BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig195

Length=835
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009588433.1|  PREDICTED: receptor-like protein kinase FERONIA    199   1e-54   Nicotiana tomentosiformis
ref|XP_009790514.1|  PREDICTED: receptor-like protein kinase FERONIA    198   4e-54   Nicotiana sylvestris
ref|XP_004232151.1|  PREDICTED: receptor-like protein kinase FERONIA    186   9e-50   Solanum lycopersicum
ref|XP_006338349.1|  PREDICTED: receptor-like protein kinase FERO...    180   9e-48   
ref|XP_009790513.1|  PREDICTED: receptor-like protein kinase FERONIA    169   1e-43   Nicotiana sylvestris
ref|XP_006338348.1|  PREDICTED: receptor-like protein kinase FERO...    165   3e-42   Solanum tuberosum [potatoes]
ref|XP_011009253.1|  PREDICTED: receptor-like protein kinase FERONIA    155   6e-39   Populus euphratica
ref|XP_012088049.1|  PREDICTED: receptor-like protein kinase FERONIA    155   7e-39   Jatropha curcas
emb|CDP19885.1|  unnamed protein product                                152   1e-37   Coffea canephora [robusta coffee]
ref|XP_007032827.1|  Malectin/receptor-like protein kinase family...    151   2e-37   
emb|CDP19887.1|  unnamed protein product                                151   2e-37   Coffea canephora [robusta coffee]
ref|XP_010246590.1|  PREDICTED: receptor-like protein kinase FERONIA    150   3e-37   Nelumbo nucifera [Indian lotus]
ref|XP_006373375.1|  hypothetical protein POPTR_0017s13190g             150   4e-37   
ref|XP_006373380.1|  hypothetical protein POPTR_0017s13240g             150   4e-37   
ref|XP_011009252.1|  PREDICTED: LOW QUALITY PROTEIN: receptor-lik...    149   8e-37   Populus euphratica
gb|KJB10568.1|  hypothetical protein B456_001G207900                    149   9e-37   Gossypium raimondii
gb|KDP24661.1|  hypothetical protein JCGZ_26520                         149   2e-36   Jatropha curcas
ref|XP_012084847.1|  PREDICTED: LOW QUALITY PROTEIN: putative rec...    148   2e-36   Jatropha curcas
emb|CDP15786.1|  unnamed protein product                                145   2e-36   Coffea canephora [robusta coffee]
ref|XP_012084348.1|  PREDICTED: receptor-like protein kinase FERONIA    147   4e-36   
ref|XP_006373370.1|  hypothetical protein POPTR_0017s13150g             147   6e-36   
emb|CDP05401.1|  unnamed protein product                                147   8e-36   Coffea canephora [robusta coffee]
gb|KDP24658.1|  hypothetical protein JCGZ_26517                         140   8e-36   Jatropha curcas
ref|XP_007032832.1|  Malectin/receptor-like protein kinase family...    146   1e-35   
ref|XP_012088048.1|  PREDICTED: receptor-like protein kinase FERONIA    146   1e-35   
ref|XP_006373383.1|  hypothetical protein POPTR_0017s13270g             146   1e-35   
ref|XP_011099030.1|  PREDICTED: receptor-like protein kinase FERONIA    146   1e-35   Sesamum indicum [beniseed]
gb|KDP27678.1|  hypothetical protein JCGZ_20098                         142   2e-35   Jatropha curcas
ref|XP_012087729.1|  PREDICTED: receptor-like protein kinase FERONIA    143   3e-35   
gb|KDP24662.1|  hypothetical protein JCGZ_26521                         144   4e-35   Jatropha curcas
ref|XP_006427852.1|  hypothetical protein CICLE_v10024830mg             144   5e-35   Citrus clementina [clementine]
gb|KDO53394.1|  hypothetical protein CISIN_1g002533mg                   144   6e-35   Citrus sinensis [apfelsine]
gb|KDP27676.1|  hypothetical protein JCGZ_20096                         142   2e-34   Jatropha curcas
ref|XP_012084350.1|  PREDICTED: receptor-like protein kinase FERONIA    143   2e-34   
ref|XP_011099029.1|  PREDICTED: receptor-like protein kinase FERONIA    142   3e-34   Sesamum indicum [beniseed]
ref|XP_011021061.1|  PREDICTED: LOW QUALITY PROTEIN: receptor-lik...    142   3e-34   Populus euphratica
emb|CDP20271.1|  unnamed protein product                                142   4e-34   Coffea canephora [robusta coffee]
ref|XP_002528705.1|  kinase, putative                                   141   6e-34   
ref|XP_010252025.1|  PREDICTED: receptor-like protein kinase FERONIA    141   6e-34   Nelumbo nucifera [Indian lotus]
gb|KFK33632.1|  hypothetical protein AALP_AA5G038800                    140   9e-34   Arabis alpina [alpine rockcress]
emb|CBI27305.3|  unnamed protein product                                139   3e-33   Vitis vinifera
ref|XP_010660576.1|  PREDICTED: receptor-like protein kinase FERONIA    139   3e-33   
ref|XP_007032799.1|  Malectin/receptor protein kinase family prot...    139   3e-33   
ref|XP_007032831.1|  Malectin/receptor-like protein kinase family...    139   4e-33   
ref|XP_002273707.2|  PREDICTED: receptor-like protein kinase FERONIA    139   4e-33   Vitis vinifera
emb|CAN77538.1|  hypothetical protein VITISV_025026                     139   5e-33   Vitis vinifera
ref|XP_002277584.3|  PREDICTED: receptor-like protein kinase FERONIA    138   7e-33   Vitis vinifera
emb|CDP05402.1|  unnamed protein product                                138   8e-33   Coffea canephora [robusta coffee]
emb|CBI21192.3|  unnamed protein product                                138   9e-33   Vitis vinifera
ref|XP_002530995.1|  kinase, putative                                   138   9e-33   Ricinus communis
ref|XP_012091030.1|  PREDICTED: receptor-like protein kinase FERONIA    137   1e-32   Jatropha curcas
ref|XP_010552466.1|  PREDICTED: putative receptor-like protein ki...    136   4e-32   Tarenaya hassleriana [spider flower]
gb|KHN29489.1|  Receptor-like protein kinase FERONIA                    136   4e-32   Glycine soja [wild soybean]
ref|NP_001237656.1|  FERONIA receptor-like kinase precursor             136   4e-32   Glycine max [soybeans]
gb|KEH32083.1|  feronia receptor-like kinase                            135   5e-32   Medicago truncatula
gb|AHZ44752.1|  CrRLK1L-like protein                                    135   5e-32   Platanus x hispanica [London plane tree]
ref|XP_009115877.1|  PREDICTED: putative receptor-like protein ki...    135   5e-32   Brassica rapa
gb|KEH23293.1|  feronia receptor-like kinase                            135   7e-32   Medicago truncatula
ref|XP_003609098.1|  FERONIA receptor-like kinase                       135   9e-32   
ref|XP_009617447.1|  PREDICTED: receptor-like protein kinase FERONIA    134   1e-31   Nicotiana tomentosiformis
emb|CDX78036.1|  BnaA09g32310D                                          134   2e-31   
emb|CDY37883.1|  BnaC04g31230D                                          134   2e-31   Brassica napus [oilseed rape]
ref|XP_007140062.1|  hypothetical protein PHAVU_008G081000g             134   2e-31   Phaseolus vulgaris [French bean]
ref|XP_004492579.1|  PREDICTED: receptor-like protein kinase FERO...    134   2e-31   Cicer arietinum [garbanzo]
ref|XP_007140079.1|  hypothetical protein PHAVU_008G082400g             134   2e-31   Phaseolus vulgaris [French bean]
ref|XP_009139818.1|  PREDICTED: putative receptor-like protein ki...    134   3e-31   Brassica rapa
emb|CDX74491.1|  BnaA04g08980D                                          134   3e-31   
ref|XP_007032823.1|  Malectin/receptor-like protein kinase family...    134   3e-31   
ref|XP_010250338.1|  PREDICTED: receptor-like protein kinase FERONIA    133   4e-31   Nelumbo nucifera [Indian lotus]
ref|XP_010247768.1|  PREDICTED: receptor-like protein kinase FERONIA    133   5e-31   Nelumbo nucifera [Indian lotus]
gb|KJB42940.1|  hypothetical protein B456_007G175600                    132   7e-31   Gossypium raimondii
ref|XP_009791682.1|  PREDICTED: receptor-like protein kinase FERONIA    132   8e-31   Nicotiana sylvestris
gb|KJB80425.1|  hypothetical protein B456_013G096400                    129   1e-30   Gossypium raimondii
ref|XP_006405671.1|  hypothetical protein EUTSA_v10027636mg             132   1e-30   Eutrema salsugineum [saltwater cress]
ref|XP_004246282.1|  PREDICTED: receptor-like protein kinase FERONIA    132   1e-30   Solanum lycopersicum
ref|XP_004142677.1|  PREDICTED: receptor-like protein kinase FERONIA    132   1e-30   Cucumis sativus [cucumbers]
ref|XP_010529939.1|  PREDICTED: receptor-like protein kinase FERONIA    131   2e-30   Tarenaya hassleriana [spider flower]
ref|XP_002870808.1|  hypothetical protein ARALYDRAFT_916421             131   2e-30   
ref|NP_001238686.1|  receptor-like kinase                               131   2e-30   Glycine max [soybeans]
gb|KDP27270.1|  hypothetical protein JCGZ_19969                         131   2e-30   Jatropha curcas
ref|NP_198716.1|  putative receptor-like protein kinase                 131   2e-30   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008463270.1|  PREDICTED: receptor-like protein kinase FERONIA    130   3e-30   Cucumis melo [Oriental melon]
ref|XP_007208402.1|  hypothetical protein PRUPE_ppa001164mg             130   3e-30   Prunus persica
ref|XP_010244547.1|  PREDICTED: receptor-like protein kinase FERONIA    130   3e-30   Nelumbo nucifera [Indian lotus]
ref|XP_008370279.1|  PREDICTED: receptor-like protein kinase FERONIA    130   3e-30   
ref|XP_006341293.1|  PREDICTED: receptor-like protein kinase FERO...    130   4e-30   Solanum tuberosum [potatoes]
ref|XP_008244701.1|  PREDICTED: receptor-like protein kinase FERONIA    130   4e-30   Prunus mume [ume]
gb|ABT18098.1|  FERONIA receptor-like kinase                            130   5e-30   Cardamine flexuosa
gb|KHN40613.1|  Receptor-like protein kinase FERONIA                    130   5e-30   Glycine soja [wild soybean]
emb|CDY36996.1|  BnaC06g12670D                                          129   7e-30   Brassica napus [oilseed rape]
ref|XP_007045784.1|  Malectin/receptor-like protein kinase family...    129   9e-30   Theobroma cacao [chocolate]
ref|XP_009370899.1|  PREDICTED: receptor-like protein kinase FERONIA    129   9e-30   Pyrus x bretschneideri [bai li]
ref|XP_006403905.1|  hypothetical protein EUTSA_v10010114mg             129   1e-29   Eutrema salsugineum [saltwater cress]
ref|XP_009337788.1|  PREDICTED: receptor-like protein kinase FERONIA    129   1e-29   Pyrus x bretschneideri [bai li]
gb|KJB10597.1|  hypothetical protein B456_001G210300                    129   1e-29   Gossypium raimondii
ref|XP_009136619.1|  PREDICTED: receptor-like protein kinase FERONIA    129   2e-29   Brassica rapa
ref|XP_006286236.1|  hypothetical protein CARUB_v10007805mg             128   2e-29   Capsella rubella
emb|CDX88223.1|  BnaA06g28140D                                          128   2e-29   
emb|CDX67422.1|  BnaA07g14620D                                          127   2e-29   
ref|XP_012084843.1|  PREDICTED: receptor-like protein kinase FERONIA    128   2e-29   Jatropha curcas
gb|KDP27267.1|  hypothetical protein JCGZ_19966                         128   3e-29   Jatropha curcas
ref|XP_007045781.1|  Malectin/receptor-like protein kinase family...    127   4e-29   
ref|XP_002279218.3|  PREDICTED: receptor-like protein kinase FERONIA    127   4e-29   
ref|XP_010098025.1|  Receptor-like protein kinase FERONIA               127   4e-29   Morus notabilis
ref|XP_010252026.1|  PREDICTED: receptor-like protein kinase FERONIA    127   6e-29   Nelumbo nucifera [Indian lotus]
gb|KJB29840.1|  hypothetical protein B456_005G120700                    127   6e-29   Gossypium raimondii
ref|XP_008231015.1|  PREDICTED: receptor-like protein kinase FERONIA    124   8e-29   Prunus mume [ume]
gb|ABT18099.1|  FERONIA receptor-like kinase                            126   8e-29   Cardamine flexuosa
gb|ABT18097.1|  FERONIA receptor-like kinase                            126   8e-29   Cardamine flexuosa
ref|XP_011095158.1|  PREDICTED: receptor-like protein kinase FERONIA    126   9e-29   Sesamum indicum [beniseed]
ref|XP_009125099.1|  PREDICTED: putative receptor-like protein ki...    126   9e-29   Brassica rapa
gb|KJB11637.1|  hypothetical protein B456_001G269100                    126   1e-28   Gossypium raimondii
ref|XP_010441030.1|  PREDICTED: putative receptor-like protein ki...    122   1e-28   
ref|XP_007151348.1|  hypothetical protein PHAVU_004G038800g             125   2e-28   Phaseolus vulgaris [French bean]
ref|XP_007032792.1|  Malectin/receptor protein kinase family protein    122   2e-28   
gb|KJB38065.1|  hypothetical protein B456_006G235700                    125   2e-28   Gossypium raimondii
ref|XP_002308259.1|  kinase family protein                              125   2e-28   
ref|XP_008813242.1|  PREDICTED: receptor-like protein kinase FERONIA    125   2e-28   Phoenix dactylifera
ref|XP_011001679.1|  PREDICTED: receptor-like protein kinase FERONIA    125   2e-28   Populus euphratica
ref|XP_009151130.1|  PREDICTED: probable receptor-like protein ki...    125   3e-28   Brassica rapa
ref|XP_007032808.1|  Malectin/receptor-like protein kinase family...    125   3e-28   
gb|ABT18095.1|  FERONIA receptor-like kinase                            125   3e-28   Cardamine flexuosa
ref|XP_002323088.2|  kinase family protein                              124   4e-28   Populus trichocarpa [western balsam poplar]
ref|NP_198715.1|  putative receptor-like protein kinase                 124   4e-28   Arabidopsis thaliana [mouse-ear cress]
gb|AAM10331.1|  AT5g38990/K15E6_170                                     124   5e-28   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010043538.1|  PREDICTED: receptor-like protein kinase FERONIA    124   5e-28   Eucalyptus grandis [rose gum]
ref|XP_006285765.1|  hypothetical protein CARUB_v10007239mg             124   5e-28   Capsella rubella
ref|XP_009373799.1|  PREDICTED: receptor-like protein kinase FERONIA    124   5e-28   
emb|CDX74492.1|  BnaA04g08970D                                          124   5e-28   
emb|CDY37884.1|  BnaC04g31220D                                          124   5e-28   Brassica napus [oilseed rape]
ref|XP_010431249.1|  PREDICTED: receptor-like protein kinase FERONIA    122   5e-28   Camelina sativa [gold-of-pleasure]
emb|CDO99857.1|  unnamed protein product                                125   5e-28   Coffea canephora [robusta coffee]
ref|XP_009139815.1|  PREDICTED: putative receptor-like protein ki...    124   5e-28   Brassica rapa
ref|XP_010553161.1|  PREDICTED: receptor-like protein kinase FERONIA    124   6e-28   Tarenaya hassleriana [spider flower]
ref|XP_012068359.1|  PREDICTED: receptor-like protein kinase FERONIA    124   6e-28   Jatropha curcas
ref|XP_007151356.1|  hypothetical protein PHAVU_004G039600g             124   7e-28   Phaseolus vulgaris [French bean]
ref|XP_012067824.1|  PREDICTED: receptor-like protein kinase FERONIA    124   7e-28   Jatropha curcas
ref|XP_008230906.1|  PREDICTED: receptor-like protein kinase FERONIA    124   7e-28   Prunus mume [ume]
dbj|BAK00988.1|  predicted protein                                      121   8e-28   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KEH25126.1|  feronia receptor-like kinase                            123   9e-28   Medicago truncatula
ref|XP_007032800.1|  Malectin/receptor-like protein kinase family...    123   9e-28   
gb|KDP37883.1|  hypothetical protein JCGZ_05765                         120   9e-28   Jatropha curcas
ref|XP_012072597.1|  PREDICTED: receptor-like protein kinase FERONIA    120   9e-28   Jatropha curcas
ref|XP_011016728.1|  PREDICTED: receptor-like protein kinase FERONIA    123   1e-27   Populus euphratica
ref|XP_012068357.1|  PREDICTED: receptor-like protein kinase FERONIA    120   1e-27   Jatropha curcas
ref|NP_198718.1|  putative receptor-like protein kinase                 123   1e-27   Arabidopsis thaliana [mouse-ear cress]
emb|CDO99867.1|  unnamed protein product                                124   1e-27   Coffea canephora [robusta coffee]
ref|XP_010667956.1|  PREDICTED: receptor-like protein kinase FERONIA    120   1e-27   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007033491.1|  Malectin/receptor-like protein kinase family...    123   1e-27   Theobroma cacao [chocolate]
ref|XP_010426729.1|  PREDICTED: receptor-like protein kinase FERONIA    122   2e-27   Camelina sativa [gold-of-pleasure]
gb|EMT01093.1|  hypothetical protein F775_16963                         120   2e-27   
ref|XP_008341792.1|  PREDICTED: receptor-like protein kinase FERONIA    122   2e-27   
ref|XP_010683454.1|  PREDICTED: receptor-like protein kinase FERONIA    122   3e-27   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007217058.1|  hypothetical protein PRUPE_ppa001157mg             122   3e-27   
ref|XP_008368476.1|  PREDICTED: LOW QUALITY PROTEIN: receptor-lik...    122   3e-27   
ref|XP_010515573.1|  PREDICTED: receptor-like protein kinase FERONIA    122   3e-27   Camelina sativa [gold-of-pleasure]
ref|XP_010921184.1|  PREDICTED: receptor-like protein kinase FERONIA    122   3e-27   Elaeis guineensis
ref|XP_008341797.1|  PREDICTED: receptor-like protein kinase FERONIA    122   3e-27   
emb|CDY33271.1|  BnaA01g19380D                                          122   3e-27   Brassica napus [oilseed rape]
ref|XP_012084845.1|  PREDICTED: receptor-like protein kinase FERONIA    122   4e-27   Jatropha curcas
ref|NP_198719.1|  putative receptor-like protein kinase                 121   4e-27   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007153476.1|  hypothetical protein PHAVU_003G038800g             121   4e-27   Phaseolus vulgaris [French bean]
gb|EPS73118.1|  hypothetical protein M569_01631                         121   6e-27   Genlisea aurea
emb|CDP06378.1|  unnamed protein product                                121   6e-27   Coffea canephora [robusta coffee]
gb|EMT17007.1|  Receptor-like protein kinase FERONIA                    120   7e-27   
ref|XP_009391670.1|  PREDICTED: receptor-like protein kinase FERONIA    120   8e-27   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010938035.1|  PREDICTED: receptor-like protein kinase FERONIA    120   9e-27   Elaeis guineensis
gb|KJB80427.1|  hypothetical protein B456_013G096600                    120   1e-26   Gossypium raimondii
ref|XP_009115840.1|  PREDICTED: receptor-like protein kinase FERONIA    120   2e-26   Brassica rapa
emb|CDY16299.1|  BnaC01g23340D                                          119   2e-26   Brassica napus [oilseed rape]
emb|CDX78012.1|  BnaA09g32070D                                          119   2e-26   
ref|XP_010243447.1|  PREDICTED: receptor-like protein kinase FERONIA    119   2e-26   Nelumbo nucifera [Indian lotus]
gb|ABT18094.1|  FERONIA receptor-like kinase                            119   2e-26   Brassica oleracea
gb|KDO64141.1|  hypothetical protein CISIN_1g036624mg                   119   2e-26   Citrus sinensis [apfelsine]
ref|XP_003557976.1|  PREDICTED: receptor-like protein kinase FERONIA    119   2e-26   Brachypodium distachyon [annual false brome]
ref|XP_009148931.1|  PREDICTED: receptor-like protein kinase FERONIA    119   2e-26   Brassica rapa
ref|XP_010242732.1|  PREDICTED: receptor-like protein kinase ANXUR1     119   2e-26   Nelumbo nucifera [Indian lotus]
gb|KJB10595.1|  hypothetical protein B456_001G210100                    119   3e-26   Gossypium raimondii
ref|XP_009140101.1|  PREDICTED: probable receptor-like protein ki...    119   3e-26   Brassica rapa
ref|XP_010450844.1|  PREDICTED: putative receptor-like protein ki...    119   3e-26   Camelina sativa [gold-of-pleasure]
ref|XP_004302537.1|  PREDICTED: receptor-like protein kinase FERONIA    119   3e-26   Fragaria vesca subsp. vesca
ref|XP_007032814.1|  Malectin/receptor-like protein kinase family...    119   3e-26   
ref|XP_010660578.1|  PREDICTED: receptor-like protein kinase FERONIA    119   4e-26   Vitis vinifera
ref|XP_002530992.1|  kinase, putative                                   119   4e-26   
ref|XP_008810848.1|  PREDICTED: receptor-like protein kinase FERONIA    118   4e-26   Phoenix dactylifera
emb|CDX73714.1|  BnaC08g22890D                                          119   5e-26   
gb|KJB75372.1|  hypothetical protein B456_012G038800                    118   5e-26   Gossypium raimondii
ref|XP_002877809.1|  hypothetical protein ARALYDRAFT_485507             118   5e-26   Arabidopsis lyrata subsp. lyrata
gb|EMS66619.1|  hypothetical protein TRIUR3_14353                       115   7e-26   Triticum urartu
ref|XP_006429617.1|  hypothetical protein CICLE_v10011034mg             118   7e-26   Citrus clementina [clementine]
ref|XP_004984479.1|  PREDICTED: receptor-like protein kinase FERO...    118   7e-26   Setaria italica
ref|XP_008231017.1|  PREDICTED: receptor-like protein kinase FERONIA    118   7e-26   Prunus mume [ume]
ref|XP_010503851.1|  PREDICTED: receptor-like protein kinase FERONIA    118   7e-26   
ref|XP_012084846.1|  PREDICTED: receptor-like protein kinase FERONIA    118   7e-26   Jatropha curcas
ref|XP_010099322.1|  Receptor-like protein kinase FERONIA               118   7e-26   Morus notabilis
gb|KJB71482.1|  hypothetical protein B456_011G124900                    117   9e-26   Gossypium raimondii
ref|XP_004507304.1|  PREDICTED: receptor-like protein kinase FERO...    117   1e-25   Cicer arietinum [garbanzo]
ref|XP_004304217.1|  PREDICTED: receptor-like protein kinase FERONIA    117   1e-25   Fragaria vesca subsp. vesca
ref|XP_009416326.1|  PREDICTED: receptor-like protein kinase FERONIA    117   1e-25   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002272797.2|  PREDICTED: receptor-like protein kinase ANXUR1     117   1e-25   Vitis vinifera
ref|XP_002870806.1|  predicted protein                                  114   2e-25   
ref|XP_008230910.1|  PREDICTED: receptor-like protein kinase FERONIA    117   2e-25   Prunus mume [ume]
gb|KFK33213.1|  hypothetical protein AALP_AA6G345300                    117   2e-25   Arabis alpina [alpine rockcress]
gb|KJB10602.1|  hypothetical protein B456_001G210700                    116   2e-25   Gossypium raimondii
ref|XP_006290584.1|  hypothetical protein CARUB_v10016673mg             116   2e-25   Capsella rubella
ref|XP_006595251.1|  PREDICTED: receptor-like protein kinase FERO...    116   2e-25   
ref|XP_009419820.1|  PREDICTED: receptor-like protein kinase FERO...    114   2e-25   
ref|XP_009412649.1|  PREDICTED: receptor-like protein kinase FERONIA    116   3e-25   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009419819.1|  PREDICTED: receptor-like protein kinase FERO...    114   3e-25   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011071382.1|  PREDICTED: receptor-like protein kinase ANXUR1     116   3e-25   Sesamum indicum [beniseed]
gb|KHN37916.1|  Receptor-like protein kinase FERONIA                    116   3e-25   Glycine soja [wild soybean]
ref|XP_010660579.1|  PREDICTED: receptor-like protein kinase FERONIA    114   3e-25   Vitis vinifera
ref|XP_006593699.1|  PREDICTED: receptor-like protein kinase FERO...    115   3e-25   
ref|XP_003552590.2|  PREDICTED: receptor-like protein kinase FERO...    116   3e-25   
gb|KJB48087.1|  hypothetical protein B456_008G053200                    115   4e-25   Gossypium raimondii
ref|XP_009373802.1|  PREDICTED: receptor-like protein kinase FERO...    115   4e-25   
ref|XP_011099165.1|  PREDICTED: receptor-like protein kinase FERONIA    116   4e-25   Sesamum indicum [beniseed]
ref|XP_009373801.1|  PREDICTED: receptor-like protein kinase FERO...    115   4e-25   Pyrus x bretschneideri [bai li]
ref|XP_010660596.1|  PREDICTED: receptor-like protein kinase FERONIA    115   4e-25   
gb|KHN37917.1|  Putative receptor-like protein kinase                   112   5e-25   Glycine soja [wild soybean]
gb|EAY75971.1|  hypothetical protein OsI_03893                          115   5e-25   Oryza sativa Indica Group [Indian rice]
ref|XP_004499647.1|  PREDICTED: receptor-like protein kinase FERO...    114   5e-25   Cicer arietinum [garbanzo]
ref|NP_001044372.1|  Os01g0769700                                       115   6e-25   
ref|XP_007151369.1|  hypothetical protein PHAVU_004G040900g             115   6e-25   Phaseolus vulgaris [French bean]
ref|XP_003520131.2|  PREDICTED: receptor-like protein kinase FERO...    115   7e-25   Glycine max [soybeans]
ref|XP_004306058.2|  PREDICTED: receptor-like protein kinase FERONIA    115   7e-25   Fragaria vesca subsp. vesca
ref|XP_008379440.1|  PREDICTED: receptor-like protein kinase FERONIA    115   8e-25   
ref|XP_007216888.1|  hypothetical protein PRUPE_ppa020589mg             115   8e-25   
gb|KHN29954.1|  Receptor-like protein kinase FERONIA                    114   9e-25   Glycine soja [wild soybean]
gb|KHN37921.1|  Receptor-like protein kinase FERONIA                    114   1e-24   Glycine soja [wild soybean]
ref|XP_010450843.1|  PREDICTED: putative receptor-like protein ki...    114   1e-24   Camelina sativa [gold-of-pleasure]
gb|ABT18100.1|  FERONIA receptor-like kinase                            114   1e-24   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010660577.1|  PREDICTED: receptor-like protein kinase FERONIA    114   1e-24   Vitis vinifera
gb|AAK59558.1|  putative receptor-protein kinase                        114   1e-24   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006482013.1|  PREDICTED: receptor-like protein kinase FERO...    114   1e-24   Citrus sinensis [apfelsine]
ref|XP_006654257.1|  PREDICTED: receptor-like protein kinase FERO...    114   1e-24   Oryza brachyantha
ref|NP_190723.1|  receptor-like protein kinase FERONIA                  114   1e-24   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011623570.1|  PREDICTED: LOW QUALITY PROTEIN: receptor-lik...    114   1e-24   
ref|XP_007139451.1|  hypothetical protein PHAVU_008G030700g             114   2e-24   Phaseolus vulgaris [French bean]
ref|XP_007151358.1|  hypothetical protein PHAVU_004G039800g             114   2e-24   Phaseolus vulgaris [French bean]
gb|ERN06449.1|  hypothetical protein AMTR_s00016p00259140               114   2e-24   Amborella trichopoda
ref|XP_008230911.1|  PREDICTED: receptor-like protein kinase FERONIA    114   2e-24   Prunus mume [ume]
ref|XP_006482014.1|  PREDICTED: receptor-like protein kinase FERO...    114   2e-24   Citrus sinensis [apfelsine]
ref|XP_003614252.1|  Kinase-like protein                                113   2e-24   
ref|XP_003614249.1|  Kinase-like protein                                113   2e-24   Medicago truncatula
gb|KHN04378.1|  Receptor-like protein kinase FERONIA                    113   3e-24   Glycine soja [wild soybean]
ref|XP_010435808.1|  PREDICTED: probable receptor-like protein ki...    113   3e-24   Camelina sativa [gold-of-pleasure]
ref|XP_007032813.1|  Malectin/receptor-like protein kinase family...    111   3e-24   
ref|XP_007227151.1|  hypothetical protein PRUPE_ppa026453mg             113   3e-24   Prunus persica
ref|XP_008341791.1|  PREDICTED: LOW QUALITY PROTEIN: receptor-lik...    113   4e-24   
ref|XP_008223394.1|  PREDICTED: receptor-like protein kinase ANXUR1     113   4e-24   Prunus mume [ume]
ref|XP_006430474.1|  hypothetical protein CICLE_v10011056mg             112   4e-24   Citrus clementina [clementine]
ref|NP_001241448.1|  receptor-like protein kinase FERONIA-like pr...    113   4e-24   Glycine max [soybeans]
ref|XP_003552594.2|  PREDICTED: receptor-like protein kinase FERO...    112   4e-24   
ref|XP_002512045.1|  conserved hypothetical protein                     112   4e-24   
ref|XP_004306059.2|  PREDICTED: receptor-like protein kinase FERO...    112   4e-24   Fragaria vesca subsp. vesca
gb|KHN07113.1|  Receptor-like protein kinase FERONIA                    112   4e-24   Glycine soja [wild soybean]
ref|XP_007151359.1|  hypothetical protein PHAVU_004G039900g             112   4e-24   Phaseolus vulgaris [French bean]
ref|XP_011467877.1|  PREDICTED: receptor-like protein kinase FERO...    112   4e-24   Fragaria vesca subsp. vesca
ref|XP_006602952.1|  PREDICTED: receptor-like protein kinase FERO...    112   4e-24   
ref|NP_001053685.1|  Os04g0586500                                       110   5e-24   
gb|EAY95324.1|  hypothetical protein OsI_17151                          110   5e-24   Oryza sativa Indica Group [Indian rice]
gb|EYU44215.1|  hypothetical protein MIMGU_mgv1a000477mg                112   5e-24   Erythranthe guttata [common monkey flower]
gb|KJB10587.1|  hypothetical protein B456_001G208900                    110   5e-24   Gossypium raimondii
ref|XP_010258502.1|  PREDICTED: receptor-like protein kinase ANXUR1     112   5e-24   Nelumbo nucifera [Indian lotus]
ref|XP_004499646.1|  PREDICTED: receptor-like protein kinase FERO...    112   6e-24   
ref|XP_010435806.1|  PREDICTED: putative receptor-like protein ki...    112   6e-24   
gb|EMT13360.1|  hypothetical protein F775_08521                         110   6e-24   
ref|XP_010660597.1|  PREDICTED: receptor-like protein kinase FERONIA    110   7e-24   Vitis vinifera
gb|KHN47259.1|  Receptor-like protein kinase FERONIA                    112   7e-24   Glycine soja [wild soybean]
ref|XP_002277565.2|  PREDICTED: receptor-like protein kinase FERONIA    112   7e-24   Vitis vinifera
ref|XP_006585798.1|  PREDICTED: receptor-like protein kinase FERO...    112   7e-24   
ref|XP_007151363.1|  hypothetical protein PHAVU_004G040300g             112   7e-24   Phaseolus vulgaris [French bean]
gb|KEH25125.1|  carbohydrate-binding protein of the ER protein          111   8e-24   Medicago truncatula
gb|EMT17367.1|  Receptor-like protein kinase FERONIA                    111   8e-24   
ref|XP_010441031.1|  PREDICTED: probable receptor-like protein ki...    111   9e-24   Camelina sativa [gold-of-pleasure]
gb|EMT16871.1|  Receptor-like protein kinase FERONIA                    111   1e-23   
ref|XP_008456162.1|  PREDICTED: receptor-like protein kinase ANXU...    111   1e-23   
ref|XP_002467915.1|  hypothetical protein SORBIDRAFT_01g036260          111   1e-23   Sorghum bicolor [broomcorn]
ref|XP_008456155.1|  PREDICTED: receptor-like protein kinase ANXU...    111   1e-23   
ref|XP_007217152.1|  hypothetical protein PRUPE_ppa001413mg             111   1e-23   
ref|XP_004514615.1|  PREDICTED: uncharacterized protein LOC101497599    111   1e-23   
ref|XP_003543886.1|  PREDICTED: receptor-like protein kinase FERO...    111   1e-23   
emb|CBI21198.3|  unnamed protein product                                111   1e-23   
gb|KHN07118.1|  Receptor-like protein kinase FERONIA                    111   1e-23   
ref|NP_001238536.1|  receptor-like kinase                               111   2e-23   
ref|NP_001238431.1|  FERONIA receptor-like kinase precursor             110   2e-23   
ref|XP_008390536.1|  PREDICTED: receptor-like protein kinase ANXUR1     110   2e-23   
ref|XP_009372137.1|  PREDICTED: receptor-like protein kinase ANXUR1     110   2e-23   
ref|XP_006593316.1|  PREDICTED: FERONIA receptor-like kinase isof...    110   2e-23   
emb|CDO98765.1|  unnamed protein product                                110   2e-23   
ref|XP_004306062.1|  PREDICTED: receptor-like protein kinase FERONIA    110   2e-23   
ref|XP_006354973.1|  PREDICTED: receptor-like protein kinase FERO...    111   2e-23   
gb|KHN07116.1|  Receptor-like protein kinase FERONIA                    110   2e-23   
gb|KJB10624.1|  hypothetical protein B456_001G211900                    110   2e-23   
ref|XP_009373821.1|  PREDICTED: putative receptor-like protein ki...    110   2e-23   
ref|XP_009799586.1|  PREDICTED: receptor-like protein kinase ANXUR1     110   2e-23   
ref|XP_004976623.1|  PREDICTED: receptor-like protein kinase FERO...    108   2e-23   
gb|EMT03407.1|  Receptor-like protein kinase FERONIA                    110   3e-23   
ref|XP_008346776.1|  PREDICTED: LOW QUALITY PROTEIN: receptor-lik...    110   3e-23   
ref|XP_006354974.1|  PREDICTED: receptor-like protein kinase FERO...    110   3e-23   
ref|XP_003580431.1|  PREDICTED: receptor-like protein kinase FERONIA    108   3e-23   
ref|XP_002311383.2|  hypothetical protein POPTR_0008s10500g             110   3e-23   
ref|XP_009602553.1|  PREDICTED: receptor-like protein kinase ANXUR1     110   4e-23   
gb|KFK33631.1|  hypothetical protein AALP_AA5G038700                    109   5e-23   
ref|XP_002316044.1|  Pto-like kinase OGw family protein                 109   6e-23   
ref|XP_006358215.1|  PREDICTED: receptor-like protein kinase ANXU...    109   6e-23   
ref|XP_006593700.1|  PREDICTED: receptor-like protein kinase FERO...    109   7e-23   
gb|KHN07117.1|  Receptor-like protein kinase FERONIA                    109   7e-23   
ref|XP_009388012.1|  PREDICTED: receptor-like protein kinase FERONIA    107   7e-23   
gb|KHN07112.1|  Receptor-like protein kinase FERONIA                    108   7e-23   
ref|XP_008660180.1|  PREDICTED: receptor-like protein kinase FERONIA    109   7e-23   
ref|XP_007217578.1|  hypothetical protein PRUPE_ppa019352mg             108   8e-23   
ref|XP_004243035.1|  PREDICTED: receptor-like protein kinase ANXUR1     108   8e-23   
ref|XP_003633771.1|  PREDICTED: receptor-like protein kinase FERONIA    108   8e-23   
emb|CDO99861.1|  unnamed protein product                                106   9e-23   
ref|XP_009373800.1|  PREDICTED: receptor-like protein kinase FERONIA    108   9e-23   
ref|XP_010319813.1|  PREDICTED: receptor-like protein kinase ANXUR1     108   1e-22   
ref|XP_008464587.1|  PREDICTED: receptor-like protein kinase FERONIA    108   1e-22   
ref|XP_009118021.1|  PREDICTED: receptor-like protein kinase FERO...    108   1e-22   
ref|XP_008668826.1|  PREDICTED: receptor-like protein kinase FERONIA    108   1e-22   
tpg|DAA45217.1|  TPA: putative receptor-like protein kinase famil...    108   1e-22   
ref|XP_004499818.1|  PREDICTED: receptor-like protein kinase FERO...    104   1e-22   
gb|KJB10590.1|  hypothetical protein B456_001G209200                    108   2e-22   
ref|XP_007151357.1|  hypothetical protein PHAVU_004G039700g             107   2e-22   
ref|XP_009414253.1|  PREDICTED: receptor-like protein kinase FERONIA    108   2e-22   
ref|XP_009365970.1|  PREDICTED: receptor-like protein kinase FERONIA    107   2e-22   
ref|XP_008230912.1|  PREDICTED: receptor-like protein kinase FERONIA    108   2e-22   
ref|XP_006493304.1|  PREDICTED: receptor-like protein kinase FERO...    107   2e-22   
ref|XP_008231019.1|  PREDICTED: receptor-like protein kinase FERONIA    105   2e-22   
ref|XP_008388681.1|  PREDICTED: LOW QUALITY PROTEIN: receptor-lik...    107   2e-22   
gb|EMT28751.1|  Receptor-like protein kinase FERONIA                    107   2e-22   
ref|XP_011019995.1|  PREDICTED: receptor-like protein kinase ANXUR1     107   2e-22   
ref|XP_008364673.1|  PREDICTED: receptor-like protein kinase FERONIA    105   2e-22   
ref|XP_008370712.1|  PREDICTED: receptor-like protein kinase ANXUR2     107   2e-22   
ref|XP_007215522.1|  hypothetical protein PRUPE_ppa003761mg             106   3e-22   
ref|XP_009373803.1|  PREDICTED: receptor-like protein kinase FERONIA    107   3e-22   
ref|XP_010694005.1|  PREDICTED: putative receptor-like protein ki...    107   3e-22   
ref|XP_012084077.1|  PREDICTED: receptor-like protein kinase ANXUR1     107   3e-22   
ref|XP_007208221.1|  hypothetical protein PRUPE_ppa018611mg             107   3e-22   
ref|XP_006842554.1|  PREDICTED: receptor-like protein kinase FERONIA    107   3e-22   
ref|XP_010694013.1|  PREDICTED: putative receptor-like protein ki...    107   3e-22   
ref|XP_006285704.1|  hypothetical protein CARUB_v10007175mg             107   4e-22   
ref|XP_003531868.1|  PREDICTED: receptor-like protein kinase FERO...    107   4e-22   
ref|XP_004139382.1|  PREDICTED: receptor-like protein kinase ANXUR2     107   4e-22   
gb|KGN60792.1|  hypothetical protein Csa_2G010280                       106   4e-22   
ref|XP_003518179.1|  PREDICTED: receptor-like protein kinase FERO...    106   4e-22   
ref|XP_010315551.1|  PREDICTED: receptor-like protein kinase FERONIA    107   5e-22   
ref|XP_007216899.1|  hypothetical protein PRUPE_ppa019630mg             106   5e-22   
ref|XP_010032549.1|  PREDICTED: receptor-like protein kinase FERONIA    106   5e-22   
ref|XP_006603591.1|  PREDICTED: receptor-like protein kinase FERO...    105   5e-22   
ref|XP_010034426.1|  PREDICTED: receptor-like protein kinase FERONIA    106   5e-22   
ref|XP_003568697.1|  PREDICTED: receptor-like protein kinase FERONIA    106   6e-22   
ref|XP_007217617.1|  hypothetical protein PRUPE_ppa016279mg             106   6e-22   
gb|EMS60533.1|  Receptor-like protein kinase FERONIA                    106   6e-22   
gb|KDO41803.1|  hypothetical protein CISIN_1g044454mg                   102   6e-22   
ref|XP_002519226.1|  ATP binding protein, putative                      106   7e-22   
ref|XP_002447169.1|  hypothetical protein SORBIDRAFT_06g029710          106   8e-22   
ref|XP_007139448.1|  hypothetical protein PHAVU_008G030400g             105   8e-22   
emb|CDY26624.1|  BnaA09g46530D                                          106   9e-22   
ref|XP_004306057.1|  PREDICTED: receptor-like protein kinase FERONIA    105   9e-22   
gb|KCW52051.1|  hypothetical protein EUGRSUZ_J01491                     105   1e-21   
ref|XP_009365908.1|  PREDICTED: receptor-like protein kinase FERONIA    105   1e-21   
ref|XP_010034437.1|  PREDICTED: receptor-like protein kinase FERONIA    105   1e-21   
gb|EMT27425.1|  Receptor-like protein kinase FERONIA                    105   1e-21   
ref|XP_004495609.1|  PREDICTED: receptor-like protein kinase ANXU...    105   1e-21   
gb|KFK33634.1|  hypothetical protein AALP_AA5G039100                    104   1e-21   
ref|XP_008218280.1|  PREDICTED: receptor-like protein kinase ANXUR1     105   1e-21   
ref|XP_008231023.1|  PREDICTED: receptor-like protein kinase FERONIA    105   1e-21   
ref|XP_009372136.1|  PREDICTED: receptor-like protein kinase ANXUR2     102   2e-21   
ref|XP_009385224.1|  PREDICTED: receptor-like protein kinase ANXUR1     105   2e-21   
ref|XP_007139452.1|  hypothetical protein PHAVU_008G030800g             105   2e-21   
ref|XP_010435807.1|  PREDICTED: putative receptor-like protein ki...    105   2e-21   
emb|CDY29022.1|  BnaC07g32280D                                          104   2e-21   
gb|KHN31469.1|  Receptor-like protein kinase ANXUR2                     104   2e-21   
ref|XP_003520841.1|  PREDICTED: receptor-like protein kinase ANXU...    104   2e-21   
ref|XP_010034409.1|  PREDICTED: receptor-like protein kinase FERONIA    104   2e-21   
ref|XP_010914574.1|  PREDICTED: receptor-like protein kinase ANXUR2     104   2e-21   
ref|XP_009365907.1|  PREDICTED: receptor-like protein kinase FERONIA    104   2e-21   
ref|XP_011099164.1|  PREDICTED: putative receptor-like protein ki...    105   2e-21   
ref|XP_010041081.1|  PREDICTED: receptor-like protein kinase FERONIA    103   2e-21   
ref|XP_010660595.1|  PREDICTED: receptor-like protein kinase FERONIA    103   2e-21   
ref|XP_003633768.2|  PREDICTED: receptor-like protein kinase FERONIA    104   3e-21   
ref|XP_009364589.1|  PREDICTED: receptor-like protein kinase ANXUR2     104   3e-21   
gb|EMS57312.1|  Receptor-like protein kinase FERONIA                    104   3e-21   
ref|XP_008231022.1|  PREDICTED: LOW QUALITY PROTEIN: receptor-lik...    104   3e-21   
ref|XP_004137258.1|  PREDICTED: receptor-like protein kinase FERONIA    104   3e-21   
ref|XP_002323908.2|  Pto-like kinase OGw family protein                 104   3e-21   
ref|XP_012078068.1|  PREDICTED: receptor-like protein kinase FERONIA    104   3e-21   
ref|XP_008390575.1|  PREDICTED: receptor-like protein kinase ANXUR1     102   4e-21   
emb|CDP17056.1|  unnamed protein product                                103   4e-21   
gb|EYU22226.1|  hypothetical protein MIMGU_mgv1a022870mg                103   4e-21   
ref|XP_010032550.1|  PREDICTED: receptor-like protein kinase FERONIA    103   4e-21   
ref|XP_009139816.1|  PREDICTED: putative receptor-like protein ki...    103   5e-21   
ref|XP_011013067.1|  PREDICTED: LOW QUALITY PROTEIN: receptor-lik...    103   5e-21   
ref|XP_011656014.1|  PREDICTED: receptor-like protein kinase FERONIA    103   5e-21   
ref|XP_006493338.1|  PREDICTED: receptor-like protein kinase FERO...    102   5e-21   
gb|EYU20621.1|  hypothetical protein MIMGU_mgv1a018196mg                103   6e-21   
ref|XP_008379865.1|  PREDICTED: receptor-like protein kinase FERONIA    103   6e-21   
ref|XP_006493305.1|  PREDICTED: receptor-like protein kinase FERO...    103   7e-21   
emb|CAN76103.1|  hypothetical protein VITISV_015218                     103   7e-21   
ref|XP_008459393.1|  PREDICTED: receptor-like protein kinase FERO...    102   7e-21   
ref|XP_007035799.1|  Malectin/receptor-like protein kinase family...    103   8e-21   
ref|XP_008459392.1|  PREDICTED: receptor-like protein kinase FERO...    103   8e-21   
gb|EYU22231.1|  hypothetical protein MIMGU_mgv1a022345mg                102   8e-21   
gb|KCW52049.1|  hypothetical protein EUGRSUZ_J01489                     102   9e-21   
ref|XP_009365906.1|  PREDICTED: receptor-like protein kinase FERO...    102   1e-20   
ref|XP_002271113.1|  PREDICTED: receptor-like protein kinase ANXUR1     102   1e-20   
ref|XP_006387808.1|  hypothetical protein POPTR_0554s00200g             102   1e-20   
ref|XP_011009251.1|  PREDICTED: receptor-like protein kinase FERONIA    102   1e-20   
ref|XP_008809255.1|  PREDICTED: receptor-like protein kinase ANXUR1     102   1e-20   
ref|XP_010097778.1|  Receptor-like protein kinase                       102   1e-20   
ref|XP_008230415.1|  PREDICTED: receptor-like protein kinase FERONIA    102   1e-20   
gb|KDO57415.1|  hypothetical protein CISIN_1g038032mg                 98.6    1e-20   
ref|XP_010099328.1|  Receptor-like protein kinase FERONIA               102   2e-20   
gb|KEH24563.1|  malectin/receptor-like kinase family protein            102   2e-20   
ref|XP_008367132.1|  PREDICTED: uncharacterized protein LOC103430767    102   2e-20   
ref|XP_010034429.1|  PREDICTED: receptor-like protein kinase FERONIA    102   2e-20   
gb|KCW52041.1|  hypothetical protein EUGRSUZ_J01482                     101   2e-20   
ref|XP_006441078.1|  hypothetical protein CICLE_v10018785mg             101   2e-20   
ref|XP_010034433.1|  PREDICTED: receptor-like protein kinase FERONIA    101   2e-20   
ref|XP_010097803.1|  Receptor-like protein kinase FERONIA               101   2e-20   
ref|XP_007147183.1|  hypothetical protein PHAVU_006G102700g             101   2e-20   
ref|XP_008231018.1|  PREDICTED: receptor-like protein kinase FERONIA    101   2e-20   
ref|XP_010921463.1|  PREDICTED: receptor-like protein kinase ANXUR2     101   3e-20   
ref|XP_011015035.1|  PREDICTED: receptor-like protein kinase FERONIA    101   3e-20   
ref|XP_004494710.1|  PREDICTED: receptor-like protein kinase ANXU...    101   3e-20   
ref|XP_008459390.1|  PREDICTED: receptor-like protein kinase FERONIA  98.2    3e-20   
gb|KEH43006.1|  malectin/receptor-like kinase family protein            100   4e-20   
ref|XP_006654205.1|  PREDICTED: receptor-like protein kinase FERO...    100   4e-20   
ref|XP_012087727.1|  PREDICTED: receptor-like protein kinase FERONIA    100   4e-20   
gb|KDP23678.1|  hypothetical protein JCGZ_23511                         100   4e-20   
ref|XP_009360627.1|  PREDICTED: receptor-like protein kinase FERONIA    100   4e-20   
ref|XP_008367555.1|  PREDICTED: LOW QUALITY PROTEIN: receptor-lik...    100   4e-20   
ref|XP_002447000.1|  hypothetical protein SORBIDRAFT_06g026735        99.4    4e-20   
ref|XP_007151355.1|  hypothetical protein PHAVU_004G039500g             100   4e-20   
ref|XP_006408164.1|  hypothetical protein EUTSA_v10020050mg             100   5e-20   
ref|XP_007151354.1|  hypothetical protein PHAVU_004G039400g             100   5e-20   
ref|XP_012089283.1|  PREDICTED: receptor-like protein kinase ANXUR1     100   5e-20   
ref|XP_006604845.1|  PREDICTED: receptor-like protein kinase ANXU...    100   5e-20   
ref|XP_009118022.1|  PREDICTED: receptor-like protein kinase FERO...    100   6e-20   
ref|XP_006646366.1|  PREDICTED: receptor-like protein kinase FERO...    100   6e-20   
ref|XP_009365902.1|  PREDICTED: receptor-like protein kinase FERO...    100   6e-20   
ref|XP_004296245.1|  PREDICTED: receptor-like protein kinase ANXUR1     100   7e-20   
ref|XP_006482015.1|  PREDICTED: receptor-like protein kinase FERO...    100   7e-20   
ref|XP_007151352.1|  hypothetical protein PHAVU_004G039200g           99.8    9e-20   
ref|XP_008245502.1|  PREDICTED: receptor-like protein kinase FERONIA  97.4    1e-19   
ref|XP_004137257.1|  PREDICTED: receptor-like protein kinase FERONIA  99.8    1e-19   
gb|KHN32319.1|  Receptor-like protein kinase FERONIA                  99.4    1e-19   
ref|XP_009365903.1|  PREDICTED: receptor-like protein kinase FERO...  99.8    1e-19   
ref|XP_010034435.1|  PREDICTED: receptor-like protein kinase FERONIA  99.8    1e-19   
gb|KDO71938.1|  hypothetical protein CISIN_1g041565mg                 99.4    1e-19   
ref|XP_006419383.1|  hypothetical protein CICLE_v10004295mg           99.4    1e-19   
ref|XP_006488842.1|  PREDICTED: receptor-like protein kinase ANXU...  99.4    1e-19   
gb|KHN37920.1|  Receptor-like protein kinase FERONIA                  99.4    1e-19   
gb|EYU41262.1|  hypothetical protein MIMGU_mgv1a021720mg              99.0    1e-19   
gb|KCW87969.1|  hypothetical protein EUGRSUZ_A00377                   99.0    2e-19   
gb|EYU40180.1|  hypothetical protein MIMGU_mgv1a022123mg              99.0    2e-19   
ref|XP_010065050.1|  PREDICTED: receptor-like protein kinase ANXUR2   99.0    2e-19   
ref|XP_010694018.1|  PREDICTED: putative receptor-like protein ki...  99.0    2e-19   
gb|EYU45497.1|  hypothetical protein MIMGU_mgv1a001016mg              99.0    2e-19   
ref|XP_004304753.1|  PREDICTED: receptor-like protein kinase ANXUR1   99.0    2e-19   
ref|NP_001055089.1|  Os05g0280700                                     98.6    3e-19   
ref|XP_002874434.1|  kinase family protein                            98.6    3e-19   
gb|EYU22227.1|  hypothetical protein MIMGU_mgv1a024435mg              98.2    3e-19   
ref|XP_008348094.1|  PREDICTED: receptor-like protein kinase FERONIA  98.2    3e-19   
ref|XP_006430476.1|  hypothetical protein CICLE_v10011088mg           98.2    3e-19   
ref|XP_010025009.1|  PREDICTED: receptor-like protein kinase ANXUR1   98.2    3e-19   
ref|XP_006482424.1|  PREDICTED: receptor-like protein kinase FERO...  98.2    3e-19   
gb|KDO72282.1|  hypothetical protein CISIN_1g042216mg                 97.8    4e-19   
dbj|BAJ88190.1|  predicted protein                                    97.8    4e-19   
ref|XP_010099331.1|  hypothetical protein L484_018194                 96.3    5e-19   
ref|XP_002439522.1|  hypothetical protein SORBIDRAFT_09g009320        97.8    5e-19   
gb|EYU46822.1|  hypothetical protein MIMGU_mgv1a022107mg              97.4    5e-19   
ref|NP_001055184.1|  Os05g0318700                                     97.4    6e-19   
ref|XP_006395027.1|  hypothetical protein EUTSA_v10003639mg           97.4    6e-19   
gb|EEC75192.1|  hypothetical protein OsI_11431                        97.4    6e-19   
gb|EEE63237.1|  hypothetical protein OsJ_18047                        97.4    6e-19   
gb|EAY97521.1|  hypothetical protein OsI_19449                        97.4    6e-19   
ref|NP_001050022.1|  Os03g0333200                                     97.4    7e-19   
ref|XP_004962493.1|  PREDICTED: receptor-like protein kinase ANXU...  97.4    7e-19   
ref|XP_009385155.1|  PREDICTED: receptor-like protein kinase ANXUR2   97.1    7e-19   
ref|XP_006602953.1|  PREDICTED: receptor-like protein kinase FERO...  96.7    9e-19   
gb|AFW77551.1|  putative receptor-like protein kinase family protein  96.7    1e-18   
ref|XP_006430941.1|  hypothetical protein CICLE_v10013889mg           96.3    1e-18   
ref|XP_002884459.1|  kinase family protein                            96.7    1e-18   
gb|EEE63232.1|  hypothetical protein OsJ_18042                        96.3    1e-18   
ref|XP_010494105.1|  PREDICTED: receptor-like protein kinase ANXUR2   96.3    1e-18   
ref|NP_001055180.1|  Os05g0317900                                     96.3    1e-18   
gb|EEC78971.1|  hypothetical protein OsI_19445                        96.3    1e-18   
ref|NP_187120.1|  receptor-like protein kinase ANXUR1                 96.3    1e-18   
ref|XP_006606937.1|  PREDICTED: receptor-like protein kinase ANXU...  96.3    1e-18   
gb|KGN52521.1|  hypothetical protein Csa_5G640550                     95.1    2e-18   
dbj|BAJ93584.1|  predicted protein                                    95.9    2e-18   
ref|XP_010032628.1|  PREDICTED: receptor-like protein kinase FERONIA  95.9    2e-18   
ref|XP_010031920.1|  PREDICTED: receptor-like protein kinase FERONIA  95.9    2e-18   
ref|XP_004962463.1|  PREDICTED: receptor-like protein kinase FERO...  95.9    2e-18   
gb|EMS52253.1|  Receptor-like protein kinase FERONIA                  95.5    2e-18   
gb|KHN18064.1|  Receptor-like protein kinase ANXUR2                   95.5    2e-18   
ref|XP_003535370.1|  PREDICTED: receptor-like protein kinase ANXU...  95.5    2e-18   



>ref|XP_009588433.1| PREDICTED: receptor-like protein kinase FERONIA [Nicotiana tomentosiformis]
Length=882

 Score =   199 bits (507),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 106/205 (52%), Positives = 144/205 (70%), Gaps = 18/205 (9%)
 Frame = +2

Query  242  FLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIA-EQGPLASQVPFTTARVF  418
            FLL+CGA S +T++D R W+TD H+   +P+N A +S+ AIA EQG L ++VP+  AR+F
Sbjct  34   FLLNCGASSGATAEDNRLWNTDIHFTNLLPSNFATISTTAIASEQGSL-TRVPYMNARIF  92

Query  419  TSELTYSFRVSPGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYTLLKNFSAF  598
             S+ TY+F VSPG KFLRLYF+PANYS         FNK++ FF+VTAN++TLL NFSAF
Sbjct  93   KSQFTYTFPVSPGTKFLRLYFHPANYSGG-------FNKSESFFSVTANHFTLLSNFSAF  145

Query  599  LTvsspdpfvfspdpfIKKEFIVNVDDKQQLNLTFSPSP--YAFVNGIEIVSMPSDLYFR  772
            LT           +  I+KE+++NVD+ Q+LN+TFSPSP  YAFVNGIEIVSMP+DLY +
Sbjct  146  LT---LSASADESNKPIRKEYVINVDESQRLNITFSPSPNSYAFVNGIEIVSMPTDLYIQ  202

Query  773  GDNNNYPIISA----VHFDNSTTME  835
            GD +   ++       + +NST +E
Sbjct  203  GDEHGIKLVQGQNNFYYINNSTALE  227



>ref|XP_009790514.1| PREDICTED: receptor-like protein kinase FERONIA [Nicotiana sylvestris]
Length=879

 Score =   198 bits (503),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 103/204 (50%), Positives = 139/204 (68%), Gaps = 15/204 (7%)
 Frame = +2

Query  242  FLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARVFT  421
            FLL+CGA S +T +D R W+TD H+   +P+N   +S+PAIA +    + VP+  AR+F 
Sbjct  34   FLLNCGASSDATDEDDRLWNTDIHFTNLLPSNFTTISTPAIASEQGSVTTVPYMNARIFK  93

Query  422  SELTYSFRVSPGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYTLLKNFSAFL  601
            S+ TY+F VSPG KFLRLYF+PA+YS      G RFNK++ FF+VTAN+ TLL NFSAFL
Sbjct  94   SQFTYTFPVSPGTKFLRLYFHPADYS------GGRFNKSESFFSVTANHVTLLSNFSAFL  147

Query  602  TvsspdpfvfspdpfIKKEFIVNVDDKQQLNLTFSPSP--YAFVNGIEIVSMPSDLYFRG  775
            T           +  I+KE++VNVD+ Q+LN+TFSPSP  YAFVNGIEIVS+P+DLY RG
Sbjct  148  T---VSASADESNKAIRKEYVVNVDESQRLNITFSPSPNSYAFVNGIEIVSIPTDLYIRG  204

Query  776  DNNNYPIISA----VHFDNSTTME  835
            D     ++       + ++ST +E
Sbjct  205  DEYGIKLVQGQNNFYYINSSTALE  228



>ref|XP_004232151.1| PREDICTED: receptor-like protein kinase FERONIA [Solanum lycopersicum]
Length=869

 Score =   186 bits (472),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 103/203 (51%), Positives = 131/203 (65%), Gaps = 18/203 (9%)
 Frame = +2

Query  239  FFLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIA-EQGPLASQVPFTTA-R  412
            F LL+CGA S  T   GR WDTD H+  F+P++ + +S+ A A EQ P  +++P+TT  R
Sbjct  31   FVLLNCGAQSAITDDTGRRWDTDTHFPNFLPSDFSSISTTATALEQDPSVNRIPYTTGIR  90

Query  413  VFTSELTYSFRVSPGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYTLLKNFS  592
            +  S+ TY+FRV+PG  FLRLYFYPANYS         FNK D FF+VTANN TLL NFS
Sbjct  91   IMRSQFTYTFRVTPGTIFLRLYFYPANYSG--------FNKADSFFSVTANNLTLLSNFS  142

Query  593  AFLTvsspdpfvfspdpfIKKEFIVNVDDKQQLNLTFSPSP--YAFVNGIEIVSMPSDLY  766
            AF T         S    ++KE+++NVD+ Q L LTFSPSP  YAFVNGIEI+SMP+DLY
Sbjct  143  AFFT------VSASSTKAVQKEYVINVDETQMLKLTFSPSPNSYAFVNGIEILSMPTDLY  196

Query  767  FRGDNNNYPIISAVHFDNSTTME  835
              GD          + +NST +E
Sbjct  197  IHGDVKLTGNTIPYNINNSTALE  219



>ref|XP_006338349.1| PREDICTED: receptor-like protein kinase FERONIA-like [Solanum 
tuberosum]
Length=856

 Score =   180 bits (457),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 101/206 (49%), Positives = 136/206 (66%), Gaps = 23/206 (11%)
 Frame = +2

Query  239  FFLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIA-EQGPLASQVPFTT-AR  412
            + LL+CGA S +T +  R WDTD H+  F+P++ + +S+ A A EQ P  ++VP+TT AR
Sbjct  31   YVLLNCGAQSATTDETDRRWDTDTHFPNFLPSDFSNISTTATASEQDPSVNRVPYTTGAR  90

Query  413  VFTSELTYSFRVSPGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYTLLKNFS  592
            +  S  TY+FRVSPG KFLRLYFYPANYS         FNK + FF+VTAN+ TLL+NFS
Sbjct  91   IMKSRFTYTFRVSPGAKFLRLYFYPANYSG--------FNKAESFFSVTANHLTLLRNFS  142

Query  593  AFLTvsspdpfvfspdpfIKKEFIVNVDDKQQLNLTFSPSP--YAFVNGIEIVSMPSDLY  766
            A          V      ++KEF++NVD+ Q L++TFSPSP  YAFVNGIEI+SMP++LY
Sbjct  143  AL-------AAVTDSSKALRKEFVINVDETQILDVTFSPSPNSYAFVNGIEILSMPTNLY  195

Query  767  FRGDNNNYPIISAVHF---DNSTTME  835
              G N+   ++    F   +NST +E
Sbjct  196  IHG-NHRIKLVGQNDFFYINNSTALE  220



>ref|XP_009790513.1| PREDICTED: receptor-like protein kinase FERONIA [Nicotiana sylvestris]
Length=874

 Score =   169 bits (427),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 96/204 (47%), Positives = 131/204 (64%), Gaps = 19/204 (9%)
 Frame = +2

Query  242  FLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARVFT  421
            FLL+CGA S +  +D R W TD +Y   +P++ + +S+ A A      ++V + +AR+F 
Sbjct  43   FLLNCGASSDAIDED-RLWSTDANYPDSLPSDFSSISTTANASGQ--VTRVYYMSARIFQ  99

Query  422  SELTYSFRVSPGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYTLLKNFSAFL  601
            S+ TY+F VSPG KFLRLYFYP +YS         FNK++ FF+VTAN+ TLL NFSAFL
Sbjct  100  SQFTYNFIVSPGTKFLRLYFYPTDYSG--------FNKSESFFSVTANHVTLLSNFSAFL  151

Query  602  TvsspdpfvfspdpfIKKEFIVNVDDKQQLNLTFSPSP--YAFVNGIEIVSMPSDLYFRG  775
            T              I+KE++++VD+ Q LN+TFSPSP  YAFVNGIEIVSMP+DLY RG
Sbjct  152  T--VSASDDDESSKAIRKEYVIHVDESQILNITFSPSPNSYAFVNGIEIVSMPTDLYIRG  209

Query  776  DNNNYPIISA----VHFDNSTTME  835
            D     ++       + +NST +E
Sbjct  210  DEYGIKLVQGRNNFYYINNSTALE  233



>ref|XP_006338348.1| PREDICTED: receptor-like protein kinase FERONIA-like [Solanum 
tuberosum]
Length=873

 Score =   165 bits (417),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 103/203 (51%), Positives = 133/203 (66%), Gaps = 18/203 (9%)
 Frame = +2

Query  239  FFLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIA-EQGPLASQVPFTT-AR  412
            F LL+CGA S +T    R WDTD H+  F+P+N   +S+ A A EQ P  ++VP+TT AR
Sbjct  31   FVLLNCGAQSATTDDTDRRWDTDTHFPNFLPSNFTSISTTATASEQDPSVNRVPYTTGAR  90

Query  413  VFTSELTYSFRVSPGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYTLLKNFS  592
            +  S+ TY+FRV+PG  FLRLYFYPANYS         F+K + FF+VTAN+ TLL NFS
Sbjct  91   IMRSQFTYTFRVTPGTIFLRLYFYPANYSG--------FDKAESFFSVTANHLTLLSNFS  142

Query  593  AFLTvsspdpfvfspdpfIKKEFIVNVDDKQQLNLTFSPSP--YAFVNGIEIVSMPSDLY  766
            AFLT         S    ++KE+++NVD+ Q L LTFSPSP  YAFVNGIEI+SMP+DLY
Sbjct  143  AFLT------VSASSRKQVQKEYVINVDETQILKLTFSPSPNSYAFVNGIEILSMPTDLY  196

Query  767  FRGDNNNYPIISAVHFDNSTTME  835
              GD       +  + +NST +E
Sbjct  197  IHGDVKLAGNTNPYNINNSTALE  219



>ref|XP_011009253.1| PREDICTED: receptor-like protein kinase FERONIA [Populus euphratica]
Length=833

 Score =   155 bits (393),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 95/203 (47%), Positives = 123/203 (61%), Gaps = 18/203 (9%)
 Frame = +2

Query  242  FLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSP-AIAEQGPLASQVPFTTARVF  418
             LL+CGA S  TS DGR WD D+   +F  +N  E SS  A + QGP   QVP+ TAR+F
Sbjct  51   ILLNCGASSNLTSPDGRSWDGDSQS-KFAASNPPEASSVFAASTQGPSGDQVPYMTARIF  109

Query  419  TSELTYSFRVSPGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYTLLKNFSAF  598
             S+ TY+F V PG KF+RLYFY A+YS          + +  +F+++ANNY LL NFSA 
Sbjct  110  HSKFTYTFPVLPGPKFVRLYFYRASYS--------NLDISTSYFSLSANNYKLLDNFSAS  161

Query  599  LTvsspdpfvfspdpfIKKEFIVNVDDKQQLNLTFSPSP--YAFVNGIEIVSMPSDLYFR  772
            LT          P     KEFI+ V DKQ+L LTF+PSP  +AF+NGIEIVSMP   Y R
Sbjct  162  LT----VSATIPPVDSFTKEFIITVWDKQKLELTFAPSPASFAFINGIEIVSMPDSFYAR  217

Query  773  GDNNNYPIISAVHFD--NSTTME  835
            G++N+   +    F   N+T +E
Sbjct  218  GNDNSLTYVGTAPFSLYNTTALE  240



>ref|XP_012088049.1| PREDICTED: receptor-like protein kinase FERONIA [Jatropha curcas]
Length=865

 Score =   155 bits (392),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 97/208 (47%), Positives = 137/208 (66%), Gaps = 21/208 (10%)
 Frame = +2

Query  236  EFFLLSCGAPSKSTSQDGRDWDTD-NHYLQFMPTNTAELSSPAIA-EQGPLASQVPFTTA  409
            +  LL+CGAP++  S DGR+W+ D  H  ++ P N +E+SSP+ A +Q    + VP+ TA
Sbjct  30   DLILLNCGAPNEGQSMDGRNWEGDAGHRSKYCPFN-SEISSPSKASQQDSSVTPVPYMTA  88

Query  410  RVFTSELTYSFRVSPGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYTLLKNF  589
            R++ S+ T +F VS G KF+RLYFYP  YS          N +  FF+VTAN+YTLL NF
Sbjct  89   RIYRSKFTCTFPVSMGPKFIRLYFYPTTYSG--------LNISTSFFSVTANDYTLLSNF  140

Query  590  SAFLTvsspdpfvfspdpfIKKEFIVNVDDKQQ-LNLTFSPSP--YAFVNGIEIVSMPSD  760
            S++LTVS+  P V        KEFI++V D Q  +NLTF+PSP  +AF+NGIEIVSMP++
Sbjct  141  SSYLTVSAMQPPVAYFV----KEFIISVWDNQAVINLTFTPSPNSFAFINGIEIVSMPTN  196

Query  761  LYFRGDNNNYPII---SAVHFDNSTTME  835
            LY + ++  YP +   S  +FDN+T +E
Sbjct  197  LYAKDNDYAYPFVNDNSIFNFDNTTALE  224



>emb|CDP19885.1| unnamed protein product [Coffea canephora]
Length=895

 Score =   152 bits (383),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 89/182 (49%), Positives = 114/182 (63%), Gaps = 16/182 (9%)
 Frame = +2

Query  236  EFFLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIA-EQGPLASQVPFTTAR  412
            ++ L++CG  S +TS DGR+W  D    +F P + A +SS   A EQ P  S  P+  AR
Sbjct  30   DYILINCGTSSNATSADGRNWYGDAGS-KFSPNDMATISSAVTAIEQDPSVSGAPYLNAR  88

Query  413  VFTSELTYSFRVSPGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYTLLKNFS  592
            +  S  +Y+F VSPG+KF+RLYFYPA+YS+        FN T+ FF V ANNYTLL NFS
Sbjct  89   IIRSNFSYTFPVSPGKKFVRLYFYPASYSS-------DFNATESFFAVMANNYTLLSNFS  141

Query  593  AFLTvsspdpfvfspdpfIKKEFIVNVDDKQQ-LNLTFSPSP--YAFVNGIEIVSMPSDL  763
            AFLT             ++ KEFI+NV+   Q LN+TFSPSP  YAF+NGIE+VS P  L
Sbjct  142  AFLT----VSAGGFSPAYVVKEFIINVEAMNQFLNVTFSPSPKSYAFINGIEVVSTPDRL  197

Query  764  YF  769
            Y 
Sbjct  198  YM  199



>ref|XP_007032827.1| Malectin/receptor-like protein kinase family protein, putative 
[Theobroma cacao]
 gb|EOY03753.1| Malectin/receptor-like protein kinase family protein, putative 
[Theobroma cacao]
Length=866

 Score =   151 bits (382),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 93/204 (46%), Positives = 122/204 (60%), Gaps = 18/204 (9%)
 Frame = +2

Query  242  FLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIA-EQGPLASQVPFTTARVF  418
             LL CGA S +TS DGR W+ D+ + +F   N    S  + A +Q    +++P+ TAR+F
Sbjct  33   ILLDCGAQSNTTSSDGRSWEADSDHSKFSAPNRENASFVSTASQQDSSVTRIPYMTARIF  92

Query  419  TSELTYSFRVSPGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYTLLKNFSAF  598
             SE TY+F VSPG KFLRLYFY A +           N T  FF+V ANN TLL NFSA+
Sbjct  93   RSEFTYNFPVSPGPKFLRLYFYSAEFPG--------LNVTTSFFSVNANNSTLLSNFSAY  144

Query  599  LTvsspdpfvfspdpfIKKEFIVNVDDKQQLNLTFSPSP--YAFVNGIEIVSMPSDLYFR  772
            LT S+  P +        KE+I+ V   Q L+LTF PSP  YAF+NGIEIVSMPS LY R
Sbjct  145  LTASATRPPISHFI----KEYIITVWGNQMLSLTFVPSPNSYAFINGIEIVSMPSSLYMR  200

Query  773  GDNNNYPIIS---AVHFDNSTTME  835
            GD++   ++    +    N+T +E
Sbjct  201  GDDDQPTLVGYGFSFLLQNTTNLE  224



>emb|CDP19887.1| unnamed protein product [Coffea canephora]
Length=825

 Score =   151 bits (381),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 91/182 (50%), Positives = 115/182 (63%), Gaps = 16/182 (9%)
 Frame = +2

Query  236  EFFLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIA-EQGPLASQVPFTTAR  412
            ++ L++CG+ S +TS DGR+W  D    +F P + A +SS   A EQ    S  P+ TAR
Sbjct  30   DYILINCGSSSNATSADGRNWYGDAGS-KFSPNDMATISSAVTATEQDSSVSGAPYLTAR  88

Query  413  VFTSELTYSFRVSPGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYTLLKNFS  592
            +  S  +Y+F VSPG+KF+RLYFYPA+YS+        FN T+ FF V ANNYTLL NFS
Sbjct  89   IIRSNFSYTFPVSPGKKFVRLYFYPASYSS-------DFNATESFFAVMANNYTLLSNFS  141

Query  593  AFLTvsspdpfvfspdpfIKKEFIVNVDDKQQ-LNLTFSPSP--YAFVNGIEIVSMPSDL  763
            AFLT      F  S    + KEFI+NV    Q LN+TFSPSP  YAF+NGIE+VS P  L
Sbjct  142  AFLT----VSFGGSSSASLVKEFIINVQAMNQFLNVTFSPSPKSYAFINGIEVVSTPDGL  197

Query  764  YF  769
            Y 
Sbjct  198  YM  199



>ref|XP_010246590.1| PREDICTED: receptor-like protein kinase FERONIA [Nelumbo nucifera]
Length=836

 Score =   150 bits (379),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 91/196 (46%), Positives = 118/196 (60%), Gaps = 22/196 (11%)
 Frame = +2

Query  236  EFFLLSCGAPSKST-SQDGRDWDTDNHYLQFMPTNTAELSSPAIA-EQGPLASQVPFTTA  409
            E  LL+CG+P KS  SQDGR+W  D     F P +   LS+ + A +Q     Q+P+ TA
Sbjct  41   EEILLNCGSPLKSIQSQDGRNWTGDVGS-NFAPMDRFNLSTTSTASQQDSSVPQIPYMTA  99

Query  410  RVFTSELTYSFRVSPGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYTLLKNF  589
            RVF S   Y+F V PG KF+RLYFYPA+YS          +KT+ FF V A +YTLL+NF
Sbjct  100  RVFHSPFVYTFLVQPGPKFIRLYFYPASYSG--------LDKTNAFFDVYAGSYTLLRNF  151

Query  590  SAFLTvsspdpfvfspdpfIKKEFIVNVDDKQQLNLTFSPSP-----YAFVNGIEIVSMP  754
            SAFLT  +     F       KEF VN ++   L++TFSP+P     Y FVNGIEIVSMP
Sbjct  152  SAFLTADTLKQASFV------KEFCVNTENSSLLDITFSPTPNAFETYGFVNGIEIVSMP  205

Query  755  SDLYFRGDNNNYPIIS  802
            + LY  GD+ + P++ 
Sbjct  206  AGLYIEGDDVSLPLVG  221



>ref|XP_006373375.1| hypothetical protein POPTR_0017s13190g, partial [Populus trichocarpa]
 gb|ERP51172.1| hypothetical protein POPTR_0017s13190g, partial [Populus trichocarpa]
Length=855

 Score =   150 bits (380),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 92/206 (45%), Positives = 124/206 (60%), Gaps = 19/206 (9%)
 Frame = +2

Query  236  EFFLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSP-AIAEQGPLASQVPFTTAR  412
            +  LL+CGA S  +S DGR WD D+   +F  +N  E SS  A + Q P  +QVP+ TAR
Sbjct  35   DLILLNCGASSNLSSPDGRSWDGDSQS-KFAASNPPETSSVFAASNQDPSVNQVPYMTAR  93

Query  413  VFTSELTYSFRVSPGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYTLLKNFS  592
            +F S+ TY+F V PG KF+RLYFYPA+YS          + +  +F+++AN+Y LL NFS
Sbjct  94   IFHSKFTYTFPVLPGPKFVRLYFYPASYS--------NLDISTSYFSLSANDYELLNNFS  145

Query  593  AFLTvsspdpfvfspdpfIKKEFIVNVDDKQQLNLTFSPSP--YAFVNGIEIVSMPSDLY  766
            A LT       +  P     KEFI+ V D Q+L LTF PSP  +AF+NGIEIVSMP   Y
Sbjct  146  ASLT----VSAIIPPVDSFTKEFIITVWDNQKLELTFIPSPASFAFINGIEIVSMPDSFY  201

Query  767  FRGDNNNYPIISA---VHFDNSTTME  835
             RG++N    +      + DN+T +E
Sbjct  202  ARGNDNPLTYVGTDLFFYLDNTTVLE  227



>ref|XP_006373380.1| hypothetical protein POPTR_0017s13240g [Populus trichocarpa]
 gb|ERP51177.1| hypothetical protein POPTR_0017s13240g [Populus trichocarpa]
Length=879

 Score =   150 bits (380),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 89/186 (48%), Positives = 116/186 (62%), Gaps = 16/186 (9%)
 Frame = +2

Query  236  EFFLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSP-AIAEQGPLASQVPFTTAR  412
            +  LL+CGA S  +S DGR WD D+   +F  +N  E SS  A + Q P  +QVP+ TAR
Sbjct  34   DLILLNCGASSNLSSPDGRGWDGDSQS-KFAASNPPEASSVFAASNQDPSVNQVPYMTAR  92

Query  413  VFTSELTYSFRVSPGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYTLLKNFS  592
            +F S+ TY+F V PG KF+RLYFYPA+YS          + +  +F++ ANNY LL NFS
Sbjct  93   IFHSKFTYTFPVLPGPKFVRLYFYPASYS--------NLDISTSYFSIRANNYQLLNNFS  144

Query  593  AFLTvsspdpfvfspdpfIKKEFIVNVDDKQQLNLTFSPSP--YAFVNGIEIVSMPSDLY  766
            A LT       +  P  +  KEFI+ V D Q+L LTF PSP  ++F+NGIEIVSMP   Y
Sbjct  145  ASLT----VSAIIPPVDYFTKEFIITVRDNQKLELTFIPSPASFSFINGIEIVSMPDSFY  200

Query  767  FRGDNN  784
             RGD+N
Sbjct  201  ARGDDN  206



>ref|XP_011009252.1| PREDICTED: LOW QUALITY PROTEIN: receptor-like protein kinase 
FERONIA [Populus euphratica]
Length=744

 Score =   149 bits (375),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 91/204 (45%), Positives = 121/204 (59%), Gaps = 19/204 (9%)
 Frame = +2

Query  236  EFFLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARV  415
            +  LL+CGA S  +S DGR WD D+   +F  +N  E SS  +  Q P  +QVP+ TAR+
Sbjct  48   DLILLNCGASSNLSSPDGRSWDGDSQS-KFAASNPPEASS--VTXQDPSVNQVPYMTARI  104

Query  416  FTSELTYSFRVSPGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYTLLKNFSA  595
            F S+ TY+F V PG KF+RLYFY A+YS          + +  +F+++ANNY LL NFSA
Sbjct  105  FHSKFTYTFPVLPGPKFVRLYFYRASYS--------NLDISTSYFSLSANNYKLLDNFSA  156

Query  596  FLTvsspdpfvfspdpfIKKEFIVNVDDKQQLNLTFSPSP--YAFVNGIEIVSMPSDLYF  769
             LT          P     KEFI+ V D Q+L LTF PSP  +AF+NGIEIVSMP   Y 
Sbjct  157  SLT----VSATIPPVDSFTKEFIITVWDNQKLELTFIPSPASFAFINGIEIVSMPDSFYA  212

Query  770  RGDNNNYPIISAVHFD--NSTTME  835
            RG++N+   +    F   N+T +E
Sbjct  213  RGNDNSLTYVGTAPFSLYNTTALE  236



>gb|KJB10568.1| hypothetical protein B456_001G207900 [Gossypium raimondii]
Length=794

 Score =   149 bits (376),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 91/205 (44%), Positives = 124/205 (60%), Gaps = 22/205 (11%)
 Frame = +2

Query  236  EFFLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARV  415
            ++ LL+CGA S +TS DGR+W  D+ +L     NT+  SS A + Q P  +QVP+ TAR 
Sbjct  28   DYILLNCGASSNTTSYDGRNWVADDDHLY---ANTSSFSSTA-SYQDPSVTQVPYMTARF  83

Query  416  FTSELTYSFRVSPGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYTLLKNFSA  595
            F  E TY F +SPG KFLRLYFYP  Y           + T  FF+V ANNYTLL NFSA
Sbjct  84   FRGEFTYKFPLSPGPKFLRLYFYPNQYPG--------LDITSSFFSVAANNYTLLSNFSA  135

Query  596  FLTvsspdpfvfspdpfIKKEFIVNVDDKQQLNLTFSPSP--YAFVNGIEIVSMPSDLYF  769
            +L           P  FI KEF++ V  +Q +++TF+PSP  +AF+NGIE+VSMP++LY 
Sbjct  136  YLV-----SATSPPQAFIVKEFVITVGKEQMMDVTFAPSPNSFAFINGIEVVSMPANLYT  190

Query  770  RGDNNNYPIISAVHF---DNSTTME  835
                 +  +I   +F   +NST ++
Sbjct  191  GQTYGSLRLIDTNYFFELENSTALD  215



>gb|KDP24661.1| hypothetical protein JCGZ_26520 [Jatropha curcas]
Length=978

 Score =   149 bits (375),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 93/206 (45%), Positives = 125/206 (61%), Gaps = 19/206 (9%)
 Frame = +2

Query  236  EFFLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELS-SPAIAEQGPLASQVPFTTAR  412
            E  LLSCGA S +TS DGR+W +D    +F  + +   S +   + Q    +QVP+ TAR
Sbjct  209  EIILLSCGASSLTTSPDGRNWVSDARS-KFGASISLNSSFAFKASGQDTSVTQVPYMTAR  267

Query  413  VFTSELTYSFRVSPGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYTLLKNFS  592
            +F S+ TYSF VSPG KF+RLYFYP  YS          + +  FF+V AN+YTLL NFS
Sbjct  268  IFLSKFTYSFPVSPGSKFVRLYFYPVAYS--------NLDISKSFFSVEANDYTLLSNFS  319

Query  593  AFLTvsspdpfvfspdpfIKKEFIVNVDDKQQLNLTFSPS--PYAFVNGIEIVSMPSDLY  766
            AFLT       +  P   I KEF+V + +KQ LN+TF+PS   +AF+NGIEIVSMP  LY
Sbjct  320  AFLT----VSAMQPPAAAIVKEFVVTIQEKQMLNITFNPSLKSFAFINGIEIVSMPDSLY  375

Query  767  FRGDNN---NYPIISAVHFDNSTTME  835
              G+++   N  I    + D++T +E
Sbjct  376  IHGNDSLLTNVGIDYPFYLDDTTALE  401



>ref|XP_012084847.1| PREDICTED: LOW QUALITY PROTEIN: putative receptor-like protein 
kinase At5g39000 [Jatropha curcas]
Length=893

 Score =   148 bits (374),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 91/206 (44%), Positives = 125/206 (61%), Gaps = 19/206 (9%)
 Frame = +2

Query  236  EFFLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELS-SPAIAEQGPLASQVPFTTAR  412
            +  LL+CGA S +TS DGR+W +D    +F  +N+   S +   + Q    +QVP+ TAR
Sbjct  42   DIILLNCGASSLTTSPDGRNWASDARS-KFGASNSQNSSFAFKASRQDTSVTQVPYMTAR  100

Query  413  VFTSELTYSFRVSPGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYTLLKNFS  592
            +F S+ TYSF VS G KF+RLYFYP  YS          + +  FF+V AN+YTLL NFS
Sbjct  101  IFLSKFTYSFPVSLGSKFVRLYFYPVAYS--------NLDISKSFFSVEANDYTLLSNFS  152

Query  593  AFLTvsspdpfvfspdpfIKKEFIVNVDDKQQLNLTFSPS--PYAFVNGIEIVSMPSDLY  766
            AFLT       +  P   I KEF+V + +KQ LN+TF+PS   +AF+NGIEI+SMP  LY
Sbjct  153  AFLT----VSAMQPPAAAIVKEFVVTIQEKQMLNVTFNPSLKSFAFINGIEIISMPEGLY  208

Query  767  FRGDNN---NYPIISAVHFDNSTTME  835
              G+++   N  I    + DN+T +E
Sbjct  209  IHGNDSPLVNVGIDYPFYLDNTTALE  234



>emb|CDP15786.1| unnamed protein product [Coffea canephora]
Length=517

 Score =   145 bits (367),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 87/189 (46%), Positives = 118/189 (62%), Gaps = 17/189 (9%)
 Frame = +2

Query  236  EFFLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIA-EQGPLASQVPFTTAR  412
            ++ L++CG+ S +TS DGR W+ D    +F+P + A +S    A EQ    +Q+PF TAR
Sbjct  30   DYILINCGSSSNATSTDGRHWEGDVGS-KFLPNDVANISLADTATEQHSSVTQIPFLTAR  88

Query  413  VFTSELTYSFRVSPGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYTLLKNFS  592
            +  S+ +Y+F VSPG+KFLRLYFYP++YS+         N ++ FFTVTANNYTLL NF+
Sbjct  89   IIRSQFSYTFPVSPGEKFLRLYFYPSSYSSG-------LNTSESFFTVTANNYTLLSNFN  141

Query  593  AFLTvsspdpfvfspdpfIKKEFIVNVDDKQQ-LNLTFSPS--PYAFVNGIEIVSMPSDL  763
            AFL               + KEFI+NV    Q L + F PS   YAFVNGIE+VS P DL
Sbjct  142  AFLI----VSAKKFAPASLIKEFIINVQGMNQFLKVNFLPSMNSYAFVNGIEVVSTPDDL  197

Query  764  YFRGDNNNY  790
            Y  G+++ Y
Sbjct  198  YM-GNHDMY  205



>ref|XP_012084348.1| PREDICTED: receptor-like protein kinase FERONIA [Jatropha curcas]
Length=904

 Score =   147 bits (372),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 91/206 (44%), Positives = 125/206 (61%), Gaps = 19/206 (9%)
 Frame = +2

Query  236  EFFLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELS-SPAIAEQGPLASQVPFTTAR  412
            +  LL+CGA S +TS DGR+W +D    +F  +N+   S +   + Q    +QVP+ TAR
Sbjct  42   DIILLNCGASSLTTSPDGRNWASDARS-KFGASNSQNSSFAFKASRQDTSVTQVPYMTAR  100

Query  413  VFTSELTYSFRVSPGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYTLLKNFS  592
            +F S+ TYSF VS G KF+RLYFYP  YS          + +  FF+V AN+YTLL NFS
Sbjct  101  IFLSKFTYSFPVSLGSKFVRLYFYPVAYS--------NLDISKSFFSVEANDYTLLSNFS  152

Query  593  AFLTvsspdpfvfspdpfIKKEFIVNVDDKQQLNLTFSPS--PYAFVNGIEIVSMPSDLY  766
            AFLT       +  P   I KEF+V + +KQ LN+TF+PS   +AF+NGIEI+SMP  LY
Sbjct  153  AFLT----VSAMQPPAAAIVKEFVVTIQEKQMLNVTFNPSLKSFAFINGIEIISMPEGLY  208

Query  767  FRGDNN---NYPIISAVHFDNSTTME  835
              G+++   N  I    + DN+T +E
Sbjct  209  IHGNDSPLVNVGIDYPFYLDNTTALE  234



>ref|XP_006373370.1| hypothetical protein POPTR_0017s13150g [Populus trichocarpa]
 gb|ERP51167.1| hypothetical protein POPTR_0017s13150g [Populus trichocarpa]
Length=855

 Score =   147 bits (370),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 91/206 (44%), Positives = 122/206 (59%), Gaps = 19/206 (9%)
 Frame = +2

Query  236  EFFLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSP-AIAEQGPLASQVPFTTAR  412
            +  LL+CGA S   S DGR WD D+   +F  +N  E SS    + Q P  +QVP+ TAR
Sbjct  33   DLILLNCGASSNLLSPDGRGWDGDSQS-KFAASNPPEASSVFEASNQDPSVNQVPYMTAR  91

Query  413  VFTSELTYSFRVSPGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYTLLKNFS  592
            +F S+ TY+F V PG KF+RLYFYPA+YS          + +  +F+++ANNY LL NFS
Sbjct  92   IFHSKFTYTFPVLPGPKFVRLYFYPASYS--------NLDISTSYFSLSANNYELLNNFS  143

Query  593  AFLTvsspdpfvfspdpfIKKEFIVNVDDKQQLNLTFSPSP--YAFVNGIEIVSMPSDLY  766
            A LT       +  P  +  KEFI+ V D Q+L L F PSP  +AF+NGIEIVSMP   Y
Sbjct  144  ASLT----VSAIRPPVDYFTKEFIITVWDSQKLELNFIPSPASFAFINGIEIVSMPDSFY  199

Query  767  FRGDNNNYPIISA---VHFDNSTTME  835
             RG++N    +      + DN+T +E
Sbjct  200  SRGNDNPLTYVGTDLFFYLDNTTVLE  225



>emb|CDP05401.1| unnamed protein product [Coffea canephora]
Length=888

 Score =   147 bits (370),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 88/181 (49%), Positives = 111/181 (61%), Gaps = 16/181 (9%)
 Frame = +2

Query  236  EFFLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARV  415
            ++ L++CG  S +TS DGR+W  D    +F P + A +SS A+    P  S  PF TAR+
Sbjct  30   DYILINCGTSSNATSADGRNWYGDAGS-KFSPNDMASISS-AVTATAPSVSGAPFLTARI  87

Query  416  FTSELTYSFRVSPGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYTLLKNFSA  595
              S  +Y+F VSPG+KF+RLYFYPA+YS+        FN T+ FF V ANNYTLL NFSA
Sbjct  88   IRSNFSYTFPVSPGKKFVRLYFYPASYSS-------DFNATESFFAVMANNYTLLSNFSA  140

Query  596  FLTvsspdpfvfspdpfIKKEFIVNVDDKQQ-LNLTFSPS--PYAFVNGIEIVSMPSDLY  766
            FLT             ++ KEFIVNV    Q LN+TF PS   YAF+NGIE+VS P  LY
Sbjct  141  FLT----VLAGDYSPAYVVKEFIVNVQSLNQFLNVTFLPSTQSYAFINGIEVVSTPDGLY  196

Query  767  F  769
             
Sbjct  197  M  197



>gb|KDP24658.1| hypothetical protein JCGZ_26517 [Jatropha curcas]
Length=264

 Score =   140 bits (352),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 90/206 (44%), Positives = 119/206 (58%), Gaps = 19/206 (9%)
 Frame = +2

Query  236  EFFLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAE-QGPLASQVPFTTAR  412
            E FLL+CGA   +TS DGR+W +D +  +F+  N+   S    A  Q P  +QVPF TAR
Sbjct  48   EIFLLNCGASFDTTSLDGRNWVSDFNS-KFLAFNSQISSLEYTASLQDPSVTQVPFMTAR  106

Query  413  VFTSELTYSFRVSPGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYTLLKNFS  592
            +  S+  Y F VSPG KF+RLYFYP              + +  FF+V AN+YTLL NFS
Sbjct  107  ISQSKFIYVFPVSPGSKFVRLYFYPV--------ASSNLDISKSFFSVEANDYTLLSNFS  158

Query  593  AFLTvsspdpfvfspdpfIKKEFIVNVDDKQQLNLTFSPS--PYAFVNGIEIVSMPSDLY  766
            A LT       +  P   I KEFI+ +   Q LN+TF+PS   +AF+NGIEIVSMP  LY
Sbjct  159  ASLT----VSAMQPPAAAIVKEFIITIQVNQMLNITFNPSLKSFAFINGIEIVSMPDSLY  214

Query  767  FRGDNN---NYPIISAVHFDNSTTME  835
              G+++   N  I    + DN+T +E
Sbjct  215  IHGNDSPLTNVGIDYPFYLDNTTALE  240



>ref|XP_007032832.1| Malectin/receptor-like protein kinase family protein, putative 
[Theobroma cacao]
 gb|EOY03758.1| Malectin/receptor-like protein kinase family protein, putative 
[Theobroma cacao]
Length=807

 Score =   146 bits (368),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 89/205 (43%), Positives = 121/205 (59%), Gaps = 18/205 (9%)
 Frame = +2

Query  236  EFFLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARV  415
            +  LL+CG  S +TS DGR+W  D  Y      + A   +   ++  P  ++VP+ TAR+
Sbjct  30   DHILLNCGTSSNTTSLDGRNWVGDADYKYSSSISKASSFASKASDLEPSVTEVPYMTARI  89

Query  416  FTSELTYSFRVSPGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYTLLKNFSA  595
            F  + TY F VSPG KFLRLYFYP  Y           + T  FF+VTANNYTLL+NFSA
Sbjct  90   FHGKFTYKFPVSPGPKFLRLYFYPNEYPG--------LDITTSFFSVTANNYTLLRNFSA  141

Query  596  FLTvsspdpfvfspdpfIKKEFIVNVDDKQQLNLTFSPSPY--AFVNGIEIVSMPSDLYF  769
            +L           P  FI KEF+V V + + L++TFSPSPY  AFVNGIE+VSMP++LY 
Sbjct  142  YLV-----SATSPPKVFIIKEFVVPVSNNKMLHVTFSPSPYSFAFVNGIEVVSMPTNLYT  196

Query  770  RGDNNNYPIISAVHF---DNSTTME  835
                 ++ ++   +F   DN+T +E
Sbjct  197  VQKYGSHRLVGTNYFFELDNNTALE  221



>ref|XP_012088048.1| PREDICTED: receptor-like protein kinase FERONIA [Jatropha curcas]
 gb|KDP24278.1| hypothetical protein JCGZ_25574 [Jatropha curcas]
Length=845

 Score =   146 bits (368),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 89/207 (43%), Positives = 127/207 (61%), Gaps = 19/207 (9%)
 Frame = +2

Query  236  EFFLLSCGAPSKSTSQDGRDWDTD-NHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTAR  412
            +  LL+ GAP    S DGR W++D +   ++ P N+   S+   ++Q P  + VP+ TAR
Sbjct  31   DLILLNSGAPYGKQSMDGRKWESDADKQSKYCPVNSETSSASKASQQDPSVTPVPYMTAR  90

Query  413  VFTSELTYSFRVSPGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYTLLKNFS  592
            +  S+ T  F VS G  F+RLYFYP  YS          + +  FF+VTAN+YTLL NFS
Sbjct  91   IIRSKYTCMFPVSVGPNFIRLYFYPTTYSG--------LDTSTSFFSVTANDYTLLSNFS  142

Query  593  AFLTvsspdpfvfspdpfIKKEFIVNVDDKQQ-LNLTFSPSP--YAFVNGIEIVSMPSDL  763
            ++LT S+  P V        KEFI+ V D Q  +NLTF+PSP  +AF+NGIEIVSMP++L
Sbjct  143  SYLTASAMQPRVVYFV----KEFIITVWDNQAIINLTFTPSPNSFAFINGIEIVSMPTNL  198

Query  764  YFRGDNNNYPIISA---VHFDNSTTME  835
            Y + ++  YP ++A    +FDN+T +E
Sbjct  199  YTKDNDYAYPFVNANTIFNFDNTTALE  225



>ref|XP_006373383.1| hypothetical protein POPTR_0017s13270g [Populus trichocarpa]
 gb|ERP51180.1| hypothetical protein POPTR_0017s13270g [Populus trichocarpa]
Length=829

 Score =   146 bits (368),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 91/206 (44%), Positives = 122/206 (59%), Gaps = 19/206 (9%)
 Frame = +2

Query  236  EFFLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSP-AIAEQGPLASQVPFTTAR  412
            +  LL+CGA S  +S DGR WD D+   +F  +   E SS    +   P  +QVP+ TAR
Sbjct  43   DLILLNCGASSNLSSPDGRSWDGDSQS-KFAASKPPEASSVFEASNHDPSVNQVPYMTAR  101

Query  413  VFTSELTYSFRVSPGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYTLLKNFS  592
            +F S+ TY+F V PG KF+RLYFYPA+YS          + +  +F+++ANNY LL NFS
Sbjct  102  IFHSKFTYTFPVLPGPKFVRLYFYPASYS--------NLDISTSYFSISANNYQLLNNFS  153

Query  593  AFLTvsspdpfvfspdpfIKKEFIVNVDDKQQLNLTFSPSP--YAFVNGIEIVSMPSDLY  766
            A LT       +  P  +  KEFI+ V D Q+L LTF PSP  ++F+NGIEIVSMP   Y
Sbjct  154  ASLT----VSAIIPPVDYFTKEFIITVRDNQKLELTFIPSPASFSFINGIEIVSMPDSFY  209

Query  767  FRGDNNNYPIISA-VH--FDNSTTME  835
             RG +N    +   VH   DN+T +E
Sbjct  210  ARGHDNPLTYVGPDVHTFLDNTTALE  235



>ref|XP_011099030.1| PREDICTED: receptor-like protein kinase FERONIA [Sesamum indicum]
Length=886

 Score =   146 bits (368),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 90/190 (47%), Positives = 112/190 (59%), Gaps = 20/190 (11%)
 Frame = +2

Query  236  EFFLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAE-QGPLASQVPFTTAR  412
            +  LL+CG+ S       R WD+D     + P N A +S  ++A    P   QVP+ TAR
Sbjct  33   DLILLNCGSLSNLNDTSSRSWDSDERS-SYAPPNAASISLSSMASTMAPSVFQVPYQTAR  91

Query  413  VFTSELTYSFRVSPGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYTLLKNFS  592
            VF S  TY+F V  G KFLRLYFYP  YS         FN +  FF+VTAN +TLL NFS
Sbjct  92   VFRSSFTYAFPVLTGAKFLRLYFYPDTYSG--------FNTSQSFFSVTANGFTLLSNFS  143

Query  593  AFLTvsspdpfvfspdpfIKKEFIVNVDDKQQLNLTFSP--SPYAFVNGIEIVSMPSDLY  766
            AFL             P   KEF+VNV +KQ+L++TFSP  + +AFVNGIEIVS+P  LY
Sbjct  144  AFLN------SPSPSRPSFMKEFVVNVQEKQRLDVTFSPNQNSFAFVNGIEIVSLPDKLY  197

Query  767  FRGDNNNYPI  796
            FRG  N+ PI
Sbjct  198  FRG--NDVPI  205



>gb|KDP27678.1| hypothetical protein JCGZ_20098 [Jatropha curcas]
Length=464

 Score =   142 bits (359),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 86/207 (42%), Positives = 124/207 (60%), Gaps = 19/207 (9%)
 Frame = +2

Query  236  EFFLLSCGAPSKSTSQDGRDWDTD-NHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTAR  412
            +  LL+ GAPS   S D R W+ D +   ++ P N+   S+   ++Q P  +QVP+ TAR
Sbjct  31   DLILLNSGAPSGDQSMDRRKWEGDADQQSKYCPMNSETSSASKASQQDPSVTQVPYMTAR  90

Query  413  VFTSELTYSFRVSPGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYTLLKNFS  592
            +  S+ T  F VS G KF+RLYFYP +YS          + +  FF+VTAN YTLL NFS
Sbjct  91   IIRSKYTCMFPVSMGPKFIRLYFYPNSYSG--------LDTSTSFFSVTANGYTLLSNFS  142

Query  593  AFLTvsspdpfvfspdpfIKKEFIVNVDDKQQ-LNLTFSPSP--YAFVNGIEIVSMPSDL  763
            ++LT       +     +  KEFI+ V D Q  +NLTF+PSP  +AF+NGIEIVS P++L
Sbjct  143  SYLT----VSAMQPRVAYFVKEFIITVWDNQAVINLTFTPSPNCFAFINGIEIVSRPTNL  198

Query  764  YFRGDNNNYPIIS---AVHFDNSTTME  835
            Y + ++  YP ++     +FDN+T +E
Sbjct  199  YSKDNDYAYPFVNDNMIFNFDNTTALE  225



>ref|XP_012087729.1| PREDICTED: receptor-like protein kinase FERONIA [Jatropha curcas]
Length=565

 Score =   143 bits (360),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 91/207 (44%), Positives = 123/207 (59%), Gaps = 21/207 (10%)
 Frame = +2

Query  236  EFFLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAI--AEQGPLASQVPFTTA  409
            +  LL+CG  S +TS DGR+W +D         +T++ SS A   + Q    +QVP+ TA
Sbjct  127  DIILLNCGESSLTTSPDGRNWVSDAR--SKFGASTSQNSSFAFKASRQDTSVTQVPYMTA  184

Query  410  RVFTSELTYSFRVSPGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYTLLKNF  589
            R+F S+ TYSF VS G KF+RLYFYP  YS          + +  FF+V AN+YTLL NF
Sbjct  185  RIFLSKFTYSFPVSLGSKFVRLYFYPVAYS--------NLDISKSFFSVEANDYTLLSNF  236

Query  590  SAFLTvsspdpfvfspdpfIKKEFIVNVDDKQQLNLTFSPS--PYAFVNGIEIVSMPSDL  763
            SAFLT       +  P   I KEF+V + +KQ LN+TF+PS   +AF+NGIEI+SMP  L
Sbjct  237  SAFLT----VSAMQPPAAAIVKEFVVTIQEKQMLNVTFNPSLKSFAFINGIEIISMPEGL  292

Query  764  YFRGDNN---NYPIISAVHFDNSTTME  835
            Y  G+++   N  I    + DN T +E
Sbjct  293  YIHGNDSPLVNVGIDYPFYLDNKTALE  319



>gb|KDP24662.1| hypothetical protein JCGZ_26521 [Jatropha curcas]
Length=740

 Score =   144 bits (363),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 91/207 (44%), Positives = 123/207 (59%), Gaps = 21/207 (10%)
 Frame = +2

Query  236  EFFLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAI--AEQGPLASQVPFTTA  409
            +  LL+CG  S +TS DGR+W +D         +T++ SS A   + Q    +QVP+ TA
Sbjct  48   DIILLNCGESSLTTSPDGRNWVSDAR--SKFGASTSQNSSFAFKASRQDTSVTQVPYMTA  105

Query  410  RVFTSELTYSFRVSPGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYTLLKNF  589
            R+F S+ TYSF VS G KF+RLYFYP  YS          + +  FF+V AN+YTLL NF
Sbjct  106  RIFLSKFTYSFPVSLGSKFVRLYFYPVAYS--------NLDISKSFFSVEANDYTLLSNF  157

Query  590  SAFLTvsspdpfvfspdpfIKKEFIVNVDDKQQLNLTFSPS--PYAFVNGIEIVSMPSDL  763
            SAFLT       +  P   I KEF+V + +KQ LN+TF+PS   +AF+NGIEI+SMP  L
Sbjct  158  SAFLT----VSAMQPPAAAIVKEFVVTIQEKQMLNVTFNPSLKSFAFINGIEIISMPEGL  213

Query  764  YFRGDNN---NYPIISAVHFDNSTTME  835
            Y  G+++   N  I    + DN T +E
Sbjct  214  YIHGNDSPLVNVGIDYPFYLDNKTALE  240



>ref|XP_006427852.1| hypothetical protein CICLE_v10024830mg [Citrus clementina]
 ref|XP_006464563.1| PREDICTED: putative receptor-like protein kinase At5g39000-like 
[Citrus sinensis]
 gb|ESR41092.1| hypothetical protein CICLE_v10024830mg [Citrus clementina]
Length=911

 Score =   144 bits (364),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 99/205 (48%), Positives = 125/205 (61%), Gaps = 15/205 (7%)
 Frame = +2

Query  236  EFFLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAE-QGPLASQVPFTTAR  412
            ++ L+ CG  S +TS DGR+WD D H  +F  +N+A  S  + A  Q     QVP+ TAR
Sbjct  33   DYILIICGESSNTTSSDGRNWDGDAHS-KFSSSNSATKSFTSRASFQENSVPQVPYMTAR  91

Query  413  VFTSELTYSFRVSPGQKFLRLYFYPANYSAAAGGGGRRFNKT--DFFFTVTANNYTLLKN  586
            VF  E TY+F VSPG KFLRL+FYPA Y      GG   N T    FFTV+AN YTLL+N
Sbjct  92   VFPEEFTYTFPVSPGPKFLRLHFYPAPYLLGQQQGGLDNNDTISTSFFTVSANKYTLLRN  151

Query  587  FSAFLTvsspdpfvfspdpfIKKEFIVNVDDKQQLNLTF---SPSPYAFVNGIEIVSMPS  757
            FSA LTVS+  P V        KEFI++V   Q LNLTF   S S YAF+NGIE+VSMP 
Sbjct  152  FSAHLTVSAIIPPVAYFF----KEFIISVSSSQMLNLTFSPSSSSSYAFINGIEVVSMPD  207

Query  758  DLYFRGDNNNYPIISAVHFDNSTTM  832
            +LY +  + +     ++ F NS T+
Sbjct  208  NLYLQQSDGD----RSIPFINSNTI  228



>gb|KDO53394.1| hypothetical protein CISIN_1g002533mg [Citrus sinensis]
Length=911

 Score =   144 bits (364),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 99/205 (48%), Positives = 125/205 (61%), Gaps = 15/205 (7%)
 Frame = +2

Query  236  EFFLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAE-QGPLASQVPFTTAR  412
            ++ L+ CG  S +TS DGR+WD D H  +F  +N+A  S  + A  Q     QVP+ TAR
Sbjct  33   DYILIICGESSNTTSSDGRNWDGDAHS-KFSSSNSATKSFTSRASFQENSVPQVPYMTAR  91

Query  413  VFTSELTYSFRVSPGQKFLRLYFYPANYSAAAGGGGRRFNKT--DFFFTVTANNYTLLKN  586
            VF  E TY+F VSPG KFLRL+FYPA Y      GG   N T    FFTV+AN YTLL+N
Sbjct  92   VFPEEFTYTFPVSPGPKFLRLHFYPAPYLLGQQQGGLDNNDTISTSFFTVSANKYTLLRN  151

Query  587  FSAFLTvsspdpfvfspdpfIKKEFIVNVDDKQQLNLTF---SPSPYAFVNGIEIVSMPS  757
            FSA LTVS+  P V        KEFI++V   Q LNLTF   S S YAF+NGIE+VSMP 
Sbjct  152  FSAHLTVSAIIPPVAYFF----KEFIISVSSSQMLNLTFSPSSSSSYAFINGIEVVSMPD  207

Query  758  DLYFRGDNNNYPIISAVHFDNSTTM  832
            +LY +  + +     ++ F NS T+
Sbjct  208  NLYLQQSDGD----RSIPFINSNTI  228



>gb|KDP27676.1| hypothetical protein JCGZ_20096 [Jatropha curcas]
Length=838

 Score =   142 bits (359),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 86/207 (42%), Positives = 127/207 (61%), Gaps = 21/207 (10%)
 Frame = +2

Query  242  FLLSCGAPSKSTSQDGRDWDTD-NHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARVF  418
             LL+ GAP    S DGR+W++D +   ++ P N+   ++   ++Q P  +QVP+ TAR+ 
Sbjct  33   ILLNSGAPDGEQSMDGRNWESDADQQSKYCPMNSETSAASKASQQDPSVTQVPYMTARII  92

Query  419  TSELTYSFRVSPGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYTLLKNFSAF  598
             S+ T  F VS G KF+RLYFYP +YS          + +  FF+VTAN YTLL NFSA 
Sbjct  93   RSKYTCMFPVSMGPKFIRLYFYPNSYSG--------LDTSTSFFSVTANGYTLLSNFSAH  144

Query  599  LTvsspdpfvfspdpfIKKEFIVNVDDKQQ-LNLTFSPSP--YAFVNGIEIVSMPSDLYF  769
            LT       +  P  ++ KEFI+ V D Q  +NLTF+ SP  +AF+NGIEIVSMP++LY 
Sbjct  145  LT----VSAMQPPVAYLVKEFIITVRDNQGVINLTFTQSPNSFAFINGIEIVSMPTNLYT  200

Query  770  RGDNNNYPIISA-----VHFDNSTTME  835
            + +++ Y  ++       +FDN+T++E
Sbjct  201  KDNDSPYSFVNDNNVPFYYFDNTTSLE  227



>ref|XP_012084350.1| PREDICTED: receptor-like protein kinase FERONIA, partial [Jatropha 
curcas]
Length=1088

 Score =   143 bits (360),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 86/207 (42%), Positives = 127/207 (61%), Gaps = 21/207 (10%)
 Frame = +2

Query  242  FLLSCGAPSKSTSQDGRDWDTD-NHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARVF  418
             LL+ GAP    S DGR+W++D +   ++ P N+   ++   ++Q P  +QVP+ TAR+ 
Sbjct  33   ILLNSGAPDGEQSMDGRNWESDADQQSKYCPMNSETSAASKASQQDPSVTQVPYMTARII  92

Query  419  TSELTYSFRVSPGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYTLLKNFSAF  598
             S+ T  F VS G KF+RLYFYP +YS          + +  FF+VTAN YTLL NFSA 
Sbjct  93   RSKYTCMFPVSMGPKFIRLYFYPNSYSG--------LDTSTSFFSVTANGYTLLSNFSAH  144

Query  599  LTvsspdpfvfspdpfIKKEFIVNVDDKQQ-LNLTFSPSP--YAFVNGIEIVSMPSDLYF  769
            LT       +  P  ++ KEFI+ V D Q  +NLTF+ SP  +AF+NGIEIVSMP++LY 
Sbjct  145  LT----VSAMQPPVAYLVKEFIITVRDNQGVINLTFTQSPNSFAFINGIEIVSMPTNLYT  200

Query  770  RGDNNNYPIISA-----VHFDNSTTME  835
            + +++ Y  ++       +FDN+T++E
Sbjct  201  KDNDSPYSFVNDNNVPFYYFDNTTSLE  227



>ref|XP_011099029.1| PREDICTED: receptor-like protein kinase FERONIA [Sesamum indicum]
Length=885

 Score =   142 bits (359),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 88/189 (47%), Positives = 108/189 (57%), Gaps = 18/189 (10%)
 Frame = +2

Query  236  EFFLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARV  415
            +  LL+CG+PS       R WD+D       P   +   S   +   P    VP+ TARV
Sbjct  33   DLILLNCGSPSNLNDTSSRSWDSDERSRYAPPNAASISLSSMASSMAPSVFHVPYQTARV  92

Query  416  FTSELTYSFRVSPGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYTLLKNFSA  595
            F S  TY+F V  G KFLRLYFYP  YS         FN +  FF+VTAN +TLL NFSA
Sbjct  93   FRSSFTYAFPVLTGPKFLRLYFYPDTYSG--------FNTSQSFFSVTANGFTLLSNFSA  144

Query  596  FLTvsspdpfvfspdpfIKKEFIVNVDDKQQLNLTFSPSP--YAFVNGIEIVSMPSDLYF  769
            FL             P   KEF+VNV +KQ+L++TFSP+P  +AFVNGIEIVS+P  LYF
Sbjct  145  FLN------SPSPSSPSFMKEFVVNVQEKQRLDVTFSPNPNSFAFVNGIEIVSLPDKLYF  198

Query  770  RGDNNNYPI  796
            RG  N+ PI
Sbjct  199  RG--NDVPI  205



>ref|XP_011021061.1| PREDICTED: LOW QUALITY PROTEIN: receptor-like protein kinase 
FERONIA, partial [Populus euphratica]
Length=834

 Score =   142 bits (357),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 89/205 (43%), Positives = 118/205 (58%), Gaps = 20/205 (10%)
 Frame = +2

Query  236  EFFLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARV  415
            +  LL+CGA S  +S DGR WD D+   +F  +N  E S      Q P  +QVP+ TAR+
Sbjct  48   DLILLNCGASSNLSSPDGRSWDGDSQS-KFAASNPPEAS--XCDSQDPSVNQVPYMTARI  104

Query  416  FTSELTYSFRVSPGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYTLLKNFSA  595
            F S+ TY+F V PG KF+RLYFYPA+ S          + +  +F+++ANNY LL N SA
Sbjct  105  FHSKFTYTFPVLPGPKFVRLYFYPASDS--------NLDISTSYFSISANNYQLLNNCSA  156

Query  596  FLTvsspdpfvfspdpfIKKEFIVNVDDKQQLNLTFSPSP--YAFVNGIEIVSMPSDLYF  769
             LT       +  P  +  KEFI+ V D Q+L LTF PSP  ++FVNGIEIVSMP   Y 
Sbjct  157  SLT----VSAIIPPVDYFTKEFIITVRDNQKLELTFVPSPASFSFVNGIEIVSMPDSFYA  212

Query  770  RGDNNNYPIIS---AVHFDNSTTME  835
            RG +N    +        DN+T +E
Sbjct  213  RGHDNPLAYVGPDVPTFLDNTTALE  237



>emb|CDP20271.1| unnamed protein product [Coffea canephora]
Length=886

 Score =   142 bits (357),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 88/187 (47%), Positives = 113/187 (60%), Gaps = 17/187 (9%)
 Frame = +2

Query  236  EFFLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIA-EQGPLASQVPFTTAR  412
            ++ L++CG+ S STS DGR WD D    +F P + A +SS   A E     S VPF++AR
Sbjct  31   DYILINCGSSSNSTSVDGRKWDGDVGS-KFSPNDMANISSAVTATELDSSVSGVPFSSAR  89

Query  413  VFTSELTYSFRVSPGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYTLLKNFS  592
            +  S+ +Y+F VS G+KFLRLYFYP +YS          N  + FF V ANN+TLL NFS
Sbjct  90   IIRSQFSYTFPVSLGKKFLRLYFYPTSYSGG-------LNTMESFFNVKANNFTLLSNFS  142

Query  593  AFLTvsspdpf-----vfspdpfIKKEFIVNVDDKQQ-LNLTFSPS--PYAFVNGIEIVS  748
            A+LTVSS                + KE+I+N+ D  Q LN+TF PS   YAFVNGIE+VS
Sbjct  143  AYLTVSSKGFSPPFVFEEHIINSVVKEYIINIQDMNQFLNVTFLPSSNSYAFVNGIEVVS  202

Query  749  MPSDLYF  769
             P DLY 
Sbjct  203  TPEDLYM  209



>ref|XP_002528705.1| kinase, putative [Ricinus communis]
 gb|EEF33694.1| kinase, putative [Ricinus communis]
Length=891

 Score =   141 bits (356),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 92/209 (44%), Positives = 118/209 (56%), Gaps = 33/209 (16%)
 Frame = +2

Query  242  FLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARVFT  421
             LL CGA S +   DG+ W  D +    + ++ + +SS A   Q P  SQ+PF TARVF 
Sbjct  33   ILLDCGATSDNADDDGQKWTADKNSKFLLSSDNSTISSAAT--QDPAVSQIPFMTARVFH  90

Query  422  SELTYSFRVSPGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYTLLKNFSAFL  601
            S  TYSF ++ G+KF+RLYFYPA+YS          N +D  F+VTA +YT+LKNFS   
Sbjct  91   SNFTYSFPLAAGRKFVRLYFYPASYSG--------LNASDALFSVTAGSYTILKNFSVAQ  142

Query  602  TvsspdpfvfspdpfIKKEFIVNVDDKQQLNLTFSPS-----PYAFVNGIEIVSMPSDLY  766
            T             +I KE+ +NVD    LN+TFSPS      YAFVNGIEIVSMP D+Y
Sbjct  143  T------TQALNYAYIVKEYSINVDGG-SLNITFSPSTNPSKSYAFVNGIEIVSMP-DIY  194

Query  767  FRGD------NNNYPIISAVHFDNSTTME  835
               D       N+ PI    + DNST +E
Sbjct  195  GSTDGTLMLLGNDSPI----YIDNSTALE  219



>ref|XP_010252025.1| PREDICTED: receptor-like protein kinase FERONIA [Nelumbo nucifera]
Length=886

 Score =   141 bits (356),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 93/210 (44%), Positives = 122/210 (58%), Gaps = 36/210 (17%)
 Frame = +2

Query  242  FLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARVFT  421
             LL+CGA S++T  DG+ W  D    +F+P++   L+S A A QGP   +VP+ TAR+F 
Sbjct  35   ILLNCGAASETTDTDGQKWSGDVGS-KFLPSSDNTLTSRA-ATQGPSVPEVPYMTARIFH  92

Query  422  SELTYSFRVSPGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYTLLKNFSAFL  601
            SE TY+F V+ G+KF+RLYFYP +Y+          N+++  F+VT+  YTLL NFSA  
Sbjct  93   SEFTYTFPVTSGRKFVRLYFYPTSYNG--------LNESNALFSVTSGPYTLLHNFSASQ  144

Query  602  TvsspdpfvfspdpfIKKEFIVNVDDKQQLNLTFSPS-----PYAFVNGIEIVSMPSDLY  766
            T              I KEF +NV++ Q LNLTF PS      YAFVNGIEIVSMP D+Y
Sbjct  145  T------AEALNYAVIPKEFSLNVEN-QSLNLTFKPSSNASNSYAFVNGIEIVSMP-DIY  196

Query  767  -------FRGDNNNYPIISAVHFDNSTTME  835
                     G N  +P      FDNST +E
Sbjct  197  NSANGALLVGHNTQFP------FDNSTALE  220



>gb|KFK33632.1| hypothetical protein AALP_AA5G038800 [Arabis alpina]
Length=827

 Score =   140 bits (354),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 99/210 (47%), Positives = 123/210 (59%), Gaps = 26/210 (12%)
 Frame = +2

Query  236  EFFLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIA-EQGPLASQVPFTTAR  412
            + FL +CG    +T   GR+W  ++   +  PTN+   S PA A  QGP    +P+  AR
Sbjct  29   DVFLFNCGDTFNNTDDTGRNWTAEDP--KTFPTNSENASFPAYANSQGPSVLLIPYKEAR  86

Query  413  VFTSELTYSFRVSPGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANN-YTLLKNF  589
            +F S+ TYSF VSPGQKF+RLYFYP  Y       G RF+    FF+VT NN +TLLKNF
Sbjct  87   IFQSDFTYSFSVSPGQKFIRLYFYPTQY-------GFRFDAASSFFSVTVNNGFTLLKNF  139

Query  590  SAFLTvsspdpfvfspdpfIKKEFIVNVDDKQQLNLTFSPSP--YAFVNGIEIVSMPSDL  763
            SA LT         S D  + KEFIV+V D+  L LTF+P+P   AFVNGIEIVSMP  L
Sbjct  140  SADLT------VNASKDFTVVKEFIVSV-DQGPLKLTFTPAPNSLAFVNGIEIVSMPDRL  192

Query  764  YFRG--DNN--NYPIISAVHF--DNSTTME  835
            Y +G  D+   N    S + F  DNST  E
Sbjct  193  YSKGGFDDKIANVGSSSTIDFKIDNSTAFE  222



>emb|CBI27305.3| unnamed protein product [Vitis vinifera]
Length=762

 Score =   139 bits (349),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 83/186 (45%), Positives = 115/186 (62%), Gaps = 22/186 (12%)
 Frame = +2

Query  236  EFFLLSCGAPSKSTSQDGRDWDTDNHYLQFMPT--NTAELSSPAIAEQGPLASQVPFTTA  409
            E   L CG+   ST+ DGR W +D    +F+ +  N + +S  +  +  PL   VP+ TA
Sbjct  143  ENIALDCGSHGHSTAPDGRKWTSDTGS-KFICSQLNASSISMASTQDSVPL---VPYMTA  198

Query  410  RVFTSELTYSFRVSPGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYTLLKNF  589
            R+FTS+ TY+F +SPG KFLRL+F+PA+YS          + +  FF+VTAN+YTLL NF
Sbjct  199  RIFTSQFTYAFPLSPGPKFLRLHFHPASYS--------NLDPSHAFFSVTANHYTLLHNF  250

Query  590  SAFLTvsspdpfvfspdpfIKKEFIVNVDDKQQLNLTFSP--SPYAFVNGIEIVSMPSDL  763
            SA+LT        F       KE+ V V  +Q LNLTF+P    +AFVNGIE+VSMP+DL
Sbjct  251  SAWLT------AGFLNQTHFSKEYCVWVSSEQLLNLTFAPVAGAFAFVNGIEVVSMPTDL  304

Query  764  YFRGDN  781
            Y +G++
Sbjct  305  YLKGED  310



>ref|XP_010660576.1| PREDICTED: receptor-like protein kinase FERONIA [Vitis vinifera]
Length=875

 Score =   139 bits (350),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 90/202 (45%), Positives = 113/202 (56%), Gaps = 17/202 (8%)
 Frame = +2

Query  242  FLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIA--EQGPLASQVPFTTARV  415
             LL CG+     S DGR W  D    +F  T+  + SS +     Q P   QVP+ TAR+
Sbjct  41   ILLDCGSSISKMSPDGRTWQGDQGS-KFSGTSDVQNSSSSSNAFRQDPSVEQVPYMTARI  99

Query  416  FTSELTYSFRVSPGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYTLLKNFSA  595
            F S  TYSF VS G KF+R YFYP  YS          N+++FFF+VT+  YTLL NFSA
Sbjct  100  FNSSFTYSFPVSSGPKFVRFYFYPTAYSG--------HNESEFFFSVTSGVYTLLSNFSA  151

Query  596  FLTvsspdpfvfspdpfIKKEFIVNVDDKQQLNLTFSPSP--YAFVNGIEIVSMPSDLYF  769
             LT       + S    + KEF +NV D Q LN+TFSPSP  +AFVNGIE+VSMP+ LY 
Sbjct  152  SLT----VAPMGSGVSSLVKEFSINVWDNQILNITFSPSPNSWAFVNGIEVVSMPNHLYG  207

Query  770  RGDNNNYPIISAVHFDNSTTME  835
            + D      +     DN T +E
Sbjct  208  QIDLKLVSAVQQFEMDNYTALE  229



>ref|XP_007032799.1| Malectin/receptor protein kinase family protein, putative [Theobroma 
cacao]
 gb|EOY03725.1| Malectin/receptor protein kinase family protein, putative [Theobroma 
cacao]
Length=888

 Score =   139 bits (350),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 85/183 (46%), Positives = 114/183 (62%), Gaps = 24/183 (13%)
 Frame = +2

Query  248  LSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAEL--SSPAIAE-QGPLASQVPFTTARVF  418
            L+CGA S S   DGR W  D    +F P  ++    S+P  A+ QG     VP+ TARV 
Sbjct  38   LNCGALSDSHGSDGRFWAGDKSS-KFGPVESSRTIPSAPYEADNQGGSVETVPYMTARVS  96

Query  419  TSELTYSFRVSPGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYTLLKNFSAF  598
            +SE  YSF VSPGQKF+RL+FYPA+Y        ++F+++  FF+V A ++TLLKNFSAF
Sbjct  97   SSEFKYSFPVSPGQKFVRLHFYPASY--------KKFDRSKAFFSVKAGSFTLLKNFSAF  148

Query  599  LTvsspdpfvfspdpfIKKEFIVNVDDKQQLNLTFSPSP------YAFVNGIEIVSMPSD  760
            L   S +   F       +EF +NV++ Q L L F+P+P      YAF+NGIEIVSMPS+
Sbjct  149  LVAESSNVKSFF------REFCLNVEENQVLELIFTPTPSSSNDTYAFINGIEIVSMPSN  202

Query  761  LYF  769
            LY+
Sbjct  203  LYY  205



>ref|XP_007032831.1| Malectin/receptor-like protein kinase family protein, putative 
[Theobroma cacao]
 gb|EOY03757.1| Malectin/receptor-like protein kinase family protein, putative 
[Theobroma cacao]
Length=884

 Score =   139 bits (350),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 86/195 (44%), Positives = 112/195 (57%), Gaps = 18/195 (9%)
 Frame = +2

Query  236  EFFLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIA-EQGPLASQVPFTTAR  412
            ++ LLSCGA   S S+DGR W  D    +F  +N+   S  + A  Q    +QVP+ TAR
Sbjct  30   DYILLSCGASLNSISEDGRKWIPDEKS-KFSTSNSVNSSFASTASRQDHAVTQVPYMTAR  88

Query  413  VFTSELTYSFRVSPGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYTLLKNFS  592
            VF    TYSF VSPG KFLR YFYP  YS         F+   FFF+VTANNY LLKNFS
Sbjct  89   VFRDIFTYSFPVSPGLKFLRFYFYPVKYS--------DFDGHTFFFSVTANNYVLLKNFS  140

Query  593  AFLTvsspdpfvfspdpfIKKEFIVNVDDKQQLNLTFSPSP--YAFVNGIEIVSMPSDLY  766
            A+LT         +    + KEF+V V +  +L++ FSPS    AFVNGIE++SMP ++Y
Sbjct  141  AYLT------AEDADAASLIKEFMVPVFETGKLDVIFSPSAKSLAFVNGIEVISMPKNMY  194

Query  767  FRGDNNNYPIISAVH  811
                 N+   ++  H
Sbjct  195  GNHQQNSLSFVNHDH  209



>ref|XP_002273707.2| PREDICTED: receptor-like protein kinase FERONIA [Vitis vinifera]
Length=924

 Score =   139 bits (350),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 83/186 (45%), Positives = 115/186 (62%), Gaps = 22/186 (12%)
 Frame = +2

Query  236  EFFLLSCGAPSKSTSQDGRDWDTDNHYLQFMPT--NTAELSSPAIAEQGPLASQVPFTTA  409
            E   L CG+   ST+ DGR W +D    +F+ +  N + +S  +  +  PL   VP+ TA
Sbjct  99   ENIALDCGSHGHSTAPDGRKWTSDTGS-KFICSQLNASSISMASTQDSVPL---VPYMTA  154

Query  410  RVFTSELTYSFRVSPGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYTLLKNF  589
            R+FTS+ TY+F +SPG KFLRL+F+PA+YS          + +  FF+VTAN+YTLL NF
Sbjct  155  RIFTSQFTYAFPLSPGPKFLRLHFHPASYS--------NLDPSHAFFSVTANHYTLLHNF  206

Query  590  SAFLTvsspdpfvfspdpfIKKEFIVNVDDKQQLNLTFSP--SPYAFVNGIEIVSMPSDL  763
            SA+LT        F       KE+ V V  +Q LNLTF+P    +AFVNGIE+VSMP+DL
Sbjct  207  SAWLT------AGFLNQTHFSKEYCVWVSSEQLLNLTFAPVAGAFAFVNGIEVVSMPTDL  260

Query  764  YFRGDN  781
            Y +G++
Sbjct  261  YLKGED  266



>emb|CAN77538.1| hypothetical protein VITISV_025026 [Vitis vinifera]
Length=853

 Score =   139 bits (349),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 90/202 (45%), Positives = 114/202 (56%), Gaps = 17/202 (8%)
 Frame = +2

Query  242  FLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIA--EQGPLASQVPFTTARV  415
             LL CG+   + S DGR W  D    +F  T+  + SS +     Q P   QVP+ TAR+
Sbjct  33   ILLDCGSSINTKSPDGRTWQGDQGS-KFSGTSDVQNSSSSSKAFRQDPSVDQVPYMTARI  91

Query  416  FTSELTYSFRVSPGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYTLLKNFSA  595
            F S  TYSF VS G KF+R YFYP  YS          N+++FFF+VT+  YTLL NFSA
Sbjct  92   FNSSFTYSFPVSAGPKFVRFYFYPTAYSG--------HNESEFFFSVTSGVYTLLSNFSA  143

Query  596  FLTvsspdpfvfspdpfIKKEFIVNVDDKQQLNLTFSPSP--YAFVNGIEIVSMPSDLYF  769
             LT       + S    + KEF +NV D Q LN+TFSPSP  +AFVNGIE+VSMP+ LY 
Sbjct  144  SLT----VAPMGSGVSSLVKEFSINVWDNQILNITFSPSPNSWAFVNGIEVVSMPNHLYG  199

Query  770  RGDNNNYPIISAVHFDNSTTME  835
            + D      +     DN T +E
Sbjct  200  QIDLKLVSAVQQFEMDNYTALE  221



>ref|XP_002277584.3| PREDICTED: receptor-like protein kinase FERONIA [Vitis vinifera]
Length=895

 Score =   138 bits (348),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 90/202 (45%), Positives = 114/202 (56%), Gaps = 17/202 (8%)
 Frame = +2

Query  242  FLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIA--EQGPLASQVPFTTARV  415
             LL CG+   + S DGR W  D    +F  T+  + SS +     Q P   QVP+ TAR+
Sbjct  41   ILLDCGSSINTKSPDGRTWQGDQGS-KFSGTSDVQNSSSSSKAFRQDPSVDQVPYMTARI  99

Query  416  FTSELTYSFRVSPGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYTLLKNFSA  595
            F S  TYSF VS G KF+R YFYP  YS          N+++FFF+VT+  YTLL NFSA
Sbjct  100  FNSSFTYSFPVSAGPKFVRFYFYPTAYSG--------HNESEFFFSVTSGVYTLLSNFSA  151

Query  596  FLTvsspdpfvfspdpfIKKEFIVNVDDKQQLNLTFSPSP--YAFVNGIEIVSMPSDLYF  769
             LT       + S    + KEF +NV D Q LN+TFSPSP  +AFVNGIE+VSMP+ LY 
Sbjct  152  SLT----VAPMGSGVSSLVKEFSINVWDNQILNITFSPSPNSWAFVNGIEVVSMPNHLYG  207

Query  770  RGDNNNYPIISAVHFDNSTTME  835
            + D      +     DN T +E
Sbjct  208  QIDLKLVSAVQQFEMDNYTALE  229



>emb|CDP05402.1| unnamed protein product [Coffea canephora]
Length=892

 Score =   138 bits (348),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 85/181 (47%), Positives = 110/181 (61%), Gaps = 17/181 (9%)
 Frame = +2

Query  236  EFFLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARV  415
            ++ L++CG  S +TS DGR+W  D    +F P + A +S    A +  L+  VP+ TAR+
Sbjct  30   DYILINCGLSSNATSADGRNWYGDAGS-KFTPIDMANISLAVTATEQGLS--VPYLTARI  86

Query  416  FTSELTYSFRVSPGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYTLLKNFSA  595
              S  +Y+F VSPG+KF+RLYF PA+YS+        FN T+ FF V ANNYTLL NFSA
Sbjct  87   IRSNFSYTFPVSPGKKFVRLYFNPASYSS-------DFNATESFFAVMANNYTLLSNFSA  139

Query  596  FLTvsspdpfvfspdpfIKKEFIVNVDDKQQ-LNLTFSPS--PYAFVNGIEIVSMPSDLY  766
            FLT             ++ KEFIVNV    Q LN+TF PS   YAF+NGIE+VS P  LY
Sbjct  140  FLT----VSAGGFSPAYVVKEFIVNVQAMNQFLNVTFLPSTQSYAFINGIEVVSTPDGLY  195

Query  767  F  769
             
Sbjct  196  M  196



>emb|CBI21192.3| unnamed protein product [Vitis vinifera]
Length=974

 Score =   138 bits (348),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 90/202 (45%), Positives = 114/202 (56%), Gaps = 17/202 (8%)
 Frame = +2

Query  242  FLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIA--EQGPLASQVPFTTARV  415
             LL CG+   + S DGR W  D    +F  T+  + SS +     Q P   QVP+ TAR+
Sbjct  123  ILLDCGSSINTKSPDGRTWQGDQGS-KFSGTSDVQNSSSSSKAFRQDPSVDQVPYMTARI  181

Query  416  FTSELTYSFRVSPGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYTLLKNFSA  595
            F S  TYSF VS G KF+R YFYP  YS          N+++FFF+VT+  YTLL NFSA
Sbjct  182  FNSSFTYSFPVSAGPKFVRFYFYPTAYSG--------HNESEFFFSVTSGVYTLLSNFSA  233

Query  596  FLTvsspdpfvfspdpfIKKEFIVNVDDKQQLNLTFSPSP--YAFVNGIEIVSMPSDLYF  769
             LT       + S    + KEF +NV D Q LN+TFSPSP  +AFVNGIE+VSMP+ LY 
Sbjct  234  SLT----VAPMGSGVSSLVKEFSINVWDNQILNITFSPSPNSWAFVNGIEVVSMPNHLYG  289

Query  770  RGDNNNYPIISAVHFDNSTTME  835
            + D      +     DN T +E
Sbjct  290  QIDLKLVSAVQQFEMDNYTALE  311



>ref|XP_002530995.1| kinase, putative [Ricinus communis]
 gb|EEF31383.1| kinase, putative [Ricinus communis]
Length=888

 Score =   138 bits (347),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 92/207 (44%), Positives = 125/207 (60%), Gaps = 20/207 (10%)
 Frame = +2

Query  236  EFFLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQ-GPLASQVPFTTAR  412
            +  LL+CG  S +TS DGR WD D    +F+ +N+   S    A Q  P A++VP+  AR
Sbjct  27   DLILLNCGTSSSATSLDGRGWDGDAQS-KFLASNSETASYGCSASQRDPSATEVPYMDAR  85

Query  413  VFTSELTYSFRVSPGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYTLLKNFS  592
            V  S+ TY F VSPG KF+RLYFYP  YS            +  FF+VTAN+YTLL+NFS
Sbjct  86   VSQSKFTYLFPVSPGSKFVRLYFYPTKYS--------DLEISKSFFSVTANDYTLLRNFS  137

Query  593  AFLTvsspdpfvfspdpfIKKEFIVNV-DDKQQLNLTFSPS--PYAFVNGIEIVSMPSDL  763
            A+L VS+  P V+S      KE+++ V D+ Q+L+LTFS S   +AF+NGIEIVS+P +L
Sbjct  138  AYLAVSAMKPDVYSFV----KEYVITVWDNNQKLDLTFSASRGSFAFINGIEIVSIPDNL  193

Query  764  YFRGDNNNYPIISA---VHFDNSTTME  835
            Y    NN    +      + DN+T +E
Sbjct  194  YASSINNPLTYVGINNPFYLDNTTALE  220



>ref|XP_012091030.1| PREDICTED: receptor-like protein kinase FERONIA [Jatropha curcas]
Length=891

 Score =   137 bits (345),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 93/206 (45%), Positives = 116/206 (56%), Gaps = 27/206 (13%)
 Frame = +2

Query  242  FLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARVFT  421
             LL CGA S S+  DG+ W  D +    + +N++   SPA A Q    SQVP+ TAR+F 
Sbjct  34   ILLDCGATSDSSDSDGQKWTADKNSKFLLSSNSS--ISPA-ATQNSAVSQVPYMTARIFR  90

Query  422  SELTYSFRVSPGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYTLLKNFSAFL  601
            S  TYSF V  G+KF+RLYFYPA+YS          N +D  F+VTA +YTLLKNFS   
Sbjct  91   SNFTYSFPVGSGRKFVRLYFYPASYSG--------LNASDALFSVTAGSYTLLKNFSVAQ  142

Query  602  TvsspdpfvfspdpfIKKEFIVNVDDKQQLNLTFSPS-----PYAFVNGIEIVSMPSDLY  766
            T             FI KE+ +NVD    LN+TFSP+      YAFVNGIEIVSMP D+Y
Sbjct  143  T------TEALNYAFIVKEYSINVDGG-TLNITFSPASNPSKAYAFVNGIEIVSMP-DIY  194

Query  767  FRGDNNNY---PIISAVHFDNSTTME  835
               D        + S  + DNST +E
Sbjct  195  SSTDGTLMMVGDVSSPFYIDNSTALE  220



>ref|XP_010552466.1| PREDICTED: putative receptor-like protein kinase At5g39000 [Tarenaya 
hassleriana]
Length=964

 Score =   136 bits (343),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 92/208 (44%), Positives = 119/208 (57%), Gaps = 21/208 (10%)
 Frame = +2

Query  236  EFFLLSCGAP-SKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAE-QGPLASQVPFTTA  409
            +  L++CGA  S    Q GR W  ++  L  +  N+   S PA A  Q P   QVP+ TA
Sbjct  89   DLLLVNCGATGSNIADQSGRIWSAEDRRL--LSANSNGSSFPATASVQEPSVEQVPYMTA  146

Query  410  RVFTSELTYSFRVSPGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYTLLKNF  589
            R+F S+  YSF VSPG KF+RLYFYP  Y       G  F+  + +F VT N ++L++NF
Sbjct  147  RIFRSDFRYSFPVSPGWKFVRLYFYPTRY-------GSDFDAVNSYFAVTVNGFSLMRNF  199

Query  590  SAFLTvsspdpfvfspdpfIKKEFIVNVDDKQQLNLTFSPSP--YAFVNGIEIVSMPSDL  763
            SA LT         +P   I KEFI+ V + Q LNLTF+PS    AFVNGIEIVSMP  L
Sbjct  200  SASLT----AAGSVTPSKSIVKEFIIPVLNGQTLNLTFAPSANSLAFVNGIEIVSMPDGL  255

Query  764  YFRG--DNNNYPIISAVHF--DNSTTME  835
            Y +G  D+    + S+V F  DN+T  E
Sbjct  256  YTKGGFDDVITNVDSSVAFEIDNTTAFE  283



>gb|KHN29489.1| Receptor-like protein kinase FERONIA [Glycine soja]
Length=896

 Score =   136 bits (342),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 90/210 (43%), Positives = 118/210 (56%), Gaps = 35/210 (17%)
 Frame = +2

Query  242  FLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARVFT  421
             LL+CG P  ST  DGR+W TDN   +F  +     +SPA A Q P   QVP+ TARVF 
Sbjct  36   ILLNCGGPPSSTDTDGREWTTDNGS-KFGSSTAKSATSPA-ATQDPAVPQVPYMTARVFH  93

Query  422  SELTYSFRVSPGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYTLLKNFSAFL  601
            +  TY+F V+ G KFLRL+FY A+YS+         N +D  F V AN+YT+L+NFS   
Sbjct  94   APYTYTFPVASGWKFLRLHFYSASYSS--------LNASDALFAVAANSYTVLRNFSVAQ  145

Query  602  TvsspdpfvfspdpfIKKEFIVNVDDKQQLNLTFSPS-----PYAFVNGIEIVSMP----  754
            T       +     +I +EF ++V + + LN+TF+PS      YAFVNGIEIVSMP    
Sbjct  146  T------TLALNYAYIMREFAIHV-EGESLNVTFTPSTNASNAYAFVNGIEIVSMPEIYT  198

Query  755  ---SDLYFRGDNNNYPIISAVHFDNSTTME  835
                 L   G N+ +PI      DNST +E
Sbjct  199  STDGTLMMVGSNSPFPI------DNSTALE  222



>ref|NP_001237656.1| FERONIA receptor-like kinase precursor [Glycine max]
 gb|ACM89524.1| FERONIA receptor-like kinase [Glycine max]
Length=892

 Score =   136 bits (342),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 90/210 (43%), Positives = 118/210 (56%), Gaps = 35/210 (17%)
 Frame = +2

Query  242  FLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARVFT  421
             LL+CG P  ST  DGR+W TDN   +F  +     +SPA A Q P   QVP+ TARVF 
Sbjct  32   ILLNCGGPPSSTDTDGREWTTDNGS-KFGSSTAKSATSPA-ATQDPAVPQVPYMTARVFH  89

Query  422  SELTYSFRVSPGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYTLLKNFSAFL  601
            +  TY+F V+ G KFLRL+FY A+YS+         N +D  F V AN+YT+L+NFS   
Sbjct  90   APYTYTFPVASGWKFLRLHFYSASYSS--------LNASDALFAVAANSYTVLRNFSVAQ  141

Query  602  TvsspdpfvfspdpfIKKEFIVNVDDKQQLNLTFSPS-----PYAFVNGIEIVSMP----  754
            T       +     +I +EF ++V + + LN+TF+PS      YAFVNGIEIVSMP    
Sbjct  142  T------TLALNYAYIMREFAIHV-EGESLNVTFTPSTNASNAYAFVNGIEIVSMPEIYT  194

Query  755  ---SDLYFRGDNNNYPIISAVHFDNSTTME  835
                 L   G N+ +PI      DNST +E
Sbjct  195  STDGTLMMVGSNSPFPI------DNSTALE  218



>gb|KEH32083.1| feronia receptor-like kinase [Medicago truncatula]
Length=701

 Score =   135 bits (339),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 92/205 (45%), Positives = 118/205 (58%), Gaps = 25/205 (12%)
 Frame = +2

Query  242  FLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARVFT  421
             LL+CG P+ ST  DGR+W TDN   +F  +     +S A A Q P   Q+PF TARVF 
Sbjct  38   ILLNCGGPAVSTDPDGREWTTDNGS-KFGSSAVKSTTSQA-ATQDPAVPQIPFMTARVFQ  95

Query  422  SELTYSFRVSPGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYTLLKNFSAFL  601
            S  TYSF V+ G KFLRLYFY A+Y    GG     N +D  F VTA +YT+L+NFS   
Sbjct  96   SPYTYSFPVASGWKFLRLYFYSASY----GG----LNASDARFGVTAQSYTVLRNFSVSE  147

Query  602  TvsspdpfvfspdpfIKKEFIVNVDDKQQLNLTFSPS-----PYAFVNGIEIVSMPSDLY  766
            T       +     +I KE+ ++VD+   LN+TF+PS      YAFVNGIE+VSMP D+Y
Sbjct  148  T------ALGLNYDYIVKEYCIHVDEG-TLNVTFTPSANASKAYAFVNGIEVVSMP-DIY  199

Query  767  FRGDNNNYPIISAVHF--DNSTTME  835
               D     + +   F  DNST +E
Sbjct  200  TSTDGTTMIVGTGTTFTIDNSTALE  224



>gb|AHZ44752.1| CrRLK1L-like protein, partial [Platanus x acerifolia]
Length=774

 Score =   135 bits (340),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 89/207 (43%), Positives = 119/207 (57%), Gaps = 32/207 (15%)
 Frame = +2

Query  242  FLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARVFT  421
             LL+CG+  ++   DGR W TD    +F+      L+S A A Q P    VPF TAR+F 
Sbjct  78   ILLNCGSAPETVDTDGRKWTTDIGS-KFVAAGDNSLASSA-ATQDPSVPDVPFMTARIFR  135

Query  422  SELTYSFRVSPGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYTLLKNFSAFL  601
            SE TYSF V  G+KF+RLYFYPA+Y           N ++  F+VT+ +YTLL+NFSA  
Sbjct  136  SEFTYSFPVVSGRKFVRLYFYPASYD--------NLNASNAIFSVTSGSYTLLRNFSASQ  187

Query  602  TvsspdpfvfspdpfIKKEFIVNVDDKQQLNLTFSPS----PYAFVNGIEIVSMP-----  754
            T             FI KEF++NVD+ ++LN+TF PS     YAFVNGIE+VSMP     
Sbjct  188  T------TEALNYAFIVKEFLINVDN-ERLNVTFKPSNAANAYAFVNGIEVVSMPDIYNT  240

Query  755  SDLYFRGDNNNYPIISAVHFDNSTTME  835
             ++YF G +  + I      DNS+ +E
Sbjct  241  DNVYFVGQSGQFNI------DNSSALE  261



>ref|XP_009115877.1| PREDICTED: putative receptor-like protein kinase At5g39000 [Brassica 
rapa]
Length=875

 Score =   135 bits (341),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 93/208 (45%), Positives = 120/208 (58%), Gaps = 27/208 (13%)
 Frame = +2

Query  236  EFFLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNT--AELSSPAIAEQGPLASQVPFTTA  409
            + FL +CGA S +T   GR W  +N   Q + +N   A  SS A +++  +  QVP+  A
Sbjct  30   DLFLFNCGATSDNTDNTGRKWTAENR--QTLSSNAVNASFSSDASSQESGVP-QVPYLKA  86

Query  410  RVFTSELTYSFRVSPGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYTLLKNF  589
            R+F S+ TYSF VSPG K+LRLYFYP  Y +        F+    FF+VT N +TLLKNF
Sbjct  87   RIFRSDFTYSFPVSPGWKYLRLYFYPTRYESG-------FDAVASFFSVTVNGFTLLKNF  139

Query  590  SAFLTvsspdpfvfspdpfIKKEFIVNVDDKQQLNLTFSPSPY--AFVNGIEIVSMPSDL  763
            SA LT       V +    + KEFIV V   Q LNLTF+PS    AFVNGIEIVSMP   
Sbjct  140  SASLT-------VTASKHVLIKEFIVPV--HQTLNLTFTPSANSPAFVNGIEIVSMPDGF  190

Query  764  YFRG--DNNNYPIISAVHF--DNSTTME  835
            Y +G  D+    + S V +  DN+T+ E
Sbjct  191  YSKGGFDDRVINVGSDVEYRIDNTTSFE  218



>gb|KEH23293.1| feronia receptor-like kinase [Medicago truncatula]
Length=899

 Score =   135 bits (340),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 92/205 (45%), Positives = 118/205 (58%), Gaps = 25/205 (12%)
 Frame = +2

Query  242  FLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARVFT  421
             LL+CG P+ ST  DGR+W TDN   +F  +     +S A A Q P   Q+PF TARVF 
Sbjct  38   ILLNCGGPAVSTDPDGREWTTDNGS-KFGSSAVKSTTSQA-ATQDPAVPQIPFMTARVFQ  95

Query  422  SELTYSFRVSPGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYTLLKNFSAFL  601
            S  TYSF V+ G KFLRLYFY A+Y    GG     N +D  F VTA +YT+L+NFS   
Sbjct  96   SPYTYSFPVASGWKFLRLYFYSASY----GG----LNASDARFGVTAQSYTVLRNFSVSE  147

Query  602  TvsspdpfvfspdpfIKKEFIVNVDDKQQLNLTFSPS-----PYAFVNGIEIVSMPSDLY  766
            T       +     +I KE+ ++VD+   LN+TF+PS      YAFVNGIE+VSMP D+Y
Sbjct  148  T------ALGLNYDYIVKEYCIHVDEG-TLNVTFTPSANASKAYAFVNGIEVVSMP-DIY  199

Query  767  FRGDNNNYPIISAVHF--DNSTTME  835
               D     + +   F  DNST +E
Sbjct  200  TSTDGTTMIVGTGTTFTIDNSTALE  224



>ref|XP_003609098.1| FERONIA receptor-like kinase [Medicago truncatula]
Length=893

 Score =   135 bits (340),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 92/205 (45%), Positives = 118/205 (58%), Gaps = 25/205 (12%)
 Frame = +2

Query  242  FLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARVFT  421
             LL+CG P+ ST  DGR+W TDN   +F  +     +S A A Q P   Q+PF TARVF 
Sbjct  32   ILLNCGGPAVSTDPDGREWTTDNGS-KFGSSAVKSTTSQA-ATQDPAVPQIPFMTARVFQ  89

Query  422  SELTYSFRVSPGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYTLLKNFSAFL  601
            S  TYSF V+ G KFLRLYFY A+Y    GG     N +D  F VTA +YT+L+NFS   
Sbjct  90   SPYTYSFPVASGWKFLRLYFYSASY----GG----LNASDARFGVTAQSYTVLRNFSVSE  141

Query  602  TvsspdpfvfspdpfIKKEFIVNVDDKQQLNLTFSPS-----PYAFVNGIEIVSMPSDLY  766
            T       +     +I KE+ ++VD+   LN+TF+PS      YAFVNGIE+VSMP D+Y
Sbjct  142  T------ALGLNYDYIVKEYCIHVDEG-TLNVTFTPSANASKAYAFVNGIEVVSMP-DIY  193

Query  767  FRGDNNNYPIISAVHF--DNSTTME  835
               D     + +   F  DNST +E
Sbjct  194  TSTDGTTMIVGTGTTFTIDNSTALE  218



>ref|XP_009617447.1| PREDICTED: receptor-like protein kinase FERONIA [Nicotiana tomentosiformis]
Length=888

 Score =   134 bits (338),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 86/207 (42%), Positives = 118/207 (57%), Gaps = 30/207 (14%)
 Frame = +2

Query  242  FLLSCGAPSKSTSQDGRDWDTD--NHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARV  415
             LL+CG P      DGR W +D  + YL+   ++T++      A+Q P   QVPF +ARV
Sbjct  36   ILLNCGGPDGLKDADGRKWGSDIGSTYLKGSKSSTSD-----AADQKPSVPQVPFMSARV  90

Query  416  FTSELTYSFRVSPGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYTLLKNFSA  595
            F SE TYSF V+PG+KF+RLYFYP++Y+        + N T+  F VT   Y+LL+NFSA
Sbjct  91   FQSEFTYSFPVAPGRKFVRLYFYPSSYN--------KLNATNAIFGVTVGPYSLLRNFSA  142

Query  596  FLTvsspdpfvfspdpfIKKEFIVNVDDKQQLNLTFSPSP-----YAFVNGIEIVSMPSD  760
              T             ++ KEF +NV   + LN+TF+PSP     +AFVNGIEI+S P D
Sbjct  143  AQT------AEALNYDYLTKEFSINV-PSETLNMTFTPSPNTSNSFAFVNGIEIISHP-D  194

Query  761  LYFRGDNNNYPIISAVHF--DNSTTME  835
            +Y   D   + +     F  DNST +E
Sbjct  195  IYNTEDGTTFIVGQTAAFIIDNSTALE  221



>emb|CDX78036.1| BnaA09g32310D [Brassica napus]
Length=867

 Score =   134 bits (338),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 93/208 (45%), Positives = 119/208 (57%), Gaps = 27/208 (13%)
 Frame = +2

Query  236  EFFLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNT--AELSSPAIAEQGPLASQVPFTTA  409
            + FL +CGA S +T   GR W  +N   Q + +N   A  SS A  ++  +  QVP+  A
Sbjct  30   DLFLFNCGATSDNTDNTGRKWTAENR--QTLSSNAVNASFSSDASFQESGVP-QVPYMKA  86

Query  410  RVFTSELTYSFRVSPGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYTLLKNF  589
            R+F S+ TYSF VSPG K+LRLYFYP  Y +        F+    FF+VT N +TLLKNF
Sbjct  87   RIFRSDFTYSFPVSPGWKYLRLYFYPTRYESG-------FDAVASFFSVTVNGFTLLKNF  139

Query  590  SAFLTvsspdpfvfspdpfIKKEFIVNVDDKQQLNLTFSPSPY--AFVNGIEIVSMPSDL  763
            SA LT       V +    + KEFIV V   Q LNLTF+PS    AFVNGIEIVSMP   
Sbjct  140  SASLT-------VTASKHVLIKEFIVPV--HQTLNLTFTPSANSPAFVNGIEIVSMPDGF  190

Query  764  YFRG--DNNNYPIISAVHF--DNSTTME  835
            Y +G  D+    + S V +  DN+T+ E
Sbjct  191  YSKGGFDDRVINVGSDVEYQIDNTTSFE  218



>emb|CDY37883.1| BnaC04g31230D [Brassica napus]
Length=793

 Score =   134 bits (336),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 86/187 (46%), Positives = 107/187 (57%), Gaps = 21/187 (11%)
 Frame = +2

Query  236  EFFLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPA-IAEQGPLASQVPFTTAR  412
            + FL++CG  S +     + W +D  +L     +    SS A   E+ P   QVP+TTAR
Sbjct  29   DLFLINCGTSSDTIDSQSQTWTSDQQHLLTSNLDNVSFSSNASYQEEVP---QVPYTTAR  85

Query  413  VFTSELTYSFRVSPGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYTLLKNFS  592
            VF S + YSF VSPG K+LRLYFYP  Y +        F+    FF+VT N +TLLKNFS
Sbjct  86   VFLSNVDYSFPVSPGWKYLRLYFYPTRYESG-------FDAASSFFSVTVNGFTLLKNFS  138

Query  593  AFLTvsspdpfvfspdpfIKKEFIVNVDDKQQLNLTFSPSP--YAFVNGIEIVSMPSDLY  766
            A LT         S    + KEFIV V+  Q LNLTF+PSP   AFVNGIEIVSMP   Y
Sbjct  139  ADLT------VKASKSKSLIKEFIVPVN--QTLNLTFTPSPSSLAFVNGIEIVSMPDGSY  190

Query  767  FRGDNNN  787
             +G  +N
Sbjct  191  SKGGFDN  197



>ref|XP_007140062.1| hypothetical protein PHAVU_008G081000g [Phaseolus vulgaris]
 gb|ESW12056.1| hypothetical protein PHAVU_008G081000g [Phaseolus vulgaris]
Length=899

 Score =   134 bits (337),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 89/205 (43%), Positives = 116/205 (57%), Gaps = 24/205 (12%)
 Frame = +2

Query  242  FLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARVFT  421
             LL CG P  ST  DGR+W TD        ++ +   SPA A Q P   QVP+ TARVF 
Sbjct  35   ILLDCGGPPSSTDTDGREWTTDVGSKFDSSSSKSTTVSPA-ATQDPAVPQVPYMTARVFH  93

Query  422  SELTYSFRVSPGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYTLLKNFSAFL  601
            +  TY+F V+ G KFLRL+FYPA+YS          N ++  F VTAN+YTLL+NFS   
Sbjct  94   APFTYAFPVASGWKFLRLHFYPASYS--------NLNASNALFAVTANSYTLLRNFSVAQ  145

Query  602  TvsspdpfvfspdpfIKKEFIVNVDDKQQLNLTFSPS-----PYAFVNGIEIVSMPSDLY  766
            T       +     +I KEF + V +++ LN+TF+PS      YAFVNGIE+VSMP D+Y
Sbjct  146  T------TLALNYAYILKEFAIYV-ERKTLNVTFTPSTNASNAYAFVNGIEVVSMP-DIY  197

Query  767  FRGDNNNYPI--ISAVHFDNSTTME  835
               D     +   +A   DNST +E
Sbjct  198  TSTDGTTMIVGTDTAYTIDNSTALE  222



>ref|XP_004492579.1| PREDICTED: receptor-like protein kinase FERONIA-like [Cicer arietinum]
Length=896

 Score =   134 bits (337),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 89/208 (43%), Positives = 116/208 (56%), Gaps = 33/208 (16%)
 Frame = +2

Query  242  FLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARVFT  421
             LL+CG P+ S+  DGR+W TDN       + T + ++   A Q P   QVPF TAR+F 
Sbjct  35   ILLNCGGPAVSSDPDGREWTTDNG--SKFGSLTGKSTTSQAAAQDPAVPQVPFMTARIFQ  92

Query  422  SELTYSFRVSPGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYTLLKNFSAFL  601
            S+ TYSF V+ G KFLRLYFY A+YS          N +D  F VT+ +Y++L NFS   
Sbjct  93   SQYTYSFPVASGWKFLRLYFYAASYSG--------LNVSDARFGVTSQSYSVLSNFSVLE  144

Query  602  TvsspdpfvfspdpfIKKEFIVNVDDKQQLNLTFSPSP-----YAFVNGIEIVSMP----  754
            T       +     +I KE+ ++VD    LN+TF+PSP     YAFVNGIEIVSMP    
Sbjct  145  T------TLGLNYDYIVKEYSIHVDGG-TLNVTFTPSPKATNAYAFVNGIEIVSMPDIYS  197

Query  755  -SDLYFRGDNNNYPIISAVHFDNSTTME  835
             +D    G NN + I      DNST +E
Sbjct  198  STDTMIVGTNNIFTI------DNSTALE  219



>ref|XP_007140079.1| hypothetical protein PHAVU_008G082400g [Phaseolus vulgaris]
 gb|ESW12073.1| hypothetical protein PHAVU_008G082400g [Phaseolus vulgaris]
Length=898

 Score =   134 bits (336),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 92/205 (45%), Positives = 114/205 (56%), Gaps = 24/205 (12%)
 Frame = +2

Query  242  FLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARVFT  421
             LL CG PS ST  DGR W TD        +  +   SPA A Q P   QVP+ TARVF 
Sbjct  35   ILLDCGGPSSSTDTDGRVWTTDVGSKFDSSSAKSTTVSPA-ATQDPAVPQVPYMTARVFH  93

Query  422  SELTYSFRVSPGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYTLLKNFSAFL  601
            +  TY+F V+ G KFLRL+FYPA+YS          N +D  F VTAN+YTLL+NFS   
Sbjct  94   APFTYAFPVASGWKFLRLHFYPASYS--------NLNASDARFAVTANSYTLLRNFSVAQ  145

Query  602  TvsspdpfvfspdpfIKKEFIVNVDDKQQLNLTFSPS-----PYAFVNGIEIVSMPSDLY  766
            T       +     +I KEF + V+ K  LN+TF+PS      YAFVNGIE+VSMP D+Y
Sbjct  146  T------TLALNYAYILKEFAIYVEGK-TLNVTFTPSTNASNAYAFVNGIEVVSMP-DIY  197

Query  767  FRGDNNNYPII--SAVHFDNSTTME  835
               D     +   +A   DNST +E
Sbjct  198  TSTDGTTMIVGTNTAYTIDNSTALE  222



>ref|XP_009139818.1| PREDICTED: putative receptor-like protein kinase At5g39000 [Brassica 
rapa]
Length=832

 Score =   134 bits (336),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 91/207 (44%), Positives = 114/207 (55%), Gaps = 25/207 (12%)
 Frame = +2

Query  236  EFFLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPA-IAEQGPLASQVPFTTAR  412
            + FL++CG  S +     + W +D  +L          SS A   E+ P   QVP+TTAR
Sbjct  31   DLFLINCGTSSDTIDSQSQTWTSDQQHLLTSKLKNLSFSSDASYQEEVP---QVPYTTAR  87

Query  413  VFTSELTYSFRVSPGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYTLLKNFS  592
            +F S + YSF VSPG K+LRLYFYP  Y +        F+    FF+VT N +TLLKNFS
Sbjct  88   IFLSNVNYSFPVSPGWKYLRLYFYPTRYESG-------FDTASSFFSVTVNGFTLLKNFS  140

Query  593  AFLTvsspdpfvfspdpfIKKEFIVNVDDKQQLNLTFSPSP--YAFVNGIEIVSMPSDLY  766
            A LT         S    + KEFIV V+  Q LNLTF PSP   AFVNGIEIVSMP   Y
Sbjct  141  ADLT------VKASKSKSLVKEFIVPVN--QTLNLTFMPSPSSLAFVNGIEIVSMPDGFY  192

Query  767  FRG--DNNNYPIISAVHFD--NSTTME  835
             +G  DN    + S + F+  N+T  E
Sbjct  193  SKGGFDNMITNVGSTIDFNIKNTTAFE  219



>emb|CDX74491.1| BnaA04g08980D [Brassica napus]
Length=832

 Score =   134 bits (336),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 91/207 (44%), Positives = 114/207 (55%), Gaps = 25/207 (12%)
 Frame = +2

Query  236  EFFLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPA-IAEQGPLASQVPFTTAR  412
            + FL++CG  S +     + W +D  +L          SS A   E+ P   QVP+TTAR
Sbjct  31   DLFLINCGTSSDTIDSQSQTWTSDQQHLLTSKLKNLSFSSDASYQEEVP---QVPYTTAR  87

Query  413  VFTSELTYSFRVSPGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYTLLKNFS  592
            +F S + YSF VSPG K+LRLYFYP  Y +        F+    FF+VT N +TLLKNFS
Sbjct  88   IFLSNVNYSFPVSPGWKYLRLYFYPTRYESG-------FDTASSFFSVTVNGFTLLKNFS  140

Query  593  AFLTvsspdpfvfspdpfIKKEFIVNVDDKQQLNLTFSPSP--YAFVNGIEIVSMPSDLY  766
            A LT         S    + KEFIV V+  Q LNLTF PSP   AFVNGIEIVSMP   Y
Sbjct  141  ADLT------VKASKSKSLVKEFIVPVN--QTLNLTFMPSPSSLAFVNGIEIVSMPDGFY  192

Query  767  FRG--DNNNYPIISAVHFD--NSTTME  835
             +G  DN    + S + F+  N+T  E
Sbjct  193  SKGGFDNMITNVGSTIDFNIKNTTAFE  219



>ref|XP_007032823.1| Malectin/receptor-like protein kinase family protein, putative 
[Theobroma cacao]
 gb|EOY03749.1| Malectin/receptor-like protein kinase family protein, putative 
[Theobroma cacao]
Length=894

 Score =   134 bits (336),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 82/187 (44%), Positives = 105/187 (56%), Gaps = 25/187 (13%)
 Frame = +2

Query  236  EFFLLSCGAPSKSTSQDGRDWDTDNHYLQFMPT---NTAELSSPAIAEQGPLASQVPFTT  406
            E   + CG+P+ +T+ DGR W  DN   +F P    N   + S A  +      QVPF T
Sbjct  46   ENITIDCGSPNDNTALDGRSWTRDN-TPKFSPIESQNNQSVYSEAPQQPPSGVGQVPFIT  104

Query  407  ARVFTSELTYSFRVSPGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYTLLKN  586
            ARV  +E  Y F ++ GQKF+RLYFYP +Y          F+    FF+V    +TLLKN
Sbjct  105  ARVSKAEFIYVFPLTSGQKFVRLYFYPTSYPP--------FDPLKAFFSVNTGEFTLLKN  156

Query  587  FSAFLTvsspdpfvfspdpfIKKEFIVNVDDKQQLNLTFSPSP-----YAFVNGIEIVSM  751
            FSA L               + KEF VNVD+ Q+LNLTF PSP     YAF+NGIEIVSM
Sbjct  157  FSASL--------HAQGQDTLIKEFCVNVDEGQRLNLTFIPSPDISDSYAFINGIEIVSM  208

Query  752  PSDLYFR  772
            P++LY+R
Sbjct  209  PTNLYYR  215



>ref|XP_010250338.1| PREDICTED: receptor-like protein kinase FERONIA [Nelumbo nucifera]
Length=790

 Score =   133 bits (334),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 78/196 (40%), Positives = 107/196 (55%), Gaps = 21/196 (11%)
 Frame = +2

Query  236  EFFLLSCGAPSKSTSQDGRDW--DTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTA  409
            E  LL CG+ +     DGR+W  D  + +      NT+ +S+     QG     +P+ TA
Sbjct  43   EQILLDCGSSALKADGDGRNWTGDVGSDFATSARFNTSTVSTALALYQGSSVPLIPYVTA  102

Query  410  RVFTSELTYSFRVSPGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYTLLKNF  589
            R+F S  TY+F V+ G K +RLYFYP +YS          +KT  FF V+A  YTLL NF
Sbjct  103  RIFHSPFTYTFPVAAGPKLIRLYFYPVSYSG--------LDKTKAFFDVSAGPYTLLHNF  154

Query  590  SAFLTvsspdpfvfspdpfIKKEFIVNVDDKQQLNLTFSPSP-----YAFVNGIEIVSMP  754
            SAF T             F+ KEF +N+++   L + F+P+P     Y FVNGIEI+SMP
Sbjct  155  SAFFT------VEALKTAFLVKEFSINIENLSLLEIIFTPTPNTFETYGFVNGIEILSMP  208

Query  755  SDLYFRGDNNNYPIIS  802
             DLY RG+  + P+I 
Sbjct  209  EDLYVRGEQISIPLIG  224



>ref|XP_010247768.1| PREDICTED: receptor-like protein kinase FERONIA [Nelumbo nucifera]
Length=876

 Score =   133 bits (334),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 86/202 (43%), Positives = 115/202 (57%), Gaps = 21/202 (10%)
 Frame = +2

Query  248  LSCGAPSKS-TSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARVFTS  424
            L+CGAP +  T+QDGR+W  D         +   +SS + A QGP   Q+P+ TAR+F +
Sbjct  34   LNCGAPPEVITAQDGRNWTGDIGSKLAPLASLINISSISQATQGPSVPQIPYLTARIFYA  93

Query  425  ELTYSFRVSPGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYTLLKNFSAFLT  604
              TY F VS G KF+RL+F+PA+Y+ A        N+T   F V+A  YTLLKNFSA LT
Sbjct  94   PFTYKFPVSAGPKFIRLHFFPASYAVA--------NRTKALFDVSAGPYTLLKNFSASLT  145

Query  605  vsspdpfvfspdpfIKKEFIVNVDDKQQLNLTFSPSP-----YAFVNGIEIVSMPSDLYF  769
                +   F       +EFIV + D ++L++TFSP+P     Y FVNGIE+VSMP +LYF
Sbjct  146  ADFFNTSHFF------REFIV-IADNEELDITFSPNPNTSDTYGFVNGIEVVSMPGNLYF  198

Query  770  RGDNNNYPIISAVHFDNSTTME  835
              D    P   A    N   +E
Sbjct  199  GNDPMLVPGKVAYSIGNEMALE  220



>gb|KJB42940.1| hypothetical protein B456_007G175600 [Gossypium raimondii]
Length=891

 Score =   132 bits (333),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 87/200 (44%), Positives = 114/200 (57%), Gaps = 19/200 (10%)
 Frame = +2

Query  236  EFFLLSCGAPSKST--SQDGRDWDTDNHYLQFMPTNTAELSSPAIA-EQGPLASQVPFTT  406
            ++ LL CGAPS S+  S+DGR W TD    +F  +N+   SS   A  Q    ++VP+ T
Sbjct  27   DYILLDCGAPSSSSLVSEDGRKWITDERS-KFATSNSENASSNFRATRQDHSVTRVPYMT  85

Query  407  ARVFTSELTYSFRVSPGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYTLLKN  586
            ARVF  + TYSF VS G KFLR YFYP   S         F+    FF+VTANN+ LLKN
Sbjct  86   ARVFHDKFTYSFPVSAGLKFLRFYFYPVQDSG--------FDGATSFFSVTANNHLLLKN  137

Query  587  FSAFLTvsspdpfvfspdpfIKKEFIVNVDDKQQLNLTFSPSP--YAFVNGIEIVSMPSD  760
            FSA+L               + KEF+V     ++L +TFSPSP   AFVNGIE+VSMP +
Sbjct  138  FSAYLA----LSAEDGQPASLIKEFMVPCFGTEKLIVTFSPSPNSLAFVNGIEVVSMPKE  193

Query  761  LYFRGDNNNYPII-SAVHFD  817
            LY +   ++   + S + FD
Sbjct  194  LYVKHQEDSVSFVNSKIPFD  213



>ref|XP_009791682.1| PREDICTED: receptor-like protein kinase FERONIA [Nicotiana sylvestris]
Length=888

 Score =   132 bits (333),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 85/207 (41%), Positives = 118/207 (57%), Gaps = 30/207 (14%)
 Frame = +2

Query  242  FLLSCGAPSKSTSQDGRDWDTD--NHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARV  415
             LL+CG P      DGR W +D  + YL+   ++T++      A+Q P   QVPF +ARV
Sbjct  36   ILLNCGGPDGLKDADGRKWGSDIGSTYLKGSKSSTSD-----AADQKPSVPQVPFMSARV  90

Query  416  FTSELTYSFRVSPGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYTLLKNFSA  595
            F SE TYSF V+PG+KF+RLYFYP++Y+        + N T+  F+VT   Y+LL+NFSA
Sbjct  91   FESEFTYSFPVAPGRKFVRLYFYPSSYN--------KLNATNAIFSVTVGPYSLLRNFSA  142

Query  596  FLTvsspdpfvfspdpfIKKEFIVNVDDKQQLNLTFSPSP-----YAFVNGIEIVSMPSD  760
              T             ++ KEF +NV   + LN+TF+PSP     +AFVNGIEI+S   D
Sbjct  143  AQT------AEALNYDYLTKEFSINV-PSETLNMTFTPSPNTSNSFAFVNGIEIISH-RD  194

Query  761  LYFRGDNNNYPIISAVHF--DNSTTME  835
            +Y   D   + +     F  DNST +E
Sbjct  195  IYNTDDGTTFIVGQTAAFIIDNSTALE  221



>gb|KJB80425.1| hypothetical protein B456_013G096400 [Gossypium raimondii]
Length=519

 Score =   129 bits (325),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 81/188 (43%), Positives = 112/188 (60%), Gaps = 22/188 (12%)
 Frame = +2

Query  236  EFFLLSCGAPS-KSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTAR  412
            E  LL CG+ + ++ S DGR+W  D+ +     + ++   S A  E+  +A +VP+ TAR
Sbjct  28   ETILLDCGSSALRALSYDGRNWTNDSSHFGASNSESSFAMSRASLEETSVA-EVPYMTAR  86

Query  413  VFTSELTYSFRVSPGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYTLLKNFS  592
            +F S  TY+F V+PG KF+RL+FYP +Y           N +  F TVTA NYTLL+NFS
Sbjct  87   LFHSRFTYTFNVTPGSKFIRLHFYPDSY--------MNLNASKSFLTVTAGNYTLLRNFS  138

Query  593  AFLTvsspdpfvfspdpfIKKEFIVNVDDKQQLNLTFSPSP-----YAFVNGIEIVSMPS  757
            A+L         F       KEFIV+V++   L+LTFSP+      YAFVNGIEIVSMP 
Sbjct  139  AYLNAKHIKSAYFF------KEFIVHVEN-HTLDLTFSPTTNASDGYAFVNGIEIVSMPL  191

Query  758  DLYFRGDN  781
             LY++ +N
Sbjct  192  SLYYQANN  199



>ref|XP_006405671.1| hypothetical protein EUTSA_v10027636mg [Eutrema salsugineum]
 gb|ESQ47124.1| hypothetical protein EUTSA_v10027636mg [Eutrema salsugineum]
Length=876

 Score =   132 bits (331),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 90/207 (43%), Positives = 114/207 (55%), Gaps = 21/207 (10%)
 Frame = +2

Query  236  EFFLLSCGAPSKSTSQDGRDWDTDNH-YLQFMPTNTAELSSPAIAEQGPLASQVPFTTAR  412
            + FL +CGA S +    GR+W  +N   L   P N +  S  +  + G    QVP+TTAR
Sbjct  31   DVFLFNCGATSDTVDNTGRNWTAENRKILSSNPVNASFPSESSFQDSG--VPQVPYTTAR  88

Query  413  VFTSELTYSFRVSPGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYTLLKNFS  592
            +F SE TYSF VSPG KFLRLY YP +Y          F+  +  F+VT N +TL++NFS
Sbjct  89   IFRSEFTYSFPVSPGDKFLRLYIYPTSYKPG-------FDAVNSLFSVTVNGFTLMENFS  141

Query  593  AFLTvsspdpfvfspdpfIKKEFIVNVDDKQQLNLTFSPSP--YAFVNGIEIVSMPSDLY  766
            A LT             F+ KEFIV V     LNLTF+PSP   AFVNGIEI+S+P   Y
Sbjct  142  ADLT----VRASKPVSNFLIKEFIVPV-HHNTLNLTFTPSPNSLAFVNGIEILSIPDRFY  196

Query  767  FRG--DNNNYPIISAV--HFDNSTTME  835
             +G  D+    + S V  H DN T  E
Sbjct  197  SKGGFDDVITNVGSTVDFHIDNKTAFE  223



>ref|XP_004246282.1| PREDICTED: receptor-like protein kinase FERONIA [Solanum lycopersicum]
Length=889

 Score =   132 bits (331),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 86/205 (42%), Positives = 116/205 (57%), Gaps = 26/205 (13%)
 Frame = +2

Query  242  FLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARVFT  421
             LL+CG P      DGR W TD    ++M  + + +S  A  +Q P   QVPF +ARVF 
Sbjct  36   ILLNCGGPDNLPDADGRKWGTDVGS-KYMLGSKSSISDAA--DQKPSVPQVPFMSARVFQ  92

Query  422  SELTYSFRVSPGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYTLLKNFSAFL  601
            SE TYSF V+ G+KF+RLYFYP++Y+        + N T+  F V +  YTLL+NFSA  
Sbjct  93   SEFTYSFPVASGRKFVRLYFYPSSYN--------KLNATNAIFDVASGQYTLLRNFSAAQ  144

Query  602  TvsspdpfvfspdpfIKKEFIVNVDDKQQLNLTFSPSP-----YAFVNGIEIVSMPSDLY  766
            T             ++ KEF +NV   + LN+TF+PSP     +AFVNGIEI+S P D+Y
Sbjct  145  T------AEALNYDYLTKEFSINV-PSETLNITFTPSPNTSNSFAFVNGIEIISHP-DIY  196

Query  767  FRGDNNNYPIISAVHF--DNSTTME  835
               D N + +     F  DNST +E
Sbjct  197  NTEDGNTFIVGQKSPFIIDNSTALE  221



>ref|XP_004142677.1| PREDICTED: receptor-like protein kinase FERONIA [Cucumis sativus]
 ref|XP_011653725.1| PREDICTED: receptor-like protein kinase FERONIA [Cucumis sativus]
 gb|KGN54458.1| hypothetical protein Csa_4G334690 [Cucumis sativus]
Length=897

 Score =   132 bits (331),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 88/207 (43%), Positives = 119/207 (57%), Gaps = 25/207 (12%)
 Frame = +2

Query  236  EFFLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARV  415
            +  LL CG PS +   D R W+TD+   +F+P  T + S    A Q P    +PF TARV
Sbjct  38   DVILLDCGGPSTANDIDNRKWNTDDKS-KFVPA-TGDSSVSKAATQDPSVPDIPFMTARV  95

Query  416  FTSELTYSFRVSPGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYTLLKNFSA  595
            F+S  TYSF V+P + F+RLYFYP++Y    GG     + +D  F+V+  +YTLLKNFSA
Sbjct  96   FSSSFTYSFPVAPSRLFVRLYFYPSSY----GG----LDASDALFSVSTQSYTLLKNFSA  147

Query  596  FLTvsspdpfvfspdpfIKKEFIVNVDDKQQLNLTFSPS-----PYAFVNGIEIVSMPSD  760
              T             +I KE+ ++VDD  +LNLTF+PS      YAFVNGIEIVSM +D
Sbjct  148  SQT------AAALNYAYIIKEYSIHVDD-DRLNLTFTPSSTHPKAYAFVNGIEIVSM-AD  199

Query  761  LYFRGDNNNYPIISAVHF--DNSTTME  835
            +Y     +   +  +  F  DNST +E
Sbjct  200  IYSDTSGSTLIVGPSTPFIVDNSTALE  226



>ref|XP_010529939.1| PREDICTED: receptor-like protein kinase FERONIA [Tarenaya hassleriana]
Length=892

 Score =   131 bits (330),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 92/205 (45%), Positives = 116/205 (57%), Gaps = 25/205 (12%)
 Frame = +2

Query  242  FLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARVFT  421
            FLL+CG  S++   D R W  D    +F+ ++    +SPA + Q P   QVP+ TARVF 
Sbjct  33   FLLNCGESSEAFDTDNRTWIPDVKS-KFLSSSGDSKASPA-STQDPSVPQVPYMTARVFR  90

Query  422  SELTYSFRVSPGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYTLLKNFSAFL  601
            S  TYSF V+ G+KF+RLYFYP +Y           N TD  F+V+   YTLLKNFSA  
Sbjct  91   SSFTYSFPVASGRKFVRLYFYPNSYDG--------LNATDALFSVSFGPYTLLKNFSASQ  142

Query  602  TvsspdpfvfspdpfIKKEFIVNVDDKQQLNLTFSP-----SPYAFVNGIEIVSMPSDLY  766
            T             FI KE++VNVD    LNLTFSP     S YAFVNGIE+ SMP D+Y
Sbjct  143  T------AQALTYAFIVKEYVVNVDGG-TLNLTFSPASTPSSAYAFVNGIEVTSMP-DIY  194

Query  767  FRGDNNNYPIISAVHF--DNSTTME  835
               D +   + SA  F  DN T++E
Sbjct  195  SSTDGSLVIVGSATSFSIDNGTSLE  219



>ref|XP_002870808.1| hypothetical protein ARALYDRAFT_916421 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47067.1| hypothetical protein ARALYDRAFT_916421 [Arabidopsis lyrata subsp. 
lyrata]
Length=884

 Score =   131 bits (330),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 92/208 (44%), Positives = 115/208 (55%), Gaps = 24/208 (12%)
 Frame = +2

Query  236  EFFLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNT--AELSSPAIAEQGPLASQVPFTTA  409
            + FL++CG  S +  Q GR W  +   ++ +P+N+  A  +S A+ +   +A QVP+  A
Sbjct  30   DVFLINCGDNSATNDQSGRTWTPEE--VKALPSNSDFASFTSDALYQDSGIA-QVPYMKA  86

Query  410  RVFTSELTYSFRVSPGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYTLLKNF  589
            R+F S  TYSF VSPG KFLRLYFYP  Y       G  F+    FF V  N  TLL+NF
Sbjct  87   RIFRSNFTYSFLVSPGWKFLRLYFYPTRY-------GSGFDAASSFFLVNVNGITLLRNF  139

Query  590  SAFLTvsspdpfvfspdpfIKKEFIVNVDDKQQLNLTFSPS--PYAFVNGIEIVSMPSDL  763
            SA LT              + KEFIV V   Q LNLTF+PS   +AFVNGIEIVSMP   
Sbjct  140  SANLT----AKASKPESKSLIKEFIVPV--HQTLNLTFTPSRDSFAFVNGIEIVSMPDRF  193

Query  764  YFRG--DNNNYPIISAVHF--DNSTTME  835
            Y +G  DN    + S   F  DNST  E
Sbjct  194  YSKGGFDNMITNVGSNADFEIDNSTAFE  221



>ref|NP_001238686.1| receptor-like kinase [Glycine max]
 gb|ACM89482.1| receptor-like kinase [Glycine max]
Length=883

 Score =   131 bits (330),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 88/205 (43%), Positives = 117/205 (57%), Gaps = 25/205 (12%)
 Frame = +2

Query  242  FLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARVFT  421
             LL+CG P  ST  DGR+W TD    +F  +     +SPA A Q P   QVP+ TARVF 
Sbjct  24   ILLNCGGPPSSTDTDGREWTTDVGS-KFGSSTAKSATSPA-ATQDPAVPQVPYMTARVFH  81

Query  422  SELTYSFRVSPGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYTLLKNFSAFL  601
            +  TY+F V+ G KFLRL+FY A+YS+         N +D  F V AN+YT+L+NFS   
Sbjct  82   APYTYTFPVASGWKFLRLHFYSASYSS--------LNASDALFAVAANSYTVLRNFSVAQ  133

Query  602  TvsspdpfvfspdpfIKKEFIVNVDDKQQLNLTFSPS-----PYAFVNGIEIVSMPSDLY  766
            T       +     +I +EF ++V + + LN+TF+PS      YAFVNGIEIVSMP ++Y
Sbjct  134  T------TLALNYAYIMREFAIHV-EGESLNVTFTPSTNASNSYAFVNGIEIVSMP-EIY  185

Query  767  FRGDNNNYPIIS--AVHFDNSTTME  835
               D     + S   V  DNST +E
Sbjct  186  TSTDGTLMMVGSNAPVTIDNSTALE  210



>gb|KDP27270.1| hypothetical protein JCGZ_19969 [Jatropha curcas]
Length=831

 Score =   131 bits (329),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 79/182 (43%), Positives = 110/182 (60%), Gaps = 20/182 (11%)
 Frame = +2

Query  236  EFFLLSCGAPSKSTSQDGRDWDTDNHYLQFMP---TNTAELSSPAIAEQGPLASQVPFTT  406
            +  L +CG+  ++T+ DGR W  D +  +F P   +N+ +  S     QG   + VP+ T
Sbjct  37   DIILSNCGSSGQTTTGDGRKWTGDLNS-KFGPVDHSNSTKSVSAIALRQGSSVASVPYMT  95

Query  407  ARVFTSELTYSFRVSPGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYTLLKN  586
            AR+  ++ TY+F V+ GQKF+RL+FYP+NY          FNK+  FF V    +TLLKN
Sbjct  96   ARISQTQFTYTFPVTAGQKFIRLFFYPSNYQGG-------FNKSKDFFDVKTGPFTLLKN  148

Query  587  FSAFLTvsspdpfvfspdpfIKKEFIVNVDDKQQLNLTFSPS--PYAFVNGIEIVSMPSD  760
            FSA L  S+     F       KEF ++V + QQLNLTFSPS   YAF+NGIEI+SMP++
Sbjct  149  FSASLYSSNGQETFF-------KEFCLHVGENQQLNLTFSPSFNSYAFINGIEILSMPAN  201

Query  761  LY  766
            LY
Sbjct  202  LY  203



>ref|NP_198716.1| putative receptor-like protein kinase [Arabidopsis thaliana]
 sp|Q9FID8.1|Y5900_ARATH RecName: Full=Putative receptor-like protein kinase At5g39000; 
Flags: Precursor [Arabidopsis thaliana]
 dbj|BAB10824.1| receptor-like protein kinase [Arabidopsis thaliana]
 gb|AED94385.1| putative receptor-like protein kinase [Arabidopsis thaliana]
Length=873

 Score =   131 bits (329),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 100/244 (41%), Positives = 130/244 (53%), Gaps = 34/244 (14%)
 Frame = +2

Query  125  AMLAFALRLSFPIIIFHFlalrladttaaaaplykatEFFLLSCGAPSKSTSQDGRDWDT  304
            A+L F++ +S PI+               A   Y+ T+ FL +CG  S +    GR+W  
Sbjct  5    ALLIFSILVSTPIV------------GEGATSTYEPTDVFLFNCGDTSNNVDVSGRNWTA  52

Query  305  DNHYLQFMPTNTAELSSPAIAE-QGPLASQVPFTTARVFTSELTYSFRVSPGQKFLRLYF  481
            +N   + + +N    S  A A  Q    SQ+P+ TAR+F SE TYSF V+PG  FLRLYF
Sbjct  53   ENQ--KILSSNLVNASFTAQASYQESGVSQIPYMTARIFRSEFTYSFPVTPGSNFLRLYF  110

Query  482  YPANYSAAAGGGGRRFNKTDFFFTVTANNYTLLKNFSAFLTvsspdpfvfspdpfIKKEF  661
            YP  Y       G +FN    FF+V  N +TLL NFSA LT             FI KEF
Sbjct  111  YPTRY-------GSQFNAVKSFFSVKVNGFTLLNNFSADLT----VKASKPQTEFIIKEF  159

Query  662  IVNVDDKQQLNLTFSPS--PYAFVNGIEIVSMPSDLYFRG--DNNNYPIISAV--HFDNS  823
            I+ V   Q LNLTF+PS    AFVNGIEIVS+P+  Y +G  D+    + S+V  H +NS
Sbjct  160  IIPV--YQTLNLTFTPSLDSLAFVNGIEIVSIPNRFYSKGGFDDVITNVGSSVDFHIENS  217

Query  824  TTME  835
            T  E
Sbjct  218  TAFE  221



>ref|XP_008463270.1| PREDICTED: receptor-like protein kinase FERONIA [Cucumis melo]
 ref|XP_008463271.1| PREDICTED: receptor-like protein kinase FERONIA [Cucumis melo]
 ref|XP_008463272.1| PREDICTED: receptor-like protein kinase FERONIA [Cucumis melo]
Length=897

 Score =   130 bits (328),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 89/207 (43%), Positives = 117/207 (57%), Gaps = 25/207 (12%)
 Frame = +2

Query  236  EFFLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARV  415
            +  LL CG PS +   D R W+TD+   +F+P       S A A Q P    +PF TARV
Sbjct  38   DVILLDCGGPSTANDIDSRKWNTDDKS-KFVPAAGDSTVSKA-ATQDPSVPDIPFMTARV  95

Query  416  FTSELTYSFRVSPGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYTLLKNFSA  595
            F+S  TYSF V+P + F+RLYFYP++Y    GG     + +D  F+V+  +YTLLKNFSA
Sbjct  96   FSSNFTYSFPVAPSRLFVRLYFYPSSY----GG----LDASDALFSVSTQSYTLLKNFSA  147

Query  596  FLTvsspdpfvfspdpfIKKEFIVNVDDKQQLNLTFSPS-----PYAFVNGIEIVSMPSD  760
              T             +I KE+ ++VDD  +LNLTF PS      YAFVNGIEIVSMP D
Sbjct  148  SQT------AAALNYAYIIKEYSIHVDD-DRLNLTFIPSSTHPKAYAFVNGIEIVSMP-D  199

Query  761  LYFRGDNNNYPIISAVHF--DNSTTME  835
            +Y     +   +  +  F  DNST +E
Sbjct  200  IYSDTSGSTLIVGPSTPFTVDNSTALE  226



>ref|XP_007208402.1| hypothetical protein PRUPE_ppa001164mg [Prunus persica]
 gb|EMJ09601.1| hypothetical protein PRUPE_ppa001164mg [Prunus persica]
Length=891

 Score =   130 bits (328),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 90/202 (45%), Positives = 114/202 (56%), Gaps = 25/202 (12%)
 Frame = +2

Query  248  LSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARVFTSE  427
            L+CG P ++T  +G  W +D        +     +SPA A Q P   +VPF TARVF SE
Sbjct  37   LNCGGPPETTDSNGLKWTSD--IGSKFASGANSTTSPA-ATQDPAVPEVPFMTARVFRSE  93

Query  428  LTYSFRVSPGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYTLLKNFSAFLTv  607
             TY F V+ G+KF+RLYFYPA+Y+          N ++  FTVTA +YTLLKNFS   T 
Sbjct  94   YTYKFPVASGRKFIRLYFYPASYAG--------LNASNAIFTVTAQSYTLLKNFSVAQT-  144

Query  608  sspdpfvfspdpfIKKEFIVNVDDKQQLNLTFSPS-----PYAFVNGIEIVSMPSDLYFR  772
                        FI KEF VNV+  + LN++F+PS      YAFVNGIEIVSMP D+Y  
Sbjct  145  -----TEALDYVFITKEFSVNVEG-ETLNISFAPSSSIANAYAFVNGIEIVSMP-DIYGA  197

Query  773  GDNNNYPIISAVHF-DNSTTME  835
             D       S+  F DNST +E
Sbjct  198  ADGTMIVGQSSPFFIDNSTALE  219



>ref|XP_010244547.1| PREDICTED: receptor-like protein kinase FERONIA [Nelumbo nucifera]
Length=890

 Score =   130 bits (328),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 90/204 (44%), Positives = 117/204 (57%), Gaps = 24/204 (12%)
 Frame = +2

Query  242  FLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARVFT  421
             LL+CGA  +ST  DGR W  D    +F P     L+S A A Q P    VP+ TARVF 
Sbjct  38   ILLNCGAAQESTDSDGRKWTGDVGS-KFAPAAANTLTSTA-ATQDPSVPDVPYMTARVFR  95

Query  422  SELTYSFRVSPGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYTLLKNFSAFL  601
            SE TYSF V+ G+KF+RLYFYPA+Y+          N ++  F+VT+  YTLLKNFS   
Sbjct  96   SEFTYSFPVASGRKFVRLYFYPASYNG--------LNASNALFSVTSGPYTLLKNFSVSQ  147

Query  602  TvsspdpfvfspdpfIKKEFIVNVDDKQQLNLTFSPS-----PYAFVNGIEIVSMPSDLY  766
            T             FI KE+ +NV++ + LN+TF PS      YAF+NGIE+VSMP D+Y
Sbjct  148  T------AEALTYAFIIKEYSLNVEN-EILNVTFRPSSNASNSYAFINGIEVVSMP-DIY  199

Query  767  FRGDNNNYPIISA-VHFDNSTTME  835
               +      +S+    DNSTT+E
Sbjct  200  SSANGALLVGLSSQFTIDNSTTLE  223



>ref|XP_008370279.1| PREDICTED: receptor-like protein kinase FERONIA [Malus domestica]
Length=891

 Score =   130 bits (328),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 87/203 (43%), Positives = 116/203 (57%), Gaps = 25/203 (12%)
 Frame = +2

Query  248  LSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARVFTSE  427
            L+CG P+++T   G  W +D    +F     +  +SPA A Q P   +VPF TARVF S+
Sbjct  35   LNCGGPAETTDSXGVKWTSDVGS-KFASGGNSSTTSPA-ATQDPAVPEVPFMTARVFRSQ  92

Query  428  LTYSFRVSPGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYTLLKNFSAFLTv  607
             TY F V+ G+KF+RLYFYPA+Y+          N ++  FTVTA +YT+LKNFS   T 
Sbjct  93   FTYKFPVASGRKFIRLYFYPASYA--------ELNASNAVFTVTAQSYTILKNFSVAQT-  143

Query  608  sspdpfvfspdpfIKKEFIVNVDDKQQLNLTFSPS-----PYAFVNGIEIVSMPSDLYFR  772
                        FI KEFIVNV+  + L ++F+PS      +AFVNGIEIVSMP D+Y  
Sbjct  144  -----TEALDYVFITKEFIVNVEG-ETLAVSFTPSSXVANAFAFVNGIEIVSMP-DIYSA  196

Query  773  GDNNNYPIISAVHF--DNSTTME  835
             D     +  +  F  DNST +E
Sbjct  197  TDGTTMIVGQSTPFYIDNSTALE  219



>ref|XP_006341293.1| PREDICTED: receptor-like protein kinase FERONIA-like [Solanum 
tuberosum]
Length=889

 Score =   130 bits (327),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 85/207 (41%), Positives = 116/207 (56%), Gaps = 30/207 (14%)
 Frame = +2

Query  242  FLLSCGAPSKSTSQDGRDWDTD--NHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARV  415
             LL+CG P      DGR W TD  + Y+    ++T++      A+Q P   QVPF +ARV
Sbjct  36   ILLNCGGPDNLPDADGRKWGTDIGSKYMLGSKSSTSD-----AADQKPSVPQVPFMSARV  90

Query  416  FTSELTYSFRVSPGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYTLLKNFSA  595
            F SE TYSF V+ G+KF+RLYFYP++Y+        + N T+  F V +  YTLL+NFSA
Sbjct  91   FQSEFTYSFPVASGRKFVRLYFYPSSYN--------KLNATNAIFNVASGQYTLLRNFSA  142

Query  596  FLTvsspdpfvfspdpfIKKEFIVNVDDKQQLNLTFSPSP-----YAFVNGIEIVSMPSD  760
              T             ++ KEF +NV   + LN+TF+PSP     +AFVNGIEI+S P D
Sbjct  143  AQT------AEALNYDYLTKEFSINV-PSETLNITFTPSPNTSNSFAFVNGIEIISHP-D  194

Query  761  LYFRGDNNNYPIISAVHF--DNSTTME  835
            +Y   D N + +     F   NST +E
Sbjct  195  IYNTEDGNTFIVGQKSSFIIGNSTALE  221



>ref|XP_008244701.1| PREDICTED: receptor-like protein kinase FERONIA [Prunus mume]
Length=891

 Score =   130 bits (327),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 89/202 (44%), Positives = 114/202 (56%), Gaps = 25/202 (12%)
 Frame = +2

Query  248  LSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARVFTSE  427
            L+CG P ++T  DG  W +D        +     +SPA A Q P   +VPF TARVF SE
Sbjct  37   LNCGGPPETTDSDGLKWTSD--IGSKFASGANSTTSPA-ATQDPAVPEVPFMTARVFRSE  93

Query  428  LTYSFRVSPGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYTLLKNFSAFLTv  607
             TY F V+ G+KF+RLYFYPA+Y+          N ++  FTVTA +YTLLKNFS   T 
Sbjct  94   YTYKFPVASGRKFIRLYFYPASYAG--------LNASNAIFTVTAQSYTLLKNFSVAQT-  144

Query  608  sspdpfvfspdpfIKKEFIVNVDDKQQLNLTFSPS-----PYAFVNGIEIVSMPSDLYFR  772
                        F+ KEF VNV+  + L+++F+PS      YAFVNGIEIVSMP D+Y  
Sbjct  145  -----TEALDYVFVTKEFSVNVEG-ETLDISFAPSSSVANAYAFVNGIEIVSMP-DIYSA  197

Query  773  GDNNNYPIISAVHF-DNSTTME  835
             D       S+  F DNST +E
Sbjct  198  PDGTMIVGQSSTFFIDNSTALE  219



>gb|ABT18098.1| FERONIA receptor-like kinase [Cardamine flexuosa]
Length=892

 Score =   130 bits (326),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 90/202 (45%), Positives = 115/202 (57%), Gaps = 23/202 (11%)
 Frame = +2

Query  242  FLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARVFT  421
             LL+CGA S S+  D R W  DN   +F+ +  ++ +SPA A Q P  S++P+ TARV  
Sbjct  39   ILLNCGASSNSSDADKRAWSADN-INKFLSSGDSK-TSPA-ATQDPSVSEIPYMTARVSR  95

Query  422  SELTYSFRVSPGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYTLLKNFSAFL  601
            S  TYSF V+ G+KF+RLYFYP  Y           N TD  F+V+   YTLLKNFSA  
Sbjct  96   SPFTYSFPVATGRKFVRLYFYPNTYDG--------LNATDALFSVSFGPYTLLKNFSAAQ  147

Query  602  TvsspdpfvfspdpfIKKEFIVNVDDKQQLNLTFSP--SPYAFVNGIEIVSMPSDLYFRG  775
            T              I KEFIVNV+    LN+TF+P  + YAFVNGIE+ SMP D+Y   
Sbjct  148  T------AEALTYAVIVKEFIVNVEGG-SLNMTFTPESNAYAFVNGIEVTSMP-DIYSST  199

Query  776  DNNNYPIISAVHF--DNSTTME  835
            D     + S+  F  DNST +E
Sbjct  200  DGTLTMVGSSGAFTIDNSTALE  221



>gb|KHN40613.1| Receptor-like protein kinase FERONIA [Glycine soja]
Length=894

 Score =   130 bits (326),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 87/205 (42%), Positives = 117/205 (57%), Gaps = 25/205 (12%)
 Frame = +2

Query  242  FLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARVFT  421
             LL+CG P  ST  DGR+W TD    +F  +     +SPA A Q P   QVP+ TARVF 
Sbjct  35   ILLNCGGPPSSTDTDGREWTTDVGS-KFGSSTAKSATSPA-ATQDPAVPQVPYMTARVFH  92

Query  422  SELTYSFRVSPGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYTLLKNFSAFL  601
            +  TY+F V+ G KFLRL+FY A+YS+         N +D  F + AN+YT+L+NFS   
Sbjct  93   APYTYTFPVASGWKFLRLHFYSASYSS--------LNASDALFAMAANSYTVLRNFSVAQ  144

Query  602  TvsspdpfvfspdpfIKKEFIVNVDDKQQLNLTFSPS-----PYAFVNGIEIVSMPSDLY  766
            T       +     +I +EF ++V + + LN+TF+PS      YAFVNGIEIVSMP ++Y
Sbjct  145  T------TLALNYAYIMREFAIHV-EGESLNVTFTPSTNASNSYAFVNGIEIVSMP-EIY  196

Query  767  FRGDNNNYPIIS--AVHFDNSTTME  835
               D     + S   V  DNST +E
Sbjct  197  TSTDGTLMMVGSNAPVTIDNSTALE  221



>emb|CDY36996.1| BnaC06g12670D [Brassica napus]
Length=872

 Score =   129 bits (325),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 87/185 (47%), Positives = 107/185 (58%), Gaps = 24/185 (13%)
 Frame = +2

Query  236  EFFLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELS---SPAIAEQG-PLASQVPFT  403
            + FL +CGA S   S  GR+W  +N   + +P+N+ + S     +  E G PL   VP+ 
Sbjct  30   DLFLFNCGANS-DVSDRGRNWTAENR--KTLPSNSGDASFSSDASFQESGVPL---VPYK  83

Query  404  TARVFTSELTYSFRVSPGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYTLLK  583
            TAR+F S+ TYSF VSPG KFLRLYFYP  Y       G  F+  + FF+V  N +TLLK
Sbjct  84   TARIFRSDFTYSFPVSPGWKFLRLYFYPTRY-------GSGFDAVNSFFSVNVNGFTLLK  136

Query  584  NFSAFLTvsspdpfvfspdpfIKKEFIVNVDDKQQLNLTFSPSP-YAFVNGIEIVSMPSD  760
            NFSA LT              + KEFIV V   Q LNLTF+PS   AFVNGIEIVSMP  
Sbjct  137  NFSADLT----VKASKPESKSLIKEFIVPV--YQTLNLTFTPSKSLAFVNGIEIVSMPDR  190

Query  761  LYFRG  775
             Y +G
Sbjct  191  FYSKG  195



>ref|XP_007045784.1| Malectin/receptor-like protein kinase family protein, putative 
[Theobroma cacao]
 gb|EOY01616.1| Malectin/receptor-like protein kinase family protein, putative 
[Theobroma cacao]
Length=822

 Score =   129 bits (324),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 89/208 (43%), Positives = 124/208 (60%), Gaps = 34/208 (16%)
 Frame = +2

Query  236  EFFLLSCGA-PSKSTSQDGRDWDTD--NHYLQFMPTNTAELSSPAIAEQGPLASQVPFTT  406
            E  LL CG+  S++ S DGR+W +D  +H++   P ++  +S  + A  G    +VP+ T
Sbjct  46   ENILLDCGSLASQAVSYDGRNWSSDIRSHFVASNPDSSFTVSRASSA--GTSVPEVPYMT  103

Query  407  ARVFTSELTYSFRVSPGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYTLLKN  586
            AR+F S+ TYSF VSPG KF+RL+FY  +Y +         N +  F +VTA ++TLL+N
Sbjct  104  ARLFHSQFTYSFNVSPGPKFIRLHFYDDSYMS--------LNASKAFLSVTAGHFTLLRN  155

Query  587  FSAFLTvsspdpfvfspdpfIKKEFIVNVDDKQQLNLTFSPSP-----YAFVNGIEIVSM  751
            FSA+LT        F       KEFIV+V++   L+LTFSPS      YAF+NGIEIVSM
Sbjct  156  FSAYLTARYMKSAYFF------KEFIVHVEN-HTLDLTFSPSTNASDGYAFLNGIEIVSM  208

Query  752  PSDLYFRGDNNNYPIISAVHFDNSTTME  835
            P +LY +G+N     +S     NST ME
Sbjct  209  PLNLYNQGNN-----VSG----NSTAME  227



>ref|XP_009370899.1| PREDICTED: receptor-like protein kinase FERONIA [Pyrus x bretschneideri]
 ref|XP_009370904.1| PREDICTED: receptor-like protein kinase FERONIA [Pyrus x bretschneideri]
Length=892

 Score =   129 bits (325),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 86/203 (42%), Positives = 116/203 (57%), Gaps = 25/203 (12%)
 Frame = +2

Query  248  LSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARVFTSE  427
            L+CG P+++T  +G  W +D    +F     +  +SPA A Q P   +VPF TARVF S+
Sbjct  35   LNCGGPAETTDSNGVKWTSDVGS-KFASGGNSSTTSPA-ATQDPAVPEVPFMTARVFRSQ  92

Query  428  LTYSFRVSPGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYTLLKNFSAFLTv  607
             TY F V+ G+KF+RLYFYPA+Y+          N ++  FTV A +YT+LKNFS   T 
Sbjct  93   FTYKFPVASGRKFIRLYFYPASYAG--------LNASNAVFTVAAQSYTILKNFSVAQT-  143

Query  608  sspdpfvfspdpfIKKEFIVNVDDKQQLNLTFSPS-----PYAFVNGIEIVSMPSDLYFR  772
                        FI KEFIVNV+  + L ++F+PS      +AFVNGIEIVSMP D+Y  
Sbjct  144  -----TEALDYVFITKEFIVNVEG-ETLAVSFTPSSRVANAFAFVNGIEIVSMP-DIYSA  196

Query  773  GDNNNYPIISAVHF--DNSTTME  835
             D     +  +  F  DNST +E
Sbjct  197  TDGTTMIVGQSTPFYIDNSTALE  219



>ref|XP_006403905.1| hypothetical protein EUTSA_v10010114mg [Eutrema salsugineum]
 gb|ESQ45358.1| hypothetical protein EUTSA_v10010114mg [Eutrema salsugineum]
Length=891

 Score =   129 bits (324),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 89/204 (44%), Positives = 116/204 (57%), Gaps = 24/204 (12%)
 Frame = +2

Query  242  FLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARVFT  421
             LL+CG  S S   D R W  D    +F+ ++    +SPA A Q P   +VPF TAR+F 
Sbjct  37   ILLNCGGSSDSADTDNRTWIPDVKS-KFLSSSGDSKTSPA-ATQDPSVPEVPFMTARIFR  94

Query  422  SELTYSFRVSPGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYTLLKNFSAFL  601
            S  TY+F V+ G+KF+RLYFYP +Y           N T+  F+V++ +YTLLKNFSA  
Sbjct  95   SPFTYTFPVAAGRKFVRLYFYPNSYDG--------LNATNSLFSVSSGSYTLLKNFSASQ  146

Query  602  TvsspdpfvfspdpfIKKEFIVNVDDKQQLNLTF----SPSPYAFVNGIEIVSMPSDLYF  769
            T             FI KEFIVNV+    LN+TF    +P+ YAFVNGIE+ SMP DLY 
Sbjct  147  T------AQALTYAFIVKEFIVNVEGG-ALNMTFTPESTPNAYAFVNGIEVTSMP-DLYS  198

Query  770  RGDNNNYPIIS--AVHFDNSTTME  835
              D +   + S  +V  DNST +E
Sbjct  199  STDGSLLVVGSSGSVTIDNSTALE  222



>ref|XP_009337788.1| PREDICTED: receptor-like protein kinase FERONIA [Pyrus x bretschneideri]
Length=893

 Score =   129 bits (324),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 86/203 (42%), Positives = 114/203 (56%), Gaps = 25/203 (12%)
 Frame = +2

Query  248  LSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARVFTSE  427
            L+CG P ++T  DG  W +D    +F     +  +S A A Q P    VPF TARVF S+
Sbjct  35   LNCGGPPETTDSDGLKWTSDVGS-KFASGGNSSTTSAA-ATQDPAVPDVPFMTARVFRSK  92

Query  428  LTYSFRVSPGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYTLLKNFSAFLTv  607
             TY F V+ G+KF+RLYFYPA+YS          N ++  FTVTA +YT+LKNFS   T 
Sbjct  93   FTYKFPVASGRKFIRLYFYPASYSG--------LNASNAVFTVTAQSYTILKNFSVAQT-  143

Query  608  sspdpfvfspdpfIKKEFIVNVDDKQQLNLTFSPS-----PYAFVNGIEIVSMPSDLYFR  772
                        +I KEF VNV D + L+++F+PS      +AFVNGIEIVSMP D+Y  
Sbjct  144  -----TEALDYVYITKEFSVNV-DGETLDVSFAPSAGVANAFAFVNGIEIVSMP-DIYSA  196

Query  773  GDNNNYPIISAVHF--DNSTTME  835
             D     +  +  F  DN+T +E
Sbjct  197  TDGTTMIVGQSAPFYIDNTTALE  219



>gb|KJB10597.1| hypothetical protein B456_001G210300 [Gossypium raimondii]
Length=869

 Score =   129 bits (323),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 76/188 (40%), Positives = 111/188 (59%), Gaps = 22/188 (12%)
 Frame = +2

Query  248  LSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAI-AEQGPLASQVPFTTARVFTS  424
            L+CGA +   + DGR W  DN+  +F P  ++   S A  A+    +  VP+ TARV  S
Sbjct  34   LNCGATTDLVANDGRSWAEDNNS-KFGPFESSHNKSQAYEADTQDGSETVPYMTARVSRS  92

Query  425  ELTYSFRVSPGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYTLLKNFSAFLT  604
            E  Y+F V+PGQKF+RLYF+PA+Y        + ++++  FF+V A ++TLLKNFSA L 
Sbjct  93   EFKYTFPVTPGQKFVRLYFHPASY--------KEYDRSKAFFSVKAGSFTLLKNFSASLV  144

Query  605  vsspdpfvfspdpfIKKEFIVNVDDKQQLNLTFSPS------PYAFVNGIEIVSMPSDLY  766
                            +EF +NV+D + L+L F+PS       YAF+NGIEIVSMP++LY
Sbjct  145  ------ADSKRRYSFSREFCLNVEDNEVLDLVFTPSRSASNDTYAFINGIEIVSMPTNLY  198

Query  767  FRGDNNNY  790
            +   ++ Y
Sbjct  199  YTPPDSTY  206



>ref|XP_009136619.1| PREDICTED: receptor-like protein kinase FERONIA [Brassica rapa]
Length=896

 Score =   129 bits (323),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 89/205 (43%), Positives = 112/205 (55%), Gaps = 24/205 (12%)
 Frame = +2

Query  242  FLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARVFT  421
             LL+CG  S  T  D R W  D    +F+ ++    +SPA A Q P   +VP+ TAR+F 
Sbjct  36   ILLNCGGSSDLTDTDNRTWIPDVKS-KFLSSSGDSKTSPA-ATQDPSVPEVPYMTARIFR  93

Query  422  SELTYSFRVSPGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVT-ANNYTLLKNFSAF  598
            S  TYSF V+ G+KF+RLYF+P +Y           N T   F+VT  ++YTLLKNFSA 
Sbjct  94   SPFTYSFPVASGRKFVRLYFHPNSYDG--------LNATTSLFSVTLGSSYTLLKNFSAA  145

Query  599  LTvsspdpfvfspdpfIKKEFIVNVDDKQQLNLTFSPS----PYAFVNGIEIVSMPSDLY  766
             T              I KEFIVNV+    LN+TF+P      YAFVNGIE+ SMP DLY
Sbjct  146  QT------AQALSYSSIVKEFIVNVEGGASLNITFTPESTPKAYAFVNGIEVTSMP-DLY  198

Query  767  FRGDNNNYPIIS--AVHFDNSTTME  835
               D     + S  AV  DNST +E
Sbjct  199  SNTDGTLSIVGSSTAVDIDNSTALE  223



>ref|XP_006286236.1| hypothetical protein CARUB_v10007805mg [Capsella rubella]
 gb|EOA19134.1| hypothetical protein CARUB_v10007805mg [Capsella rubella]
Length=814

 Score =   128 bits (322),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 79/182 (43%), Positives = 103/182 (57%), Gaps = 16/182 (9%)
 Frame = +2

Query  236  EFFLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARV  415
            + FL++CG  S +   +GR W  ++  L       A LSS A A Q    + +P+  AR+
Sbjct  30   DVFLINCGDTSDNMDDNGRKWTAEDWKLLSSNLVNASLSSEA-AYQDSGVTLIPYMKARI  88

Query  416  FTSELTYSFRVSPGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYTLLKNFSA  595
            F SE TY+F+V+PG KF++LYFYP  Y       G  F    FFF+V+ N +TLL+NFSA
Sbjct  89   FRSEFTYTFQVTPGWKFIKLYFYPTRY-------GSDFVPISFFFSVSVNGFTLLRNFSA  141

Query  596  FLTvsspdpfvfspdpfIKKEFIVNVDDKQQLNLTFSPSP--YAFVNGIEIVSMPSDLYF  769
             LT           +  + KEFIV +     LNLTF PSP   AFVNGIEIVSMP   Y 
Sbjct  142  DLT-----VKASKRESTLIKEFIVPI-HLSGLNLTFKPSPNSLAFVNGIEIVSMPDRFYS  195

Query  770  RG  775
            +G
Sbjct  196  KG  197



>emb|CDX88223.1| BnaA06g28140D [Brassica napus]
Length=811

 Score =   128 bits (321),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 83/186 (45%), Positives = 104/186 (56%), Gaps = 17/186 (9%)
 Frame = +2

Query  236  EFFLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAE-QGPLASQVPFTTAR  412
            +  L++CGA S +     R W T   Y    P N+ +LS  A A  Q   AS VPF  AR
Sbjct  30   DVLLINCGATSYTNDTGNRTW-TVEFYWDHSPWNSEKLSFAAKASYQDVAASPVPFREAR  88

Query  413  VFTSELTYSFRVSPGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYTLLKNFS  592
            +F S  TY F VSPG KFLRLYFYP  Y       G  F+    FF+V  N +TLLKNFS
Sbjct  89   IFRSNFTYKFHVSPGWKFLRLYFYPTRY-------GSNFDANGSFFSVKVNGFTLLKNFS  141

Query  593  AFLTvsspdpfvfspdpfIKKEFIVNVDDKQQLNLTFSPSP--YAFVNGIEIVSMPSDLY  766
            A+LT             ++ KEFIV V   + L+LTF+PSP   AFVNG+EI+SMP   Y
Sbjct  142  AYLT----VKTSKPESKYLIKEFIVPV--FETLSLTFTPSPNSLAFVNGVEILSMPDRFY  195

Query  767  FRGDNN  784
             +G ++
Sbjct  196  TKGGDD  201



>emb|CDX67422.1| BnaA07g14620D [Brassica napus]
Length=722

 Score =   127 bits (320),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 94/209 (45%), Positives = 115/209 (55%), Gaps = 28/209 (13%)
 Frame = +2

Query  236  EFFLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELS---SPAIAEQG-PLASQVPFT  403
            + FL +CGA S  T   GR W  +N   + +P+N+ + S     +  E G PL   VP+ 
Sbjct  30   DLFLFNCGANSDVTDS-GRSWTAENR--KTLPSNSGDASFSSEASFQESGVPL---VPYK  83

Query  404  TARVFTSELTYSFRVSPGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYTLLK  583
            TAR+F S+ TYSF VSPG KFLRLYFYP  Y       G  F+    FF+V  N +TLL 
Sbjct  84   TARIFRSDFTYSFPVSPGWKFLRLYFYPTRY-------GSGFDAVSSFFSVNVNGFTLLN  136

Query  584  NFSAFLTvsspdpfvfspdpfIKKEFIVNVDDKQQLNLTFSPSP-YAFVNGIEIVSMPSD  760
            NFSA LT              + KEFIV V   Q LNLTF+PS   AFVNGIEIVSMP  
Sbjct  137  NFSADLT----VKASKPESKSLIKEFIVPV--YQTLNLTFTPSKSLAFVNGIEIVSMPDR  190

Query  761  LYFRG--DNNNYPIISAVHF--DNSTTME  835
             Y +G  D+    + S V F  DN+T  E
Sbjct  191  FYSKGGFDDVITNVGSNVDFIIDNTTAFE  219



>ref|XP_012084843.1| PREDICTED: receptor-like protein kinase FERONIA [Jatropha curcas]
Length=860

 Score =   128 bits (321),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 79/182 (43%), Positives = 108/182 (59%), Gaps = 20/182 (11%)
 Frame = +2

Query  236  EFFLLSCGAPSKSTSQDGRDWDTDNHYLQFMP---TNTAELSSPAIAEQGPLASQVPFTT  406
            +  L +CG   ++T+ DG  W  D +  +F P   +N+ +  S     QG   + VP+ T
Sbjct  37   DIILSNCGFSGQTTAPDGSKWTGDLNS-KFGPVDHSNSTKSVSAIALRQGSSVASVPYMT  95

Query  407  ARVFTSELTYSFRVSPGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYTLLKN  586
            AR+  ++ TY+F V+ GQKF+RL+FYP+NY          FNK+  FF V    +TLLKN
Sbjct  96   ARISQTQFTYTFPVTAGQKFIRLFFYPSNYQGG-------FNKSKDFFDVKTGPFTLLKN  148

Query  587  FSAFLTvsspdpfvfspdpfIKKEFIVNVDDKQQLNLTFSPS--PYAFVNGIEIVSMPSD  760
            FSA L  S+     F       KEF +NV + QQLNLTFSPS   YAF+NGIEI+SMP++
Sbjct  149  FSASLYSSNRQETFF-------KEFCLNVAENQQLNLTFSPSFNSYAFINGIEILSMPAN  201

Query  761  LY  766
            LY
Sbjct  202  LY  203



>gb|KDP27267.1| hypothetical protein JCGZ_19966 [Jatropha curcas]
Length=858

 Score =   128 bits (321),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 79/182 (43%), Positives = 108/182 (59%), Gaps = 20/182 (11%)
 Frame = +2

Query  236  EFFLLSCGAPSKSTSQDGRDWDTDNHYLQFMP---TNTAELSSPAIAEQGPLASQVPFTT  406
            +  L +CG   ++T+ DG  W  D +  +F P   +N+ +  S     QG   + VP+ T
Sbjct  35   DIILSNCGFSGQTTAPDGSKWTGDLNS-KFGPVDHSNSTKSVSAIALRQGSSVASVPYMT  93

Query  407  ARVFTSELTYSFRVSPGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYTLLKN  586
            AR+  ++ TY+F V+ GQKF+RL+FYP+NY          FNK+  FF V    +TLLKN
Sbjct  94   ARISQTQFTYTFPVTAGQKFIRLFFYPSNYQGG-------FNKSKDFFDVKTGPFTLLKN  146

Query  587  FSAFLTvsspdpfvfspdpfIKKEFIVNVDDKQQLNLTFSPS--PYAFVNGIEIVSMPSD  760
            FSA L  S+     F       KEF +NV + QQLNLTFSPS   YAF+NGIEI+SMP++
Sbjct  147  FSASLYSSNRQETFF-------KEFCLNVAENQQLNLTFSPSFNSYAFINGIEILSMPAN  199

Query  761  LY  766
            LY
Sbjct  200  LY  201



>ref|XP_007045781.1| Malectin/receptor-like protein kinase family protein, putative 
isoform 1 [Theobroma cacao]
 ref|XP_007045782.1| Malectin/receptor-like protein kinase family protein, putative 
isoform 1 [Theobroma cacao]
 gb|EOY01613.1| Malectin/receptor-like protein kinase family protein, putative 
isoform 1 [Theobroma cacao]
 gb|EOY01614.1| Malectin/receptor-like protein kinase family protein, putative 
isoform 1 [Theobroma cacao]
Length=832

 Score =   127 bits (320),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 84/210 (40%), Positives = 119/210 (57%), Gaps = 26/210 (12%)
 Frame = +2

Query  236  EFFLLSCGAPS-KSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTAR  412
            E   L CG+ + KS   DGR+W +D     F   N+   S+ + A  G    +VP+ TAR
Sbjct  47   EQIFLDCGSSAEKSLLFDGRNWSSDIGS-DFTAYNSDSNSTVSSASIGTAVPRVPYMTAR  105

Query  413  VFTSELTYSFRVSPGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYTLLKNFS  592
            +F S+ +Y+F V+PG KF+RLYFYP +Y        R  N ++ F TVT+ +YTLL+NFS
Sbjct  106  LFYSKFSYTFNVTPGPKFIRLYFYPDSY--------RGLNVSESFLTVTSGHYTLLRNFS  157

Query  593  AFLTvsspdpfvfspdpfIKKEFIVNVDDKQQLNLTFSPS-----PYAFVNGIEIVSMPS  757
             +LT    +   F       KEFI++V++   L LTFSP+      Y FVNGIE+VSMP 
Sbjct  158  CYLTAKYLNAAYFF------KEFIIHVEN-HTLELTFSPTLDAPNAYGFVNGIEVVSMPL  210

Query  758  DLYFRGDNNNYPIIS----AVHFDNSTTME  835
             LY RG +   P I      + F+N++ +E
Sbjct  211  HLYIRGHDVPLPFIGFLPKMIMFNNNSALE  240



>ref|XP_002279218.3| PREDICTED: receptor-like protein kinase FERONIA [Vitis vinifera]
Length=893

 Score =   127 bits (319),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 88/205 (43%), Positives = 116/205 (57%), Gaps = 25/205 (12%)
 Frame = +2

Query  242  FLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARVFT  421
             LL+CGA S +T  DG  W TD    +FM      L+S A   Q P    VP+ TAR+  
Sbjct  34   ILLNCGASSSTTDTDGLVWTTDIGS-KFMVAAENSLTSEA-DTQDPSVPTVPYMTARISK  91

Query  422  SELTYSFRVSPGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYTLLKNFSAFL  601
            SE +Y F ++ G+KF+RLYFYPA+YS          + +D  F+VTA +YTLLKNFS   
Sbjct  92   SEFSYRFPLAMGRKFVRLYFYPASYS--------NLSASDALFSVTAGSYTLLKNFSVAQ  143

Query  602  TvsspdpfvfspdpfIKKEFIVNVDDKQQLNLTFSPSP-----YAFVNGIEIVSMPSDLY  766
            T             FI KE+ +NV D + LN+TFSPSP     YAFVNGIEIVSMP D+Y
Sbjct  144  T------TEALNYAFIMKEYSINV-DSEALNITFSPSPSGKNFYAFVNGIEIVSMP-DIY  195

Query  767  FRGDNNNYPIISAVHF--DNSTTME  835
               D ++  + + + +   N T +E
Sbjct  196  NTEDGSSMIVGADIPYTIGNDTALE  220



>ref|XP_010098025.1| Receptor-like protein kinase FERONIA [Morus notabilis]
 gb|EXB74408.1| Receptor-like protein kinase FERONIA [Morus notabilis]
Length=888

 Score =   127 bits (319),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 85/207 (41%), Positives = 112/207 (54%), Gaps = 28/207 (14%)
 Frame = +2

Query  236  EFFLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARV  415
            E   L+CG P++    DG+ W +D   L    +  A+ ++   + Q P  S +PF TARV
Sbjct  35   EQIFLNCGGPTEEA--DGKKWTSDKGSLYL--SKAAKSTTSEASSQDPSVSTIPFMTARV  90

Query  416  FTSELTYSFRVSPGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYTLLKNFSA  595
            F S+ TYS  V+PG+KF+RLYFYP++YS          N ++  F VTA +YTLLKNFS 
Sbjct  91   FQSDFTYSISVAPGRKFIRLYFYPSSYSG--------LNASNAVFDVTAQSYTLLKNFSV  142

Query  596  FLTvsspdpfvfspdpfIKKEFIVNVDDKQQLNLTFSPS-----PYAFVNGIEIVSMPSD  760
              T              I KE+ VNV+    L LTF PS      YAFVNGIE+VSMP D
Sbjct  143  AQT------TEALNYVSIVKEYSVNVEG-DTLALTFKPSSSIPNAYAFVNGIELVSMP-D  194

Query  761  LYFRGDNNNYPIISAVHF--DNSTTME  835
            +Y   D     +  +V F  DN T +E
Sbjct  195  MY-SADGTTMIVSQSVPFIIDNGTALE  220



>ref|XP_010252026.1| PREDICTED: receptor-like protein kinase FERONIA [Nelumbo nucifera]
Length=886

 Score =   127 bits (318),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 87/210 (41%), Positives = 117/210 (56%), Gaps = 36/210 (17%)
 Frame = +2

Query  242  FLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARVFT  421
             LL+CG+ S++T  DG+ W  D    +F P+    L S A A QGP    VP+ TAR+F 
Sbjct  35   ILLNCGSTSETTDTDGQKWTGDVGS-KFAPSTANTLISTA-ATQGPSVPDVPYMTARIFR  92

Query  422  SELTYSFRVSPGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYTLLKNFSAFL  601
            SE TY+F V+ G+KF+RLYFYPA+Y+          N ++  F+VT+  YTLL NFSA  
Sbjct  93   SEFTYTFPVASGRKFVRLYFYPASYNG--------LNASNALFSVTSGPYTLLNNFSASQ  144

Query  602  TvsspdpfvfspdpfIKKEFIVNVDDKQQLNLTFSPS-----PYAFVNGIEIVSMPSDLY  766
            T              I KEF +  +D + LN+TF PS      YAFVNGI+++SMP D+Y
Sbjct  145  T------AEAINFAVIFKEFSLIAED-ESLNITFKPSSNISNAYAFVNGIQVLSMP-DIY  196

Query  767  -------FRGDNNNYPIISAVHFDNSTTME  835
                     G N+ +PI      DNST +E
Sbjct  197  NDANGAFLVGLNSQFPI------DNSTALE  220



>gb|KJB29840.1| hypothetical protein B456_005G120700 [Gossypium raimondii]
Length=889

 Score =   127 bits (318),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 89/209 (43%), Positives = 112/209 (54%), Gaps = 31/209 (15%)
 Frame = +2

Query  236  EFFLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARV  415
            E  LL+CG  S++T  D R W  D    +F+  +   ++S A A Q P   +VP+ TARV
Sbjct  32   EKILLNCGGKSEATDNDNRKWTPDVGS-KFLLGSGNSVASQA-ATQDPAVPEVPYMTARV  89

Query  416  FTSELTYSFRVSPGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYTLLKNFSA  595
            F S  TYSF V PG+KFLRLYFY  +Y              +  F+VT  +YTLLKNFSA
Sbjct  90   FRSNFTYSFPVVPGRKFLRLYFYANSYDGQIA--------ANALFSVTCGSYTLLKNFSA  141

Query  596  FLTvsspdpfvfspdpfIKKEFIVNVDDKQQLNLTFSPS----PYAFVNGIEIVSMPSDL  763
              T             F+ KE+ +NVDD   LNLTF+PS     YAFVNGIE++SMP D+
Sbjct  142  AQT------SEALNYAFVVKEYSINVDD-DHLNLTFTPSTPSNAYAFVNGIEVLSMP-DI  193

Query  764  YFRGD-----NNNYPIISAVHFDNSTTME  835
            Y   D       N P       DNST +E
Sbjct  194  YGNADGISIVGQNIPFT----IDNSTALE  218



>ref|XP_008231015.1| PREDICTED: receptor-like protein kinase FERONIA [Prunus mume]
Length=497

 Score =   124 bits (311),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 77/190 (41%), Positives = 109/190 (57%), Gaps = 20/190 (11%)
 Frame = +2

Query  236  EFFLLSCG-APSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTAR  412
            E   L CG +  +    D R W  D +  +F P       SP+I+ Q P +S VP++TAR
Sbjct  47   EDITLQCGFSGDQLNPDDTRTWTGDINS-KFSPFENQAAGSPSISRQAPSSSSVPYSTAR  105

Query  413  VFTSELTYSFRVSPGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYTLLKNFS  592
            +  SE TY F V+ GQKF+RLYF PA+Y       G  F+++   F+V A  +TLLK+F+
Sbjct  106  LSRSEFTYRFLVATGQKFIRLYFNPASY-------GPDFDRSKALFSVKAGGFTLLKDFN  158

Query  593  AFLTvsspdpfvfspdpfIKKEFIVNVDDKQQLNLTFSPS-----PYAFVNGIEIVSMPS  757
            + +T         S    I +EF +NV+ +Q LN+TF PS      YAF+NGIEIVSMP+
Sbjct  159  SSVT------ADASESDIIYREFCLNVESEQSLNITFMPSRATADAYAFINGIEIVSMPN  212

Query  758  DLYFRGDNNN  787
            +LY+    N+
Sbjct  213  NLYYTSAQNS  222



>gb|ABT18099.1| FERONIA receptor-like kinase [Cardamine flexuosa]
Length=898

 Score =   126 bits (317),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 87/205 (42%), Positives = 115/205 (56%), Gaps = 25/205 (12%)
 Frame = +2

Query  242  FLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARVFT  421
             LL+CGA S S+  D R W  D++  +F+ ++    +SPA A QG   S++P+ TAR+  
Sbjct  39   ILLNCGASSNSSDADKRAWSADDNN-KFLSSSGDSKTSPA-ATQGSSVSEIPYMTARISQ  96

Query  422  SELTYSFRVSPGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYTLLKNFSAFL  601
            S  TYSF V+ G+K +RLYFYP+ Y           N TD  F+ +   YTLLKNFSA  
Sbjct  97   SPFTYSFSVAAGRKIVRLYFYPSTYDG--------LNATDGLFSFSFGPYTLLKNFSAAQ  148

Query  602  TvsspdpfvfspdpfIKKEFIVNVDDKQQLNLTFSP-----SPYAFVNGIEIVSMPSDLY  766
            T          P   I KEFIVNV+    LN+TF+P     + YAFVNGIE+ SMP D+Y
Sbjct  149  T------VEALPYAVIVKEFIVNVEGG-SLNMTFTPESTPSNAYAFVNGIEVTSMP-DIY  200

Query  767  FRGDNNNYPIISAVHF--DNSTTME  835
               D     + S+  F  DNST +E
Sbjct  201  SNTDGTLTMVGSSGAFTIDNSTALE  225



>gb|ABT18097.1| FERONIA receptor-like kinase [Cardamine flexuosa]
Length=891

 Score =   126 bits (317),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 87/202 (43%), Positives = 113/202 (56%), Gaps = 22/202 (11%)
 Frame = +2

Query  242  FLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARVFT  421
             LL+CG  S     D R W +D    +F+ ++    +SPA A Q P  SQVP+ TARVF 
Sbjct  37   ILLNCGGVSDLVDTDNRTWISDVKS-KFLSSSGDSKTSPA-ATQDPSVSQVPYMTARVFR  94

Query  422  SELTYSFRVSPGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYTLLKNFSAFL  601
            S  TYSF V+ G+KF+RLYFYP  Y           N T+  F+V+   YTLLKNFSA  
Sbjct  95   SPFTYSFPVAAGRKFVRLYFYPNTYDG--------LNATNALFSVSFGPYTLLKNFSAAQ  146

Query  602  TvsspdpfvfspdpfIKKEFIVNVDDKQQLNLTFSP--SPYAFVNGIEIVSMPSDLYFRG  775
            T              I KEFIVNV+    LN+TF+P  + YAF+NGIE+ SMP D+Y   
Sbjct  147  T------AEALTYAVIVKEFIVNVEGG-SLNMTFTPESNAYAFMNGIEVTSMP-DIYSST  198

Query  776  DNNNYPIISAVHF--DNSTTME  835
            D +   + ++  F  DNST +E
Sbjct  199  DGSLIMVGASSDFTIDNSTALE  220



>ref|XP_011095158.1| PREDICTED: receptor-like protein kinase FERONIA [Sesamum indicum]
Length=883

 Score =   126 bits (317),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 86/203 (42%), Positives = 113/203 (56%), Gaps = 26/203 (13%)
 Frame = +2

Query  248  LSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARVFTSE  427
            L+CG P  ST  DGR W +D      + T  +  ++ AI  Q P   +VP+ TAR+F SE
Sbjct  38   LNCGGPPDSTDSDGRKWTSDIGSKFALSTTKSSTATAAI--QKPSVPEVPYMTARIFQSE  95

Query  428  LTYSFRVSPGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYTLLKNFSAFLTv  607
             TYSF V+ G+KF+RLYFYPA+Y+          N ++  F+VT+  YTLL+NFSA LT 
Sbjct  96   FTYSFPVASGRKFVRLYFYPASYNG--------LNASNAIFSVTSGAYTLLRNFSAALT-  146

Query  608  sspdpfvfspdpfIKKEFIVNVDDKQQLNLTFSPS-----PYAFVNGIEIVSMPSDLYFR  772
                        +I KEF VNV   + LN+TF PS      YAFVNGIE+VS P D+Y  
Sbjct  147  -----TEALNYDYIMKEFSVNV-PSEVLNVTFIPSQNASNSYAFVNGIEVVSHP-DIY-S  198

Query  773  GDNNNYPIISAVHF--DNSTTME  835
             D     +  +  F  DN T +E
Sbjct  199  TDGTEIVVGQSTGFNIDNRTALE  221



>ref|XP_009125099.1| PREDICTED: putative receptor-like protein kinase At5g39000 [Brassica 
rapa]
Length=873

 Score =   126 bits (317),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 93/209 (44%), Positives = 115/209 (55%), Gaps = 28/209 (13%)
 Frame = +2

Query  236  EFFLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELS---SPAIAEQG-PLASQVPFT  403
            + FL +CGA S  T   GR W  +N   + +P+N+ + S     +  E G PL   VP+ 
Sbjct  30   DLFLFNCGANSDVTDS-GRSWTAENR--KTLPSNSGDASFSSEASFQESGVPL---VPYK  83

Query  404  TARVFTSELTYSFRVSPGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYTLLK  583
            TAR+F S+ TYSF VSPG KFLRLYFYP  Y       G  F+    FF+V  N +TLL 
Sbjct  84   TARIFRSDFTYSFPVSPGWKFLRLYFYPTRY-------GSGFDAVSSFFSVNVNGFTLLN  136

Query  584  NFSAFLTvsspdpfvfspdpfIKKEFIVNVDDKQQLNLTFSPSP-YAFVNGIEIVSMPSD  760
            NFSA LT              + KEFIV V   Q LNLTF+PS   AFVNGIEIVS+P  
Sbjct  137  NFSADLT----VKASKPESKSLIKEFIVPV--YQTLNLTFTPSKSLAFVNGIEIVSLPDR  190

Query  761  LYFRGDNNNY--PIISAVHF--DNSTTME  835
             Y +G  N+    + S V F  DN+T  E
Sbjct  191  FYSKGGFNDVITNVGSNVDFIIDNTTAFE  219



>gb|KJB11637.1| hypothetical protein B456_001G269100 [Gossypium raimondii]
Length=889

 Score =   126 bits (317),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 79/190 (42%), Positives = 106/190 (56%), Gaps = 23/190 (12%)
 Frame = +2

Query  236  EFFLLSCGAPSKSTSQDGRDWDTDNH-YLQFMPT-NTAELSSPAIAEQGPLASQVPFTTA  409
            E   + CG+P+ +   DGR W  D+   L  + + N   +SS A  +      QVPF TA
Sbjct  37   ESITIDCGSPNDNIGLDGRVWTGDSMPKLSLVESKNNKSVSSKAFQQPPSSLGQVPFATA  96

Query  410  RVFTSELTYSFRVSPGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYTLLKNF  589
            R   SE TY   ++ GQKF+RLYF+P +Y +        F+ +   F+V A + TLLKNF
Sbjct  97   RASNSEFTYVIPLTSGQKFIRLYFFPTSYPS--------FDASKALFSVKAGDITLLKNF  148

Query  590  SAFLTvsspdpfvfspdpfIKKEFIVNVDDKQQLNLTFSPSP-----YAFVNGIEIVSMP  754
            SA L            +  + KEF VN++  Q LNLTF PSP     YAFVNGIEIVSMP
Sbjct  149  SATL--------HAQGEETLIKEFCVNLERGQGLNLTFIPSPDISDSYAFVNGIEIVSMP  200

Query  755  SDLYFRGDNN  784
            ++LY+R  N+
Sbjct  201  NNLYYRPAND  210



>ref|XP_010441030.1| PREDICTED: putative receptor-like protein kinase At5g39000 [Camelina 
sativa]
Length=326

 Score =   122 bits (305),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 89/209 (43%), Positives = 116/209 (56%), Gaps = 23/209 (11%)
 Frame = +2

Query  236  EFFLLSCGAPSKSTSQDGRDWDTDN-HYLQFMPTNTAELSSPAIAEQGPLASQVPFTTAR  412
            + FL +CG  S +    GR+W  ++   +     N +  S  +  E G   SQ+P+  AR
Sbjct  30   DVFLFNCGDTSNNLDDTGRNWTVEDPKTMSSNLVNASFTSEASYQESG--VSQIPYMKAR  87

Query  413  VFTSELTYSFRVS-PGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYTLLKNF  589
            VF SE TY+F+V+ PG KFLRL FYP  Y       G  FN  + FF+V  N++TLL NF
Sbjct  88   VFRSEYTYTFQVTTPGSKFLRLNFYPTRY-------GSNFNAINSFFSVKVNDFTLLNNF  140

Query  590  SAFLTvsspdpfvfspdpfIKKEFIVNVDDKQQLNLTFSPS---PYAFVNGIEIVSMPSD  760
            SA LTV +             KEFI+ V+  Q LNLTF+PS     AFVNGIEIVSMP  
Sbjct  141  SADLTVKASKTKTEFITI---KEFIIPVN--QTLNLTFTPSSTNSLAFVNGIEIVSMPQR  195

Query  761  LYFRG--DNNNYPIISAVHF--DNSTTME  835
            LY +G  D+    + S+V F  +NST  E
Sbjct  196  LYSKGGYDDVITNVGSSVDFRIENSTAFE  224



>ref|XP_007151348.1| hypothetical protein PHAVU_004G038800g [Phaseolus vulgaris]
 gb|ESW23342.1| hypothetical protein PHAVU_004G038800g [Phaseolus vulgaris]
Length=891

 Score =   125 bits (315),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 78/184 (42%), Positives = 107/184 (58%), Gaps = 26/184 (14%)
 Frame = +2

Query  236  EFFLLSCGAPSKSTSQDG-RDW--DTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTT  406
            E F +SCG   KS+  DG R W  D D  YL F   + +E ++     Q P  +Q+P++T
Sbjct  33   EIFTISCGTTGKSS--DGQRRWTGDEDTKYLSFKDGSVSEKAT----TQSPSTNQIPYST  86

Query  407  ARVFTSELTYSFRVSPGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYTLLKN  586
            AR+  S+  YSF VSPG KFLRL+FYPA+Y          F +    FTV +N +TLL  
Sbjct  87   ARLSRSQFNYSFPVSPGPKFLRLFFYPADYP--------NFPRNQASFTVQSNQFTLLHA  138

Query  587  FSAFLTvsspdpfvfspdpfIKKEFIVNVDDKQQLNLTFSPS---PYAFVNGIEIVSMPS  757
            F+A L               I +E++VNV+D + L LTF+PS    YAF+NGIE++SMP+
Sbjct  139  FNASLN------ADAQATETIFREYVVNVNDGEGLILTFTPSNSNSYAFINGIEVLSMPT  192

Query  758  DLYF  769
            DLY+
Sbjct  193  DLYY  196



>ref|XP_007032792.1| Malectin/receptor protein kinase family protein [Theobroma cacao]
 gb|EOY03718.1| Malectin/receptor protein kinase family protein [Theobroma cacao]
Length=371

 Score =   122 bits (306),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 79/183 (43%), Positives = 104/183 (57%), Gaps = 24/183 (13%)
 Frame = +2

Query  248  LSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPA---IAEQGPLASQVPFTTARVF  418
            L+C A S S   DGR W  D    +F P  ++  S  A    A QG     VP+  ARV 
Sbjct  150  LNCKALSDSHGSDGRFWAGDKSS-KFGPFESSRDSPSAPYEAANQGGFVKTVPYMNARVS  208

Query  419  TSELTYSFRVSPGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYTLLKNFSAF  598
            +SE  Y+F VSP QKF+  +FYPA+Y        ++ N +  FF+V A ++TLLKNFSAF
Sbjct  209  SSEFKYNFPVSPSQKFVGRHFYPASY--------KKLNLSKAFFSVKAGSFTLLKNFSAF  260

Query  599  LTvsspdpfvfspdpfIKKEFIVNVDDKQQLNLTFSPSP------YAFVNGIEIVSMPSD  760
            L   S +   F       +EF +NV++ Q L L FSP+P      YAF+NGIEIVSMP +
Sbjct  261  LVAESSNVKSFF------REFCLNVEENQGLELIFSPTPSSSNDTYAFINGIEIVSMPPN  314

Query  761  LYF  769
            LY+
Sbjct  315  LYY  317



>gb|KJB38065.1| hypothetical protein B456_006G235700 [Gossypium raimondii]
Length=895

 Score =   125 bits (314),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 88/208 (42%), Positives = 113/208 (54%), Gaps = 28/208 (13%)
 Frame = +2

Query  236  EFFLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARV  415
            E  LL+CG  S  +  D R W  D    +F+      ++SPA + Q P   +VP+ TARV
Sbjct  36   EKILLNCGEKSDLSDNDNRKWTPDVGS-KFLTGTEKSVTSPA-SSQDPAVPEVPYMTARV  93

Query  416  FTSELTYSFRVSPGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYTLLKNFSA  595
            F S  TYSF V  G+KF+RLYFY  +Y           N T+  F+VT+ +YTLLKNFSA
Sbjct  94   FHSNFTYSFPVVSGRKFVRLYFYANSYDGQ--------NATNALFSVTSGSYTLLKNFSA  145

Query  596  FLTvsspdpfvfspdpfIKKEFIVNVDDKQQLNLTFSPS-----PYAFVNGIEIVSMPSD  760
              T             F+ KE+ +NV D   LNLTFSPS      YAFVNGIE++SMP D
Sbjct  146  AQT------SEALNYAFVIKEYSINV-DGDHLNLTFSPSSTPSNAYAFVNGIEVLSMP-D  197

Query  761  LYFRGDNNNYPIISA---VHFDNSTTME  835
            LY   D    PI+     +  DN+T +E
Sbjct  198  LYSNSD--GVPIVGQQVPLTIDNATALE  223



>ref|XP_002308259.1| kinase family protein [Populus trichocarpa]
 gb|EEE91782.1| kinase family protein [Populus trichocarpa]
Length=893

 Score =   125 bits (314),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 80/182 (44%), Positives = 100/182 (55%), Gaps = 23/182 (13%)
 Frame = +2

Query  236  EFFLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARV  415
            E  LL CGA S  +  DGRDW +D        +  +  +    + Q P   QVP+ TAR+
Sbjct  31   EKILLDCGANSDQSDSDGRDWTSDRGSSFLSSSTNSSTA--TASTQDPSVPQVPYLTARI  88

Query  416  FTSELTYSFRVSPGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYTLLKNFSA  595
            F S  TYSF V  G+KF+RLYFYP++YS          N ++  F+VTA +YTLL NFS 
Sbjct  89   FRSSFTYSFPVVSGRKFIRLYFYPSSYSG--------LNASNALFSVTAGSYTLLSNFSV  140

Query  596  FLTvsspdpfvfspdpfIKKEFIVNVDDKQQLNLTFSP-----SPYAFVNGIEIVSMPSD  760
              T              I KE++VNV D   L +TFSP     S YAFVNGIEIVSMP D
Sbjct  141  AQT------AEALNYVSIMKEYLVNV-DGDTLKITFSPSSNPSSAYAFVNGIEIVSMP-D  192

Query  761  LY  766
            +Y
Sbjct  193  IY  194



>ref|XP_008813242.1| PREDICTED: receptor-like protein kinase FERONIA [Phoenix dactylifera]
Length=894

 Score =   125 bits (314),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 79/178 (44%), Positives = 104/178 (58%), Gaps = 23/178 (13%)
 Frame = +2

Query  248  LSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARVFTSE  427
            L+CGA  + T  DG +W  D         N A  S+   + Q     Q+P+ TARVFTS 
Sbjct  46   LNCGASGQVTDTDGLNWTGDAGSKYAPSINGAGASA---SSQDSSVPQIPYMTARVFTSP  102

Query  428  LTYSFRVSPGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYTLLKNFSAFLTv  607
             TY+F + PG KF+RLYFYP+NYS+ A         +D FF+VTA + TLL+NFSA+LT 
Sbjct  103  YTYTFPLGPGGKFVRLYFYPSNYSSRAA--------SDAFFSVTAGSNTLLQNFSAYLT-  153

Query  608  sspdpfvfspdpfIKKEFIVNVDDKQQLNLTFSPSP-----YAFVNGIEIVSMPSDLY  766
                        ++ +E+ VNV     LNLTF+PSP     YAFVNGIEIVS+P D++
Sbjct  154  -----ANALNFNYLVREYSVNVSSG-ALNLTFTPSPDHPNSYAFVNGIEIVSIPDDIF  205



>ref|XP_011001679.1| PREDICTED: receptor-like protein kinase FERONIA [Populus euphratica]
Length=894

 Score =   125 bits (314),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 86/209 (41%), Positives = 110/209 (53%), Gaps = 30/209 (14%)
 Frame = +2

Query  236  EFFLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARV  415
            E  LL CGA S     DGRDW +D        +  +  ++ +   Q P   QVP+ TAR+
Sbjct  34   EKTLLDCGANSDRPDSDGRDWTSDKGSSFLSSSGKSSTATAST--QDPAVPQVPYLTARI  91

Query  416  FTSELTYSFRVSPGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYTLLKNFSA  595
            F S  TYSF V  G KF+RLYFYP++Y+          N +D  F+VTA +YTLL NFS 
Sbjct  92   FQSNFTYSFPVISGHKFVRLYFYPSSYNG--------LNASDALFSVTAGSYTLLSNFSV  143

Query  596  FLTvsspdpfvfspdpfIKKEFIVNVDDKQQLNLTFSP-----SPYAFVNGIEIVSMPSD  760
              T              I KE+++NV +   LN+TFSP     S YAFVNGIEIVSMP D
Sbjct  144  AQT------TDALNYVSIMKEYLINV-NGDTLNITFSPSSNPSSAYAFVNGIEIVSMP-D  195

Query  761  LYFRGDNNNYPIISAVH----FDNSTTME  835
            +Y    N N  +I         DN+T +E
Sbjct  196  IY---SNANGVMIVGQGVPYVIDNTTALE  221



>ref|XP_009151130.1| PREDICTED: probable receptor-like protein kinase At5g39030 [Brassica 
rapa]
Length=811

 Score =   125 bits (313),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 82/186 (44%), Positives = 103/186 (55%), Gaps = 17/186 (9%)
 Frame = +2

Query  236  EFFLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAE-QGPLASQVPFTTAR  412
            +  L++CGA S +     R W T   Y    P N+ +LS  A A  Q   A  VPF  AR
Sbjct  30   DVLLINCGATSYTNDTGNRTW-TVEFYWDHSPWNSEKLSFAAKASYQDVAAFPVPFREAR  88

Query  413  VFTSELTYSFRVSPGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYTLLKNFS  592
            +F S  TY F VSPG KFLRLYFYP  Y       G  F+    FF+V  N +TLLKNFS
Sbjct  89   IFRSNFTYKFHVSPGWKFLRLYFYPTRY-------GSNFDANGSFFSVKVNGFTLLKNFS  141

Query  593  AFLTvsspdpfvfspdpfIKKEFIVNVDDKQQLNLTFSPSP--YAFVNGIEIVSMPSDLY  766
            A+LT             ++ KEFIV V   + L+LTF+PSP   AFVNG+EI+SMP   Y
Sbjct  142  AYLT----VKTSKPESKYLIKEFIVPV--FETLSLTFTPSPNSLAFVNGVEILSMPDRFY  195

Query  767  FRGDNN  784
             +G ++
Sbjct  196  TKGGDD  201



>ref|XP_007032808.1| Malectin/receptor-like protein kinase family protein, putative 
[Theobroma cacao]
 gb|EOY03734.1| Malectin/receptor-like protein kinase family protein, putative 
[Theobroma cacao]
Length=910

 Score =   125 bits (313),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 86/228 (38%), Positives = 122/228 (54%), Gaps = 45/228 (20%)
 Frame = +2

Query  236  EFFLLSCGAPSKSTSQDGRDWDTDNHYLQFMP----TNTAELSSPAIA--EQGPLASQVP  397
            E   + CG+ +   + D R W  D +  +F P    +N    SS  +   EQ P   +VP
Sbjct  47   ENITIDCGSSTDGHALDNRPWTGDGNG-KFSPIEQQSNNNNKSSVLLTALEQPPSVDKVP  105

Query  398  FTTARVFTSELTYSFRVSPGQKFLRLYFYPANYSAAAGGGGRRFN--KTDFFFTVTANNY  571
            ++TAR+  SE TY+  ++ GQKF+RLYFYP +Y        R F+      FF+V A  +
Sbjct  106  YSTARLSYSEFTYTISLTAGQKFIRLYFYPTSY--------RGFDDPSNKAFFSVKAGPF  157

Query  572  TLLKNFSAFLTvsspdpfvfspdpfIKKEFIVNVDDKQQLNLTFSPSP-----YAFVNGI  736
            TLL+NFSA L             P + KEF +NVD+ ++LNLTF+PSP     YAF+NGI
Sbjct  158  TLLRNFSALL--------HAQGQPTLIKEFCLNVDEGERLNLTFTPSPDISDSYAFINGI  209

Query  737  EIVSMPSDLYFR----------GDNNNYPI-----ISAVHFDNSTTME  835
            EIVSMP++LY+R          G  ++YP+     +  VH  N   M+
Sbjct  210  EIVSMPTNLYYRQASDEGVTFLGQGSSYPLGNNSALEMVHRVNVGGMQ  257



>gb|ABT18095.1| FERONIA receptor-like kinase [Cardamine flexuosa]
Length=891

 Score =   125 bits (313),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 86/202 (43%), Positives = 112/202 (55%), Gaps = 22/202 (11%)
 Frame = +2

Query  242  FLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARVFT  421
             LL+CG  S     D R W +D    +F+ ++    +SPA A Q P  SQVP+ TARVF 
Sbjct  37   ILLNCGGASDLVDTDNRTWISDVKS-KFLSSSGDSKTSPA-ATQDPSVSQVPYMTARVFR  94

Query  422  SELTYSFRVSPGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYTLLKNFSAFL  601
            S  TY F V+ G+KF+RLYFYP  Y           N T+  F+V+   YTLLKNFSA  
Sbjct  95   SPFTYPFPVAAGRKFVRLYFYPNTYDG--------LNATNALFSVSFGPYTLLKNFSAAQ  146

Query  602  TvsspdpfvfspdpfIKKEFIVNVDDKQQLNLTFSP--SPYAFVNGIEIVSMPSDLYFRG  775
            T              I KEFIVNV+    LN+TF+P  + YAF+NGIE+ SMP D+Y   
Sbjct  147  T------AEALTYAVIVKEFIVNVEGG-SLNMTFTPESNAYAFMNGIEVTSMP-DIYSST  198

Query  776  DNNNYPIISAVHF--DNSTTME  835
            D +   + ++  F  DNST +E
Sbjct  199  DGSLIMVGASSDFTIDNSTALE  220



>ref|XP_002323088.2| kinase family protein [Populus trichocarpa]
 gb|EEF04849.2| kinase family protein [Populus trichocarpa]
Length=894

 Score =   124 bits (312),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 86/209 (41%), Positives = 110/209 (53%), Gaps = 30/209 (14%)
 Frame = +2

Query  236  EFFLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARV  415
            E  LL CGA S     DGR W +D        +  +  ++ +   Q P   QVP+ TAR+
Sbjct  34   EKTLLDCGANSDLPDSDGRGWTSDKGSSFLSSSGKSSTATAST--QDPAVPQVPYLTARI  91

Query  416  FTSELTYSFRVSPGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYTLLKNFSA  595
            F S  TYSF V  G KF+RLYFYP++Y+          N +D  F+VTA +YTLL NFS 
Sbjct  92   FQSSFTYSFPVVSGHKFVRLYFYPSSYNG--------LNASDALFSVTAGSYTLLSNFSV  143

Query  596  FLTvsspdpfvfspdpfIKKEFIVNVDDKQQLNLTFSP-----SPYAFVNGIEIVSMPSD  760
              T              I KE+++NV+D   LN+TFSP     S YAFVNGIEIVSMP D
Sbjct  144  AQT------TDALNYVSIMKEYLINVND-DTLNITFSPSSNPSSAYAFVNGIEIVSMP-D  195

Query  761  LYFRGDNNNYPIISAVH----FDNSTTME  835
            +Y    N N  +I         DN+T +E
Sbjct  196  IY---SNANGVMIVGQGVPYVIDNTTALE  221



>ref|NP_198715.1| putative receptor-like protein kinase [Arabidopsis thaliana]
 sp|Q9FID9.1|Y5389_ARATH RecName: Full=Probable receptor-like protein kinase At5g38990; 
Flags: Precursor [Arabidopsis thaliana]
 dbj|BAB10823.1| receptor protein kinase-like protein [Arabidopsis thaliana]
 gb|AED94384.1| malectin/receptor-like protein kinase family protein [Arabidopsis 
thaliana]
Length=880

 Score =   124 bits (312),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 88/210 (42%), Positives = 112/210 (53%), Gaps = 31/210 (15%)
 Frame = +2

Query  236  EFFLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAE----LSSPAIAEQGPLASQVPFT  403
            + FL++CG  S +    GR+W T+N   +FM +N  +     SS +  E G    QVP+ 
Sbjct  27   DVFLINCGDTSNNMDYSGRNWTTENP--KFMSSNAVDDASFTSSASYQESG--IPQVPYL  82

Query  404  TARVFTSELTYSFRVSPGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYTLLK  583
             AR+F  + TYSF VSPG KFLRLYFYP  Y       G  F+    FF+V  N +TLL 
Sbjct  83   KARIFRYDFTYSFPVSPGWKFLRLYFYPTRY-------GSDFDAVKSFFSVNVNRFTLLH  135

Query  584  NFSAFLTvsspdpfvfspdpfIKKEFIVNVDDKQQLNLTFSPSP--YAFVNGIEIVSMPS  757
            NFS                  + KEFIV V+  Q L+LTF+PSP   AFVNGIEI+SMP 
Sbjct  136  NFSV--------KASIPESSSLIKEFIVPVN--QTLDLTFTPSPNSLAFVNGIEIISMPD  185

Query  758  DLYFRG--DNNNYPIISAVHF--DNSTTME  835
              Y +G  D+    +   V F  DNST  E
Sbjct  186  RFYSKGGFDDVVRNVGRDVDFEIDNSTAFE  215



>gb|AAM10331.1| AT5g38990/K15E6_170 [Arabidopsis thaliana]
 gb|AAN18200.1| At5g38990/K15E6_170 [Arabidopsis thaliana]
Length=880

 Score =   124 bits (311),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 88/210 (42%), Positives = 112/210 (53%), Gaps = 31/210 (15%)
 Frame = +2

Query  236  EFFLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAE----LSSPAIAEQGPLASQVPFT  403
            + FL++CG  S +    GR+W T+N   +FM +N  +     SS +  E G    QVP+ 
Sbjct  27   DVFLINCGDTSNNMDYSGRNWTTENP--KFMSSNAVDDASFTSSASYQESG--IPQVPYL  82

Query  404  TARVFTSELTYSFRVSPGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYTLLK  583
             AR+F  + TYSF VSPG KFLRLYFYP  Y       G  F+    FF+V  N +TLL 
Sbjct  83   KARIFRYDFTYSFPVSPGWKFLRLYFYPTRY-------GSDFDAVKSFFSVNVNRFTLLH  135

Query  584  NFSAFLTvsspdpfvfspdpfIKKEFIVNVDDKQQLNLTFSPSP--YAFVNGIEIVSMPS  757
            NFS                  + KEFIV V+  Q L+LTF+PSP   AFVNGIEI+SMP 
Sbjct  136  NFSV--------KASIPESSSLIKEFIVPVN--QTLDLTFTPSPNSLAFVNGIEIISMPD  185

Query  758  DLYFRG--DNNNYPIISAVHF--DNSTTME  835
              Y +G  D+    +   V F  DNST  E
Sbjct  186  RFYSKGGFDDVVRNVGRDVDFEIDNSTAFE  215



>ref|XP_010043538.1| PREDICTED: receptor-like protein kinase FERONIA [Eucalyptus grandis]
 ref|XP_010043545.1| PREDICTED: receptor-like protein kinase FERONIA [Eucalyptus grandis]
 gb|KCW88392.1| hypothetical protein EUGRSUZ_A00782 [Eucalyptus grandis]
Length=897

 Score =   124 bits (312),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 81/205 (40%), Positives = 115/205 (56%), Gaps = 25/205 (12%)
 Frame = +2

Query  242  FLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARVFT  421
             LL CGA S++T  DG+ W ++      +P +TA       A Q P   QVP+ TAR+F 
Sbjct  38   ILLDCGAASQTTDADGQVWTSE--IGSKIPASTANAIMATAATQDPSVPQVPYMTARIFQ  95

Query  422  SELTYSFRVSPGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYTLLKNFSAFL  601
            S  TYSF V+ G+KF+RLYFYP+ Y+         +N ++  F+V+A  YTLLKNFS   
Sbjct  96   SNFTYSFPVASGRKFVRLYFYPSVYNT--------YNASNAIFSVSAEGYTLLKNFSVAQ  147

Query  602  TvsspdpfvfspdpfIKKEFIVNVDDKQQLNLTFSPS-----PYAFVNGIEIVSMPSDLY  766
            T             ++ KE+ VNV + + LN+TFSPS      +AFVNGIE+ SMP D+Y
Sbjct  148  T------TEALNFAYVLKEYSVNV-EGETLNITFSPSKNYAGAFAFVNGIEVQSMP-DIY  199

Query  767  FRGDNNNYPII--SAVHFDNSTTME  835
               D +   +   + +  DN+T +E
Sbjct  200  SATDGSTMIVGLNAPLTIDNTTALE  224



>ref|XP_006285765.1| hypothetical protein CARUB_v10007239mg [Capsella rubella]
 gb|EOA18663.1| hypothetical protein CARUB_v10007239mg [Capsella rubella]
Length=888

 Score =   124 bits (311),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 88/208 (42%), Positives = 113/208 (54%), Gaps = 26/208 (13%)
 Frame = +2

Query  236  EFFLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNT--AELSSPAIAEQGPLASQVPFTTA  409
            + F ++CGA S      GR W  + + L   P+N+  A  +S A+ ++  + SQVP+  A
Sbjct  29   DVFFINCGATSND-ENGGRTWTPERNIL---PSNSESASFTSDALYQESGV-SQVPYMVA  83

Query  410  RVFTSELTYSFRVSPGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYTLLKNF  589
            R+F SE TYSF +SPG K+LRLYFYP  Y       G  F+     F V  N +TLL+NF
Sbjct  84   RLFRSEFTYSFPLSPGWKYLRLYFYPTRY-------GSGFDAAHSLFDVNVNGFTLLRNF  136

Query  590  SAFLTvsspdpfvfspdpfIKKEFIVNVDDKQQLNLTFSPSP--YAFVNGIEIVSMPSDL  763
            SA LT              + KEFIV V   Q LN+TF+PSP   AFVNGIEIVSMP   
Sbjct  137  SADLT----VKASKPESKSVIKEFIVPV--YQTLNITFTPSPDSLAFVNGIEIVSMPDLF  190

Query  764  YFRGDNNNYPIISAVHFD----NSTTME  835
            Y +G  ++  I     FD    NST  E
Sbjct  191  YSKGGFDDKIIYVGREFDLDINNSTAFE  218



>ref|XP_009373799.1| PREDICTED: receptor-like protein kinase FERONIA [Pyrus x bretschneideri]
Length=890

 Score =   124 bits (311),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 83/215 (39%), Positives = 119/215 (55%), Gaps = 40/215 (19%)
 Frame = +2

Query  248  LSCG-APSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLAS--QVPFTTARVF  418
            L CG +  +   QDGR W  D +  +F P+  A  SS  +    P++S  QVP+TTAR+ 
Sbjct  37   LQCGFSGDQVNQQDGRTWSGDINS-KFSPSQAAG-SSSVLKAATPISSSSQVPYTTARLS  94

Query  419  TSELTYSFRVSPGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYTLLKNFSAF  598
             SE TY+F ++ GQKF+RL FYP  Y+A        F+++   F+V A  +TLL++F+A 
Sbjct  95   RSEFTYTFPLTSGQKFIRLSFYPTFYAA-------EFDRSKSLFSVEAGGFTLLRDFNAS  147

Query  599  LTvsspdpfvfspdpfIKKEFIVNVDDKQQLNLTFSPS-----PYAFVNGIEIVSMPSDL  763
            +T         S    + +EF +N+  +Q LN+TF+PS      YAF+NGIEIVSMP +L
Sbjct  148  VT------ADASWSETVSREFCLNIASEQSLNITFTPSRASPDAYAFINGIEIVSMPDNL  201

Query  764  YFR-----------GDNNNYPIISAVHFDNSTTME  835
            Y+            G  N YPI      +N+T ME
Sbjct  202  YYTPPQSEDGAVLVGSINQYPI------ENNTAME  230



>emb|CDX74492.1| BnaA04g08970D [Brassica napus]
Length=885

 Score =   124 bits (311),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 89/208 (43%), Positives = 114/208 (55%), Gaps = 22/208 (11%)
 Frame = +2

Query  236  EFFLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAE-QGPLASQVPFTTAR  412
            + FL +CG  S      GR+W  +     F+P+N A  S  + A  QG   S+VP+ TAR
Sbjct  30   DVFLFNCGETSDQMDISGRNWMAEQP--NFLPSNAANASFVSHASFQGSGVSKVPYMTAR  87

Query  413  VFTSELTYSFRVSPGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYTLLKNFS  592
            +F  + TY F VSPG KFLRLYFYP  YS+            + +F+V  N +TLLKNFS
Sbjct  88   IFRHDFTYRFPVSPGWKFLRLYFYPTRYSSDLDAA------VNSYFSVIVNGFTLLKNFS  141

Query  593  AFLTvsspdpfvfspdpfIKKEFIVNVDDKQ-QLNLTFSPS--PYAFVNGIEIVSMPSDL  763
            A LT         S   FI KEFIV V      LNLTF+PS    AFVNG+EIVSMP   
Sbjct  142  ADLT------AKASNGAFIFKEFIVPVSSGHTMLNLTFTPSLNMLAFVNGVEIVSMPDRF  195

Query  764  YFRG--DNNNYPIISAVHFD--NSTTME  835
            Y +G  D+    + +++ F+  NST  E
Sbjct  196  YSKGGFDDKIAQVGNSIDFEINNSTAFE  223



>emb|CDY37884.1| BnaC04g31220D [Brassica napus]
Length=867

 Score =   124 bits (311),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 91/208 (44%), Positives = 113/208 (54%), Gaps = 22/208 (11%)
 Frame = +2

Query  236  EFFLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAE-QGPLASQVPFTTAR  412
            + FL +CG  S      GR+W  +      +P+N A  S  + A  QG    QVP+ TAR
Sbjct  48   DIFLFNCGETSNQMDISGRNWMAEQP--NILPSNAAIASFVSHASFQGSGVPQVPYMTAR  105

Query  413  VFTSELTYSFRVSPGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYTLLKNFS  592
            +F  + TYSF VSPG KFLRLYFYP  YS+            + +F+VT N +TLLKNF 
Sbjct  106  IFRHDFTYSFPVSPGWKFLRLYFYPTRYSSDLEAA------VNSYFSVTVNGFTLLKNFR  159

Query  593  AFLTvsspdpfvfspdpfIKKEFIVNVDDK-QQLNLTFSPS--PYAFVNGIEIVSMPSDL  763
            A LT         S D  I KEFIV V      LNLTFSPS    AFVNGIEIVSMP   
Sbjct  160  ADLT------AKASHDASIFKEFIVPVSSGYTMLNLTFSPSLNMLAFVNGIEIVSMPDRF  213

Query  764  YFRG--DNNNYPIISAVHFD--NSTTME  835
            Y +G  D+    + +++ F+  NST  E
Sbjct  214  YSKGGFDDKIKQVGNSIDFEINNSTAFE  241



>ref|XP_010431249.1| PREDICTED: receptor-like protein kinase FERONIA [Camelina sativa]
Length=490

 Score =   122 bits (305),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 88/207 (43%), Positives = 113/207 (55%), Gaps = 24/207 (12%)
 Frame = +2

Query  236  EFFLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARV  415
            E  LL+CG  S     D R W +D         +    +SPA+  Q P   +VP+ TARV
Sbjct  34   EKILLNCGGASDLVDTDNRTWISDVKSKFLSSPSGDSKTSPALT-QDPSVPEVPYMTARV  92

Query  416  FTSELTYSFRVSPGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYTLLKNFSA  595
            F S  TY+F V+ G+KF+RLYFYP +Y +         N T+  F+V++  YTLLKNFSA
Sbjct  93   FRSPFTYTFPVASGRKFVRLYFYPNSYDS--------LNATNSLFSVSSGPYTLLKNFSA  144

Query  596  FLTvsspdpfvfspdpfIKKEFIVNVDDKQQLNLTFSP--SP---YAFVNGIEIVSMPSD  760
              T             FI KEF+VNV+    LN+TF+P  SP   YAFVNGIE+ SMP D
Sbjct  145  AQT------AEALTYAFIVKEFVVNVEGG-TLNMTFTPETSPANAYAFVNGIEVTSMP-D  196

Query  761  LYFRGDNNNYPIIS--AVHFDNSTTME  835
            +Y   D     + S  AV  DNST +E
Sbjct  197  IYSSTDGTLSMVGSSGAVTIDNSTALE  223



>emb|CDO99857.1| unnamed protein product [Coffea canephora]
Length=1301

 Score =   125 bits (313),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 83/211 (39%), Positives = 116/211 (55%), Gaps = 34/211 (16%)
 Frame = +2

Query  248  LSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPL-ASQVPFTTARVFTS  424
            ++CG    ST+ DGR+W  D   L+F+       S  + A + P     VP+ T+RV  +
Sbjct  76   INCGFNGNSTALDGREWIGDAP-LKFLSGK----SRISTAAEKPFPIDPVPYKTSRVSAT  130

Query  425  ELTYSFRVSPGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYTLLKNFSAFLT  604
            E  YSF VSPGQKF+RL+ YPA+Y        R F  +  FFTV A  +TLL++FSA +T
Sbjct  131  EFGYSFEVSPGQKFIRLHLYPASY--------RGFENSIDFFTVKAGPFTLLRDFSASIT  182

Query  605  vsspdpfvfspdpfIKKEFIVNVDDKQQLNLTFSP---------SPYAFVNGIEIVSMPS  757
                     S   ++ KEF +NV++  +LN+TFSP         S +AFVNGIEI+SMP+
Sbjct  183  ------AETSGVKYLIKEFCLNVEENTKLNITFSPSLNLNSKSKSTHAFVNGIEIISMPA  236

Query  758  DLYFRGDNNNYPIISAVH-----FDNSTTME  835
             LY+  D ++   I          DNST +E
Sbjct  237  GLYYTSDRDSGAAIVGQKNRFFSIDNSTALE  267



>ref|XP_009139815.1| PREDICTED: putative receptor-like protein kinase At5g39000 isoform 
X1 [Brassica rapa]
Length=885

 Score =   124 bits (311),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 89/208 (43%), Positives = 114/208 (55%), Gaps = 22/208 (11%)
 Frame = +2

Query  236  EFFLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAE-QGPLASQVPFTTAR  412
            + FL +CG  S      GR+W  +     F+P+N A  S  + A  QG   S+VP+ TAR
Sbjct  30   DVFLFNCGETSDQMDISGRNWMAEQP--NFLPSNAANASFVSHASFQGSGVSKVPYMTAR  87

Query  413  VFTSELTYSFRVSPGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYTLLKNFS  592
            +F  + TY F VSPG KFLRLYFYP  YS+            + +F+V  N +TLLKNFS
Sbjct  88   IFRHDFTYRFPVSPGWKFLRLYFYPTRYSSDLDAA------VNSYFSVIVNGFTLLKNFS  141

Query  593  AFLTvsspdpfvfspdpfIKKEFIVNVDDKQ-QLNLTFSPS--PYAFVNGIEIVSMPSDL  763
            A LT         S   FI KEFIV V      LNLTF+PS    AFVNG+EIVSMP   
Sbjct  142  ADLT------AKASNGAFIFKEFIVPVSSGHTMLNLTFTPSLNMLAFVNGVEIVSMPDRF  195

Query  764  YFRG--DNNNYPIISAVHFD--NSTTME  835
            Y +G  D+    + +++ F+  NST  E
Sbjct  196  YSKGGFDDKIAQVGNSIDFEINNSTAFE  223



>ref|XP_010553161.1| PREDICTED: receptor-like protein kinase FERONIA [Tarenaya hassleriana]
Length=852

 Score =   124 bits (311),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 89/202 (44%), Positives = 109/202 (54%), Gaps = 26/202 (13%)
 Frame = +2

Query  248  LSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPA-IAEQGPLASQVPFTTARVFTS  424
            LSCG  S+ T  D R W  D +     P +    S PA  A Q P   QVPF TAR+F S
Sbjct  43   LSCGESSQRTDSDQRQWIPDVNSKFLSPGS----SKPAKAATQDPGVPQVPFMTARIFHS  98

Query  425  ELTYSFRVSPGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYTLLKNFSAFLT  604
              TYSF V PG+KFLRLYFY  +Y A         N TD  F+V++  Y LL NFS   T
Sbjct  99   AFTYSFPVEPGRKFLRLYFYANSYDA--------LNATDALFSVSSGPYQLLHNFSVSQT  150

Query  605  vsspdpfvfspdpfIKKEFIVNVDDKQQLNLTFSPSP---YAFVNGIEIVSMPSDLY--F  769
                         +I KE+++NVDD   LN+TF P+    +AFVNGIEIVSMP D+Y   
Sbjct  151  ------SEALSYAYITKEYVLNVDDG-PLNVTFLPAAAASFAFVNGIEIVSMP-DIYRNI  202

Query  770  RGDNNNYPIISAVHFDNSTTME  835
            RG+       +A   DNST +E
Sbjct  203  RGNLMVVGSSTAFTIDNSTALE  224



>ref|XP_012068359.1| PREDICTED: receptor-like protein kinase FERONIA [Jatropha curcas]
Length=816

 Score =   124 bits (310),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 82/191 (43%), Positives = 110/191 (58%), Gaps = 23/191 (12%)
 Frame = +2

Query  248  LSCGAPSKSTSQ-DGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARVFTS  424
            L CG+    TS  DGR+W  D  ++    TN+   S  +  E G    QVP+ TAR+F S
Sbjct  37   LDCGSSGLHTSSFDGRNWTNDATFISQSQTNSTATSMVSSIEPG--VPQVPYKTARLFFS  94

Query  425  ELTYSFRVSPGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYTLLKNFSAFLT  604
            E TY+F ++PG KFLRL+FYP +Y          F+ +  F +VT  ++TLL NFSA L 
Sbjct  95   EFTYTFNLTPGPKFLRLHFYPTSYPG--------FDASKAFLSVTGGDHTLLSNFSASLA  146

Query  605  vsspdpfvfspdpfIKKEFIVNVDDKQQLNLTFSPS-----PYAFVNGIEIVSMPSDLYF  769
             +  + +VF       KEFIV+V +   L LTFSPS      +AFVNGIE+VSMP +LY 
Sbjct  147  ANYKNVYVFF------KEFIVHVQN-HSLRLTFSPSSNASDAFAFVNGIELVSMPLNLYI  199

Query  770  RGDNNNYPIIS  802
            RG+N   P + 
Sbjct  200  RGENVPLPFVG  210



>ref|XP_007151356.1| hypothetical protein PHAVU_004G039600g [Phaseolus vulgaris]
 gb|ESW23350.1| hypothetical protein PHAVU_004G039600g [Phaseolus vulgaris]
Length=865

 Score =   124 bits (310),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 75/183 (41%), Positives = 109/183 (60%), Gaps = 19/183 (10%)
 Frame = +2

Query  236  EFFLLSCGAPSKSTSQDGRDW--DTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTA  409
            + F +SCG   KS S   R W  D D  YL F   + +E ++     Q P  +Q+P++TA
Sbjct  24   DIFTISCGTTGKS-SDAQRRWTGDEDTKYLSFKEGSVSEKAT----RQSPSTNQIPYSTA  78

Query  410  RVFTSELTYSFRVSPGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYTLLKNF  589
            R+  S+  YSF VSPG KFLRL+FYP++Y +        F ++   FTV +N +TLL  F
Sbjct  79   RLSRSQFNYSFPVSPGPKFLRLFFYPSDYPS--------FPRSHASFTVQSNQFTLLNAF  130

Query  590  SAFLTvsspdpfvfspdpfIKKEFIVNVDDKQQLNLTFSPS---PYAFVNGIEIVSMPSD  760
            +A L  +            I +E++VNV+D ++L LTF+PS    YAF+NGIE++SMP+D
Sbjct  131  NASL-HADAQVADAQAADTIFREYVVNVNDSERLVLTFTPSYPNSYAFINGIEVLSMPTD  189

Query  761  LYF  769
            LY+
Sbjct  190  LYY  192



>ref|XP_012067824.1| PREDICTED: receptor-like protein kinase FERONIA [Jatropha curcas]
Length=811

 Score =   124 bits (310),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 81/191 (42%), Positives = 108/191 (57%), Gaps = 23/191 (12%)
 Frame = +2

Query  248  LSCGAPSKSTSQ-DGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARVFTS  424
            L CG+    TS  DGR+W  D  ++    TN+   S   I+   P   QVP+ TAR+F S
Sbjct  37   LDCGSSGLHTSSFDGRNWTNDATFISQSQTNSTATS--IISSIDPGVPQVPYKTARLFFS  94

Query  425  ELTYSFRVSPGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYTLLKNFSAFLT  604
            E T +F ++PG KFLRL+FYP +Y          F+ +  F +VT  N+TLL NFSA L 
Sbjct  95   EFTCTFNLTPGHKFLRLHFYPTSYPG--------FDASKAFISVTGGNHTLLSNFSASLA  146

Query  605  vsspdpfvfspdpfIKKEFIVNVDDKQQLNLTFSPS-----PYAFVNGIEIVSMPSDLYF  769
             +  + + F       KEFIV+V +   L LTFSPS      +AFVNGIE+VSMP +LY 
Sbjct  147  ANYKNVYAFF------KEFIVHVQN-HSLRLTFSPSSNASDAFAFVNGIELVSMPLNLYI  199

Query  770  RGDNNNYPIIS  802
            RG+N   P + 
Sbjct  200  RGENVPLPFVG  210



>ref|XP_008230906.1| PREDICTED: receptor-like protein kinase FERONIA [Prunus mume]
Length=877

 Score =   124 bits (310),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 76/186 (41%), Positives = 107/186 (58%), Gaps = 20/186 (11%)
 Frame = +2

Query  248  LSCG-APSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARVFTS  424
            L CG +  +    D R W  D +  +F P       SP+I+ Q P +S VP++TAR+  S
Sbjct  51   LQCGFSGEQLNPADTRTWTGDINS-KFYPFENQAAGSPSISRQAPSSSSVPYSTARLSRS  109

Query  425  ELTYSFRVSPGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYTLLKNFSAFLT  604
            E TY F V+ GQKF+RLYF  A+Y       G  F+++   F+V A  +TLLK+F+A +T
Sbjct  110  EFTYRFPVTTGQKFIRLYFNAASY-------GPDFDRSKALFSVKAGGFTLLKDFNASVT  162

Query  605  vsspdpfvfspdpfIKKEFIVNVDDKQQLNLTFSPS-----PYAFVNGIEIVSMPSDLYF  769
                     S    I +EF +NV+ +Q LN+TF PS      YAF+NGIEIVSMP++LY+
Sbjct  163  ------ADASRSDTIYREFCLNVESEQSLNITFKPSGATSDAYAFINGIEIVSMPNNLYY  216

Query  770  RGDNNN  787
                N+
Sbjct  217  TSAQNS  222



>dbj|BAK00988.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=507

 Score =   121 bits (303),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 74/174 (43%), Positives = 100/174 (57%), Gaps = 20/174 (11%)
 Frame = +2

Query  248  LSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARVFTSE  427
            LSCGAP+ +T  DGR WD D+   +F+P+  A +++ A  +   L S VP+ TARVF S 
Sbjct  39   LSCGAPASATDSDGRAWDGDSAS-KFLPSTNAGVAARASYQDPSLPSSVPYVTARVFASS  97

Query  428  LTYSFRVSPGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYTLLKNFSAFLTv  607
             TY+F + PG+ FLRLYFYPA+Y   +  G          F VTA   TLL++F+A  T 
Sbjct  98   HTYTFPLRPGRVFLRLYFYPADYGNHSAYGA--------LFGVTAGGVTLLRDFNASQT-  148

Query  608  sspdpfvfspdpfIKKEFIVNVDDKQQLNLTFSPSP-----YAFVNGIEIVSMP  754
                  +     ++ +EF VNV    +L +TF+PS      YAFVNGIEIV  P
Sbjct  149  -----ALALDAAYLVREFSVNVSSSGRLEVTFAPSSGASSHYAFVNGIEIVPTP  197



>gb|KEH25126.1| feronia receptor-like kinase [Medicago truncatula]
Length=900

 Score =   123 bits (309),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 78/186 (42%), Positives = 106/186 (57%), Gaps = 21/186 (11%)
 Frame = +2

Query  236  EFFLLSCGAPSKSTSQDG-RDW--DTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTT  406
            E F +SCGA   ST  DG R W  D ++  L  +  N   +S P    Q P +++VP++T
Sbjct  31   EHFTVSCGATGNST--DGQRTWTGDINSKLLSSLQNNPTTISVPKTT-QNPSSNKVPYST  87

Query  407  ARVFTSELTYSFRVSPGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYTLLKN  586
            AR+  S   YS  VS G KFLRL+FYP  Y+         FN+ D  FTV +N +TLLK+
Sbjct  88   ARLSHSIFNYSLPVSKGPKFLRLFFYPTTYTNG-------FNRYDASFTVISNGFTLLKD  140

Query  587  FSAFLTvsspdpfvfspdpfIKKEFIVNVDDKQQLNLTFSPS--PYAFVNGIEIVSMPSD  760
            F+A L               I KE+++NV D Q+L+L+F PS   Y F+NGIE++SMP D
Sbjct  141  FNASLN------ADVEGVVTILKEYVINVGDDQRLDLSFIPSNNNYGFINGIEVLSMPDD  194

Query  761  LYFRGD  778
            LY+  D
Sbjct  195  LYYTPD  200



>ref|XP_007032800.1| Malectin/receptor-like protein kinase family protein, putative 
[Theobroma cacao]
 gb|EOY03726.1| Malectin/receptor-like protein kinase family protein, putative 
[Theobroma cacao]
Length=895

 Score =   123 bits (309),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 76/185 (41%), Positives = 103/185 (56%), Gaps = 24/185 (13%)
 Frame = +2

Query  248  LSCGAPSKSTSQDGRDWDTDN----HYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARV  415
            L+CG  + S   DG +W  D+     ++    +N   + S +I  +  +   VPF TAR+
Sbjct  42   LNCGTSTNSIRLDGHEWTGDSGTGSKFIASEQSNDTSIVSKSIKLESSI-DPVPFRTARI  100

Query  416  FTSELTYSFRVSPGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYTLLKNFSA  595
            F S  TYSFRV P QKFLRLYF P  Y        + F ++  FF+VTA  +TLL NFS 
Sbjct  101  FQSPFTYSFRVRPRQKFLRLYFNPRTY--------QEFPRSTAFFSVTAGPFTLLSNFSP  152

Query  596  FLTvsspdpfvfspdpfIKKEFIVNVDDKQQLNLTFSPS-----PYAFVNGIEIVSMPSD  760
             LT              + KEF +N+++ Q LN+TFSPS      YAF+N IEIVSMP++
Sbjct  153  SLT------ADSLGLQTLVKEFCLNIEENQVLNITFSPSSTPLGAYAFINAIEIVSMPTN  206

Query  761  LYFRG  775
            LY+ G
Sbjct  207  LYYGG  211



>gb|KDP37883.1| hypothetical protein JCGZ_05765 [Jatropha curcas]
Length=441

 Score =   120 bits (302),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 81/207 (39%), Positives = 110/207 (53%), Gaps = 24/207 (12%)
 Frame = +2

Query  236  EFFLLSCGAPSKSTSQ-DGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTAR  412
            E   L CG+P   T   DGR+W +D  ++    +  A +   +  E G    QVP+ TAR
Sbjct  15   ENIALDCGSPDLRTLPFDGRNWTSDASFISQSKSTVAPIMVSSSIEPG--VPQVPYKTAR  72

Query  413  VFTSELTYSFRVSPGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYTLLKNFS  592
            +F SE TY+F ++PG KFLRL+FYP +Y          F+ +  F +V   N+TLL NFS
Sbjct  73   LFFSEFTYTFNLTPGPKFLRLHFYPTSYPG--------FDASKEFLSVMEGNHTLLSNFS  124

Query  593  AFLTvsspdpfvfspdpfIKKEFIVNVDDKQQLNLTFSPS---PYAFVNGIEIVSMPSDL  763
            A L               + KEFIV V +   L LTFSPS    +AFVNGIE+VSMP +L
Sbjct  125  ASLA------ANCKNVTTLIKEFIVAVQN-HSLRLTFSPSSSDAFAFVNGIELVSMPLNL  177

Query  764  YFRGDNNNYPIIS---AVHFDNSTTME  835
            Y RG+N   P +     +  D++   E
Sbjct  178  YKRGENFPLPFVGYSQVIRLDSTYVFE  204



>ref|XP_012072597.1| PREDICTED: receptor-like protein kinase FERONIA [Jatropha curcas]
Length=453

 Score =   120 bits (302),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 80/203 (39%), Positives = 109/203 (54%), Gaps = 24/203 (12%)
 Frame = +2

Query  248  LSCGAPSKSTSQ-DGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARVFTS  424
            L CG+P   T   DGR+W +D  ++    +  A +   +  E G    QVP+ TAR+F S
Sbjct  31   LDCGSPDLRTLPFDGRNWTSDASFISQSKSTVAPIMVSSSIEPG--VPQVPYKTARLFFS  88

Query  425  ELTYSFRVSPGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYTLLKNFSAFLT  604
            E TY+F ++PG KFLRL+FYP +Y          F+ +  F +V   N+TLL NFSA L 
Sbjct  89   EFTYTFNLTPGPKFLRLHFYPTSYPG--------FDASKEFLSVMEGNHTLLSNFSASLA  140

Query  605  vsspdpfvfspdpfIKKEFIVNVDDKQQLNLTFSPS---PYAFVNGIEIVSMPSDLYFRG  775
                          + KEFIV V +   L LTFSPS    +AFVNGIE+VSMP +LY RG
Sbjct  141  ------ANCKNVTTLIKEFIVAVQN-HSLRLTFSPSSSDAFAFVNGIELVSMPLNLYKRG  193

Query  776  DNNNYPIIS---AVHFDNSTTME  835
            +N   P +     +  D++   E
Sbjct  194  ENFPLPFVGYSQVIRLDSTYVFE  216



>ref|XP_011016728.1| PREDICTED: receptor-like protein kinase FERONIA [Populus euphratica]
Length=893

 Score =   123 bits (309),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 85/208 (41%), Positives = 110/208 (53%), Gaps = 28/208 (13%)
 Frame = +2

Query  236  EFFLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARV  415
            E  LL CGA S     DGRDW +D        +  +  +    + Q P   QVP+ TAR+
Sbjct  31   EKILLDCGANSDQPDSDGRDWTSDRGSSFLSSSANSSTA--TASTQDPSVPQVPYLTARI  88

Query  416  FTSELTYSFRVSPGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYTLLKNFSA  595
            F S  TYSF V  G+KF+RLYFYP++YS          N ++  F+VT+ +YTLL NFS 
Sbjct  89   FRSNFTYSFPVVSGRKFIRLYFYPSSYSG--------LNASNALFSVTSGSYTLLSNFSV  140

Query  596  FLTvsspdpfvfspdpfIKKEFIVNVDDKQQLNLTFSP-----SPYAFVNGIEIVSMPSD  760
              T              I KE++V+VD    LN+TFSP     S YAFVNGIEIVSMP D
Sbjct  141  AQT------AEALNYVSIMKEYLVSVDG-DTLNITFSPSSNPTSAYAFVNGIEIVSMP-D  192

Query  761  LYFRGDNNNYPIISAVH---FDNSTTME  835
            +Y   D     I+  +     DN+T +E
Sbjct  193  IYSNVD--GVMIVGQLAPFTIDNTTALE  218



>ref|XP_012068357.1| PREDICTED: receptor-like protein kinase FERONIA [Jatropha curcas]
 gb|KDP41347.1| hypothetical protein JCGZ_15754 [Jatropha curcas]
Length=478

 Score =   120 bits (302),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 78/206 (38%), Positives = 114/206 (55%), Gaps = 29/206 (14%)
 Frame = +2

Query  248  LSCGAPS-KSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARVFTS  424
            L CG+   ++ S DGR+W +D  ++    + +   ++  ++   P   QVP+ TAR+F S
Sbjct  37   LDCGSFDFQTLSFDGRNWTSDGTFI----SQSNSTAASIVSSIDPGVPQVPYKTARLFFS  92

Query  425  ELTYSFRVSPGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYTLLKNFSAFLT  604
            E TY+F ++PG KFL L+FYP +Y          F+ +  F +VT  N+TLL NFSA L 
Sbjct  93   EFTYNFNLTPGPKFLSLHFYPTSYPG--------FDASKAFLSVTEGNHTLLSNFSASLA  144

Query  605  vsspdpfvfspdpfIKKEFIVNVDDKQQLNLTFSPS-----PYAFVNGIEIVSMPSDLYF  769
                    +       KEFIV+V +   L LTFSPS      +AFVNGIE+VSMP +LY 
Sbjct  145  ------ANYKDVYAFSKEFIVHVKN-HSLRLTFSPSSNASDAFAFVNGIEVVSMPRNLYV  197

Query  770  RGDNNNYPII----SAVHFDNSTTME  835
            RG+N   P +    + +  DN+  +E
Sbjct  198  RGENVPLPFVGYLYNPIRLDNTYALE  223



>ref|NP_198718.1| putative receptor-like protein kinase [Arabidopsis thaliana]
 sp|Q9FID6.1|Y5392_ARATH RecName: Full=Probable receptor-like protein kinase At5g39020; 
Flags: Precursor [Arabidopsis thaliana]
 dbj|BAB10826.1| receptor protein kinase-like protein [Arabidopsis thaliana]
 gb|AED94387.1| putative receptor-like protein kinase [Arabidopsis thaliana]
Length=813

 Score =   123 bits (308),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 85/207 (41%), Positives = 111/207 (54%), Gaps = 22/207 (11%)
 Frame = +2

Query  236  EFFLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAE-QGPLASQVPFTTAR  412
            + FL +CG  S +    GR+W  ++   Q + +N    S  + A  Q    S++P+  AR
Sbjct  27   DVFLFNCGDTSNNVDNSGRNWTVESR--QILSSNLVNASFTSEASYQKAGVSRIPYMKAR  84

Query  413  VFTSELTYSFRVSPGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYTLLKNFS  592
            +F SE TYSF V+PG  FLRLYFYP  Y +        F+  + FF+V  N +TLL+NF+
Sbjct  85   IFRSEFTYSFPVTPGSIFLRLYFYPTQYKSG-------FDAVNSFFSVKVNGFTLLRNFN  137

Query  593  AFLTvsspdpfvfspdpfIKKEFIVNVDDKQQLNLTFSPSP--YAFVNGIEIVSMPSDLY  766
            A  T              + KEFI+ V   Q LNLTF+PS    AFVNGIEIVSMP   Y
Sbjct  138  ADST----VQASIPLSNSLIKEFIIPV--HQTLNLTFTPSKNLLAFVNGIEIVSMPDRFY  191

Query  767  FRG--DNNNYPIISAVHF--DNSTTME  835
             +G  DN    + S V F  DNST  E
Sbjct  192  SKGGFDNVLRNVSSDVDFQIDNSTAFE  218



>emb|CDO99867.1| unnamed protein product [Coffea canephora]
Length=1444

 Score =   124 bits (310),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 81/211 (38%), Positives = 119/211 (56%), Gaps = 30/211 (14%)
 Frame = +2

Query  248   LSCGAPSKSTSQDGRDWDTDNHYLQFMPT---NTAELSSPAIAEQGPLASQVPFTTARVF  418
             ++CG+   S + DGR+W  +    +FMP+        SS A+         VP+TTAR+ 
Sbjct  847   INCGSVGNSAALDGREWIGEASS-KFMPSLQPRGKSRSSTALQVSSLSVDPVPYTTARIS  905

Query  419   TSELTYSFRVSPGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYTLLKNFSAF  598
              +   Y+F+VSPGQKF+RL+FYPA+Y        R F K+  FFTV A  +TLL++FSA 
Sbjct  906   ATPFYYTFQVSPGQKFIRLHFYPASY--------RGFEKSMDFFTVKAGPFTLLRDFSA-  956

Query  599   LTvsspdpfvfspdpfIKKEFIVNVDDKQQLNLTFSPS-------PYAFVNGIEIVSMPS  757
                        S   ++ KEF VNV++ ++LN+ FSPS        YAFVNGIE++S+P+
Sbjct  957   -----SYAADTSSVKYLVKEFCVNVEENRELNIVFSPSLSSKSRNTYAFVNGIELISIPT  1011

Query  758   DLYFRGDNN-NYPIISAVH----FDNSTTME  835
              LY   D +    I++ ++     DNST +E
Sbjct  1012  GLYHTPDGDLGARIVNLMNRFHVIDNSTALE  1042


 Score = 99.4 bits (246),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 62/156 (40%), Positives = 90/156 (58%), Gaps = 26/156 (17%)
 Frame = +2

Query  407  ARVFTSELTYSFRVSPGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYTLLKN  586
            +R+  +   Y+F+VSPGQK +RL+FYPA+Y        R F  +   F+V A  +TLL++
Sbjct  3    SRISATPFHYTFQVSPGQKIIRLHFYPASY--------RGFENSFDLFSVKAGLFTLLED  54

Query  587  FSAFLTvsspdpfvfspdpfIKKEFIVNVDDKQQLNLTFSPS--------PYAFVNGIEI  742
            FS  LT              I KEF +NV++ ++L+++FSPS        PYAFVNGIEI
Sbjct  55   FSPSLT-----ADGSGEKYIIVKEFCLNVEENKKLSISFSPSLITESKDNPYAFVNGIEI  109

Query  743  VSMPSDLYFRGDNN-NYPIISAVH----FDNSTTME  835
            +SMP+ LY+  D +   PI+   +     DNST +E
Sbjct  110  ISMPAGLYYTPDGDLGAPIVGQKNRFYSVDNSTALE  145



>ref|XP_010667956.1| PREDICTED: receptor-like protein kinase FERONIA [Beta vulgaris 
subsp. vulgaris]
Length=412

 Score =   120 bits (300),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 85/200 (43%), Positives = 111/200 (56%), Gaps = 20/200 (10%)
 Frame = +2

Query  245  LLSCGA-PSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARVFT  421
            LL+CG+  +K+T  DGR+W +DN   +F+ ++     + A  E  P    +P+ +AR+F 
Sbjct  30   LLNCGSFDAKTTDSDGRNWTSDNGS-KFLQSSKGSFRASATTE-APDVGNIPYMSARIFH  87

Query  422  SELTYSFRVSPGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYTLLKNFSAFL  601
            S  TYSF VSPG+ FLRLYFYP  YS        R N  +  F+VTA  YTLL+NF+A  
Sbjct  88   SNATYSFPVSPGRIFLRLYFYPNVYS--------RSNSANAVFSVTAGPYTLLRNFNASQ  139

Query  602  TvsspdpfvfspdpfIKKEFIVNVDDKQQLNLTFSPSP--YAFVNGIEIVSMPSDLYFRG  775
            T             FI KE+ +NV D   L +TF PSP  +AFVNGIE+VSMPS      
Sbjct  140  T------AKKLDAHFIIKEYSINV-DGGVLTITFIPSPKSFAFVNGIEVVSMPSIYDNDV  192

Query  776  DNNNYPIISAVHFDNSTTME  835
              N     S    DNST +E
Sbjct  193  GANIVGTSSPFQIDNSTALE  212



>ref|XP_007033491.1| Malectin/receptor-like protein kinase family protein [Theobroma 
cacao]
 gb|EOY04417.1| Malectin/receptor-like protein kinase family protein [Theobroma 
cacao]
Length=892

 Score =   123 bits (308),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 90/212 (42%), Positives = 110/212 (52%), Gaps = 35/212 (17%)
 Frame = +2

Query  236  EFFLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARV  415
            E  LL+CG  S+ T  D R W  D      +   T  + S A A Q P   +VP+ TARV
Sbjct  33   EKILLNCGEKSELTDDDNRKWTPDVGSKFLVGGGTNSVPSQA-ATQDPAVPEVPYLTARV  91

Query  416  FTSELTYSFRVSPGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYTLLKNFSA  595
            F S  TYSF V  G+KF+RLYF+  +Y           N T+  F+VT  +YTLLKNFSA
Sbjct  92   FLSNFTYSFPVVAGRKFVRLYFHANSYDGQ--------NATNALFSVTCGSYTLLKNFSA  143

Query  596  FLTvsspdpfvfspdpfIKKEFIVNVDDKQQLNLTFSPS-----PYAFVNGIEIVSMPSD  760
              T             FI KE+ +NVD    LNLTFSPS      YAFVNGIE++SMP D
Sbjct  144  AQT------SEALNYAFIIKEYSINVDG-DHLNLTFSPSSTPSNAYAFVNGIEVLSMP-D  195

Query  761  LY-------FRGDNNNYPIISAVHFDNSTTME  835
            +Y         G NN + I      DNST +E
Sbjct  196  IYSNTDGITIVGQNNQFTI------DNSTALE  221



>ref|XP_010426729.1| PREDICTED: receptor-like protein kinase FERONIA [Camelina sativa]
Length=894

 Score =   122 bits (307),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 88/207 (43%), Positives = 113/207 (55%), Gaps = 24/207 (12%)
 Frame = +2

Query  236  EFFLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARV  415
            E  LL+CG  S     D R W +D         +    +SPA+  Q P   +VP+ TARV
Sbjct  34   EKILLNCGGASDLVDTDNRTWISDVKSKFLSSPSGDSKTSPALT-QDPSVPEVPYMTARV  92

Query  416  FTSELTYSFRVSPGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYTLLKNFSA  595
            F S  TY+F V+ G+KF+RLYFYP +Y +         N T+  F+V++  YTLLKNFSA
Sbjct  93   FRSPFTYTFPVASGRKFVRLYFYPNSYDS--------LNATNSLFSVSSGPYTLLKNFSA  144

Query  596  FLTvsspdpfvfspdpfIKKEFIVNVDDKQQLNLTFSP--SP---YAFVNGIEIVSMPSD  760
              T             FI KEF+VNV+    LN+TF+P  SP   YAFVNGIE+ SMP D
Sbjct  145  AQT------AEALTYAFIVKEFVVNVEGG-TLNMTFTPETSPANAYAFVNGIEVTSMP-D  196

Query  761  LYFRGDNNNYPIIS--AVHFDNSTTME  835
            +Y   D     + S  AV  DNST +E
Sbjct  197  IYSSTDGTLSMVGSSGAVTIDNSTALE  223



>gb|EMT01093.1| hypothetical protein F775_16963 [Aegilops tauschii]
Length=509

 Score =   120 bits (301),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 72/174 (41%), Positives = 101/174 (58%), Gaps = 20/174 (11%)
 Frame = +2

Query  248  LSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARVFTSE  427
            LSCG+ + +T  DGR WD D+  + F+P+  A +++ A  +   L S VP+ TARVF S 
Sbjct  41   LSCGSSASATDSDGRAWDGDSASM-FLPSTNAGVAARASYQDPSLPSTVPYMTARVFASS  99

Query  428  LTYSFRVSPGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYTLLKNFSAFLTv  607
             TY+F V PG+ FLRLYFYPA+Y   +  G          F VTA   TLL++F+A  T 
Sbjct  100  HTYTFLVRPGRVFLRLYFYPADYGNRSASGA--------LFGVTAGGVTLLQDFNASQT-  150

Query  608  sspdpfvfspdpfIKKEFIVNVDDKQQLNLTFSPSP-----YAFVNGIEIVSMP  754
                  +     ++ +EF +NV+   +L +TF+PSP     YAFVNGIEI+  P
Sbjct  151  -----ALALDAAYLVREFSLNVNSSGRLEVTFAPSPGASSHYAFVNGIEILPTP  199



>ref|XP_008341792.1| PREDICTED: receptor-like protein kinase FERONIA [Malus domestica]
Length=892

 Score =   122 bits (306),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 75/182 (41%), Positives = 108/182 (59%), Gaps = 23/182 (13%)
 Frame = +2

Query  248  LSCG-APSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPL--ASQVPFTTARVF  418
            L CG +  +   QDGR W  D +  +F P   A  SS   A   P+  +SQVP+TTAR+ 
Sbjct  37   LQCGFSGDQVNQQDGRTWSGDINS-KFSPFQAAGSSSVYKAAT-PIXSSSQVPYTTARLS  94

Query  419  TSELTYSFRVSPGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYTLLKNFSAF  598
             SE TY+F ++ GQKF+RLYFYP +Y+A        F+++   F+V A  +TLL++F+A 
Sbjct  95   RSEFTYTFPLTSGQKFIRLYFYPTSYAA-------EFDRSKSLFSVEAGGFTLLRDFNAS  147

Query  599  LTvsspdpfvfspdpfIKKEFIVNVDDKQQLNLTFSPS-----PYAFVNGIEIVSMPSDL  763
            +T              + +EF +N+  +Q LN+TF+PS      YAF+NGIEIVSMP +L
Sbjct  148  VT------ADAFSSETVSREFCLNIASEQSLNITFTPSRASPDAYAFINGIEIVSMPDNL  201

Query  764  YF  769
            Y+
Sbjct  202  YY  203



>ref|XP_010683454.1| PREDICTED: receptor-like protein kinase FERONIA [Beta vulgaris 
subsp. vulgaris]
Length=881

 Score =   122 bits (306),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 90/208 (43%), Positives = 119/208 (57%), Gaps = 31/208 (15%)
 Frame = +2

Query  242  FLLSCGAPSK-STSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARVF  418
             LL+CGA  + ST  DGR+W++D+   +FM T T   S    A Q P   +VP+ TAR+F
Sbjct  29   ILLNCGASDRQSTDVDGRNWNSDDGS-KFMST-TRGSSMATAATQAPDVGEVPYMTARIF  86

Query  419  TSELTYSFRVSPGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYTLLKNFSAF  598
             S  TYS  V+PG+KFLRLYFYP  YS      GR  N T+  F+VTA  +TLL NFSA 
Sbjct  87   DSNFTYSIAVAPGRKFLRLYFYPNTYS------GR--NSTNGIFSVTAGPFTLLSNFSAA  138

Query  599  LTvsspdpfvfspdpfIKKEFIVNVDDKQQLNLTFSPS-----PYAFVNGIEIVSMPSDL  763
             T             ++ KE+ ++V + + L+LTFSPS      +AFVNGIE+VSMP D+
Sbjct  139  QT------TEALNFDYLIKEYSLHV-EGETLSLTFSPSSNYSDSFAFVNGIEVVSMP-DI  190

Query  764  YFRGDNNNYPIISAVH----FDNSTTME  835
            Y   D+     +  V      DNST +E
Sbjct  191  Y---DSATGVTVVGVDSPFTIDNSTALE  215



>ref|XP_007217058.1| hypothetical protein PRUPE_ppa001157mg [Prunus persica]
 gb|EMJ18257.1| hypothetical protein PRUPE_ppa001157mg [Prunus persica]
Length=893

 Score =   122 bits (306),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 75/186 (40%), Positives = 107/186 (58%), Gaps = 20/186 (11%)
 Frame = +2

Query  248  LSCG-APSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARVFTS  424
            L CG +  +    D R W  D +  +F P        P+I+ Q P +S VP++TAR+  S
Sbjct  37   LQCGFSGDQLNPADTRTWTGDINS-KFSPFENQASGRPSISTQAPSSSSVPYSTARLSLS  95

Query  425  ELTYSFRVSPGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYTLLKNFSAFLT  604
            E TY F V+ GQKF+RLYF PA+Y       G  F+++   F+V A  +TLLK+F++ +T
Sbjct  96   EFTYRFPVTTGQKFIRLYFNPASY-------GPDFDRSKALFSVKAGGFTLLKDFNSSVT  148

Query  605  vsspdpfvfspdpfIKKEFIVNVDDKQQLNLTFSPS-----PYAFVNGIEIVSMPSDLYF  769
                     S    I +EF +NV+ +Q LN+TF PS      YAF+NGIEIVSMP++LY+
Sbjct  149  ------ADASESDTIYREFCLNVESEQSLNITFMPSRATADAYAFINGIEIVSMPNNLYY  202

Query  770  RGDNNN  787
                N+
Sbjct  203  TSAQNS  208



>ref|XP_008368476.1| PREDICTED: LOW QUALITY PROTEIN: receptor-like protein kinase 
FERONIA [Malus domestica]
Length=892

 Score =   122 bits (305),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 75/182 (41%), Positives = 108/182 (59%), Gaps = 23/182 (13%)
 Frame = +2

Query  248  LSCG-APSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPL--ASQVPFTTARVF  418
            L CG +  +   QDGR W  D +  +F P   A  SS   A   P+  +SQVP+TTAR+ 
Sbjct  37   LQCGFSGDQVNQQDGRTWSGDINS-KFSPFQAAGSSSVYKAAT-PIXSSSQVPYTTARLS  94

Query  419  TSELTYSFRVSPGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYTLLKNFSAF  598
             SE TY+F ++ GQKF+RLYFYP +Y+A        F+++   F+V A  +TLL++F+A 
Sbjct  95   RSEFTYTFPLTSGQKFIRLYFYPTSYAA-------EFDRSKSLFSVEAGGFTLLRDFNAS  147

Query  599  LTvsspdpfvfspdpfIKKEFIVNVDDKQQLNLTFSPS-----PYAFVNGIEIVSMPSDL  763
            +T              + +EF +N+  +Q LN+TF+PS      YAF+NGIEIVSMP +L
Sbjct  148  VT------ADAFXSETVSREFCLNIASEQSLNITFTPSRASPDAYAFINGIEIVSMPDNL  201

Query  764  YF  769
            Y+
Sbjct  202  YY  203



>ref|XP_010515573.1| PREDICTED: receptor-like protein kinase FERONIA [Camelina sativa]
Length=896

 Score =   122 bits (305),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 90/209 (43%), Positives = 117/209 (56%), Gaps = 28/209 (13%)
 Frame = +2

Query  236  EFFLLSCGAPSKSTSQDGRDW--DTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTA  409
            E  LL+CG  S     D R W  D  + +L   P+  ++ +SPA+  Q P   +VP+ TA
Sbjct  36   EKILLNCGGASDLDDADKRTWIPDVKSKFLS-SPSGDSK-TSPALT-QDPSVPEVPYMTA  92

Query  410  RVFTSELTYSFRVSPGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYTLLKNF  589
            RVF S  TY+F V+ G+KF+RLYFYP +Y           N T+  F+V++  YTLLKNF
Sbjct  93   RVFRSPFTYTFPVASGRKFVRLYFYPNSYDG--------LNATNSLFSVSSGPYTLLKNF  144

Query  590  SAFLTvsspdpfvfspdpfIKKEFIVNVDDKQQLNLTFSP--SP---YAFVNGIEIVSMP  754
            SA  T             FI KEF+VNV+    LN+TF+P  SP   YAFVNGIE+ SMP
Sbjct  145  SAAQT------AEALTYAFIVKEFVVNVEGG-TLNMTFTPETSPANAYAFVNGIEVTSMP  197

Query  755  SDLYFRGDNNNYPIIS--AVHFDNSTTME  835
             D+Y   D     + S  AV  DNST +E
Sbjct  198  -DIYSSTDGTLSMVGSSGAVTIDNSTALE  225



>ref|XP_010921184.1| PREDICTED: receptor-like protein kinase FERONIA [Elaeis guineensis]
Length=895

 Score =   122 bits (305),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 81/196 (41%), Positives = 106/196 (54%), Gaps = 29/196 (15%)
 Frame = +2

Query  242  FLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARVFT  421
             LL+CG    +   DGR W  D         N A +++     Q     QVP+ + RVFT
Sbjct  41   ILLNCGFSGTANDTDGRTWTGDAASKYAPSMNGAAVTA---TSQDSSVPQVPYLSGRVFT  97

Query  422  SELTYSFRVSPGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYTLLKNFSAFL  601
            S  TY+F +  G+KF+RLYFYP+NYS  A         +D FFTVTA++YTLL+NFSA+L
Sbjct  98   SPYTYTFPLGAGRKFIRLYFYPSNYSTHAA--------SDAFFTVTADSYTLLQNFSAYL  149

Query  602  TvsspdpfvfspdpfIKKEFIVNVDDKQQLNLTFSPS-----PYAFVNGIEIVSMPSDLY  766
            T             ++ +EF VNV     L LTF+PS      YAFVNGIEIVS+P D++
Sbjct  150  T------AGALNYAYLVREFSVNV-SSSGLKLTFTPSTDHHNSYAFVNGIEIVSIPDDIF  202

Query  767  ------FRGDNNNYPI  796
                    G N +Y I
Sbjct  203  TPVNALLVGTNTDYTI  218



>ref|XP_008341797.1| PREDICTED: receptor-like protein kinase FERONIA [Malus domestica]
Length=892

 Score =   122 bits (305),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 75/182 (41%), Positives = 108/182 (59%), Gaps = 23/182 (13%)
 Frame = +2

Query  248  LSCG-APSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPL--ASQVPFTTARVF  418
            L CG +  +   QDGR W  D +  +F P   A  SS   A   P+  +SQVP+TTAR+ 
Sbjct  37   LQCGFSGDQVNQQDGRTWSGDINS-KFSPFQAAGSSSVYKAAT-PIYSSSQVPYTTARLS  94

Query  419  TSELTYSFRVSPGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYTLLKNFSAF  598
             SE TY+F ++ GQKF+RLYFYP +Y+A        F+++   F+V A  +TLL++F+A 
Sbjct  95   RSEFTYTFPLTSGQKFIRLYFYPTSYAA-------EFDRSKSLFSVEAGGFTLLRDFNAS  147

Query  599  LTvsspdpfvfspdpfIKKEFIVNVDDKQQLNLTFSPS-----PYAFVNGIEIVSMPSDL  763
            +T              + +EF +N+  +Q LN+TF+PS      YAF+NGIEIVSMP +L
Sbjct  148  VT------ADAFXSETVSREFCLNIASEQSLNITFTPSRASPDAYAFINGIEIVSMPDNL  201

Query  764  YF  769
            Y+
Sbjct  202  YY  203



>emb|CDY33271.1| BnaA01g19380D [Brassica napus]
Length=856

 Score =   122 bits (305),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 87/205 (42%), Positives = 113/205 (55%), Gaps = 25/205 (12%)
 Frame = +2

Query  242  FLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARVFT  421
            FLL+CG  S     D R W  D    +F+ ++    +SPA A Q P    VP+ TAR+F 
Sbjct  34   FLLNCGGSSDLPDTDNRTWIPDVKS-KFLSSSADSKTSPA-ATQDPSVPDVPYMTARIFR  91

Query  422  SELTYSFRVSPGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYTLLKNFSAFL  601
            S  TYSF VS G+KF+RL+FYP +Y           N T+  F+V+  +YTLLKNFSA  
Sbjct  92   SPFTYSFPVSSGRKFVRLHFYPNSYDG--------LNATNSLFSVSLGSYTLLKNFSA--  141

Query  602  TvsspdpfvfspdpfIKKEFIVNVDDKQQLNLTFSP-----SPYAFVNGIEIVSMPSDLY  766
                          FI KEFIVNV+    LN+TF+P     + YA+VNGIE+ SMP DLY
Sbjct  142  ----AQMAQALTFSFIVKEFIVNVEGG-ALNVTFTPESTPSNAYAYVNGIEVTSMP-DLY  195

Query  767  FRGDNNNYPIISA--VHFDNSTTME  835
               D +   + S+  V  DNST +E
Sbjct  196  SSTDGSLTVVGSSGGVTIDNSTALE  220



>ref|XP_012084845.1| PREDICTED: receptor-like protein kinase FERONIA [Jatropha curcas]
Length=918

 Score =   122 bits (305),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 75/181 (41%), Positives = 107/181 (59%), Gaps = 23/181 (13%)
 Frame = +2

Query  248  LSCGAPSKSTSQDGRDW--DTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARVFT  421
            + CG+ S +T++  R W  DTD+ +    PTN A ++SPA ++      QVP+ TAR+  
Sbjct  65   IDCGSTSATTAEGDRIWTVDTDSKFSLLDPTN-ASITSPA-SKHPTSGDQVPYITARLSQ  122

Query  422  SELTYSFRVSPGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYTLLKNFSAFL  601
            S+ TY+  V+PG KF+ LYFYPA+Y +        F+    FF+V A  +TLL NFSA L
Sbjct  123  SDFTYTLPVTPGPKFILLYFYPASYVS--------FSSPTAFFSVNAGGFTLLSNFSAAL  174

Query  602  TvsspdpfvfspdpfIKKEFIVNVDDKQQLNLTFSPSP-----YAFVNGIEIVSMPSDLY  766
                             KEF +NV+D Q LN+TFSP+P     YAF+NG+EIVS+P++L 
Sbjct  175  ------YAQAHNFDSFVKEFSLNVEDGQMLNVTFSPAPSMTGAYAFINGLEIVSIPTNLL  228

Query  767  F  769
            +
Sbjct  229  Y  229



>ref|NP_198719.1| putative receptor-like protein kinase [Arabidopsis thaliana]
 sp|Q9FID5.1|Y5393_ARATH RecName: Full=Probable receptor-like protein kinase At5g39030; 
Flags: Precursor [Arabidopsis thaliana]
 dbj|BAB10827.1| receptor protein kinase-like protein [Arabidopsis thaliana]
 gb|AED94389.1| putative receptor-like protein kinase [Arabidopsis thaliana]
Length=806

 Score =   121 bits (304),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 85/206 (41%), Positives = 110/206 (53%), Gaps = 19/206 (9%)
 Frame = +2

Query  236  EFFLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARV  415
            + FL++CG         GR W  +   +    ++ A  SS    ++     QVP+ TAR+
Sbjct  25   DVFLINCGETDVPFDNHGRTWTQEEKNILPKNSDNASFSSVVSYKEESGIPQVPYMTARI  84

Query  416  FTSELTYSFRVSPGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYTLLKNFSA  595
            F S+ TYSF VSPG KFLRLYFYP +Y +        F+  + F +VT N++TLL+NFSA
Sbjct  85   FRSDFTYSFPVSPGWKFLRLYFYPTSYKSG-------FDAVNSFVSVTVNDFTLLQNFSA  137

Query  596  FLTvsspdpfvfspdpfIKKEFIVNVDDKQQLNLTFSPS--PYAFVNGIEIVSMPSDLYF  769
             LT              + KEFIV V     LNLTF PS    AFVNGIEIVSMP   Y 
Sbjct  138  DLT----VKASIPESKSLIKEFIVPV--YLTLNLTFRPSNNSLAFVNGIEIVSMPDRFYS  191

Query  770  RG--DNNNYPIISAVHF--DNSTTME  835
            +G  D+    + S + F  DNST  E
Sbjct  192  KGGFDDLITNVGSLIDFEIDNSTASE  217



>ref|XP_007153476.1| hypothetical protein PHAVU_003G038800g [Phaseolus vulgaris]
 gb|ESW25470.1| hypothetical protein PHAVU_003G038800g [Phaseolus vulgaris]
Length=840

 Score =   121 bits (304),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 85/213 (40%), Positives = 121/213 (57%), Gaps = 30/213 (14%)
 Frame = +2

Query  236  EFFLLSCGAPSKSTSQ-DGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLAS--QVPFTT  406
            E  +L+CG+ +    Q DGR+W  D     ++P+N A+  S  +     L S  + P+ T
Sbjct  33   ENIVLNCGSSTSEFVQYDGRNWSGDI-VSPYVPSN-ADTKSLVVRAPNTLQSIPEAPYMT  90

Query  407  ARVFTSELTYSFRVSPGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYTLLKN  586
            AR+F S+ TY+F V+PG KF+RL+FYPA+Y           N ++ F +V+A N+TLL N
Sbjct  91   ARIFHSQFTYTFNVTPGPKFIRLHFYPASY--------MDLNISNAFLSVSAANFTLLHN  142

Query  587  FSAFLTvsspdpfvfspdpfIKKEFIVNVDDKQQLNLTFSPS-----PYAFVNGIEIVSM  751
            FSA L         +    + KKEFIV+V     L LTFSPS      +AFVNGIE+VSM
Sbjct  143  FSASLN------AEYYNLAYFKKEFIVHVSG-SVLQLTFSPSYNASRAFAFVNGIEVVSM  195

Query  752  PSDLYFRGDNNN-YPIIS----AVHFDNSTTME  835
            P +LY RGD+ +  P++      V+  N + ME
Sbjct  196  PLNLYMRGDDGDPLPLVGHDNKVVNIYNDSAME  228



>gb|EPS73118.1| hypothetical protein M569_01631 [Genlisea aurea]
Length=873

 Score =   121 bits (303),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 84/204 (41%), Positives = 116/204 (57%), Gaps = 28/204 (14%)
 Frame = +2

Query  248  LSCGAPSKSTSQDGRDWDTD--NHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARVFT  421
            L+CG P+ ST  D + W TD  + +L    TN+   S+   + Q P   QVP+ TAR+F 
Sbjct  36   LNCGGPAVSTDSDNQTWTTDVLSKFLSSPSTNSLTASA---SVQLPDVPQVPYMTARIFK  92

Query  422  SELTYSFRVSPGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYTLLKNFSAFL  601
            SE TYSF ++ G+KFLRLYFYPA+Y+          N ++  F+V++  YTLL NFSAF+
Sbjct  93   SEFTYSFPLAAGRKFLRLYFYPASYAG--------LNASNGIFSVSSGGYTLLNNFSAFI  144

Query  602  TvsspdpfvfspdpfIKKEFIVNVDDKQQLNLTFSP----SPYAFVNGIEIVSMPSDLYF  769
            T             ++ KE+ +NV  K  LN+TF+P    S YAF+NGIE+VS P D+Y 
Sbjct  145  T------TQALNFDYVVKEYSLNVPSK-VLNVTFTPNASASSYAFINGIEVVSHP-DIY-  195

Query  770  RGDNNNYPIISAVHF--DNSTTME  835
              D     +     F  DNST +E
Sbjct  196  SSDGAITVVGQPTGFVIDNSTVLE  219



>emb|CDP06378.1| unnamed protein product [Coffea canephora]
Length=889

 Score =   121 bits (303),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 89/211 (42%), Positives = 111/211 (53%), Gaps = 38/211 (18%)
 Frame = +2

Query  242  FLLSCGAPSKSTSQDGRDWDTD-NHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARVF  418
             LLSCG PS+ST  DGR W +D         +N++    PA A Q P   QVP+  AR+F
Sbjct  36   ILLSCGGPSQSTDIDGRKWYSDIGSKFALASSNSSVF--PA-AVQKPSVPQVPYMNARIF  92

Query  419  TSELTYSFRVSPGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYTLLKNFSAF  598
             S  TY F V+PG+KF+RLYFYP +Y           N ++  F+VTA  + L+KNFSA 
Sbjct  93   QSNYTYRFPVAPGRKFIRLYFYPTSYGG--------LNASNAIFSVTAGRFMLMKNFSAA  144

Query  599  LTvsspdpfvfspdpfIKKEFIVNVDDKQQLNLTFSPS-----PYAFVNGIEIVSMPSDL  763
             T             FI KEF VNV     LNLTFSP+      YAFVNGIE+VS P D+
Sbjct  145  QT------AEALNYDFITKEFSVNVPSG-VLNLTFSPASDPGNSYAFVNGIEVVSHP-DI  196

Query  764  Y-------FRGDNNNYPIISAVHFDNSTTME  835
            Y         G N  + I      DN+T +E
Sbjct  197  YSAEGPSLLAGQNAPFSI------DNTTALE  221



>gb|EMT17007.1| Receptor-like protein kinase FERONIA [Aegilops tauschii]
Length=890

 Score =   120 bits (302),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 84/198 (42%), Positives = 105/198 (53%), Gaps = 34/198 (17%)
 Frame = +2

Query  242  FLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARVFT  421
             LL CGA  K    DGR WD D    ++ P    +L+S +   Q P   QVP+ TARV  
Sbjct  44   ILLDCGATGKGNDTDGRQWDGDAGS-KYAP---PKLASASAGAQDPSVPQVPYLTARVSA  99

Query  422  SELTYSFRVSPGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVT--ANNYTLLKNFSA  595
            +  TYSF + PG+KFLRL+FYPANYS          N  D FF+V+  A   TLL NFSA
Sbjct  100  APFTYSFPLGPGRKFLRLHFYPANYS--------NRNAADAFFSVSVPAAKVTLLSNFSA  151

Query  596  FLTvsspdpfvfspdpfIKKEFIVNVDDKQQLNLTFSPSP-----YAFVNGIEIVSMPSD  760
            + T             +I +EF VNV   Q L+LTF+P       YAF+NGIE+VS P D
Sbjct  152  YQT------TTALNFAYIVREFSVNV-TGQNLDLTFTPEKGHPNAYAFINGIEVVSSP-D  203

Query  761  LY-------FRGDNNNYP  793
            L+         GD N+ P
Sbjct  204  LFDLATPQLVTGDGNSQP  221



>ref|XP_009391670.1| PREDICTED: receptor-like protein kinase FERONIA [Musa acuminata 
subsp. malaccensis]
Length=887

 Score =   120 bits (302),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 80/180 (44%), Positives = 103/180 (57%), Gaps = 27/180 (15%)
 Frame = +2

Query  236  EFFLLSCGAPSKSTSQDGRDW--DTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTA  409
            +  LL CGA  ++T  +GR W  D+ + Y  F+  N    ++P    Q     QVP+ TA
Sbjct  38   DHILLDCGASGQATDANGRSWTADSGSKYAPFL--NGGGFTAPL---QDSSVPQVPYLTA  92

Query  410  RVFTSELTYSFRVSPGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYTLLKNF  589
            RVFTS  TYSF +  G+KF+RL+FYP+NYS  A         +D FF+VTA  YTLL NF
Sbjct  93   RVFTSPYTYSFPLGAGRKFIRLHFYPSNYSNHAA--------SDAFFSVTAGPYTLLHNF  144

Query  590  SAFLTvsspdpfvfspdpfIKKEFIVNVDDKQQLNLTFSPS-----PYAFVNGIEIVSMP  754
            SA+ T             ++ +EF VNV     LNLTF+PS      YAFVNGIEIVS+P
Sbjct  145  SAYQT------ADALNFAYLTREFSVNV-STGGLNLTFTPSTGRANSYAFVNGIEIVSIP  197



>ref|XP_010938035.1| PREDICTED: receptor-like protein kinase FERONIA [Elaeis guineensis]
Length=891

 Score =   120 bits (302),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 81/195 (42%), Positives = 107/195 (55%), Gaps = 28/195 (14%)
 Frame = +2

Query  242  FLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARVFT  421
             LL+CGA  +    DGR W  D         N   L++P+     P   QVP+ TAR FT
Sbjct  42   ILLNCGASGQDKDTDGRIWTGDAGSKYAPSINGVGLTAPSQDSSVP---QVPYLTARFFT  98

Query  422  SELTYSFRVSPGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYTLLKNFSAFL  601
            S  TY+F +  G+KF+RLYFYP+NYS  A         +D FF+VTA ++TLL+NFSA+L
Sbjct  99   SPYTYTFPLGAGRKFIRLYFYPSNYSDRAA--------SDAFFSVTAGSHTLLQNFSAYL  150

Query  602  TvsspdpfvfspdpfIKKEFIVNVDDKQQLNLTFSPSP-----YAFVNGIEIVSMP----  754
            T             ++ +EF VNV     LNLTF+PS      YAFVNGIEIVS+P    
Sbjct  151  T------ADALNFAYLIREFSVNV-SSSGLNLTFTPSADHPNSYAFVNGIEIVSIPDIFT  203

Query  755  -SDLYFRGDNNNYPI  796
             +     G + ++PI
Sbjct  204  TTSAVLVGTSTDFPI  218



>gb|KJB80427.1| hypothetical protein B456_013G096600 [Gossypium raimondii]
Length=811

 Score =   120 bits (301),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 76/193 (39%), Positives = 106/193 (55%), Gaps = 24/193 (12%)
 Frame = +2

Query  236  EFFLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARV  415
            E   L CG+ +K +   GR+W +D    QF+ +N+   S    A +G     VP+ TAR+
Sbjct  46   ESIFLDCGSSAKQSLSLGRNWSSDIGS-QFIASNSDSDSIITTASKG---MTVPYITARL  101

Query  416  FTSELTYSFRVSPGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYTLLKNFSA  595
            F ++ +Y+F V+PG KF+RL+FY  +Y           N +  F T+TA  YTLL+NFS 
Sbjct  102  FYTKFSYTFNVTPGPKFIRLHFYSDSYQG--------LNASQSFLTITAGRYTLLRNFSC  153

Query  596  FLTvsspdpfvfspdpfIKKEFIVNVDDKQQLNLTFSPS-----PYAFVNGIEIVSMPSD  760
            +LT        F       KEFIV V++   L L FSP+      Y FVNGIE+VSMP  
Sbjct  154  YLTAKYLKTDHFF------KEFIVYVEN-HTLELIFSPTSNPPNAYGFVNGIEVVSMPLQ  206

Query  761  LYFRGDNNNYPII  799
            LY RGD+ + P +
Sbjct  207  LYIRGDDVSLPFV  219



>ref|XP_009115840.1| PREDICTED: receptor-like protein kinase FERONIA [Brassica rapa]
 ref|XP_009115841.1| PREDICTED: receptor-like protein kinase FERONIA [Brassica rapa]
Length=895

 Score =   120 bits (300),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 83/205 (40%), Positives = 112/205 (55%), Gaps = 25/205 (12%)
 Frame = +2

Query  242  FLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARVFT  421
             LL+CG  S  T  D R W  D    +F+ ++    +SPA A Q P    VP+ +AR+F 
Sbjct  37   ILLNCGGSSDLTDTDNRTWIQDVKS-KFLSSSGDSKTSPA-ATQDPSVPTVPYMSARIFR  94

Query  422  SELTYSFRVSPGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYTLLKNFSAFL  601
            S  TYSF V+ G+KF+RLYFYP +Y           N T+  F++++  YTLLKNFSA  
Sbjct  95   SPFTYSFPVASGRKFVRLYFYPNSYDG--------LNATNSLFSLSSGPYTLLKNFSAAQ  146

Query  602  TvsspdpfvfspdpfIKKEFIVNVDDKQQLNLTFSP-----SPYAFVNGIEIVSMPSDLY  766
            T             +I KEF+VNV+    LN+TF+P     + YAFVNGIE+ SMP D+Y
Sbjct  147  T------SQALNYAYIIKEFVVNVEGG-TLNMTFTPESTPSNAYAFVNGIEVTSMP-DIY  198

Query  767  FRGDNNNYPI--ISAVHFDNSTTME  835
               D     +   S V  DN+T +E
Sbjct  199  SSTDGTLTVVGTSSGVTIDNTTALE  223



>emb|CDY16299.1| BnaC01g23340D [Brassica napus]
Length=866

 Score =   119 bits (299),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 86/205 (42%), Positives = 113/205 (55%), Gaps = 25/205 (12%)
 Frame = +2

Query  242  FLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARVFT  421
            FLL+CG  S     D R W  D    +F+ ++    +SPA A Q P    VP+ TAR+F 
Sbjct  38   FLLNCGGSSDLPDTDNRTWIPDVKS-KFLSSSADSKTSPA-ATQDPSVPDVPYMTARIFR  95

Query  422  SELTYSFRVSPGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYTLLKNFSAFL  601
            S  TYSF V+ G+KF+R +FYP +Y           N T+  F+V+  +YTLLKNFSA  
Sbjct  96   SPFTYSFPVAAGRKFVRFHFYPNSYDG--------LNATNSLFSVSLGSYTLLKNFSAAQ  147

Query  602  TvsspdpfvfspdpfIKKEFIVNVDDKQQLNLTFSP-----SPYAFVNGIEIVSMPSDLY  766
            T             FI KEFIVNV+    LN+TF+P     + YA+VNGIE+ SMP DLY
Sbjct  148  T------AQALTFSFIVKEFIVNVEGG-ALNVTFTPESAPSNAYAYVNGIEVTSMP-DLY  199

Query  767  FRGDNNNYPIISA--VHFDNSTTME  835
               D +   + S+  V  DNST +E
Sbjct  200  SSTDGSLTVVGSSGGVTIDNSTALE  224



>emb|CDX78012.1| BnaA09g32070D [Brassica napus]
Length=851

 Score =   119 bits (299),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 83/205 (40%), Positives = 112/205 (55%), Gaps = 25/205 (12%)
 Frame = +2

Query  242  FLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARVFT  421
             LL+CG  S  T  D R W  D    +F+ ++    +SPA A Q P    VP+ +AR+F 
Sbjct  37   ILLNCGGSSDLTDTDNRTWIPDVKS-KFLSSSGDSKTSPA-ATQDPSVPTVPYMSARIFR  94

Query  422  SELTYSFRVSPGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYTLLKNFSAFL  601
            S  TYSF V+ G+KF+RLYFYP +Y           N T+  F++++  YTLLKNFSA  
Sbjct  95   SPFTYSFPVASGRKFVRLYFYPNSYDG--------LNATNSLFSLSSGPYTLLKNFSAAQ  146

Query  602  TvsspdpfvfspdpfIKKEFIVNVDDKQQLNLTFSP-----SPYAFVNGIEIVSMPSDLY  766
            T             +I KEF+VNV+    LN+TF+P     + YAFVNGIE+ SMP D+Y
Sbjct  147  T------SQALNYAYIIKEFVVNVEGG-TLNMTFTPESTPSNAYAFVNGIEVTSMP-DIY  198

Query  767  FRGDNNNYPI--ISAVHFDNSTTME  835
               D     +   S V  DN+T +E
Sbjct  199  SSTDGTLTVVGTSSGVTIDNTTALE  223



>ref|XP_010243447.1| PREDICTED: receptor-like protein kinase FERONIA [Nelumbo nucifera]
Length=825

 Score =   119 bits (299),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 79/190 (42%), Positives = 110/190 (58%), Gaps = 22/190 (12%)
 Frame = +2

Query  248  LSCGAPSKST-SQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARVFTS  424
            + CG+  + T S DGR+W T +   ++ P      S+  ++ QG    Q+P+ TAR+F S
Sbjct  40   VDCGSHGEVTESHDGRNW-TGDFGGKYKPYANIRGSTFVVSVQGISVPQIPYMTARIFRS  98

Query  425  ELTYSFR-VSPGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYTLLKNFSAFL  601
             LTY F  VS G KF+RLYFYPA+YS          N++  FF V+A  Y LL+NFSA L
Sbjct  99   HLTYKFSDVSAGPKFIRLYFYPASYS--------NLNQSYAFFDVSAGPYILLRNFSASL  150

Query  602  TvsspdpfvfspdpfIKKEFIVNVDDKQQLNLTFSPSP-----YAFVNGIEIVSMPSDLY  766
            T +  D   F       KEF+VN++ + +L +TFSP+P     + FVNGIEI+SMP + Y
Sbjct  151  TANFLDTDRFF------KEFVVNIERQSELIITFSPTPNIFETHGFVNGIEILSMPDNFY  204

Query  767  FRGDNNNYPI  796
             R +   Y I
Sbjct  205  IRDEILPYAI  214



>gb|ABT18094.1| FERONIA receptor-like kinase [Brassica oleracea]
Length=895

 Score =   119 bits (299),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 86/205 (42%), Positives = 112/205 (55%), Gaps = 25/205 (12%)
 Frame = +2

Query  242  FLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARVFT  421
            F L+CG  S     D R W  D    +F+ ++    +SPA A Q P    VP+ TAR+F 
Sbjct  36   FFLNCGGSSDLPDTDNRTWIPDVKS-KFLSSSADSKTSPA-ATQDPSVPDVPYMTARIFR  93

Query  422  SELTYSFRVSPGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYTLLKNFSAFL  601
            S  TYSF V+ G+KF+RL+FYP +Y           N T+  F+V+  +YTLLKNFSA  
Sbjct  94   SPFTYSFPVAAGRKFVRLHFYPNSYDG--------LNATNSLFSVSLGSYTLLKNFSAAQ  145

Query  602  TvsspdpfvfspdpfIKKEFIVNVDDKQQLNLTFSP-----SPYAFVNGIEIVSMPSDLY  766
            T             FI KEFIVNV+    LN+TF+P     + YA+VNGIE+ SMP DLY
Sbjct  146  T------AQALTFSFIVKEFIVNVEGG-ALNVTFTPESAPSNAYAYVNGIEVTSMP-DLY  197

Query  767  FRGDNNNYPIIS--AVHFDNSTTME  835
               D +   + S   V  DNST +E
Sbjct  198  SSTDGSLTVVGSSGGVTIDNSTALE  222



>gb|KDO64141.1| hypothetical protein CISIN_1g036624mg [Citrus sinensis]
Length=893

 Score =   119 bits (299),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 82/208 (39%), Positives = 113/208 (54%), Gaps = 28/208 (13%)
 Frame = +2

Query  236  EFFLLSCGAPSKSTSQDGRDW--DTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTA  409
            E  LL+CG  S  +  D R W  D  + +L     +T + ++   A Q P    +P+ TA
Sbjct  34   EQILLNCGESSILSDDDKRSWTPDIGSKFL----LSTKDSTTSKAATQDPSTPTIPYMTA  89

Query  410  RVFTSELTYSFRVSPGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYTLLKNF  589
            RVF SE TYSF V  G+KF+RLYFYP +Y+        R N TD  F+V+   YTLLKNF
Sbjct  90   RVFRSEFTYSFPVVAGRKFVRLYFYPNSYN--------RLNATDALFSVSTGPYTLLKNF  141

Query  590  SAFLTvsspdpfvfspdpfIKKEFIVNVDDKQQLNLTFSP----SPYAFVNGIEIVSMPS  757
            S   T             ++ KE+ + VD  + LN+TFSP    + YAFVNGIE++SMP 
Sbjct  142  SVAQT------AEALNYAYVIKEYAIPVDG-ETLNITFSPMNVSNAYAFVNGIEVMSMP-  193

Query  758  DLYFRGDNNNYPI--ISAVHFDNSTTME  835
            D+Y   D +   +   S +  DN+T +E
Sbjct  194  DIYKNTDGDLMIVGQSSPISIDNTTALE  221



>ref|XP_003557976.1| PREDICTED: receptor-like protein kinase FERONIA [Brachypodium 
distachyon]
Length=898

 Score =   119 bits (299),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 84/198 (42%), Positives = 102/198 (52%), Gaps = 34/198 (17%)
 Frame = +2

Query  242  FLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARVFT  421
             LL CGA       DGR+W  D    ++ P N   L S     Q P   QVP+ TARV  
Sbjct  51   ILLDCGATGNGNDTDGREWGGDAGS-KYAPAN---LGSAIAGAQDPSVPQVPYLTARVSA  106

Query  422  SELTYSFRVSPGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVT--ANNYTLLKNFSA  595
            +  TYSF + PG+KFLRL+FYPANYS          N  D FF+VT  A   TLL NFSA
Sbjct  107  APFTYSFPLGPGRKFLRLHFYPANYS--------NRNAADAFFSVTVPAAKVTLLSNFSA  158

Query  596  FLTvsspdpfvfspdpfIKKEFIVNVDDKQQLNLTFSPSP-----YAFVNGIEIVSMPSD  760
            + T             ++ +EF VNV   Q L+LTF+P       YAF+NGIE+VS P D
Sbjct  159  YQT------STALNFAYLIREFSVNV-TGQTLDLTFTPEKGHPNAYAFINGIEVVSSP-D  210

Query  761  LY-------FRGDNNNYP  793
            L+         GD NN P
Sbjct  211  LFDLSTPELVMGDGNNQP  228



>ref|XP_009148931.1| PREDICTED: receptor-like protein kinase FERONIA [Brassica rapa]
Length=899

 Score =   119 bits (299),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 87/206 (42%), Positives = 111/206 (54%), Gaps = 26/206 (13%)
 Frame = +2

Query  242  FLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARVFT  421
            FLL+CG  S     D R W  D    +F+ ++    +SPA A Q P    VP+ TAR+F 
Sbjct  38   FLLNCGGSSDLPDTDNRTWIPDVKS-KFLSSSADSKTSPA-ATQDPSVPDVPYMTARIFR  95

Query  422  SELTYSFRVSPGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYTLLKNFSAFL  601
            S  TYSF VS G+KF+RL+FYP +Y           N T+  F+V+  +YTLLKNFSA  
Sbjct  96   SPFTYSFPVSSGRKFVRLHFYPNSYDG--------LNATNSLFSVSLGSYTLLKNFSA--  145

Query  602  TvsspdpfvfspdpfIKKEFIVNVDDKQQLNLTFSP------SPYAFVNGIEIVSMPSDL  763
                          FI KEFIVNV+    LN+TF+P      + YAFVNGIE+ SMP DL
Sbjct  146  ----AQMAQALTFSFIVKEFIVNVEGG-ALNVTFTPESTPSNNAYAFVNGIEVTSMP-DL  199

Query  764  YFRGDNNNYPIIS--AVHFDNSTTME  835
            Y     +   + S   V  DNST +E
Sbjct  200  YSSTHGSLTVVGSSGGVTIDNSTALE  225



>ref|XP_010242732.1| PREDICTED: receptor-like protein kinase ANXUR1 [Nelumbo nucifera]
Length=858

 Score =   119 bits (298),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 77/198 (39%), Positives = 117/198 (59%), Gaps = 33/198 (17%)
 Frame = +2

Query  242  FLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAE-QGP-LASQVPFTTARV  415
            F+LSCG+ + ST  DGR WD D+ YL+     + + S P+ A+ Q P L S +P+  AR+
Sbjct  30   FVLSCGSVNSSTDSDGRVWDLDSKYLK-----SEDNSVPSKAQFQDPSLPSTIPYMNARI  84

Query  416  FTSELTYSFRVSPGQK-FLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYTLLKNFS  592
            FT+E +Y+F VSP Q+ ++RL+FYP++YS+         N TD FF+V A   TLL NFS
Sbjct  85   FTAEASYTFSVSPKQRHWVRLHFYPSSYSS--------LNATDAFFSVVAGGVTLLNNFS  136

Query  593  AFLTvsspdpfvfspdpfIKKEFIVNVDDKQQLNLTFSPS-----PYAFVNGIEIVSMPS  757
            A++T             +I +EF ++     +L+LTF PS      +AF+NGIE++ MP 
Sbjct  137  AYIT------AEALTQAYIVREFSLSPFPTGKLDLTFKPSDKHSGSFAFINGIEVIPMP-  189

Query  758  DLYFRGDNNNYPIISAVH  811
            +L+        P++ +VH
Sbjct  190  ELFHPA-----PVVGSVH  202



>gb|KJB10595.1| hypothetical protein B456_001G210100 [Gossypium raimondii]
Length=868

 Score =   119 bits (298),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 76/188 (40%), Positives = 107/188 (57%), Gaps = 22/188 (12%)
 Frame = +2

Query  248  LSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAI-AEQGPLASQVPFTTARVFTS  424
            L+CGAP+   + DGR W  D     F P  ++   S A  A+    +  VP+ TARV  S
Sbjct  34   LNCGAPTDLLANDGRSWAADKTS-NFGPFESSHNKSQAYEADTQDGSETVPYMTARVSRS  92

Query  425  ELTYSFRVSPGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYTLLKNFSAFLT  604
            E  Y+F V+ GQKF+RLYF+PA+Y           +++  FF+V A ++TLLKNFSA L 
Sbjct  93   EFKYTFPVTSGQKFVRLYFHPASYEGN--------DRSKAFFSVKAGSFTLLKNFSASLV  144

Query  605  vsspdpfvfspdpfIKKEFIVNVDDKQQLNLTFSPS------PYAFVNGIEIVSMPSDLY  766
              S     F       +EF +NV+D + L+L F+PS       YA +NGIEIVSMP++LY
Sbjct  145  ADSKGRNWFF------REFCLNVEDNEVLDLVFTPSRSASNDTYAIINGIEIVSMPTNLY  198

Query  767  FRGDNNNY  790
            +   ++ Y
Sbjct  199  YTPPDSRY  206



>ref|XP_009140101.1| PREDICTED: probable receptor-like protein kinase At5g39020, partial 
[Brassica rapa]
Length=811

 Score =   119 bits (297),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 89/207 (43%), Positives = 114/207 (55%), Gaps = 21/207 (10%)
 Frame = +2

Query  236  EFFLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELS-SPAIAEQGPLASQVPFTTAR  412
            + FL++CGA S +    GR W T+  Y   MP+N   LS + + + Q    SQVPFT AR
Sbjct  24   DVFLINCGATSDTNDASGRTWTTE--YETLMPSNLDNLSFAASPSYQDVEVSQVPFTEAR  81

Query  413  VFTSELTYSFRVSPGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYTLLKNFS  592
            +F SE TY F+VSPG KFLRLYFY   Y       G  F+   FFF+VT +  TLLKNF+
Sbjct  82   IFQSEFTYKFQVSPGWKFLRLYFYRTRY-------GSDFSSNSFFFSVTVDGLTLLKNFN  134

Query  593  AFLTvsspdpfvfspdpfIKKEFIVNVDDKQQLNLTFSPS--PYAFVNGIEIVSMPSDLY  766
            A LT                KEFIV     + L LTF+PS    AFVNG+EIVS+P   Y
Sbjct  135  ADLTTVRTYEPESKYFI---KEFIVTA--YKTLRLTFTPSTDSLAFVNGVEIVSIPDGFY  189

Query  767  FRG--DNNNYPIISAVHF--DNSTTME  835
             +G  D+    + S + F  D+  T+E
Sbjct  190  TKGGFDDKIKNVGSNIDFELDDEITLE  216



>ref|XP_010450844.1| PREDICTED: putative receptor-like protein kinase At5g39000 [Camelina 
sativa]
Length=888

 Score =   119 bits (298),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 87/206 (42%), Positives = 120/206 (58%), Gaps = 24/206 (12%)
 Frame = +2

Query  242  FLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIA-EQGPLASQVPFTTARVF  418
            FL++CG+ S ++  +GR W  +    + +P+N+   S  + A  Q    SQVP+  AR+F
Sbjct  32   FLINCGSTSNNSDTNGRTWTPE--IGKILPSNSDSASFSSDALYQDSGISQVPYMKARIF  89

Query  419  TSELTYSFRVS-PGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYTLLKNFSA  595
             SE TY+F VS PG +FLRLYFYP+ Y       G  F+   +FF V  N +TLL+NFSA
Sbjct  90   RSEFTYTFPVSTPGWQFLRLYFYPSRY-------GSGFDAAPYFFDVNVNGFTLLRNFSA  142

Query  596  FLTvsspdpfvfspdpfIKKEFIVNVDDKQQLNLTFSPSP--YAFVNGIEIVSMPSDLYF  769
             LTV +           + KEF+V V  +  LNLTF+PSP   AFVNGIEIV+MP   Y 
Sbjct  143  DLTVKASVSKS------LIKEFVVPVH-QTYLNLTFTPSPNSLAFVNGIEIVTMPDQFYS  195

Query  770  RG--DNNNYPIISAVHF--DNSTTME  835
            +G  D+    ++S+  F  DN T +E
Sbjct  196  KGGFDDMITNLVSSTDFVIDNYTALE  221



>ref|XP_004302537.1| PREDICTED: receptor-like protein kinase FERONIA [Fragaria vesca 
subsp. vesca]
Length=883

 Score =   119 bits (298),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 81/203 (40%), Positives = 109/203 (54%), Gaps = 26/203 (13%)
 Frame = +2

Query  248  LSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARVFTSE  427
            L+CG P +ST  DG+ W +D        +     +SPA A Q P   + PF TARVF S+
Sbjct  30   LNCGGPQESTDADGQKWTSD--VGSKFASGANSTTSPA-ATQDPSVPETPFMTARVFHSD  86

Query  428  LTYSFRVSPGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYTLLKNFSAFLTv  607
             TY F V+ G+ F+RL FYPA+Y+          N +   F+V   +YT+LKNFS   T 
Sbjct  87   YTYKFPVASGRIFVRLSFYPASYAG--------LNASGAVFSVMVESYTVLKNFSVVQT-  137

Query  608  sspdpfvfspdpfIKKEFIVNVDDKQQLNLTFSPS-----PYAFVNGIEIVSMPSDLYFR  772
                        F+ KEF+VNV+  + L++TF PS      YAFVNGIE+VSMP D+Y  
Sbjct  138  -----TEALDYAFVTKEFVVNVEG-ESLDVTFKPSSSVPNAYAFVNGIEVVSMP-DIYSS  190

Query  773  GDNNNYPI--ISAVHFDNSTTME  835
             D     +   S  + DNST +E
Sbjct  191  TDGTTMIVGQSSPFYIDNSTALE  213



>ref|XP_007032814.1| Malectin/receptor-like protein kinase family protein, putative 
[Theobroma cacao]
 gb|EOY03740.1| Malectin/receptor-like protein kinase family protein, putative 
[Theobroma cacao]
Length=888

 Score =   119 bits (297),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 74/185 (40%), Positives = 99/185 (54%), Gaps = 24/185 (13%)
 Frame = +2

Query  248  LSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARVFTSE  427
            L CG+ S +     R W  D+ YL   P NT  + S      G     +P+ TAR+  S 
Sbjct  46   LDCGSVSNNNDSTPRLWLGDDKYLD-QPKNTEAVMSNV---SGTKTDPIPYNTARLSHSH  101

Query  428  LTYSFRVSPGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYTLLKNFSAFLTv  607
             +Y+F V+PGQKF+RL+FYP +Y          FN++  FF V    YTLL NFSA LT 
Sbjct  102  FSYTFNVTPGQKFVRLHFYPTSYG--------EFNRSTAFFDVHIGRYTLLSNFSAALT-  152

Query  608  sspdpfvfspdpfIKKEFIVNVDD-KQQLNLTFS-----PSPYAFVNGIEIVSMPSDLYF  769
                           KEF VNV+D +++L + F+     P  YAF+NGIEIVSMP +LY+
Sbjct  153  -----ADDCKSETFSKEFCVNVEDSERKLTILFTASRSMPDSYAFINGIEIVSMPDNLYY  207

Query  770  RGDNN  784
              DN+
Sbjct  208  SADND  212



>ref|XP_010660578.1| PREDICTED: receptor-like protein kinase FERONIA [Vitis vinifera]
Length=900

 Score =   119 bits (297),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 73/187 (39%), Positives = 103/187 (55%), Gaps = 23/187 (12%)
 Frame = +2

Query  236  EFFLLSCGAPSKSTSQDGRDW--DTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTA  409
            +  LL+CG+   ST+ D R W  D  + +      N   +S+ A    G     VP+ T 
Sbjct  50   DIILLNCGSFGNSTALDDRGWMGDVGSKFTSSRLLNQTSVSAKAPHSHGFSIDPVPYMTV  109

Query  410  RVFTSELTYSFRVSPGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYTLLKNF  589
            R F S+ TY+F V PGQKF+RL+FYPA++          F +++ FF+V A  YTLL NF
Sbjct  110  RFFRSQFTYTFHVKPGQKFIRLHFYPASFPG--------FERSEAFFSVKAGPYTLLSNF  161

Query  590  SAFLTvsspdpfvfspdpfIKKEFIVNVDDKQQ-LNLTFSPS------PYAFVNGIEIVS  748
            S   T              + KEF VN++D Q+ +N+TF PS       +AF+NGIEIVS
Sbjct  162  SPSHT------ADALGVKVLVKEFSVNINDNQRSINITFLPSSNARKDAFAFINGIEIVS  215

Query  749  MPSDLYF  769
            MP++LY+
Sbjct  216  MPANLYY  222



>ref|XP_002530992.1| kinase, putative [Ricinus communis]
 gb|EEF31380.1| kinase, putative [Ricinus communis]
Length=904

 Score =   119 bits (297),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 76/196 (39%), Positives = 113/196 (58%), Gaps = 23/196 (12%)
 Frame = +2

Query  248  LSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARVFTSE  427
            L CG+PS     + R+W  D ++       +  L +   A +  L S VP+ TAR+  S+
Sbjct  52   LDCGSPSNGPDMNHRNWIADTNFFDLQHNASTPLQANESASRKGLDS-VPYATARLSFSQ  110

Query  428  LTYSFRVS-PGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYTLLKNFSAFLT  604
             TYSF ++  G KF+RLYFYPA+YS         F+ ++ +F+V A  YTLL NFS+ L 
Sbjct  111  FTYSFPITTAGPKFVRLYFYPASYS--------DFDMSNAYFSVQAGRYTLLSNFSSVL-  161

Query  605  vsspdpfvfspdpfIKKEFIVNVDDKQQL-NLTFSPSP-----YAFVNGIEIVSMPSDLY  766
                        P   KEF +NV++ Q L NLTF+P+P     YAF+NGIEIVSMP++LY
Sbjct  162  -----HSKNLSLPGFVKEFCLNVEEGQNLLNLTFTPTPNMPDAYAFINGIEIVSMPANLY  216

Query  767  FRGDNN-NYPIISAVH  811
            +  +N+  +P + +++
Sbjct  217  YSAENDVGFPSVGSLN  232



>ref|XP_008810848.1| PREDICTED: receptor-like protein kinase FERONIA [Phoenix dactylifera]
Length=891

 Score =   118 bits (296),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 85/206 (41%), Positives = 109/206 (53%), Gaps = 35/206 (17%)
 Frame = +2

Query  242  FLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARVFT  421
             LL+CGA  +    DGR W  D         N   L++   + Q     QVP+ TAR FT
Sbjct  41   ILLNCGASGQDKDTDGRIWTADAGSKYAPSINGVGLTA---SSQDSSVPQVPYLTARFFT  97

Query  422  SELTYSFRVSPGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYTLLKNFSAFL  601
            S  TY+F +  G+KF+RLYFYP+NYS  A         +D FF+VTA + TLL+NFSA+L
Sbjct  98   SPYTYTFPLGAGRKFIRLYFYPSNYSGHAA--------SDAFFSVTAASSTLLQNFSAYL  149

Query  602  TvsspdpfvfspdpfIKKEFIVNVDDKQQLNLTFSPSP-----YAFVNGIEIVSMPSDLY  766
            T             ++ +EF VNV     LNLTF+PS      YAFVNGIEIVS+P D++
Sbjct  150  T------ADALNFAYLVREFSVNV-SSSGLNLTFTPSADHPHSYAFVNGIEIVSIP-DIF  201

Query  767  ------FRGDNNNYPI-----ISAVH  811
                    G +  YPI     I  VH
Sbjct  202  TTGSALLAGTSTEYPIDQDWAIETVH  227



>emb|CDX73714.1| BnaC08g22890D [Brassica napus]
Length=1176

 Score =   119 bits (297),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 82/205 (40%), Positives = 113/205 (55%), Gaps = 25/205 (12%)
 Frame = +2

Query  242  FLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARVFT  421
             LL+CG  S  T  D R W  D    +F+ ++    +SPA A Q P    VP+ +AR+F 
Sbjct  349  ILLNCGGSSDLTDTDNRTWIPDVKS-KFLSSSGDSKTSPA-ATQDPSVPTVPYMSARIFR  406

Query  422  SELTYSFRVSPGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYTLLKNFSAFL  601
            S  TYSF V+ G+KF+RLYFYP +Y           N T+  F++++  YTLLKNFSA  
Sbjct  407  SPFTYSFPVASGRKFVRLYFYPNSYDG--------LNATNSLFSLSSGPYTLLKNFSAAQ  458

Query  602  TvsspdpfvfspdpfIKKEFIVNVDDKQQLNLTFSP-----SPYAFVNGIEIVSMPSDLY  766
            T             +I KEF+VNV+    LN+TF+P     + YAFVNGIE+ SMP D+Y
Sbjct  459  T------SQALNYAYIIKEFVVNVEGG-TLNMTFTPESTPSNAYAFVNGIEVTSMP-DIY  510

Query  767  FRGDNNNYPIISA--VHFDNSTTME  835
               D     + ++  V  DN+T +E
Sbjct  511  SSTDGTLTVVGTSGGVTIDNTTALE  535



>gb|KJB75372.1| hypothetical protein B456_012G038800 [Gossypium raimondii]
Length=853

 Score =   118 bits (295),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 71/179 (40%), Positives = 102/179 (57%), Gaps = 21/179 (12%)
 Frame = +2

Query  248  LSCGAPS--KSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARVFT  421
            L CG+ +   ST+ DGR+W  DN  + +   + ++  S ++ +       VP+ TAR+  
Sbjct  29   LDCGSSTSGNSTAPDGREWTGDN--MSWFAESGSQSVSASVEKHNSSFHVVPYMTARISK  86

Query  422  SELTYSFRVSPGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYTLLKNFSAFL  601
            SE TY F V+ GQKF+RLYF PA Y+         F+ + +FF+V    YTLL NF+A +
Sbjct  87   SEFTYMFPVTAGQKFIRLYFNPARYNG--------FDTSVYFFSVKVGPYTLLNNFTASI  138

Query  602  TvsspdpfvfspdpfIKKEFIVNVDDKQQLNLTFSPS---PYAFVNGIEIVSMPSDLYF  769
            T                +EF V++   Q LN+TF+PS    YAFVNGIEIVSMP++LY+
Sbjct  139  TADRSRKGSSI------REFCVSLMQNQTLNVTFTPSLEGSYAFVNGIEIVSMPTNLYY  191



>ref|XP_002877809.1| hypothetical protein ARALYDRAFT_485507 [Arabidopsis lyrata subsp. 
lyrata]
 gb|ABT18096.1| FERONIA receptor-like kinase [Arabidopsis lyrata]
 gb|EFH54068.1| hypothetical protein ARALYDRAFT_485507 [Arabidopsis lyrata subsp. 
lyrata]
Length=891

 Score =   118 bits (296),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 84/207 (41%), Positives = 112/207 (54%), Gaps = 24/207 (12%)
 Frame = +2

Query  236  EFFLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARV  415
            E  LL+CG  S     D R W +D        +++   +SPA+  Q P   +VP+ TARV
Sbjct  31   EKILLNCGGASDLVDTDNRTWISDVKSKFLSSSSSDSKTSPALT-QDPSVPEVPYMTARV  89

Query  416  FTSELTYSFRVSPGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYTLLKNFSA  595
            F S  TY+F V+ G+KF+RLYFYP +Y           N T+  F+V+   YTLLKNFSA
Sbjct  90   FRSPFTYTFPVASGRKFVRLYFYPNSYDG--------LNATNSLFSVSFGPYTLLKNFSA  141

Query  596  FLTvsspdpfvfspdpfIKKEFIVNVDDKQQLNLTFSP-----SPYAFVNGIEIVSMPSD  760
              T             FI KEF+VNV+    LN+TF+P     + YAFVNGIE+ SMP D
Sbjct  142  AQT------AEALTYAFIIKEFVVNVEGG-TLNMTFTPESTPSNAYAFVNGIEVTSMP-D  193

Query  761  LYFRGDNNNYPIIS--AVHFDNSTTME  835
            +Y   D     + S  ++  DNST +E
Sbjct  194  IYSSTDGTLTMVGSSTSITIDNSTALE  220



>gb|EMS66619.1| hypothetical protein TRIUR3_14353 [Triticum urartu]
Length=503

 Score =   115 bits (289),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 73/174 (42%), Positives = 99/174 (57%), Gaps = 20/174 (11%)
 Frame = +2

Query  248  LSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARVFTSE  427
            LSCGA + +T  DGR W+ D+   +F+ +  A +++ A  +   L S VP+ TARVF S 
Sbjct  34   LSCGASAPATDSDGRAWEGDSTS-KFLASTNAGVAARASYQDPSLPSSVPYVTARVFASS  92

Query  428  LTYSFRVSPGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYTLLKNFSAFLTv  607
             TY+F VSPG+ FLRLYFYPA+Y   +  G          F VTA   TLL++F+A    
Sbjct  93   HTYTFLVSPGRVFLRLYFYPADYGNRSASGA--------LFGVTAGGVTLLRDFNASQAA  144

Query  608  sspdpfvfspdpfIKKEFIVNVDDKQQLNLTFSPSP-----YAFVNGIEIVSMP  754
             + D           +EF +NV    +L++TF+PSP     YAFVNGIEIV  P
Sbjct  145  LALDAAYLV------REFSLNVSSGGKLDVTFAPSPGASSHYAFVNGIEIVPTP  192



>ref|XP_006429617.1| hypothetical protein CICLE_v10011034mg [Citrus clementina]
 ref|XP_006481221.1| PREDICTED: receptor-like protein kinase FERONIA-like [Citrus 
sinensis]
 gb|ESR42857.1| hypothetical protein CICLE_v10011034mg [Citrus clementina]
Length=895

 Score =   118 bits (295),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 81/208 (39%), Positives = 113/208 (54%), Gaps = 28/208 (13%)
 Frame = +2

Query  236  EFFLLSCGAPSKSTSQDGRDW--DTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTA  409
            E  LL+CG  S  +  D R W  D  + +L     +T + ++   A Q P    +P+ TA
Sbjct  36   EQILLNCGESSILSDDDKRSWTPDIGSKFL----LSTKDSTTSKAATQDPSTPTIPYMTA  91

Query  410  RVFTSELTYSFRVSPGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYTLLKNF  589
            RVF SE TYSF V  G+KF+RLYFYP +Y+        R N TD  F+V+   +TLLKNF
Sbjct  92   RVFRSEFTYSFPVVAGRKFVRLYFYPNSYN--------RLNATDALFSVSTGPFTLLKNF  143

Query  590  SAFLTvsspdpfvfspdpfIKKEFIVNVDDKQQLNLTFSP----SPYAFVNGIEIVSMPS  757
            S   T             ++ KE+ + VD  + LN+TFSP    + YAFVNGIE++SMP 
Sbjct  144  SVAQT------AEALNYAYVIKEYAIPVDG-ETLNITFSPMNVSNAYAFVNGIEVMSMP-  195

Query  758  DLYFRGDNNNYPI--ISAVHFDNSTTME  835
            D+Y   D +   +   S +  DN+T +E
Sbjct  196  DIYKNTDGDLMIVGQSSPISIDNTTALE  223



>ref|XP_004984479.1| PREDICTED: receptor-like protein kinase FERONIA-like [Setaria 
italica]
Length=884

 Score =   118 bits (295),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 82/196 (42%), Positives = 102/196 (52%), Gaps = 31/196 (16%)
 Frame = +2

Query  242  FLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARVFT  421
             LL CGA  +    DGR W  D       P+N A  ++PA + Q P   QVP+ TARV  
Sbjct  36   ILLDCGAKGQGNDTDGRMWGGDEGSKYAPPSNLAA-AAPA-SGQDPSVPQVPYLTARVSA  93

Query  422  SELTYSFRVSPGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYTLLKNFSAFL  601
            S  TYSF + PG+KFLRL+FYPANYS          +  D  F+V+    TLL NFSA+ 
Sbjct  94   SPFTYSFPLGPGRKFLRLHFYPANYS--------NRDAADGVFSVSVGKLTLLSNFSAYQ  145

Query  602  TvsspdpfvfspdpfIKKEFIVNVDDKQQLNLTFSPSP-----YAFVNGIEIVSMPSDLY  766
            T             ++ +EF VNV     L+LTF+P       YAFVNGIE+VS P DL+
Sbjct  146  T------AAAITFSYLVREFSVNV--SSTLDLTFTPEKSHPNAYAFVNGIEVVSSP-DLF  196

Query  767  -------FRGDNNNYP  793
                     GD NN P
Sbjct  197  GLTPPNMVTGDGNNQP  212



>ref|XP_008231017.1| PREDICTED: receptor-like protein kinase FERONIA [Prunus mume]
Length=850

 Score =   118 bits (295),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 79/215 (37%), Positives = 118/215 (55%), Gaps = 30/215 (14%)
 Frame = +2

Query  236  EFFLLSCG-APSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGP---LASQVPFT  403
            E F + CG + +K +  DGR+W  D +  +F P     + + +I +Q P      QVP+T
Sbjct  35   EDFTVKCGYSGNKISEDDGRNWIGDINS-KFSPLERQAVGNTSIFKQAPHSNTVQQVPYT  93

Query  404  TARVFTSELTYSFRVSPGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYTLLK  583
            T R+  SE +YSF ++ G KF+RLYF P +Y       G  F+++   F+V A  + LL 
Sbjct  94   TVRLSRSEFSYSFELTSGPKFIRLYFNPVSY-------GPDFDRSKALFSVKAGGFNLLH  146

Query  584  NFSAFLTvsspdpfvfspdpfIKKEFIVNVDDKQQLNLTFSPS-----PYAFVNGIEIVS  748
            +F+A +T         S    I KEF +N+D ++ LN+TF+PS      YAF+NGIEIVS
Sbjct  147  DFNASVT------ADASRLDRIYKEFCLNMDKEESLNITFTPSITIPDAYAFINGIEIVS  200

Query  749  MPSDLYFRGDNNNYPIISAVH------FDNSTTME  835
            MP+ LY+ G   +  +I  +        DNST +E
Sbjct  201  MPAHLYY-GVPKSGRLIEIIDTGRYFSLDNSTALE  234



>ref|XP_010503851.1| PREDICTED: receptor-like protein kinase FERONIA [Camelina sativa]
Length=895

 Score =   118 bits (295),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 87/209 (42%), Positives = 117/209 (56%), Gaps = 28/209 (13%)
 Frame = +2

Query  236  EFFLLSCGAPSKSTSQDGRDW--DTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTA  409
            E  LL+CG  S     D R W  D  + +L   P+  ++ +SPA+  Q P   +VP+ TA
Sbjct  35   EKILLNCGGASDLEDTDKRTWIPDVKSKFLS-SPSGDSK-TSPALT-QDPSVPEVPYMTA  91

Query  410  RVFTSELTYSFRVSPGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYTLLKNF  589
            RVF S  TY+F V+ G+KF+RLYFYP +Y           N T+  F+V++  YTLLKNF
Sbjct  92   RVFRSPFTYTFPVASGRKFVRLYFYPNSYDG--------LNATNSLFSVSSGPYTLLKNF  143

Query  590  SAFLTvsspdpfvfspdpfIKKEFIVNVDDKQQLNLTFSP--SP---YAFVNGIEIVSMP  754
            SA  T             FI KEF+V+V+    LN+TF+P  SP   YAFVNGIE+ SMP
Sbjct  144  SAAQT------AEALTYAFIVKEFVVHVEGG-TLNMTFTPETSPANAYAFVNGIEVTSMP  196

Query  755  SDLYFRGDN--NNYPIISAVHFDNSTTME  835
             D+Y   D   +     ++V  DNST +E
Sbjct  197  -DIYSSTDGTLSMVGTSTSVTIDNSTALE  224



>ref|XP_012084846.1| PREDICTED: receptor-like protein kinase FERONIA [Jatropha curcas]
 gb|KDP27273.1| hypothetical protein JCGZ_19972 [Jatropha curcas]
Length=918

 Score =   118 bits (295),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 78/182 (43%), Positives = 109/182 (60%), Gaps = 25/182 (14%)
 Frame = +2

Query  248  LSCGAPSKSTSQDGRDW--DTDNHYLQFMPTNTAELSSPAIAEQGPLAS-QVPFTTARVF  418
            + CG+ S  T++ GR W  DTD+ +    PTN A ++SPA   + P +  QVP+ TAR+ 
Sbjct  65   IDCGSTSAPTAEGGRIWTADTDSKFSLLDPTN-ASITSPA--PKNPTSGDQVPYITARLS  121

Query  419  TSELTYSFRVSPGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYTLLKNFSAF  598
             S+ TY+  V+PG KF+RLYFYPA+Y + +         +  FF+V A  +TLL NFSA 
Sbjct  122  RSDFTYTLPVTPGPKFIRLYFYPASYVSFS--------SSTAFFSVKAGGFTLLSNFSAA  173

Query  599  LTvsspdpfvfspdpfIKKEFIVNVDDKQQLNLTFSPSP-----YAFVNGIEIVSMPSDL  763
            L                 KEF +NV+D Q LN+TFSP+P     YAF+NG+EIVS+PS+L
Sbjct  174  L------YAQAHNFDTFVKEFSLNVEDGQMLNVTFSPTPSMTGAYAFINGLEIVSIPSNL  227

Query  764  YF  769
             +
Sbjct  228  LY  229



>ref|XP_010099322.1| Receptor-like protein kinase FERONIA [Morus notabilis]
 gb|EXB77668.1| Receptor-like protein kinase FERONIA [Morus notabilis]
Length=870

 Score =   118 bits (295),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 85/186 (46%), Positives = 111/186 (60%), Gaps = 25/186 (13%)
 Frame = +2

Query  242  FLLSCGAPSKST--SQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPL--ASQVPFTTA  409
            FLL+CG+ S  T  +  GR W++D+H   F   N    SS + A +     A +VP+ TA
Sbjct  33   FLLNCGSSSNQTYYNDQGRLWESDSHSQHFSSQNIQSSSSESNASEQDYNSAPKVPYKTA  92

Query  410  RVFTSELTYSFRV-SPGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYTLLKN  586
            R+F S+ TYSF + SPG KF+RLYFY A YS          NK+D FF+VTA+N+ LL N
Sbjct  93   RIFHSKFTYSFHLLSPGPKFVRLYFYSATYSG--------LNKSDSFFSVTADNFILLNN  144

Query  587  FSAFLTvsspdpfvfspdpfIKKEFIVNV-DDKQQLNL---TFSPSP--YAFVNGIEIVS  748
            FSA L             P+  KEFI++V ++  Q NL    F+PSP  YAF+NGIEIVS
Sbjct  145  FSASL------FASSRTSPYFVKEFIISVANNHNQFNLFELAFNPSPNSYAFINGIEIVS  198

Query  749  MPSDLY  766
            MP +LY
Sbjct  199  MPENLY  204



>gb|KJB71482.1| hypothetical protein B456_011G124900 [Gossypium raimondii]
Length=893

 Score =   117 bits (294),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 99/240 (41%), Positives = 126/240 (53%), Gaps = 36/240 (15%)
 Frame = +2

Query  152  SFPIIIFHFlalrladttaaaaplykatEFFLLSCGAPSKSTSQDGRDWDTDNHYLQFMP  331
            SFP+ +  FL+L L       A  Y  TE  LL+CG  S+ T  D R W  D      + 
Sbjct  8    SFPMSVIIFLSLLLLLFQLVLAADYVPTEKILLNCGEKSELTDNDNRKWTPDFGSKFLVG  67

Query  332  TNTAELSSPAIAEQGPLASQVPFTTARVFTSELTYSFRVSPGQKFLRLYFYPANYSAAAG  511
            T  + +S  A   Q P   +VP+ TARVF S  TYSF V  G+KF+RLYFY  +Y     
Sbjct  68   TGNSVISRAAT--QDPAVPEVPYLTARVFRSNFTYSFPVVAGRKFVRLYFYANSYDDR--  123

Query  512  GGGRRFNKTDFFFTVTANNYTLLKNFSAFLTvsspdpfvfspdpfIKKEFIVNVDDKQQL  691
                  N ++  F+VT+ +YTLLKNFSA  T             FI KE+ +NV D  +L
Sbjct  124  ------NSSNALFSVTSGSYTLLKNFSAAQT------SEAMNYAFIVKEYSINV-DGDRL  170

Query  692  NLTFS----PS-PYAFVNGIEIVSMPSDLY-------FRGDNNNYPIISAVHFDNSTTME  835
            NLTFS    PS  YAFVNGIE++SMP D+Y         G N+ + I      DNSTT+E
Sbjct  171  NLTFSLGSTPSNAYAFVNGIEVLSMP-DIYSNTDGITIVGQNSQFTI------DNSTTLE  223



>ref|XP_004507304.1| PREDICTED: receptor-like protein kinase FERONIA-like [Cicer arietinum]
Length=912

 Score =   117 bits (294),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 75/196 (38%), Positives = 107/196 (55%), Gaps = 36/196 (18%)
 Frame = +2

Query  242  FLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVP-------F  400
            F L+CG    ST  + R W  D        TN+  L + +++  G    Q P       +
Sbjct  36   FTLNCGTTGNSTDGE-RTWTGD--------TNSKLLKTLSVSILGTTTQQTPTSVNKNPY  86

Query  401  TTARVFTSELTYSFRVSPGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYTLL  580
            +TAR+   +  +SF V  G KFLRL+FYP+NY+         FN+ D FFTV +N +TLL
Sbjct  87   STARLSREQFNHSFSVGKGPKFLRLFFYPSNYNG-------NFNRYDAFFTVESNGFTLL  139

Query  581  KNFSAFLTvsspdpfvfspdpfIKKEFIVNV--DDKQQLNLTFSPSP-----YAFVNGIE  739
            K+F+A L               + KE+++NV  DD Q+L+L+F PS      YAF+NGIE
Sbjct  140  KDFNASLN------ADVEGVGTLFKEYVINVGDDDDQRLDLSFIPSGGNSNNYAFINGIE  193

Query  740  IVSMPSDLYFRGDNNN  787
            ++SMPSDLY+   N+N
Sbjct  194  VLSMPSDLYYTSSNDN  209



>ref|XP_004304217.1| PREDICTED: receptor-like protein kinase FERONIA [Fragaria vesca 
subsp. vesca]
Length=876

 Score =   117 bits (293),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 73/177 (41%), Positives = 104/177 (59%), Gaps = 19/177 (11%)
 Frame = +2

Query  248  LSCGAPSKSTSQDG-RDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARVFTS  424
            L+CG   + TS D  R W  D +  +F P   A  S    A +   ASQVP+T AR+  S
Sbjct  34   LACGNSGQPTSNDLLRTWTGDVNS-KFTPIGNA--SESITAPRSSTASQVPYTNARLSRS  90

Query  425  ELTYSFRVSPGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYTLLKNFSAFLT  604
            E TY+  +SPGQKF+RL+F P  Y+         F +++  F+VTA  +TLLK+F+A +T
Sbjct  91   EFTYTIPLSPGQKFIRLHFNPDTYN-------NNFQRSNSLFSVTAAGFTLLKDFNASVT  143

Query  605  vsspdpfvfspdpfIKKEFIVNVDDKQQLNLTFSPSP--YAFVNGIEIVSMPSDLYF  769
                     +    + KEF VN++  Q+LN+TF+PS   YAF+NGIE+VSMP+  Y+
Sbjct  144  ------ADANGGSPLVKEFCVNIETGQRLNITFTPSKDAYAFINGIEVVSMPTSFYY  194



>ref|XP_009416326.1| PREDICTED: receptor-like protein kinase FERONIA [Musa acuminata 
subsp. malaccensis]
 ref|XP_009416327.1| PREDICTED: receptor-like protein kinase FERONIA [Musa acuminata 
subsp. malaccensis]
Length=882

 Score =   117 bits (293),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 73/178 (41%), Positives = 101/178 (57%), Gaps = 23/178 (13%)
 Frame = +2

Query  236  EFFLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARV  415
            ++ LL+CGA  K+   D + W  D         N    ++P   +Q     +VP+ TARV
Sbjct  32   DYILLNCGASGKAIDTDSQTWTGDAGSKYGPSLNAVGFTAP---QQDSSVPEVPYLTARV  88

Query  416  FTSELTYSFRVSPGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYTLLKNFSA  595
            FTS  TYSF V PG+K++RL+FYP+NYS            +D FF+VT++ +TLL NFSA
Sbjct  89   FTSPYTYSFPVGPGRKYVRLHFYPSNYSNHVA--------SDAFFSVTSDTHTLLSNFSA  140

Query  596  FLTvsspdpfvfspdpfIKKEFIVNVDDKQQLNLTFSPS-----PYAFVNGIEIVSMP  754
            +LT             ++ +EF VNV     LNLTF+PS      +AF+NGIEIVS+P
Sbjct  141  YLT------ADSLNYAYLAREFSVNV-STGGLNLTFTPSTTHPNAFAFINGIEIVSIP  191



>ref|XP_002272797.2| PREDICTED: receptor-like protein kinase ANXUR1 [Vitis vinifera]
 emb|CBI22880.3| unnamed protein product [Vitis vinifera]
Length=857

 Score =   117 bits (292),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 73/177 (41%), Positives = 99/177 (56%), Gaps = 23/177 (13%)
 Frame = +2

Query  242  FLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARVFT  421
            F+LSCG  S     DGR W  D    +F+ +    +S+ A  +   L S VP+ +AR+FT
Sbjct  35   FILSCGDSSGGADADGRKWVPDT---KFLASPGKSISATAQLQDPSLPSPVPYMSARIFT  91

Query  422  SELTYSFRVSPGQK-FLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYTLLKNFSAF  598
            SE TY F VSP  + ++RL+FYP+ YSA         N +D FF+VTA  +TLL NFSA 
Sbjct  92   SESTYQFSVSPKNRLWVRLHFYPSFYSA--------LNASDSFFSVTAGGFTLLNNFSAS  143

Query  599  LTvsspdpfvfspdpfIKKEFIVNVDDKQQLNLTFSPSP-----YAFVNGIEIVSMP  754
             T             +I K+F +   +   LN+TF PSP     YAF+NGIE++SMP
Sbjct  144  TT------AQALTQAYIIKDFSLMPPESGHLNITFKPSPNHNGSYAFINGIEVISMP  194



>ref|XP_002870806.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH47065.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=478

 Score =   114 bits (286),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 71/182 (39%), Positives = 101/182 (55%), Gaps = 16/182 (9%)
 Frame = +2

Query  236  EFFLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARV  415
            + FL +CG  S +   +GR+W  ++  +       A  +S A + Q    S++P+  AR+
Sbjct  27   DVFLFNCGDTSNNVDNNGRNWTAEDRKILSSNLVNASYTSEA-SYQKTGVSRIPYMKARI  85

Query  416  FTSELTYSFRVSPGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYTLLKNFSA  595
            F SE TYSF V+PG KFLRLYFYP  Y +        F+  + F +V  + +TLL+NF+A
Sbjct  86   FRSEFTYSFPVTPGWKFLRLYFYPTQYKSG-------FDAVNSFVSVKVSGFTLLRNFNA  138

Query  596  FLTvsspdpfvfspdpfIKKEFIVNVDDKQQLNLTFSPSP--YAFVNGIEIVSMPSDLYF  769
             +T         +    + KEFI+ V   Q LNLTF+PS    AFVN +EIVSMP   Y 
Sbjct  139  DIT----VQASITESSSLIKEFIIPV--YQTLNLTFTPSENSLAFVNRVEIVSMPDRFYS  192

Query  770  RG  775
            +G
Sbjct  193  KG  194



>ref|XP_008230910.1| PREDICTED: receptor-like protein kinase FERONIA [Prunus mume]
Length=874

 Score =   117 bits (292),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 72/189 (38%), Positives = 114/189 (60%), Gaps = 26/189 (14%)
 Frame = +2

Query  236  EFFLLSCG-APSKSTSQDGRDW--DTDNHYLQFMPTNTAELSSPAIAEQGPLASQV---P  397
            E   ++CG + +K+   DGR+W  D D+   +F P     + + + +++ P +  V   P
Sbjct  37   EDITVNCGDSGNKTFEDDGRNWIGDVDS---RFSPFEHQAVGNKSESKEAPHSYPVKPFP  93

Query  398  FTTARVFTSELTYSFRVSPGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYTL  577
            +TT R+  SE TYSF++S GQKF+RLYF P +Y       G  F+++   F+V A N+TL
Sbjct  94   YTTVRLSRSEFTYSFKLSSGQKFIRLYFNPVSY-------GPDFDQSKALFSVKAGNFTL  146

Query  578  LKNFSAFLTvsspdpfvfspdpfIKKEFIVNVDDKQQLNLTFSPS-----PYAFVNGIEI  742
            L +F+A +T        F+    I +EF +N+D+++ LN+TF+PS      Y F+NGIEI
Sbjct  147  LHDFNASVT-----AEAFNFTKIIYREFCLNIDEEESLNITFTPSRKIPDAYGFINGIEI  201

Query  743  VSMPSDLYF  769
            VSMP++LY+
Sbjct  202  VSMPTNLYY  210



>gb|KFK33213.1| hypothetical protein AALP_AA6G345300 [Arabis alpina]
Length=872

 Score =   117 bits (292),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 84/199 (42%), Positives = 112/199 (56%), Gaps = 26/199 (13%)
 Frame = +2

Query  236  EFFLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAE---LSSPAIAEQGPLASQVPFTT  406
            + FL +CG  S +    GR+W  +N   + +P+N+     LS+    E G   S +P+  
Sbjct  30   DVFLFNCGDTSDNLDS-GRNWTAENR--KTLPSNSQNASFLSNANSQESG--VSLIPYMK  84

Query  407  ARVFTSELTYSFRVSPGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYTLLKN  586
            AR+F S+ TYSF V+ G KFLRLYFYP  Y       G  F+    FFTVT N +TLLKN
Sbjct  85   ARIFRSDFTYSFPVTSGPKFLRLYFYPTRY-------GSDFDAGTSFFTVTVNGFTLLKN  137

Query  587  FSAFLTvsspdpfvfspdpfIKKEFIVNVDDKQQLNLTFSP--SPYAFVNGIEIVSMPSD  760
            FSA LT         S +  + KEFI+ V +   LNLTF+P  +  AFVNGIE+VSMP  
Sbjct  138  FSAGLT------VKASKEFTVVKEFIIPVYE-TTLNLTFTPFKNSLAFVNGIEVVSMPDR  190

Query  761  LYFRGDNNNYPIISAVHFD  817
             Y +G  ++  +IS V  D
Sbjct  191  FYSKGGFDD--VISNVGSD  207



>gb|KJB10602.1| hypothetical protein B456_001G210700 [Gossypium raimondii]
Length=856

 Score =   116 bits (291),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 76/188 (40%), Positives = 107/188 (57%), Gaps = 22/188 (12%)
 Frame = +2

Query  248  LSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAI-AEQGPLASQVPFTTARVFTS  424
            L+CGAP+   + DGR W  D     F P  ++   S A  A+    +  VP+ TARV  S
Sbjct  34   LNCGAPTDLLANDGRYWAADKTS-NFGPFESSHNKSQAYEADTQDGSETVPYMTARVSRS  92

Query  425  ELTYSFRVSPGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYTLLKNFSAFLT  604
            E  Y+F V+ GQKF+RLYF+PA+Y           +++  FF+V A + TLLKNF+A L 
Sbjct  93   EFKYTFPVTSGQKFVRLYFHPASYEEN--------DRSKAFFSVKAGSVTLLKNFTASLV  144

Query  605  vsspdpfvfspdpfIKKEFIVNVDDKQQLNLTFSPS------PYAFVNGIEIVSMPSDLY  766
              S     F       +EF +NV+D + L+L F+PS       YAF+NGIEIVSMP++LY
Sbjct  145  ADSRGRNWFF------REFCLNVEDNEVLDLVFTPSRSASNDTYAFINGIEIVSMPTNLY  198

Query  767  FRGDNNNY  790
            +   ++ Y
Sbjct  199  YTPPDSTY  206



>ref|XP_006290584.1| hypothetical protein CARUB_v10016673mg [Capsella rubella]
 gb|EOA23482.1| hypothetical protein CARUB_v10016673mg [Capsella rubella]
Length=892

 Score =   116 bits (291),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 85/207 (41%), Positives = 110/207 (53%), Gaps = 24/207 (12%)
 Frame = +2

Query  236  EFFLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARV  415
            E  LL+CG  S     D R W +D        ++    +SPA+  Q P   +VP+ TARV
Sbjct  32   EKILLNCGGASDLRDTDNRTWISDVKSKFLSSSSGDSKTSPALT-QDPSVPEVPYMTARV  90

Query  416  FTSELTYSFRVSPGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYTLLKNFSA  595
            F S  TY+F V+ G+KF+RLYFYP +Y           N T+  F+V+   YTLLKNFS 
Sbjct  91   FRSPFTYTFPVASGRKFVRLYFYPNSYDG--------LNATNSLFSVSFGPYTLLKNFSV  142

Query  596  FLTvsspdpfvfspdpfIKKEFIVNVDDKQQLNLTFSP-----SPYAFVNGIEIVSMPSD  760
              T             FI KEFIVNV+    LN+TF+P     + YAFVNGIE+ SMP D
Sbjct  143  AQT------ADALTYAFIIKEFIVNVEGG-TLNMTFTPESTPSNAYAFVNGIEVTSMP-D  194

Query  761  LYFRGDNNNYPIIS--AVHFDNSTTME  835
            LY   D     + S  ++  DNST +E
Sbjct  195  LYSSTDGTLIVVGSSASITIDNSTALE  221



>ref|XP_006595251.1| PREDICTED: receptor-like protein kinase FERONIA-like [Glycine 
max]
Length=794

 Score =   116 bits (291),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 77/186 (41%), Positives = 106/186 (57%), Gaps = 23/186 (12%)
 Frame = +2

Query  242  FLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARVFT  421
            F +SCG   KS   + R W  D     F+      +S+ A   Q P  +QVP+T AR+  
Sbjct  31   FTISCGTTGKSYDGE-RTWTGDTGS-TFLSHQDGTVSANATT-QSPSTNQVPYTAARLSR  87

Query  422  SELTYSFRVSPGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYTLLKNFSAFL  601
            S  +YSF VSPG KFLRL+FYPA Y++        F  ++  FT  +N +TLL  F+A L
Sbjct  88   SRFSYSFPVSPGPKFLRLFFYPAEYAS--------FPSSNASFTDQSNQFTLLHVFNASL  139

Query  602  TvsspdpfvfspdpfIKKEFIVNVD-DKQQLNLTFSPS---PYAFVNGIEIVSMPSDLYF  769
                           I +E++VNVD D ++LNLTF+PS    YAF+NGIE++SMPS+LY+
Sbjct  140  K--------AENTKTIFREYVVNVDGDSERLNLTFTPSQPNSYAFINGIEVLSMPSNLYY  191

Query  770  RGDNNN  787
               N+N
Sbjct  192  TSANDN  197



>ref|XP_009419820.1| PREDICTED: receptor-like protein kinase FERONIA isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=531

 Score =   114 bits (286),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 77/180 (43%), Positives = 105/180 (58%), Gaps = 24/180 (13%)
 Frame = +2

Query  242  FLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARVFT  421
             LL+CGA  +++S DGR W  D    ++ P+   +        Q P  S VP++TARVFT
Sbjct  37   ILLNCGASGQASSFDGRSWTGDTG-TRYAPSLNGD--GFDALRQDPSVSTVPYSTARVFT  93

Query  422  SELTYSFRVSPGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYTLLKNFSAFL  601
            S  TY F +S G+KF+RL+FYP++YS  A         +D FF+VT+  YTLL NFS++L
Sbjct  94   SPFTYRFPLSAGRKFIRLHFYPSDYSNHA--------VSDAFFSVTSGPYTLLHNFSSYL  145

Query  602  TvsspdpfvfspdpfIKKEFIVNVDDKQQLNLTFSPS-----PYAFVNGIEIVSMPSDLY  766
            T             ++ +E+ VNV     LNLTF PS      YAF+NGIEIVS+P DL+
Sbjct  146  T------ADALNFAYLIREYSVNV-STGGLNLTFIPSTTHPNSYAFINGIEIVSIP-DLF  197



>ref|XP_009412649.1| PREDICTED: receptor-like protein kinase FERONIA [Musa acuminata 
subsp. malaccensis]
 ref|XP_009412650.1| PREDICTED: receptor-like protein kinase FERONIA [Musa acuminata 
subsp. malaccensis]
Length=889

 Score =   116 bits (290),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 74/176 (42%), Positives = 100/176 (57%), Gaps = 23/176 (13%)
 Frame = +2

Query  242  FLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARVFT  421
             LL+CGA  ++   D R W  D         N A L++   + Q     QVP+ TARVFT
Sbjct  39   ILLNCGASGQAKDTDSRIWTGDTGSKYGPSLNVAGLTA---SLQDSSVPQVPYMTARVFT  95

Query  422  SELTYSFRVSPGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYTLLKNFSAFL  601
            S  T+SF + PG+K++RL+FYP NYS  A         +D  F+VT++++TLL NFSA+L
Sbjct  96   SPYTFSFPLGPGRKYIRLHFYPCNYSTHAA--------SDALFSVTSDSHTLLSNFSAYL  147

Query  602  TvsspdpfvfspdpfIKKEFIVNVDDKQQLNLTFSPS-----PYAFVNGIEIVSMP  754
            T             ++ +EF VNV     LNLTF+PS      YAFVNGIE+VS+P
Sbjct  148  T------ADSLNYAYLTREFSVNV-STGGLNLTFTPSTAHPQAYAFVNGIEVVSIP  196



>ref|XP_009419819.1| PREDICTED: receptor-like protein kinase FERONIA isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=545

 Score =   114 bits (286),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 77/180 (43%), Positives = 105/180 (58%), Gaps = 24/180 (13%)
 Frame = +2

Query  242  FLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARVFT  421
             LL+CGA  +++S DGR W  D    ++ P+   +        Q P  S VP++TARVFT
Sbjct  51   ILLNCGASGQASSFDGRSWTGDTG-TRYAPSLNGD--GFDALRQDPSVSTVPYSTARVFT  107

Query  422  SELTYSFRVSPGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYTLLKNFSAFL  601
            S  TY F +S G+KF+RL+FYP++YS  A         +D FF+VT+  YTLL NFS++L
Sbjct  108  SPFTYRFPLSAGRKFIRLHFYPSDYSNHA--------VSDAFFSVTSGPYTLLHNFSSYL  159

Query  602  TvsspdpfvfspdpfIKKEFIVNVDDKQQLNLTFSPS-----PYAFVNGIEIVSMPSDLY  766
            T             ++ +E+ VNV     LNLTF PS      YAF+NGIEIVS+P DL+
Sbjct  160  T------ADALNFAYLIREYSVNV-STGGLNLTFIPSTTHPNSYAFINGIEIVSIP-DLF  211



>ref|XP_011071382.1| PREDICTED: receptor-like protein kinase ANXUR1 [Sesamum indicum]
Length=871

 Score =   116 bits (290),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 72/177 (41%), Positives = 104/177 (59%), Gaps = 23/177 (13%)
 Frame = +2

Query  242  FLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARVFT  421
            F+L+CGA + +T  +GR W +D    +F+ +  + LS+ A ++   L S VP+ TAR+F 
Sbjct  48   FVLACGATADATDSNGRKWASD---AKFLISPNSSLSATAQSQDPSLPSTVPYMTARIFK  104

Query  422  SELTYSFRVSPG-QKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYTLLKNFSAF  598
            SE TY F VSP  + ++RL+FYP+ Y          F+    FF+VTA  +TLL NFSA 
Sbjct  105  SEATYKFSVSPNFRHWIRLHFYPSFYD--------NFDTLRSFFSVTAGGFTLLNNFSAS  156

Query  599  LTvsspdpfvfspdpfIKKEFIVNVDDKQQLNLTFSPS-----PYAFVNGIEIVSMP  754
            +T             +I +EF +N+ +   LNLTF+PS      +AFVNGIEI+SMP
Sbjct  157  IT------AEALTQSYIIREFSMNMLESGILNLTFTPSASYNNAFAFVNGIEIISMP  207



>gb|KHN37916.1| Receptor-like protein kinase FERONIA [Glycine soja]
Length=1071

 Score =   116 bits (290),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 71/185 (38%), Positives = 109/185 (59%), Gaps = 25/185 (14%)
 Frame = +2

Query  236  EFFLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARV  415
            E F ++CG+ S  +++DGR+W  D   ++F+  N   +++PA+    P   + P+T AR 
Sbjct  330  ELFSINCGSSSSLSTRDGRNWTAD---IKFLSENKDSVAAPALT---PSTLEGPYTDARF  383

Query  416  FTSELTYSFRVSPGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYTLLKNFSA  595
              S+ TYSF VS G KFLRL+FY  +Y        + F++++ +F+V A  YTLL+NF+A
Sbjct  384  SHSQFTYSFPVSTGPKFLRLFFYSTSY--------QNFHRSEAYFSVKAGLYTLLQNFNA  435

Query  596  FLTvsspdpfvfspdpfIKKEFIVNVDDKQQLNLTFSPSP-------YAFVNGIEIVSMP  754
             L           P  ++ +E+ +N+ D  +LN+TF PS        YAF+NGIEIVSMP
Sbjct  436  SL----HADAGNEPGDYLFREYCINLKDGDRLNITFIPSKTSQNPDSYAFINGIEIVSMP  491

Query  755  SDLYF  769
              LY+
Sbjct  492  PFLYY  496



>ref|XP_010660579.1| PREDICTED: receptor-like protein kinase FERONIA [Vitis vinifera]
Length=522

 Score =   114 bits (284),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 82/208 (39%), Positives = 114/208 (55%), Gaps = 29/208 (14%)
 Frame = +2

Query  248  LSCGAPSKSTSQDGRDW--DTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARVFT  421
            L CG+   ST+ DGR W  D  +      P +T  +++ AI  QGP+   +P+ TAR+ +
Sbjct  47   LDCGSSGNSTASDGRAWTGDIGSILATLQPLDTT-IAARAI-RQGPVEG-IPYLTARMSS  103

Query  422  SELTYSFRVSPGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYTLLKNFSAFL  601
            S+ TY+F VS G KF+RLYFYP+ Y          F+++   F+V +  +TLL NF A L
Sbjct  104  SQFTYTFLVSAGLKFVRLYFYPSWYPG--------FDRSKALFSVKSGPFTLLSNFRADL  155

Query  602  TvsspdpfvfspdpfIKKEFIVNVDDKQQLNLTFSP------SPYAFVNGIEIVSMPSDL  763
               S     F       +EF +NV++ Q LNLTFSP        YAFVNGIEIVSMP +L
Sbjct  156  VADSLGLEYFV------REFCINVEENQLLNLTFSPSPSSSNDSYAFVNGIEIVSMPHNL  209

Query  764  YFR-GDNNNYPIISAVHF---DNSTTME  835
            Y+     +  P I   +F   +N T +E
Sbjct  210  YYTPAGADGIPFIGQTYFYEIENITALE  237



>ref|XP_006593699.1| PREDICTED: receptor-like protein kinase FERONIA-like [Glycine 
max]
Length=702

 Score =   115 bits (288),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 76/182 (42%), Positives = 104/182 (57%), Gaps = 25/182 (14%)
 Frame = +2

Query  242  FLLSCGAPSKSTSQDG-RDW--DTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTAR  412
            F +SCG  +     DG R W  D D  YL     +T    +   A Q P  +QVP+TTAR
Sbjct  31   FTISCG--TTGIVFDGQRTWTGDADTKYLSGGQGSTVLTQA---ATQDPSVNQVPYTTAR  85

Query  413  VFTSELTYSFRVSPGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYTLLKNFS  592
            +  S+  YSF VS G KF+RL+FYPA+Y +        F +TD  F+V +N +T LK F+
Sbjct  86   LSPSQFNYSFPVSAGPKFVRLFFYPADYPS--------FPRTDASFSVQSNGFTFLKGFN  137

Query  593  AFLTvsspdpfvfspdpfIKKEFIVNVDDKQQLNLTFSPS---PYAFVNGIEIVSMPSDL  763
            A L               I +E++VNV+D + L L+F+PS    YAF+NGIE++SMPSDL
Sbjct  138  ASLN------ADAEATKTIFREYVVNVNDGETLILSFTPSQPNSYAFINGIEVLSMPSDL  191

Query  764  YF  769
            Y+
Sbjct  192  YY  193



>ref|XP_003552590.2| PREDICTED: receptor-like protein kinase FERONIA-like [Glycine 
max]
Length=922

 Score =   116 bits (290),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 70/185 (38%), Positives = 109/185 (59%), Gaps = 25/185 (14%)
 Frame = +2

Query  236  EFFLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARV  415
            E F ++CG+ S  +++DGR+W  D   ++F+  N   +++PA+    P   + P+T AR+
Sbjct  88   ELFSINCGSSSNLSTRDGRNWTAD---IKFLSENKDSVAAPALT---PSTLEGPYTDARL  141

Query  416  FTSELTYSFRVSPGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYTLLKNFSA  595
              S+ TYSF VS G KFLRL+FY  +Y        + F+++  +F+V A  YTLL+NF+A
Sbjct  142  SHSQFTYSFPVSTGPKFLRLFFYSTSY--------QNFHRSKAYFSVKAGPYTLLQNFNA  193

Query  596  FLTvsspdpfvfspdpfIKKEFIVNVDDKQQLNLTF-------SPSPYAFVNGIEIVSMP  754
             L           P  ++ +E+ +N+ D  +LN+TF       +P  YAF+NGIEIVSMP
Sbjct  194  SL----HADAGNEPGDYLFREYCINLKDGDRLNITFIASKTSQNPDSYAFINGIEIVSMP  249

Query  755  SDLYF  769
              LY+
Sbjct  250  PFLYY  254



>gb|KJB48087.1| hypothetical protein B456_008G053200 [Gossypium raimondii]
Length=851

 Score =   115 bits (289),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 79/209 (38%), Positives = 108/209 (52%), Gaps = 26/209 (12%)
 Frame = +2

Query  236  EFFLLSCGAPSKSTSQDGRDWDTDN----HYLQFMPTNTAELSSPAIAEQGPLASQVPFT  403
            E   L+CG+ S S   +GR+W  D+     ++     N   + S A     P    VP+ 
Sbjct  26   ENIFLNCGSSSNSIDLNGREWAGDSTPGSKFIASHQPNETSIVSKA-TNLNPSIDPVPYL  84

Query  404  TARVFTSELTYSFRVSPGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYTLLK  583
            TAR+F S  TYSF V+PG KFLRL+F P+ Y          F     FFTVTA  +TLL 
Sbjct  85   TARIFQSPFTYSFPVTPGHKFLRLFFNPSAYHG--------FQSPGDFFTVTAGPFTLLT  136

Query  584  NFSAFLTvsspdpfvfspdpfIKKEFIVNVDDKQQLNLTFSPS-----PYAFVNGIEIVS  748
            +FS  LT              + KEF +++ + Q LN+TFSPS      +AFVNGIEI+S
Sbjct  137  HFSPSLT------AQSLGLKTLDKEFCLHIQENQVLNITFSPSSVPLGAFAFVNGIEIIS  190

Query  749  MPSDLYFRGDNNNYPIISAVHFDNSTTME  835
            MP+ LY+   +   P+ +     NST +E
Sbjct  191  MPTHLYY--ISRARPMPNGFAVPNSTALE  217



>ref|XP_009373802.1| PREDICTED: receptor-like protein kinase FERONIA isoform X2 [Pyrus 
x bretschneideri]
Length=766

 Score =   115 bits (288),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 73/187 (39%), Positives = 104/187 (56%), Gaps = 29/187 (16%)
 Frame = +2

Query  248  LSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLAS-----QVPFTTAR  412
            ++CG        D R W  D H + + P+   +  + +I  + PL+S     QVP+T AR
Sbjct  45   IACGHSGPQILND-RSWTGDKHSI-YSPSGERQAGNTSITREAPLSSSSSASQVPYTMAR  102

Query  413  VFTSELTYSFRVS-PGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYTLLKNF  589
            +   E TY F  S  GQKF+RLYFYPA+Y        R FN++   F+V A  +TLL NF
Sbjct  103  LSPLEFTYRFSFSTAGQKFIRLYFYPASY--------RDFNRSQALFSVKAGGFTLLHNF  154

Query  590  SAFLTvsspdpfvfspdpfIKKEFIVNVDDKQQ-LNLTFSPS------PYAFVNGIEIVS  748
            +A              +  + +EF +N+DD++Q LN+TF+PS       YAF+NGIEIV 
Sbjct  155  NA------SAIADVYGEETLYREFCLNIDDQEQSLNITFTPSRAASPDAYAFINGIEIVD  208

Query  749  MPSDLYF  769
            MPS+LY+
Sbjct  209  MPSNLYY  215



>ref|XP_011099165.1| PREDICTED: receptor-like protein kinase FERONIA [Sesamum indicum]
Length=1197

 Score =   116 bits (290),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 77/209 (37%), Positives = 103/209 (49%), Gaps = 33/209 (16%)
 Frame = +2

Query  248  LSCGAPSKSTSQDGRDWDTDNHYLQ-FMPTNTAELSSPAIAEQGPLASQVPFTTARVFTS  424
            +SCG+  K T+ DGR W  D+ Y   F P    + S      Q      VP+ TARV   
Sbjct  39   ISCGSSGKLTAPDGRVWIGDSGYESSFSPQINGKPSKSRAIHQ---LDSVPYKTARVSHR  95

Query  425  ELTYSFRVSPGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYTLLKNFSAFLT  604
            E +Y F V PGQKF+RL+FY  +Y          F  +   FTV A  YTLL NF+A   
Sbjct  96   EFSYVFPVEPGQKFVRLHFYQGSYKG--------FKSSKALFTVKAGPYTLLSNFTA---  144

Query  605  vsspdpfvfspdpfIKKEFIVNVDDKQQLNLTFSPSP--------YAFVNGIEIVSMPSD  760
                          + +E+ VN+D+   L +TFSP+P        YAFVNGIE+V MP+ 
Sbjct  145  ------ADVLGSKQMIREYCVNIDNGGSLTITFSPAPRKRRSDNFYAFVNGIEVVYMPTS  198

Query  761  LYFRGDNN-NYPIISAV---HFDNSTTME  835
            LYF  +     P++      + DNST +E
Sbjct  199  LYFTPEGELGAPVVGQKYRFYIDNSTALE  227



>ref|XP_009373801.1| PREDICTED: receptor-like protein kinase FERONIA isoform X1 [Pyrus 
x bretschneideri]
Length=855

 Score =   115 bits (289),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 73/187 (39%), Positives = 104/187 (56%), Gaps = 29/187 (16%)
 Frame = +2

Query  248  LSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLAS-----QVPFTTAR  412
            ++CG        D R W  D H + + P+   +  + +I  + PL+S     QVP+T AR
Sbjct  45   IACGHSGPQILND-RSWTGDKHSI-YSPSGERQAGNTSITREAPLSSSSSASQVPYTMAR  102

Query  413  VFTSELTYSFRVS-PGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYTLLKNF  589
            +   E TY F  S  GQKF+RLYFYPA+Y        R FN++   F+V A  +TLL NF
Sbjct  103  LSPLEFTYRFSFSTAGQKFIRLYFYPASY--------RDFNRSQALFSVKAGGFTLLHNF  154

Query  590  SAFLTvsspdpfvfspdpfIKKEFIVNVDDKQQ-LNLTFSPS------PYAFVNGIEIVS  748
            +A              +  + +EF +N+DD++Q LN+TF+PS       YAF+NGIEIV 
Sbjct  155  NA------SAIADVYGEETLYREFCLNIDDQEQSLNITFTPSRAASPDAYAFINGIEIVD  208

Query  749  MPSDLYF  769
            MPS+LY+
Sbjct  209  MPSNLYY  215



>ref|XP_010660596.1| PREDICTED: receptor-like protein kinase FERONIA [Vitis vinifera]
Length=895

 Score =   115 bits (289),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 72/197 (37%), Positives = 116/197 (59%), Gaps = 27/197 (14%)
 Frame = +2

Query  236  EFFLLSCGAPSKSTSQDGRDW--DTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTA  409
            E F ++CG+ +++     R+W  D D+   +F P+   ELS+ ++A + P  S  P++TA
Sbjct  42   ENFAINCGS-AENWQALARNWTGDVDS---KFSPSEKGELSTTSLAAEQPFES-FPYSTA  96

Query  410  RVFTSELTYSFRVSPGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTV-TANNYTLLKN  586
            R+  +E TYSF ++ GQK++RL+FYP++Y          F+++  FF+V T   YTLL N
Sbjct  97   RLSRNEFTYSFPLTAGQKYIRLHFYPSSYG--------EFDRSKAFFSVKTGGGYTLLSN  148

Query  587  FSAFLTvsspdpfvfspdpfIKKEFIVNVDDK-QQLNLTFSPS----PYAFVNGIEIVSM  751
            FSA L               I +EF +N +++ ++LN+TF+P+     YAF+NGIEIVSM
Sbjct  149  FSAALA------AEDIQKETIVREFCINFNEEGEKLNITFTPTAGADAYAFINGIEIVSM  202

Query  752  PSDLYFRGDNNNYPIIS  802
            P +LY+   +  +  I 
Sbjct  203  PDNLYYTAQDGGFQFIG  219



>gb|KHN37917.1| Putative receptor-like protein kinase [Glycine soja]
Length=314

 Score =   112 bits (279),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 68/185 (37%), Positives = 106/185 (57%), Gaps = 23/185 (12%)
 Frame = +2

Query  236  EFFLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARV  415
            E F ++CG+ S  +++DGR+W  D   ++F+  N   +++PA+    P   + P+T AR 
Sbjct  35   EIFSINCGSNSSLSTRDGRNWTAD---IKFLSENKDSVAAPALT---PSTLEGPYTDARF  88

Query  416  FTSELTYSFRVSPGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYTLLKNFSA  595
              S+ TYSF VS G KFLRL+FY  +Y        + F+++  +F+V A  YTL ++F+A
Sbjct  89   SHSQFTYSFSVSTGPKFLRLFFYSTSY--------QNFHRSKAYFSVKAGPYTLFQDFNA  140

Query  596  FLTvsspdpfvfspdpfIKKEFIVNVDDKQQLNLTFSPSP-------YAFVNGIEIVSMP  754
             L   +           + +E+ +N+ D  +LN+TF PS        YAF+NGIEIVSMP
Sbjct  141  SLN--ADADDDPGQTDILFREYCINLKDGDRLNITFIPSKTSQHQDSYAFINGIEIVSMP  198

Query  755  SDLYF  769
              LY+
Sbjct  199  PFLYY  203



>gb|EAY75971.1| hypothetical protein OsI_03893 [Oryza sativa Indica Group]
Length=859

 Score =   115 bits (288),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 83/196 (42%), Positives = 101/196 (52%), Gaps = 30/196 (15%)
 Frame = +2

Query  242  FLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARVFT  421
             LL CGA  K    DGR W  D    ++ P   A L S + A Q P   QVP+ TARV  
Sbjct  50   ILLDCGATGKGNDTDGRVWSGDAGS-KYAP---ASLGSASAAGQDPSVPQVPYLTARVSA  105

Query  422  SELTYSFRVSPGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYTLLKNFSAFL  601
            +  TYSF +  G+KFLRL+FYPANYS+      R      F  +V A N TLL NFSA+ 
Sbjct  106  APFTYSFPLGAGRKFLRLHFYPANYSS------RDAADARFSVSVPAANVTLLSNFSAYQ  159

Query  602  TvsspdpfvfspdpfIKKEFIVNVDDKQQLNLTFS-----PSPYAFVNGIEIVSMPSDLY  766
            T             +I +EF VNV     + LTF+     P+ YAFVNGIE+VS P DL+
Sbjct  160  T------ATALNFAYIVREFSVNV-TTPTMELTFTPEKGHPNAYAFVNGIEVVSSP-DLF  211

Query  767  -------FRGDNNNYP  793
                     GD NN P
Sbjct  212  DISTPNLVTGDGNNQP  227



>ref|XP_004499647.1| PREDICTED: receptor-like protein kinase FERONIA-like [Cicer arietinum]
Length=575

 Score =   114 bits (285),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 82/205 (40%), Positives = 112/205 (55%), Gaps = 28/205 (14%)
 Frame = +2

Query  245  LLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARVFTS  424
            LL CG P  S + DGR W TD    +     + + +   +A   P   QVPF TA++F S
Sbjct  324  LLYCGGPFLSLNLDGRSWSTD----RGSNFRSGKSTMSEVATNDPPVPQVPFMTAQIFES  379

Query  425  ELTYSFRVSPGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYTLLKNFSAFLT  604
              TYSF V  G  FLRLYFYPA+YS          N +D  F VT+ +YTLL+NFS   T
Sbjct  380  PYTYSFPVPSGWIFLRLYFYPASYSG--------LNISDTRFGVTSQSYTLLRNFSVLET  431

Query  605  vsspdpfvfspdpfIKKEFIVNVDDKQQLNLTFSPS-----PYAFVNGIEIVSMPSDLYF  769
                   + S D ++ KE+ +++D    LN+TF+PS      YAFVN IE++SMP ++Y 
Sbjct  432  ------TLGSKDYYVVKEYSIHIDGG-TLNVTFTPSTTAINSYAFVNWIEVMSMP-NIYT  483

Query  770  RGDNNNYPII---SAVHFDNSTTME  835
              D++ Y I+   S    DN T +E
Sbjct  484  STDDDVYVIVGIRSVFTIDNRTALE  508


 Score =   101 bits (251),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 70/167 (42%), Positives = 96/167 (57%), Gaps = 24/167 (14%)
 Frame = +2

Query  359  AIAEQGPLASQVPFTTARVFTSELTYSFRVSPGQKFLRLYFYPANYSAAAGGGGRRFNKT  538
             +A   P   QVPF TAR+F S  TYSF VS G  FLRLYFYPA+YS          N +
Sbjct  17   VVATNDPAIPQVPFMTARIFESPYTYSFLVSSGWIFLRLYFYPASYSG--------LNIS  68

Query  539  DFFFTVTANNYTLLKNFSAFLTvsspdpfvfspdpfIKKEFIVNVDDKQQLNLTFSPS--  712
            D  F VT+ +YTLL+NF+   T       + S D ++  E+ +++D    LN+TF+PS  
Sbjct  69   DARFGVTSQSYTLLRNFNVLET------TLGSKDHYVVTEYFIHIDGG-TLNVTFTPSTT  121

Query  713  ---PYAFVNGIEIVSMPSDLYFRGDNNNYPII---SAVHFDNSTTME  835
                YAFVNGIE++SMP ++Y   D++ + I+   S    DN T +E
Sbjct  122  AINAYAFVNGIEVMSMP-NIYTSTDDDVHVIVGIRSVFTIDNITALE  167



>ref|NP_001044372.1| Os01g0769700 [Oryza sativa Japonica Group]
 dbj|BAB56062.1| putative protein kinase [Oryza sativa Japonica Group]
 dbj|BAD53342.1| putative protein kinase [Oryza sativa Japonica Group]
 dbj|BAF06286.1| Os01g0769700 [Oryza sativa Japonica Group]
 gb|EEE55446.1| hypothetical protein OsJ_03602 [Oryza sativa Japonica Group]
Length=896

 Score =   115 bits (288),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 83/196 (42%), Positives = 101/196 (52%), Gaps = 30/196 (15%)
 Frame = +2

Query  242  FLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARVFT  421
             LL CGA  K    DGR W  D    ++ P   A L S + A Q P   QVP+ TARV  
Sbjct  50   ILLDCGATGKGNDTDGRVWSGDAGS-KYAP---ASLGSASAAGQDPSVPQVPYLTARVSA  105

Query  422  SELTYSFRVSPGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYTLLKNFSAFL  601
            +  TYSF +  G+KFLRL+FYPANYS+      R      F  +V A N TLL NFSA+ 
Sbjct  106  APFTYSFPLGAGRKFLRLHFYPANYSS------RDAADARFSVSVPAANVTLLSNFSAYQ  159

Query  602  TvsspdpfvfspdpfIKKEFIVNVDDKQQLNLTFS-----PSPYAFVNGIEIVSMPSDLY  766
            T             +I +EF VNV     + LTF+     P+ YAFVNGIE+VS P DL+
Sbjct  160  T------ATALNFAYIVREFSVNV-TTPTMELTFTPEKGHPNAYAFVNGIEVVSSP-DLF  211

Query  767  -------FRGDNNNYP  793
                     GD NN P
Sbjct  212  DISTPNLVTGDGNNQP  227



>ref|XP_007151369.1| hypothetical protein PHAVU_004G040900g [Phaseolus vulgaris]
 gb|ESW23363.1| hypothetical protein PHAVU_004G040900g [Phaseolus vulgaris]
Length=746

 Score =   115 bits (287),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 72/186 (39%), Positives = 107/186 (58%), Gaps = 22/186 (12%)
 Frame = +2

Query  236  EFFLLSCGAPSKSTSQDG-RDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTAR  412
            + F +SCG    S+  DG R W  D  YL       +E ++     Q    +++P++TAR
Sbjct  30   DIFTISCGTTGNSS--DGQRRWTGDEEYLSSQDGTVSEKATT----QSFSINEIPYSTAR  83

Query  413  VFTSELTYSFRVSPGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYTLLKNFS  592
            +  S+  YSF VSPG KFLRL+FYPA+Y +        F+++   FTV +N +TLL  F+
Sbjct  84   LSRSQFNYSFPVSPGPKFLRLFFYPADYPS--------FSRSHASFTVQSNQFTLLNAFN  135

Query  593  AFL----TvsspdpfvfspdpfIKKEFIVNVDDKQQLNLTFSPS---PYAFVNGIEIVSM  751
            A L      +            I +E++VNV+D ++L LTF+PS    YAF+NGIE++SM
Sbjct  136  ASLHADAQAADAQAADAQATKTIFREYVVNVNDGERLILTFTPSHPNSYAFINGIEVLSM  195

Query  752  PSDLYF  769
            P+DLY+
Sbjct  196  PTDLYY  201



>ref|XP_003520131.2| PREDICTED: receptor-like protein kinase FERONIA-like [Glycine 
max]
Length=847

 Score =   115 bits (287),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 80/215 (37%), Positives = 117/215 (54%), Gaps = 34/215 (16%)
 Frame = +2

Query  236  EFFLLSCGAPSKSTSQ--DGRDWDTDNHYLQFMPTNTAE----LSSPAIAEQGPLASQVP  397
            E  +L+CG+   +  +  DGR+W  D     +MP++         +P   +  P   +VP
Sbjct  38   ENIVLNCGSNVSNVVEYVDGRNWSGDIAS-PYMPSDADTKFLVARAPNTLQSIP---EVP  93

Query  398  FTTARVFTSELTYSFRVSPGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYTL  577
            + TAR+F S+ TY+F V+PG KF+RL+FYPA+Y           N ++ F +V+A N+TL
Sbjct  94   YMTARIFQSQFTYTFNVTPGPKFIRLHFYPASY--------LNLNLSNAFLSVSAANFTL  145

Query  578  LKNFSAFLTvsspdpfvfspdpfIKKEFIVNVDDKQQLNLTFSPS-----PYAFVNGIEI  742
            L NFS  L         +    +  KEFIV+V  +  L LTF+P+      YAFVNGIE+
Sbjct  146  LHNFSVSLN------ADYLNVNYFMKEFIVHVSGR-VLELTFTPTYNASDAYAFVNGIEV  198

Query  743  VSMPSDLYFRGDNNNYPIIS----AVHFDNSTTME  835
            VSMP  LY RGD+   P++      V+  N + ME
Sbjct  199  VSMPLGLYSRGDDAPLPLVGHYPELVYIYNDSAME  233



>ref|XP_004306058.2| PREDICTED: receptor-like protein kinase FERONIA [Fragaria vesca 
subsp. vesca]
Length=864

 Score =   115 bits (287),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 75/192 (39%), Positives = 107/192 (56%), Gaps = 25/192 (13%)
 Frame = +2

Query  248  LSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARVFTSE  427
            L+CG   + T+   R W  D +  +F P   A  S    A     ASQVP+T AR+  SE
Sbjct  64   LACGNSGQPTNDLLRTWTGDVNS-KFTPIGNA--SESITAPMSSTASQVPYTKARLSRSE  120

Query  428  LTYSFRVSPGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYTLLKNFSAFLTv  607
             TY+  +SPGQKF+RL+F P  Y+         F +++  F+VTA  +TLLK+F+A +T 
Sbjct  121  FTYTIPLSPGQKFIRLHFNPDTYN-------NNFQRSNSLFSVTAAGFTLLKDFNASVT-  172

Query  608  sspdpfvfspdpfIKKEFIVNVDDKQQLNLTFSPSP--YAFVNGIEIVSMPSDLYFRGDN  781
                    S    + KEF VN++  Q+L++TF+PS   YAF+NGIE+VSMP+  Y+    
Sbjct  173  -----ADASGGSPLVKEFCVNIETGQRLDITFTPSKDAYAFINGIEVVSMPTGFYYTSSP  227

Query  782  N-------NYPI  796
            N       +YPI
Sbjct  228  NFIDTSASSYPI  239



>ref|XP_008379440.1| PREDICTED: receptor-like protein kinase FERONIA [Malus domestica]
Length=905

 Score =   115 bits (287),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 74/219 (34%), Positives = 120/219 (55%), Gaps = 28/219 (13%)
 Frame = +2

Query  236  EFFLLSCGAPSKSTSQ-DGRDWDTDNHYLQFMPTNT---AELSSPAIAEQGPLAS--QVP  397
            E   + CG+P +  ++ D R+W  D    +F P +    A  ++    E  P +S  Q+P
Sbjct  37   EDITVKCGSPGQLFNEYDERNWSGDIKS-KFTPIDVHQAAGSNTSVFKEALPSSSALQIP  95

Query  398  FTTARVFTSELTYSFRVSPGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYTL  577
            +TT R+  SE TY F +  GQKF+RLYFYP +Y          F++++  F+V A+ +TL
Sbjct  96   YTTVRLSRSEFTYRFNLXAGQKFIRLYFYPVSYP--------DFDRSEALFSVKASGFTL  147

Query  578  LKNFSAFLTvsspdpfvfspdpfIKKEFIVNVDDKQQ-LNLTFSPS-------PYAFVNG  733
            LK+F+A +   +           + +EF +N++++ Q LN+TF+PS        YAF+NG
Sbjct  148  LKDFNASVNADASXKADGYEVGTLYREFCINIEEEDQSLNITFTPSGSKASPDAYAFING  207

Query  734  IEIVSMPSDLYFRGDNNNYPI-----ISAVHFDNSTTME  835
            IEIVSMP +LY+    + + I      + +  +N+T ME
Sbjct  208  IEIVSMPPNLYYTAPEDPHGIEMIGTENTIRVENNTAME  246



>ref|XP_007216888.1| hypothetical protein PRUPE_ppa020589mg [Prunus persica]
 gb|EMJ18087.1| hypothetical protein PRUPE_ppa020589mg [Prunus persica]
Length=887

 Score =   115 bits (287),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 70/187 (37%), Positives = 112/187 (60%), Gaps = 22/187 (12%)
 Frame = +2

Query  236  EFFLLSCG-APSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLA---SQVPFT  403
            E   ++CG +  K    DGR+W  D +  +F P     + + + +++ P +     VP+T
Sbjct  52   EDITVNCGYSGDKIGEDDGRNWIGDINS-KFSPFEHQAVGNKSESKEAPHSYTFKPVPYT  110

Query  404  TARVFTSELTYSFRVSPGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYTLLK  583
            T R+  SE TYSF+++ GQKF+RLYF P +Y       G  F+++   F+V A N+TLL 
Sbjct  111  TVRLSRSEFTYSFKLNSGQKFIRLYFNPVSY-------GPDFDQSKALFSVKAGNFTLLH  163

Query  584  NFSAFLTvsspdpfvfspdpfIKKEFIVNVDDKQQLNLTFSPS-----PYAFVNGIEIVS  748
            +F+A +T        F+    I +EF +N+D+++ LN+TF+PS      Y+F+NGIEIVS
Sbjct  164  DFNASVT-----AEAFNFTKIIYREFCLNIDEEKSLNITFTPSRTIPDAYSFINGIEIVS  218

Query  749  MPSDLYF  769
            MP++LY+
Sbjct  219  MPTNLYY  225



>gb|KHN29954.1| Receptor-like protein kinase FERONIA [Glycine soja]
Length=841

 Score =   114 bits (286),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 80/215 (37%), Positives = 117/215 (54%), Gaps = 34/215 (16%)
 Frame = +2

Query  236  EFFLLSCGAPSKSTSQ--DGRDWDTDNHYLQFMPTNTAE----LSSPAIAEQGPLASQVP  397
            E  +L+CG+   +  +  DGR+W  D     +MP++         +P   +  P   +VP
Sbjct  33   ENIVLNCGSNVSNVVEYVDGRNWSGDIAS-PYMPSDADTKFLVARAPNTLQSIP---EVP  88

Query  398  FTTARVFTSELTYSFRVSPGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYTL  577
            + TAR+F S+ TY+F V+PG KF+RL+FYPA+Y           N ++ F +V+A N+TL
Sbjct  89   YMTARIFQSQFTYTFNVTPGPKFIRLHFYPASY--------LNLNLSNAFLSVSAANFTL  140

Query  578  LKNFSAFLTvsspdpfvfspdpfIKKEFIVNVDDKQQLNLTFSPS-----PYAFVNGIEI  742
            L NFS  L         +    +  KEFIV+V  +  L LTF+P+      YAFVNGIE+
Sbjct  141  LHNFSVSLN------ADYLNVNYFMKEFIVHVSGR-VLELTFTPTYNASDAYAFVNGIEV  193

Query  743  VSMPSDLYFRGDNNNYPIIS----AVHFDNSTTME  835
            VSMP  LY RGD+   P++      V+  N + ME
Sbjct  194  VSMPLGLYSRGDDAPLPLVGHYPELVYIYNDSAME  228



>gb|KHN37921.1| Receptor-like protein kinase FERONIA [Glycine soja]
Length=855

 Score =   114 bits (286),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 72/197 (37%), Positives = 117/197 (59%), Gaps = 21/197 (11%)
 Frame = +2

Query  236  EFFLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARV  415
            E F ++CG+ S  +++DGR+W  D   ++F+  N   +++PA+    P   + P+T AR 
Sbjct  35   ELFSINCGSNSSLSTRDGRNWTAD---IKFLSENKDSVAAPALT---PSILEGPYTDARF  88

Query  416  FTSELTYSFRVSPGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYTLLKNFSA  595
              S+ TYSF VS G KFLRL+FY  +Y        + F+++  +F+V A  YTLL+ F+A
Sbjct  89   SHSQFTYSFPVSTGPKFLRLFFYSTSY--------QNFHRSQAYFSVKAGPYTLLQYFNA  140

Query  596  FLTvsspdpfvfspdpfIKKEFIVNVDDKQQLNLTFSPS---PYAFVNGIEIVSMPSDLY  766
             L           PD F+ +E+ +N+ D ++LN++F PS    YAF+NGIEIVSMP  LY
Sbjct  141  SLN----ADADDDPDNFLFREYCINLRDGERLNISFIPSTEDSYAFINGIEIVSMPPFLY  196

Query  767  FRGDNNNYPIISAVHFD  817
            +   +++ P +  ++ +
Sbjct  197  YTNPDDDLPQLVGLNMN  213



>ref|XP_010450843.1| PREDICTED: putative receptor-like protein kinase At5g39000 [Camelina 
sativa]
Length=867

 Score =   114 bits (286),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 82/208 (39%), Positives = 111/208 (53%), Gaps = 22/208 (11%)
 Frame = +2

Query  236  EFFLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAE-QGPLASQVPFTTAR  412
            + FL +CG  S +    GR+W  +  Y + M +N    S  + A  Q    SQ+P+  AR
Sbjct  31   DVFLFNCGGTSNNFDDTGRNWTVE--YPKTMSSNLVNASFTSEASYQESGVSQIPYMKAR  88

Query  413  VFTSELTYSFRVS-PGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYTLLKNF  589
            +F S+ TY+F+V+ PG KFLRLYFYP  Y       G  F+  + FF+V  N +TLL NF
Sbjct  89   IFRSQFTYTFQVTTPGSKFLRLYFYPTRY-------GSNFDAVNSFFSVKVNGFTLLNNF  141

Query  590  SAFLTvsspdpfvfspdpfIKKEFIVNVDDKQQLNLTFSPS--PYAFVNGIEIVSMPSDL  763
            SA LTV +                +      + L+LTF+PS    AFVNGIEIVSMP  L
Sbjct  142  SADLTVKASKTKTKFIIIKEFIIPV-----NRTLHLTFTPSTNSLAFVNGIEIVSMPQRL  196

Query  764  YFRG--DNNNYPIISAV--HFDNSTTME  835
            Y +G  D+    + S+V  H +NST  E
Sbjct  197  YSKGGFDDVITNVGSSVDFHIENSTAFE  224



>gb|ABT18100.1| FERONIA receptor-like kinase [Arabidopsis thaliana]
Length=893

 Score =   114 bits (286),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 88/208 (42%), Positives = 113/208 (54%), Gaps = 25/208 (12%)
 Frame = +2

Query  236  EFFLLSCGA-PSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTAR  412
            E  LL+CG   S  T  D R W +D        ++    +SPA+  Q P   +VP+ TAR
Sbjct  32   EKILLNCGGGASNLTDTDNRIWISDVKSKFLSSSSEDSKTSPALT-QDPSVPEVPYMTAR  90

Query  413  VFTSELTYSFRVSPGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYTLLKNFS  592
            VF S  TY+F V+ G+KF+RLYFYP +Y           N T+  F+V+   YTLLKNFS
Sbjct  91   VFRSPFTYTFPVASGRKFVRLYFYPNSYDG--------LNATNSLFSVSFGPYTLLKNFS  142

Query  593  AFLTvsspdpfvfspdpfIKKEFIVNVDDKQQLNLTFSP--SP---YAFVNGIEIVSMPS  757
            A  T             FI KEF+VNV+    LN+TF+P  SP   YAFVNGIE+ SMP 
Sbjct  143  ASQT------AEALTYAFIIKEFVVNVEGG-TLNMTFTPESSPSNAYAFVNGIEVTSMP-  194

Query  758  DLYFRGDNNNYPIIS--AVHFDNSTTME  835
            D+Y   D     + S  +V  DNST +E
Sbjct  195  DMYSSTDGTLTMVGSSGSVTIDNSTALE  222



>ref|XP_010660577.1| PREDICTED: receptor-like protein kinase FERONIA [Vitis vinifera]
Length=876

 Score =   114 bits (286),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 80/209 (38%), Positives = 109/209 (52%), Gaps = 28/209 (13%)
 Frame = +2

Query  248  LSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAE---QGPLASQVPFTTARVF  418
            L+CG+P  + + D R W  D     F        ++  I+E   Q P   + P+ TAR+F
Sbjct  36   LNCGSPGVTMALDSRLWQGDEQS-NFTSAPKQLQNASFISEARQQAPSIDRTPYMTARIF  94

Query  419  TSELTYSFR-VSPGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYTLLKNFSA  595
             S  TY F  V PG KF+RL+FYP  Y          F+ +  FF+VT + YT L NFSA
Sbjct  95   RSPFTYVFDPVPPGPKFIRLHFYPVLYG--------EFDGSKTFFSVTVSTYTFLSNFSA  146

Query  596  FLTvsspdpfvfspdpfIKKEFIVNVDDKQQLNLTFSPSP-----YAFVNGIEIVSMPSD  760
             LT  S             KEF +N+ + Q LN+TF PS      YAF+NGIEIVSMP  
Sbjct  147  SLTAQSLGLEA------FSKEFCINLAEDQLLNITFIPSSETSDGYAFINGIEIVSMPDY  200

Query  761  LYFRGDNNNY-PII---SAVHFDNSTTME  835
            LY+ G ++ + PII   S++  D +  +E
Sbjct  201  LYYSGSDDIWVPIIGQSSSMPIDEALALE  229



>gb|AAK59558.1| putative receptor-protein kinase [Arabidopsis thaliana]
Length=895

 Score =   114 bits (285),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 86/208 (41%), Positives = 112/208 (54%), Gaps = 25/208 (12%)
 Frame = +2

Query  236  EFFLLSCGA-PSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTAR  412
            E  LL+CG   S  T  D R W +D        ++    +SPA+  Q P   +VP+ TAR
Sbjct  34   EKILLNCGGGASNLTDTDNRIWISDVKSKFLSSSSEDSKTSPALT-QDPSVPEVPYMTAR  92

Query  413  VFTSELTYSFRVSPGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYTLLKNFS  592
            VF S  TY+F V+ G+KF+RLYFYP +Y           N T+  F+V+   YTLLKNFS
Sbjct  93   VFRSPFTYTFPVASGRKFVRLYFYPNSYDG--------LNATNSLFSVSFGPYTLLKNFS  144

Query  593  AFLTvsspdpfvfspdpfIKKEFIVNVDDKQQLNLTFSP-----SPYAFVNGIEIVSMPS  757
            A  T             FI KEF+VNV+    LN+TF+P     + YAFVNGIE+ SMP 
Sbjct  145  ASQT------AEALTYAFIIKEFVVNVEGG-TLNMTFTPESAPSNAYAFVNGIEVTSMP-  196

Query  758  DLYFRGDNNNYPIIS--AVHFDNSTTME  835
            D+Y   D     + S  +V  DNST +E
Sbjct  197  DMYSSTDGTLTMVGSSGSVTIDNSTALE  224



>ref|XP_006482013.1| PREDICTED: receptor-like protein kinase FERONIA-like [Citrus 
sinensis]
Length=835

 Score =   114 bits (285),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 85/218 (39%), Positives = 114/218 (52%), Gaps = 45/218 (21%)
 Frame = +2

Query  236  EFFLLSCGAPSKSTSQDGRDW--DTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTA  409
            E   L+CG+   S + D R W  D ++ Y    P N  E S    A Q P     P++  
Sbjct  37   ESIFLACGSTGSSGTLDYRTWIGDINSEYSPSEPEN--EASRTFTAPQQP-----PYSAV  89

Query  410  RVFTSELTYSFRVSPGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYTLLKNF  589
            R+  S+ TY+F ++ GQKF+RLYFY  +YS         FN +  FF+V A ++TLL NF
Sbjct  90   RLSQSQFTYTFNLTAGQKFIRLYFYSTSYSG--------FNSSKAFFSVKAGSFTLLSNF  141

Query  590  SAFLTvsspdpfvfspdpfIKKEFIVNVDDKQQ-LNLTFSPSP-----YAFVNGIEIVSM  751
            SA LT  +    +F       KEF +NV++ Q+ LN+T   SP     YAF+NGIEIVSM
Sbjct  142  SASLTADALGKDLFF------KEFCINVEEGQRFLNITLMASPDYKDSYAFINGIEIVSM  195

Query  752  PSDLY----------FRGDNNNYPIISAVHFDNSTTME  835
            P +LY          F G  N Y II      NST++E
Sbjct  196  PPNLYYTAANDPGFEFVGQGNQYGII------NSTSLE  227



>ref|XP_006654257.1| PREDICTED: receptor-like protein kinase FERONIA-like [Oryza brachyantha]
Length=889

 Score =   114 bits (285),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 75/175 (43%), Positives = 97/175 (55%), Gaps = 19/175 (11%)
 Frame = +2

Query  242  FLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARVFT  421
             LL+CGA +  T    R WD D    +F P+    L + A  +   L S VP++TARVF 
Sbjct  36   ILLNCGASAAQTDNYNRSWDGDASS-RFAPS-VRGLQASAGYQDPSLPSPVPYSTARVFA  93

Query  422  SELTYSFRVSPGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYTLLKNFSAFL  601
            S  TYSF V PG+ FLRLYFYP +Y       G R++  D +F V AN+  LL +F+A  
Sbjct  94   SNYTYSFPVGPGRVFLRLYFYPTDY-------GSRYDSADAYFGVAANDLVLLDSFNASQ  146

Query  602  TvsspdpfvfspdpfIKKEFIVNVDDKQQLNLTFSPSP----YAFVNGIEIVSMP  754
            T       + +   ++ +EF VNV     LNLTF+PS     YAFVNGIEIV  P
Sbjct  147  T------ALATNFAYLIREFSVNVTTSGGLNLTFAPSARNGSYAFVNGIEIVPTP  195



>ref|NP_190723.1| receptor-like protein kinase FERONIA [Arabidopsis thaliana]
 sp|Q9SCZ4.1|FERON_ARATH RecName: Full=Receptor-like protein kinase FERONIA; AltName: 
Full=Protein SIRENE; Flags: Precursor [Arabidopsis thaliana]
 emb|CAB63019.1| receptor-protein kinase-like protein [Arabidopsis thaliana]
 gb|AEE78805.1| receptor-like protein kinase FERONIA [Arabidopsis thaliana]
Length=895

 Score =   114 bits (285),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 86/208 (41%), Positives = 112/208 (54%), Gaps = 25/208 (12%)
 Frame = +2

Query  236  EFFLLSCGA-PSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTAR  412
            E  LL+CG   S  T  D R W +D        ++    +SPA+  Q P   +VP+ TAR
Sbjct  34   EKILLNCGGGASNLTDTDNRIWISDVKSKFLSSSSEDSKTSPALT-QDPSVPEVPYMTAR  92

Query  413  VFTSELTYSFRVSPGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYTLLKNFS  592
            VF S  TY+F V+ G+KF+RLYFYP +Y           N T+  F+V+   YTLLKNFS
Sbjct  93   VFRSPFTYTFPVASGRKFVRLYFYPNSYDG--------LNATNSLFSVSFGPYTLLKNFS  144

Query  593  AFLTvsspdpfvfspdpfIKKEFIVNVDDKQQLNLTFSP-----SPYAFVNGIEIVSMPS  757
            A  T             FI KEF+VNV+    LN+TF+P     + YAFVNGIE+ SMP 
Sbjct  145  ASQT------AEALTYAFIIKEFVVNVEGG-TLNMTFTPESAPSNAYAFVNGIEVTSMP-  196

Query  758  DLYFRGDNNNYPIIS--AVHFDNSTTME  835
            D+Y   D     + S  +V  DNST +E
Sbjct  197  DMYSSTDGTLTMVGSSGSVTIDNSTALE  224



>ref|XP_011623570.1| PREDICTED: LOW QUALITY PROTEIN: receptor-like protein kinase 
FERONIA [Amborella trichopoda]
Length=882

 Score =   114 bits (285),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 77/183 (42%), Positives = 106/183 (58%), Gaps = 26/183 (14%)
 Frame = +2

Query  242  FLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAE-QGP-LASQVPFTTARV  415
             L++CG+ S     DGR W  D H  ++  T  +E + PA AE Q P L S +P+ +AR+
Sbjct  43   ILVNCGSSSDGVDADGRSWKGDVHGSRY--TLDSENTVPARAETQDPSLPSTIPYMSARI  100

Query  416  FTSELTYSFRVSPGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTAN-NYTLLKNFS  592
            F+S  TY F V+PG+ ++RL+FYP++YS          +  D  F+V A+  + LL+NFS
Sbjct  101  FSSRSTYEFSVTPGRHWVRLHFYPSSYSG--------LSPDDALFSVEASGGFMLLRNFS  152

Query  593  AFLTvsspdpfvfspdpfIKKEFIVNVDDKQQLNLTFSP-----SPYAFVNGIEIVSMPS  757
            A +T             +I +EF VNV  K  L+LTF P     S YAFVNGIEIVSMP 
Sbjct  153  ASIT------ATALTQAYIIREFSVNVTGK-SLSLTFEPSVKHRSAYAFVNGIEIVSMP-  204

Query  758  DLY  766
            D+Y
Sbjct  205  DIY  207



>ref|XP_007139451.1| hypothetical protein PHAVU_008G030700g [Phaseolus vulgaris]
 gb|ESW11445.1| hypothetical protein PHAVU_008G030700g [Phaseolus vulgaris]
Length=858

 Score =   114 bits (284),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 69/188 (37%), Positives = 107/188 (57%), Gaps = 18/188 (10%)
 Frame = +2

Query  236  EFFLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARV  415
            E F +SCG+ +  ++ D R+W  D H+L   PT    +++P++    P   Q P+T AR+
Sbjct  36   ELFSISCGSSTNFSTLDTRNWTADIHFLS--PTTHLSVAAPSLT---PSTQQGPYTYARL  90

Query  416  FTSELTYSFRVSPGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYTLLKNFSA  595
              S  TYSF ++PG KF+RL+FY  +Y        + FN++   F+V A  YTLL+ F+A
Sbjct  91   SHSPFTYSFPLTPGPKFIRLFFYSTSY--------QNFNRSQACFSVKAGPYTLLQGFNA  142

Query  596  FLTvsspdpfvfspdpfIKKEFIVNVDDKQQLNLTFSPS---PYAFVNGIEIVSMPSDLY  766
             L   +      S    + +E+ +N+ D + LN+ F P+    YAF+NGIEIVSMP  LY
Sbjct  143  SLN--ADADDDPSHSDILFREYCINLQDAENLNIIFIPNTTDSYAFINGIEIVSMPPSLY  200

Query  767  FRGDNNNY  790
            +   + +Y
Sbjct  201  YTDPDEDY  208



>ref|XP_007151358.1| hypothetical protein PHAVU_004G039800g [Phaseolus vulgaris]
 gb|ESW23352.1| hypothetical protein PHAVU_004G039800g [Phaseolus vulgaris]
Length=813

 Score =   114 bits (284),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 71/186 (38%), Positives = 105/186 (56%), Gaps = 24/186 (13%)
 Frame = +2

Query  236  EFFLLSCGAPSKSTSQDG-RDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTAR  412
            + F +SCG    S+  DG R W  D  YL       +E ++     Q    +++P++TAR
Sbjct  29   DIFTISCGTTGNSS--DGQRRWTGDEEYLSSQDGTVSEKATT----QSFSINEIPYSTAR  82

Query  413  VFTSELTYSFRVSPGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYTLLKNFS  592
            +  S+  YSF VSPG KFLRL+FYP++Y +        F +    FT+ +N +TLL  F+
Sbjct  83   LSRSQFNYSFPVSPGPKFLRLFFYPSDYPS--------FPRNQASFTLQSNQFTLLNAFN  134

Query  593  AFLTvsspdpfvfspdpfIKKEFIVNVDDKQQLNLTFSPS---PYAFVNGIEIVSMPSDL  763
            A L               I +E++VNV+D ++L LTF+PS    YAF+NGIE++SMP+DL
Sbjct  135  ASL------HADDQATTTIFREYVVNVNDGERLILTFTPSHPNSYAFINGIEVLSMPADL  188

Query  764  YFRGDN  781
            Y+   N
Sbjct  189  YYTQQN  194



>gb|ERN06449.1| hypothetical protein AMTR_s00016p00259140 [Amborella trichopoda]
Length=856

 Score =   114 bits (284),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 77/183 (42%), Positives = 106/183 (58%), Gaps = 26/183 (14%)
 Frame = +2

Query  242  FLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAE-QGP-LASQVPFTTARV  415
             L++CG+ S     DGR W  D H  ++  T  +E + PA AE Q P L S +P+ +AR+
Sbjct  42   ILVNCGSSSDGVDADGRSWKGDVHGSRY--TLDSENTVPARAETQDPSLPSTIPYMSARI  99

Query  416  FTSELTYSFRVSPGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTAN-NYTLLKNFS  592
            F+S  TY F V+PG+ ++RL+FYP++YS          +  D  F+V A+  + LL+NFS
Sbjct  100  FSSRSTYEFSVTPGRHWVRLHFYPSSYSG--------LSPDDALFSVEASGGFMLLRNFS  151

Query  593  AFLTvsspdpfvfspdpfIKKEFIVNVDDKQQLNLTFSP-----SPYAFVNGIEIVSMPS  757
            A +T             +I +EF VNV  K  L+LTF P     S YAFVNGIEIVSMP 
Sbjct  152  ASIT------ATALTQAYIIREFSVNVTGK-SLSLTFEPSVKHRSAYAFVNGIEIVSMP-  203

Query  758  DLY  766
            D+Y
Sbjct  204  DIY  206



>ref|XP_008230911.1| PREDICTED: receptor-like protein kinase FERONIA [Prunus mume]
Length=879

 Score =   114 bits (284),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 78/217 (36%), Positives = 114/217 (53%), Gaps = 40/217 (18%)
 Frame = +2

Query  248  LSCGAPSKSTS-QDGRDWDTD-NHYLQFMPTNTAELSSPAIAEQGPLAS---QVPFTTAR  412
            ++CG+   S +  D R+W  D N  L     N A  ++ +   + P +S   QVP+T AR
Sbjct  37   INCGSSGTSLNMDDNRNWTGDINSKLSPSEFNQANTNTSSQVREAPTSSSVSQVPYTMAR  96

Query  413  VFTSELTYSFRVSPGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYTLLKNFS  592
            +  SE TY   +S GQKF+R YF P +Y       G  F+++   F+V A  +TLL +F+
Sbjct  97   LSRSEFTYKVPLSTGQKFIRFYFRPVSY-------GPDFDRSKALFSVQAGGFTLLHDFN  149

Query  593  AFLTvsspdpfvfspdpfIKKEFIVNVDDKQQLNLTFSPS-----PYAFVNGIEIVSMPS  757
            A +T              + +EF +N+D+ Q L +TF+P+      YAF+NGIEIVSMP+
Sbjct  150  ASVT------ADAGKTEKLIREFCLNIDEGQSLTITFTPNRAISDAYAFINGIEIVSMPT  203

Query  758  DLY-----------FRGDNNNYPIISAVHFDNSTTME  835
            +LY           F G+ NNY I      +NST ME
Sbjct  204  NLYYTPPENRYGADFVGNGNNYLI------ENSTAME  234



>ref|XP_006482014.1| PREDICTED: receptor-like protein kinase FERONIA-like [Citrus 
sinensis]
Length=834

 Score =   114 bits (284),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 85/218 (39%), Positives = 113/218 (52%), Gaps = 45/218 (21%)
 Frame = +2

Query  236  EFFLLSCGAPSKSTSQDGRDW--DTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTA  409
            E   L+CG+   S + D R W  D ++ Y    P N  E S    A Q P     P++  
Sbjct  37   ESIFLACGSTGSSGTLDYRTWIGDINSEYSPSEPEN--EASRTFTAPQQP-----PYSAV  89

Query  410  RVFTSELTYSFRVSPGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYTLLKNF  589
            R+  S+ TY+F ++ GQKF+RLYFY  +YS         FN +  FF+V A ++TLL NF
Sbjct  90   RLSQSQFTYTFNLTAGQKFIRLYFYSTSYSG--------FNSSKAFFSVKAGSFTLLSNF  141

Query  590  SAFLTvsspdpfvfspdpfIKKEFIVNVDDKQQ-LNLTFSPSP-----YAFVNGIEIVSM  751
            SA LT  +    +F       KEF +NV++ Q+ LN+T   SP     YAF+NGIEIVSM
Sbjct  142  SASLTADALGKDLFF------KEFCINVEEGQRFLNITLMASPDYKDSYAFINGIEIVSM  195

Query  752  PSDLY----------FRGDNNNYPIISAVHFDNSTTME  835
            P +LY          F G  N Y II      NST +E
Sbjct  196  PPNLYYTAANGPGFVFVGQGNQYRII------NSTALE  227



>ref|XP_003614252.1| Kinase-like protein [Medicago truncatula]
 gb|AES97210.1| feronia receptor-like kinase [Medicago truncatula]
Length=817

 Score =   113 bits (283),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 82/216 (38%), Positives = 119/216 (55%), Gaps = 35/216 (16%)
 Frame = +2

Query  236  EFFLLSCGAPSKSTSQ-DGRDW--DTDNHYLQFMPTNTAELSSPAIAEQGP--LAS--QV  394
            E  +L+CG+ +    Q DGR W  D D+ Y+     +  E+ + ++  + P  L S  +V
Sbjct  32   ENIVLNCGSNTSELVQYDGRIWNGDIDSPYV----PSYEEIINKSLTAKAPSNLQSIPEV  87

Query  395  PFTTARVFTSELTYSFRVSPGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYT  574
            P+ TAR+F S+ TY F V+ G KF+RL+FYP +Y          FN +  F +VTA N+T
Sbjct  88   PYMTARIFQSQFTYRFNVTSGPKFIRLHFYPFSY--------LNFNISKAFLSVTAGNFT  139

Query  575  LLKNFSAFLTvsspdpfvfspdpfIKKEFIVNVDDKQQLNLTFSPS-----PYAFVNGIE  739
            LL NFS  L         +    ++ KEFIV+V     L LTF+PS      YAFVNGIE
Sbjct  140  LLHNFSVSLN------VDYFNLAYLMKEFIVHVKG-NSLELTFTPSSNDSDAYAFVNGIE  192

Query  740  IVSMPSDLYFRGDNNNYPIIS----AVHFDNSTTME  835
            +VS+P+ LY  GD++  P++      V+  N + ME
Sbjct  193  VVSIPNGLYIGGDDSPIPLVGHDTKVVYIYNDSAME  228



>ref|XP_003614249.1| Kinase-like protein [Medicago truncatula]
 gb|AES97207.1| feronia receptor-like kinase [Medicago truncatula]
Length=833

 Score =   113 bits (283),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 80/212 (38%), Positives = 115/212 (54%), Gaps = 27/212 (13%)
 Frame = +2

Query  236  EFFLLSCGAPSKSTSQ-DGRDW--DTDNHYL-QFMPTNTAELSSPAIAEQGPLASQVPFT  403
            E  +L+CG+ +    Q DGR W  D D+ Y+  +       L++ A++       +VP+ 
Sbjct  32   ENIVLNCGSNTSELVQYDGRIWNGDIDSPYVPSYEDIINKSLTAKALSSNLESIPEVPYM  91

Query  404  TARVFTSELTYSFRVSPGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYTLLK  583
            TAR+F S+ TY F V+ G KF+RL+FYP +Y          FN +  F +VTA N+TLL 
Sbjct  92   TARIFQSQFTYRFNVTSGPKFIRLHFYPFSY--------LDFNISKAFLSVTAGNFTLLH  143

Query  584  NFSAFLTvsspdpfvfspdpfIKKEFIVNVDDKQQLNLTFSPS-----PYAFVNGIEIVS  748
            NFS  L         +    ++ KEFIV+V     L LTF+PS      YAFVNGIE+VS
Sbjct  144  NFSVSLN------VDYFNLAYLMKEFIVHV-KGNSLELTFTPSSNDSDAYAFVNGIEVVS  196

Query  749  MPSDLYFRGDNNNYPII---SAVHFDNSTTME  835
            +P+ LY  GD++  P     + V+  N + ME
Sbjct  197  IPNGLYIGGDDSPIPFAGHDTIVYIYNDSAME  228



>gb|KHN04378.1| Receptor-like protein kinase FERONIA [Glycine soja]
Length=862

 Score =   113 bits (283),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 72/180 (40%), Positives = 101/180 (56%), Gaps = 21/180 (12%)
 Frame = +2

Query  242  FLLSCGAPSKSTSQDG-RDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARVF  418
            F +SCG  +  TS DG R W  D H  +++     +  S     Q P   QVP+T+ R+ 
Sbjct  30   FSISCG--TTGTSFDGERTWTGDIHK-KYLSGGQDDTVSTEATTQSPSVKQVPYTSVRLS  86

Query  419  TSELTYSFRVSPGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYTLLKNFSAF  598
             S+  YSF V+ G KF+RL+FYPA+Y +        F +TD  FTV +N +TLLK F+  
Sbjct  87   RSQFNYSFPVTAGPKFVRLFFYPADYPS--------FPRTDASFTVQSNQFTLLKGFNTS  138

Query  599  LTvsspdpfvfspdpfIKKEFIVNVDDKQQLNLTFSPSP---YAFVNGIEIVSMPSDLYF  769
            L               I  E++VNV+D   L L+F+PS    YAF+NGIE++SMP+DLY+
Sbjct  139  LN------ADAGKTETIFGEYVVNVNDGGILLLSFTPSKPYSYAFINGIEVLSMPTDLYY  192



>ref|XP_010435808.1| PREDICTED: probable receptor-like protein kinase At5g39030 [Camelina 
sativa]
Length=825

 Score =   113 bits (282),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 86/208 (41%), Positives = 116/208 (56%), Gaps = 17/208 (8%)
 Frame = +2

Query  236  EFFLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNT--AELSSPAIAEQGPLASQVPFTTA  409
            E  L++CG  S +    GR+W  +    + +P+N+     +S A +++     QVP+  A
Sbjct  40   EVILINCGEFSFTFDTGGRNWMPEAEK-KILPSNSDYTSFTSDASSDKESWTPQVPYMNA  98

Query  410  RVFTSELTYSFRVSPGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYTLLKNF  589
            R+F S+ TYSF +SPG KF+RL+FYP  Y     G G  F+    FF+V+ N +TLL NF
Sbjct  99   RIFRSDFTYSFPLSPGWKFIRLHFYPCYYYGYH-GYGPDFDAVSSFFSVSLNGFTLLTNF  157

Query  590  SAFLTvsspdpfvfspdpfIKKEFIVNVDDKQQLNLTFSPSP--YAFVNGIEIVSMPSDL  763
            SA LT           +P + KEFIV V   Q LNLTF P+    AFV GIEIVSMP   
Sbjct  158  SADLT-----VKASKGEPTLIKEFIVPV--HQGLNLTFRPAKKSLAFVKGIEIVSMPDRF  210

Query  764  YFRG--DNNNYPIISAVHF--DNSTTME  835
            Y +G  DN    + S V F  +NST +E
Sbjct  211  YSKGGFDNMVSEVGSTVDFKIENSTALE  238



>ref|XP_007032813.1| Malectin/receptor-like protein kinase family protein [Theobroma 
cacao]
 gb|EOY03739.1| Malectin/receptor-like protein kinase family protein [Theobroma 
cacao]
Length=517

 Score =   111 bits (277),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 70/186 (38%), Positives = 103/186 (55%), Gaps = 27/186 (15%)
 Frame = +2

Query  248  LSCGAPSKSTSQDGRDWDTDNH-YLQFMPTNTAELSSPAIAEQGPLASQVPFTTARVFTS  424
            L CG+   +T   GR W  D+  YL      +   SSP   +       +P+ TAR+  S
Sbjct  49   LDCGSTGNNTDLAGRSWLADSTIYLDRSNKVSVISSSPTKGDS------IPYRTARLSRS  102

Query  425  ELTYSFRVSPGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYTLLKNFSAFLT  604
            + +YSF V+PG KF+RL+FYP +Y        + FN++   F V    YTLL+N+SA LT
Sbjct  103  QFSYSFTVTPGPKFIRLHFYPTSY--------QEFNRSKASFDVHIGRYTLLRNYSAALT  154

Query  605  vsspdpfvfspdpfIKKEFIVNVDDKQQLNLTFSPS-----PYAFVNGIEIVSMPSDLYF  769
                            +EF +NVDD Q+LN+ F+P+      YAF+NGIEIVSMP++LY+
Sbjct  155  ------ADDLKSEVFSREFCINVDD-QKLNILFTPNTRMPDSYAFINGIEIVSMPNNLYY  207

Query  770  RGDNNN  787
              ++++
Sbjct  208  SAEDDS  213



>ref|XP_007227151.1| hypothetical protein PRUPE_ppa026453mg [Prunus persica]
 gb|EMJ28350.1| hypothetical protein PRUPE_ppa026453mg [Prunus persica]
Length=860

 Score =   113 bits (282),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 68/181 (38%), Positives = 104/181 (57%), Gaps = 23/181 (13%)
 Frame = +2

Query  242  FLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARVFT  421
            +++SCG+ S  T  DGR W +D+   QF+ ++    ++ A  +   L SQVP+ +AR+F 
Sbjct  31   YVISCGSSSGGTDSDGRKWASDS---QFLTSSYKSNTATAQYQDPSLPSQVPYMSARIFN  87

Query  422  SELTYSFRVSPGQKFL-RLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYTLLKNFSAF  598
            S  +Y F VSP Q+ L RL+FYP +Y++         + ++ +F V AN +TLL NFSA 
Sbjct  88   SASSYKFSVSPKQRLLVRLHFYPTSYNS--------LDPSNSYFDVVANGFTLLHNFSAS  139

Query  599  LTvsspdpfvfspdpfIKKEFIVNVDDKQQLNLTFSPS-----PYAFVNGIEIVSMPSDL  763
            +T             +I +EF +       LN+TF PS      YAFVNGIE++SMP+D+
Sbjct  140  IT------AQALTQAYIMREFSLIPPQSGNLNITFIPSSPHDKSYAFVNGIEVISMPADM  193

Query  764  Y  766
            +
Sbjct  194  F  194



>ref|XP_008341791.1| PREDICTED: LOW QUALITY PROTEIN: receptor-like protein kinase 
FERONIA [Malus domestica]
Length=856

 Score =   113 bits (282),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 72/182 (40%), Positives = 105/182 (58%), Gaps = 23/182 (13%)
 Frame = +2

Query  248  LSCG-APSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLAS--QVPFTTARVF  418
            L CG +  +   QD R W  D +  +  P   A  SS       P++S  QVP+TTAR+ 
Sbjct  37   LQCGFSGDQVNQQDERTWSGDINS-KLSPFQAAG-SSFVFKAATPISSSSQVPYTTARLS  94

Query  419  TSELTYSFRVSPGQKFLRLYFYPANYSAAAGGGGRRFNKTDFFFTVTANNYTLLKNFSAF  598
             S+ TY+F ++ GQKF+RLYFYP +Y+A        F++    F+V A  +TLL++F+A 
Sbjct  95   RSKFTYTFPLTSGQKFIRLYFYPTSYAA-------EFDRLKSLFSVEARGFTLLRDFNAS  147

Query  599  LTvsspdpfvfspdpfIKKEFIVNVDDKQQLNLTFSPS-----PYAFVNGIEIVSMPSDL  763
            +T         S    + +EF +N+  +Q LN+TF+PS      YAF+NGIEIVSMP +L
Sbjct  148  VT------ADASWSETVSREFCLNIASEQSLNITFTPSRASPDAYAFINGIEIVSMPDNL  201

Query  764  YF  769
            Y+
Sbjct  202  YY  203



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1785100074290