassica rapa
emb|CDY18679.1|  BnaA09g07160D                                        64.7    7e-09   Brassica napus [oilseed rape]
ref|XP_006833393.1|  PREDICTED: auxin-responsive protein IAA27        60.1    3e-07   Amborella trichopoda
gb|ACU24212.1|  unknown                                               57.4    4e-07   Glycine max [soybeans]
ref|XP_009112194.1|  PREDICTED: auxin-responsive protein IAA9-lik...  59.3    5e-07   Brassica rapa
ref|XP_009112193.1|  PREDICTED: auxin-responsive protein IAA9-lik...  59.3    6e-07   Brassica rapa
ref|XP_009352507.1|  PREDICTED: auxin-responsive protein IAA27-like   58.9    7e-07   Pyrus x bretschneideri [bai li]
emb|CDY25617.1|  BnaA04g13090D                                        58.2    1e-06   Brassica napus [oilseed rape]
ref|XP_009140376.1|  PREDICTED: auxin-responsive protein IAA8         58.2    1e-06   Brassica rapa
ref|XP_003637872.1|  Auxin-responsive aux/iaa gene family member      55.8    3e-06   
ref|XP_007152862.1|  hypothetical protein PHAVU_004G166400g           57.4    3e-06   Phaseolus vulgaris [French bean]
ref|XP_003534212.1|  PREDICTED: auxin-responsive protein IAA27        57.0    3e-06   Glycine max [soybeans]
gb|ABR16139.1|  unknown                                               57.0    5e-06   Picea sitchensis
ref|NP_001280937.1|  auxin-responsive protein IAA27                   56.6    5e-06   Malus domestica [apple tree]
ref|XP_009336858.1|  PREDICTED: auxin-responsive protein IAA27-like   56.2    6e-06   Pyrus x bretschneideri [bai li]
ref|XP_003637871.1|  Auxin-responsive aux/iaa gene family member      55.5    6e-06   
gb|AFK45766.1|  unknown                                               55.8    7e-06   Medicago truncatula
gb|KEH27147.1|  auxin response factor                                 55.5    8e-06   Medicago truncatula
ref|XP_008242568.1|  PREDICTED: auxin-responsive protein IAA27        55.5    1e-05   Prunus mume [ume]
gb|AIT98184.1|  auxin-responsive protein                              52.8    2e-05   Medicago sativa [alfalfa]
ref|XP_012073397.1|  PREDICTED: auxin-responsive protein IAA27-li...  54.7    2e-05   Jatropha curcas
ref|XP_012073398.1|  PREDICTED: auxin-responsive protein IAA27-li...  54.7    2e-05   
emb|CDX89499.1|  BnaC04g35180D                                        53.9    3e-05   
emb|CDO98008.1|  unnamed protein product                              53.9    4e-05   Coffea canephora [robusta coffee]
ref|XP_002284282.1|  PREDICTED: auxin-responsive protein IAA27-like   53.5    5e-05   Vitis vinifera
ref|XP_004287443.1|  PREDICTED: auxin-responsive protein IAA27        53.5    5e-05   Fragaria vesca subsp. vesca
ref|XP_010249636.1|  PREDICTED: auxin-responsive protein IAA27        53.1    8e-05   Nelumbo nucifera [Indian lotus]
ref|XP_006381732.1|  hypothetical protein POPTR_0006s16640g           52.8    9e-05   Populus trichocarpa [western balsam poplar]
ref|XP_003630761.1|  Auxin-responsive protein (Aux/IAA)               52.8    1e-04   Medicago truncatula
gb|KHN41649.1|  Auxin-responsive protein IAA27                        52.4    1e-04   Glycine soja [wild soybean]
gb|AFK49596.1|  unknown                                               52.4    1e-04   Medicago truncatula
ref|NP_001239808.1|  uncharacterized protein LOC100778529             52.4    1e-04   Glycine max [soybeans]
ref|XP_002284118.1|  PREDICTED: auxin-responsive protein IAA27        52.4    1e-04   Vitis vinifera
ref|XP_008793078.1|  PREDICTED: auxin-responsive protein IAA27-li...  52.4    1e-04   Phoenix dactylifera
ref|XP_008793077.1|  PREDICTED: auxin-responsive protein IAA27-li...  52.0    2e-04   Phoenix dactylifera
ref|XP_004503453.1|  PREDICTED: auxin-responsive protein IAA27-like   52.0    2e-04   Cicer arietinum [garbanzo]
ref|XP_008462746.1|  PREDICTED: auxin-responsive protein IAA27        51.6    2e-04   Cucumis melo [Oriental melon]
ref|XP_006584572.1|  PREDICTED: uncharacterized protein LOC100795...  51.6    2e-04   Glycine max [soybeans]
ref|XP_010917562.1|  PREDICTED: auxin-responsive protein IAA27-like   51.6    2e-04   Elaeis guineensis
ref|XP_007013106.1|  Phytochrome-associated protein 2 isoform 1       51.6    2e-04   
ref|XP_007013107.1|  Phytochrome-associated protein 2 isoform 2       51.6    3e-04   
gb|KHN16618.1|  Auxin-responsive protein IAA27                        51.2    3e-04   Glycine soja [wild soybean]
ref|XP_007160318.1|  hypothetical protein PHAVU_002G311500g           51.2    3e-04   Phaseolus vulgaris [French bean]
ref|NP_001242283.1|  uncharacterized protein LOC100795749             50.8    3e-04   Glycine max [soybeans]
gb|KJB54241.1|  hypothetical protein B456_009G026700                  50.8    4e-04   Gossypium raimondii
gb|KJB54243.1|  hypothetical protein B456_009G026700                  50.8    4e-04   Gossypium raimondii
gb|KJB54240.1|  hypothetical protein B456_009G026700                  50.8    4e-04   Gossypium raimondii
ref|XP_004150556.1|  PREDICTED: auxin-responsive protein IAA27        50.8    4e-04   Cucumis sativus [cucumbers]
gb|KJB54244.1|  hypothetical protein B456_009G026700                  50.8    4e-04   Gossypium raimondii
gb|AIT98188.1|  auxin-responsive protein                              49.3    5e-04   Medicago sativa [alfalfa]
gb|KHG03466.1|  Auxin-responsive IAA27 -like protein                  50.8    5e-04   Gossypium arboreum [tree cotton]
emb|CBW30571.1|  auxin-responsive protein iaa27                       50.1    5e-04   Helianthus annuus
ref|XP_010254042.1|  PREDICTED: auxin-responsive protein IAA27-like   50.4    5e-04   Nelumbo nucifera [Indian lotus]
ref|XP_010925905.1|  PREDICTED: auxin-responsive protein IAA17-like   50.4    5e-04   Elaeis guineensis
gb|KHG09793.1|  Auxin-responsive IAA27 -like protein                  50.4    6e-04   Gossypium arboreum [tree cotton]
gb|KJB18639.1|  hypothetical protein B456_003G064200                  50.1    7e-04   Gossypium raimondii
gb|KJB18637.1|  hypothetical protein B456_003G064200                  50.1    7e-04   Gossypium raimondii
gb|KJB18636.1|  hypothetical protein B456_003G064200                  49.7    9e-04   Gossypium raimondii
gb|KJB18635.1|  hypothetical protein B456_003G064200                  50.1    9e-04   Gossypium raimondii
ref|XP_009390697.1|  PREDICTED: auxin-responsive protein IAA17-like   49.7    9e-04   Musa acuminata subsp. malaccensis [pisang utan]



>gb|ABB55368.1| Aux/IAA protein-like [Solanum tuberosum]
Length=349

 Score =   178 bits (452),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 109/145 (75%), Positives = 124/145 (86%), Gaps = 5/145 (3%)
 Frame = +3

Query  312  MSPPLLGVGED-GQSNVTHMASPISLDSVCQNGPELKEWNYMGLsdcssvdsstisstse  488
            MSPPLLGVGE+ GQSNVT +AS  SL S+C+ G  LKE NYMGLSDCSSVDS  IS++SE
Sbjct  1    MSPPLLGVGEEEGQSNVTLLASSTSLGSICKKGSALKERNYMGLSDCSSVDSCNISTSSE  60

Query  489  nnsGRGLNLRATELRLGLPGSQSPQRDSEP----STKLDEKLLFPLHPAKESNFTLSQKT  656
            +N+G GLNL+ATELRLGLPGSQSP+R  E     STK+DEKLLFPLHPAK++ F++SQKT
Sbjct  61   DNNGCGLNLKATELRLGLPGSQSPERGEETCPVSSTKVDEKLLFPLHPAKDTAFSVSQKT  120

Query  657  VVTGNKRGFSDAMDEFSEGKFLSNS  731
            VVTGNKRGFSDAMD FSEGKFLSNS
Sbjct  121  VVTGNKRGFSDAMDGFSEGKFLSNS  145



>ref|NP_001275473.1| Aux/IAA protein [Solanum tuberosum]
 gb|AAM29182.1| Aux/IAA protein [Solanum tuberosum]
Length=349

 Score =   177 bits (448),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 108/145 (74%), Positives = 123/145 (85%), Gaps = 5/145 (3%)
 Frame = +3

Query  312  MSPPLLGVGED-GQSNVTHMASPISLDSVCQNGPELKEWNYMGLsdcssvdsstisstse  488
            MSPPLLGVGE+ GQSNVT +AS  SL S+C+ G  LKE NYMGLSDCSSVDS  IS++SE
Sbjct  1    MSPPLLGVGEEEGQSNVTLLASSTSLGSICKKGSALKERNYMGLSDCSSVDSCNISTSSE  60

Query  489  nnsGRGLNLRATELRLGLPGSQSPQRDSEP----STKLDEKLLFPLHPAKESNFTLSQKT  656
            +N+G GLNL+ATELRLGLPGSQSP+R  E     STK+DEKLLFPLHPAK++ F++SQKT
Sbjct  61   DNNGCGLNLKATELRLGLPGSQSPERGEETCPVSSTKVDEKLLFPLHPAKDTAFSVSQKT  120

Query  657  VVTGNKRGFSDAMDEFSEGKFLSNS  731
            VVTGNKRGFSD MD FSEGKFLSNS
Sbjct  121  VVTGNKRGFSDTMDGFSEGKFLSNS  145



>emb|CAJ13716.1| auxin induced protein [Capsicum chinense]
Length=210

 Score =   171 bits (432),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 109/145 (75%), Positives = 124/145 (86%), Gaps = 5/145 (3%)
 Frame = +3

Query  312  MSPPLLGVGED-GQSNVTHMASPISLDSVCQNGPELKEWNYMGLsdcssvdsstisstse  488
            MSPPLLGVGE+ GQSNVT + S  SL S+CQ G  LKE NYMGLSDCSSVDS  IS++SE
Sbjct  1    MSPPLLGVGEEEGQSNVTLLGSSSSLGSICQKGLALKERNYMGLSDCSSVDSCNISTSSE  60

Query  489  nnsGRGLNLRATELRLGLPGSQSPQRDSEP----STKLDEKLLFPLHPAKESNFTLSQKT  656
            +N+G GLNL+ATELRLGLPGSQSP+R + P    STK+DEKLLFPLHPAK++ F++SQKT
Sbjct  61   DNNGVGLNLKATELRLGLPGSQSPERGTAPCPLGSTKVDEKLLFPLHPAKDTAFSVSQKT  120

Query  657  VVTGNKRGFSDAMDEFSEGKFLSNS  731
            VVTGNKRGFSDAMD FSEGKFLSNS
Sbjct  121  VVTGNKRGFSDAMDGFSEGKFLSNS  145



>ref|XP_010320058.1| PREDICTED: auxin-responsive protein (Aux/IAA) isoform X1 [Solanum 
lycopersicum]
Length=349

 Score =   174 bits (441),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 107/145 (74%), Positives = 123/145 (85%), Gaps = 5/145 (3%)
 Frame = +3

Query  312  MSPPLLGVGED-GQSNVTHMASPISLDSVCQNGPELKEWNYMGLsdcssvdsstisstse  488
            MSPPLLGVGE+ GQSNVT +AS  SL S+C  G  LKE NYMGLSDCSSVDS  IS++SE
Sbjct  1    MSPPLLGVGEEEGQSNVTLLASSTSLGSICIKGSALKERNYMGLSDCSSVDSCNISTSSE  60

Query  489  nnsGRGLNLRATELRLGLPGSQSPQRDSEP----STKLDEKLLFPLHPAKESNFTLSQKT  656
            +N+G GLNL+ATELRLGLPGSQSP+R  E     STK+DEKLLFPLHP+K++ F++SQKT
Sbjct  61   DNNGCGLNLKATELRLGLPGSQSPERGEETCPVSSTKVDEKLLFPLHPSKDTAFSVSQKT  120

Query  657  VVTGNKRGFSDAMDEFSEGKFLSNS  731
            VV+GNKRGFSDAMD FSEGKFLSNS
Sbjct  121  VVSGNKRGFSDAMDGFSEGKFLSNS  145



>ref|NP_001265888.1| auxin-responsive protein (Aux/IAA) [Solanum lycopersicum]
 gb|AAZ20313.1| AUX/IAA protein [Solanum lycopersicum]
 gb|ADN51993.1| entire [Solanum lycopersicum]
 gb|AEX00353.1| IAA9 [Solanum lycopersicum]
Length=349

 Score =   174 bits (441),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 107/145 (74%), Positives = 123/145 (85%), Gaps = 5/145 (3%)
 Frame = +3

Query  312  MSPPLLGVGED-GQSNVTHMASPISLDSVCQNGPELKEWNYMGLsdcssvdsstisstse  488
            MSPPLLGVGE+ GQSNVT +AS  SL S+C  G  LKE NYMGLSDCSSVDS  IS++SE
Sbjct  1    MSPPLLGVGEEEGQSNVTLLASSTSLGSICIKGSALKERNYMGLSDCSSVDSCNISTSSE  60

Query  489  nnsGRGLNLRATELRLGLPGSQSPQRDSEP----STKLDEKLLFPLHPAKESNFTLSQKT  656
            +N+G GLNL+ATELRLGLPGSQSP+R  E     STK+DEKLLFPLHP+K++ F++SQKT
Sbjct  61   DNNGCGLNLKATELRLGLPGSQSPERGEETCPVISTKVDEKLLFPLHPSKDTAFSVSQKT  120

Query  657  VVTGNKRGFSDAMDEFSEGKFLSNS  731
            VV+GNKRGFSDAMD FSEGKFLSNS
Sbjct  121  VVSGNKRGFSDAMDGFSEGKFLSNS  145



>ref|XP_009789143.1| PREDICTED: auxin-responsive protein IAA8-like [Nicotiana sylvestris]
Length=346

 Score =   157 bits (396),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 100/142 (70%), Positives = 115/142 (81%), Gaps = 2/142 (1%)
 Frame = +3

Query  312  MSPPLLGVGED-GQSNVTHMASPISLDSVCQNGPELKEWNYMGLsdcssvdsstisstse  488
            MSPPLL V E+ GQSNVT +AS  SL S+C+ G ELKE NYMGLSDCSSVDS TIS++S 
Sbjct  1    MSPPLLDVREEEGQSNVTLLASSASLGSICKKGSELKERNYMGLSDCSSVDSCTISTSSG  60

Query  489  nnsGRGLNLRATELRLGLPGSQSPQRDSEPS-TKLDEKLLFPLHPAKESNFTLSQKTVVT  665
            +N+  GLNL+ATELRLGLPGS SP+R  E      +EKLLFPLHPAK+S+  +SQKTVVT
Sbjct  61   DNNACGLNLKATELRLGLPGSLSPERGIETCPLASNEKLLFPLHPAKDSDLVVSQKTVVT  120

Query  666  GNKRGFSDAMDEFSEGKFLSNS  731
            GNKRGFSDAMD FSEGKF+ NS
Sbjct  121  GNKRGFSDAMDGFSEGKFMPNS  142



>ref|XP_009608764.1| PREDICTED: auxin-responsive protein IAA8-like [Nicotiana tomentosiformis]
Length=346

 Score =   156 bits (394),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 101/142 (71%), Positives = 115/142 (81%), Gaps = 2/142 (1%)
 Frame = +3

Query  312  MSPPLLGVGED-GQSNVTHMASPISLDSVCQNGPELKEWNYMGLsdcssvdsstisstse  488
            MSPPLL V E+ GQSNVT +AS  SL S+C+ G ELKE NYMGLSDCSSVDS TIS++SE
Sbjct  1    MSPPLLDVREEEGQSNVTLLASSASLGSICKKGSELKERNYMGLSDCSSVDSCTISTSSE  60

Query  489  nnsGRGLNLRATELRLGLPGSQSPQRDSEPS-TKLDEKLLFPLHPAKESNFTLSQKTVVT  665
            +N+  GLNL+ATELRLGLPGS SP+R  E      +EKLLFPLHPAK+S   +SQKTVVT
Sbjct  61   DNNACGLNLKATELRLGLPGSLSPERGIETCPLASNEKLLFPLHPAKDSALAVSQKTVVT  120

Query  666  GNKRGFSDAMDEFSEGKFLSNS  731
            GNKRGFSDAMD FSEGKF+ NS
Sbjct  121  GNKRGFSDAMDGFSEGKFMPNS  142



>ref|XP_009366395.1| PREDICTED: auxin-responsive protein IAA8-like [Pyrus x bretschneideri]
 ref|XP_009366396.1| PREDICTED: auxin-responsive protein IAA8-like [Pyrus x bretschneideri]
Length=363

 Score =   156 bits (394),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 95/140 (68%), Positives = 116/140 (83%), Gaps = 5/140 (4%)
 Frame = +3

Query  312  MSPPLLGVGED-GQSNVTHMASPISLDSVCQNGPELKEWNYMGLsdcssvdsstisstse  488
            MSPPLLGVGE+ GQS+VT ++S  S++SVCQN  ELKE NYMGLSDCSSV SS +S+ S+
Sbjct  1    MSPPLLGVGEEEGQSDVTFLSSSGSMESVCQNSLELKEQNYMGLSDCSSVGSSKVSTASD  60

Query  489  nnsGRGLNLRATELRLGLPGSQSPQRDSE---PSTKLDEKLLFPLHPAKESNFTLSQKTV  659
             +    LNL+ATELRLGLPGSQSP+RDS+    +T+LDEK LFPLHP K+ +++ SQK V
Sbjct  61   GSKS-SLNLKATELRLGLPGSQSPERDSDLRVITTQLDEKSLFPLHPLKDGHYSSSQKIV  119

Query  660  VTGNKRGFSDAMDEFSEGKF  719
            V+GNKRGFSDAMDEFSEGK+
Sbjct  120  VSGNKRGFSDAMDEFSEGKY  139



>gb|KJB58777.1| hypothetical protein B456_009G226000 [Gossypium raimondii]
 gb|KJB58778.1| hypothetical protein B456_009G226000 [Gossypium raimondii]
 gb|KJB58779.1| hypothetical protein B456_009G226000 [Gossypium raimondii]
 gb|KJB58780.1| hypothetical protein B456_009G226000 [Gossypium raimondii]
Length=367

 Score =   155 bits (391),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 96/144 (67%), Positives = 113/144 (78%), Gaps = 5/144 (3%)
 Frame = +3

Query  312  MSPPLLGVGEDGQSNVTHMASPISLDSVCQNGPELKEWNYMGLsdcssvdsstisstsen  491
            MSPPLLGV E GQ+NVT + S  S+DSVCQN  ELKE NYMGLSDCSS+D S ++  S++
Sbjct  1    MSPPLLGVEEGGQNNVTLLGSSGSIDSVCQNNAELKERNYMGLSDCSSIDCSVVTLGSDD  60

Query  492  nsGRGLNLRATELRLGLPGSQSPQRDSE----PSTKLDEKLLFPLHPAKESNFTLSQKTV  659
            +    LNL+ATELRLGLPGSQSP+R+SE     S +LDEK LFPLHP+ + +   SQKTV
Sbjct  61   S-NVSLNLKATELRLGLPGSQSPERNSELCLLSSAQLDEKPLFPLHPSSDGHCFPSQKTV  119

Query  660  VTGNKRGFSDAMDEFSEGKFLSNS  731
            V+GNKRGFSDAMD FSEG FLSNS
Sbjct  120  VSGNKRGFSDAMDGFSEGNFLSNS  143



>gb|KJB58782.1| hypothetical protein B456_009G226000 [Gossypium raimondii]
 gb|KJB58783.1| hypothetical protein B456_009G226000 [Gossypium raimondii]
Length=334

 Score =   154 bits (389),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 96/144 (67%), Positives = 113/144 (78%), Gaps = 5/144 (3%)
 Frame = +3

Query  312  MSPPLLGVGEDGQSNVTHMASPISLDSVCQNGPELKEWNYMGLsdcssvdsstisstsen  491
            MSPPLLGV E GQ+NVT + S  S+DSVCQN  ELKE NYMGLSDCSS+D S ++  S++
Sbjct  1    MSPPLLGVEEGGQNNVTLLGSSGSIDSVCQNNAELKERNYMGLSDCSSIDCSVVTLGSDD  60

Query  492  nsGRGLNLRATELRLGLPGSQSPQRDSE----PSTKLDEKLLFPLHPAKESNFTLSQKTV  659
            +    LNL+ATELRLGLPGSQSP+R+SE     S +LDEK LFPLHP+ + +   SQKTV
Sbjct  61   S-NVSLNLKATELRLGLPGSQSPERNSELCLLSSAQLDEKPLFPLHPSSDGHCFPSQKTV  119

Query  660  VTGNKRGFSDAMDEFSEGKFLSNS  731
            V+GNKRGFSDAMD FSEG FLSNS
Sbjct  120  VSGNKRGFSDAMDGFSEGNFLSNS  143



>ref|XP_007018336.1| Aux/IAA protein isoform 1 [Theobroma cacao]
 ref|XP_007018337.1| Aux/IAA protein isoform 1 [Theobroma cacao]
 gb|EOY15561.1| Aux/IAA protein isoform 1 [Theobroma cacao]
 gb|EOY15562.1| Aux/IAA protein isoform 1 [Theobroma cacao]
Length=368

 Score =   154 bits (389),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 101/145 (70%), Positives = 115/145 (79%), Gaps = 6/145 (4%)
 Frame = +3

Query  312  MSPPLLGVGEDG-QSNVTHMASPISLDSVCQNGPELKEWNYMGLsdcssvdsstisstse  488
            MSPPLLGV E+G QSNVT + S  S+DSVCQN  ELKE NYMGLSDCSSVDSS  S  SE
Sbjct  1    MSPPLLGVEEEGGQSNVTCLGSSGSMDSVCQNSAELKERNYMGLSDCSSVDSSVGSPVSE  60

Query  489  nnsGRGLNLRATELRLGLPGSQSPQRDSE----PSTKLDEKLLFPLHPAKESNFTLSQKT  656
             + G  LNL+ATELRLGLPGSQSP+R+ E     S +LDEK LFPLHP+ + + + SQKT
Sbjct  61   ESKGN-LNLKATELRLGLPGSQSPKRNPELCLLSSPQLDEKPLFPLHPSSDGHCSASQKT  119

Query  657  VVTGNKRGFSDAMDEFSEGKFLSNS  731
            VV+GNKRGFSDAMD FS+GKFLSNS
Sbjct  120  VVSGNKRGFSDAMDGFSQGKFLSNS  144



>ref|XP_008219180.1| PREDICTED: auxin-responsive protein IAA8-like [Prunus mume]
 ref|XP_008219181.1| PREDICTED: auxin-responsive protein IAA8-like [Prunus mume]
Length=366

 Score =   154 bits (389),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 95/141 (67%), Positives = 114/141 (81%), Gaps = 6/141 (4%)
 Frame = +3

Query  312  MSPPLLGVGED--GQSNVTHMASPISLDSVCQNGPELKEWNYMGLsdcssvdsstissts  485
            MSPPLLGVGE+  G S+VT ++S +S++SVC N  ELKE NYMGLSDCSSVDSS +S+ S
Sbjct  1    MSPPLLGVGEEEEGHSDVTLLSSSVSMESVCHNSSELKERNYMGLSDCSSVDSSKVSTVS  60

Query  486  ennsGRGLNLRATELRLGLPGSQSPQRDSE---PSTKLDEKLLFPLHPAKESNFTLSQKT  656
              +    LNL+AT+LRLGLPGSQSP+RDSE    ST+LDEK LFPLHP K+ N++  QKT
Sbjct  61   GGSKS-SLNLKATDLRLGLPGSQSPERDSELRLISTQLDEKPLFPLHPIKDGNYSSLQKT  119

Query  657  VVTGNKRGFSDAMDEFSEGKF  719
            VV+GNKRGFSDAMD FSEGK+
Sbjct  120  VVSGNKRGFSDAMDGFSEGKY  140



>ref|NP_001280795.1| auxin-responsive protein IAA8-like [Malus domestica]
 gb|ADL36582.1| ARF domain class transcription factor [Malus domestica]
Length=363

 Score =   153 bits (387),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 97/140 (69%), Positives = 116/140 (83%), Gaps = 5/140 (4%)
 Frame = +3

Query  312  MSPPLLGVGED-GQSNVTHMASPISLDSVCQNGPELKEWNYMGLsdcssvdsstisstse  488
            MSPPLLGV E+ GQS+VT +AS  S++SVCQN  ELKE NYMGLSDCSSVDSS +S+ S+
Sbjct  1    MSPPLLGVDEEEGQSDVTLLASSGSMESVCQNSLELKERNYMGLSDCSSVDSSKVSAVSD  60

Query  489  nnsGRGLNLRATELRLGLPGSQSPQRDSEP---STKLDEKLLFPLHPAKESNFTLSQKTV  659
             +    L+L+ATELRLGLPGSQSP+RDSE    ST+LDEK LFPLHP K+ +++  QKTV
Sbjct  61   GSRS-SLHLKATELRLGLPGSQSPERDSEARVISTQLDEKPLFPLHPLKDGHYSSLQKTV  119

Query  660  VTGNKRGFSDAMDEFSEGKF  719
            V+GNKRGFSDAMDEFSEGK+
Sbjct  120  VSGNKRGFSDAMDEFSEGKY  139



>ref|XP_008378626.1| PREDICTED: auxin-responsive protein IAA8-like [Malus domestica]
 ref|XP_008378627.1| PREDICTED: auxin-responsive protein IAA8-like [Malus domestica]
Length=363

 Score =   153 bits (387),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 97/140 (69%), Positives = 116/140 (83%), Gaps = 5/140 (4%)
 Frame = +3

Query  312  MSPPLLGVGED-GQSNVTHMASPISLDSVCQNGPELKEWNYMGLsdcssvdsstisstse  488
            MSPPLLGV E+ GQS+VT +AS  S++SVCQN  ELKE NYMGLSDCSSVDSS +S+ S+
Sbjct  1    MSPPLLGVDEEEGQSDVTLLASSGSMESVCQNSLELKERNYMGLSDCSSVDSSKVSAVSD  60

Query  489  nnsGRGLNLRATELRLGLPGSQSPQRDSEP---STKLDEKLLFPLHPAKESNFTLSQKTV  659
             +    L+L+ATELRLGLPGSQSP+RDSE    ST+LDEK LFPLHP K+ +++  QKTV
Sbjct  61   GSXS-SLHLKATELRLGLPGSQSPERDSEARVISTQLDEKPLFPLHPLKDGHYSSLQKTV  119

Query  660  VTGNKRGFSDAMDEFSEGKF  719
            V+GNKRGFSDAMDEFSEGK+
Sbjct  120  VSGNKRGFSDAMDEFSEGKY  139



>emb|CAD10639.1| IAA9 protein [Nicotiana tabacum]
Length=346

 Score =   152 bits (385),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 100/142 (70%), Positives = 114/142 (80%), Gaps = 2/142 (1%)
 Frame = +3

Query  312  MSPPLLGVGED-GQSNVTHMASPISLDSVCQNGPELKEWNYMGLsdcssvdsstisstse  488
            MSPPLL V E+ GQSNVT +AS  SL S+C+ G ELKE NYMGLSDCSSVDS TIS++SE
Sbjct  1    MSPPLLDVREEEGQSNVTLLASSASLGSICKKGSELKERNYMGLSDCSSVDSCTISTSSE  60

Query  489  nnsGRGLNLRATELRLGLPGSQSPQRDSEPS-TKLDEKLLFPLHPAKESNFTLSQKTVVT  665
            +N+  GLNL+ATELRLGLPGS SP+R  E      +EKLLFPLHPAK+S   +SQKTVVT
Sbjct  61   DNNACGLNLKATELRLGLPGSLSPERGIETCPLASNEKLLFPLHPAKDSALAVSQKTVVT  120

Query  666  GNKRGFSDAMDEFSEGKFLSNS  731
            GNKR FSDAMD FSEGKF+ NS
Sbjct  121  GNKRRFSDAMDGFSEGKFMPNS  142



>ref|NP_001268170.1| Aux/IAA protein [Vitis vinifera]
 gb|AEV89794.1| indole-3-acetic acid-induced protein 4 [Vitis vinifera]
Length=359

 Score =   152 bits (385),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 100/145 (69%), Positives = 116/145 (80%), Gaps = 6/145 (4%)
 Frame = +3

Query  312  MSPPLLGVGED-GQSNVTHMASPISLDSVCQNGPELKEWNYMGLsdcssvdsstisstse  488
            MSPPLLGVGE+ GQSNVT +AS  S++SVCQ    LKE NYMGLS+CSSVDSS IS+ S+
Sbjct  1    MSPPLLGVGEEEGQSNVTILASSASMESVCQISSGLKERNYMGLSECSSVDSSAISTDSD  60

Query  489  nnsGRGLNLRATELRLGLPGSQSPQRDSE----PSTKLDEKLLFPLHPAKESNFTLSQKT  656
             N    LNL+ATELRLGLPGS SP R+ E     STKLDEK LFPLHP+K+  +T SQKT
Sbjct  61   GNKS-SLNLKATELRLGLPGSLSPGREPELCLLSSTKLDEKPLFPLHPSKDLTYTSSQKT  119

Query  657  VVTGNKRGFSDAMDEFSEGKFLSNS  731
            VV+GNKRGF+DAM+ FSEGKFL+NS
Sbjct  120  VVSGNKRGFADAMNGFSEGKFLANS  144



>ref|XP_010664066.1| PREDICTED: aux/IAA protein isoform X1 [Vitis vinifera]
 ref|XP_010664068.1| PREDICTED: aux/IAA protein isoform X1 [Vitis vinifera]
 ref|XP_010664069.1| PREDICTED: aux/IAA protein isoform X1 [Vitis vinifera]
 gb|ADR80320.1| indole-3-acetic acid-induced protein 9 [Vitis vinifera]
Length=359

 Score =   152 bits (385),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 100/145 (69%), Positives = 116/145 (80%), Gaps = 6/145 (4%)
 Frame = +3

Query  312  MSPPLLGVGED-GQSNVTHMASPISLDSVCQNGPELKEWNYMGLsdcssvdsstisstse  488
            MSPPLLGVGE+ GQSNVT +AS  S++SVCQ    LKE NYMGLS+CSSVDSS IS+ S+
Sbjct  1    MSPPLLGVGEEEGQSNVTILASSASMESVCQISSGLKERNYMGLSECSSVDSSAISTDSD  60

Query  489  nnsGRGLNLRATELRLGLPGSQSPQRDSE----PSTKLDEKLLFPLHPAKESNFTLSQKT  656
             N    LNL+ATELRLGLPGS SP R+ E     STKLDEK LFPLHP+K+  +T SQKT
Sbjct  61   GNKS-SLNLKATELRLGLPGSLSPGREPELCLLSSTKLDEKPLFPLHPSKDLTYTSSQKT  119

Query  657  VVTGNKRGFSDAMDEFSEGKFLSNS  731
            VV+GNKRGF+DAM+ FSEGKFL+NS
Sbjct  120  VVSGNKRGFADAMNGFSEGKFLANS  144



>emb|CAN77436.1| hypothetical protein VITISV_007399 [Vitis vinifera]
Length=359

 Score =   152 bits (385),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 100/145 (69%), Positives = 116/145 (80%), Gaps = 6/145 (4%)
 Frame = +3

Query  312  MSPPLLGVGED-GQSNVTHMASPISLDSVCQNGPELKEWNYMGLsdcssvdsstisstse  488
            MSPPLLGVGE+ GQSNVT +AS  S++SVCQ    LKE NYMGLS+CSSVDSS IS+ S+
Sbjct  1    MSPPLLGVGEEEGQSNVTILASSASMESVCQISSGLKERNYMGLSECSSVDSSAISTDSD  60

Query  489  nnsGRGLNLRATELRLGLPGSQSPQRDSE----PSTKLDEKLLFPLHPAKESNFTLSQKT  656
             N    LNL+ATELRLGLPGS SP R+ E     STKLDEK LFPLHP+K+  +T SQKT
Sbjct  61   GNKS-SLNLKATELRLGLPGSLSPGREPELCLLSSTKLDEKPLFPLHPSKDLTYTSSQKT  119

Query  657  VVTGNKRGFSDAMDEFSEGKFLSNS  731
            VV+GNKRGF+DAM+ FSEGKFL+NS
Sbjct  120  VVSGNKRGFADAMNGFSEGKFLANS  144



>ref|XP_008339000.1| PREDICTED: auxin-responsive protein IAA8-like isoform X2 [Malus 
domestica]
Length=363

 Score =   152 bits (384),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 94/140 (67%), Positives = 113/140 (81%), Gaps = 5/140 (4%)
 Frame = +3

Query  312  MSPPLLGVGED-GQSNVTHMASPISLDSVCQNGPELKEWNYMGLsdcssvdsstisstse  488
            MSPPLLGVGE+ GQS+VT ++S  S++SVCQN  ELKE NYMGLSDCSSV SS +S+ S+
Sbjct  1    MSPPLLGVGEEEGQSDVTFLSSSGSMESVCQNSSELKEQNYMGLSDCSSVGSSNVSTASD  60

Query  489  nnsGRGLNLRATELRLGLPGSQSPQRDSEP---STKLDEKLLFPLHPAKESNFTLSQKTV  659
             ++   LNL+ATELRLGLPGSQSP RDS      T+LDEK LFPLHP K+ +++  QK V
Sbjct  61   GSNS-SLNLKATELRLGLPGSQSPXRDSXXRVIXTQLDEKPLFPLHPLKDGHYSSXQKXV  119

Query  660  VTGNKRGFSDAMDEFSEGKF  719
            V+GNKRGFSDAMDEFSEGK+
Sbjct  120  VSGNKRGFSDAMDEFSEGKY  139



>ref|XP_008338995.1| PREDICTED: auxin-responsive protein IAA9-like isoform X1 [Malus 
domestica]
 ref|XP_008338996.1| PREDICTED: auxin-responsive protein IAA9-like isoform X1 [Malus 
domestica]
 ref|XP_008338997.1| PREDICTED: auxin-responsive protein IAA9-like isoform X1 [Malus 
domestica]
 ref|XP_008338999.1| PREDICTED: auxin-responsive protein IAA9-like isoform X1 [Malus 
domestica]
Length=366

 Score =   152 bits (384),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 94/140 (67%), Positives = 113/140 (81%), Gaps = 5/140 (4%)
 Frame = +3

Query  312  MSPPLLGVGED-GQSNVTHMASPISLDSVCQNGPELKEWNYMGLsdcssvdsstisstse  488
            MSPPLLGVGE+ GQS+VT ++S  S++SVCQN  ELKE NYMGLSDCSSV SS +S+ S+
Sbjct  1    MSPPLLGVGEEEGQSDVTFLSSSGSMESVCQNSSELKEQNYMGLSDCSSVGSSNVSTASD  60

Query  489  nnsGRGLNLRATELRLGLPGSQSPQRDSEP---STKLDEKLLFPLHPAKESNFTLSQKTV  659
             ++   LNL+ATELRLGLPGSQSP RDS      T+LDEK LFPLHP K+ +++  QK V
Sbjct  61   GSNS-SLNLKATELRLGLPGSQSPXRDSXXRVIXTQLDEKPLFPLHPLKDGHYSSXQKXV  119

Query  660  VTGNKRGFSDAMDEFSEGKF  719
            V+GNKRGFSDAMDEFSEGK+
Sbjct  120  VSGNKRGFSDAMDEFSEGKY  139



>ref|XP_007225723.1| hypothetical protein PRUPE_ppa006744mg [Prunus persica]
 gb|EMJ26922.1| hypothetical protein PRUPE_ppa006744mg [Prunus persica]
Length=293

 Score =   150 bits (379),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 93/141 (66%), Positives = 112/141 (79%), Gaps = 6/141 (4%)
 Frame = +3

Query  312  MSPPLLGVGED--GQSNVTHMASPISLDSVCQNGPELKEWNYMGLsdcssvdsstissts  485
            MSPPLLGVGE+  G S+VT ++S +S++SVC N  ELKE NYMGLSDCSSVDSS +S+ S
Sbjct  1    MSPPLLGVGEEEEGHSDVTLLSSSVSMESVCHNSSELKERNYMGLSDCSSVDSSKVSTVS  60

Query  486  ennsGRGLNLRATELRLGLPGSQSPQRDSE---PSTKLDEKLLFPLHPAKESNFTLSQKT  656
              +    LNL+AT+LRLGLPGSQSP+RDSE    ST+LDEK LFPLHP  + N++  QKT
Sbjct  61   GGSK-NSLNLKATDLRLGLPGSQSPERDSELRLISTQLDEKPLFPLHPIMDGNYSSLQKT  119

Query  657  VVTGNKRGFSDAMDEFSEGKF  719
            VV+GNKRGFSDAMD F EGK+
Sbjct  120  VVSGNKRGFSDAMDGFLEGKY  140



>ref|XP_002509993.1| Auxin-responsive protein IAA19, putative [Ricinus communis]
 gb|EEF52180.1| Auxin-responsive protein IAA19, putative [Ricinus communis]
Length=374

 Score =   151 bits (381),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 93/143 (65%), Positives = 113/143 (79%), Gaps = 5/143 (3%)
 Frame = +3

Query  312  MSPPLLGVGEDGQSNVTHMASPISLDSVCQNGPELKEWNYMGLsdcssvdsstisstsen  491
            MSPPL+GV E+GQSNVT +AS  S +S+CQNG +LKE NYMGLSDCSSVDSS   S+S+ 
Sbjct  1    MSPPLIGVVEEGQSNVTVLASSTSAESICQNGSKLKERNYMGLSDCSSVDSSIAPSSSDE  60

Query  492  nsGRGLNLRATELRLGLPGSQSPQRDSE----PSTKLDEKLLFPLHPAKESNFTLSQKTV  659
            +  R LNL+ATELRLGLPGSQSPQR+SE     ST+ DEK  FPL+P+ + +++ +QK V
Sbjct  61   SKTR-LNLKATELRLGLPGSQSPQRNSELSLLNSTQFDEKPFFPLNPSNDGHYSSTQKNV  119

Query  660  VTGNKRGFSDAMDEFSEGKFLSN  728
            V+GNKRGFSDAMD FSEGK   N
Sbjct  120  VSGNKRGFSDAMDGFSEGKLEVN  142



>gb|KJB58781.1| hypothetical protein B456_009G226000 [Gossypium raimondii]
Length=368

 Score =   150 bits (379),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 96/145 (66%), Positives = 113/145 (78%), Gaps = 6/145 (4%)
 Frame = +3

Query  312  MSPPLLGVGEDGQSNVTHMASPISLDSVCQNGPELKEWNYMGLsdcssvdsstisstsen  491
            MSPPLLGV E GQ+NVT + S  S+DSVCQN  ELKE NYMGLSDCSS+D S ++  S++
Sbjct  1    MSPPLLGVEEGGQNNVTLLGSSGSIDSVCQNNAELKERNYMGLSDCSSIDCSVVTLGSDD  60

Query  492  nsGRGLNLRATELRLGLPGSQSPQRDSE----PSTKLDEKLLFPLHPAKESNFTLSQKTV  659
            +    LNL+ATELRLGLPGSQSP+R+SE     S +LDEK LFPLHP+ + +   SQKTV
Sbjct  61   S-NVSLNLKATELRLGLPGSQSPERNSELCLLSSAQLDEKPLFPLHPSSDGHCFPSQKTV  119

Query  660  VTGNKRGFSDAMDEFSE-GKFLSNS  731
            V+GNKRGFSDAMD FSE G FLSNS
Sbjct  120  VSGNKRGFSDAMDGFSEVGNFLSNS  144



>gb|AAL92850.1| Aux/IAA protein [Vitis vinifera]
Length=359

 Score =   150 bits (378),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 99/145 (68%), Positives = 115/145 (79%), Gaps = 6/145 (4%)
 Frame = +3

Query  312  MSPPLLGVGED-GQSNVTHMASPISLDSVCQNGPELKEWNYMGLsdcssvdsstisstse  488
            MSPPLLGVGE+ GQSNVT +AS  S++SVCQ    LKE NYMGLS+CSSVDSS IS+ S+
Sbjct  1    MSPPLLGVGEEEGQSNVTILASSASMESVCQISSGLKERNYMGLSECSSVDSSAISTDSD  60

Query  489  nnsGRGLNLRATELRLGLPGSQSPQRDSE----PSTKLDEKLLFPLHPAKESNFTLSQKT  656
             N    LNL+ATELRLGLPG  SP R+ E     STKLDEK LFPLHP+K+  +T SQKT
Sbjct  61   GNKS-SLNLKATELRLGLPGFLSPGREPELCLLSSTKLDEKPLFPLHPSKDLTYTSSQKT  119

Query  657  VVTGNKRGFSDAMDEFSEGKFLSNS  731
            VV+GNKRGF+DAM+ FSEGKFL+NS
Sbjct  120  VVSGNKRGFADAMNGFSEGKFLANS  144



>ref|XP_007225724.1| hypothetical protein PRUPE_ppa006744mg [Prunus persica]
 ref|XP_007225725.1| hypothetical protein PRUPE_ppa006744mg [Prunus persica]
 ref|XP_007225726.1| hypothetical protein PRUPE_ppa006744mg [Prunus persica]
 gb|EMJ26923.1| hypothetical protein PRUPE_ppa006744mg [Prunus persica]
 gb|EMJ26924.1| hypothetical protein PRUPE_ppa006744mg [Prunus persica]
 gb|EMJ26925.1| hypothetical protein PRUPE_ppa006744mg [Prunus persica]
Length=366

 Score =   149 bits (376),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 93/141 (66%), Positives = 112/141 (79%), Gaps = 6/141 (4%)
 Frame = +3

Query  312  MSPPLLGVGED--GQSNVTHMASPISLDSVCQNGPELKEWNYMGLsdcssvdsstissts  485
            MSPPLLGVGE+  G S+VT ++S +S++SVC N  ELKE NYMGLSDCSSVDSS +S+ S
Sbjct  1    MSPPLLGVGEEEEGHSDVTLLSSSVSMESVCHNSSELKERNYMGLSDCSSVDSSKVSTVS  60

Query  486  ennsGRGLNLRATELRLGLPGSQSPQRDSE---PSTKLDEKLLFPLHPAKESNFTLSQKT  656
              +    LNL+AT+LRLGLPGSQSP+RDSE    ST+LDEK LFPLHP  + N++  QKT
Sbjct  61   GGSKN-SLNLKATDLRLGLPGSQSPERDSELRLISTQLDEKPLFPLHPIMDGNYSSLQKT  119

Query  657  VVTGNKRGFSDAMDEFSEGKF  719
            VV+GNKRGFSDAMD F EGK+
Sbjct  120  VVSGNKRGFSDAMDGFLEGKY  140



>gb|KJB64034.1| hypothetical protein B456_010G031600 [Gossypium raimondii]
 gb|KJB64035.1| hypothetical protein B456_010G031600 [Gossypium raimondii]
Length=303

 Score =   144 bits (363),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 96/145 (66%), Positives = 110/145 (76%), Gaps = 6/145 (4%)
 Frame = +3

Query  312  MSPPLLGVGEDG-QSNVTHMASPISLDSVCQNGPELKEWNYMGLsdcssvdsstisstse  488
            MSPPLLGV E+G QSNVT + S  S++SVCQN  ELKE NYMGLSDCSSVDSS  S  SE
Sbjct  1    MSPPLLGVEEEGIQSNVTLLGSSGSMESVCQNSAELKERNYMGLSDCSSVDSSVFSPPSE  60

Query  489  nnsGRGLNLRATELRLGLPGSQSPQRDSE----PSTKLDEKLLFPLHPAKESNFTLSQKT  656
                  LNL+ATELRLGLPG QSP+R+ E     S++LDEK  FPLHP+ + +   SQK 
Sbjct  61   ERKA-SLNLKATELRLGLPGLQSPERNPELCLLSSSQLDEKPFFPLHPSSDGHCFASQKN  119

Query  657  VVTGNKRGFSDAMDEFSEGKFLSNS  731
            VV+GNKRGFSDAMD FSEGKFLS+S
Sbjct  120  VVSGNKRGFSDAMDGFSEGKFLSDS  144



>gb|KHG13564.1| Auxin-responsive IAA9 -like protein [Gossypium arboreum]
Length=357

 Score =   145 bits (365),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 97/145 (67%), Positives = 111/145 (77%), Gaps = 6/145 (4%)
 Frame = +3

Query  312  MSPPLLGVGEDG-QSNVTHMASPISLDSVCQNGPELKEWNYMGLsdcssvdsstisstse  488
            MSPPLLGV E+G QSNVT + S  S++SVCQN  ELKE NYMGLSDCSSVDSS  S  SE
Sbjct  1    MSPPLLGVEEEGVQSNVTLLGSSGSMESVCQNSAELKERNYMGLSDCSSVDSSVFSPPSE  60

Query  489  nnsGRGLNLRATELRLGLPGSQSPQRDSE----PSTKLDEKLLFPLHPAKESNFTLSQKT  656
                  LNL+ATELRLGLPG QSP+R+ E     S++LDEK LFPLHP+ + +   SQK 
Sbjct  61   ERKA-SLNLKATELRLGLPGLQSPERNPELCLLSSSQLDEKPLFPLHPSSDGHCFASQKN  119

Query  657  VVTGNKRGFSDAMDEFSEGKFLSNS  731
            VV+GNKRGFSDAMD FSEGKFLS+S
Sbjct  120  VVSGNKRGFSDAMDGFSEGKFLSDS  144



>gb|AEI70507.1| auxin-responsive protein [Gossypium hirsutum]
Length=357

 Score =   144 bits (364),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 97/145 (67%), Positives = 111/145 (77%), Gaps = 6/145 (4%)
 Frame = +3

Query  312  MSPPLLGVGEDG-QSNVTHMASPISLDSVCQNGPELKEWNYMGLsdcssvdsstisstse  488
            MSPPLLGV E+G QSNVT + S  S++SVCQN  ELKE NYMGLSDCSSVDSS  S  SE
Sbjct  1    MSPPLLGVEEEGVQSNVTLLGSSGSMESVCQNSAELKERNYMGLSDCSSVDSSVFSPPSE  60

Query  489  nnsGRGLNLRATELRLGLPGSQSPQRDSE----PSTKLDEKLLFPLHPAKESNFTLSQKT  656
                  LNL+ATELRLGLPG QSP+R+ E     S++LDEK LFPLHP+ + +   SQK 
Sbjct  61   ERKA-SLNLKATELRLGLPGLQSPERNPELCLLSSSQLDEKPLFPLHPSSDGHCFASQKN  119

Query  657  VVTGNKRGFSDAMDEFSEGKFLSNS  731
            VV+GNKRGFSDAMD FSEGKFLS+S
Sbjct  120  VVSGNKRGFSDAMDGFSEGKFLSDS  144



>gb|KJB64033.1| hypothetical protein B456_010G031600 [Gossypium raimondii]
Length=330

 Score =   144 bits (362),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 96/145 (66%), Positives = 110/145 (76%), Gaps = 6/145 (4%)
 Frame = +3

Query  312  MSPPLLGVGEDG-QSNVTHMASPISLDSVCQNGPELKEWNYMGLsdcssvdsstisstse  488
            MSPPLLGV E+G QSNVT + S  S++SVCQN  ELKE NYMGLSDCSSVDSS  S  SE
Sbjct  1    MSPPLLGVEEEGIQSNVTLLGSSGSMESVCQNSAELKERNYMGLSDCSSVDSSVFSPPSE  60

Query  489  nnsGRGLNLRATELRLGLPGSQSPQRDSE----PSTKLDEKLLFPLHPAKESNFTLSQKT  656
                  LNL+ATELRLGLPG QSP+R+ E     S++LDEK  FPLHP+ + +   SQK 
Sbjct  61   ERKA-SLNLKATELRLGLPGLQSPERNPELCLLSSSQLDEKPFFPLHPSSDGHCFASQKN  119

Query  657  VVTGNKRGFSDAMDEFSEGKFLSNS  731
            VV+GNKRGFSDAMD FSEGKFLS+S
Sbjct  120  VVSGNKRGFSDAMDGFSEGKFLSDS  144



>ref|XP_011016963.1| PREDICTED: auxin-responsive protein IAA9-like [Populus euphratica]
Length=366

 Score =   144 bits (363),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 95/145 (66%), Positives = 110/145 (76%), Gaps = 6/145 (4%)
 Frame = +3

Query  312  MSPPLLGV-GEDGQSNVTHMASPISLDSVCQNGPELKEWNYMGLsdcssvdsstisstse  488
            MSPPLLGV  E+GQSNVT ++SP+S +S C NG ELKE NYMGLSDCSSVDSS +S+ S 
Sbjct  1    MSPPLLGVVEEEGQSNVTLLSSPVSAESACLNGLELKERNYMGLSDCSSVDSSAVSAASN  60

Query  489  nnsGRGLNLRATELRLGLPGSQSPQRDSEPSTKL----DEKLLFPLHPAKESNFTLSQKT  656
                  LNL+ATELRLGLPGSQSP+R  E S       DEK  FPLHP+ + ++T +QK 
Sbjct  61   ERK-TSLNLKATELRLGLPGSQSPERHHELSLLSSALLDEKPFFPLHPSIDGHYTSTQKN  119

Query  657  VVTGNKRGFSDAMDEFSEGKFLSNS  731
            VV+GNKR FSDAMDEFSE KFLSNS
Sbjct  120  VVSGNKRVFSDAMDEFSESKFLSNS  144



>ref|XP_007225727.1| hypothetical protein PRUPE_ppa006744mg [Prunus persica]
 gb|EMJ26926.1| hypothetical protein PRUPE_ppa006744mg [Prunus persica]
Length=397

 Score =   144 bits (364),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 93/143 (65%), Positives = 111/143 (78%), Gaps = 6/143 (4%)
 Frame = +3

Query  312  MSPPLLGVGED--GQSNVTHMASPISLDSVCQNGPELKEWNYMGLsdcssvdsstissts  485
            MSPPLLGVGE+  G S+VT ++S +S++SVC N  ELKE NYMGLSDCSSVDSS +S+ S
Sbjct  1    MSPPLLGVGEEEEGHSDVTLLSSSVSMESVCHNSSELKERNYMGLSDCSSVDSSKVSTVS  60

Query  486  ennsGRGLNLRATELRLGLPGSQSPQRDSE---PSTKLDEKLLFPLHPAKESNFTLSQKT  656
              +    LNL+AT+LRLGLPGSQSP+RDSE    ST+LDEK LFPLHP  + N++  QKT
Sbjct  61   GGSKN-SLNLKATDLRLGLPGSQSPERDSELRLISTQLDEKPLFPLHPIMDGNYSSLQKT  119

Query  657  VVTGNKRGFSDAMDEFSEGKFLS  725
            VV+GNKRGFSDAMD F E K  S
Sbjct  120  VVSGNKRGFSDAMDGFLEVKTTS  142



>ref|XP_012068087.1| PREDICTED: auxin-responsive protein IAA9-like [Jatropha curcas]
 ref|XP_012068088.1| PREDICTED: auxin-responsive protein IAA9-like [Jatropha curcas]
 gb|KDP41528.1| hypothetical protein JCGZ_15935 [Jatropha curcas]
Length=368

 Score =   144 bits (362),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 95/145 (66%), Positives = 110/145 (76%), Gaps = 6/145 (4%)
 Frame = +3

Query  312  MSPPLLG-VGEDGQSNVTHMASPISLDSVCQNGPELKEWNYMGLsdcssvdsstisstse  488
            MS PLLG V E+GQSNVT +AS  S +S CQ G EL+E NYMGLSDCSSVDSS I +  +
Sbjct  1    MSSPLLGAVEEEGQSNVTLLASSTSAESTCQTGSELRERNYMGLSDCSSVDSSVIPAACD  60

Query  489  nnsGRGLNLRATELRLGLPGSQSPQRDSE----PSTKLDEKLLFPLHPAKESNFTLSQKT  656
             N  R L L+ATELRLGLPGSQSP+R+SE     S +LDEK  FPLHP+ E + +  QK 
Sbjct  61   QNKTR-LILKATELRLGLPGSQSPERNSELCLLSSAQLDEKPFFPLHPSNERHCSSVQKN  119

Query  657  VVTGNKRGFSDAMDEFSEGKFLSNS  731
            VV+GNKRGFSDAMD FSEGKFLSN+
Sbjct  120  VVSGNKRGFSDAMDGFSEGKFLSNA  144



>gb|KJB64027.1| hypothetical protein B456_010G031600 [Gossypium raimondii]
 gb|KJB64028.1| hypothetical protein B456_010G031600 [Gossypium raimondii]
 gb|KJB64029.1| hypothetical protein B456_010G031600 [Gossypium raimondii]
 gb|KJB64030.1| hypothetical protein B456_010G031600 [Gossypium raimondii]
 gb|KJB64031.1| hypothetical protein B456_010G031600 [Gossypium raimondii]
 gb|KJB64032.1| hypothetical protein B456_010G031600 [Gossypium raimondii]
Length=357

 Score =   143 bits (361),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 96/145 (66%), Positives = 110/145 (76%), Gaps = 6/145 (4%)
 Frame = +3

Query  312  MSPPLLGVGEDG-QSNVTHMASPISLDSVCQNGPELKEWNYMGLsdcssvdsstisstse  488
            MSPPLLGV E+G QSNVT + S  S++SVCQN  ELKE NYMGLSDCSSVDSS  S  SE
Sbjct  1    MSPPLLGVEEEGIQSNVTLLGSSGSMESVCQNSAELKERNYMGLSDCSSVDSSVFSPPSE  60

Query  489  nnsGRGLNLRATELRLGLPGSQSPQRDSE----PSTKLDEKLLFPLHPAKESNFTLSQKT  656
                  LNL+ATELRLGLPG QSP+R+ E     S++LDEK  FPLHP+ + +   SQK 
Sbjct  61   ERKA-SLNLKATELRLGLPGLQSPERNPELCLLSSSQLDEKPFFPLHPSSDGHCFASQKN  119

Query  657  VVTGNKRGFSDAMDEFSEGKFLSNS  731
            VV+GNKRGFSDAMD FSEGKFLS+S
Sbjct  120  VVSGNKRGFSDAMDGFSEGKFLSDS  144



>ref|XP_002302351.1| auxin-responsive family protein [Populus trichocarpa]
 gb|ABK95187.1| unknown [Populus trichocarpa]
 gb|EEE81624.1| auxin-responsive family protein [Populus trichocarpa]
Length=366

 Score =   142 bits (358),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 94/145 (65%), Positives = 110/145 (76%), Gaps = 6/145 (4%)
 Frame = +3

Query  312  MSPPLLGV-GEDGQSNVTHMASPISLDSVCQNGPELKEWNYMGLsdcssvdsstisstse  488
            MSPPLLGV  E+G SNVT +ASP S +S C NG ELKE NYMGLSDCSSVDSS +S+ S+
Sbjct  1    MSPPLLGVVEEEGHSNVTLLASPASAESACLNGLELKERNYMGLSDCSSVDSSAVSAASD  60

Query  489  nnsGRGLNLRATELRLGLPGSQSPQRDSEPSTKL----DEKLLFPLHPAKESNFTLSQKT  656
                  LNL+ATELRLGLPGSQSP+R+ E S       DEK  FPLHP+ + +++ +QK 
Sbjct  61   ERK-TSLNLKATELRLGLPGSQSPERNHELSLLSSALLDEKPFFPLHPSNDGHYSSTQKN  119

Query  657  VVTGNKRGFSDAMDEFSEGKFLSNS  731
            VV+GNKR FSDAMDEFSE KFLSNS
Sbjct  120  VVSGNKRVFSDAMDEFSESKFLSNS  144



>emb|CAC84706.1| aux/IAA protein [Populus tremula x Populus tremuloides]
Length=365

 Score =   141 bits (356),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 96/145 (66%), Positives = 112/145 (77%), Gaps = 7/145 (5%)
 Frame = +3

Query  312  MSPPLLGV-GEDGQSNVTHMASPISLDSVCQNGPELKEWNYMGLsdcssvdsstisstse  488
            MSPPLLGV  E+GQSNVT +ASP S +S C NG ELKE NYMGLSDCSSVDSS +S+ S+
Sbjct  1    MSPPLLGVVEEEGQSNVTLLASPASAESACLNGLELKERNYMGLSDCSSVDSSAVSAASD  60

Query  489  nnsGRGLNLRATELRLGLPGSQSPQRDSE----PSTKLDEKLLFPLHPAKESNFTLSQKT  656
                  LNL+ATELRLGLPGSQSP+R+ E     S  LDEK  FPLHP+ + +++ +QK 
Sbjct  61   ERKA-SLNLKATELRLGLPGSQSPERNHELSLLSSALLDEKPFFPLHPSNDGHYS-TQKN  118

Query  657  VVTGNKRGFSDAMDEFSEGKFLSNS  731
            VV+GNKR FSDAMDEFSE KFLSNS
Sbjct  119  VVSGNKRVFSDAMDEFSESKFLSNS  143



>gb|AFZ78618.1| hypothetical protein [Populus tomentosa]
Length=365

 Score =   139 bits (349),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 94/145 (65%), Positives = 110/145 (76%), Gaps = 7/145 (5%)
 Frame = +3

Query  312  MSPPLLGV-GEDGQSNVTHMASPISLDSVCQNGPELKEWNYMGLsdcssvdsstisstse  488
            MSPPLLGV  E+G SNVT +ASP S +S C NG ELKE NYMGLSDCSSVDSS +S+ S+
Sbjct  1    MSPPLLGVVEEEGHSNVTLLASPASAESACLNGLELKERNYMGLSDCSSVDSSAVSAASD  60

Query  489  nnsGRGLNLRATELRLGLPGSQSPQRDSEPSTKL----DEKLLFPLHPAKESNFTLSQKT  656
                  LNL+ATELRLGLPGSQSP+R+ E S       DEK  FPLHP+ + +++ +QK 
Sbjct  61   ERK-TSLNLKATELRLGLPGSQSPERNHELSLLSSALLDEKPFFPLHPSNDGHYS-TQKN  118

Query  657  VVTGNKRGFSDAMDEFSEGKFLSNS  731
            VV+GNKR FSDAMDEFSE KFLSNS
Sbjct  119  VVSGNKRVFSDAMDEFSESKFLSNS  143



>ref|XP_010104556.1| Auxin-responsive protein IAA9 [Morus notabilis]
 gb|EXC01157.1| Auxin-responsive protein IAA9 [Morus notabilis]
Length=378

 Score =   137 bits (346),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 90/144 (63%), Positives = 109/144 (76%), Gaps = 11/144 (8%)
 Frame = +3

Query  312  MSPPLLGVGED-GQSNVTHMASPISLDSVCQNGPELKEWNYMGLsdcssvdsstisstse  488
            MSPPL GVGED GQSNVT + S  S++S      ELKE NYMGLSDCSS D S +S  S+
Sbjct  1    MSPPLHGVGEDEGQSNVTVLTSSPSMES------ELKERNYMGLSDCSSGDCSVVSPASD  54

Query  489  nnsGRGLNLRATELRLGLPGSQSPQRDSEP---STKLDEKLLFPLHPAKESNFTLSQKTV  659
             +  R LNL+ATELRLGLPGSQSP+RD  P   S +LDEK LFPLHP+ + ++  S KTV
Sbjct  55   ESK-RTLNLKATELRLGLPGSQSPERDPGPRQSSAQLDEKKLFPLHPSNDVHYNHSLKTV  113

Query  660  VTGNKRGFSDAMDEFSEGKFLSNS  731
            V+GNKRGFSDAM+ FSEGK+++N+
Sbjct  114  VSGNKRGFSDAMNGFSEGKYMTNA  137



>gb|KCW68554.1| hypothetical protein EUGRSUZ_F02172 [Eucalyptus grandis]
 gb|KCW68555.1| hypothetical protein EUGRSUZ_F02172 [Eucalyptus grandis]
Length=321

 Score =   134 bits (337),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 86/144 (60%), Positives = 104/144 (72%), Gaps = 8/144 (6%)
 Frame = +3

Query  312  MSPPLLGVGED-GQSNVTHMASPISLDSVCQNGPELKEWNYMGLsdcssvdsstisstse  488
            MSPPLL VGE+  +SNVT +ASP SL SVCQN  ELKE NYMG+ D  S D S I +  +
Sbjct  1    MSPPLLSVGEEECESNVTLLASPSSLGSVCQNA-ELKERNYMGMGDHPSADGSVIPNAFD  59

Query  489  nnsGRGLNLRATELRLGLPGSQSPQRDSE----PSTKLDEKLLFPLHPAKESNFTLSQKT  656
                  LNLRATELRLGLPGSQSP+RD++     S KLDEK  FPLHP+ + +++ SQK 
Sbjct  60   GCK-ITLNLRATELRLGLPGSQSPERDADFCTISSAKLDEKPFFPLHPSNDGHYS-SQKI  117

Query  657  VVTGNKRGFSDAMDEFSEGKFLSN  728
            VV+GNKRGF+DAM   SE KF++N
Sbjct  118  VVSGNKRGFADAMGGDSEAKFMAN  141



>gb|KCW68553.1| hypothetical protein EUGRSUZ_F02172 [Eucalyptus grandis]
Length=330

 Score =   134 bits (336),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 86/144 (60%), Positives = 104/144 (72%), Gaps = 8/144 (6%)
 Frame = +3

Query  312  MSPPLLGVGED-GQSNVTHMASPISLDSVCQNGPELKEWNYMGLsdcssvdsstisstse  488
            MSPPLL VGE+  +SNVT +ASP SL SVCQN  ELKE NYMG+ D  S D S I +  +
Sbjct  1    MSPPLLSVGEEECESNVTLLASPSSLGSVCQNA-ELKERNYMGMGDHPSADGSVIPNAFD  59

Query  489  nnsGRGLNLRATELRLGLPGSQSPQRDSE----PSTKLDEKLLFPLHPAKESNFTLSQKT  656
                  LNLRATELRLGLPGSQSP+RD++     S KLDEK  FPLHP+ + +++ SQK 
Sbjct  60   GCK-ITLNLRATELRLGLPGSQSPERDADFCTISSAKLDEKPFFPLHPSNDGHYS-SQKI  117

Query  657  VVTGNKRGFSDAMDEFSEGKFLSN  728
            VV+GNKRGF+DAM   SE KF++N
Sbjct  118  VVSGNKRGFADAMGGDSEAKFMAN  141



>ref|XP_004299829.1| PREDICTED: auxin-responsive protein IAA8-like isoform X1 [Fragaria 
vesca subsp. vesca]
Length=356

 Score =   134 bits (336),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 90/140 (64%), Positives = 106/140 (76%), Gaps = 10/140 (7%)
 Frame = +3

Query  312  MSPPLLGVGED-GQSNVTHMASPISLDSVCQNGPELKEWNYMGLsdcssvdsstisstse  488
            MS P +G GE+ G S+VT ++S +S+DSVC N  +LKE NYMGLSDCSSVDSS  S    
Sbjct  1    MSQPQVGAGEEEGSSDVTALSSSLSMDSVCPNSSDLKERNYMGLSDCSSVDSSKGSDVDG  60

Query  489  nnsGRGLNLRATELRLGLPGSQSPQRDSE---PSTKLDEKLLFPLHPAKESNFTLSQKTV  659
            + S   LNL ATELRLGLPGSQSP+R+SE    ST+ DEK LFPLHP K+S     QKT+
Sbjct  61   SKSR--LNLMATELRLGLPGSQSPERNSELRLISTQPDEKPLFPLHPVKDS----LQKTI  114

Query  660  VTGNKRGFSDAMDEFSEGKF  719
            V+GNKRGFSDAMDEFSEGK+
Sbjct  115  VSGNKRGFSDAMDEFSEGKY  134



>ref|XP_010061570.1| PREDICTED: auxin-responsive protein IAA9-like [Eucalyptus grandis]
 ref|XP_010061571.1| PREDICTED: auxin-responsive protein IAA9-like [Eucalyptus grandis]
 gb|KCW68552.1| hypothetical protein EUGRSUZ_F02172 [Eucalyptus grandis]
Length=359

 Score =   134 bits (336),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 86/144 (60%), Positives = 104/144 (72%), Gaps = 8/144 (6%)
 Frame = +3

Query  312  MSPPLLGVGED-GQSNVTHMASPISLDSVCQNGPELKEWNYMGLsdcssvdsstisstse  488
            MSPPLL VGE+  +SNVT +ASP SL SVCQN  ELKE NYMG+ D  S D S I +  +
Sbjct  1    MSPPLLSVGEEECESNVTLLASPSSLGSVCQNA-ELKERNYMGMGDHPSADGSVIPNAFD  59

Query  489  nnsGRGLNLRATELRLGLPGSQSPQRDSE----PSTKLDEKLLFPLHPAKESNFTLSQKT  656
                  LNLRATELRLGLPGSQSP+RD++     S KLDEK  FPLHP+ + +++ SQK 
Sbjct  60   GCK-ITLNLRATELRLGLPGSQSPERDADFCTISSAKLDEKPFFPLHPSNDGHYS-SQKI  117

Query  657  VVTGNKRGFSDAMDEFSEGKFLSN  728
            VV+GNKRGF+DAM   SE KF++N
Sbjct  118  VVSGNKRGFADAMGGDSEAKFMAN  141



>gb|KDO81312.1| hypothetical protein CISIN_1g017824mg [Citrus sinensis]
Length=210

 Score =   130 bits (326),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 86/142 (61%), Positives = 103/142 (73%), Gaps = 5/142 (4%)
 Frame = +3

Query  318  PPLLGVGEDGQSNVTHMASPISLDSVCQNGPELKEWNYMGLsdcssvdsstisstsenns  497
            PP +G  + G  NV  +ASP S+ SVCQ    +KE NYMGLSD SS+DSS +SS S  +S
Sbjct  4    PPAVGEEKRGPGNVNLLASPASMGSVCQKSSVIKERNYMGLSDSSSMDSSVVSSVSGESS  63

Query  498  GRGLNLRATELRLGLPGSQSPQRDSEPS----TKLDEKLLFPLHPAKESNFTLSQKTVVT  665
               LNL+ATELRLGLPGSQSP+R SE       +LDEK LFPLHP  +S++  SQK VV+
Sbjct  64   KSSLNLKATELRLGLPGSQSPERGSELCLLGPAQLDEKPLFPLHPTSDSHYP-SQKNVVS  122

Query  666  GNKRGFSDAMDEFSEGKFLSNS  731
            GNKRGFSDAMD F EGK+LS+S
Sbjct  123  GNKRGFSDAMDGFLEGKYLSSS  144



>emb|CDP00957.1| unnamed protein product [Coffea canephora]
Length=366

 Score =   133 bits (334),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 97/141 (69%), Positives = 111/141 (79%), Gaps = 5/141 (4%)
 Frame = +3

Query  312  MSPPLLGVGED-GQSNVTHMASPISLDSVCQNGPELKEWNYMGLsdcssvdsstisstse  488
            MS PLLGVGE+ GQSNV+ + S  SLDS  QNG   KE NYMGLS+CSSVDSSTIS+ S 
Sbjct  1    MSTPLLGVGEEEGQSNVSLLTSSSSLDSSRQNGSVFKERNYMGLSECSSVDSSTISNISG  60

Query  489  nnsGRGLNLRATELRLGLPGSQSPQRDSE----PSTKLDEKLLFPLHPAKESNFTLSQKT  656
             ++G  LNL+ATELRLGLPGSQSP+RDSE     STKLDEK LFPLHP K+ N +  Q+T
Sbjct  61   GSNGSCLNLKATELRLGLPGSQSPERDSELCLVSSTKLDEKPLFPLHPLKDGNCSNLQRT  120

Query  657  VVTGNKRGFSDAMDEFSEGKF  719
            + +GNKRGFSDAMD FSEGKF
Sbjct  121  ITSGNKRGFSDAMDGFSEGKF  141



>ref|XP_004509715.1| PREDICTED: auxin-responsive protein IAA9-like isoform X1 [Cicer 
arietinum]
Length=353

 Score =   132 bits (332),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 92/146 (63%), Positives = 106/146 (73%), Gaps = 7/146 (5%)
 Frame = +3

Query  312  MSPPLLGVGEDGQSNVTHMAS--PISLDSVCQNGPELKEWNYMGLsdcssvdsstissts  485
            MSPPLL   E+ QSN + +AS  P SLD   QNG  LKE NY+GLSDCSSVDSST+ S S
Sbjct  1    MSPPLLVTEEERQSNTSTVASASPQSLDCFSQNGAGLKERNYLGLSDCSSVDSSTVPSLS  60

Query  486  ennsGRGLNLRATELRLGLPGSQSPQRDSE----PSTKLDEKLLFPLHPAKESNFTLSQK  653
            +      LNL+ATELRLGLPGSQSP+RD +     STKLDEK LFPL P K+   +LSQK
Sbjct  61   DEKK-ENLNLKATELRLGLPGSQSPERDPDLFLLSSTKLDEKPLFPLLPTKDGICSLSQK  119

Query  654  TVVTGNKRGFSDAMDEFSEGKFLSNS  731
             VV+GNKRGFSDAMD F EGK+  N+
Sbjct  120  NVVSGNKRGFSDAMDGFREGKYTGNA  145



>gb|KDO81311.1| hypothetical protein CISIN_1g017824mg [Citrus sinensis]
Length=288

 Score =   130 bits (326),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 86/142 (61%), Positives = 103/142 (73%), Gaps = 5/142 (4%)
 Frame = +3

Query  318  PPLLGVGEDGQSNVTHMASPISLDSVCQNGPELKEWNYMGLsdcssvdsstisstsenns  497
            PP +G  + G  NV  +ASP S+ SVCQ    +KE NYMGLSD SS+DSS +SS S  +S
Sbjct  4    PPAVGEEKRGPGNVNLLASPASMGSVCQKSSVIKERNYMGLSDSSSMDSSVVSSVSGESS  63

Query  498  GRGLNLRATELRLGLPGSQSPQRDSEPS----TKLDEKLLFPLHPAKESNFTLSQKTVVT  665
               LNL+ATELRLGLPGSQSP+R SE       +LDEK LFPLHP  +S++  SQK VV+
Sbjct  64   KSSLNLKATELRLGLPGSQSPERGSELCLLGPAQLDEKPLFPLHPTSDSHYP-SQKNVVS  122

Query  666  GNKRGFSDAMDEFSEGKFLSNS  731
            GNKRGFSDAMD F EGK+LS+S
Sbjct  123  GNKRGFSDAMDGFLEGKYLSSS  144



>ref|XP_006433732.1| hypothetical protein CICLE_v10001479mg [Citrus clementina]
 ref|XP_006433733.1| hypothetical protein CICLE_v10001479mg [Citrus clementina]
 ref|XP_006433734.1| hypothetical protein CICLE_v10001479mg [Citrus clementina]
 ref|XP_006433735.1| hypothetical protein CICLE_v10001479mg [Citrus clementina]
 ref|XP_006433737.1| hypothetical protein CICLE_v10001479mg [Citrus clementina]
 ref|XP_006433738.1| hypothetical protein CICLE_v10001479mg [Citrus clementina]
 ref|XP_006433739.1| hypothetical protein CICLE_v10001479mg [Citrus clementina]
 ref|XP_006433740.1| hypothetical protein CICLE_v10001479mg [Citrus clementina]
 gb|ESR46972.1| hypothetical protein CICLE_v10001479mg [Citrus clementina]
 gb|ESR46973.1| hypothetical protein CICLE_v10001479mg [Citrus clementina]
 gb|ESR46974.1| hypothetical protein CICLE_v10001479mg [Citrus clementina]
 gb|ESR46975.1| hypothetical protein CICLE_v10001479mg [Citrus clementina]
 gb|ESR46977.1| hypothetical protein CICLE_v10001479mg [Citrus clementina]
 gb|ESR46978.1| hypothetical protein CICLE_v10001479mg [Citrus clementina]
 gb|ESR46979.1| hypothetical protein CICLE_v10001479mg [Citrus clementina]
 gb|ESR46980.1| hypothetical protein CICLE_v10001479mg [Citrus clementina]
Length=365

 Score =   130 bits (328),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 91/146 (62%), Positives = 107/146 (73%), Gaps = 8/146 (5%)
 Frame = +3

Query  312  MSPPLLGVGED--GQSNVTHMASPISLDSVCQNGPELKEWNYMGLsdcssvdsstissts  485
            MSPP  GVGE+  G  NV  +ASP S+ SVCQ    +KE NYMGLSD SS+DSS +SS S
Sbjct  1    MSPPP-GVGEEKRGPGNVNLLASPASMGSVCQKSSVIKERNYMGLSDSSSMDSSVVSSVS  59

Query  486  ennsGRGLNLRATELRLGLPGSQSPQRDSEPS----TKLDEKLLFPLHPAKESNFTLSQK  653
              +S   LNL+ATELRLGLPGSQSP+R SE       +LDEK LFPLHP  +S++  SQK
Sbjct  60   GESSKSSLNLKATELRLGLPGSQSPERGSELCLLGPAQLDEKPLFPLHPTSDSHYP-SQK  118

Query  654  TVVTGNKRGFSDAMDEFSEGKFLSNS  731
             VV+GNKRGFSDAMD F EGK+LS+S
Sbjct  119  NVVSGNKRGFSDAMDGFLEGKYLSSS  144



>ref|XP_006433736.1| hypothetical protein CICLE_v10001479mg [Citrus clementina]
 gb|ESR46976.1| hypothetical protein CICLE_v10001479mg [Citrus clementina]
Length=383

 Score =   130 bits (328),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 91/146 (62%), Positives = 107/146 (73%), Gaps = 8/146 (5%)
 Frame = +3

Query  312  MSPPLLGVGED--GQSNVTHMASPISLDSVCQNGPELKEWNYMGLsdcssvdsstissts  485
            MSPP  GVGE+  G  NV  +ASP S+ SVCQ    +KE NYMGLSD SS+DSS +SS S
Sbjct  1    MSPPP-GVGEEKRGPGNVNLLASPASMGSVCQKSSVIKERNYMGLSDSSSMDSSVVSSVS  59

Query  486  ennsGRGLNLRATELRLGLPGSQSPQRDSEPS----TKLDEKLLFPLHPAKESNFTLSQK  653
              +S   LNL+ATELRLGLPGSQSP+R SE       +LDEK LFPLHP  +S++  SQK
Sbjct  60   GESSKSSLNLKATELRLGLPGSQSPERGSELCLLGPAQLDEKPLFPLHPTSDSHYP-SQK  118

Query  654  TVVTGNKRGFSDAMDEFSEGKFLSNS  731
             VV+GNKRGFSDAMD F EGK+LS+S
Sbjct  119  NVVSGNKRGFSDAMDGFLEGKYLSSS  144



>ref|NP_001267710.1| auxin-responsive protein IAA9-like [Cucumis sativus]
 dbj|BAA85821.1| Aux/IAA protein [Cucumis sativus]
 gb|KGN62776.1| hypothetical protein Csa_2G372720 [Cucumis sativus]
Length=355

 Score =   130 bits (326),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 84/145 (58%), Positives = 107/145 (74%), Gaps = 7/145 (5%)
 Frame = +3

Query  312  MSPPLLGVGE--DGQSNVTHMASPISLDSVCQNGPELKEWNYMGLsdcssvdsstissts  485
            MSPPLL VGE  + +SNVT +AS  S++SV  N  E +E NYMGLSD SS DS   ++ S
Sbjct  1    MSPPLLDVGEVEESRSNVTLLASSNSMESVSPNNLEFEERNYMGLSDSSSEDSCMTATKS  60

Query  486  ennsGRGLNLRATELRLGLPGSQSPQRDSE----PSTKLDEKLLFPLHPAKESNFTLSQK  653
            + N    LNL+ATELRLGLPGS+SP+RD +     S++LDEK LFPLHP+ +  ++  QK
Sbjct  61   DGNKP-SLNLKATELRLGLPGSESPERDPDNCLRSSSQLDEKPLFPLHPSSDGLYSSPQK  119

Query  654  TVVTGNKRGFSDAMDEFSEGKFLSN  728
            TVV+GNKRGFSDAM+EFSE K+ +N
Sbjct  120  TVVSGNKRGFSDAMNEFSEEKYHAN  144



>gb|KDO81310.1| hypothetical protein CISIN_1g017824mg [Citrus sinensis]
Length=333

 Score =   129 bits (324),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 86/142 (61%), Positives = 103/142 (73%), Gaps = 5/142 (4%)
 Frame = +3

Query  318  PPLLGVGEDGQSNVTHMASPISLDSVCQNGPELKEWNYMGLsdcssvdsstisstsenns  497
            PP +G  + G  NV  +ASP S+ SVCQ    +KE NYMGLSD SS+DSS +SS S  +S
Sbjct  4    PPAVGEEKRGPGNVNLLASPASMGSVCQKSSVIKERNYMGLSDSSSMDSSVVSSVSGESS  63

Query  498  GRGLNLRATELRLGLPGSQSPQRDSEPS----TKLDEKLLFPLHPAKESNFTLSQKTVVT  665
               LNL+ATELRLGLPGSQSP+R SE       +LDEK LFPLHP  +S++  SQK VV+
Sbjct  64   KSSLNLKATELRLGLPGSQSPERGSELCLLGPAQLDEKPLFPLHPTSDSHYP-SQKNVVS  122

Query  666  GNKRGFSDAMDEFSEGKFLSNS  731
            GNKRGFSDAMD F EGK+LS+S
Sbjct  123  GNKRGFSDAMDGFLEGKYLSSS  144



>gb|KDO81302.1| hypothetical protein CISIN_1g017824mg [Citrus sinensis]
 gb|KDO81303.1| hypothetical protein CISIN_1g017824mg [Citrus sinensis]
 gb|KDO81304.1| hypothetical protein CISIN_1g017824mg [Citrus sinensis]
 gb|KDO81305.1| hypothetical protein CISIN_1g017824mg [Citrus sinensis]
 gb|KDO81306.1| hypothetical protein CISIN_1g017824mg [Citrus sinensis]
 gb|KDO81307.1| hypothetical protein CISIN_1g017824mg [Citrus sinensis]
 gb|KDO81308.1| hypothetical protein CISIN_1g017824mg [Citrus sinensis]
 gb|KDO81309.1| hypothetical protein CISIN_1g017824mg [Citrus sinensis]
Length=365

 Score =   129 bits (324),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 86/142 (61%), Positives = 103/142 (73%), Gaps = 5/142 (4%)
 Frame = +3

Query  318  PPLLGVGEDGQSNVTHMASPISLDSVCQNGPELKEWNYMGLsdcssvdsstisstsenns  497
            PP +G  + G  NV  +ASP S+ SVCQ    +KE NYMGLSD SS+DSS +SS S  +S
Sbjct  4    PPAVGEEKRGPGNVNLLASPASMGSVCQKSSVIKERNYMGLSDSSSMDSSVVSSVSGESS  63

Query  498  GRGLNLRATELRLGLPGSQSPQRDSEPS----TKLDEKLLFPLHPAKESNFTLSQKTVVT  665
               LNL+ATELRLGLPGSQSP+R SE       +LDEK LFPLHP  +S++  SQK VV+
Sbjct  64   KSSLNLKATELRLGLPGSQSPERGSELCLLGPAQLDEKPLFPLHPTSDSHYP-SQKNVVS  122

Query  666  GNKRGFSDAMDEFSEGKFLSNS  731
            GNKRGFSDAMD F EGK+LS+S
Sbjct  123  GNKRGFSDAMDGFLEGKYLSSS  144



>ref|XP_006472387.1| PREDICTED: auxin-responsive protein IAA9-like isoform X1 [Citrus 
sinensis]
 ref|XP_006472388.1| PREDICTED: auxin-responsive protein IAA9-like isoform X2 [Citrus 
sinensis]
 ref|XP_006472389.1| PREDICTED: auxin-responsive protein IAA9-like isoform X3 [Citrus 
sinensis]
 ref|XP_006472390.1| PREDICTED: auxin-responsive protein IAA9-like isoform X4 [Citrus 
sinensis]
Length=365

 Score =   129 bits (324),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 86/142 (61%), Positives = 103/142 (73%), Gaps = 5/142 (4%)
 Frame = +3

Query  318  PPLLGVGEDGQSNVTHMASPISLDSVCQNGPELKEWNYMGLsdcssvdsstisstsenns  497
            PP +G  + G  NV  +ASP S+ SVCQ    +KE NYMGLSD SS+DSS +SS S  +S
Sbjct  4    PPAVGEEKRGPGNVNLLASPASMGSVCQKSSVIKERNYMGLSDSSSMDSSVVSSVSGESS  63

Query  498  GRGLNLRATELRLGLPGSQSPQRDSEPS----TKLDEKLLFPLHPAKESNFTLSQKTVVT  665
               LNL+ATELRLGLPGSQSP+R SE       +L EK LFPLHP  +S++  SQK VV+
Sbjct  64   KSSLNLKATELRLGLPGSQSPERGSELCLLGPAQLGEKPLFPLHPTNDSHYP-SQKNVVS  122

Query  666  GNKRGFSDAMDEFSEGKFLSNS  731
            GNKRGFSDAMD FSEGK+LS+S
Sbjct  123  GNKRGFSDAMDGFSEGKYLSSS  144



>ref|XP_008444965.1| PREDICTED: auxin-responsive protein IAA9-like [Cucumis melo]
Length=355

 Score =   129 bits (323),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 83/145 (57%), Positives = 107/145 (74%), Gaps = 7/145 (5%)
 Frame = +3

Query  312  MSPPLLGVGE--DGQSNVTHMASPISLDSVCQNGPELKEWNYMGLsdcssvdsstissts  485
            MSPPLL VGE  + +SNVT +AS  S++SV  N    +E NYMGLSD SS DS   ++ S
Sbjct  1    MSPPLLDVGEVEESRSNVTLLASSNSMESVSPNNLGFEERNYMGLSDSSSEDSCMTATKS  60

Query  486  ennsGRGLNLRATELRLGLPGSQSPQRDSE----PSTKLDEKLLFPLHPAKESNFTLSQK  653
            + N    LNL+ATELRLGLPGS+SP+RD +     S++LDEK LFPLHP+ + +++  QK
Sbjct  61   DGNKP-SLNLKATELRLGLPGSESPERDPDNCLRSSSQLDEKPLFPLHPSSDGHYSSPQK  119

Query  654  TVVTGNKRGFSDAMDEFSEGKFLSN  728
            TVV+GNKRGFSDAM+EFSE K+ +N
Sbjct  120  TVVSGNKRGFSDAMNEFSEEKYHAN  144



>ref|XP_007137671.1| hypothetical protein PHAVU_009G146000g [Phaseolus vulgaris]
 ref|XP_007137672.1| hypothetical protein PHAVU_009G146000g [Phaseolus vulgaris]
 gb|ESW09665.1| hypothetical protein PHAVU_009G146000g [Phaseolus vulgaris]
 gb|ESW09666.1| hypothetical protein PHAVU_009G146000g [Phaseolus vulgaris]
Length=366

 Score =   127 bits (319),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 89/145 (61%), Positives = 107/145 (74%), Gaps = 8/145 (6%)
 Frame = +3

Query  312  MSPPLLGVGEDGQSNVTHM-ASPISLDSVCQNGPELKEWNYMGLsdcssvdsstisstse  488
            MSPPLLG+GE+G+SNVT + +S  +++SVC    ELKE NYMGLSDCSSVDSS  S + E
Sbjct  1    MSPPLLGIGEEGKSNVTLLVSSSTTMESVCLKTLELKERNYMGLSDCSSVDSSVPSVSEE  60

Query  489  nnsGRGLNLRATELRLGLPGSQSPQRDSE----PSTKLDEKLLFPLHPAKESNFTLSQKT  656
              S   LNL+ATEL LGLPGSQS +RDS+     ST+ DEK LFPL P  + + + S KT
Sbjct  61   TKSN--LNLKATELTLGLPGSQSSERDSDLCLRSSTQFDEKALFPLCPLADDHHS-STKT  117

Query  657  VVTGNKRGFSDAMDEFSEGKFLSNS  731
             V GNKRGFSDAM+ FSEGKFL +S
Sbjct  118  AVLGNKRGFSDAMNGFSEGKFLVDS  142



>gb|AID60626.1| auxin-responsive protein IAA8 [Dimocarpus longan]
Length=257

 Score =   125 bits (313),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 94/147 (64%), Positives = 107/147 (73%), Gaps = 12/147 (8%)
 Frame = +3

Query  312  MSPPLLGVGED--GQSNVTHMASPISLDSVCQNGPELKEWNYMGLsdcssvdsstissts  485
            MSPPLLGV E+    SNVT +AS  SLDS+CQN PELKE NYMGLSDCSSVDSS IS+ S
Sbjct  1    MSPPLLGVEEEEGHPSNVTLLASSSSLDSICQNNPELKERNYMGLSDCSSVDSSVISNLS  60

Query  486  ennsGR-GLNLRATELRLGLPGSQSPQRDSE----PSTKLDEKLLFPLHPAKESNFTLSQ  650
                 +  LNL+ATELRLGLPGSQSP+RD       S +LDEK LFPLHP  + ++ L +
Sbjct  61   NETKSKSSLNLKATELRLGLPGSQSPERDPNLCLLSSAQLDEKPLFPLHPTNDGHYPLQK  120

Query  651  KTVVTGNKRGFSDAMDEFSEGKFLSNS  731
                  NKRGFSDAMD FSEGK+LSNS
Sbjct  121  N-----NKRGFSDAMDGFSEGKYLSNS  142



>emb|CAI77628.1| Aux/IAA protein [Solanum lycopersicum]
Length=308

 Score =   125 bits (315),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 63/82 (77%), Positives = 72/82 (88%), Gaps = 4/82 (5%)
 Frame = +3

Query  498  GRGLNLRATELRLGLPGSQSPQRDSEP----STKLDEKLLFPLHPAKESNFTLSQKTVVT  665
            G GLNL+ATELRLGLPGSQSP+R  E     STK+DEKLLFPLHP+K++ F++SQKTVV+
Sbjct  23   GCGLNLKATELRLGLPGSQSPERGEETCPVISTKVDEKLLFPLHPSKDTAFSVSQKTVVS  82

Query  666  GNKRGFSDAMDEFSEGKFLSNS  731
            GNKRGFSDAMD FSEGKFLSNS
Sbjct  83   GNKRGFSDAMDGFSEGKFLSNS  104



>ref|XP_012079519.1| PREDICTED: auxin-responsive protein IAA9 [Jatropha curcas]
 gb|KDP32156.1| hypothetical protein JCGZ_12617 [Jatropha curcas]
Length=380

 Score =   126 bits (316),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 85/139 (61%), Positives = 103/139 (74%), Gaps = 5/139 (4%)
 Frame = +3

Query  312  MSPPLLGVGEDGQSNVTHMASPISLDSVCQNGPELKEWNYMGLsdcssvdsstisstsen  491
            MSPPLLGV E+G++NV+ +AS  S+D + QNG  L E NY+GLSDCSSVDSS + S S+ 
Sbjct  1    MSPPLLGVEEEGENNVSLVASSPSIDCISQNGCGLTERNYLGLSDCSSVDSSAVPSLSKE  60

Query  492  nsGRGLNLRATELRLGLPGSQSPQRDSEPST----KLDEKLLFPLHPAKESNFTLSQKTV  659
                 LNL+ATELRLGLPGSQSP+R+++ S     KLDEK LFPL P K+   + SQK V
Sbjct  61   TKNN-LNLKATELRLGLPGSQSPERETDVSLLSTGKLDEKPLFPLLPLKDGICSSSQKHV  119

Query  660  VTGNKRGFSDAMDEFSEGK  716
            V+GNKRGFSD MD FSE K
Sbjct  120  VSGNKRGFSDTMDGFSEVK  138



>ref|XP_011099452.1| PREDICTED: auxin-responsive protein IAA9-like [Sesamum indicum]
Length=359

 Score =   124 bits (311),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 88/139 (63%), Positives = 101/139 (73%), Gaps = 5/139 (4%)
 Frame = +3

Query  312  MSPPLLGVGEDGQSNVTHMASPISLDSVCQNGPELKEWNYMGLsdcssvdsstisstsen  491
            MSPPLLGV    Q NV+ MAS  S+D+V QNG  LKE NY+GLSDCSSVDSS +SS  E 
Sbjct  1    MSPPLLGVEGQDQCNVSLMASSASVDTVSQNGLGLKERNYLGLSDCSSVDSSGVSSVPEE  60

Query  492  nsGRGLNLRATELRLGLPGSQSPQRDSE----PSTKLDEKLLFPLHPAKESNFTLSQKTV  659
            N    LNL+ATELRLGLPGSQSP+RD +     S KLDEK LFPL P+K+    LS KTV
Sbjct  61   NKNN-LNLKATELRLGLPGSQSPERDPDFSPLSSVKLDEKQLFPLVPSKDGICLLSPKTV  119

Query  660  VTGNKRGFSDAMDEFSEGK  716
            V+GNKRGF+D +D F E K
Sbjct  120  VSGNKRGFADTVDGFLESK  138



>ref|XP_003628839.1| Indoleacetic acid-induced-like protein [Medicago truncatula]
 gb|AET03315.1| auxin-responsive AUX/IAA family protein [Medicago truncatula]
Length=356

 Score =   124 bits (310),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 88/147 (60%), Positives = 106/147 (72%), Gaps = 7/147 (5%)
 Frame = +3

Query  309  LMSPPLLGVGEDGQSNVTHMAS--PISLDSVCQNGPELKEWNYMGLsdcssvdsstisst  482
            LMSPPLL   E+GQSN + +AS  P SLD   Q    LKE NY+GLSDCSSVDSST+ S 
Sbjct  8    LMSPPLLLPEEEGQSNPSTVASASPQSLDRFSQTAAGLKERNYLGLSDCSSVDSSTVPSL  67

Query  483  sennsGRGLNLRATELRLGLPGSQSPQRDSE----PSTKLDEKLLFPLHPAKESNFTLSQ  650
            S+      LNL+ATELRLGLPGSQSP+RD +     STKLDEK LFPL P K+   +LSQ
Sbjct  68   SDEKK-ENLNLKATELRLGLPGSQSPERDLDLFPLNSTKLDEKPLFPLLPTKDGICSLSQ  126

Query  651  KTVVTGNKRGFSDAMDEFSEGKFLSNS  731
            KTVV+GNKRGF+D ++ F E K+ +N+
Sbjct  127  KTVVSGNKRGFADTLEVFPEAKYTANT  153



>gb|ACU23129.1| unknown [Glycine max]
Length=210

 Score =   120 bits (301),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 86/146 (59%), Positives = 104/146 (71%), Gaps = 9/146 (6%)
 Frame = +3

Query  312  MSPPLLGVGED-GQSNVTHM-ASPISLDSVCQNGPELKEWNYMGLsdcssvdsstissts  485
            MS PLLG+GE+ GQSNVT + +S + ++SVC N  +LKE NYMGLSDCSSVDSS  S + 
Sbjct  1    MSKPLLGIGEEEGQSNVTLLVSSSVIMESVCLNSSKLKERNYMGLSDCSSVDSSAPSFSD  60

Query  486  ennsGRGLNLRATELRLGLPGSQSPQRDSE----PSTKLDEKLLFPLHPAKESNFTLSQK  653
            E  S   LNL+ATELRLGLPG QSP+RDS+     S + DEK LFPLHPA + + + S K
Sbjct  61   ETKSN--LNLKATELRLGLPGLQSPERDSDLCLRSSIQFDEKPLFPLHPATDDHHS-SSK  117

Query  654  TVVTGNKRGFSDAMDEFSEGKFLSNS  731
              V GNKRGFSD M  F+E K L +S
Sbjct  118  PAVLGNKRGFSDVMSGFAEEKLLVSS  143



>gb|AFK49626.1| unknown [Medicago truncatula]
Length=348

 Score =   122 bits (307),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 87/146 (60%), Positives = 105/146 (72%), Gaps = 7/146 (5%)
 Frame = +3

Query  312  MSPPLLGVGEDGQSNVTHMAS--PISLDSVCQNGPELKEWNYMGLsdcssvdsstissts  485
            MSPPLL   E+GQSN + +AS  P SLD   Q    LKE NY+GLSDCSSVDSST+ S S
Sbjct  1    MSPPLLLPEEEGQSNPSTVASASPQSLDRFSQTAAGLKERNYLGLSDCSSVDSSTVPSLS  60

Query  486  ennsGRGLNLRATELRLGLPGSQSPQRDSE----PSTKLDEKLLFPLHPAKESNFTLSQK  653
            +      LNL+ATELRLGLPGSQSP+RD +     STKLDEK LFPL P K+   +LSQK
Sbjct  61   DEKK-ENLNLKATELRLGLPGSQSPERDLDLFPLNSTKLDEKPLFPLLPTKDGICSLSQK  119

Query  654  TVVTGNKRGFSDAMDEFSEGKFLSNS  731
            TVV+GNKRGF+D ++ F E K+ +N+
Sbjct  120  TVVSGNKRGFADTLEVFPEAKYTANT  145



>gb|ACJ84551.1| unknown [Medicago truncatula]
Length=348

 Score =   122 bits (307),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 87/146 (60%), Positives = 105/146 (72%), Gaps = 7/146 (5%)
 Frame = +3

Query  312  MSPPLLGVGEDGQSNVTHMAS--PISLDSVCQNGPELKEWNYMGLsdcssvdsstissts  485
            MSPPLL   E+GQSN + +AS  P SLD   Q    LKE NY+GLSDCSSVDSST+ S S
Sbjct  1    MSPPLLLPEEEGQSNPSTVASASPQSLDRFSQTAAGLKERNYLGLSDCSSVDSSTVPSLS  60

Query  486  ennsGRGLNLRATELRLGLPGSQSPQRDSE----PSTKLDEKLLFPLHPAKESNFTLSQK  653
            +      LNL+ATELRLGLPGSQSP+RD +     STKLDEK LFPL P K+   +LSQK
Sbjct  61   DEKK-ENLNLKATELRLGLPGSQSPERDLDLFPLNSTKLDEKPLFPLLPTKDGICSLSQK  119

Query  654  TVVTGNKRGFSDAMDEFSEGKFLSNS  731
            TVV+GNKRGF+D ++ F E K+ +N+
Sbjct  120  TVVSGNKRGFADTLEVFPEAKYTANT  145



>ref|XP_010275505.1| PREDICTED: auxin-responsive protein IAA9 isoform X2 [Nelumbo 
nucifera]
Length=409

 Score =   121 bits (304),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 96/140 (69%), Positives = 107/140 (76%), Gaps = 7/140 (5%)
 Frame = +3

Query  309  LMSPPLLGVGEDGQSNVTHMASPISLDSVCQNGPELKEWNYMGLsdcssvdsstisstse  488
            LMSPPLLGVGE GQSNV+ ++S  S+D  CQNG  LKE NYMGLSDCSSVDSS IS  +E
Sbjct  21   LMSPPLLGVGE-GQSNVSVVSS-PSVDGSCQNGSGLKERNYMGLSDCSSVDSSAISGLAE  78

Query  489  nnsGRGLNLRATELRLGLPGSQSPQRDSEPST----KLDEKLLFPLHPAKESNFTLSQKT  656
             N    LNL+ATELRLGLPGSQSP+RD E       KLDEK LFPL P+K+  ++ SQK 
Sbjct  79   ENKS-SLNLKATELRLGLPGSQSPERDPELCLLNPGKLDEKPLFPLLPSKDGIYSSSQKA  137

Query  657  VVTGNKRGFSDAMDEFSEGK  716
            VVTGNKRGFSDAMD FSE K
Sbjct  138  VVTGNKRGFSDAMDNFSEVK  157



>ref|XP_010275504.1| PREDICTED: auxin-responsive protein IAA9 isoform X1 [Nelumbo 
nucifera]
Length=410

 Score =   121 bits (304),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 96/140 (69%), Positives = 107/140 (76%), Gaps = 7/140 (5%)
 Frame = +3

Query  309  LMSPPLLGVGEDGQSNVTHMASPISLDSVCQNGPELKEWNYMGLsdcssvdsstisstse  488
            LMSPPLLGVGE GQSNV+ ++S  S+D  CQNG  LKE NYMGLSDCSSVDSS IS  +E
Sbjct  22   LMSPPLLGVGE-GQSNVSVVSS-PSVDGSCQNGSGLKERNYMGLSDCSSVDSSAISGLAE  79

Query  489  nnsGRGLNLRATELRLGLPGSQSPQRDSEPST----KLDEKLLFPLHPAKESNFTLSQKT  656
             N    LNL+ATELRLGLPGSQSP+RD E       KLDEK LFPL P+K+  ++ SQK 
Sbjct  80   ENKS-SLNLKATELRLGLPGSQSPERDPELCLLNPGKLDEKPLFPLLPSKDGIYSSSQKA  138

Query  657  VVTGNKRGFSDAMDEFSEGK  716
            VVTGNKRGFSDAMD FSE K
Sbjct  139  VVTGNKRGFSDAMDNFSEVK  158



>ref|XP_010105114.1| Auxin-responsive protein IAA9 [Morus notabilis]
 gb|EXC03899.1| Auxin-responsive protein IAA9 [Morus notabilis]
Length=378

 Score =   121 bits (303),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 87/139 (63%), Positives = 103/139 (74%), Gaps = 7/139 (5%)
 Frame = +3

Query  312  MSPPLLGVGEDGQSNVTHMASPISLDSVCQNGPELKEWNYMGLsdcssvdsstisstsen  491
            MSPPLLG  E+G S++  +AS  ++D + QNG  LKEWNY+GLSDCSSVDSS +SS SE 
Sbjct  1    MSPPLLGGEEEGHSSL--VASSPTIDCISQNGSGLKEWNYLGLSDCSSVDSSAVSSLSEE  58

Query  492  nsGRGLNLRATELRLGLPGSQSPQRDSE----PSTKLDEKLLFPLHPAKESNFTLSQKTV  659
            N    LN +ATELRLGLPGSQSP+R+ E     S+KLDEK LFPL P+K+   + SQK V
Sbjct  59   NKNN-LNFKATELRLGLPGSQSPEREPELSLLGSSKLDEKQLFPLLPSKDGICSSSQKNV  117

Query  660  VTGNKRGFSDAMDEFSEGK  716
            V GNKRGFSD MD FSE K
Sbjct  118  VLGNKRGFSDTMDGFSEVK  136



>ref|XP_003544843.1| PREDICTED: auxin-responsive protein IAA9 [Glycine max]
 gb|KHN39979.1| Auxin-responsive protein IAA9 [Glycine soja]
Length=367

 Score =   120 bits (300),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 86/146 (59%), Positives = 104/146 (71%), Gaps = 9/146 (6%)
 Frame = +3

Query  312  MSPPLLGVGED-GQSNVTHM-ASPISLDSVCQNGPELKEWNYMGLsdcssvdsstissts  485
            MS PLLG+GE+ GQSNVT + +S + ++SVC N  +LKE NYMGLSDCSSVDSS  S + 
Sbjct  1    MSKPLLGIGEEEGQSNVTLLVSSSVIMESVCLNSSKLKERNYMGLSDCSSVDSSAPSFSD  60

Query  486  ennsGRGLNLRATELRLGLPGSQSPQRDSE----PSTKLDEKLLFPLHPAKESNFTLSQK  653
            E  S   LNL+ATELRLGLPG QSP+RDS+     S + DEK LFPLHPA + + + S K
Sbjct  61   ETKSN--LNLKATELRLGLPGLQSPERDSDLCLRSSIQFDEKPLFPLHPATDDHHS-SSK  117

Query  654  TVVTGNKRGFSDAMDEFSEGKFLSNS  731
              V GNKRGFSD M  F+E K L +S
Sbjct  118  PAVLGNKRGFSDVMSGFAEEKLLVSS  143



>ref|XP_010275506.1| PREDICTED: auxin-responsive protein IAA9 isoform X3 [Nelumbo 
nucifera]
 ref|XP_010275507.1| PREDICTED: auxin-responsive protein IAA9 isoform X3 [Nelumbo 
nucifera]
Length=388

 Score =   120 bits (300),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 95/139 (68%), Positives = 106/139 (76%), Gaps = 7/139 (5%)
 Frame = +3

Query  312  MSPPLLGVGEDGQSNVTHMASPISLDSVCQNGPELKEWNYMGLsdcssvdsstisstsen  491
            MSPPLLGVGE GQSNV+ ++S  S+D  CQNG  LKE NYMGLSDCSSVDSS IS  +E 
Sbjct  1    MSPPLLGVGE-GQSNVSVVSS-PSVDGSCQNGSGLKERNYMGLSDCSSVDSSAISGLAEE  58

Query  492  nsGRGLNLRATELRLGLPGSQSPQRDSEPST----KLDEKLLFPLHPAKESNFTLSQKTV  659
            N    LNL+ATELRLGLPGSQSP+RD E       KLDEK LFPL P+K+  ++ SQK V
Sbjct  59   NKS-SLNLKATELRLGLPGSQSPERDPELCLLNPGKLDEKPLFPLLPSKDGIYSSSQKAV  117

Query  660  VTGNKRGFSDAMDEFSEGK  716
            VTGNKRGFSDAMD FSE K
Sbjct  118  VTGNKRGFSDAMDNFSEVK  136



>ref|XP_003519213.1| PREDICTED: auxin-responsive protein IAA9-like [Glycine max]
 gb|KHN26175.1| Auxin-responsive protein IAA9 [Glycine soja]
Length=366

 Score =   119 bits (299),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 86/146 (59%), Positives = 104/146 (71%), Gaps = 9/146 (6%)
 Frame = +3

Query  312  MSPPLLGVGED-GQSNVTHM-ASPISLDSVCQNGPELKEWNYMGLsdcssvdsstissts  485
            MS PLLG+ E+ GQSNVT + +S  +++SVC N  +LKE NYMGLSDCSSVDSS  S + 
Sbjct  1    MSKPLLGIAEEEGQSNVTLLVSSSATMESVCLNSSKLKERNYMGLSDCSSVDSSAPSFSD  60

Query  486  ennsGRGLNLRATELRLGLPGSQSPQRDSE----PSTKLDEKLLFPLHPAKESNFTLSQK  653
            E  S   LNL+ATELRLGLPGSQSP+RDS+     S + DEK LFPLHPA + + + S K
Sbjct  61   ETKSN--LNLKATELRLGLPGSQSPERDSDLCLRSSIQFDEKPLFPLHPATDEHHS-SSK  117

Query  654  TVVTGNKRGFSDAMDEFSEGKFLSNS  731
              V GNKRGFSD M  F+E K L +S
Sbjct  118  PAVLGNKRGFSDVMSGFAEEKLLVSS  143



>gb|KHN09036.1| Auxin-responsive protein IAA8 [Glycine soja]
Length=361

 Score =   119 bits (299),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 88/147 (60%), Positives = 106/147 (72%), Gaps = 10/147 (7%)
 Frame = +3

Query  312  MSPPLLGVGED-GQSNVTHM-ASPISLDSVCQNGPELKEWNYMGLsdcssvdsstissts  485
            MSPP+L +GE+ G+SNVT + +S  +++SVC    E KE NYMGLSDCSSVDSS  S + 
Sbjct  1    MSPPVLSIGEEEGKSNVTLLVSSSTTMESVCLKSLEFKERNYMGLSDCSSVDSSVPSFSE  60

Query  486  ennsGRGLNLRATELRLGLPGSQSPQRDSE----PSTKLDEKLLFPLHPAKESNFTLSQK  653
            E  S   LNL+ATELRLGLPGSQSP RDS+     ST+ DEK LFPL P  + + + S K
Sbjct  61   ETKSN--LNLKATELRLGLPGSQSPDRDSDLCLRSSTQFDEKTLFPLRPLTDDHHS-SAK  117

Query  654  TVVTGNKRGFSDAMDEF-SEGKFLSNS  731
            T V GNKRGFSDAM+ F SEGKFL +S
Sbjct  118  TAVLGNKRGFSDAMNGFSSEGKFLVDS  144



>ref|XP_008236708.1| PREDICTED: auxin-responsive protein IAA9 [Prunus mume]
 ref|XP_008236714.1| PREDICTED: auxin-responsive protein IAA9 [Prunus mume]
 ref|XP_008236721.1| PREDICTED: auxin-responsive protein IAA9 [Prunus mume]
 ref|XP_008236728.1| PREDICTED: auxin-responsive protein IAA9 [Prunus mume]
Length=378

 Score =   119 bits (297),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 86/139 (62%), Positives = 102/139 (73%), Gaps = 5/139 (4%)
 Frame = +3

Query  312  MSPPLLGVGEDGQSNVTHMASPISLDSVCQNGPELKEWNYMGLsdcssvdsstisstsen  491
            MSPPLLG  E+GQSN + +AS  S+D +  NG  LKE NY+GLSDCSSVDSST+SS SE 
Sbjct  1    MSPPLLGGEEEGQSNGSMVASSRSMDCISHNGSGLKERNYLGLSDCSSVDSSTVSSLSEE  60

Query  492  nsGRGLNLRATELRLGLPGSQSPQRDSE----PSTKLDEKLLFPLHPAKESNFTLSQKTV  659
               + LN +ATELRLGLPGSQSP+R  +     S KLDEK LFPL P+K+   + SQK V
Sbjct  61   KKNK-LNFQATELRLGLPGSQSPERVPDLCLLSSGKLDEKPLFPLLPSKDGICSSSQKNV  119

Query  660  VTGNKRGFSDAMDEFSEGK  716
            V+GNKRGF+D MD FSE K
Sbjct  120  VSGNKRGFADTMDGFSEVK  138



>ref|XP_007047688.1| Transcription factor, putative isoform 2 [Theobroma cacao]
 gb|EOX91845.1| Transcription factor, putative isoform 2 [Theobroma cacao]
Length=374

 Score =   119 bits (297),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 91/139 (65%), Positives = 105/139 (76%), Gaps = 9/139 (6%)
 Frame = +3

Query  312  MSPPLLGVGEDGQSNVTHMASPISLDSVCQNGPELKEWNYMGLsdcssvdsstisstsen  491
            MS PLLGV E+GQSNV+   SP S D + QNG  LKE NY+GLSDCSSVDSS +SS +E+
Sbjct  1    MSQPLLGVEEEGQSNVS---SP-SDDCISQNGLGLKERNYLGLSDCSSVDSSGVSSLTED  56

Query  492  nsGRGLNLRATELRLGLPGSQSPQRDSE----PSTKLDEKLLFPLHPAKESNFTLSQKTV  659
            N    LNL+ATELRLGLPGSQSP+R+ E     S KLDEK LFPL P+K+   + SQKTV
Sbjct  57   NKNN-LNLKATELRLGLPGSQSPEREPELCLLNSGKLDEKPLFPLLPSKDGICSSSQKTV  115

Query  660  VTGNKRGFSDAMDEFSEGK  716
            V+GNKRGFSD MD FSE K
Sbjct  116  VSGNKRGFSDTMDGFSEVK  134



>ref|XP_007205358.1| hypothetical protein PRUPE_ppa007194mg [Prunus persica]
 ref|XP_007205359.1| hypothetical protein PRUPE_ppa007194mg [Prunus persica]
 gb|EMJ06557.1| hypothetical protein PRUPE_ppa007194mg [Prunus persica]
 gb|EMJ06558.1| hypothetical protein PRUPE_ppa007194mg [Prunus persica]
Length=378

 Score =   119 bits (297),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 84/139 (60%), Positives = 103/139 (74%), Gaps = 5/139 (4%)
 Frame = +3

Query  312  MSPPLLGVGEDGQSNVTHMASPISLDSVCQNGPELKEWNYMGLsdcssvdsstisstsen  491
            MSPPLLG  E+GQSN + +AS  S+D +  NG  LKE NY+GLSDCSSVDSST+SS SE 
Sbjct  1    MSPPLLGGEEEGQSNGSMVASSRSMDCISHNGSGLKERNYLGLSDCSSVDSSTVSSLSEE  60

Query  492  nsGRGLNLRATELRLGLPGSQSPQRDSE----PSTKLDEKLLFPLHPAKESNFTLSQKTV  659
               + LN +ATELRLGLPGSQ+P+R+ +     S KLDEK LFPL P+K+   + SQK V
Sbjct  61   KKNK-LNFQATELRLGLPGSQTPEREPDLCLLSSGKLDEKPLFPLLPSKDGICSSSQKNV  119

Query  660  VTGNKRGFSDAMDEFSEGK  716
            V+GNKRGF+D MD +SE K
Sbjct  120  VSGNKRGFADTMDGYSEVK  138



>ref|XP_007047687.1| Transcription factor, putative isoform 1 [Theobroma cacao]
 gb|EOX91844.1| Transcription factor, putative isoform 1 [Theobroma cacao]
Length=376

 Score =   118 bits (296),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 91/139 (65%), Positives = 105/139 (76%), Gaps = 9/139 (6%)
 Frame = +3

Query  312  MSPPLLGVGEDGQSNVTHMASPISLDSVCQNGPELKEWNYMGLsdcssvdsstisstsen  491
            MS PLLGV E+GQSNV+   SP S D + QNG  LKE NY+GLSDCSSVDSS +SS +E+
Sbjct  1    MSQPLLGVEEEGQSNVS---SP-SDDCISQNGLGLKERNYLGLSDCSSVDSSGVSSLTED  56

Query  492  nsGRGLNLRATELRLGLPGSQSPQRDSE----PSTKLDEKLLFPLHPAKESNFTLSQKTV  659
            N    LNL+ATELRLGLPGSQSP+R+ E     S KLDEK LFPL P+K+   + SQKTV
Sbjct  57   NKNN-LNLKATELRLGLPGSQSPEREPELCLLNSGKLDEKPLFPLLPSKDGICSSSQKTV  115

Query  660  VTGNKRGFSDAMDEFSEGK  716
            V+GNKRGFSD MD FSE K
Sbjct  116  VSGNKRGFSDTMDGFSEVK  134



>ref|XP_007047690.1| Transcription factor, putative isoform 4 [Theobroma cacao]
 gb|EOX91847.1| Transcription factor, putative isoform 4 [Theobroma cacao]
Length=372

 Score =   118 bits (296),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 91/139 (65%), Positives = 105/139 (76%), Gaps = 9/139 (6%)
 Frame = +3

Query  312  MSPPLLGVGEDGQSNVTHMASPISLDSVCQNGPELKEWNYMGLsdcssvdsstisstsen  491
            MS PLLGV E+GQSNV+   SP S D + QNG  LKE NY+GLSDCSSVDSS +SS +E+
Sbjct  1    MSQPLLGVEEEGQSNVS---SP-SDDCISQNGLGLKERNYLGLSDCSSVDSSGVSSLTED  56

Query  492  nsGRGLNLRATELRLGLPGSQSPQRDSE----PSTKLDEKLLFPLHPAKESNFTLSQKTV  659
            N    LNL+ATELRLGLPGSQSP+R+ E     S KLDEK LFPL P+K+   + SQKTV
Sbjct  57   NKNN-LNLKATELRLGLPGSQSPEREPELCLLNSGKLDEKPLFPLLPSKDGICSSSQKTV  115

Query  660  VTGNKRGFSDAMDEFSEGK  716
            V+GNKRGFSD MD FSE K
Sbjct  116  VSGNKRGFSDTMDGFSEVK  134



>ref|XP_003517136.1| PREDICTED: auxin-responsive protein IAA9 isoform X1 [Glycine 
max]
 ref|XP_006572983.1| PREDICTED: auxin-responsive protein IAA9 isoform X2 [Glycine 
max]
Length=359

 Score =   118 bits (295),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 82/149 (55%), Positives = 101/149 (68%), Gaps = 8/149 (5%)
 Frame = +3

Query  309  LMSPPLLGVGEDGQSNVTHMA---SPISLDSVCQNGPELKEWNYMGLsdcssvdsstiss  479
            +MSPP +   E+G+SNV+      S  SLD   QNG  LKE NY+GLSDCSSVDSS  + 
Sbjct  1    MMSPPAVVTEEEGRSNVSSTVASGSSQSLDRFSQNGAGLKERNYLGLSDCSSVDSSASTV  60

Query  480  tsennsGR-GLNLRATELRLGLPGSQSPQRD----SEPSTKLDEKLLFPLHPAKESNFTL  644
             S  +  +  +NL+ATELRLGLPGSQSP+R+    S    KLDEK LFPL P K+     
Sbjct  61   PSLCDEKKENMNLKATELRLGLPGSQSPEREPDLFSLSPAKLDEKPLFPLLPTKDGICLS  120

Query  645  SQKTVVTGNKRGFSDAMDEFSEGKFLSNS  731
            +QKTVV+GNKRGF+D MD FS+GKF  N+
Sbjct  121  AQKTVVSGNKRGFADTMDGFSQGKFAGNT  149



>emb|CDP02673.1| unnamed protein product [Coffea canephora]
Length=374

 Score =   117 bits (293),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 76/139 (55%), Positives = 95/139 (68%), Gaps = 6/139 (4%)
 Frame = +3

Query  312  MSPPLLGVGEDGQSNVTHMASPISLDSVCQNGPELKEWNYMGLsdcssvdsstisstsen  491
            MSPPLLG+  +GQ NV+ MAS  S+D V  NG  LKE NY+GLSD S   +S  + + E 
Sbjct  1    MSPPLLGIEGEGQGNVSVMASSKSVDCVSNNGLGLKERNYLGLSDSSEESTSMSTVSKEK  60

Query  492  nsGRGLNLRATELRLGLPGSQSPQRDSE----PSTKLDEKLLFPLHPAKESNFTLSQKTV  659
             S   LNL+AT+LRLGLPGSQSP+R+SE     S K DEK LFPL P+K+   +   K+V
Sbjct  61   KS--SLNLKATDLRLGLPGSQSPERESELNLLSSDKFDEKPLFPLLPSKDGICSSIHKSV  118

Query  660  VTGNKRGFSDAMDEFSEGK  716
            V+GNKR FSD +DE+S  K
Sbjct  119  VSGNKRVFSDTIDEYSTVK  137



>ref|XP_007158315.1| hypothetical protein PHAVU_002G142500g [Phaseolus vulgaris]
 ref|XP_007158316.1| hypothetical protein PHAVU_002G142500g [Phaseolus vulgaris]
 gb|AGV54410.1| auxin-responsive protein IAA8 [Phaseolus vulgaris]
 gb|ESW30309.1| hypothetical protein PHAVU_002G142500g [Phaseolus vulgaris]
 gb|ESW30310.1| hypothetical protein PHAVU_002G142500g [Phaseolus vulgaris]
Length=350

 Score =   117 bits (292),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 80/142 (56%), Positives = 94/142 (66%), Gaps = 8/142 (6%)
 Frame = +3

Query  312  MSPPLLGVGEDGQSNVTHM---ASPISLDSVCQNGPELKEWNYMGLsdcssvdsstisst  482
            MSPP +   EDG S V+      S  SLD   QNG  LKE NY+GLSDCSSVDS   +  
Sbjct  1    MSPPAVVTEEDGLSKVSSTLASGSSQSLDCFSQNGAGLKERNYLGLSDCSSVDSCASTVP  60

Query  483  sennsGR-GLNLRATELRLGLPGSQSPQRD----SEPSTKLDEKLLFPLHPAKESNFTLS  647
               +  +  +NL+ATELRLGLPGSQSP+RD    S  S K+DEK LFPL P K+  F  S
Sbjct  61   GLGDEKKENMNLKATELRLGLPGSQSPERDPDLFSLSSAKIDEKPLFPLGPTKDGIFLSS  120

Query  648  QKTVVTGNKRGFSDAMDEFSEG  713
            QKTVV+GNKRGF+D MD FS+G
Sbjct  121  QKTVVSGNKRGFADTMDAFSQG  142



>ref|NP_001241389.1| uncharacterized protein LOC100783314 [Glycine max]
 ref|XP_006577803.1| PREDICTED: uncharacterized protein LOC100783314 isoform X1 [Glycine 
max]
 gb|ACU23462.1| unknown [Glycine max]
Length=360

 Score =   116 bits (291),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 87/144 (60%), Positives = 105/144 (73%), Gaps = 10/144 (7%)
 Frame = +3

Query  312  MSPPLLGVGED-GQSNVTHM-ASPISLDSVCQNGPELKEWNYMGLsdcssvdsstissts  485
            MSPP+L +GE+ G+SNVT + +S  +++SVC    E KE NYMG SDCSSVDSS  S + 
Sbjct  1    MSPPVLSMGEEEGKSNVTLLGSSSTAMESVCLKSLEFKERNYMGSSDCSSVDSSVPSFSE  60

Query  486  ennsGRGLNLRATELRLGLPGSQSPQRDSE----PSTKLDEKLLFPLHPAKESNFTLSQK  653
            E  S   LNL+ATELRLGLPGSQSP+RDS+     ST+LDEK LFPLHP  + + + S K
Sbjct  61   ECKSN--LNLKATELRLGLPGSQSPERDSDLCLRSSTQLDEKPLFPLHPLTDDHHS-SAK  117

Query  654  TVVTGNKRGFSDAMDEF-SEGKFL  722
            T V GNKRGFSDAM+   SEGKFL
Sbjct  118  TAVLGNKRGFSDAMNGLSSEGKFL  141



>ref|XP_011464769.1| PREDICTED: auxin-responsive protein IAA8-like isoform X2 [Fragaria 
vesca subsp. vesca]
Length=331

 Score =   115 bits (289),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 78/115 (68%), Positives = 88/115 (77%), Gaps = 9/115 (8%)
 Frame = +3

Query  384  LDSVCQNGPELKEWNYMGLsdcssvdsstisstsennsGRGLNLRATELRLGLPGSQSPQ  563
            +DSVC N  +LKE NYMGLSDCSSVDSS  S    + S   LNL ATELRLGLPGSQSP+
Sbjct  1    MDSVCPNSSDLKERNYMGLSDCSSVDSSKGSDVDGSKSR--LNLMATELRLGLPGSQSPE  58

Query  564  RDSE---PSTKLDEKLLFPLHPAKESNFTLSQKTVVTGNKRGFSDAMDEFSEGKF  719
            R+SE    ST+ DEK LFPLHP K+S     QKT+V+GNKRGFSDAMDEFSEGK+
Sbjct  59   RNSELRLISTQPDEKPLFPLHPVKDS----LQKTIVSGNKRGFSDAMDEFSEGKY  109



>gb|ACU19961.1| unknown [Glycine max]
Length=235

 Score =   113 bits (283),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 80/145 (55%), Positives = 97/145 (67%), Gaps = 6/145 (4%)
 Frame = +3

Query  312  MSPPLLGVGEDGQSNVTHMASPISLDSVCQNGPELKEWNYMGLsdcssvdsstisstsen  491
            MSPP L   E+G+S V   +S  SLD   QNG  LKE NY+GLSDCSSVDS   +  S  
Sbjct  1    MSPPTLVTEEEGRSTVASDSS-QSLDCFSQNGAGLKERNYLGLSDCSSVDSCASTVPSLC  59

Query  492  nsGR-GLNLRATELRLGLPGSQSPQRD----SEPSTKLDEKLLFPLHPAKESNFTLSQKT  656
            +  +  +NL+ATELRLGLPG QSP+R+    S  S KLDEK LFPL P K+   +  QK 
Sbjct  60   DEKKENMNLKATELRLGLPGFQSPEREPDLFSLSSPKLDEKPLFPLLPTKDGICSSGQKA  119

Query  657  VVTGNKRGFSDAMDEFSEGKFLSNS  731
            VV+GNKRGF+D MD FS+GKF  N+
Sbjct  120  VVSGNKRGFADTMDGFSQGKFAGNT  144



>ref|XP_002528895.1| transcription factor, putative [Ricinus communis]
 gb|EEF33475.1| transcription factor, putative [Ricinus communis]
Length=382

 Score =   115 bits (288),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 89/141 (63%), Positives = 104/141 (74%), Gaps = 7/141 (5%)
 Frame = +3

Query  312  MSPPLLGVGEDGQSNVTHMASPISLDSVCQNGPELKEWNYMGLsdcssvdsstisstsen  491
            MSPPLLGV + GQS V+ +AS  S+D + QNG  LKE NY+GLSDCSSVDSS + S SE 
Sbjct  1    MSPPLLGVEDGGQSKVSLVASSPSVDCISQNGCRLKERNYLGLSDCSSVDSSAVPSLSEE  60

Query  492  nsGRGLNLRATELRLGLPGSQSPQRDSEPST----KLDEKLLFPLHPAKESN--FTLSQK  653
            N+   LNL+ATELRLGLPGS SP+RD+E S     KLDEK LFPL P K+ +   +L QK
Sbjct  61   NN-NNLNLKATELRLGLPGSLSPERDTEVSLLISGKLDEKPLFPLLPLKDGHGICSLPQK  119

Query  654  TVVTGNKRGFSDAMDEFSEGK  716
             VV+GNKRGFSD MD FSE K
Sbjct  120  HVVSGNKRGFSDTMDGFSEVK  140



>gb|KHN08222.1| Auxin-responsive protein IAA8 [Glycine soja]
Length=360

 Score =   114 bits (286),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 86/144 (60%), Positives = 104/144 (72%), Gaps = 10/144 (7%)
 Frame = +3

Query  312  MSPPLLGVGED-GQSNVTHM-ASPISLDSVCQNGPELKEWNYMGLsdcssvdsstissts  485
            MSPP+L +GE+ G+SNVT + +S  +++SVC    E KE NYMG SDCSSVDSS  S + 
Sbjct  1    MSPPVLSMGEEEGKSNVTLLGSSSTAMESVCLKSLEFKERNYMGSSDCSSVDSSVPSFSE  60

Query  486  ennsGRGLNLRATELRLGLPGSQSPQRDSE----PSTKLDEKLLFPLHPAKESNFTLSQK  653
            E  S   LNL+ATELRLGLPGSQSP+RDS+     ST+LDEK LFPLHP  + + + S K
Sbjct  61   ECKSN--LNLKATELRLGLPGSQSPERDSDLCLRSSTQLDEKPLFPLHPLTDDHHS-SAK  117

Query  654  TVVTGNKRGFSDAMDEF-SEGKFL  722
              V GNKRGFSDAM+   SEGKFL
Sbjct  118  IAVLGNKRGFSDAMNGLSSEGKFL  141



>ref|XP_004490496.1| PREDICTED: auxin-responsive protein IAA9-like [Cicer arietinum]
Length=362

 Score =   114 bits (286),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 77/149 (52%), Positives = 97/149 (65%), Gaps = 13/149 (9%)
 Frame = +3

Query  312  MSPPLLGVG-EDGQSNVTHM-ASPISLDSVCQN--GPELKEWNYMGLsdcssvdssti--  473
            MS P LG+G E+G+SNVT + +S  +++SVC N    + KE+NYMGLS  SS  S     
Sbjct  1    MSLPRLGIGDEEGESNVTLLVSSSTTMESVCLNVSKSKPKEFNYMGLSCDSSSSSVESSV  60

Query  474  -sstsennsGRGLNLRATELRLGLPGSQSPQRDS------EPSTKLDEKLLFPLHPAKES  632
               +  + +   LNL+ATELRLG+PGSQSP+RDS        STK DEK LFPLHP K+ 
Sbjct  61   PIQSFSDETKSNLNLKATELRLGIPGSQSPERDSSSDLCLRSSTKFDEKTLFPLHPQKDD  120

Query  633  NFTLSQKTVVTGNKRGFSDAMDEFSEGKF  719
            +   S K  V G+KRGFSDAM+ FSEGK 
Sbjct  121  HHLSSPKVAVLGSKRGFSDAMNVFSEGKL  149



>ref|XP_006426197.1| hypothetical protein CICLE_v10025873mg [Citrus clementina]
 ref|XP_006426198.1| hypothetical protein CICLE_v10025873mg [Citrus clementina]
 gb|ESR39437.1| hypothetical protein CICLE_v10025873mg [Citrus clementina]
 gb|ESR39438.1| hypothetical protein CICLE_v10025873mg [Citrus clementina]
Length=376

 Score =   114 bits (286),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 87/140 (62%), Positives = 102/140 (73%), Gaps = 7/140 (5%)
 Frame = +3

Query  312  MSPPLL-GVGEDGQSNVTHMASPISLDSVCQNGPELKEWNYMGLsdcssvdsstisstse  488
            MSPPLL GV E+GQSNV+ MAS  S D + QN   L+E NY+GLSDCSSVDSS  SS   
Sbjct  1    MSPPLLLGVEEEGQSNVSLMASSPS-DCISQNVSGLQERNYLGLSDCSSVDSSAASSLPV  59

Query  489  nnsGRGLNLRATELRLGLPGSQSPQRDSE----PSTKLDEKLLFPLHPAKESNFTLSQKT  656
            +N  + LNL+ATELRLGLPGS+SP+R+ +     S KLDEK LFPL P+K+     SQK 
Sbjct  60   DNKNK-LNLKATELRLGLPGSESPEREPDLSLLSSGKLDEKPLFPLLPSKDGICPGSQKN  118

Query  657  VVTGNKRGFSDAMDEFSEGK  716
            VV+GNKRGFSD MD FSE K
Sbjct  119  VVSGNKRGFSDTMDRFSEVK  138



>ref|XP_006466369.1| PREDICTED: auxin-responsive protein IAA9-like [Citrus sinensis]
 gb|KDO78726.1| hypothetical protein CISIN_1g017170mg [Citrus sinensis]
Length=376

 Score =   114 bits (286),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 87/140 (62%), Positives = 102/140 (73%), Gaps = 7/140 (5%)
 Frame = +3

Query  312  MSPPLL-GVGEDGQSNVTHMASPISLDSVCQNGPELKEWNYMGLsdcssvdsstisstse  488
            MSPPLL GV E+GQSNV+ MAS  S D + QN   L+E NY+GLSDCSSVDSS  SS   
Sbjct  1    MSPPLLLGVEEEGQSNVSLMASSPS-DCISQNVSGLQERNYLGLSDCSSVDSSAASSLPV  59

Query  489  nnsGRGLNLRATELRLGLPGSQSPQRDSE----PSTKLDEKLLFPLHPAKESNFTLSQKT  656
            +N  + LNL+ATELRLGLPGS+SP+R+ +     S KLDEK LFPL P+K+     SQK 
Sbjct  60   DNKNK-LNLKATELRLGLPGSESPEREPDLSLLSSGKLDEKPLFPLLPSKDGICPGSQKN  118

Query  657  VVTGNKRGFSDAMDEFSEGK  716
            VV+GNKRGFSD MD FSE K
Sbjct  119  VVSGNKRGFSDTMDRFSEVK  138



>ref|XP_003534264.1| PREDICTED: auxin-responsive protein IAA9 [Glycine max]
 gb|KHN38914.1| Auxin-responsive protein IAA8 [Glycine soja]
Length=354

 Score =   114 bits (284),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 80/145 (55%), Positives = 97/145 (67%), Gaps = 6/145 (4%)
 Frame = +3

Query  312  MSPPLLGVGEDGQSNVTHMASPISLDSVCQNGPELKEWNYMGLsdcssvdsstisstsen  491
            MSPP L   E+G+S V   +S  SLD   QNG  LKE NY+GLSDCSSVDS   +  S  
Sbjct  1    MSPPTLVTEEEGRSTVASDSSQ-SLDCFSQNGAGLKERNYLGLSDCSSVDSCASTVPSLC  59

Query  492  nsGR-GLNLRATELRLGLPGSQSPQRD----SEPSTKLDEKLLFPLHPAKESNFTLSQKT  656
            +  +  +NL+ATELRLGLPG QSP+R+    S  S KLDEK LFPL P K+   +  QK 
Sbjct  60   DEKKENMNLKATELRLGLPGFQSPEREPDLFSLSSPKLDEKPLFPLLPTKDGICSSGQKA  119

Query  657  VVTGNKRGFSDAMDEFSEGKFLSNS  731
            VV+GNKRGF+D MD FS+GKF  N+
Sbjct  120  VVSGNKRGFADTMDGFSQGKFAGNT  144



>gb|KJB71171.1| hypothetical protein B456_011G109000 [Gossypium raimondii]
Length=289

 Score =   113 bits (282),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 77/142 (54%), Positives = 101/142 (71%), Gaps = 13/142 (9%)
 Frame = +3

Query  312  MSPPLLGVGEDGQSNVTHMASPISLDSVCQNGPELKEWNYMGLsdcssvdsstisstsen  491
            MSP LLGV E+GQ   T ++SP S++ + QNG  ++EWNY+GLSD  SVDSS +   +  
Sbjct  1    MSPLLLGVEEEGQ---TRVSSP-SVECISQNGLGIREWNYLGLSDFCSVDSSGVPDDN--  54

Query  492  nsGRGLNLRATELRLGLPGSQSPQRDSE----PSTKLDEKLLFPLHPAKESNFTLSQKTV  659
              G  LNL+ATELRLGLPGSQSP+R++E     S KLDEK LFPL P+K+   + SQK+V
Sbjct  55   --GNNLNLKATELRLGLPGSQSPERETELCFLNSGKLDEKTLFPLLPSKDGICSSSQKSV  112

Query  660  VTGNKRGFSDAMDE-FSEGKFL  722
            VTGNKRGFS+     ++E K++
Sbjct  113  VTGNKRGFSEVKGTIYTEKKWM  134



>gb|KJB71165.1| hypothetical protein B456_011G109000 [Gossypium raimondii]
 gb|KJB71170.1| hypothetical protein B456_011G109000 [Gossypium raimondii]
Length=352

 Score =   113 bits (282),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 77/142 (54%), Positives = 101/142 (71%), Gaps = 13/142 (9%)
 Frame = +3

Query  312  MSPPLLGVGEDGQSNVTHMASPISLDSVCQNGPELKEWNYMGLsdcssvdsstisstsen  491
            MSP LLGV E+GQ   T ++SP S++ + QNG  ++EWNY+GLSD  SVDSS +   +  
Sbjct  1    MSPLLLGVEEEGQ---TRVSSP-SVECISQNGLGIREWNYLGLSDFCSVDSSGVPDDN--  54

Query  492  nsGRGLNLRATELRLGLPGSQSPQRDSE----PSTKLDEKLLFPLHPAKESNFTLSQKTV  659
              G  LNL+ATELRLGLPGSQSP+R++E     S KLDEK LFPL P+K+   + SQK+V
Sbjct  55   --GNNLNLKATELRLGLPGSQSPERETELCFLNSGKLDEKTLFPLLPSKDGICSSSQKSV  112

Query  660  VTGNKRGFSDAMDE-FSEGKFL  722
            VTGNKRGFS+     ++E K++
Sbjct  113  VTGNKRGFSEVKGTIYTEKKWM  134



>gb|KJB71172.1| hypothetical protein B456_011G109000 [Gossypium raimondii]
Length=344

 Score =   113 bits (282),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 77/142 (54%), Positives = 101/142 (71%), Gaps = 13/142 (9%)
 Frame = +3

Query  312  MSPPLLGVGEDGQSNVTHMASPISLDSVCQNGPELKEWNYMGLsdcssvdsstisstsen  491
            MSP LLGV E+GQ   T ++SP S++ + QNG  ++EWNY+GLSD  SVDSS +   +  
Sbjct  1    MSPLLLGVEEEGQ---TRVSSP-SVECISQNGLGIREWNYLGLSDFCSVDSSGVPDDN--  54

Query  492  nsGRGLNLRATELRLGLPGSQSPQRDSE----PSTKLDEKLLFPLHPAKESNFTLSQKTV  659
              G  LNL+ATELRLGLPGSQSP+R++E     S KLDEK LFPL P+K+   + SQK+V
Sbjct  55   --GNNLNLKATELRLGLPGSQSPERETELCFLNSGKLDEKTLFPLLPSKDGICSSSQKSV  112

Query  660  VTGNKRGFSDAMDE-FSEGKFL  722
            VTGNKRGFS+     ++E K++
Sbjct  113  VTGNKRGFSEVKGTIYTEKKWM  134



>gb|KJB71166.1| hypothetical protein B456_011G109000 [Gossypium raimondii]
 gb|KJB71167.1| hypothetical protein B456_011G109000 [Gossypium raimondii]
 gb|KJB71168.1| hypothetical protein B456_011G109000 [Gossypium raimondii]
 gb|KJB71169.1| hypothetical protein B456_011G109000 [Gossypium raimondii]
Length=351

 Score =   113 bits (282),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 77/142 (54%), Positives = 101/142 (71%), Gaps = 13/142 (9%)
 Frame = +3

Query  312  MSPPLLGVGEDGQSNVTHMASPISLDSVCQNGPELKEWNYMGLsdcssvdsstisstsen  491
            MSP LLGV E+GQ   T ++SP S++ + QNG  ++EWNY+GLSD  SVDSS +   +  
Sbjct  1    MSPLLLGVEEEGQ---TRVSSP-SVECISQNGLGIREWNYLGLSDFCSVDSSGVPDDN--  54

Query  492  nsGRGLNLRATELRLGLPGSQSPQRDSE----PSTKLDEKLLFPLHPAKESNFTLSQKTV  659
              G  LNL+ATELRLGLPGSQSP+R++E     S KLDEK LFPL P+K+   + SQK+V
Sbjct  55   --GNNLNLKATELRLGLPGSQSPERETELCFLNSGKLDEKTLFPLLPSKDGICSSSQKSV  112

Query  660  VTGNKRGFSDAMDE-FSEGKFL  722
            VTGNKRGFS+     ++E K++
Sbjct  113  VTGNKRGFSEVKGTIYTEKKWM  134



>gb|AAM12952.1| auxin-regulated protein [Zinnia violacea]
Length=351

 Score =   113 bits (282),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 79/141 (56%), Positives = 97/141 (69%), Gaps = 8/141 (6%)
 Frame = +3

Query  312  MSPPLLGVGEDGQSNVTHMASPISLDSVCQNGPELKEWNYMGLsdcssvdsstisstsen  491
            M PPLLGV  DG  NV+ M S  +++S+ Q   EL E NY+GLSDCSS DS+ +S  SE 
Sbjct  1    MPPPLLGVEGDGLGNVSLMTSASTMESIFQKNAELTERNYLGLSDCSSFDSTAVSGISEV  60

Query  492  nsGRGLNLRATELRLGLPGSQSPQRDSEP----STKLDEKLLFPLHPAKESNFTLSQKTV  659
                 LNL+ATELRLGLPGSQSP+RD +     S  LDEK LFPL P+K+   + SQK  
Sbjct  61   KRNN-LNLKATELRLGLPGSQSPERDVDVDLVNSESLDEKPLFPLLPSKDGICSNSQKVF  119

Query  660  VTGNKRGFSDAMDEFSEGKFL  722
            V+GNKRGFSDA+D   EGK++
Sbjct  120  VSGNKRGFSDAID---EGKWM  137



>gb|KHG08881.1| Auxin-responsive IAA9 -like protein [Gossypium arboreum]
Length=351

 Score =   112 bits (280),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 78/142 (55%), Positives = 101/142 (71%), Gaps = 13/142 (9%)
 Frame = +3

Query  312  MSPPLLGVGEDGQSNVTHMASPISLDSVCQNGPELKEWNYMGLsdcssvdsstisstsen  491
            MSPPLLGV E+GQS V+   SP S++ + QNG  ++E NY+GLSD  SVDSS +   +  
Sbjct  1    MSPPLLGVEEEGQSRVS---SP-SVECISQNGLGIRERNYLGLSDFCSVDSSGVPDDN--  54

Query  492  nsGRGLNLRATELRLGLPGSQSPQRDSEP----STKLDEKLLFPLHPAKESNFTLSQKTV  659
              G  LNL+ATELRLGLPGSQSP+R++E     S KLDEK LFPL P+K+   + SQK+V
Sbjct  55   --GNNLNLKATELRLGLPGSQSPERETEHCFLNSGKLDEKTLFPLLPSKDGICSSSQKSV  112

Query  660  VTGNKRGFSDAMDE-FSEGKFL  722
            VTGNKRGFS+     ++E K++
Sbjct  113  VTGNKRGFSEVKGTIYTEKKWM  134



>ref|XP_004288310.1| PREDICTED: auxin-responsive protein IAA9 [Fragaria vesca subsp. 
vesca]
 ref|XP_011466548.1| PREDICTED: auxin-responsive protein IAA9 [Fragaria vesca subsp. 
vesca]
Length=370

 Score =   110 bits (276),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 83/135 (61%), Positives = 99/135 (73%), Gaps = 2/135 (1%)
 Frame = +3

Query  312  MSPPLLGVGEDGQSNVTHMASPISLDSVCQNGPELKEWNYMGLsdcssvdsstisstsen  491
            MSPPLLG   +G+SN + +A   S++ + QN   LKE NY+GLSDCSSVDSST+SS SE 
Sbjct  1    MSPPLLGGEGEGKSNGSMVACSPSMEMIPQNSSGLKERNYLGLSDCSSVDSSTVSSLSEE  60

Query  492  nsGRGLNLRATELRLGLPGSQSPQRDSEPSTKLDEKLLFPLHPAKESNFTLSQKTVVTGN  671
            N  +  N +ATELRLGLPGSQSP+R SE    LDEK LFPL P+K+   + SQK VV+GN
Sbjct  61   NKSK-FNFKATELRLGLPGSQSPERQSELCL-LDEKPLFPLLPSKDGICSSSQKNVVSGN  118

Query  672  KRGFSDAMDEFSEGK  716
            KRGFSD MD FSE K
Sbjct  119  KRGFSDTMDGFSEVK  133



>ref|XP_010254653.1| PREDICTED: auxin-responsive protein IAA9-like [Nelumbo nucifera]
Length=386

 Score =   111 bits (277),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 91/139 (65%), Positives = 100/139 (72%), Gaps = 6/139 (4%)
 Frame = +3

Query  312  MSPPLLGVGEDGQSNVTHMASPISLDSVCQNGPELKEWNYMGLsdcssvdsstisstsen  491
            MSPPLL V E   SNVT + S  S+DS CQN   L+E NYMGLSDCSSVDSS IS  SE 
Sbjct  1    MSPPLLNVVER-PSNVTLVPSSPSVDSSCQNVSGLRERNYMGLSDCSSVDSSAISGLSEE  59

Query  492  nsGRGLNLRATELRLGLPGSQSPQRDSEPST----KLDEKLLFPLHPAKESNFTLSQKTV  659
            N    LNL+ATELRLGLPGSQSP+R SE       KLDEK LFPL P+K+   + SQK V
Sbjct  60   NKS-SLNLKATELRLGLPGSQSPERGSELCLLSPGKLDEKPLFPLLPSKDGICSSSQKAV  118

Query  660  VTGNKRGFSDAMDEFSEGK  716
            V+GNKRGFSDAMD FSE K
Sbjct  119  VSGNKRGFSDAMDGFSEMK  137



>emb|CBI19314.3| unnamed protein product [Vitis vinifera]
Length=318

 Score =   109 bits (273),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 57/79 (72%), Positives = 66/79 (84%), Gaps = 4/79 (5%)
 Frame = +3

Query  507  LNLRATELRLGLPGSQSPQRDSE----PSTKLDEKLLFPLHPAKESNFTLSQKTVVTGNK  674
            LNL+ATELRLGLPGS SP R+ E     STKLDEK LFPLHP+K+  +T SQKTVV+GNK
Sbjct  25   LNLKATELRLGLPGSLSPGREPELCLLSSTKLDEKPLFPLHPSKDLTYTSSQKTVVSGNK  84

Query  675  RGFSDAMDEFSEGKFLSNS  731
            RGF+DAM+ FSEGKFL+NS
Sbjct  85   RGFADAMNGFSEGKFLANS  103



>gb|EYU44549.1| hypothetical protein MIMGU_mgv1a010252mg [Erythranthe guttata]
Length=306

 Score =   108 bits (271),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 75/132 (57%), Positives = 91/132 (69%), Gaps = 7/132 (5%)
 Frame = +3

Query  312  MSPPLLGVGEDGQSNVTHMASPISLDSVCQNGPELKEWNYMGLsdcssvdsstisstsen  491
            MSPPLLG+    Q+NV+ MAS  S D V QN   LKE NY+GLSDCSSVDSST+  T   
Sbjct  1    MSPPLLGIEGHNQANVSPMASSSSTDCVSQNVSCLKERNYLGLSDCSSVDSSTVMLTVPA  60

Query  492  nsGRGLNLRATELRLGLPGSQSPQRDSEPSTKLDEKLLFPLHPAKESNFTLSQKTVVTGN  671
            +    LNL+ATELRLGLPGS SP R+SE S  +DEK LFPL P+K+  F+       +GN
Sbjct  61   DPKSNLNLKATELRLGLPGSHSPGRESEFSPLIDEKQLFPLIPSKDGIFS-------SGN  113

Query  672  KRGFSDAMDEFS  707
            KRGF+D ++ FS
Sbjct  114  KRGFADTVNAFS  125



>gb|EYU44548.1| hypothetical protein MIMGU_mgv1a010252mg [Erythranthe guttata]
Length=318

 Score =   109 bits (272),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 75/132 (57%), Positives = 91/132 (69%), Gaps = 7/132 (5%)
 Frame = +3

Query  312  MSPPLLGVGEDGQSNVTHMASPISLDSVCQNGPELKEWNYMGLsdcssvdsstisstsen  491
            MSPPLLG+    Q+NV+ MAS  S D V QN   LKE NY+GLSDCSSVDSST+  T   
Sbjct  1    MSPPLLGIEGHNQANVSPMASSSSTDCVSQNVSCLKERNYLGLSDCSSVDSSTVMLTVPA  60

Query  492  nsGRGLNLRATELRLGLPGSQSPQRDSEPSTKLDEKLLFPLHPAKESNFTLSQKTVVTGN  671
            +    LNL+ATELRLGLPGS SP R+SE S  +DEK LFPL P+K+  F+       +GN
Sbjct  61   DPKSNLNLKATELRLGLPGSHSPGRESEFSPLIDEKQLFPLIPSKDGIFS-------SGN  113

Query  672  KRGFSDAMDEFS  707
            KRGF+D ++ FS
Sbjct  114  KRGFADTVNAFS  125



>gb|AFK43616.1| unknown [Lotus japonicus]
Length=180

 Score =   106 bits (264),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 77/143 (54%), Positives = 97/143 (68%), Gaps = 8/143 (6%)
 Frame = +3

Query  312  MSPPLLGVG-EDGQSNVTHMASPISL-DSVCQNGPELKEWNYMGLsdcssvdsstissts  485
            MS P LGVG E+G+SNV+ + S  +  +SVC NG +LKE+NYMGLS   S   S+    S
Sbjct  1    MSLPRLGVGDEEGESNVSLLVSSSATGESVCLNGSKLKEFNYMGLSSDCSSVDSSAPLPS  60

Query  486  ennsGRG-LNLRATELRLGLPGSQSPQRDS----EPSTKLDEKLLFPLHPAKESNFTLSQ  650
             ++  +  LNL+ATELRLGLPGSQSP+RDS      S + DEK LFPLHP  + + + S 
Sbjct  61   FSDESKSNLNLKATELRLGLPGSQSPERDSNLCLRGSAQFDEKPLFPLHPVTDDHHS-SS  119

Query  651  KTVVTGNKRGFSDAMDEFSEGKF  719
            K  V G+KRGFSDAM+ FSEGK 
Sbjct  120  KPAVLGSKRGFSDAMNGFSEGKL  142



>ref|XP_007156440.1| hypothetical protein PHAVU_003G286200g [Phaseolus vulgaris]
 gb|ESW28434.1| hypothetical protein PHAVU_003G286200g [Phaseolus vulgaris]
Length=348

 Score =   108 bits (271),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 78/135 (58%), Positives = 95/135 (70%), Gaps = 8/135 (6%)
 Frame = +3

Query  312  MSPPLLGVGEDGQSNVTHMASPISLDSVCQNGPE--LKEWNYMGLsdcssvdsstissts  485
            MSPPLL   ++GQSN + +AS  S    C +  E   KE NY+G SDCSSV+SST+ S S
Sbjct  1    MSPPLLVTEDEGQSNASMVASASSPSMECFSPHEARFKERNYLGFSDCSSVESSTVPSLS  60

Query  486  ennsGRGLNLRATELRLGLPGSQSPQRDSE----PSTKLDEKLLFPLHPAKESNFTLSQK  653
                 + LNL+ATELRLGLPGSQSP+R+ +     S+KLDEK LFPL P K+  F LSQK
Sbjct  61   NEK--KNLNLKATELRLGLPGSQSPERNPDLFPLTSSKLDEKPLFPLLPTKDGIFALSQK  118

Query  654  TVVTGNKRGFSDAMD  698
            TVV+GNKRGF+D MD
Sbjct  119  TVVSGNKRGFADTMD  133



>gb|KHN46011.1| Auxin-responsive protein IAA9 [Glycine soja]
Length=350

 Score =   108 bits (271),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 80/138 (58%), Positives = 98/138 (71%), Gaps = 8/138 (6%)
 Frame = +3

Query  312  MSPPLLGVGEDGQSNVTHMASPIS--LDSVCQNGPELKEWNYMGLsdcssvdsstissts  485
            MSPPLL   ++GQ + + +AS  S  L+    N    KE NY+GLSDCSSVDSST+ + S
Sbjct  1    MSPPLLVTEDEGQCHASMVASASSPSLNCFSLNEAGFKECNYLGLSDCSSVDSSTVPNLS  60

Query  486  ennsGRGLNLRATELRLGLPGSQSPQRDSE----PSTKLDEKLLFPLHPAKESNFTLSQK  653
            +      LNL+ATELRLGLPGSQSP+R++E     STKLDEK LFPL P K+   +LSQK
Sbjct  61   DEKK-ENLNLKATELRLGLPGSQSPERETELFSLSSTKLDEKPLFPLLPTKDGICSLSQK  119

Query  654  TVVTGNKRGFSDAMD-EF  704
            TVV+GNKRGF+D MD EF
Sbjct  120  TVVSGNKRGFADTMDPEF  137



>ref|XP_009344514.1| PREDICTED: auxin-responsive protein IAA9 [Pyrus x bretschneideri]
 ref|XP_009344515.1| PREDICTED: auxin-responsive protein IAA9 [Pyrus x bretschneideri]
 ref|XP_009344516.1| PREDICTED: auxin-responsive protein IAA9 [Pyrus x bretschneideri]
Length=373

 Score =   108 bits (271),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 82/139 (59%), Positives = 98/139 (71%), Gaps = 8/139 (6%)
 Frame = +3

Query  312  MSPPLLGVGEDGQSNVTHMASPISLDSVCQNGPELKEWNYMGLsdcssvdsstisstsen  491
            MSPPLLG  E+GQSN + +A   S+D +  NG  LKE NY+GLSDCSSVDSST+S+ SE 
Sbjct  1    MSPPLLGGEEEGQSNGSMVAFSRSMDCISHNGSGLKERNYLGLSDCSSVDSSTVSNLSEG  60

Query  492  nsGRGLNLRATELRLGLPGSQSPQRDSE----PSTKLDEKLLFPLHPAKESNFTLSQKTV  659
                 LN +ATELRLGLPGSQSP+R+ +     S KLDEK LFPL P+K+   + SQK  
Sbjct  61   TK-NNLNFKATELRLGLPGSQSPEREPDLCLLNSGKLDEKPLFPLLPSKDGICSSSQK--  117

Query  660  VTGNKRGFSDAMDEFSEGK  716
              GNKRGF+D MD FSE K
Sbjct  118  -NGNKRGFADTMDGFSEVK  135



>ref|XP_003531969.1| PREDICTED: auxin-responsive protein IAA9-like isoform X1 [Glycine 
max]
 ref|XP_006585901.1| PREDICTED: auxin-responsive protein IAA9-like isoform X2 [Glycine 
max]
Length=350

 Score =   108 bits (270),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 85/139 (61%), Positives = 97/139 (70%), Gaps = 9/139 (6%)
 Frame = +3

Query  312  MSPPLLGVGED-GQSNVTHMASPISLDSVC--QNGPELKEWNYMGLsdcssvdsstisst  482
            MSPPLL   ED GQSN + +AS  S  S C   N   LKE NY+GLSDCSSVDSS + S 
Sbjct  1    MSPPLLVTEEDEGQSNASMVASASSPSSECFTLNEARLKERNYLGLSDCSSVDSSIVPSL  60

Query  483  sennsGRGLNLRATELRLGLPGSQSPQRD----SEPSTKLDEKLLFPLHPAKESNFTLSQ  650
            S+      LNL+ATELRLGLPGSQSP+RD    S  STKLDEK LF L P K+   +LSQ
Sbjct  61   SDEKK-ENLNLKATELRLGLPGSQSPERDPDLFSLSSTKLDEKPLFSLLPTKDGICSLSQ  119

Query  651  KTVVTGNKRGFSDAMD-EF  704
            KTVV+GNKRGF+D +D EF
Sbjct  120  KTVVSGNKRGFADTIDPEF  138



>gb|KHN22187.1| Auxin-responsive protein IAA9 [Glycine soja]
Length=350

 Score =   108 bits (270),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 85/139 (61%), Positives = 97/139 (70%), Gaps = 9/139 (6%)
 Frame = +3

Query  312  MSPPLLGVGED-GQSNVTHMASPISLDSVC--QNGPELKEWNYMGLsdcssvdsstisst  482
            MSPPLL   ED GQSN + +AS  S  S C   N   LKE NY+GLSDCSSVDSS + S 
Sbjct  1    MSPPLLVTEEDEGQSNASMVASASSPSSECFTLNEARLKERNYLGLSDCSSVDSSIVPSL  60

Query  483  sennsGRGLNLRATELRLGLPGSQSPQRD----SEPSTKLDEKLLFPLHPAKESNFTLSQ  650
            S+      LNL+ATELRLGLPGSQSP+RD    S  STKLDEK LF L P K+   +LSQ
Sbjct  61   SDEKK-ENLNLKATELRLGLPGSQSPERDPDLFSLSSTKLDEKPLFSLLPTKDGICSLSQ  119

Query  651  KTVVTGNKRGFSDAMD-EF  704
            KTVV+GNKRGF+D +D EF
Sbjct  120  KTVVSGNKRGFADTIDPEF  138



>ref|XP_006585902.1| PREDICTED: auxin-responsive protein IAA9-like isoform X3 [Glycine 
max]
Length=348

 Score =   108 bits (270),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 83/136 (61%), Positives = 95/136 (70%), Gaps = 8/136 (6%)
 Frame = +3

Query  312  MSPPLLGVGED-GQSNVTHMASPISLDSVC--QNGPELKEWNYMGLsdcssvdsstisst  482
            MSPPLL   ED GQSN + +AS  S  S C   N   LKE NY+GLSDCSSVDSS + S 
Sbjct  1    MSPPLLVTEEDEGQSNASMVASASSPSSECFTLNEARLKERNYLGLSDCSSVDSSIVPSL  60

Query  483  sennsGRGLNLRATELRLGLPGSQSPQRD----SEPSTKLDEKLLFPLHPAKESNFTLSQ  650
            S+      LNL+ATELRLGLPGSQSP+RD    S  STKLDEK LF L P K+   +LSQ
Sbjct  61   SDEKK-ENLNLKATELRLGLPGSQSPERDPDLFSLSSTKLDEKPLFSLLPTKDGICSLSQ  119

Query  651  KTVVTGNKRGFSDAMD  698
            KTVV+GNKRGF+D +D
Sbjct  120  KTVVSGNKRGFADTID  135



>gb|ADL36578.1| ARF domain class transcription factor [Malus domestica]
Length=373

 Score =   108 bits (270),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 82/139 (59%), Positives = 98/139 (71%), Gaps = 8/139 (6%)
 Frame = +3

Query  312  MSPPLLGVGEDGQSNVTHMASPISLDSVCQNGPELKEWNYMGLsdcssvdsstisstsen  491
            MSPPLLG  E+GQSN + +A   S+D + QN   LKE NY+GLSDCSSVDSST+S+ SE 
Sbjct  1    MSPPLLGGEEEGQSNGSMVAFSRSMDCISQNSSGLKERNYLGLSDCSSVDSSTVSNLSEG  60

Query  492  nsGRGLNLRATELRLGLPGSQSPQRDSE----PSTKLDEKLLFPLHPAKESNFTLSQKTV  659
                 LN +ATELRLGLPGSQSP+R+ +     S KLDEK LFPL P+K+   + SQK  
Sbjct  61   TK-NNLNFKATELRLGLPGSQSPEREPDLCLLNSGKLDEKPLFPLLPSKDGICSSSQK--  117

Query  660  VTGNKRGFSDAMDEFSEGK  716
              GNKRGF+D MD FSE K
Sbjct  118  -NGNKRGFADTMDGFSEVK  135



>gb|KJB18143.1| hypothetical protein B456_003G035700 [Gossypium raimondii]
Length=255

 Score =   105 bits (261),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 81/139 (58%), Positives = 97/139 (70%), Gaps = 16/139 (12%)
 Frame = +3

Query  312  MSPPLLGVGEDGQSNVTHMASPISLDSVCQNGPELKEWNYMGLsdcssvdsstisstsen  491
            MSPPLLGV E+ QS+V+  +     + + +NG  LKE NY+GLSDCSSVDSS +S     
Sbjct  1    MSPPLLGVEEEVQSSVSSPSV----ECISENGIGLKERNYLGLSDCSSVDSSGVS-----  51

Query  492  nsGRGLNLRATELRLGLPGSQSPQRDSEPST----KLDEKLLFPLHPAKESNFTLSQKTV  659
                 LNL+ATELRLGLPGSQSP+R++E       KLDEK LFPL P+K+   + SQK V
Sbjct  52   ---SNLNLKATELRLGLPGSQSPERETELCLLNLGKLDEKPLFPLLPSKDGICSSSQKNV  108

Query  660  VTGNKRGFSDAMDEFSEGK  716
            VTGNKRGFSD MD FSE K
Sbjct  109  VTGNKRGFSDTMDGFSEVK  127



>gb|KJB18142.1| hypothetical protein B456_003G035700 [Gossypium raimondii]
Length=296

 Score =   105 bits (263),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 81/139 (58%), Positives = 97/139 (70%), Gaps = 16/139 (12%)
 Frame = +3

Query  312  MSPPLLGVGEDGQSNVTHMASPISLDSVCQNGPELKEWNYMGLsdcssvdsstisstsen  491
            MSPPLLGV E+ QS+V+  +     + + +NG  LKE NY+GLSDCSSVDSS +S     
Sbjct  1    MSPPLLGVEEEVQSSVSSPSV----ECISENGIGLKERNYLGLSDCSSVDSSGVS-----  51

Query  492  nsGRGLNLRATELRLGLPGSQSPQRDSEPST----KLDEKLLFPLHPAKESNFTLSQKTV  659
                 LNL+ATELRLGLPGSQSP+R++E       KLDEK LFPL P+K+   + SQK V
Sbjct  52   ---SNLNLKATELRLGLPGSQSPERETELCLLNLGKLDEKPLFPLLPSKDGICSSSQKNV  108

Query  660  VTGNKRGFSDAMDEFSEGK  716
            VTGNKRGFSD MD FSE K
Sbjct  109  VTGNKRGFSDTMDGFSEVK  127



>ref|XP_011073641.1| PREDICTED: auxin-responsive protein IAA9-like [Sesamum indicum]
Length=346

 Score =   106 bits (264),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 78/121 (64%), Positives = 89/121 (74%), Gaps = 6/121 (5%)
 Frame = +3

Query  366  MASPISLDSVCQNGPELKEWNYMGLsdcssvdsstisstsennsGRGLNLRATELRLGLP  545
            MAS  S D V QNG  LKE NY+GLSDCSSVDSS +SS  E      LNL+ATELRLGLP
Sbjct  1    MASSASADRVAQNGLGLKERNYLGLSDCSSVDSSAVSSVPEEKKSN-LNLKATELRLGLP  59

Query  546  GSQSPQRDSE----PSTKLDEKLLFPLHPAKESNFTLSQKTVVTGNKRGFSDAMDEFSEG  713
            GSQSP+R+S+      +KLDEK LFPL P+K+    LSQKTVV+GNKRGFSD +D FSE 
Sbjct  60   GSQSPERESDFTLLSPSKLDEKQLFPLIPSKD-GILLSQKTVVSGNKRGFSDTVDGFSES  118

Query  714  K  716
            K
Sbjct  119  K  119



>gb|KJB18140.1| hypothetical protein B456_003G035700 [Gossypium raimondii]
Length=403

 Score =   106 bits (264),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 81/139 (58%), Positives = 97/139 (70%), Gaps = 16/139 (12%)
 Frame = +3

Query  312  MSPPLLGVGEDGQSNVTHMASPISLDSVCQNGPELKEWNYMGLsdcssvdsstisstsen  491
            MSPPLLGV E+ QS+V+  +     + + +NG  LKE NY+GLSDCSSVDSS +S     
Sbjct  1    MSPPLLGVEEEVQSSVSSPSV----ECISENGIGLKERNYLGLSDCSSVDSSGVS-----  51

Query  492  nsGRGLNLRATELRLGLPGSQSPQRDSEPST----KLDEKLLFPLHPAKESNFTLSQKTV  659
                 LNL+ATELRLGLPGSQSP+R++E       KLDEK LFPL P+K+   + SQK V
Sbjct  52   ---SNLNLKATELRLGLPGSQSPERETELCLLNLGKLDEKPLFPLLPSKDGICSSSQKNV  108

Query  660  VTGNKRGFSDAMDEFSEGK  716
            VTGNKRGFSD MD FSE K
Sbjct  109  VTGNKRGFSDTMDGFSEVK  127



>ref|XP_004512542.1| PREDICTED: auxin-responsive protein IAA8-like [Cicer arietinum]
Length=348

 Score =   106 bits (264),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 75/142 (53%), Positives = 96/142 (68%), Gaps = 6/142 (4%)
 Frame = +3

Query  312  MSPPLLGVGEDGQSNVTHMASPISLDSVCQNGPELKEWNYMGLsdcssvdsstisstsen  491
            MSP ++   E+G++ ++      S  S  Q G +LKE NY+GLSDCSSVDS   +  S  
Sbjct  1    MSPAVVVTEEEGRNKLSSTVVSASSQSFSQIGADLKERNYLGLSDCSSVDSCDSTVPSLC  60

Query  492  nsGR-GLNLRATELRLGLPGSQSPQRDSE-PSTKLDEKLLFPLHPAKESNFTLSQKTVVT  665
            +  +  LNL+ATELRLGLPGSQSP+RDS+  STKLDEK LFPL P K+      QK VV+
Sbjct  61   DEKKENLNLKATELRLGLPGSQSPERDSDFYSTKLDEKPLFPLVPTKDG----IQKNVVS  116

Query  666  GNKRGFSDAMDEFSEGKFLSNS  731
            GNKRGF+D +D FS+ KF  N+
Sbjct  117  GNKRGFADTVDGFSQVKFNGNT  138



>gb|AAB70005.1| GH1 protein [Glycine max]
Length=339

 Score =   105 bits (263),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 72/122 (59%), Positives = 86/122 (70%), Gaps = 5/122 (4%)
 Frame = +3

Query  381  SLDSVCQNGPELKEWNYMGLsdcssvdsstisstsennsGR-GLNLRATELRLGLPGSQS  557
            SLD   QNG  LKE NY+GLSDCSSVDSS  +  S  +  +  +NL+ATELRLGLPGSQS
Sbjct  8    SLDRFSQNGAGLKERNYLGLSDCSSVDSSASTVPSLCDEKKENMNLKATELRLGLPGSQS  67

Query  558  PQRD----SEPSTKLDEKLLFPLHPAKESNFTLSQKTVVTGNKRGFSDAMDEFSEGKFLS  725
            P+R+    S    KLDEK LFPL P K+     +QKTVV+GNKRGF+D MD FS+GKF  
Sbjct  68   PEREPDLFSLSPAKLDEKPLFPLLPTKDGICLSAQKTVVSGNKRGFADTMDGFSQGKFAG  127

Query  726  NS  731
            N+
Sbjct  128  NT  129



>gb|KJB18136.1| hypothetical protein B456_003G035700 [Gossypium raimondii]
 gb|KJB18137.1| hypothetical protein B456_003G035700 [Gossypium raimondii]
 gb|KJB18138.1| hypothetical protein B456_003G035700 [Gossypium raimondii]
 gb|KJB18139.1| hypothetical protein B456_003G035700 [Gossypium raimondii]
 gb|KJB18141.1| hypothetical protein B456_003G035700 [Gossypium raimondii]
 gb|KJB18144.1| hypothetical protein B456_003G035700 [Gossypium raimondii]
Length=377

 Score =   105 bits (263),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 81/139 (58%), Positives = 97/139 (70%), Gaps = 16/139 (12%)
 Frame = +3

Query  312  MSPPLLGVGEDGQSNVTHMASPISLDSVCQNGPELKEWNYMGLsdcssvdsstisstsen  491
            MSPPLLGV E+ QS+V+  +     + + +NG  LKE NY+GLSDCSSVDSS +S     
Sbjct  1    MSPPLLGVEEEVQSSVSSPSV----ECISENGIGLKERNYLGLSDCSSVDSSGVS-----  51

Query  492  nsGRGLNLRATELRLGLPGSQSPQRDSEPST----KLDEKLLFPLHPAKESNFTLSQKTV  659
                 LNL+ATELRLGLPGSQSP+R++E       KLDEK LFPL P+K+   + SQK V
Sbjct  52   ---SNLNLKATELRLGLPGSQSPERETELCLLNLGKLDEKPLFPLLPSKDGICSSSQKNV  108

Query  660  VTGNKRGFSDAMDEFSEGK  716
            VTGNKRGFSD MD FSE K
Sbjct  109  VTGNKRGFSDTMDGFSEVK  127



>gb|EYU41350.1| hypothetical protein MIMGU_mgv1a009380mg [Erythranthe guttata]
Length=344

 Score =   105 bits (262),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 73/131 (56%), Positives = 88/131 (67%), Gaps = 6/131 (5%)
 Frame = +3

Query  327  LGVGEDGQSNVTHMASPISLDSVCQNGPELKEWNYMGLsdcssvdsstisstsennsGRG  506
            LGV    Q NV+ MAS  S D + QNG  LKE NY+GLSDCSSVDSS +S  ++      
Sbjct  6    LGVEGQSQCNVSLMASSASADCITQNGSSLKERNYLGLSDCSSVDSSAVSCGADTEIKSN  65

Query  507  LNLRATELRLGLPGSQSPQRDSEPSTK-LDEKLLFPLHPAKESNFTLSQKTVVTGNKRGF  683
            LNL+ATEL LGLPGSQSP       T  LDEK LFPL P+K+     +QK+VV+GNKRGF
Sbjct  66   LNLKATELTLGLPGSQSPHHQELSFTALLDEKQLFPLIPSKD-----AQKSVVSGNKRGF  120

Query  684  SDAMDEFSEGK  716
            +D +D FS+ K
Sbjct  121  ADTVDGFSDSK  131



>dbj|BAP94244.1| auxin-responsive protein IAA homolog, partial [Rubus grayanus]
 dbj|BAP94245.1| auxin-responsive protein IAA homolog, partial [Rubus grayanus]
 dbj|BAP94246.1| auxin-responsive protein IAA homolog, partial [Rubus grayanus]
 dbj|BAP94247.1| auxin-responsive protein IAA homolog, partial [Rubus grayanus]
 dbj|BAP94248.1| auxin-responsive protein IAA homolog, partial [Rubus grayanus]
 dbj|BAP94249.1| auxin-responsive protein IAA homolog, partial [Rubus grayanus]
 dbj|BAP94250.1| auxin-responsive protein IAA homolog, partial [Rubus grayanus]
 dbj|BAP94251.1| auxin-responsive protein IAA homolog, partial [Rubus grayanus]
 dbj|BAP94252.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94253.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94254.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94255.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94256.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94257.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94258.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94259.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94260.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94261.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94263.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94264.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94265.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94266.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94268.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94269.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94270.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94271.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94272.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94273.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94275.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94292.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94293.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94294.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94295.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94296.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94297.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94298.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94299.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94300.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94301.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94303.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94304.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94305.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94306.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94311.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94313.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
Length=78

 Score = 99.0 bits (245),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 54/71 (76%), Positives = 59/71 (83%), Gaps = 7/71 (10%)
 Frame = +3

Query  507  LNLRATELRLGLPGSQSPQRDSE---PSTKLDEKLLFPLHPAKESNFTLSQKTVVTGNKR  677
            LNL+ATELRLGLPGSQSP+RDSE    ST+LDEK LFPLHP K+S     QKTVV+GNKR
Sbjct  12   LNLKATELRLGLPGSQSPERDSELRLISTQLDEKPLFPLHPLKDS----LQKTVVSGNKR  67

Query  678  GFSDAMDEFSE  710
            GFSD MDEFSE
Sbjct  68   GFSDTMDEFSE  78



>dbj|BAP94276.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94277.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94278.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94279.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94280.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94281.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94282.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94284.1| auxin-responsive protein IAA homolog, partial [Rubus palmatus]
 dbj|BAP94285.1| auxin-responsive protein IAA homolog, partial [Rubus palmatus]
 dbj|BAP94286.1| auxin-responsive protein IAA homolog, partial [Rubus palmatus]
 dbj|BAP94287.1| auxin-responsive protein IAA homolog, partial [Rubus palmatus]
 dbj|BAP94288.1| auxin-responsive protein IAA homolog, partial [Rubus palmatus]
 dbj|BAP94289.1| auxin-responsive protein IAA homolog, partial [Rubus palmatus]
 dbj|BAP94290.1| auxin-responsive protein IAA homolog, partial [Rubus palmatus]
 dbj|BAP94291.1| auxin-responsive protein IAA homolog, partial [Rubus palmatus]
 dbj|BAP94316.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94317.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94318.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94319.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94320.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94321.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94322.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94323.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
Length=78

 Score = 98.6 bits (244),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 54/71 (76%), Positives = 58/71 (82%), Gaps = 7/71 (10%)
 Frame = +3

Query  507  LNLRATELRLGLPGSQSPQRDSE---PSTKLDEKLLFPLHPAKESNFTLSQKTVVTGNKR  677
            LNL+ATELRLGLPGSQSP RDSE    ST+LDEK LFPLHP K+S     QKTVV+GNKR
Sbjct  12   LNLKATELRLGLPGSQSPDRDSELRLISTQLDEKPLFPLHPLKDS----LQKTVVSGNKR  67

Query  678  GFSDAMDEFSE  710
            GFSD MDEFSE
Sbjct  68   GFSDTMDEFSE  78



>ref|XP_008357957.1| PREDICTED: LOW QUALITY PROTEIN: auxin-responsive protein IAA9-like 
[Malus domestica]
Length=216

 Score =   102 bits (253),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 78/139 (56%), Positives = 94/139 (68%), Gaps = 12/139 (9%)
 Frame = +3

Query  312  MSPPLLGVGEDGQSNVTHMASPISLDSVCQNGPELKEWNYMGLsdcssvdsstisstsen  491
            MSPPL G  E+G+SN        S+D +  NG  LKE NY GLSDCSSV+SS +S+ SE 
Sbjct  1    MSPPLXGGEEEGKSNG-------SMDCISHNGSGLKELNYHGLSDCSSVNSSXVSNLSEG  53

Query  492  nsGRGLNLRATELRLGLPGSQSPQRDSE----PSTKLDEKLLFPLHPAKESNFTLSQKTV  659
            N    LN +A ELRLGLP SQSP+R+S+     S KLDEK LFPL P+K+   + SQK  
Sbjct  54   NKNN-LNFKAPELRLGLPASQSPERESDLCLLSSGKLDEKPLFPLLPSKDGIXSSSQKDG  112

Query  660  VTGNKRGFSDAMDEFSEGK  716
            V+GNKRGF+D MD FSE K
Sbjct  113  VSGNKRGFADTMDRFSEVK  131



>dbj|BAP94262.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94267.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94274.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94283.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94302.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94307.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94308.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94309.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94310.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94312.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94314.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94315.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
Length=78

 Score = 98.2 bits (243),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 54/71 (76%), Positives = 58/71 (82%), Gaps = 7/71 (10%)
 Frame = +3

Query  507  LNLRATELRLGLPGSQSPQRDSE---PSTKLDEKLLFPLHPAKESNFTLSQKTVVTGNKR  677
            LNL+ATELRLGLPGSQSP RDSE    ST+LDEK LFPLHP K+S     QKTVV+GNKR
Sbjct  12   LNLKATELRLGLPGSQSPXRDSELRLISTQLDEKPLFPLHPLKDS----LQKTVVSGNKR  67

Query  678  GFSDAMDEFSE  710
            GFSD MDEFSE
Sbjct  68   GFSDTMDEFSE  78



>ref|XP_004509716.1| PREDICTED: auxin-responsive protein IAA9-like isoform X2 [Cicer 
arietinum]
Length=326

 Score =   102 bits (254),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 78/142 (55%), Positives = 90/142 (63%), Gaps = 26/142 (18%)
 Frame = +3

Query  312  MSPPLLGVGEDGQSNVTHMAS--PISLDSVCQNGPELKEWNYMGLsdcssvdsstissts  485
            MSPPLL   E+ QSN + +AS  P SLD   QNG  LKE NY+GLSDCSSVDSST+ S S
Sbjct  1    MSPPLLVTEEERQSNTSTVASASPQSLDCFSQNGAGLKERNYLGLSDCSSVDSSTVPSLS  60

Query  486  ennsGRGLNLRATELRLGLPGSQSPQRDSEPSTKLDEKLLFPLHPAKESNFTLSQKTVVT  665
            +      LNL+ATELRLGLPGSQSP+RD                        +SQK VV+
Sbjct  61   DEKK-ENLNLKATELRLGLPGSQSPERD-----------------------PVSQKNVVS  96

Query  666  GNKRGFSDAMDEFSEGKFLSNS  731
            GNKRGFSDAMD F EGK+  N+
Sbjct  97   GNKRGFSDAMDGFREGKYTGNA  118



>ref|XP_010547581.1| PREDICTED: auxin-responsive protein IAA9-like isoform X2 [Tarenaya 
hassleriana]
Length=342

 Score =   101 bits (252),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 71/139 (51%), Positives = 98/139 (71%), Gaps = 5/139 (4%)
 Frame = +3

Query  312  MSPPLLGVGEDGQSNVTHMASPISLDSVCQNGPELKEWNYMGLsdcssvdsstisstsen  491
            MSPP+  V E+ QSNV+  +S  + + + +N    KE NY+GLS+CSSV SS +   +E+
Sbjct  1    MSPPVADVEEELQSNVSVASSSPTSECLSRNTSGPKEHNYLGLSECSSVGSSNLPGLAED  60

Query  492  nsGRGLNLRATELRLGLPGSQSPQRDSEPST----KLDEKLLFPLHPAKESNFTLSQKTV  659
            +    ++L+ATELRLGLPGSQSP+R+++ +T    KLDEK LFPL P+K+   + SQK  
Sbjct  61   DKN-SISLKATELRLGLPGSQSPERETDFNTLTSGKLDEKPLFPLAPSKDGICSQSQKNS  119

Query  660  VTGNKRGFSDAMDEFSEGK  716
             TGNKRGFSD MD+F+E K
Sbjct  120  GTGNKRGFSDTMDQFAEVK  138



>gb|KEH28135.1| auxin response factor [Medicago truncatula]
Length=272

 Score =   100 bits (250),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 70/145 (48%), Positives = 88/145 (61%), Gaps = 15/145 (10%)
 Frame = +3

Query  312  MSPPLLGVG-EDGQSNVTHMASPISLDSVCQNGPELKEWNYMGL---sdcssvdsstiss  479
            MS P LG+G E+ +SNVT +   + L     NG + KE+NYMGL   +  S   S     
Sbjct  1    MSLPRLGIGDEESKSNVTLLEKSLHL-----NGSKPKEFNYMGLPSSNCSSVDSSVPKIQ  55

Query  480  tsennsGRGLNLRATELRLGLPGSQSPQRDS-----EPSTKLDEKLLFPLHPAKESNFTL  644
            + ++ +   LNL+ATELRLGLPGS SP+RDS       S + DEK LFPLHP K+ +   
Sbjct  56   SFKDETKSNLNLKATELRLGLPGSLSPERDSSDFCLRSSKQFDEKPLFPLHPQKDDHL-F  114

Query  645  SQKTVVTGNKRGFSDAMDEFSEGKF  719
              K  V GNKRGFSDAM+ FSEGK 
Sbjct  115  ESKPAVLGNKRGFSDAMNVFSEGKL  139



>ref|XP_010547580.1| PREDICTED: auxin-responsive protein IAA9-like isoform X1 [Tarenaya 
hassleriana]
Length=350

 Score =   101 bits (251),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 71/139 (51%), Positives = 98/139 (71%), Gaps = 5/139 (4%)
 Frame = +3

Query  312  MSPPLLGVGEDGQSNVTHMASPISLDSVCQNGPELKEWNYMGLsdcssvdsstisstsen  491
            MSPP+  V E+ QSNV+  +S  + + + +N    KE NY+GLS+CSSV SS +   +E+
Sbjct  1    MSPPVADVEEELQSNVSVASSSPTSECLSRNTSGPKEHNYLGLSECSSVGSSNLPGLAED  60

Query  492  nsGRGLNLRATELRLGLPGSQSPQRDSEPST----KLDEKLLFPLHPAKESNFTLSQKTV  659
            +    ++L+ATELRLGLPGSQSP+R+++ +T    KLDEK LFPL P+K+   + SQK  
Sbjct  61   DK-NSISLKATELRLGLPGSQSPERETDFNTLTSGKLDEKPLFPLAPSKDGICSQSQKNS  119

Query  660  VTGNKRGFSDAMDEFSEGK  716
             TGNKRGFSD MD+F+E K
Sbjct  120  GTGNKRGFSDTMDQFAEVK  138



>gb|AFK38170.1| unknown [Lotus japonicus]
Length=347

 Score =   100 bits (250),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 74/141 (52%), Positives = 94/141 (67%), Gaps = 8/141 (6%)
 Frame = +3

Query  312  MSPPLLGVGEDGQSNVTHMASPISLDSVCQNGPELKEWNYMGLsdcssvdsstisstsen  491
            M+PP +   E+G+  +T   +  +  S   +  ELKE NY+GLSDCSSVDS   +  S  
Sbjct  1    MTPPAVVTEEEGRCKLTSTTTVATASSQV-DCFELKERNYLGLSDCSSVDSCASTVPSLC  59

Query  492  nsGRG-LNLRATELRLGLPGSQSPQRDSE------PSTKLDEKLLFPLHPAKESNFTLSQ  650
            +  +G LNL+ATELRLGLPGSQSP+RD E       +TKLDEK LFPL P K+   + SQ
Sbjct  60   DEKKGNLNLKATELRLGLPGSQSPERDPELFSLSSAATKLDEKPLFPLLPTKDGISSTSQ  119

Query  651  KTVVTGNKRGFSDAMDEFSEG  713
            K VV+GNKRGF+D MD FS+G
Sbjct  120  KAVVSGNKRGFADTMDGFSQG  140



>ref|XP_003615390.1| Auxin-responsive protein IAA5 [Medicago truncatula]
 gb|AES98348.1| auxin response factor [Medicago truncatula]
Length=347

 Score =   100 bits (250),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 70/145 (48%), Positives = 88/145 (61%), Gaps = 15/145 (10%)
 Frame = +3

Query  312  MSPPLLGVG-EDGQSNVTHMASPISLDSVCQNGPELKEWNYMGL---sdcssvdsstiss  479
            MS P LG+G E+ +SNVT +   + L     NG + KE+NYMGL   +  S   S     
Sbjct  1    MSLPRLGIGDEESKSNVTLLEKSLHL-----NGSKPKEFNYMGLPSSNCSSVDSSVPKIQ  55

Query  480  tsennsGRGLNLRATELRLGLPGSQSPQRDS-----EPSTKLDEKLLFPLHPAKESNFTL  644
            + ++ +   LNL+ATELRLGLPGS SP+RDS       S + DEK LFPLHP K+ +   
Sbjct  56   SFKDETKSNLNLKATELRLGLPGSLSPERDSSDFCLRSSKQFDEKPLFPLHPQKDDHL-F  114

Query  645  SQKTVVTGNKRGFSDAMDEFSEGKF  719
              K  V GNKRGFSDAM+ FSEGK 
Sbjct  115  ESKPAVLGNKRGFSDAMNVFSEGKL  139



>ref|XP_010023413.1| PREDICTED: auxin-responsive protein IAA9 isoform X2 [Eucalyptus 
grandis]
 gb|KCW59654.1| hypothetical protein EUGRSUZ_H02407 [Eucalyptus grandis]
Length=368

 Score =   100 bits (249),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 80/140 (57%), Positives = 98/140 (70%), Gaps = 7/140 (5%)
 Frame = +3

Query  312  MSPPLLGVGEDGQSNVTHMASPISLDSVCQNGPELKEWNYMGLsdcssvdsstisstsen  491
            MSPPLLGV E+G  N + +A+  S+D    +   LKE NY+GLSDCSSVDSS +SS S+ 
Sbjct  1    MSPPLLGV-EEGGGNTSTVATSPSIDGASHDCLGLKERNYLGLSDCSSVDSSAVSSLSDE  59

Query  492  nsGRGLNLRATELRLGLPGSQSPQRDSE----PSTKLDEKLLFPLHPAKESNFTLS-QKT  656
            N    LNL+ATEL LGLPGSQSP+R+ +     S KLDEK LFPL P K+   + S QK 
Sbjct  60   NKSN-LNLKATELTLGLPGSQSPEREPKLCLLSSGKLDEKPLFPLLPLKDGICSSSLQKN  118

Query  657  VVTGNKRGFSDAMDEFSEGK  716
            + +GNKRGFSD +DEFSE K
Sbjct  119  IASGNKRGFSDTIDEFSELK  138



>ref|XP_010023411.1| PREDICTED: auxin-responsive protein IAA9 isoform X1 [Eucalyptus 
grandis]
 ref|XP_010023412.1| PREDICTED: auxin-responsive protein IAA9 isoform X1 [Eucalyptus 
grandis]
Length=377

 Score =   100 bits (249),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 80/140 (57%), Positives = 98/140 (70%), Gaps = 7/140 (5%)
 Frame = +3

Query  312  MSPPLLGVGEDGQSNVTHMASPISLDSVCQNGPELKEWNYMGLsdcssvdsstisstsen  491
            MSPPLLGV E+G  N + +A+  S+D    +   LKE NY+GLSDCSSVDSS +SS S+ 
Sbjct  1    MSPPLLGV-EEGGGNTSTVATSPSIDGASHDCLGLKERNYLGLSDCSSVDSSAVSSLSDE  59

Query  492  nsGRGLNLRATELRLGLPGSQSPQRDSE----PSTKLDEKLLFPLHPAKESNFTLS-QKT  656
            N    LNL+ATEL LGLPGSQSP+R+ +     S KLDEK LFPL P K+   + S QK 
Sbjct  60   NKSN-LNLKATELTLGLPGSQSPEREPKLCLLSSGKLDEKPLFPLLPLKDGICSSSLQKN  118

Query  657  VVTGNKRGFSDAMDEFSEGK  716
            + +GNKRGFSD +DEFSE K
Sbjct  119  IASGNKRGFSDTIDEFSELK  138



>gb|KCW59655.1| hypothetical protein EUGRSUZ_H02407 [Eucalyptus grandis]
Length=345

 Score =   100 bits (248),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 80/140 (57%), Positives = 98/140 (70%), Gaps = 7/140 (5%)
 Frame = +3

Query  312  MSPPLLGVGEDGQSNVTHMASPISLDSVCQNGPELKEWNYMGLsdcssvdsstisstsen  491
            MSPPLLGV E+G  N + +A+  S+D    +   LKE NY+GLSDCSSVDSS +SS S+ 
Sbjct  1    MSPPLLGV-EEGGGNTSTVATSPSIDGASHDCLGLKERNYLGLSDCSSVDSSAVSSLSDE  59

Query  492  nsGRGLNLRATELRLGLPGSQSPQRDSE----PSTKLDEKLLFPLHPAKESNFTLS-QKT  656
            N    LNL+ATEL LGLPGSQSP+R+ +     S KLDEK LFPL P K+   + S QK 
Sbjct  60   NKSN-LNLKATELTLGLPGSQSPEREPKLCLLSSGKLDEKPLFPLLPLKDGICSSSLQKN  118

Query  657  VVTGNKRGFSDAMDEFSEGK  716
            + +GNKRGFSD +DEFSE K
Sbjct  119  IASGNKRGFSDTIDEFSELK  138



>gb|KHG08155.1| Auxin-responsive IAA9 -like protein [Gossypium arboreum]
 gb|KHG17373.1| Auxin-responsive IAA9 -like protein [Gossypium arboreum]
Length=376

 Score =   100 bits (248),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 81/139 (58%), Positives = 96/139 (69%), Gaps = 17/139 (12%)
 Frame = +3

Query  312  MSPPLLGVGEDGQSNVTHMASPISLDSVCQNGPELKEWNYMGLsdcssvdsstisstsen  491
            MSPPLLGV E+ QS+V+  +     + + +NG  LKE NY+GLSDCSSVDSS +S     
Sbjct  1    MSPPLLGVEEEVQSSVSSPSV----ECISENGMGLKERNYLGLSDCSSVDSSGVS-----  51

Query  492  nsGRGLNLRATELRLGLPGSQSPQRDSEPST----KLDEKLLFPLHPAKESNFTLSQKTV  659
                 LNL ATELRLGLPGSQSP+R++E       KLDEK LFPL P+K+   + SQK V
Sbjct  52   ---SNLNL-ATELRLGLPGSQSPERETEFCLLNLGKLDEKPLFPLLPSKDGICSSSQKNV  107

Query  660  VTGNKRGFSDAMDEFSEGK  716
            VTGNKRGFSD MD FSE K
Sbjct  108  VTGNKRGFSDTMDGFSEVK  126



>ref|XP_010666360.1| PREDICTED: auxin-responsive protein IAA8-like [Beta vulgaris 
subsp. vulgaris]
Length=365

 Score = 99.4 bits (246),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 69/135 (51%), Positives = 92/135 (68%), Gaps = 4/135 (3%)
 Frame = +3

Query  339  EDGQSNVTHMASPISLDSVCQNGPELKEWNYMGLsdcssvdsstisstsennsGRGLNLR  518
            EDGQS+ T      S +S+  N  EL+E NYMG SDCSS   S+  S +   S    NL+
Sbjct  8    EDGQSSGTLPFPASSAESILHNNSELREVNYMGYSDCSSSVDSSAISVASGESRSNYNLK  67

Query  519  ATELRLGLPGSQSPQRDSE----PSTKLDEKLLFPLHPAKESNFTLSQKTVVTGNKRGFS  686
            ATELRLGLPGSQSP RD+E     S+KLD+K LFPL+P  +   + S+ ++V+G+KRGF+
Sbjct  68   ATELRLGLPGSQSPGRDTELGPLTSSKLDKKPLFPLYPVSDGTSSSSRISIVSGHKRGFA  127

Query  687  DAMDEFSEGKFLSNS  731
            DA++ FS+GK LS+S
Sbjct  128  DAVNGFSKGKLLSSS  142



>gb|KHN04889.1| Auxin-responsive protein IAA8 [Glycine soja]
Length=289

 Score = 94.0 bits (232),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 49/79 (62%), Positives = 59/79 (75%), Gaps = 4/79 (5%)
 Frame = +3

Query  507  LNLRATELRLGLPGSQSPQRD----SEPSTKLDEKLLFPLHPAKESNFTLSQKTVVTGNK  674
            +NL+ATELRLGLPGSQSP+R+    S    KLDEK LFPL P K+     +QKTVV+GNK
Sbjct  1    MNLKATELRLGLPGSQSPEREPDLFSLSPAKLDEKPLFPLLPTKDGICLSAQKTVVSGNK  60

Query  675  RGFSDAMDEFSEGKFLSNS  731
            RGF+D MD FS+GKF  N+
Sbjct  61   RGFADTMDGFSQGKFAGNT  79



>ref|XP_006394000.1| hypothetical protein EUTSA_v10004532mg [Eutrema salsugineum]
 gb|ESQ31286.1| hypothetical protein EUTSA_v10004532mg [Eutrema salsugineum]
Length=337

 Score = 93.2 bits (230),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 69/132 (52%), Positives = 91/132 (69%), Gaps = 7/132 (5%)
 Frame = +3

Query  339  EDGQSNVTHMASPISLDSVCQN--GPELKEWNYMGLsdcssvdsstisstsennsGRGLN  512
            E+ QSNV+  +S  + + + +N  G  LKE NY+GLSDCSSV SST+S  +E++    ++
Sbjct  5    EELQSNVSVASSSPTSNCISRNTAGGGLKEHNYLGLSDCSSVGSSTLSGLAEDDKAT-IS  63

Query  513  LRATELRLGLPGSQSPQRDSE----PSTKLDEKLLFPLHPAKESNFTLSQKTVVTGNKRG  680
            L+ATEL LGLPG QSP RD++       KLDEK  FPL P+K+   + SQK +  GNKRG
Sbjct  64   LKATELTLGLPGPQSPARDTDLNLLSPAKLDEKTFFPLLPSKDEICSSSQKNIALGNKRG  123

Query  681  FSDAMDEFSEGK  716
            FSDAMD+FSE K
Sbjct  124  FSDAMDQFSEAK  135



>ref|NP_001237053.1| uncharacterized protein LOC100500373 [Glycine max]
 gb|ACU15430.1| unknown [Glycine max]
Length=193

 Score = 91.7 bits (226),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 71/134 (53%), Positives = 89/134 (66%), Gaps = 13/134 (10%)
 Frame = +3

Query  312  MSPPLLGVGEDGQSNVTHMASPIS--LDSVCQNGPELKEWNYMGLsdcssvdsstissts  485
            MSPPLL   ++GQ + + +AS  S  L+    N    KE NY+GLSDCSSVDSST+ + S
Sbjct  1    MSPPLLVTEDEGQCHASMVASASSPSLNCFSLNEAGFKECNYLGLSDCSSVDSSTVPNLS  60

Query  486  ennsGRGLNLRATELRLGLPGSQSPQRDSEPSTKLDEKLLFPLHPAKESNFTLSQKTVVT  665
            +      LNL+ATELRLGLPGSQSP+R++E         LF L   K+   +LSQKTVV+
Sbjct  61   DEKK-ENLNLKATELRLGLPGSQSPERETE---------LFSLSSTKDGICSLSQKTVVS  110

Query  666  GNKRGFSDAMD-EF  704
            GNKRGF+D MD EF
Sbjct  111  GNKRGFADTMDPEF  124



>ref|XP_006394001.1| hypothetical protein EUTSA_v10004532mg [Eutrema salsugineum]
 ref|XP_006394002.1| hypothetical protein EUTSA_v10004532mg [Eutrema salsugineum]
 dbj|BAJ33783.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ31287.1| hypothetical protein EUTSA_v10004532mg [Eutrema salsugineum]
 gb|ESQ31288.1| hypothetical protein EUTSA_v10004532mg [Eutrema salsugineum]
Length=339

 Score = 93.2 bits (230),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 69/132 (52%), Positives = 91/132 (69%), Gaps = 7/132 (5%)
 Frame = +3

Query  339  EDGQSNVTHMASPISLDSVCQN--GPELKEWNYMGLsdcssvdsstisstsennsGRGLN  512
            E+ QSNV+  +S  + + + +N  G  LKE NY+GLSDCSSV SST+S  +E++    ++
Sbjct  5    EELQSNVSVASSSPTSNCISRNTAGGGLKEHNYLGLSDCSSVGSSTLSGLAEDDKAT-IS  63

Query  513  LRATELRLGLPGSQSPQRDSE----PSTKLDEKLLFPLHPAKESNFTLSQKTVVTGNKRG  680
            L+ATEL LGLPG QSP RD++       KLDEK  FPL P+K+   + SQK +  GNKRG
Sbjct  64   LKATELTLGLPGPQSPARDTDLNLLSPAKLDEKTFFPLLPSKDEICSSSQKNIALGNKRG  123

Query  681  FSDAMDEFSEGK  716
            FSDAMD+FSE K
Sbjct  124  FSDAMDQFSEAK  135



>ref|XP_008440498.1| PREDICTED: auxin-responsive protein IAA9-like [Cucumis melo]
 ref|XP_008440499.1| PREDICTED: auxin-responsive protein IAA9-like [Cucumis melo]
Length=377

 Score = 93.6 bits (231),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 71/139 (51%), Positives = 90/139 (65%), Gaps = 5/139 (4%)
 Frame = +3

Query  312  MSPPLLGVGEDGQSNVTHMASPISLDSVCQNGPELKEWNYMGLsdcssvdsstisstsen  491
            MSPPLL   E+   NV  +A+  S+D   QNG + +E NY+ LS CSSVDSS +S+ SE 
Sbjct  1    MSPPLLNSVEEALGNVPVVAASPSMDCHSQNGTKFRERNYLRLSPCSSVDSSAVSNLSEE  60

Query  492  nsGRGLNLRATELRLGLPGSQSPQRDSE----PSTKLDEKLLFPLHPAKESNFTLSQKTV  659
            N    LNL+ATELRLGLPGS SP+RD E     S + DEK L  L P+ +     SQK +
Sbjct  61   NKSN-LNLKATELRLGLPGSLSPERDQEFTLISSGEPDEKTLLQLLPSTDGYSVASQKNI  119

Query  660  VTGNKRGFSDAMDEFSEGK  716
            + G+KRGFSD M+ +SE K
Sbjct  120  IAGSKRGFSDTMEGYSEVK  138



>ref|XP_007047689.1| Transcription factor, putative isoform 3, partial [Theobroma 
cacao]
 gb|EOX91846.1| Transcription factor, putative isoform 3, partial [Theobroma 
cacao]
Length=345

 Score = 93.2 bits (230),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 51/74 (69%), Positives = 58/74 (78%), Gaps = 4/74 (5%)
 Frame = +3

Query  507  LNLRATELRLGLPGSQSPQRDSE----PSTKLDEKLLFPLHPAKESNFTLSQKTVVTGNK  674
            LNL+ATELRLGLPGSQSP+R+ E     S KLDEK LFPL P+K+   + SQKTVV+GNK
Sbjct  30   LNLKATELRLGLPGSQSPEREPELCLLNSGKLDEKPLFPLLPSKDGICSSSQKTVVSGNK  89

Query  675  RGFSDAMDEFSEGK  716
            RGFSD MD FSE K
Sbjct  90   RGFSDTMDGFSEVK  103



>ref|XP_010521481.1| PREDICTED: auxin-responsive protein IAA8-like isoform X1 [Tarenaya 
hassleriana]
Length=352

 Score = 91.7 bits (226),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 69/132 (52%), Positives = 81/132 (61%), Gaps = 4/132 (3%)
 Frame = +3

Query  309  LMSPPLLGVGED--GQSNVTHMASPISLDSVCQNGPELKEWNYMGLsdcssvdsstisst  482
            LMSPPL GV E+   QSN    +  +S  S+     ELKE NYM LS+ S  D S  S  
Sbjct  2    LMSPPLRGVAEEEKAQSNNNATSLLVSSASMDNKISELKERNYMSLSESSPGDESNNSGV  61

Query  483  sennsGRGLNLRATELRLGLPGSQSPQRDSEPSTKLDEKLLFPLHPAKESNFTLSQKTVV  662
            S       ++L+ TELRLGLPGSQ  QR+  PS  LDEK LFPLHP  + + T S K VV
Sbjct  62   SIITDEIKISLKETELRLGLPGSQPLQREPSPSL-LDEKPLFPLHPTGDDHCT-SLKNVV  119

Query  663  TGNKRGFSDAMD  698
             GNKRGFSDAM+
Sbjct  120  FGNKRGFSDAME  131



>gb|AGV54485.1| auxin-responsive protein [Phaseolus vulgaris]
Length=352

 Score = 90.5 bits (223),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 72/146 (49%), Positives = 85/146 (58%), Gaps = 9/146 (6%)
 Frame = +3

Query  312  MSPPLLGVGEDGQSNVTHM---ASPISLDSVCQNGPELKEWNYMGLsdcssvdsstisst  482
            MSPP +   EDG S V+      S  SLD   QNG  LKE NY+GLSDCSSVDS   +  
Sbjct  1    MSPPAVVTEEDGLSKVSSTLASGSSQSLDCFSQNGAGLKERNYLGLSDCSSVDSCASTVP  60

Query  483  sennsGR-GLNLRATELRLGLPGSQSPQRD----SEPSTKLDEKLLFPLHPAKESNFTLS  647
               +  +  +NL+ATELRLGLPGSQSP+RD    S  S K+DEK LFPL P K+  F  S
Sbjct  61   GLGDEKKENMNLKATELRLGLPGSQSPERDPDLFSLSSAKIDEKPLFPLGPTKDGIFLSS  120

Query  648  QKTVVTGNKRG-FSDAMDEFSEGKFL  722
            +K       R    D MD FS+G  L
Sbjct  121  RKNCCFRQTRKVLPDTMDAFSQGNGL  146



>gb|ABY48132.1| GH1 protein [Medicago truncatula]
Length=335

 Score = 90.1 bits (222),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 49/78 (63%), Positives = 59/78 (76%), Gaps = 7/78 (9%)
 Frame = +3

Query  507  LNLRATELRLGLPGSQSPQRDSEPS---TKLDEKLLFPLHPAKESNFTLSQKTVVTGNKR  677
            LNL+ATELRLGLPGSQSP+R+ +     TKLDEK LFPL PAK+      QK VV+GNKR
Sbjct  51   LNLKATELRLGLPGSQSPEREMDSDFYLTKLDEKPLFPLLPAKDG----LQKNVVSGNKR  106

Query  678  GFSDAMDEFSEGKFLSNS  731
            GF+D +D FS+GKF  N+
Sbjct  107  GFADTVDGFSQGKFNGNT  124



>ref|XP_002862301.1| hypothetical protein ARALYDRAFT_920936 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH38559.1| hypothetical protein ARALYDRAFT_920936 [Arabidopsis lyrata subsp. 
lyrata]
Length=238

 Score = 89.4 bits (220),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 68/135 (50%), Positives = 92/135 (68%), Gaps = 6/135 (4%)
 Frame = +3

Query  327  LGVGEDGQSNVTHMASPISLDSVCQNGPE-LKEWNYMGLsdcssvdsstisstsennsGR  503
            +   E+ QSNV+  +S  + + + +N    LKE NY+GLSDCSSV SST+S  +E++   
Sbjct  1    MSTEEELQSNVSVASSSPTSNCISRNTLGGLKEHNYLGLSDCSSVGSSTLSLLAEDDKAT  60

Query  504  GLNLRATELRLGLPGSQSPQRDSEPS----TKLDEKLLFPLHPAKESNFTLSQKTVVTGN  671
             ++L+ATEL LGLPGSQSP RD+E +     KLDEK  FPL P+K+   + SQK   +GN
Sbjct  61   -ISLKATELTLGLPGSQSPARDTELNLLSPAKLDEKPFFPLLPSKDEICSSSQKNNASGN  119

Query  672  KRGFSDAMDEFSEGK  716
            KRGFSD MD+F+E K
Sbjct  120  KRGFSDTMDQFAEAK  134



>ref|XP_003612933.1| Auxin-responsive protein (Aux/IAA) [Medicago truncatula]
 gb|AES95891.1| auxin-responsive AUX/IAA family protein [Medicago truncatula]
Length=335

 Score = 90.1 bits (222),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 49/78 (63%), Positives = 59/78 (76%), Gaps = 7/78 (9%)
 Frame = +3

Query  507  LNLRATELRLGLPGSQSPQRDSEPS---TKLDEKLLFPLHPAKESNFTLSQKTVVTGNKR  677
            LNL+ATELRLGLPGSQSP+R+ +     TKLDEK LFPL PAK+      QK VV+GNKR
Sbjct  51   LNLKATELRLGLPGSQSPEREMDSDFYLTKLDEKPLFPLLPAKDG----LQKNVVSGNKR  106

Query  678  GFSDAMDEFSEGKFLSNS  731
            GF+D +D FS+GKF  N+
Sbjct  107  GFADTVDGFSQGKFNGNT  124



>gb|AFK38538.1| unknown [Lotus japonicus]
Length=318

 Score = 89.7 bits (221),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 58/106 (55%), Positives = 71/106 (67%), Gaps = 6/106 (6%)
 Frame = +3

Query  417  KEWNYMGLsdcssvdsstisstsennsGRG-LNLRATELRLGLPGSQSPQRDS----EPS  581
            KE+NYMGLS   S   S+    S ++  +  LNL+ATELRLGLPGSQSP+RDS      S
Sbjct  5    KEFNYMGLSSDCSSVDSSAPLPSFSDESKSNLNLKATELRLGLPGSQSPERDSNLCLRGS  64

Query  582  TKLDEKLLFPLHPAKESNFTLSQKTVVTGNKRGFSDAMDEFSEGKF  719
             + DEK LFPLHP  + + + S K  V G+KRGFSDAM+ FSEGK 
Sbjct  65   AQFDEKPLFPLHPVTDDHHS-SSKPAVLGSKRGFSDAMNGFSEGKL  109



>gb|ADL70577.1| indole-3-acetic acid inducible 9 [Arabidopsis thaliana]
Length=292

 Score = 89.0 bits (219),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 68/131 (52%), Positives = 90/131 (69%), Gaps = 6/131 (5%)
 Frame = +3

Query  339  EDGQSNVTHMASPISLDSVCQNG-PELKEWNYMGLsdcssvdsstisstsennsGRGLNL  515
            E+ QSNV+  +S  + + + +N    LKE NY+GLSDCSSV SST+S  +E++    ++L
Sbjct  5    EELQSNVSVASSSPTSNCISRNTLGGLKEHNYLGLSDCSSVGSSTLSPLAEDDKAT-ISL  63

Query  516  RATELRLGLPGSQSPQRDSE----PSTKLDEKLLFPLHPAKESNFTLSQKTVVTGNKRGF  683
            +ATEL LGLPGSQSP RD+E       KLDEK  FPL P+K+   + SQK   +GNKRGF
Sbjct  64   KATELTLGLPGSQSPARDTELNLLSPAKLDEKPFFPLLPSKDEICSSSQKNNASGNKRGF  123

Query  684  SDAMDEFSEGK  716
            SD MD+F+E K
Sbjct  124  SDTMDQFAEAK  134



>ref|XP_010683059.1| PREDICTED: auxin-responsive protein IAA9 [Beta vulgaris subsp. 
vulgaris]
Length=339

 Score = 89.4 bits (220),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 76/132 (58%), Positives = 89/132 (67%), Gaps = 12/132 (9%)
 Frame = +3

Query  312  MSPPLLGVGEDGQSNVTHMA-SPISLDSVCQNGPELKEWNYMGLsdcssvdsstisstse  488
            MSPPLLG+   GQSN   +  SP   +S       LKE NY GLSDCSSVDSS +SS SE
Sbjct  1    MSPPLLGLEGGGQSNDHSLVPSPTCAES------GLKELNYFGLSDCSSVDSSNVSSLSE  54

Query  489  nnsGR-GLNLRATELRLGLPGSQSPQRDSE----PSTKLDEKLLFPLHPAKESNFTLSQK  653
             N     LN +ATELRLGLPGSQSP+RDS+     ++KLDEK LFPL P K+   + SQK
Sbjct  55   ENKDSLNLNFKATELRLGLPGSQSPERDSDLCLLSASKLDEKPLFPLTPLKDGISSSSQK  114

Query  654  TVVTGNKRGFSD  689
              V+G+KRGFSD
Sbjct  115  AAVSGSKRGFSD  126



>ref|XP_010521482.1| PREDICTED: auxin-responsive protein IAA8-like isoform X2 [Tarenaya 
hassleriana]
Length=352

 Score = 89.4 bits (220),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 68/131 (52%), Positives = 80/131 (61%), Gaps = 4/131 (3%)
 Frame = +3

Query  309  LMSPPLLGVGED--GQSNVTHMASPISLDSVCQNGPELKEWNYMGLsdcssvdsstisst  482
            LMSPPL GV E+   QSN    +  +S  S+     ELKE NYM LS+ S  D S  S  
Sbjct  2    LMSPPLRGVAEEEKAQSNNNATSLLVSSASMDNKISELKERNYMSLSESSPGDESNNSGV  61

Query  483  sennsGRGLNLRATELRLGLPGSQSPQRDSEPSTKLDEKLLFPLHPAKESNFTLSQKTVV  662
            S       ++L+ TELRLGLPGSQ  QR+  PS  LDEK LFPLHP  + + T S K VV
Sbjct  62   SIITDEIKISLKETELRLGLPGSQPLQREPSPSL-LDEKPLFPLHPTGDDHCT-SLKNVV  119

Query  663  TGNKRGFSDAM  695
             GNKRGFSDA+
Sbjct  120  FGNKRGFSDAV  130



>gb|ADC29395.2| indole-3-acetic acid inducible 9 [Arabidopsis thaliana]
 gb|ADC29396.2| indole-3-acetic acid inducible 9 [Arabidopsis thaliana]
 gb|ADL70575.1| indole-3-acetic acid inducible 9 [Arabidopsis thaliana]
 gb|ADL70576.1| indole-3-acetic acid inducible 9 [Arabidopsis thaliana]
 gb|ADL70580.1| indole-3-acetic acid inducible 9 [Arabidopsis thaliana]
 gb|ADL70581.1| indole-3-acetic acid inducible 9 [Arabidopsis thaliana]
Length=303

 Score = 88.6 bits (218),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 68/131 (52%), Positives = 90/131 (69%), Gaps = 6/131 (5%)
 Frame = +3

Query  339  EDGQSNVTHMASPISLDSVCQNG-PELKEWNYMGLsdcssvdsstisstsennsGRGLNL  515
            E+ QSNV+  +S  + + + +N    LKE NY+GLSDCSSV SST+S  +E++    ++L
Sbjct  5    EELQSNVSVASSSPTSNCISRNTLGGLKEHNYLGLSDCSSVGSSTLSPLAEDDKAT-ISL  63

Query  516  RATELRLGLPGSQSPQRDSE----PSTKLDEKLLFPLHPAKESNFTLSQKTVVTGNKRGF  683
            +ATEL LGLPGSQSP RD+E       KLDEK  FPL P+K+   + SQK   +GNKRGF
Sbjct  64   KATELTLGLPGSQSPARDTELNLLSPAKLDEKPFFPLLPSKDEICSSSQKNNASGNKRGF  123

Query  684  SDAMDEFSEGK  716
            SD MD+F+E K
Sbjct  124  SDTMDQFAEAK  134



>ref|XP_002864969.1| auxin-induced protein IAA9 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH41228.1| auxin-induced protein IAA9 [Arabidopsis lyrata subsp. lyrata]
Length=338

 Score = 89.0 bits (219),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 68/131 (52%), Positives = 90/131 (69%), Gaps = 6/131 (5%)
 Frame = +3

Query  339  EDGQSNVTHMASPISLDSVCQNG-PELKEWNYMGLsdcssvdsstisstsennsGRGLNL  515
            E+ QSNV+  +S  + + + +N    LKE NY+GLSDCSSV SST+S  +E++    ++L
Sbjct  5    EELQSNVSVASSSPTSNCISRNTLGGLKEHNYLGLSDCSSVGSSTLSLLAEDDKAT-ISL  63

Query  516  RATELRLGLPGSQSPQRDSE----PSTKLDEKLLFPLHPAKESNFTLSQKTVVTGNKRGF  683
            +ATEL LGLPGSQSP RD+E       KLDEK  FPL P+K+   + SQK   +GNKRGF
Sbjct  64   KATELTLGLPGSQSPARDTELNLLSPAKLDEKPFFPLLPSKDEICSSSQKNNASGNKRGF  123

Query  684  SDAMDEFSEGK  716
            SD MD+F+E K
Sbjct  124  SDTMDQFAEAK  134



>gb|ABD98054.1| auxin-regulated protein [Striga asiatica]
Length=305

 Score = 88.6 bits (218),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 71/134 (53%), Positives = 85/134 (63%), Gaps = 15/134 (11%)
 Frame = +3

Query  312  MSPPLLGVGEDGQSNVTHMASPISLDSVCQNGPELKEWNYMGLsdcssvdsstisstsen  491
            M+PP  G+    Q N   MAS  S D + QN   LKE NY+GLSDCSSVDSST+SS+ + 
Sbjct  1    MTPPFSGIEGQNQFNAHLMASSSSADCITQNTLGLKERNYLGLSDCSSVDSSTVSSSPDE  60

Query  492  nsGRGLNLRATELRLGLPGSQSPQRDSEPS-----TKLDEKLLFPLHPAKESNFTLSQKT  656
                 LNL+ATELRLGLPGSQSP+RD + S      KLDEK LFPL P            
Sbjct  61   GK-TNLNLKATELRLGLPGSQSPKRDLDFSLLSSVNKLDEKQLFPLVP---------NTV  110

Query  657  VVTGNKRGFSDAMD  698
            +V+GNKRGFSD ++
Sbjct  111  IVSGNKRGFSDTVN  124



>gb|ADC29394.1| indole-3-acetic acid inducible 9 [Arabidopsis thaliana]
 gb|ADC29397.1| indole-3-acetic acid inducible 9 [Arabidopsis thaliana]
Length=300

 Score = 88.6 bits (218),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 68/131 (52%), Positives = 90/131 (69%), Gaps = 6/131 (5%)
 Frame = +3

Query  339  EDGQSNVTHMASPISLDSVCQNG-PELKEWNYMGLsdcssvdsstisstsennsGRGLNL  515
            E+ QSNV+  +S  + + + +N    LKE NY+GLSDCSSV SST+S  +E++    ++L
Sbjct  2    EELQSNVSVASSSPTSNCISRNTLGGLKEHNYLGLSDCSSVGSSTLSPLAEDDKAT-ISL  60

Query  516  RATELRLGLPGSQSPQRDSE----PSTKLDEKLLFPLHPAKESNFTLSQKTVVTGNKRGF  683
            +ATEL LGLPGSQSP RD+E       KLDEK  FPL P+K+   + SQK   +GNKRGF
Sbjct  61   KATELTLGLPGSQSPARDTELNLLSPAKLDEKPFFPLLPSKDEICSSSQKNNASGNKRGF  120

Query  684  SDAMDEFSEGK  716
            SD MD+F+E K
Sbjct  121  SDTMDQFAEAK  131



>gb|ADL70578.1| indole-3-acetic acid inducible 9 [Arabidopsis thaliana]
 gb|ADL70582.1| indole-3-acetic acid inducible 9 [Arabidopsis thaliana]
Length=303

 Score = 88.6 bits (218),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 68/131 (52%), Positives = 90/131 (69%), Gaps = 6/131 (5%)
 Frame = +3

Query  339  EDGQSNVTHMASPISLDSVCQNG-PELKEWNYMGLsdcssvdsstisstsennsGRGLNL  515
            E+ QSNV+  +S  + + + +N    LKE NY+GLSDCSSV SST+S  +E++    ++L
Sbjct  5    EELQSNVSVASSSPTSNCISRNTLGGLKEHNYLGLSDCSSVGSSTLSPLAEDDKAT-ISL  63

Query  516  RATELRLGLPGSQSPQRDSE----PSTKLDEKLLFPLHPAKESNFTLSQKTVVTGNKRGF  683
            +ATEL LGLPGSQSP RD+E       KLDEK  FPL P+K+   + SQK   +GNKRGF
Sbjct  64   KATELTLGLPGSQSPARDTELNLLSPAKLDEKPFFPLLPSKDEICSSSQKNNASGNKRGF  123

Query  684  SDAMDEFSEGK  716
            SD MD+F+E K
Sbjct  124  SDTMDQFAEAK  134



>ref|XP_004143431.1| PREDICTED: auxin-responsive protein IAA8-like [Cucumis sativus]
 gb|KGN48671.1| ARF domain class transcription factor [Cucumis sativus]
Length=380

 Score = 89.4 bits (220),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 70/139 (50%), Positives = 89/139 (64%), Gaps = 5/139 (4%)
 Frame = +3

Query  312  MSPPLLGVGEDGQSNVTHMASPISLDSVCQNGPELKEWNYMGLsdcssvdsstisstsen  491
            MSPPLL   E+   NV  +A+  S+D   QNG + +E NY+ LS CSSVDSS +S+ SE 
Sbjct  1    MSPPLLNSVEEALGNVPVVAASPSMDCHSQNGTKFRERNYLRLSPCSSVDSSAVSNLSEE  60

Query  492  nsGRGLNLRATELRLGLPGSQSPQRDSE----PSTKLDEKLLFPLHPAKESNFTLSQKTV  659
            N    LNL+ATELRLGLPGS SP+RD E     S + DEK L  L P+ +      QK +
Sbjct  61   NKS-NLNLKATELRLGLPGSLSPERDQEFTLISSVEPDEKTLLQLLPSTDGYSVSLQKNI  119

Query  660  VTGNKRGFSDAMDEFSEGK  716
            V+G+KR FSD M+ +SE K
Sbjct  120  VSGSKRVFSDTMEGYSEVK  138



>gb|ADC29398.1| indole-3-acetic acid inducible 9 [Arabidopsis thaliana]
Length=300

 Score = 88.6 bits (218),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 68/131 (52%), Positives = 90/131 (69%), Gaps = 6/131 (5%)
 Frame = +3

Query  339  EDGQSNVTHMASPISLDSVCQNG-PELKEWNYMGLsdcssvdsstisstsennsGRGLNL  515
            E+ QSNV+  +S  + + + +N    LKE NY+GLSDCSSV SST+S  +E++    ++L
Sbjct  2    EELQSNVSVASSSPTSNCISRNTLGGLKEHNYLGLSDCSSVGSSTLSPLAEDDKAT-ISL  60

Query  516  RATELRLGLPGSQSPQRDSE----PSTKLDEKLLFPLHPAKESNFTLSQKTVVTGNKRGF  683
            +ATEL LGLPGSQSP RD+E       KLDEK  FPL P+K+   + SQK   +GNKRGF
Sbjct  61   KATELTLGLPGSQSPARDTELNLLSPAKLDEKPFFPLLPSKDEICSSSQKNNASGNKRGF  120

Query  684  SDAMDEFSEGK  716
            SD MD+F+E K
Sbjct  121  SDTMDQFAEAK  131



>gb|ADL70583.1| indole-3-acetic acid inducible 9 [Arabidopsis thaliana]
 gb|ADL70584.1| indole-3-acetic acid inducible 9 [Arabidopsis thaliana]
Length=302

 Score = 88.6 bits (218),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 68/131 (52%), Positives = 90/131 (69%), Gaps = 6/131 (5%)
 Frame = +3

Query  339  EDGQSNVTHMASPISLDSVCQNG-PELKEWNYMGLsdcssvdsstisstsennsGRGLNL  515
            E+ QSNV+  +S  + + + +N    LKE NY+GLSDCSSV SST+S  +E++    ++L
Sbjct  4    EELQSNVSVASSSPTSNCISRNTLGGLKEHNYLGLSDCSSVGSSTLSPLAEDDKAT-ISL  62

Query  516  RATELRLGLPGSQSPQRDSE----PSTKLDEKLLFPLHPAKESNFTLSQKTVVTGNKRGF  683
            +ATEL LGLPGSQSP RD+E       KLDEK  FPL P+K+   + SQK   +GNKRGF
Sbjct  63   KATELTLGLPGSQSPARDTELNLLSPAKLDEKPFFPLLPSKDEICSSSQKNNASGNKRGF  122

Query  684  SDAMDEFSEGK  716
            SD MD+F+E K
Sbjct  123  SDTMDQFAEAK  133



>gb|ADL70586.1| indole-3-acetic acid inducible 9 [Arabidopsis thaliana]
Length=302

 Score = 88.2 bits (217),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 68/131 (52%), Positives = 90/131 (69%), Gaps = 6/131 (5%)
 Frame = +3

Query  339  EDGQSNVTHMASPISLDSVCQNG-PELKEWNYMGLsdcssvdsstisstsennsGRGLNL  515
            E+ QSNV+  +S  + + + +N    LKE NY+GLSDCSSV SST+S  +E++    ++L
Sbjct  4    EELQSNVSVASSSPTSNCISRNTLGGLKEHNYLGLSDCSSVGSSTLSPLAEDDKAT-ISL  62

Query  516  RATELRLGLPGSQSPQRDSE----PSTKLDEKLLFPLHPAKESNFTLSQKTVVTGNKRGF  683
            +ATEL LGLPGSQSP RD+E       KLDEK  FPL P+K+   + SQK   +GNKRGF
Sbjct  63   KATELTLGLPGSQSPARDTELNLLSPAKLDEKPFFPLLPSKDEICSSSQKNNASGNKRGF  122

Query  684  SDAMDEFSEGK  716
            SD MD+F+E K
Sbjct  123  SDTMDQFAEAK  133



>dbj|BAB10673.1| auxin-induced protein IAA9 [Arabidopsis thaliana]
Length=333

 Score = 88.6 bits (218),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 68/131 (52%), Positives = 90/131 (69%), Gaps = 6/131 (5%)
 Frame = +3

Query  339  EDGQSNVTHMASPISLDSVCQNG-PELKEWNYMGLsdcssvdsstisstsennsGRGLNL  515
            E+ QSNV+  +S  + + + +N    LKE NY+GLSDCSSV SST+S  +E++    ++L
Sbjct  5    EELQSNVSVASSSPTSNCISRNTLGGLKEHNYLGLSDCSSVGSSTLSPLAEDDKAT-ISL  63

Query  516  RATELRLGLPGSQSPQRDSE----PSTKLDEKLLFPLHPAKESNFTLSQKTVVTGNKRGF  683
            +ATEL LGLPGSQSP RD+E       KLDEK  FPL P+K+   + SQK   +GNKRGF
Sbjct  64   KATELTLGLPGSQSPARDTELNLLSPAKLDEKPFFPLLPSKDEICSSSQKNNASGNKRGF  123

Query  684  SDAMDEFSEGK  716
            SD MD+F+E K
Sbjct  124  SDTMDQFAEAK  134



>ref|NP_569017.2| auxin-responsive protein IAA9 [Arabidopsis thaliana]
 gb|AED98085.1| auxin-responsive protein IAA9 [Arabidopsis thaliana]
Length=336

 Score = 88.2 bits (217),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 68/131 (52%), Positives = 90/131 (69%), Gaps = 6/131 (5%)
 Frame = +3

Query  339  EDGQSNVTHMASPISLDSVCQNG-PELKEWNYMGLsdcssvdsstisstsennsGRGLNL  515
            E+ QSNV+  +S  + + + +N    LKE NY+GLSDCSSV SST+S  +E++    ++L
Sbjct  5    EELQSNVSVASSSPTSNCISRNTLGGLKEHNYLGLSDCSSVGSSTLSPLAEDDKAT-ISL  63

Query  516  RATELRLGLPGSQSPQRDSE----PSTKLDEKLLFPLHPAKESNFTLSQKTVVTGNKRGF  683
            +ATEL LGLPGSQSP RD+E       KLDEK  FPL P+K+   + SQK   +GNKRGF
Sbjct  64   KATELTLGLPGSQSPARDTELNLLSPAKLDEKPFFPLLPSKDEICSSSQKNNASGNKRGF  123

Query  684  SDAMDEFSEGK  716
            SD MD+F+E K
Sbjct  124  SDTMDQFAEAK  134



>ref|NP_851275.1| auxin-responsive protein IAA9 [Arabidopsis thaliana]
 sp|Q38827.1|IAA9_ARATH RecName: Full=Auxin-responsive protein IAA9; AltName: Full=Indoleacetic 
acid-induced protein 9 [Arabidopsis thaliana]
 gb|AAG50093.1|AF334715_1 auxin-induced protein IAA9 [Arabidopsis thaliana]
 gb|AAC49050.1| IAA9 [Arabidopsis thaliana]
 emb|CAA16692.1| auxin-induced protein IAA9 [Arabidopsis thaliana]
 gb|AED98084.1| auxin-responsive protein IAA9 [Arabidopsis thaliana]
Length=338

 Score = 88.2 bits (217),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 68/131 (52%), Positives = 90/131 (69%), Gaps = 6/131 (5%)
 Frame = +3

Query  339  EDGQSNVTHMASPISLDSVCQNG-PELKEWNYMGLsdcssvdsstisstsennsGRGLNL  515
            E+ QSNV+  +S  + + + +N    LKE NY+GLSDCSSV SST+S  +E++    ++L
Sbjct  5    EELQSNVSVASSSPTSNCISRNTLGGLKEHNYLGLSDCSSVGSSTLSPLAEDDKAT-ISL  63

Query  516  RATELRLGLPGSQSPQRDSE----PSTKLDEKLLFPLHPAKESNFTLSQKTVVTGNKRGF  683
            +ATEL LGLPGSQSP RD+E       KLDEK  FPL P+K+   + SQK   +GNKRGF
Sbjct  64   KATELTLGLPGSQSPARDTELNLLSPAKLDEKPFFPLLPSKDEICSSSQKNNASGNKRGF  123

Query  684  SDAMDEFSEGK  716
            SD MD+F+E K
Sbjct  124  SDTMDQFAEAK  134



>gb|AFK49555.1| unknown [Medicago truncatula]
Length=99

 Score = 84.3 bits (207),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 46/72 (64%), Positives = 55/72 (76%), Gaps = 7/72 (10%)
 Frame = +3

Query  507  LNLRATELRLGLPGSQSPQRDSEPS---TKLDEKLLFPLHPAKESNFTLSQKTVVTGNKR  677
            LNL+ATELRLGLPGSQSP+R+ +     TKLDEK LFPL PAK+      QK VV+GNKR
Sbjct  32   LNLKATELRLGLPGSQSPEREMDSDFYLTKLDEKPLFPLLPAKDG----LQKNVVSGNKR  87

Query  678  GFSDAMDEFSEG  713
            GF+D +D FS+G
Sbjct  88   GFADTVDGFSQG  99



>gb|ADL70579.1| indole-3-acetic acid inducible 9 [Arabidopsis thaliana]
Length=302

 Score = 87.8 bits (216),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 68/131 (52%), Positives = 90/131 (69%), Gaps = 6/131 (5%)
 Frame = +3

Query  339  EDGQSNVTHMASPISLDSVCQNG-PELKEWNYMGLsdcssvdsstisstsennsGRGLNL  515
            E+ QSNV+  +S  + + + +N    LKE NY+GLSDCSSV SST+S  +E++    ++L
Sbjct  4    EELQSNVSVASSSPTSNCISRNTLGGLKEHNYLGLSDCSSVGSSTLSPLAEDDKAT-ISL  62

Query  516  RATELRLGLPGSQSPQRDSE----PSTKLDEKLLFPLHPAKESNFTLSQKTVVTGNKRGF  683
            +ATEL LGLPGSQSP RD+E       KLDEK  FPL P+K+   + SQK   +GNKRGF
Sbjct  63   KATELTLGLPGSQSPVRDTELNLLSPAKLDEKPFFPLLPSKDEICSSSQKNNASGNKRGF  122

Query  684  SDAMDEFSEGK  716
            SD MD+F+E K
Sbjct  123  SDTMDQFAEAK  133



>ref|XP_010484401.1| PREDICTED: auxin-responsive protein IAA9 [Camelina sativa]
 ref|XP_010484402.1| PREDICTED: auxin-responsive protein IAA9 [Camelina sativa]
Length=343

 Score = 88.2 bits (217),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 64/135 (47%), Positives = 86/135 (64%), Gaps = 9/135 (7%)
 Frame = +3

Query  339  EDGQSNVTHMASPISLDSVCQN---GPELKEWNYMGLsdcssvdsstisstsennsGRG-  506
            E+ QSNV+  +S  + + + +    G  LKE NY+GLSDCSS   S+  ST      +  
Sbjct  5    EELQSNVSVASSSPTSNCISRGTTLGGGLKEHNYLGLSDCSSSVGSSTLSTGLTEDDKAS  64

Query  507  LNLRATELRLGLPGSQSPQRDSE-----PSTKLDEKLLFPLHPAKESNFTLSQKTVVTGN  671
            ++L+ATEL LGLPGS+SP RD++     P  KLDEK  FPL P+K+   + SQK   +GN
Sbjct  65   ISLKATELTLGLPGSRSPARDTDLNLMTPPVKLDEKPFFPLLPSKDEICSSSQKINASGN  124

Query  672  KRGFSDAMDEFSEGK  716
            KRGFSD MD+F+E K
Sbjct  125  KRGFSDTMDQFAEAK  139



>ref|XP_006279648.1| hypothetical protein CARUB_v10026736mg [Capsella rubella]
 gb|EOA12546.1| hypothetical protein CARUB_v10026736mg [Capsella rubella]
Length=339

 Score = 87.8 bits (216),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 62/131 (47%), Positives = 85/131 (65%), Gaps = 5/131 (4%)
 Frame = +3

Query  339  EDGQSNVTHMASPISLDSVCQNGPE-LKEWNYMGLsdcssvdsstisstsennsGRGLNL  515
            E+ QSNV+  +S  + + + ++    LKE NY+GLSDCSS   S+  S   ++    ++L
Sbjct  5    EELQSNVSVASSSPTSNCISRSTVGGLKEHNYLGLSDCSSSVGSSTLSGLADDDKATISL  64

Query  516  RATELRLGLPGSQSPQRDSE----PSTKLDEKLLFPLHPAKESNFTLSQKTVVTGNKRGF  683
            +ATEL LGLPGSQSP RD++       KLDEK  FPL P+K+   + SQK   +GNKRGF
Sbjct  65   KATELTLGLPGSQSPARDTDLNLMTPVKLDEKPFFPLLPSKDEICSSSQKNNASGNKRGF  124

Query  684  SDAMDEFSEGK  716
            SD MD+F+E K
Sbjct  125  SDTMDQFAEAK  135



>gb|AAM64650.1| auxin-induced protein IAA9 [Arabidopsis thaliana]
Length=338

 Score = 87.4 bits (215),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 67/131 (51%), Positives = 90/131 (69%), Gaps = 6/131 (5%)
 Frame = +3

Query  339  EDGQSNVTHMASPISLDSVCQNG-PELKEWNYMGLsdcssvdsstisstsennsGRGLNL  515
            E+ Q+NV+  +S  + + + +N    LKE NY+GLSDCSSV SST+S  +E++    ++L
Sbjct  5    EELQTNVSVASSSPTSNCISRNTLGGLKEHNYLGLSDCSSVGSSTLSPLAEDDKAT-ISL  63

Query  516  RATELRLGLPGSQSPQRDSE----PSTKLDEKLLFPLHPAKESNFTLSQKTVVTGNKRGF  683
            +ATEL LGLPGSQSP RD+E       KLDEK  FPL P+K+   + SQK   +GNKRGF
Sbjct  64   KATELTLGLPGSQSPARDTELNLLSPAKLDEKPFFPLLPSKDEICSSSQKNNASGNKRGF  123

Query  684  SDAMDEFSEGK  716
            SD MD+F+E K
Sbjct  124  SDTMDQFAEAK  134



>ref|XP_010472259.1| PREDICTED: auxin-responsive protein IAA8-like [Camelina sativa]
Length=326

 Score = 85.9 bits (211),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 63/110 (57%), Positives = 79/110 (72%), Gaps = 8/110 (7%)
 Frame = +3

Query  408  PELKEWNYMGLsdcssvdsstisstsennsGRGLNLRATELRLGLPGSQSPQRDSE----  575
            P LKE NY+GLSDCSSVDSSTI +  ++     LN +ATELRLGLP SQSP+R+++    
Sbjct  18   PGLKERNYLGLSDCSSVDSSTIHNRVQDGEKSNLNFKATELRLGLPESQSPERETDFGLL  77

Query  576  -PSTKLDEKLLFPLHPAKE--SNFTLSQKTVVTGNKRGFSDAMDEFSEGK  716
             P T  DEKLLFPL P+K+  ++ T+  K VV+GNKRGF+D  DEFS  K
Sbjct  78   SPRTP-DEKLLFPLLPSKDIAASATIGHKNVVSGNKRGFADTWDEFSSVK  126



>ref|XP_010429195.1| PREDICTED: auxin-responsive protein IAA8 [Camelina sativa]
Length=326

 Score = 85.9 bits (211),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 63/110 (57%), Positives = 79/110 (72%), Gaps = 8/110 (7%)
 Frame = +3

Query  408  PELKEWNYMGLsdcssvdsstisstsennsGRGLNLRATELRLGLPGSQSPQRDSE----  575
            P LKE NY+GLSDCSSVDSSTI +  ++     LN +ATELRLGLP SQSP+R+++    
Sbjct  18   PGLKERNYLGLSDCSSVDSSTIHNRVQDGEKSNLNFKATELRLGLPESQSPERETDFGLL  77

Query  576  -PSTKLDEKLLFPLHPAKE--SNFTLSQKTVVTGNKRGFSDAMDEFSEGK  716
             P T  DEKLLFPL P+K+  ++ T+  K VV+GNKRGF+D  DEFS  K
Sbjct  78   SPRTP-DEKLLFPLLPSKDTAASATIGHKNVVSGNKRGFADTWDEFSSVK  126



>gb|ADL70574.1| indole-3-acetic acid inducible 9 [Arabidopsis thaliana]
 gb|ADL70585.1| indole-3-acetic acid inducible 9 [Arabidopsis thaliana]
Length=286

 Score = 85.1 bits (209),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 61/105 (58%), Positives = 76/105 (72%), Gaps = 5/105 (5%)
 Frame = +3

Query  414  LKEWNYMGLsdcssvdsstisstsennsGRGLNLRATELRLGLPGSQSPQRDSE----PS  581
            LKE NY+GLSDCSSV SST+S  +E++    ++L+ATEL LGLPGSQSP RD+E      
Sbjct  14   LKEHNYLGLSDCSSVGSSTLSPLAEDDKAT-ISLKATELTLGLPGSQSPARDTELNLLSP  72

Query  582  TKLDEKLLFPLHPAKESNFTLSQKTVVTGNKRGFSDAMDEFSEGK  716
             KLDEK  FPL P+K+   + SQK   +GNKRGFSD MD+F+E K
Sbjct  73   AKLDEKPFFPLLPSKDEICSSSQKNNASGNKRGFSDTMDQFAEAK  117



>ref|XP_010518881.1| PREDICTED: auxin-responsive protein IAA9-like [Tarenaya hassleriana]
Length=312

 Score = 84.7 bits (208),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 62/130 (48%), Positives = 81/130 (62%), Gaps = 19/130 (15%)
 Frame = +3

Query  312  MSPPLLGVGEDGQSNVT-HMASPISLDSVCQNGPELKEWNYMGLsdcssvdsstisstse  488
            MSPP+  V E+ QSNV+   +SPIS + + +N   LKE NY+GLSDCSS           
Sbjct  1    MSPPIAEVEEELQSNVSVASSSPIS-ECLSRNTSGLKEHNYLGLSDCSSTLPDLSEDDKS  59

Query  489  nnsGRGLNLRATELRLGLPGSQSPQRDSEPSTKLDEKLLFPLHPAKESNFTLSQKTVVTG  668
                 G++L+ATELRLGLPGSQSP+RD    T L+EK  FPL P+K+         + +G
Sbjct  60   -----GISLKATELRLGLPGSQSPERD----TDLNEKPFFPLVPSKDG--------ICSG  102

Query  669  NKRGFSDAMD  698
            NKRGFSD ++
Sbjct  103  NKRGFSDTVE  112



>emb|CDY45607.1| BnaCnng13150D [Brassica napus]
Length=329

 Score = 84.3 bits (207),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 63/126 (50%), Positives = 86/126 (68%), Gaps = 11/126 (9%)
 Frame = +3

Query  339  EDGQSNVTHMASPISLDSVCQNGPELKEWNYMGLsdcssvdsstisstsennsGRGLNLR  518
            E+ QSNV+  +S  ++  V      LKE NY+GLSDCSSV SS +S  ++++    ++L+
Sbjct  5    EELQSNVSVASSTRNIVGV------LKEHNYLGLSDCSSVGSSNLSGLADDDKAT-ISLK  57

Query  519  ATELRLGLPGSQSPQRDSEPST----KLDEKLLFPLHPAKESNFTLSQKTVVTGNKRGFS  686
            ATEL LGLPGSQSP RD+E ++    KLDEKL FPL P+K+     SQK + +GNKRGF+
Sbjct  58   ATELTLGLPGSQSPARDTELNSLGPAKLDEKLFFPLLPSKDEICPSSQKNIASGNKRGFA  117

Query  687  DAMDEF  704
            D MD+ 
Sbjct  118  DTMDKV  123



>ref|XP_006294567.1| hypothetical protein CARUB_v10023602mg [Capsella rubella]
 gb|EOA27465.1| hypothetical protein CARUB_v10023602mg [Capsella rubella]
Length=323

 Score = 82.8 bits (203),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 62/109 (57%), Positives = 77/109 (71%), Gaps = 7/109 (6%)
 Frame = +3

Query  408  PELKEWNYMGLsdcssvdsstisstsennsGRGLNLRATELRLGLPGSQSPQRDSE----  575
            P LKE NY+GLSDCSSVDSSTI +   +     L  +ATELRLGLP SQSP+R+++    
Sbjct  17   PGLKERNYLGLSDCSSVDSSTIHNRVPDVEKSNLIFKATELRLGLPESQSPERETDFGLL  76

Query  576  -PSTKLDEKLLFPLHPAKE-SNFTLSQKTVVTGNKRGFSDAMDEFSEGK  716
             P T  DEKLLFPL P+K+ ++ T+  K VV+GNKRGF+D  DEFS  K
Sbjct  77   SPRTP-DEKLLFPLLPSKDTASATIGHKNVVSGNKRGFADTWDEFSSVK  124



>ref|XP_006294565.1| hypothetical protein CARUB_v10023602mg [Capsella rubella]
 ref|XP_006294566.1| hypothetical protein CARUB_v10023602mg [Capsella rubella]
 gb|EOA27463.1| hypothetical protein CARUB_v10023602mg [Capsella rubella]
 gb|EOA27464.1| hypothetical protein CARUB_v10023602mg [Capsella rubella]
Length=330

 Score = 82.8 bits (203),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 62/109 (57%), Positives = 77/109 (71%), Gaps = 7/109 (6%)
 Frame = +3

Query  408  PELKEWNYMGLsdcssvdsstisstsennsGRGLNLRATELRLGLPGSQSPQRDSE----  575
            P LKE NY+GLSDCSSVDSSTI +   +     L  +ATELRLGLP SQSP+R+++    
Sbjct  17   PGLKERNYLGLSDCSSVDSSTIHNRVPDVEKSNLIFKATELRLGLPESQSPERETDFGLL  76

Query  576  -PSTKLDEKLLFPLHPAKES-NFTLSQKTVVTGNKRGFSDAMDEFSEGK  716
             P T  DEKLLFPL P+K++ + T+  K VV+GNKRGF+D  DEFS  K
Sbjct  77   SPRTP-DEKLLFPLLPSKDTASATIGHKNVVSGNKRGFADTWDEFSSVK  124



>ref|XP_002878628.1| indoleacetic acid-induced protein 8 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH54887.1| indoleacetic acid-induced protein 8 [Arabidopsis lyrata subsp. 
lyrata]
Length=313

 Score = 82.4 bits (202),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 65/114 (57%), Positives = 81/114 (71%), Gaps = 11/114 (10%)
 Frame = +3

Query  384  LDSVCQNGPELKEWNYMGLsdcssvdsstisstsennsGRGLNLRATELRLGLPGSQSPQ  563
            L SV +  P LKE NY+GLSDCSSVDSSTI +  ++     LN +ATELRLGLP S+SP+
Sbjct  5    LLSVDKEEPGLKERNYLGLSDCSSVDSSTIPNVEKS----NLNFKATELRLGLPESESPE  60

Query  564  RDSE-----PSTKLDEKLLFPLHPAKE-SNFTLSQKTVVTGNKRGFSDAMDEFS  707
            R+++     P T LDEKLLFPL P K+ ++ T   K VV+GNKRGF+D  DEFS
Sbjct  61   RETDFGLLSPRT-LDEKLLFPLLPCKDNTSATTGHKNVVSGNKRGFADTWDEFS  113



>ref|XP_006404728.1| hypothetical protein EUTSA_v10000236mg [Eutrema salsugineum]
 ref|XP_006404729.1| hypothetical protein EUTSA_v10000236mg [Eutrema salsugineum]
 dbj|BAJ33826.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ46181.1| hypothetical protein EUTSA_v10000236mg [Eutrema salsugineum]
 gb|ESQ46182.1| hypothetical protein EUTSA_v10000236mg [Eutrema salsugineum]
Length=334

 Score = 81.6 bits (200),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 65/111 (59%), Positives = 75/111 (68%), Gaps = 9/111 (8%)
 Frame = +3

Query  408  PELKEWNYMGLsdcssvdsstisstsennsGRG-LNLRATELRLGLPGSQSPQRDSE---  575
            P LKE NY+GLSDCSSVDSSTI +       +  LN +ATELRLGLP SQSP+R+++   
Sbjct  17   PGLKERNYLGLSDCSSVDSSTIPNVVVPEIEKSNLNFKATELRLGLPESQSPERETDFGL  76

Query  576  --PSTKLDEKLLFPLHPAKE--SNFTLSQKTVVTGNKRGFSDAMDEFSEGK  716
              P T  DEKLLFPL P K+  S  T   K VV+GNKRGFSD  DEFS  K
Sbjct  77   LSPRTP-DEKLLFPLLPCKDHASGATTVHKNVVSGNKRGFSDTWDEFSAVK  126



>gb|ADL70561.1| indole-3-acetic acid inducible 8 [Arabidopsis thaliana]
Length=249

 Score = 80.1 bits (196),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 62/106 (58%), Positives = 77/106 (73%), Gaps = 10/106 (9%)
 Frame = +3

Query  408  PELKEWNYMGLsdcssvdsstisstsennsGRGLNLRATELRLGLPGSQSPQRDSE----  575
            P LKE NY+GLSDCSSVDSSTI +    ++   LN +ATELRLGLP SQSP+R+++    
Sbjct  10   PCLKERNYLGLSDCSSVDSSTIPNVVGKSN---LNFKATELRLGLPESQSPERETDFGLL  66

Query  576  -PSTKLDEKLLFPLHPAKES-NFTLSQKTVVTGNKRGFSDAMDEFS  707
             P T  DEKLLFPL P+K++ + T   K VV+GNKRGF+D  DEFS
Sbjct  67   SPRTP-DEKLLFPLLPSKDNGSATTGHKNVVSGNKRGFADTWDEFS  111



>gb|ADL70565.1| indole-3-acetic acid inducible 8 [Arabidopsis thaliana]
Length=247

 Score = 80.1 bits (196),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 62/106 (58%), Positives = 77/106 (73%), Gaps = 10/106 (9%)
 Frame = +3

Query  408  PELKEWNYMGLsdcssvdsstisstsennsGRGLNLRATELRLGLPGSQSPQRDSE----  575
            P LKE NY+GLSDCSSVDSSTI +    ++   LN +ATELRLGLP SQSP+R+++    
Sbjct  7    PCLKERNYLGLSDCSSVDSSTIPNVVGKSN---LNFKATELRLGLPESQSPERETDFGLL  63

Query  576  -PSTKLDEKLLFPLHPAKES-NFTLSQKTVVTGNKRGFSDAMDEFS  707
             P T  DEKLLFPL P+K++ + T   K VV+GNKRGF+D  DEFS
Sbjct  64   SPRTP-DEKLLFPLLPSKDNGSATTGHKNVVSGNKRGFADTWDEFS  108



>gb|ADL70572.1| indole-3-acetic acid inducible 8 [Arabidopsis thaliana]
Length=252

 Score = 80.1 bits (196),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 62/106 (58%), Positives = 77/106 (73%), Gaps = 10/106 (9%)
 Frame = +3

Query  408  PELKEWNYMGLsdcssvdsstisstsennsGRGLNLRATELRLGLPGSQSPQRDSE----  575
            P LKE NY+GLSDCSSVDSSTI +    ++   LN +ATELRLGLP SQSP+R+++    
Sbjct  12   PCLKERNYLGLSDCSSVDSSTIPNVVGKSN---LNFKATELRLGLPESQSPERETDFGLL  68

Query  576  -PSTKLDEKLLFPLHPAKES-NFTLSQKTVVTGNKRGFSDAMDEFS  707
             P T  DEKLLFPL P+K++ + T   K VV+GNKRGF+D  DEFS
Sbjct  69   SPRTP-DEKLLFPLLPSKDNGSATTGHKNVVSGNKRGFADTWDEFS  113



>gb|ADL70573.1| indole-3-acetic acid inducible 8 [Arabidopsis thaliana]
Length=253

 Score = 80.1 bits (196),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 62/106 (58%), Positives = 77/106 (73%), Gaps = 10/106 (9%)
 Frame = +3

Query  408  PELKEWNYMGLsdcssvdsstisstsennsGRGLNLRATELRLGLPGSQSPQRDSE----  575
            P LKE NY+GLSDCSSVDSSTI +    ++   LN +ATELRLGLP SQSP+R+++    
Sbjct  13   PCLKERNYLGLSDCSSVDSSTIPNVVGKSN---LNFKATELRLGLPESQSPERETDFGLL  69

Query  576  -PSTKLDEKLLFPLHPAKES-NFTLSQKTVVTGNKRGFSDAMDEFS  707
             P T  DEKLLFPL P+K++ + T   K VV+GNKRGF+D  DEFS
Sbjct  70   SPRTP-DEKLLFPLLPSKDNGSATTGHKNVVSGNKRGFADTWDEFS  114



>gb|ADL70566.1| indole-3-acetic acid inducible 8 [Arabidopsis thaliana]
Length=251

 Score = 80.1 bits (196),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 62/106 (58%), Positives = 77/106 (73%), Gaps = 10/106 (9%)
 Frame = +3

Query  408  PELKEWNYMGLsdcssvdsstisstsennsGRGLNLRATELRLGLPGSQSPQRDSE----  575
            P LKE NY+GLSDCSSVDSSTI +    ++   LN +ATELRLGLP SQSP+R+++    
Sbjct  11   PCLKERNYLGLSDCSSVDSSTIPNVVGKSN---LNFKATELRLGLPESQSPERETDFGLL  67

Query  576  -PSTKLDEKLLFPLHPAKES-NFTLSQKTVVTGNKRGFSDAMDEFS  707
             P T  DEKLLFPL P+K++ + T   K VV+GNKRGF+D  DEFS
Sbjct  68   SPRTP-DEKLLFPLLPSKDNGSATTGHKNVVSGNKRGFADTWDEFS  112



>gb|ADC29390.2| indole-3-acetic acid inducible 8 [Arabidopsis thaliana]
Length=257

 Score = 80.1 bits (196),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 62/106 (58%), Positives = 76/106 (72%), Gaps = 10/106 (9%)
 Frame = +3

Query  408  PELKEWNYMGLsdcssvdsstisstsennsGRGLNLRATELRLGLPGSQSPQRDSE----  575
            P LKE NY+GLSDCSSVDSSTI +    +    LN +ATELRLGLP SQSP+R+++    
Sbjct  15   PCLKERNYLGLSDCSSVDSSTIPNVVGKS---NLNFKATELRLGLPESQSPERETDFGLL  71

Query  576  -PSTKLDEKLLFPLHPAKES-NFTLSQKTVVTGNKRGFSDAMDEFS  707
             P T  DEKLLFPL P+K++ + T   K VV+GNKRGF+D  DEFS
Sbjct  72   SPRTP-DEKLLFPLLPSKDNGSATTGHKNVVSGNKRGFADTWDEFS  116



>gb|ADC29393.2| indole-3-acetic acid inducible 8 [Arabidopsis thaliana]
Length=253

 Score = 80.1 bits (196),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 62/106 (58%), Positives = 77/106 (73%), Gaps = 10/106 (9%)
 Frame = +3

Query  408  PELKEWNYMGLsdcssvdsstisstsennsGRGLNLRATELRLGLPGSQSPQRDSE----  575
            P LKE NY+GLSDCSSVDSSTI +    ++   LN +ATELRLGLP SQSP+R+++    
Sbjct  11   PCLKERNYLGLSDCSSVDSSTIPNVVGKSN---LNFKATELRLGLPESQSPERETDFGLL  67

Query  576  -PSTKLDEKLLFPLHPAKES-NFTLSQKTVVTGNKRGFSDAMDEFS  707
             P T  DEKLLFPL P+K++ + T   K VV+GNKRGF+D  DEFS
Sbjct  68   SPRTP-DEKLLFPLLPSKDNGSATTGHKNVVSGNKRGFADTWDEFS  112



>gb|ADL70564.1| indole-3-acetic acid inducible 8 [Arabidopsis thaliana]
Length=252

 Score = 80.1 bits (196),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 62/106 (58%), Positives = 77/106 (73%), Gaps = 10/106 (9%)
 Frame = +3

Query  408  PELKEWNYMGLsdcssvdsstisstsennsGRGLNLRATELRLGLPGSQSPQRDSE----  575
            P LKE NY+GLSDCSSVDSSTI +    ++   LN +ATELRLGLP SQSP+R+++    
Sbjct  10   PCLKERNYLGLSDCSSVDSSTIPNVVGKSN---LNFKATELRLGLPESQSPERETDFGLL  66

Query  576  -PSTKLDEKLLFPLHPAKES-NFTLSQKTVVTGNKRGFSDAMDEFS  707
             P T  DEKLLFPL P+K++ + T   K VV+GNKRGF+D  DEFS
Sbjct  67   SPRTP-DEKLLFPLLPSKDNGSATTGHKNVVSGNKRGFADTWDEFS  111



>gb|ADL70563.1| indole-3-acetic acid inducible 8 [Arabidopsis thaliana]
Length=250

 Score = 80.1 bits (196),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 62/106 (58%), Positives = 77/106 (73%), Gaps = 10/106 (9%)
 Frame = +3

Query  408  PELKEWNYMGLsdcssvdsstisstsennsGRGLNLRATELRLGLPGSQSPQRDSE----  575
            P LKE NY+GLSDCSSVDSSTI +    ++   LN +ATELRLGLP SQSP+R+++    
Sbjct  8    PCLKERNYLGLSDCSSVDSSTIPNVVGKSN---LNFKATELRLGLPESQSPERETDFGLL  64

Query  576  -PSTKLDEKLLFPLHPAKES-NFTLSQKTVVTGNKRGFSDAMDEFS  707
             P T  DEKLLFPL P+K++ + T   K VV+GNKRGF+D  DEFS
Sbjct  65   SPRTP-DEKLLFPLLPSKDNGSATTGHKNVVSGNKRGFADTWDEFS  109



>gb|EPS59988.1| auxin-regulated protein [Genlisea aurea]
Length=317

 Score = 80.9 bits (198),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 67/137 (49%), Positives = 82/137 (60%), Gaps = 26/137 (19%)
 Frame = +3

Query  312  MSPPLLGVGEDGQSNVTHMASPISLDSVCQNGPELKEWNYMGLsdcssvdsstisstsen  491
            MSPP L  G  G +     AS  S++S+      LKE NY+G SDCSSVDSS +   ++ 
Sbjct  1    MSPPCLTAGIGGSNGSVMAASSGSVNSLV-----LKEINYLGFSDCSSVDSSALPEDNKT  55

Query  492  nsGRGLNLRATELRLGLPGSQSPQRDSEPSTKLDEKLLFPLHPAKESNFTLSQK--TVVT  665
                 +NL+ATELRLGLPGSQSP R        DEK LFPL P+       SQK   +V+
Sbjct  56   T----MNLKATELRLGLPGSQSPDR--------DEKQLFPLVPS-------SQKPVIIVS  96

Query  666  GNKRGFSDAMDEFSEGK  716
            GNKRGFSD +D F+E K
Sbjct  97   GNKRGFSDTVDCFTESK  113



>gb|ADL70567.1| indole-3-acetic acid inducible 8 [Arabidopsis thaliana]
Length=259

 Score = 80.1 bits (196),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 62/106 (58%), Positives = 76/106 (72%), Gaps = 10/106 (9%)
 Frame = +3

Query  408  PELKEWNYMGLsdcssvdsstisstsennsGRGLNLRATELRLGLPGSQSPQRDSE----  575
            P LKE NY+GLSDCSSVDSSTI +    +    LN +ATELRLGLP SQSP+R+++    
Sbjct  17   PCLKERNYLGLSDCSSVDSSTIPNVVGKS---NLNFKATELRLGLPESQSPERETDFGLL  73

Query  576  -PSTKLDEKLLFPLHPAKES-NFTLSQKTVVTGNKRGFSDAMDEFS  707
             P T  DEKLLFPL P+K++ + T   K VV+GNKRGF+D  DEFS
Sbjct  74   SPRTP-DEKLLFPLLPSKDNGSATTGHKNVVSGNKRGFADTWDEFS  118



>gb|ADL70569.1| indole-3-acetic acid inducible 8 [Arabidopsis thaliana]
Length=263

 Score = 80.1 bits (196),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 62/106 (58%), Positives = 76/106 (72%), Gaps = 10/106 (9%)
 Frame = +3

Query  408  PELKEWNYMGLsdcssvdsstisstsennsGRGLNLRATELRLGLPGSQSPQRDSE----  575
            P LKE NY+GLSDCSSVDSSTI +    +    LN +ATELRLGLP SQSP+R+++    
Sbjct  17   PCLKERNYLGLSDCSSVDSSTIPNVVGKS---NLNFKATELRLGLPESQSPERETDFGLL  73

Query  576  -PSTKLDEKLLFPLHPAKES-NFTLSQKTVVTGNKRGFSDAMDEFS  707
             P T  DEKLLFPL P+K++ + T   K VV+GNKRGF+D  DEFS
Sbjct  74   SPRTP-DEKLLFPLLPSKDNGSATTGHKNVVSGNKRGFADTWDEFS  118



>gb|ADL70571.1| indole-3-acetic acid inducible 8 [Arabidopsis thaliana]
Length=262

 Score = 80.1 bits (196),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 62/106 (58%), Positives = 76/106 (72%), Gaps = 10/106 (9%)
 Frame = +3

Query  408  PELKEWNYMGLsdcssvdsstisstsennsGRGLNLRATELRLGLPGSQSPQRDSE----  575
            P LKE NY+GLSDCSSVDSSTI +    +    LN +ATELRLGLP SQSP+R+++    
Sbjct  17   PCLKERNYLGLSDCSSVDSSTIPNVVGKS---NLNFKATELRLGLPESQSPERETDFGLL  73

Query  576  -PSTKLDEKLLFPLHPAKES-NFTLSQKTVVTGNKRGFSDAMDEFS  707
             P T  DEKLLFPL P+K++ + T   K VV+GNKRGF+D  DEFS
Sbjct  74   SPRTP-DEKLLFPLLPSKDNGSATTGHKNVVSGNKRGFADTWDEFS  118



>gb|ADL70570.1| indole-3-acetic acid inducible 8 [Arabidopsis thaliana]
Length=278

 Score = 80.1 bits (196),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 62/106 (58%), Positives = 76/106 (72%), Gaps = 10/106 (9%)
 Frame = +3

Query  408  PELKEWNYMGLsdcssvdsstisstsennsGRGLNLRATELRLGLPGSQSPQRDSE----  575
            P LKE NY+GLSDCSSVDSSTI +    +    LN +ATELRLGLP SQSP+R+++    
Sbjct  17   PCLKERNYLGLSDCSSVDSSTIPNVVGKS---NLNFKATELRLGLPESQSPERETDFGLL  73

Query  576  -PSTKLDEKLLFPLHPAKES-NFTLSQKTVVTGNKRGFSDAMDEFS  707
             P T  DEKLLFPL P+K++ + T   K VV+GNKRGF+D  DEFS
Sbjct  74   SPRTP-DEKLLFPLLPSKDNGSATTGHKNVVSGNKRGFADTWDEFS  118



>ref|NP_179852.1| auxin-responsive protein IAA8 [Arabidopsis thaliana]
 ref|NP_001077943.1| auxin-responsive protein IAA8 [Arabidopsis thaliana]
 sp|Q38826.1|IAA8_ARATH RecName: Full=Auxin-responsive protein IAA8; AltName: Full=Indoleacetic 
acid-induced protein 8 [Arabidopsis thaliana]
 gb|AAG50092.1|AF334714_1 auxin-regulated protein IAA8 [Arabidopsis thaliana]
 gb|AAC49049.1| IAA8 [Arabidopsis thaliana]
 gb|AAD15575.1| auxin-regulated protein (IAA8) [Arabidopsis thaliana]
 gb|AAL24387.1| auxin-regulated protein (IAA8) [Arabidopsis thaliana]
 gb|AAL49895.1| auxin-regulated protein IAA8 [Arabidopsis thaliana]
 gb|AAM20092.1| auxin-regulated protein IAA8 [Arabidopsis thaliana]
 gb|AAM47990.1| auxin-regulated protein IAA8 [Arabidopsis thaliana]
 gb|AAM65174.1| auxin-regulated protein IAA8 [Arabidopsis thaliana]
 gb|AEC07336.1| auxin-responsive protein IAA8 [Arabidopsis thaliana]
 gb|AEC07338.1| auxin-responsive protein IAA8 [Arabidopsis thaliana]
Length=321

 Score = 79.7 bits (195),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 62/106 (58%), Positives = 76/106 (72%), Gaps = 10/106 (9%)
 Frame = +3

Query  408  PELKEWNYMGLsdcssvdsstisstsennsGRGLNLRATELRLGLPGSQSPQRDSE----  575
            P LKE NY+GLSDCSSVDSSTI +    +    LN +ATELRLGLP SQSP+R+++    
Sbjct  17   PCLKERNYLGLSDCSSVDSSTIPNVVGKS---NLNFKATELRLGLPESQSPERETDFGLL  73

Query  576  -PSTKLDEKLLFPLHPAKES-NFTLSQKTVVTGNKRGFSDAMDEFS  707
             P T  DEKLLFPL P+K++ + T   K VV+GNKRGF+D  DEFS
Sbjct  74   SPRTP-DEKLLFPLLPSKDNGSATTGHKNVVSGNKRGFADTWDEFS  118



>ref|NP_850028.1| auxin-responsive protein IAA8 [Arabidopsis thaliana]
 gb|AEC07337.1| auxin-responsive protein IAA8 [Arabidopsis thaliana]
Length=319

 Score = 79.7 bits (195),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 62/106 (58%), Positives = 76/106 (72%), Gaps = 10/106 (9%)
 Frame = +3

Query  408  PELKEWNYMGLsdcssvdsstisstsennsGRGLNLRATELRLGLPGSQSPQRDSE----  575
            P LKE NY+GLSDCSSVDSSTI +    +    LN +ATELRLGLP SQSP+R+++    
Sbjct  17   PCLKERNYLGLSDCSSVDSSTIPNVVGKS---NLNFKATELRLGLPESQSPERETDFGLL  73

Query  576  -PSTKLDEKLLFPLHPAKES-NFTLSQKTVVTGNKRGFSDAMDEFS  707
             P T  DEKLLFPL P+K++ + T   K VV+GNKRGF+D  DEFS
Sbjct  74   SPRTP-DEKLLFPLLPSKDNGSATTGHKNVVSGNKRGFADTWDEFS  118



>ref|NP_001189579.1| auxin-responsive protein IAA8 [Arabidopsis thaliana]
 gb|AEC07339.1| auxin-responsive protein IAA8 [Arabidopsis thaliana]
Length=338

 Score = 80.1 bits (196),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 62/106 (58%), Positives = 76/106 (72%), Gaps = 10/106 (9%)
 Frame = +3

Query  408  PELKEWNYMGLsdcssvdsstisstsennsGRGLNLRATELRLGLPGSQSPQRDSE----  575
            P LKE NY+GLSDCSSVDSSTI +    +    LN +ATELRLGLP SQSP+R+++    
Sbjct  34   PCLKERNYLGLSDCSSVDSSTIPNVVGKS---NLNFKATELRLGLPESQSPERETDFGLL  90

Query  576  -PSTKLDEKLLFPLHPAKES-NFTLSQKTVVTGNKRGFSDAMDEFS  707
             P T  DEKLLFPL P+K++ + T   K VV+GNKRGF+D  DEFS
Sbjct  91   SPRTP-DEKLLFPLLPSKDNGSATTGHKNVVSGNKRGFADTWDEFS  135



>gb|ADL70562.1| indole-3-acetic acid inducible 8 [Arabidopsis thaliana]
Length=226

 Score = 78.6 bits (192),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 61/104 (59%), Positives = 76/104 (73%), Gaps = 10/104 (10%)
 Frame = +3

Query  414  LKEWNYMGLsdcssvdsstisstsennsGRGLNLRATELRLGLPGSQSPQRDSE-----P  578
            LKE NY+GLSDCSSVDSSTI +    ++   LN +ATELRLGLP SQSP+R+++     P
Sbjct  1    LKERNYLGLSDCSSVDSSTIPNVVGKSN---LNFKATELRLGLPESQSPERETDFGLLSP  57

Query  579  STKLDEKLLFPLHPAKES-NFTLSQKTVVTGNKRGFSDAMDEFS  707
             T  DEKLLFPL P+K++ + T   K VV+GNKRGF+D  DEFS
Sbjct  58   RTP-DEKLLFPLLPSKDNGSATTGHKNVVSGNKRGFADTWDEFS  100



>gb|ADC29389.2| indole-3-acetic acid inducible 8 [Arabidopsis thaliana]
Length=221

 Score = 78.6 bits (192),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 61/104 (59%), Positives = 75/104 (72%), Gaps = 10/104 (10%)
 Frame = +3

Query  414  LKEWNYMGLsdcssvdsstisstsennsGRGLNLRATELRLGLPGSQSPQRDSE-----P  578
            LKE NY+GLSDCSSVDSSTI +    +    LN +ATELRLGLP SQSP+R+++     P
Sbjct  1    LKERNYLGLSDCSSVDSSTIPNVVGKS---NLNFKATELRLGLPESQSPERETDFGLLSP  57

Query  579  STKLDEKLLFPLHPAKES-NFTLSQKTVVTGNKRGFSDAMDEFS  707
             T  DEKLLFPL P+K++ + T   K VV+GNKRGF+D  DEFS
Sbjct  58   RTP-DEKLLFPLLPSKDNGSATTGHKNVVSGNKRGFADTWDEFS  100



>ref|XP_010463449.1| PREDICTED: auxin-responsive protein IAA9-like isoform X1 [Camelina 
sativa]
Length=339

 Score = 79.7 bits (195),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 60/131 (46%), Positives = 81/131 (62%), Gaps = 5/131 (4%)
 Frame = +3

Query  339  EDGQSNVTHMASPISLDSVCQNGP-ELKEWNYMGLsdcssvdsstisstsennsGRG-LN  512
            E+ QSNV+  +S  + + + +     LKE NY+GLSDCSS   S+  S       +  ++
Sbjct  5    EELQSNVSVASSSPTSNCISRGTTVALKEHNYLGLSDCSSSVGSSTLSAGLTEDDKASIS  64

Query  513  LRATELRLGLPGSQSPQRD---SEPSTKLDEKLLFPLHPAKESNFTLSQKTVVTGNKRGF  683
            L+ATEL LGLPGSQ+   D    + S KLDEK  FPL P+K+   + SQK   +GNKRGF
Sbjct  65   LKATELTLGLPGSQARDTDLNLMKNSVKLDEKPFFPLLPSKDEICSSSQKNNASGNKRGF  124

Query  684  SDAMDEFSEGK  716
            SD MD+F+E K
Sbjct  125  SDTMDQFAEAK  135



>ref|XP_006850381.1| PREDICTED: auxin-responsive protein IAA9 [Amborella trichopoda]
 ref|XP_011625576.1| PREDICTED: auxin-responsive protein IAA9 [Amborella trichopoda]
 ref|XP_011625577.1| PREDICTED: auxin-responsive protein IAA9 [Amborella trichopoda]
 ref|XP_011625578.1| PREDICTED: auxin-responsive protein IAA9 [Amborella trichopoda]
 gb|ERN11962.1| hypothetical protein AMTR_s00184p00030540 [Amborella trichopoda]
Length=393

 Score = 80.1 bits (196),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 72/142 (51%), Positives = 87/142 (61%), Gaps = 8/142 (6%)
 Frame = +3

Query  312  MSPPLLGVGEDGQSNVTHMASPISLDSVCQNGPELKEWNYMGLsdcssvdsstisstsen  491
            MSPPL  V E     V  + S  S +++  N   L+E NYMGLSD SS++SS I+   E 
Sbjct  1    MSPPLGHVEEGLGKGVPSLISSASSENLSNNNSGLREHNYMGLSDASSLESSVITCPLEE  60

Query  492  nsGRGLNLRATELRLGLPGSQSPQRDSE----PSTKLDEKLLFPLHPAKE--SNFTLSQK  653
                 LNL+ TELRLGLPGS+SP RD E    PS KLDEK LFPL P KE  S     + 
Sbjct  61   KED-SLNLKETELRLGLPGSRSPVRDPELCLLPSLKLDEKALFPLAPLKENTSEEKNGRN  119

Query  654  TVVTGNKRGFSDAMDE-FSEGK  716
             + +GNKRGFSDA+D+ F E K
Sbjct  120  GIFSGNKRGFSDAIDDGFLEAK  141



>ref|XP_010555426.1| PREDICTED: auxin-responsive protein IAA8-like [Tarenaya hassleriana]
 ref|XP_010555427.1| PREDICTED: auxin-responsive protein IAA8-like [Tarenaya hassleriana]
Length=360

 Score = 79.3 bits (194),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 61/138 (44%), Positives = 78/138 (57%), Gaps = 22/138 (16%)
 Frame = +3

Query  312  MSPPLLGVGEDGQSNVTHMASPISLDSVCQNGPELKEWNYMGLsdcssvdsstisstsen  491
            M+PPLL V ++          P   + V Q    LKE NY+          S+   +  +
Sbjct  1    MAPPLLTVEKE--------VVPSQDNHVHQYAFGLKEHNYL-----VRSVDSSTLCSVPD  47

Query  492  nsGRG-LNLRATELRLGLPGSQSPQRDS-----EPSTKLDEKLLFPLHPAKESNFTLSQK  653
            N G+G LN +ATELRLGLPG QSP+R+S      P T  DEKLLFPL  +K+    +  K
Sbjct  48   NEGKGNLNFKATELRLGLPGLQSPERESNFALLNPRTP-DEKLLFPLSASKDP--AIVHK  104

Query  654  TVVTGNKRGFSDAMDEFS  707
             VV+GNKRGFSD +DEFS
Sbjct  105  NVVSGNKRGFSDTLDEFS  122



>gb|AAM76222.1| putative IAA-responsive protein 9 [Gossypium hirsutum]
Length=122

 Score = 75.5 bits (184),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 36/51 (71%), Positives = 43/51 (84%), Gaps = 0/51 (0%)
 Frame = +3

Query  579  STKLDEKLLFPLHPAKESNFTLSQKTVVTGNKRGFSDAMDEFSEGKFLSNS  731
            S++LDEK LFPLHP+ + +   SQK VV+GNKRGFSDAMD FSEGKFLS+S
Sbjct  10   SSQLDEKPLFPLHPSSDGHCFASQKNVVSGNKRGFSDAMDGFSEGKFLSDS  60



>ref|XP_010527157.1| PREDICTED: auxin-responsive protein IAA8, partial [Tarenaya hassleriana]
Length=354

 Score = 78.6 bits (192),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 62/112 (55%), Positives = 80/112 (71%), Gaps = 7/112 (6%)
 Frame = +3

Query  393  VCQNGPELKEWNYMGLsdcssvdsstisstsennsGRGLNLRATELRLGLPGSQSPQRDS  572
            + Q+   LKE NY+GLSDCSSVDSST+ +  ++  G  LN++ATELRLGLPGS+S + +S
Sbjct  9    IPQSALSLKERNYLGLSDCSSVDSSTVPNVPDDEKG-NLNVKATELRLGLPGSRSSEGES  67

Query  573  E---PSTKL-DEKLLFPLHPAKESNFTLSQKTVVTGNKRGFSDAMDEFSEGK  716
            +   PS +  DEKLLFPL P+K+       K VV+ NKRGFSD +DEFSE K
Sbjct  68   DFGLPSPRTPDEKLLFPLAPSKDP--ATGHKNVVSRNKRGFSDTLDEFSEVK  117



>gb|AAM76224.1| putative IAA-responsive protein 9 [Gossypioides kirkii]
Length=122

 Score = 75.1 bits (183),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 36/51 (71%), Positives = 43/51 (84%), Gaps = 0/51 (0%)
 Frame = +3

Query  579  STKLDEKLLFPLHPAKESNFTLSQKTVVTGNKRGFSDAMDEFSEGKFLSNS  731
            S++LDEK LFPLHP+ + +   SQK VV+GNKRGFSDAMD FSEGKFLS+S
Sbjct  10   SSQLDEKPLFPLHPSSDVHCFASQKNVVSGNKRGFSDAMDGFSEGKFLSDS  60



>gb|ADL70568.1| indole-3-acetic acid inducible 8 [Arabidopsis thaliana]
Length=225

 Score = 77.0 bits (188),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 60/103 (58%), Positives = 75/103 (73%), Gaps = 10/103 (10%)
 Frame = +3

Query  417  KEWNYMGLsdcssvdsstisstsennsGRGLNLRATELRLGLPGSQSPQRDSE-----PS  581
            KE NY+GLSDCSSVDSSTI +    ++   LN +ATELRLGLP SQSP+R+++     P 
Sbjct  1    KERNYLGLSDCSSVDSSTIPNVVGKSN---LNFKATELRLGLPESQSPERETDFGLLSPR  57

Query  582  TKLDEKLLFPLHPAKES-NFTLSQKTVVTGNKRGFSDAMDEFS  707
            T  DEKLLFPL P+K++ + T   K VV+GNKRGF+D  DEFS
Sbjct  58   TP-DEKLLFPLLPSKDNGSATTGHKNVVSGNKRGFADTWDEFS  99



>gb|AAM76223.1| putative IAA-responsive protein 9 [Gossypium hirsutum]
Length=122

 Score = 74.7 bits (182),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 35/51 (69%), Positives = 43/51 (84%), Gaps = 0/51 (0%)
 Frame = +3

Query  579  STKLDEKLLFPLHPAKESNFTLSQKTVVTGNKRGFSDAMDEFSEGKFLSNS  731
            S++LDEK  FPLHP+ + +   SQK+VV+GNKRGFSDAMD FSEGKFLS+S
Sbjct  10   SSQLDEKPFFPLHPSSDGHCFASQKSVVSGNKRGFSDAMDGFSEGKFLSDS  60



>gb|AAM76220.1| putative IAA-responsive protein 9 [Gossypium herbaceum]
Length=122

 Score = 74.3 bits (181),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 35/51 (69%), Positives = 43/51 (84%), Gaps = 0/51 (0%)
 Frame = +3

Query  579  STKLDEKLLFPLHPAKESNFTLSQKTVVTGNKRGFSDAMDEFSEGKFLSNS  731
            S++LDEK LFPLHP+ + +   SQK VV+GNKRGFSDAMD FSEGKFL++S
Sbjct  10   SSQLDEKPLFPLHPSSDGHCFASQKNVVSGNKRGFSDAMDGFSEGKFLADS  60



>gb|ADC29392.2| indole-3-acetic acid inducible 8 [Arabidopsis thaliana]
Length=224

 Score = 76.3 bits (186),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 43/73 (59%), Positives = 54/73 (74%), Gaps = 7/73 (10%)
 Frame = +3

Query  507  LNLRATELRLGLPGSQSPQRDSE-----PSTKLDEKLLFPLHPAKES-NFTLSQKTVVTG  668
            LN +ATELRLGLP SQSP+R+++     P T  DEKLLFPL P+K++ + T   K VV+G
Sbjct  23   LNFKATELRLGLPESQSPERETDFGLLSPRTP-DEKLLFPLLPSKDNGSATTGHKNVVSG  81

Query  669  NKRGFSDAMDEFS  707
            NKRGF+D  DEFS
Sbjct  82   NKRGFADTWDEFS  94



>gb|ADC29391.2| indole-3-acetic acid inducible 8 [Arabidopsis thaliana]
Length=229

 Score = 76.3 bits (186),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 43/73 (59%), Positives = 54/73 (74%), Gaps = 7/73 (10%)
 Frame = +3

Query  507  LNLRATELRLGLPGSQSPQRDSE-----PSTKLDEKLLFPLHPAKES-NFTLSQKTVVTG  668
            LN +ATELRLGLP SQSP+R+++     P T  DEKLLFPL P+K++ + T   K VV+G
Sbjct  23   LNFKATELRLGLPESQSPERETDFGLLSPRTP-DEKLLFPLLPSKDNGSATTGHKNVVSG  81

Query  669  NKRGFSDAMDEFS  707
            NKRGF+D  DEFS
Sbjct  82   NKRGFADTWDEFS  94



>gb|AAM76221.1| putative IAA-responsive protein 9 [Gossypium raimondii]
Length=122

 Score = 73.6 bits (179),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 35/51 (69%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = +3

Query  579  STKLDEKLLFPLHPAKESNFTLSQKTVVTGNKRGFSDAMDEFSEGKFLSNS  731
            S++LDEK  FPLHP+ + +   SQK VV+GNKRGFSDAMD FSEGKFLS+S
Sbjct  10   SSQLDEKPFFPLHPSSDGHCFASQKNVVSGNKRGFSDAMDGFSEGKFLSDS  60



>ref|XP_010417025.1| PREDICTED: auxin-responsive protein IAA8-like [Camelina sativa]
Length=327

 Score = 76.6 bits (187),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 44/77 (57%), Positives = 54/77 (70%), Gaps = 8/77 (10%)
 Frame = +3

Query  507  LNLRATELRLGLPGSQSPQRDSE-----PSTKLDEKLLFPLHPAKE--SNFTLSQKTVVT  665
            LN +ATELRLGLP SQSP+R+++     P T  DEKLLFPL P K+  ++ T   K VV+
Sbjct  52   LNFKATELRLGLPESQSPERETDFGLLSPRTP-DEKLLFPLLPCKDTAASATTEHKNVVS  110

Query  666  GNKRGFSDAMDEFSEGK  716
            GNKRGF+D  DEFS  K
Sbjct  111  GNKRGFADTWDEFSSVK  127



>ref|XP_010444576.1| PREDICTED: auxin-responsive protein IAA9-like [Camelina sativa]
Length=341

 Score = 75.5 bits (184),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 62/137 (45%), Positives = 79/137 (58%), Gaps = 15/137 (11%)
 Frame = +3

Query  339  EDGQSNVTHMASP-----ISLDSVCQNGPELKEWNYMGLsdcssvdsstisstsennsGR  503
            E+ QSNV+  +S      IS  +       LKE NY+GLSDCSS   S+  S       +
Sbjct  5    EELQSNVSVASSSPTSNCISRGTTVSVCGGLKEHNYLGLSDCSSSVGSSTLSAGLVEDDK  64

Query  504  G-LNLRATELRLGLPGSQSPQRDSE-----PSTKLDEKLLFPLHPAKESNFTLSQKTVVT  665
               +L+ATEL LGLPGS    RD++     P  KLDEK  FPL P+K+   + SQK   +
Sbjct  65   ATFSLKATELTLGLPGS----RDTDLNLMTPPVKLDEKPFFPLLPSKDDICSSSQKNNAS  120

Query  666  GNKRGFSDAMDEFSEGK  716
            GNKRGFSD MD+F+E K
Sbjct  121  GNKRGFSDTMDQFAEAK  137



>emb|CDY68170.1| BnaCnng57860D [Brassica napus]
Length=311

 Score = 74.7 bits (182),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 60/119 (50%), Positives = 79/119 (66%), Gaps = 6/119 (5%)
 Frame = +3

Query  339  EDGQSNVTHMASPISLDSVCQNGPELKEWNYMGLsdcssvdsstisstsennsGRGLNLR  518
            E+ QSNV+  +S  + + + + G  LK  NY GLSD SSV+SST+S   E++    ++L+
Sbjct  5    EELQSNVSVASSSPTSNCISKGG-GLKVHNYFGLSDSSSVESSTLSRNVEDDKAT-ISLK  62

Query  519  ATELRLGLPGSQSPQRDSEPSTKLDEKLLFPLHPAKESNFTLSQKTVVTGNKRGFSDAM  695
            ATEL LGLPGSQSP R++E    LDEK  FPL P K+  F+ S K +  GNKRGFSD M
Sbjct  63   ATELTLGLPGSQSPARETE----LDEKPFFPLLPTKDEIFSSSHKNIGPGNKRGFSDTM  117



>ref|XP_009150656.1| PREDICTED: auxin-responsive protein IAA9-like isoform X2 [Brassica 
rapa]
Length=330

 Score = 74.7 bits (182),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 56/102 (55%), Positives = 72/102 (71%), Gaps = 6/102 (6%)
 Frame = +3

Query  414  LKEWNYMGLsdcssvdsstisstsennsGRGLNLRATELRLGLPGSQSPQRDSEPS----  581
            LKE NY+GLSDCSSV SS +S  ++++    ++L+ATEL LGLPGSQSP RD+E +    
Sbjct  24   LKEHNYLGLSDCSSVGSSNLSGLADDDKAT-ISLKATELTLGLPGSQSPARDTELNLLGP  82

Query  582  TKLDEKLLFPLHPAK-ESNFTLSQKTVVTGNKRGFSDAMDEF  704
             KLDEK  FPL P+K E   + S K + +GNKRGFSD MD+ 
Sbjct  83   AKLDEKPFFPLLPSKDEMCSSSSHKNIASGNKRGFSDTMDKV  124



>emb|CDY08767.1| BnaA06g24570D [Brassica napus]
Length=332

 Score = 74.7 bits (182),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 56/102 (55%), Positives = 72/102 (71%), Gaps = 6/102 (6%)
 Frame = +3

Query  414  LKEWNYMGLsdcssvdsstisstsennsGRGLNLRATELRLGLPGSQSPQRDSEPS----  581
            LKE NY+GLSDCSSV SS +S  ++++    ++L+ATEL LGLPGSQSP RD+E +    
Sbjct  24   LKEHNYLGLSDCSSVGSSNLSGLADDDKAT-ISLKATELTLGLPGSQSPARDTELNLLGP  82

Query  582  TKLDEKLLFPLHPAK-ESNFTLSQKTVVTGNKRGFSDAMDEF  704
             KLDEK  FPL P+K E   + S K + +GNKRGFSD MD+ 
Sbjct  83   AKLDEKPFFPLLPSKDEMCSSSSHKNIASGNKRGFSDTMDKV  124



>ref|XP_009150655.1| PREDICTED: auxin-responsive protein IAA9-like isoform X1 [Brassica 
rapa]
Length=332

 Score = 74.7 bits (182),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 56/102 (55%), Positives = 72/102 (71%), Gaps = 6/102 (6%)
 Frame = +3

Query  414  LKEWNYMGLsdcssvdsstisstsennsGRGLNLRATELRLGLPGSQSPQRDSEPS----  581
            LKE NY+GLSDCSSV SS +S  ++++    ++L+ATEL LGLPGSQSP RD+E +    
Sbjct  24   LKEHNYLGLSDCSSVGSSNLSGLADDDKAT-ISLKATELTLGLPGSQSPARDTELNLLGP  82

Query  582  TKLDEKLLFPLHPAK-ESNFTLSQKTVVTGNKRGFSDAMDEF  704
             KLDEK  FPL P+K E   + S K + +GNKRGFSD MD+ 
Sbjct  83   AKLDEKPFFPLLPSKDEMCSSSSHKNIASGNKRGFSDTMDKV  124



>emb|CDY18679.1| BnaA09g07160D [Brassica napus]
Length=312

 Score = 64.7 bits (156),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 58/119 (49%), Positives = 76/119 (64%), Gaps = 12/119 (10%)
 Frame = +3

Query  339  EDGQSNVTHMASPISLDSVCQNGPELKEWNYMGLsdcssvdsstisstsennsGRGLNLR  518
            E+ QSNV+  +S  + + + + G  LK  NY GLSD SSV+SST+S   ++     ++L+
Sbjct  5    EELQSNVSLASSSPTSNCISKGG-GLKVHNYFGLSDSSSVESSTLSCGEDDKGT--ISLK  61

Query  519  ATELRLGLPGSQSPQRDSEPSTKLDEKLLFPLHPAKESNFTLSQKTVVTGNKRGFSDAM  695
            ATEL LGLPGSQSP RD    TKLDEK  FPL P+K+   + S K     NKRGFSD +
Sbjct  62   ATELTLGLPGSQSPARD----TKLDEKPFFPLLPSKDEICSSSHK-----NKRGFSDTI  111



>ref|XP_006833393.1| PREDICTED: auxin-responsive protein IAA27 [Amborella trichopoda]
 ref|XP_011620573.1| PREDICTED: auxin-responsive protein IAA27 [Amborella trichopoda]
 ref|XP_011620574.1| PREDICTED: auxin-responsive protein IAA27 [Amborella trichopoda]
 ref|XP_011620575.1| PREDICTED: auxin-responsive protein IAA27 [Amborella trichopoda]
 gb|ERM98671.1| hypothetical protein AMTR_s00109p00120700 [Amborella trichopoda]
Length=347

 Score = 60.1 bits (144),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 47/101 (47%), Positives = 62/101 (61%), Gaps = 9/101 (9%)
 Frame = +3

Query  414  LKEWNYMGLsdcssvdsstisstsennsGRGLNLRATELRLGLPGSQSPQRDSEPSTKLD  593
            LKE +Y+GLS+ SS++ +++S       G  LNL+ TELRLGLPGS SP R      K +
Sbjct  17   LKEHDYIGLSEVSSMERTSLSKEEN---GNSLNLKETELRLGLPGSGSPDR-----KKPE  68

Query  594  EKLLFPLHPAKESNFTL-SQKTVVTGNKRGFSDAMDEFSEG  713
              LL PL P ++  F L S K VV+G KRG SD +D   +G
Sbjct  69   LCLLGPLRPEEKGIFPLVSPKNVVSGAKRGISDVIDGVKKG  109



>gb|ACU24212.1| unknown [Glycine max]
Length=152

 Score = 57.4 bits (137),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 36/75 (48%), Positives = 48/75 (64%), Gaps = 14/75 (19%)
 Frame = +3

Query  498  GRGLNLRATELRLGLPGSQSPQRDSEPSTKLDEKLLFPLHPAKESNFTLSQKTVVTGNKR  677
            G GLNL+ATELRLGLPGS+SP+R+      +++K + PL            K +V+G KR
Sbjct  27   GGGLNLKATELRLGLPGSESPEREE----GVEDKNVHPLGMV---------KCLVSGAKR  73

Query  678  GFSDAMDEFSEGKFL  722
            GFSD +D  S GK+L
Sbjct  74   GFSDTIDGGS-GKWL  87



>ref|XP_009112194.1| PREDICTED: auxin-responsive protein IAA9-like isoform X2 [Brassica 
rapa]
Length=278

 Score = 59.3 bits (142),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 56/119 (47%), Positives = 75/119 (63%), Gaps = 12/119 (10%)
 Frame = +3

Query  339  EDGQSNVTHMASPISLDSVCQNGPELKEWNYMGLsdcssvdsstisstsennsGRGLNLR  518
            E+ QSNV+  +S  + + + + G  LK  NY GLSD SSV+SST+S   ++     ++L+
Sbjct  5    EELQSNVSVASSSPTSNCISKGG-GLKVHNYFGLSDSSSVESSTLSCGEDDKGT--ISLK  61

Query  519  ATELRLGLPGSQSPQRDSEPSTKLDEKLLFPLHPAKESNFTLSQKTVVTGNKRGFSDAM  695
            ATEL LGLPGSQS  R+    TKLDEK  FPL P+K+   + S K     NKRGFSD +
Sbjct  62   ATELTLGLPGSQSHARE----TKLDEKPFFPLLPSKDEICSSSHK-----NKRGFSDTV  111



>ref|XP_009112193.1| PREDICTED: auxin-responsive protein IAA9-like isoform X1 [Brassica 
rapa]
Length=312

 Score = 59.3 bits (142),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 56/119 (47%), Positives = 75/119 (63%), Gaps = 12/119 (10%)
 Frame = +3

Query  339  EDGQSNVTHMASPISLDSVCQNGPELKEWNYMGLsdcssvdsstisstsennsGRGLNLR  518
            E+ QSNV+  +S  + + + + G  LK  NY GLSD SSV+SST+S   ++     ++L+
Sbjct  5    EELQSNVSVASSSPTSNCISKGG-GLKVHNYFGLSDSSSVESSTLSCGEDDKGT--ISLK  61

Query  519  ATELRLGLPGSQSPQRDSEPSTKLDEKLLFPLHPAKESNFTLSQKTVVTGNKRGFSDAM  695
            ATEL LGLPGSQS  R+    TKLDEK  FPL P+K+   + S K     NKRGFSD +
Sbjct  62   ATELTLGLPGSQSHARE----TKLDEKPFFPLLPSKDEICSSSHK-----NKRGFSDTV  111



>ref|XP_009352507.1| PREDICTED: auxin-responsive protein IAA27-like [Pyrus x bretschneideri]
Length=318

 Score = 58.9 bits (141),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 37/73 (51%), Positives = 47/73 (64%), Gaps = 10/73 (14%)
 Frame = +3

Query  507  LNLRATELRLGLPGSQSPQRDSEPSTKLDEKLLFPLHPAKESNFT-LSQKTVVTGNKRGF  683
            LNL+ATELRLGLPGSQSP+RDS       E+        K + F+    K +V+G KRGF
Sbjct  25   LNLKATELRLGLPGSQSPERDSGGGGGGVEE--------KVAGFSACGVKGLVSGAKRGF  76

Query  684  SDAMDEFSEGKFL  722
            SDA+D  S GK++
Sbjct  77   SDAIDGAS-GKWV  88



>emb|CDY25617.1| BnaA04g13090D [Brassica napus]
Length=266

 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 55/98 (56%), Positives = 65/98 (66%), Gaps = 19/98 (19%)
 Frame = +3

Query  408  PELKEWNYMGLsdcssvdsstisstsennsGRGLNLRATELRLGLP-GSQSPQRDSE---  575
            P LKE NYMGLSDCSSVDSSTI +  + +S   LN +ATELRLGLP  SQSPQR+++   
Sbjct  17   PGLKERNYMGLSDCSSVDSSTIPNVDKKSS---LNFKATELRLGLPESSQSPQRETDYRL  73

Query  576  --PSTKLDEKLLFPLHPAKESNFTLSQKTVVTGNKRGF  683
              P T  DEKLLFPL P K+           +GNKRG+
Sbjct  74   LSPRTP-DEKLLFPLLPCKDH---------ASGNKRGY  101



>ref|XP_009140376.1| PREDICTED: auxin-responsive protein IAA8 [Brassica rapa]
Length=266

 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 55/98 (56%), Positives = 65/98 (66%), Gaps = 19/98 (19%)
 Frame = +3

Query  408  PELKEWNYMGLsdcssvdsstisstsennsGRGLNLRATELRLGLP-GSQSPQRDSE---  575
            P LKE NYMGLSDCSSVDSSTI +  + +S   LN +ATELRLGLP  SQSPQR+++   
Sbjct  17   PGLKERNYMGLSDCSSVDSSTIPNVDKKSS---LNFKATELRLGLPESSQSPQRETDFGL  73

Query  576  --PSTKLDEKLLFPLHPAKESNFTLSQKTVVTGNKRGF  683
              P T  DEKLLFPL P K+           +GNKRG+
Sbjct  74   LSPRTP-DEKLLFPLLPCKDH---------ASGNKRGY  101



>ref|XP_003637872.1| Auxin-responsive aux/iaa gene family member [Medicago truncatula]
 gb|KEH27148.1| auxin response factor [Medicago truncatula]
Length=193

 Score = 55.8 bits (133),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 32/65 (49%), Positives = 43/65 (66%), Gaps = 12/65 (18%)
 Frame = +3

Query  504  GLNLRATELRLGLPGSQSPQRDSEPSTKLDEKLLFPLHPAKESNFTLSQKTVVTGNKRGF  683
            GLNL+ATELRLGLPGS+SP+RD++    L+EK  + L             ++ +G KRGF
Sbjct  14   GLNLKATELRLGLPGSESPERDNDL---LEEKNAYSLCML---------NSLFSGAKRGF  61

Query  684  SDAMD  698
            SDA+D
Sbjct  62   SDAID  66



>ref|XP_007152862.1| hypothetical protein PHAVU_004G166400g [Phaseolus vulgaris]
 gb|ESW24856.1| hypothetical protein PHAVU_004G166400g [Phaseolus vulgaris]
Length=307

 Score = 57.4 bits (137),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 47/73 (64%), Gaps = 14/73 (19%)
 Frame = +3

Query  504  GLNLRATELRLGLPGSQSPQRDSEPSTKLDEKLLFPLHPAKESNFTLSQKTVVTGNKRGF  683
            GLNL+ATELRLGLPGS+SP+RD      ++E+ + PL            K +V+G KRGF
Sbjct  31   GLNLKATELRLGLPGSESPERDG----GVEERNVHPLGMV---------KNLVSGAKRGF  77

Query  684  SDAMDEFSEGKFL  722
            SD +D  S GK+L
Sbjct  78   SDTIDGGS-GKWL  89



>ref|XP_003534212.1| PREDICTED: auxin-responsive protein IAA27 [Glycine max]
 gb|KHN45622.1| Auxin-responsive protein IAA27 [Glycine soja]
Length=307

 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 36/75 (48%), Positives = 48/75 (64%), Gaps = 14/75 (19%)
 Frame = +3

Query  498  GRGLNLRATELRLGLPGSQSPQRDSEPSTKLDEKLLFPLHPAKESNFTLSQKTVVTGNKR  677
            G GLNL+ATELRLGLPGS+SP+R+      +++K + PL            K +V+G KR
Sbjct  27   GGGLNLKATELRLGLPGSESPEREE----GVEDKNVHPLGMV---------KCLVSGAKR  73

Query  678  GFSDAMDEFSEGKFL  722
            GFSD +D  S GK+L
Sbjct  74   GFSDTIDGGS-GKWL  87



>gb|ABR16139.1| unknown [Picea sitchensis]
Length=461

 Score = 57.0 bits (136),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 60/164 (37%), Positives = 84/164 (51%), Gaps = 36/164 (22%)
 Frame = +3

Query  312  MSPPLLGVGEDGQSNVTHMASPISLDSVCQNGP-ELKEWNYMGLsdcssvdsstisstse  488
            MS  +    E+G S V+  AS    ++  QN   +LK  +Y+GLS+ SS   S++ S+ +
Sbjct  1    MSSNINAYMEEGLSKVSPPASSSISENDSQNSSVDLKAHDYIGLSEVSSSMESSVVSSQD  60

Query  489  nnsGRGLNLRATELRLGLPGSQSPQRDSEPS---------TKLDEKLLFPLHP-------  620
                  +NL+ TELRLGLPGS SP RDS            T+++EK LFP+         
Sbjct  61   GEENN-MNLKETELRLGLPGSLSPARDSSELSLLSPLNIRTEVEEKKLFPVEKQQHSTKD  119

Query  621  --AKESN----------------FTLSQKTVVTGNKRGFSDAMD  698
              A+E N                 T+S KT+VTG KRGFS+AM+
Sbjct  120  GVAEEKNGQDKYNIQPSGMGRNMMTVSPKTIVTGAKRGFSEAME  163



>ref|NP_001280937.1| auxin-responsive protein IAA27 [Malus domestica]
 gb|ADL36581.1| ARF domain class transcription factor [Malus domestica]
Length=319

 Score = 56.6 bits (135),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 35/73 (48%), Positives = 46/73 (63%), Gaps = 9/73 (12%)
 Frame = +3

Query  507  LNLRATELRLGLPGSQSPQRDSEPSTKLDEKLLFPLHPAKESNFTLSQ-KTVVTGNKRGF  683
            LNL+ATELRLGLPGSQSP+RD         +        K + F++   K +V+G KRGF
Sbjct  25   LNLKATELRLGLPGSQSPERDGGGGGGGGVE-------EKATGFSVCGVKGLVSGAKRGF  77

Query  684  SDAMDEFSEGKFL  722
            SDA+D  S GK++
Sbjct  78   SDAIDGAS-GKWV  89



>ref|XP_009336858.1| PREDICTED: auxin-responsive protein IAA27-like [Pyrus x bretschneideri]
Length=319

 Score = 56.2 bits (134),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 35/73 (48%), Positives = 47/73 (64%), Gaps = 9/73 (12%)
 Frame = +3

Query  507  LNLRATELRLGLPGSQSPQRDSEPSTKLDEKLLFPLHPAKESNFTLSQ-KTVVTGNKRGF  683
            LNL+ATELRLGLPGS+SP+RDS        +        K + F++   K +V+G KRGF
Sbjct  25   LNLKATELRLGLPGSRSPERDSGGGGGGGVE-------EKAAGFSVCGVKGLVSGAKRGF  77

Query  684  SDAMDEFSEGKFL  722
            SDA+D  S GK++
Sbjct  78   SDAIDGAS-GKWV  89



>ref|XP_003637871.1| Auxin-responsive aux/iaa gene family member [Medicago truncatula]
Length=222

 Score = 55.5 bits (132),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 32/65 (49%), Positives = 43/65 (66%), Gaps = 12/65 (18%)
 Frame = +3

Query  504  GLNLRATELRLGLPGSQSPQRDSEPSTKLDEKLLFPLHPAKESNFTLSQKTVVTGNKRGF  683
            GLNL+ATELRLGLPGS+SP+RD++    L+EK  + L             ++ +G KRGF
Sbjct  14   GLNLKATELRLGLPGSESPERDNDL---LEEKNAYSL---------CMLNSLFSGAKRGF  61

Query  684  SDAMD  698
            SDA+D
Sbjct  62   SDAID  66



>gb|AFK45766.1| unknown [Medicago truncatula]
Length=254

 Score = 55.8 bits (133),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 32/65 (49%), Positives = 43/65 (66%), Gaps = 12/65 (18%)
 Frame = +3

Query  504  GLNLRATELRLGLPGSQSPQRDSEPSTKLDEKLLFPLHPAKESNFTLSQKTVVTGNKRGF  683
            GLNL+ATELRLGLPGS+SP+RD++    L+EK  + L             ++ +G KRGF
Sbjct  14   GLNLKATELRLGLPGSESPERDNDL---LEEKNAYSL---------CMLNSLFSGAKRGF  61

Query  684  SDAMD  698
            SDA+D
Sbjct  62   SDAID  66



>gb|KEH27147.1| auxin response factor [Medicago truncatula]
Length=254

 Score = 55.5 bits (132),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 32/65 (49%), Positives = 43/65 (66%), Gaps = 12/65 (18%)
 Frame = +3

Query  504  GLNLRATELRLGLPGSQSPQRDSEPSTKLDEKLLFPLHPAKESNFTLSQKTVVTGNKRGF  683
            GLNL+ATELRLGLPGS+SP+RD++    L+EK  + L             ++ +G KRGF
Sbjct  14   GLNLKATELRLGLPGSESPERDNDL---LEEKNAYSL---------CMLNSLFSGAKRGF  61

Query  684  SDAMD  698
            SDA+D
Sbjct  62   SDAID  66



>ref|XP_008242568.1| PREDICTED: auxin-responsive protein IAA27 [Prunus mume]
Length=319

 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 35/75 (47%), Positives = 43/75 (57%), Gaps = 11/75 (15%)
 Frame = +3

Query  498  GRGLNLRATELRLGLPGSQSPQRDSEPSTKLDEKLLFPLHPAKESNFTLSQKTVVTGNKR  677
            G  LNL+ATELRLGLPGS+SP+RD       D          K        K +V+G KR
Sbjct  31   GTALNLKATELRLGLPGSESPERDGGGGLVED----------KTGYSVCVVKGLVSGAKR  80

Query  678  GFSDAMDEFSEGKFL  722
            GFSDA+D  S GK++
Sbjct  81   GFSDAIDGAS-GKWI  94



>gb|AIT98184.1| auxin-responsive protein, partial [Medicago sativa]
Length=138

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 32/73 (44%), Positives = 43/73 (59%), Gaps = 22/73 (30%)
 Frame = +3

Query  504  GLNLRATELRLGLPGSQSPQRDSEPSTKLDEKLLFPLHPAKESNFTLSQKTVVTGNKRGF  683
            GLNL+ATELRLGLPGS+SP+R                    E+   L  K++V+G KRGF
Sbjct  23   GLNLKATELRLGLPGSESPER--------------------ENGGVL--KSLVSGAKRGF  60

Query  684  SDAMDEFSEGKFL  722
            SDA+ +   GK++
Sbjct  61   SDAITDGGSGKWV  73



>ref|XP_012073397.1| PREDICTED: auxin-responsive protein IAA27-like isoform X1 [Jatropha 
curcas]
 gb|KDP37265.1| hypothetical protein JCGZ_06321 [Jatropha curcas]
Length=342

 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 38/74 (51%), Positives = 50/74 (68%), Gaps = 8/74 (11%)
 Frame = +3

Query  507  LNLRATELRLGLPGSQSPQRDSEPSTKLDEKLLFPLHPAKESN-FTLSQ-KTVVTGNKRG  680
            LNL+ TELRLGLPGSQSP+R  +P T +    LF       +N ++LS  K +V+G KRG
Sbjct  49   LNLKETELRLGLPGSQSPER--KPLTGVS---LFGKDIETNNNGYSLSSLKNLVSGAKRG  103

Query  681  FSDAMDEFSEGKFL  722
            FSDA+D  S GK++
Sbjct  104  FSDAIDS-SSGKWV  116



>ref|XP_012073398.1| PREDICTED: auxin-responsive protein IAA27-like isoform X2 [Jatropha 
curcas]
Length=326

 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 38/74 (51%), Positives = 50/74 (68%), Gaps = 8/74 (11%)
 Frame = +3

Query  507  LNLRATELRLGLPGSQSPQRDSEPSTKLDEKLLFPLHPAKESN-FTLSQ-KTVVTGNKRG  680
            LNL+ TELRLGLPGSQSP+R  +P T +    LF       +N ++LS  K +V+G KRG
Sbjct  33   LNLKETELRLGLPGSQSPER--KPLTGVS---LFGKDIETNNNGYSLSSLKNLVSGAKRG  87

Query  681  FSDAMDEFSEGKFL  722
            FSDA+D  S GK++
Sbjct  88   FSDAIDS-SSGKWV  100



>emb|CDX89499.1| BnaC04g35180D [Brassica napus]
Length=271

 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 47/98 (48%), Positives = 59/98 (60%), Gaps = 18/98 (18%)
 Frame = +3

Query  414  LKEWNYMGLsdcssvdsstisstsennsGR--GLNLRATELRLGLP-GSQSPQRDSE---  575
            LKE NY+GLSDCSS   S+       ++ +   LN +ATELRLGLP  SQSPQR+++   
Sbjct  19   LKERNYLGLSDCSSSVDSSTVPNLVLDTDKKSSLNFKATELRLGLPESSQSPQRETDFGL  78

Query  576  --PSTKLDEKLLFPLHPAKESNFTLSQKTVVTGNKRGF  683
              P T  DEKLLFPL P K+           +GNKRG+
Sbjct  79   LSPRTP-DEKLLFPLLPCKDH---------ASGNKRGY  106



>emb|CDO98008.1| unnamed protein product [Coffea canephora]
Length=334

 Score = 53.9 bits (128),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 34/64 (53%), Positives = 40/64 (63%), Gaps = 8/64 (13%)
 Frame = +3

Query  507  LNLRATELRLGLPGSQSPQRDSEPSTKLDEKLLFPLHPAKESNFTLSQKTVVTGNKRGFS  686
            LNL+ TELRLGLPGSQSP+R +     L  K L      K S F    K+ V+G KRGFS
Sbjct  45   LNLKETELRLGLPGSQSPERKAGHGVSLFGKDL----EEKTSGF----KSCVSGAKRGFS  96

Query  687  DAMD  698
            DA+D
Sbjct  97   DAID  100



>ref|XP_002284282.1| PREDICTED: auxin-responsive protein IAA27-like [Vitis vinifera]
Length=343

 Score = 53.5 bits (127),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 34/65 (52%), Positives = 42/65 (65%), Gaps = 5/65 (8%)
 Frame = +3

Query  507  LNLRATELRLGLPGSQSPQRDSEPSTKLDEKLLFPLHPAKESNFTL-SQKTVVTGNKRGF  683
            LNLR TELRLGLPGS+SP+R  +    L  K L      K + ++L S K  V+G KRGF
Sbjct  43   LNLRETELRLGLPGSESPERKPQLGVSLFGKDL----EDKTNGYSLGSLKGFVSGAKRGF  98

Query  684  SDAMD  698
            SDA+D
Sbjct  99   SDAID  103



>ref|XP_004287443.1| PREDICTED: auxin-responsive protein IAA27 [Fragaria vesca subsp. 
vesca]
Length=303

 Score = 53.5 bits (127),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 34/71 (48%), Positives = 44/71 (62%), Gaps = 18/71 (25%)
 Frame = +3

Query  510  NLRATELRLGLPGSQSPQRDSEPSTKLDEKLLFPLHPAKESNFTLSQKTVVTGNKRGFSD  689
            NL+ATELRLGLPGS+SP+RDS     +++K  F L P             V+G KR FSD
Sbjct  28   NLKATELRLGLPGSESPKRDS-----VEDKTGFSLKP------------CVSGAKRVFSD  70

Query  690  AMDEFSEGKFL  722
            A+D  S GK++
Sbjct  71   AIDGAS-GKWV  80



>ref|XP_010249636.1| PREDICTED: auxin-responsive protein IAA27 [Nelumbo nucifera]
Length=343

 Score = 53.1 bits (126),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 32/73 (44%), Positives = 47/73 (64%), Gaps = 6/73 (8%)
 Frame = +3

Query  507  LNLRATELRLGLPGSQSPQRDSEPSTKLDEKLLFPLHPAKESNFTLSQ-KTVVTGNKRGF  683
            LNL+ TELRLGLPGS+SP+R ++    +    L       ++ ++LS  K  V+G KRGF
Sbjct  42   LNLKETELRLGLPGSESPERKADARVGIS---LLGRTVEDKNGYSLSVLKNFVSGAKRGF  98

Query  684  SDAMDEFSEGKFL  722
            SDA+D+   GK++
Sbjct  99   SDAIDD--SGKWV  109



>ref|XP_006381732.1| hypothetical protein POPTR_0006s16640g [Populus trichocarpa]
 gb|ERP59529.1| hypothetical protein POPTR_0006s16640g [Populus trichocarpa]
Length=307

 Score = 52.8 bits (125),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 31/65 (48%), Positives = 43/65 (66%), Gaps = 10/65 (15%)
 Frame = +3

Query  501  RGLNLRATELRLGLPGSQSPQRDSEPSTKLDEKLLFPLHPAKESNFTLSQKTVVTGNKRG  680
            +GLNL+ATELRLGLPGS SP+R +E     +++L F L+     N     K+ V+G +RG
Sbjct  36   KGLNLKATELRLGLPGSDSPERGNE-----NQQLGFSLN-----NNNSKDKSFVSGARRG  85

Query  681  FSDAM  695
            FS A+
Sbjct  86   FSVAI  90



>ref|XP_003630761.1| Auxin-responsive protein (Aux/IAA) [Medicago truncatula]
 gb|AET05237.1| auxin-responsive AUX/IAA family protein [Medicago truncatula]
Length=293

 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 32/73 (44%), Positives = 43/73 (59%), Gaps = 22/73 (30%)
 Frame = +3

Query  504  GLNLRATELRLGLPGSQSPQRDSEPSTKLDEKLLFPLHPAKESNFTLSQKTVVTGNKRGF  683
            GLNL+ATELRLGLPGS+SP+R                    E+   L  K++V+G KRGF
Sbjct  23   GLNLKATELRLGLPGSESPER--------------------ENGGVL--KSLVSGAKRGF  60

Query  684  SDAMDEFSEGKFL  722
            SDA+ +   GK++
Sbjct  61   SDAITDGGSGKWV  73



>gb|KHN41649.1| Auxin-responsive protein IAA27 [Glycine soja]
Length=287

 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 31/66 (47%), Positives = 37/66 (56%), Gaps = 23/66 (35%)
 Frame = +3

Query  504  GLNLRATELRLGLPGSQSPQRDSEPSTKLDEKLLFPLHPAKESNFTLSQKTVVTGNKRGF  683
            GLNL+ATELRLGLPG +SP+R                    E  F   +  VV+G KRGF
Sbjct  21   GLNLKATELRLGLPGCESPER--------------------EGAF---RSVVVSGAKRGF  57

Query  684  SDAMDE  701
            SDA+DE
Sbjct  58   SDAIDE  63



>gb|AFK49596.1| unknown [Medicago truncatula]
Length=293

 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 32/73 (44%), Positives = 43/73 (59%), Gaps = 22/73 (30%)
 Frame = +3

Query  504  GLNLRATELRLGLPGSQSPQRDSEPSTKLDEKLLFPLHPAKESNFTLSQKTVVTGNKRGF  683
            GLNL+ATELRLGLPGS+SP+R                    E+   L  K++V+G KRGF
Sbjct  23   GLNLKATELRLGLPGSESPER--------------------ENGGVL--KSLVSGAKRGF  60

Query  684  SDAMDEFSEGKFL  722
            SDA+ +   GK++
Sbjct  61   SDAITDGGSGKWV  73



>ref|NP_001239808.1| uncharacterized protein LOC100778529 [Glycine max]
 gb|ACU23444.1| unknown [Glycine max]
Length=287

 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 31/66 (47%), Positives = 37/66 (56%), Gaps = 23/66 (35%)
 Frame = +3

Query  504  GLNLRATELRLGLPGSQSPQRDSEPSTKLDEKLLFPLHPAKESNFTLSQKTVVTGNKRGF  683
            GLNL+ATELRLGLPG +SP+R                    E  F   +  VV+G KRGF
Sbjct  21   GLNLKATELRLGLPGCESPER--------------------EGAF---RSVVVSGAKRGF  57

Query  684  SDAMDE  701
            SDA+DE
Sbjct  58   SDAIDE  63



>ref|XP_002284118.1| PREDICTED: auxin-responsive protein IAA27 [Vitis vinifera]
Length=320

 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 46/73 (63%), Gaps = 12/73 (16%)
 Frame = +3

Query  504  GLNLRATELRLGLPGSQSPQRDSEPSTKLDEKLLFPLHPAKESNFTLSQKTVVTGNKRGF  683
            GLNL+ATELRLGLPGS+SP+R    S    +K  +PL            K +V+G KRGF
Sbjct  33   GLNLKATELRLGLPGSESPERID--SVGGLDKNGYPLG---------VLKNLVSGAKRGF  81

Query  684  SDAMDEFSEGKFL  722
            SDA+D  S GK++
Sbjct  82   SDAIDGGS-GKWV  93



>ref|XP_008793078.1| PREDICTED: auxin-responsive protein IAA27-like isoform X2 [Phoenix 
dactylifera]
Length=318

 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 32/72 (44%), Positives = 42/72 (58%), Gaps = 19/72 (26%)
 Frame = +3

Query  507  LNLRATELRLGLPGSQSPQRDSEPSTKLDEKLLFPLHPAKESNFTLSQKTVVTGNKRGFS  686
            LN++ TELRLGLPGSQSP+R+  P   L      P             K++V+G KRGFS
Sbjct  46   LNIKETELRLGLPGSQSPEREDGPGLTLG----LP-------------KSLVSGAKRGFS  88

Query  687  DAMDEFSEGKFL  722
            DA+D    GK++
Sbjct  89   DAID--GSGKWM  98



>ref|XP_008793077.1| PREDICTED: auxin-responsive protein IAA27-like isoform X1 [Phoenix 
dactylifera]
Length=322

 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 32/72 (44%), Positives = 42/72 (58%), Gaps = 19/72 (26%)
 Frame = +3

Query  507  LNLRATELRLGLPGSQSPQRDSEPSTKLDEKLLFPLHPAKESNFTLSQKTVVTGNKRGFS  686
            LN++ TELRLGLPGSQSP+R+  P   L      P             K++V+G KRGFS
Sbjct  46   LNIKETELRLGLPGSQSPEREDGPGLTLG----LP-------------KSLVSGAKRGFS  88

Query  687  DAMDEFSEGKFL  722
            DA+D    GK++
Sbjct  89   DAID--GSGKWM  98



>ref|XP_004503453.1| PREDICTED: auxin-responsive protein IAA27-like [Cicer arietinum]
Length=302

 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 35/74 (47%), Positives = 45/74 (61%), Gaps = 22/74 (30%)
 Frame = +3

Query  504  GLNLRATELRLGLPGSQSPQRDSEPSTKLDEKLLFPLHPAKESNFTLSQ-KTVVTGNKRG  680
            GLNL+ATELRLGLPGS+SP+R                    E+   LS  K++V+G KRG
Sbjct  26   GLNLKATELRLGLPGSESPER--------------------ENGGGLSMLKSLVSGAKRG  65

Query  681  FSDAMDEFSEGKFL  722
            FSDA+D  S GK++
Sbjct  66   FSDAIDGGS-GKWV  78



>ref|XP_008462746.1| PREDICTED: auxin-responsive protein IAA27 [Cucumis melo]
Length=307

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 32/68 (47%), Positives = 37/68 (54%), Gaps = 16/68 (24%)
 Frame = +3

Query  504  GLNLRATELRLGLPGSQSPQRDSEPSTKLDEKLLFPLHPAKESNFTLSQKTVVTGNKRGF  683
            GLNL+ATELRLGLPGS+SP RD                   E N     K+ V+G KRGF
Sbjct  33   GLNLKATELRLGLPGSESPGRDD----------------GFEDNNGFLHKSPVSGAKRGF  76

Query  684  SDAMDEFS  707
            S A+D  S
Sbjct  77   SIAIDRAS  84



>ref|XP_006584572.1| PREDICTED: uncharacterized protein LOC100795749 isoform X1 [Glycine 
max]
Length=357

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/65 (43%), Positives = 36/65 (55%), Gaps = 23/65 (35%)
 Frame = +3

Query  504  GLNLRATELRLGLPGSQSPQRDSEPSTKLDEKLLFPLHPAKESNFTLSQKTVVTGNKRGF  683
            GLNL+ATELRLGLPG +SP+R+                        + +  VV+G KRGF
Sbjct  83   GLNLKATELRLGLPGCESPEREG-----------------------VFKSVVVSGAKRGF  119

Query  684  SDAMD  698
            SDA+D
Sbjct  120  SDAID  124



>ref|XP_010917562.1| PREDICTED: auxin-responsive protein IAA27-like [Elaeis guineensis]
Length=318

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 37/64 (58%), Gaps = 17/64 (27%)
 Frame = +3

Query  507  LNLRATELRLGLPGSQSPQRDSEPSTKLDEKLLFPLHPAKESNFTLSQKTVVTGNKRGFS  686
            LNL+ TELRLGLPGSQSP+R+  P   L      P             K+ V+G KRGFS
Sbjct  46   LNLKETELRLGLPGSQSPEREDGPGLTLG----LP-------------KSFVSGAKRGFS  88

Query  687  DAMD  698
            DA+D
Sbjct  89   DAID  92



>ref|XP_007013106.1| Phytochrome-associated protein 2 isoform 1 [Theobroma cacao]
 gb|EOY30725.1| Phytochrome-associated protein 2 isoform 1 [Theobroma cacao]
Length=312

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 31/65 (48%), Positives = 40/65 (62%), Gaps = 18/65 (28%)
 Frame = +3

Query  504  GLNLRATELRLGLPGSQSPQRDSEPSTKLDEKLLFPLHPAKESNFTLSQKTVVTGNKRGF  683
            GL+L+ATELRLGLPGS+SP+R+       D KL             LS K+ V+G KRGF
Sbjct  32   GLHLKATELRLGLPGSESPEREDH-----DHKL-------------LSLKSFVSGAKRGF  73

Query  684  SDAMD  698
            SD ++
Sbjct  74   SDTLN  78



>ref|XP_007013107.1| Phytochrome-associated protein 2 isoform 2 [Theobroma cacao]
 gb|EOY30726.1| Phytochrome-associated protein 2 isoform 2 [Theobroma cacao]
Length=313

 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 31/65 (48%), Positives = 40/65 (62%), Gaps = 18/65 (28%)
 Frame = +3

Query  504  GLNLRATELRLGLPGSQSPQRDSEPSTKLDEKLLFPLHPAKESNFTLSQKTVVTGNKRGF  683
            GL+L+ATELRLGLPGS+SP+R+       D KL             LS K+ V+G KRGF
Sbjct  32   GLHLKATELRLGLPGSESPEREDH-----DHKL-------------LSLKSFVSGAKRGF  73

Query  684  SDAMD  698
            SD ++
Sbjct  74   SDTLN  78



>gb|KHN16618.1| Auxin-responsive protein IAA27 [Glycine soja]
Length=283

 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 28/65 (43%), Positives = 36/65 (55%), Gaps = 23/65 (35%)
 Frame = +3

Query  504  GLNLRATELRLGLPGSQSPQRDSEPSTKLDEKLLFPLHPAKESNFTLSQKTVVTGNKRGF  683
            GLNL+ATELRLGLPG +SP+R+                        + +  VV+G KRGF
Sbjct  9    GLNLKATELRLGLPGCESPEREG-----------------------VFKSVVVSGAKRGF  45

Query  684  SDAMD  698
            SDA+D
Sbjct  46   SDAID  50



>ref|XP_007160318.1| hypothetical protein PHAVU_002G311500g [Phaseolus vulgaris]
 gb|ESW32312.1| hypothetical protein PHAVU_002G311500g [Phaseolus vulgaris]
Length=291

 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 28/65 (43%), Positives = 36/65 (55%), Gaps = 23/65 (35%)
 Frame = +3

Query  504  GLNLRATELRLGLPGSQSPQRDSEPSTKLDEKLLFPLHPAKESNFTLSQKTVVTGNKRGF  683
            GLNL+ATELRLGLPG +SP+R+                        + +  VV+G KRGF
Sbjct  18   GLNLKATELRLGLPGCESPEREG-----------------------VFKTVVVSGAKRGF  54

Query  684  SDAMD  698
            SDA+D
Sbjct  55   SDAID  59



>ref|NP_001242283.1| uncharacterized protein LOC100795749 [Glycine max]
 gb|ACU24320.1| unknown [Glycine max]
Length=290

 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 28/65 (43%), Positives = 36/65 (55%), Gaps = 23/65 (35%)
 Frame = +3

Query  504  GLNLRATELRLGLPGSQSPQRDSEPSTKLDEKLLFPLHPAKESNFTLSQKTVVTGNKRGF  683
            GLNL+ATELRLGLPG +SP+R+                        + +  VV+G KRGF
Sbjct  20   GLNLKATELRLGLPGCESPEREG-----------------------VFKSVVVSGAKRGF  56

Query  684  SDAMD  698
            SDA+D
Sbjct  57   SDAID  61



>gb|KJB54241.1| hypothetical protein B456_009G026700 [Gossypium raimondii]
 gb|KJB54242.1| hypothetical protein B456_009G026700 [Gossypium raimondii]
Length=278

 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 37/65 (57%), Gaps = 18/65 (28%)
 Frame = +3

Query  504  GLNLRATELRLGLPGSQSPQRDSEPSTKLDEKLLFPLHPAKESNFTLSQKTVVTGNKRGF  683
            GL+L+ TELRLGLPGS+SP+R+                        LS K+ V+G KRGF
Sbjct  29   GLHLKDTELRLGLPGSESPEREDHDQN------------------VLSLKSFVSGAKRGF  70

Query  684  SDAMD  698
            SDA+D
Sbjct  71   SDALD  75



>gb|KJB54243.1| hypothetical protein B456_009G026700 [Gossypium raimondii]
Length=301

 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 37/65 (57%), Gaps = 18/65 (28%)
 Frame = +3

Query  504  GLNLRATELRLGLPGSQSPQRDSEPSTKLDEKLLFPLHPAKESNFTLSQKTVVTGNKRGF  683
            GL+L+ TELRLGLPGS+SP+R+                        LS K+ V+G KRGF
Sbjct  29   GLHLKDTELRLGLPGSESPEREDHDQN------------------VLSLKSFVSGAKRGF  70

Query  684  SDAMD  698
            SDA+D
Sbjct  71   SDALD  75



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1344627596975