BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig192

Length=754
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_002521172.1|  diphosphomevalonate decarboxylase, putative        344   1e-113   Ricinus communis
ref|XP_011024216.1|  PREDICTED: diphosphomevalonate decarboxylase...    343   3e-113   Populus euphratica
ref|XP_002315441.1|  mevalonate disphosphate decarboxylase family...    341   3e-112   Populus trichocarpa [western balsam poplar]
gb|KJB78631.1|  hypothetical protein B456_013G012400                    336   5e-112   Gossypium raimondii
gb|AID51442.1|  mevalonate diphosphate decarboxylase                    340   5e-112   Astragalus membranaceus
ref|XP_011032862.1|  PREDICTED: diphosphomevalonate decarboxylase...    340   9e-112   Populus euphratica
gb|KJB78632.1|  hypothetical protein B456_013G012400                    337   1e-111   Gossypium raimondii
ref|XP_002311015.1|  mevalonate disphosphate decarboxylase family...    338   3e-111   Populus trichocarpa [western balsam poplar]
gb|KDO47061.1|  hypothetical protein CISIN_1g014714mg                   332   5e-111   Citrus sinensis [apfelsine]
gb|KHG20400.1|  Mvd                                                     338   1e-110   Gossypium arboreum [tree cotton]
gb|KHG20401.1|  Mvd                                                     337   2e-110   Gossypium arboreum [tree cotton]
gb|KJB78629.1|  hypothetical protein B456_013G012400                    337   2e-110   Gossypium raimondii
gb|ADR65113.1|  mevalonate 5-diphosphate decarboxylase                  337   2e-110   Catharanthus roseus [chatas]
ref|XP_007010317.1|  Mevalonate diphosphate decarboxylase 1 isofo...    332   2e-110   
gb|AAL18927.1|AF429386_1  mevalonate disphosphate decarboxylase         336   2e-110   Hevea brasiliensis [jebe]
ref|XP_009792788.1|  PREDICTED: diphosphomevalonate decarboxylase...    335   4e-110   Nicotiana sylvestris
gb|AII99848.1|  mevalonate disphosphate decarboxylase                   335   5e-110   Nicotiana tabacum [American tobacco]
gb|KDO47060.1|  hypothetical protein CISIN_1g014714mg                   332   6e-110   Citrus sinensis [apfelsine]
ref|XP_009619582.1|  PREDICTED: diphosphomevalonate decarboxylase...    335   7e-110   Nicotiana tomentosiformis
emb|CDO99902.1|  unnamed protein product                                335   9e-110   Coffea canephora [robusta coffee]
ref|XP_007010316.1|  GHMP kinase family protein isoform 3               331   9e-110   
dbj|BAF98285.1|  diphosphomevelonate decarboxylase                      334   1e-109   Hevea brasiliensis [jebe]
ref|XP_007142839.1|  hypothetical protein PHAVU_007G021200g             334   1e-109   Phaseolus vulgaris [French bean]
ref|XP_004497159.1|  PREDICTED: diphosphomevalonate decarboxylase...    333   5e-109   Cicer arietinum [garbanzo]
ref|XP_009630346.1|  PREDICTED: diphosphomevalonate decarboxylase...    333   5e-109   Nicotiana tomentosiformis
gb|KDO47059.1|  hypothetical protein CISIN_1g014714mg                   332   7e-109   Citrus sinensis [apfelsine]
gb|KHN11470.1|  Diphosphomevalonate decarboxylase                       332   7e-109   Glycine soja [wild soybean]
ref|XP_003555870.1|  PREDICTED: diphosphomevalonate decarboxylase...    332   1e-108   Glycine max [soybeans]
ref|XP_009795010.1|  PREDICTED: diphosphomevalonate decarboxylase...    332   2e-108   Nicotiana sylvestris
ref|XP_007010315.1|  GHMP kinase family protein isoform 2               332   2e-108   
gb|KEH44325.1|  mevalonate diphosphate decarboxylase                    332   2e-108   Medicago truncatula
ref|XP_007010314.1|  GHMP kinase family protein isoform 1               331   2e-108   
ref|XP_012074674.1|  PREDICTED: diphosphomevalonate decarboxylase       331   2e-108   Jatropha curcas
ref|XP_006359351.1|  PREDICTED: diphosphomevalonate decarboxylase...    328   5e-107   
ref|XP_010032077.1|  PREDICTED: diphosphomevalonate decarboxylase...    327   7e-107   Eucalyptus grandis [rose gum]
gb|EPS58761.1|  hypothetical protein M569_16051                         318   4e-106   Genlisea aurea
ref|XP_003536712.1|  PREDICTED: diphosphomevalonate decarboxylase...    324   1e-105   Glycine max [soybeans]
ref|XP_006361468.1|  PREDICTED: diphosphomevalonate decarboxylase...    324   1e-105   Solanum tuberosum [potatoes]
ref|XP_011469322.1|  PREDICTED: diphosphomevalonate decarboxylase       323   2e-105   Fragaria vesca subsp. vesca
ref|XP_008232018.1|  PREDICTED: diphosphomevalonate decarboxylase...    323   3e-105   Prunus mume [ume]
ref|XP_007211744.1|  hypothetical protein PRUPE_ppa006290mg             322   6e-105   Prunus persica
ref|NP_001234815.1|  mevalonate disphosphate decarboxylase              322   7e-105   Solanum lycopersicum
gb|ABG24207.2|  mevalonate disphosphate decarboxylase                   321   2e-104   Arnebia euchroma
ref|XP_006445714.1|  hypothetical protein CICLE_v10015368mg             318   4e-104   
gb|AEM42974.1|  diphosphomevalonate decarboxylase                       320   4e-104   Siraitia grosvenorii [arhat fruit]
ref|NP_181404.1|  mevalonate diphosphate decarboxylase 1                320   4e-104   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006411092.1|  hypothetical protein EUTSA_v10016888mg             317   4e-104   Eutrema salsugineum [saltwater cress]
ref|XP_010676219.1|  PREDICTED: diphosphomevalonate decarboxylase...    320   6e-104   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_011084229.1|  PREDICTED: diphosphomevalonate decarboxylase...    320   6e-104   
gb|KFK36776.1|  hypothetical protein AALP_AA4G169000                    319   8e-104   Arabis alpina [alpine rockcress]
ref|XP_010088787.1|  Diphosphomevalonate decarboxylase                  318   1e-103   
ref|XP_006403598.1|  hypothetical protein EUTSA_v10010411mg             315   1e-103   
ref|XP_006294305.1|  hypothetical protein CARUB_v10023314mg             318   2e-103   Capsella rubella
ref|XP_002266399.1|  PREDICTED: diphosphomevalonate decarboxylase       318   3e-103   Vitis vinifera
ref|XP_006445713.1|  hypothetical protein CICLE_v10015368mg             318   4e-103   Citrus clementina [clementine]
gb|AFM77982.1|  mevalonate diphosphate decarboxylase                    318   4e-103   Eleutherococcus senticosus
gb|AEZ55675.1|  mevalonate diphosphate decarboxylase                    317   7e-103   Salvia miltiorrhiza [Chinese salvia]
ref|XP_010536297.1|  PREDICTED: diphosphomevalonate decarboxylase...    317   1e-102   Tarenaya hassleriana [spider flower]
ref|XP_010536296.1|  PREDICTED: diphosphomevalonate decarboxylase...    317   1e-102   Tarenaya hassleriana [spider flower]
ref|XP_009139253.1|  PREDICTED: diphosphomevalonate decarboxylase...    316   2e-102   Brassica rapa
emb|CDY65399.1|  BnaCnng46900D                                          316   2e-102   Brassica napus [oilseed rape]
gb|AGZ15316.1|  mevalonate decarboxylase                                316   2e-102   Platycodon grandiflorus [balloon-flower]
gb|EYU19776.1|  hypothetical protein MIMGU_mgv1a007068mg                313   2e-102   Erythranthe guttata [common monkey flower]
emb|CAN82519.1|  hypothetical protein VITISV_042700                     317   2e-102   Vitis vinifera
gb|ADI80345.1|  mevalonate diphosphate decarboxylase                    316   2e-102   Panax ginseng [Asiatic ginseng]
ref|XP_006403599.1|  hypothetical protein EUTSA_v10010411mg             316   2e-102   Eutrema salsugineum [saltwater cress]
ref|XP_010536295.1|  PREDICTED: diphosphomevalonate decarboxylase...    316   3e-102   Tarenaya hassleriana [spider flower]
ref|XP_008446768.1|  PREDICTED: diphosphomevalonate decarboxylase       316   3e-102   Cucumis melo [Oriental melon]
gb|ABV02028.1|  mevalonate diphosphate decarboxylase                    314   5e-102   Nicotiana langsdorffii x Nicotiana sanderae
emb|CDX76157.1|  BnaA04g04210D                                          315   6e-102   
gb|KHN37414.1|  Diphosphomevalonate decarboxylase                       322   8e-102   Glycine soja [wild soybean]
emb|CDX73494.1|  BnaC08g25090D                                          314   9e-102   
ref|XP_004236810.1|  PREDICTED: diphosphomevalonate decarboxylase...    314   1e-101   Solanum lycopersicum
emb|CAB70999.1|  DIPHOSPHOMEVALONATE DECARBOXYLASE-like protein         313   3e-101   Arabidopsis thaliana [mouse-ear cress]
gb|EYU19775.1|  hypothetical protein MIMGU_mgv1a007068mg                313   3e-101   Erythranthe guttata [common monkey flower]
ref|XP_010515945.1|  PREDICTED: diphosphomevalonate decarboxylase...    313   3e-101   Camelina sativa [gold-of-pleasure]
ref|XP_009116111.1|  PREDICTED: diphosphomevalonate decarboxylase       313   3e-101   Brassica rapa
ref|XP_006391873.1|  hypothetical protein EUTSA_v10023484mg             313   3e-101   Eutrema salsugineum [saltwater cress]
ref|NP_566995.1|  diphosphomevalonate decarboxylase                     313   3e-101   Arabidopsis thaliana [mouse-ear cress]
gb|AIK21783.1|  mevalonate diphosphate decarboxylase                    311   1e-100   Panax notoginseng [san-qi]
gb|AAM64988.1|  mevalonate diphosphate decarboxylase                    310   2e-100   Arabidopsis thaliana [mouse-ear cress]
gb|AAM65192.1|  diphosphomevalonate decarboxylase-like protein          310   4e-100   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008345749.1|  PREDICTED: diphosphomevalonate decarboxylase...    310   6e-100   
ref|XP_009356125.1|  PREDICTED: diphosphomevalonate decarboxylase       309   1e-99    Pyrus x bretschneideri [bai li]
gb|ACW83616.2|  mevalonate diphosphate decarboxylase                    307   5e-99    Panax ginseng [Asiatic ginseng]
ref|XP_008356850.1|  PREDICTED: diphosphomevalonate decarboxylase...    306   1e-98    
ref|XP_008364764.1|  PREDICTED: diphosphomevalonate decarboxylase...    306   1e-98    
ref|XP_010244659.1|  PREDICTED: diphosphomevalonate decarboxylase...    306   2e-98    Nelumbo nucifera [Indian lotus]
gb|AFJ93089.1|  mevalonate diphosphate decarboxylase                    300   2e-98    Bacopa monnieri
ref|XP_010907122.1|  PREDICTED: diphosphomevalonate decarboxylase...    303   3e-97    Elaeis guineensis
ref|XP_010554524.1|  PREDICTED: diphosphomevalonate decarboxylase...    302   5e-97    Tarenaya hassleriana [spider flower]
ref|XP_010505522.1|  PREDICTED: diphosphomevalonate decarboxylase...    301   6e-97    Camelina sativa [gold-of-pleasure]
ref|XP_010509167.1|  PREDICTED: diphosphomevalonate decarboxylase...    301   7e-97    Camelina sativa [gold-of-pleasure]
gb|ACO35355.1|  mevalonate pyrophosphate decarboxylase                  294   7e-97    Elaeis oleifera
ref|XP_008788072.1|  PREDICTED: diphosphomevalonate decarboxylase...    300   3e-96    Phoenix dactylifera
ref|XP_002881611.1|  hypothetical protein ARALYDRAFT_482881             299   5e-96    
gb|EAZ21434.1|  hypothetical protein OsJ_05037                          302   5e-96    Oryza sativa Japonica Group [Japonica rice]
ref|XP_002877963.1|  hypothetical protein ARALYDRAFT_906831             299   8e-96    Arabidopsis lyrata subsp. lyrata
ref|XP_004150845.1|  PREDICTED: diphosphomevalonate decarboxylase       299   1e-95    Cucumis sativus [cucumbers]
ref|XP_010427097.1|  PREDICTED: diphosphomevalonate decarboxylase...    298   2e-95    Camelina sativa [gold-of-pleasure]
gb|EMT01953.1|  Diphosphomevalonate decarboxylase                       299   3e-95    
dbj|BAD27942.1|  putative mevalonate disphosphate decarboxylase         298   3e-95    Oryza sativa Japonica Group [Japonica rice]
gb|EEC72312.1|  hypothetical protein OsI_05503                          294   3e-95    Oryza sativa Indica Group [Indian rice]
ref|XP_006291202.1|  hypothetical protein CARUB_v10017330mg             297   4e-95    Capsella rubella
ref|XP_010504223.1|  PREDICTED: diphosphomevalonate decarboxylase...    296   6e-95    Camelina sativa [gold-of-pleasure]
emb|CDM86983.1|  unnamed protein product                                295   2e-94    Triticum aestivum [Canadian hard winter wheat]
ref|XP_006646770.1|  PREDICTED: diphosphomevalonate decarboxylase...    295   4e-94    Oryza brachyantha
ref|XP_008665378.1|  PREDICTED: diphosphomevalonate decarboxylase...    293   3e-93    Zea mays [maize]
gb|KFK34679.1|  hypothetical protein AALP_AA5G177200                    292   4e-93    Arabis alpina [alpine rockcress]
ref|XP_002452980.1|  hypothetical protein SORBIDRAFT_04g035950          292   6e-93    Sorghum bicolor [broomcorn]
ref|NP_001149256.1|  LOC100282878                                       291   7e-93    Zea mays [maize]
ref|XP_008665377.1|  PREDICTED: diphosphomevalonate decarboxylase...    294   7e-93    Zea mays [maize]
ref|XP_009404708.1|  PREDICTED: diphosphomevalonate decarboxylase...    290   5e-92    Musa acuminata subsp. malaccensis [pisang utan]
gb|AEA72605.1|  mevalonate 5-diphosphate decarboxylase                  289   5e-92    Houttuynia cordata [chameleon-plant]
gb|EEC72316.1|  hypothetical protein OsI_05509                          276   3e-90    Oryza sativa Indica Group [Indian rice]
ref|XP_006836043.1|  PREDICTED: diphosphomevalonate decarboxylase       281   5e-89    Amborella trichopoda
ref|XP_003565147.1|  PREDICTED: diphosphomevalonate decarboxylase...    281   6e-89    Brachypodium distachyon [annual false brome]
gb|ACN41090.1|  unknown                                                 281   8e-89    Picea sitchensis
ref|XP_004954217.1|  PREDICTED: diphosphomevalonate decarboxylase...    281   1e-88    Setaria italica
gb|AAV32433.1|  mevalonate disphosphate decarboxylase                   280   2e-88    Ginkgo biloba [ginkgo]
ref|XP_004963234.1|  PREDICTED: diphosphomevalonate decarboxylase...    279   5e-88    Setaria italica
tpg|DAA51253.1|  TPA: hypothetical protein ZEAMMB73_408503              294   2e-87    
gb|AGT17596.1|  mevalonate diphosphate decarboxylase                    272   4e-85    Picrorhiza kurrooa
ref|XP_010067138.1|  PREDICTED: diphosphomevalonate decarboxylase...    269   4e-85    
ref|XP_010067136.1|  PREDICTED: diphosphomevalonate decarboxylase...    268   8e-84    Eucalyptus grandis [rose gum]
ref|XP_001773902.1|  predicted protein                                  264   5e-82    
ref|XP_001774493.1|  predicted protein                                  261   7e-81    
ref|XP_002979347.1|  hypothetical protein SELMODRAFT_268244             243   3e-74    Selaginella moellendorffii
ref|XP_006367129.1|  PREDICTED: diphosphomevalonate decarboxylase...    234   3e-74    
ref|XP_002992344.1|  hypothetical protein SELMODRAFT_135101             242   8e-74    Selaginella moellendorffii
gb|AFW73866.1|  hypothetical protein ZEAMMB73_421648                    230   4e-72    
gb|AFW73864.1|  hypothetical protein ZEAMMB73_421648                    225   1e-67    
tpg|DAA51252.1|  TPA: hypothetical protein ZEAMMB73_408503              233   3e-66    
ref|NP_001045633.2|  Os02g0107200                                       205   1e-62    
ref|XP_008668933.1|  PREDICTED: diphosphomevalonate decarboxylase...    197   3e-59    Zea mays [maize]
ref|XP_008668934.1|  PREDICTED: diphosphomevalonate decarboxylase...    196   3e-59    Zea mays [maize]
ref|NP_001045642.2|  Os02g0109100                                       189   1e-56    
gb|KDO47062.1|  hypothetical protein CISIN_1g014714mg                   196   2e-56    Citrus sinensis [apfelsine]
ref|XP_001121619.2|  PREDICTED: diphosphomevalonate decarboxylase...    194   8e-56    Apis mellifera [bee]
ref|XP_006623086.1|  PREDICTED: diphosphomevalonate decarboxylase...    194   1e-55    Apis dorsata [rock honeybee]
ref|XP_003693647.1|  PREDICTED: diphosphomevalonate decarboxylase...    194   2e-55    Apis florea [dwarf honeybee]
gb|EMS63646.1|  Diphosphomevalonate decarboxylase                       187   7e-54    Triticum urartu
ref|NP_001133968.1|  Diphosphomevalonate decarboxylase                  188   3e-53    Salmo salar
emb|CDQ87522.1|  unnamed protein product                                187   8e-53    Oncorhynchus mykiss
gb|ELU01936.1|  hypothetical protein CAPTEDRAFT_176844                  187   1e-52    Capitella teleta
ref|XP_003758532.1|  PREDICTED: diphosphomevalonate decarboxylase       187   1e-52    Sarcophilus harrisii
ref|NP_001093300.1|  diphosphomevalonate decarboxylase                  186   1e-52    Bombyx mori [silk moth]
ref|XP_010739786.1|  PREDICTED: diphosphomevalonate decarboxylase       187   1e-52    Larimichthys crocea [croceine croaker]
ref|XP_010877776.1|  PREDICTED: diphosphomevalonate decarboxylase       187   1e-52    Esox lucius
ref|XP_004600545.1|  PREDICTED: diphosphomevalonate decarboxylase       186   2e-52    Sorex araneus [Eurasian shrew]
gb|KDR21975.1|  Diphosphomevalonate decarboxylase                       184   2e-52    Zootermopsis nevadensis
ref|XP_010996754.1|  PREDICTED: diphosphomevalonate decarboxylase...    181   2e-52    Camelus dromedarius [camel]
gb|ELK31386.1|  Diphosphomevalonate decarboxylase                       184   3e-52    Myotis davidii
ref|XP_008137975.1|  PREDICTED: diphosphomevalonate decarboxylase       184   9e-52    Eptesicus fuscus
ref|XP_006762259.1|  PREDICTED: diphosphomevalonate decarboxylase...    184   9e-52    Myotis davidii
gb|KJA27615.1|  hypothetical protein HYPSUDRAFT_130498                  185   9e-52    Hypholoma sublateritium FD-334 SS-4
ref|XP_004067388.1|  PREDICTED: diphosphomevalonate decarboxylase       183   1e-51    
ref|XP_001376834.1|  PREDICTED: diphosphomevalonate decarboxylase       184   1e-51    Monodelphis domestica
emb|CDQ81132.1|  unnamed protein product                                184   1e-51    Oncorhynchus mykiss
ref|XP_007244091.1|  PREDICTED: diphosphomevalonate decarboxylase       184   2e-51    
dbj|GAM24015.1|  hypothetical protein SAMD00019534_071900               184   2e-51    Acytostelium subglobosum LB1
ref|XP_006097406.1|  PREDICTED: diphosphomevalonate decarboxylase       184   2e-51    Myotis lucifugus
ref|XP_002942038.1|  PREDICTED: diphosphomevalonate decarboxylase...    183   2e-51    Xenopus tropicalis [western clawed frog]
ref|XP_005805001.1|  PREDICTED: diphosphomevalonate decarboxylase...    183   2e-51    Xiphophorus maculatus
ref|XP_008308874.1|  PREDICTED: diphosphomevalonate decarboxylase       183   2e-51    Cynoglossus semilaevis [half-smooth tongue sole]
ref|XP_004913618.1|  PREDICTED: diphosphomevalonate decarboxylase...    183   3e-51    Xenopus tropicalis [western clawed frog]
ref|XP_002432413.1|  Diphosphomevalonate decarboxylase, putative        183   3e-51    Pediculus humanus corporis [human body lice]
ref|XP_005862569.1|  PREDICTED: diphosphomevalonate decarboxylase...    183   3e-51    Myotis brandtii
ref|XP_005708031.1|  diphosphomevalonate decarboxylase isoform 1        182   4e-51    Galdieria sulphuraria
ref|XP_007549941.1|  PREDICTED: diphosphomevalonate decarboxylase       183   4e-51    Poecilia formosa
ref|XP_006780089.1|  PREDICTED: diphosphomevalonate decarboxylase...    182   5e-51    Neolamprologus brichardi [lyretail cichlid]
ref|XP_005915248.1|  PREDICTED: diphosphomevalonate decarboxylase...    182   5e-51    Haplochromis burtoni
ref|XP_005753004.1|  PREDICTED: diphosphomevalonate decarboxylase...    182   6e-51    Pundamilia nyererei
ref|XP_002735076.1|  PREDICTED: diphosphomevalonate decarboxylase...    182   7e-51    Saccoglossus kowalevskii
ref|XP_005708030.1|  diphosphomevalonate decarboxylase isoform 2        182   7e-51    Galdieria sulphuraria
ref|NP_001267865.1|  diphosphomevalonate decarboxylase                  182   7e-51    Bombus terrestris [large earth bumblebee]
ref|XP_003442298.1|  PREDICTED: diphosphomevalonate decarboxylase...    182   8e-51    Oreochromis niloticus
gb|ACO09861.1|  Diphosphomevalonate decarboxylase                       182   9e-51    Osmerus mordax
ref|XP_006008326.1|  PREDICTED: diphosphomevalonate decarboxylase...    181   9e-51    
ref|XP_010792093.1|  PREDICTED: diphosphomevalonate decarboxylase       182   1e-50    Notothenia coriiceps [yellowbelly rockcod]
ref|XP_010966484.1|  PREDICTED: diphosphomevalonate decarboxylase       182   1e-50    Camelus bactrianus [camel]
ref|XP_004539436.1|  PREDICTED: diphosphomevalonate decarboxylase...    181   1e-50    Maylandia zebra
gb|AAH63907.1|  mvd-prov protein                                        181   1e-50    Xenopus tropicalis [western clawed frog]
ref|XP_004362385.1|  diphosphomevalonate decarboxylase                  181   1e-50    Cavenderia fasciculata
ref|NP_001007423.1|  diphosphomevalonate decarboxylase                  181   2e-50    Danio rerio [leopard danio]
ref|XP_003228605.1|  PREDICTED: diphosphomevalonate decarboxylase       181   2e-50    Anolis carolinensis [Carolina anole]
ref|XP_006008325.1|  PREDICTED: diphosphomevalonate decarboxylase...    181   2e-50    Latimeria chalumnae
ref|XP_004310733.1|  PREDICTED: diphosphomevalonate decarboxylase       181   2e-50    
ref|XP_008403677.1|  PREDICTED: diphosphomevalonate decarboxylase       181   2e-50    Poecilia reticulata
ref|XP_004356734.1|  diphosphomevalonate decarboxylase                  181   3e-50    Acanthamoeba castellanii str. Neff
ref|XP_003970115.1|  PREDICTED: diphosphomevalonate decarboxylase       180   4e-50    Takifugu rubripes [tiger puffer]
ref|XP_002592260.1|  hypothetical protein BRAFLDRAFT_277163             180   4e-50    Branchiostoma floridae
gb|EUC58622.1|  diphosphomevalonate decarboxylase                       180   5e-50    Rhizoctonia solani AG-3 Rhs1AP
ref|XP_011670280.1|  PREDICTED: LOW QUALITY PROTEIN: diphosphomev...    179   5e-50    Strongylocentrotus purpuratus [purple urchin]
ref|XP_011497479.1|  PREDICTED: diphosphomevalonate decarboxylase       180   5e-50    Ceratosolen solmsi marchali
ref|XP_003287684.1|  hypothetical protein DICPUDRAFT_32847              179   5e-50    Dictyostelium purpureum
ref|XP_008553889.1|  PREDICTED: diphosphomevalonate decarboxylase       179   5e-50    Microplitis demolitor
ref|XP_004666010.1|  PREDICTED: diphosphomevalonate decarboxylase       180   5e-50    Jaculus jaculus
ref|XP_002913420.1|  PREDICTED: LOW QUALITY PROTEIN: diphosphomev...    179   6e-50    
dbj|BAC40852.1|  unnamed protein product                                179   6e-50    Mus musculus [mouse]
ref|XP_008300019.1|  PREDICTED: diphosphomevalonate decarboxylase       179   7e-50    Stegastes partitus
ref|XP_011315112.1|  PREDICTED: diphosphomevalonate decarboxylase...    179   7e-50    Fopius arisanus
gb|KIY47272.1|  Diphosphomevalonate decarboxylase                       179   7e-50    Fistulina hepatica ATCC 64428
ref|XP_006734134.1|  PREDICTED: diphosphomevalonate decarboxylase       179   7e-50    Leptonychotes weddellii
ref|XP_003484695.1|  PREDICTED: diphosphomevalonate decarboxylase...    181   7e-50    
emb|CAC35731.1|  diphosphomevalonate decarboxylase                      179   7e-50    Mus musculus [mouse]
gb|AAH08526.1|  Mevalonate (diphospho) decarboxylase                    179   7e-50    Mus musculus [mouse]
ref|XP_005531982.1|  PREDICTED: diphosphomevalonate decarboxylase       179   7e-50    Pseudopodoces humilis [Tibetan ground-jay]
ref|NP_619597.2|  diphosphomevalonate decarboxylase                     179   7e-50    Mus musculus [mouse]
dbj|BAE42019.1|  unnamed protein product                                179   8e-50    Mus musculus [mouse]
ref|XP_004280113.1|  PREDICTED: diphosphomevalonate decarboxylase       179   8e-50    Orcinus orca [Orca]
ref|XP_007266924.1|  Diphosphomevalonate decarboxylase                  179   1e-49    Fomitiporia mediterranea MF3/22
ref|XP_007125573.1|  PREDICTED: diphosphomevalonate decarboxylase...    179   1e-49    Physeter catodon
ref|XP_007468497.1|  PREDICTED: diphosphomevalonate decarboxylase       179   1e-49    Lipotes vexillifer [baiji]
pdb|3F0N|A  Chain A, Mus Musculus Mevalonate Pyrophosphate Decarb...    179   1e-49    Mus musculus [mouse]
ref|XP_007172621.1|  PREDICTED: diphosphomevalonate decarboxylase       179   1e-49    Balaenoptera acutorostrata scammoni
ref|XP_011703654.1|  PREDICTED: diphosphomevalonate decarboxylase       179   1e-49    Wasmannia auropunctata
gb|ELR58766.1|  Diphosphomevalonate decarboxylase                       179   1e-49    Bos mutus
ref|NP_001068892.1|  diphosphomevalonate decarboxylase                  179   1e-49    Bos taurus [bovine]
ref|XP_007887516.1|  PREDICTED: diphosphomevalonate decarboxylase       179   1e-49    Callorhinchus milii [Australian ghost shark]
ref|XP_005892469.1|  PREDICTED: diphosphomevalonate decarboxylase       179   1e-49    Bos mutus
ref|XP_010842266.1|  PREDICTED: diphosphomevalonate decarboxylase       179   1e-49    Bison bison bison
ref|XP_642143.1|  diphosphomevalonate decarboxylase                     178   2e-49    Dictyostelium discoideum AX4
ref|XP_546783.2|  PREDICTED: diphosphomevalonate decarboxylase          178   2e-49    Canis lupus familiaris [dogs]
ref|XP_008838768.1|  PREDICTED: diphosphomevalonate decarboxylase       178   2e-49    Nannospalax galili
ref|XP_006027907.1|  PREDICTED: diphosphomevalonate decarboxylase       178   2e-49    Alligator sinensis
ref|XP_005819249.1|  mevalonate pyrophosphate decarboxylase             177   3e-49    Guillardia theta CCMP2712
ref|XP_011370192.1|  PREDICTED: diphosphomevalonate decarboxylase       178   3e-49    Pteropus vampyrus
ref|XP_004392172.1|  PREDICTED: diphosphomevalonate decarboxylase       178   3e-49    Odobenus rosmarus divergens
gb|EIE86507.1|  diphosphomevalonate decarboxylase                       178   3e-49    Rhizopus delemar RA 99-880
ref|XP_011564748.1|  PREDICTED: diphosphomevalonate decarboxylase       177   4e-49    Plutella xylostella [cabbage moth]
gb|ELK00496.1|  Diphosphomevalonate decarboxylase                       175   4e-49    Pteropus alecto
ref|XP_012014998.1|  PREDICTED: diphosphomevalonate decarboxylase...    177   5e-49    Ovis aries musimon
ref|XP_006043222.1|  PREDICTED: diphosphomevalonate decarboxylase       177   5e-49    
ref|XP_004753891.1|  PREDICTED: diphosphomevalonate decarboxylase       177   5e-49    Mustela putorius furo [black ferret]
gb|AAH81784.1|  Mevalonate (diphospho) decarboxylase                    177   6e-49    Rattus norvegicus [brown rat]
ref|XP_009089159.1|  PREDICTED: diphosphomevalonate decarboxylase       177   6e-49    Serinus canaria [canary]
ref|XP_004437181.1|  PREDICTED: diphosphomevalonate decarboxylase       177   7e-49    Ceratotherium simum simum [southern square-lipped rhinoceros]
ref|NP_112324.1|  diphosphomevalonate decarboxylase                     177   7e-49    Rattus norvegicus [brown rat]
gb|AAA34506.2|  ORF                                                     171   7e-49    Saccharomyces cerevisiae [brewer's yeast]
gb|KIM44772.1|  hypothetical protein M413DRAFT_442732                   177   8e-49    Hebeloma cylindrosporum h7
ref|XP_011058925.1|  PREDICTED: diphosphomevalonate decarboxylase       176   8e-49    Acromyrmex echinatior
ref|XP_011880662.1|  PREDICTED: diphosphomevalonate decarboxylase       176   8e-49    Vollenhovia emeryi
ref|XP_004058175.1|  PREDICTED: diphosphomevalonate decarboxylase       177   8e-49    
emb|CBJ48557.1|  Diphosphomevalonate decarboxylase                      177   9e-49    Ectocarpus siliculosus
ref|XP_011163917.1|  PREDICTED: diphosphomevalonate decarboxylase...    176   1e-48    Solenopsis invicta [imported red fire ant]
emb|CEI99330.1|  Putative Diphosphomevalonate decarboxylase             177   1e-48    Rhizopus microsporus
ref|XP_011163916.1|  PREDICTED: diphosphomevalonate decarboxylase...    176   1e-48    Solenopsis invicta [imported red fire ant]
emb|CDR37714.1|  CYFA0S01e15566g1_1                                     176   1e-48    Cyberlindnera fabianii
gb|EFA74532.1|  diphosphomevalonate decarboxylase                       176   1e-48    Heterostelium album PN500
ref|XP_009029357.1|  hypothetical protein HELRODRAFT_185177             176   1e-48    Helobdella robusta
emb|CEG64400.1|  Putative Diphosphomevalonate decarboxylase             176   1e-48    Rhizopus microsporus
ref|XP_002111980.1|  hypothetical protein TRIADDRAFT_55561              176   1e-48    Trichoplax adhaerens
ref|XP_003702160.1|  PREDICTED: diphosphomevalonate decarboxylase       176   1e-48    Megachile rotundata
emb|CDS06586.1|  hypothetical protein LRAMOSA09114                      176   1e-48    Lichtheimia ramosa
ref|XP_523460.3|  PREDICTED: diphosphomevalonate decarboxylase          176   2e-48    
ref|XP_005052358.1|  PREDICTED: diphosphomevalonate decarboxylase       176   2e-48    
gb|KJE94985.1|  diphosphomevalonate decarboxylase, variant 3            173   2e-48    Capsaspora owczarzaki ATCC 30864
ref|XP_006926815.1|  PREDICTED: diphosphomevalonate decarboxylase       176   2e-48    Pteropus alecto
ref|XP_005292289.1|  PREDICTED: diphosphomevalonate decarboxylase       176   2e-48    Chrysemys picta bellii
ref|XP_010353865.1|  PREDICTED: diphosphomevalonate decarboxylase...    175   2e-48    Rhinopithecus roxellana
gb|KDN34074.1|  hypothetical protein RSAG8_12833                        176   2e-48    Rhizoctonia solani AG-8 WAC10335
gb|AAP36301.1|  Homo sapiens mevalonate (diphospho) decarboxylase       176   2e-48    synthetic construct
gb|AJP70489.1|  diphosphomevalonate decarboxylase                       175   2e-48    Helicoverpa armigera [American bollworm]
ref|NP_002452.1|  diphosphomevalonate decarboxylase                     176   2e-48    Homo sapiens [man]
ref|XP_005691918.1|  PREDICTED: diphosphomevalonate decarboxylase       176   2e-48    
ref|XP_003998380.1|  PREDICTED: diphosphomevalonate decarboxylase       176   2e-48    
gb|KIK02242.1|  hypothetical protein K443DRAFT_677763                   176   2e-48    Laccaria amethystina LaAM-08-1
ref|XP_006212468.1|  PREDICTED: diphosphomevalonate decarboxylase       176   2e-48    Vicugna pacos
ref|XP_012055530.1|  PREDICTED: diphosphomevalonate decarboxylase       175   2e-48    Atta cephalotes
gb|KFM61632.1|  Diphosphomevalonate decarboxylase                       175   3e-48    Stegodyphus mimosarum
gb|KIM45531.1|  hypothetical protein M413DRAFT_442202                   175   3e-48    Hebeloma cylindrosporum h7
ref|XP_004377812.1|  PREDICTED: diphosphomevalonate decarboxylase       175   3e-48    Trichechus manatus latirostris
ref|XP_010353864.1|  PREDICTED: diphosphomevalonate decarboxylase...    175   3e-48    Rhinopithecus roxellana
ref|XP_006641302.1|  PREDICTED: LOW QUALITY PROTEIN: diphosphomev...    174   3e-48    
ref|XP_006888835.1|  PREDICTED: diphosphomevalonate decarboxylase       175   3e-48    Elephantulus edwardii [Cape long-eared elephant shrew]
ref|XP_001880930.1|  predicted protein                                  175   4e-48    Laccaria bicolor S238N-H82
gb|KIJ60024.1|  hypothetical protein HYDPIDRAFT_99556                   175   5e-48    Hydnomerulius pinastri MD-312
ref|XP_007937353.1|  PREDICTED: diphosphomevalonate decarboxylase       174   5e-48    Orycteropus afer afer
ref|XP_003281885.1|  PREDICTED: LOW QUALITY PROTEIN: diphosphomev...    174   5e-48    
gb|ELU38465.1|  diphosphomevalonate decarboxylase                       174   5e-48    
gb|KIY64502.1|  Diphosphomevalonate decarboxylase                       174   6e-48    
ref|XP_002100713.1|  GE17215                                            174   6e-48    
ref|XP_007334426.1|  hypothetical protein AGABI1DRAFT_116646            174   7e-48    
ref|XP_005345851.1|  PREDICTED: diphosphomevalonate decarboxylase       174   8e-48    
ref|XP_001488083.1|  PREDICTED: diphosphomevalonate decarboxylase       174   8e-48    
ref|XP_003805806.1|  PREDICTED: diphosphomevalonate decarboxylase       174   8e-48    
ref|XP_001873551.1|  predicted protein                                  174   8e-48    
ref|XP_011629560.1|  PREDICTED: LOW QUALITY PROTEIN: diphosphomev...    174   8e-48    
ref|XP_011751593.1|  PREDICTED: diphosphomevalonate decarboxylase       174   9e-48    
ref|XP_001986237.1|  GH20637                                            174   9e-48    
ref|XP_003029710.1|  hypothetical protein SCHCODRAFT_69496              174   9e-48    
emb|CAF99534.1|  unnamed protein product                                174   9e-48    
ref|XP_006457330.1|  hypothetical protein AGABI2DRAFT_196085            174   9e-48    
ref|XP_007532001.1|  PREDICTED: diphosphomevalonate decarboxylase       174   1e-47    
gb|KDR67556.1|  hypothetical protein GALMADRAFT_258221                  173   2e-47    
ref|XP_004346191.2|  diphosphomevalonate decarboxylase                  173   2e-47    
ref|XP_011924278.1|  PREDICTED: diphosphomevalonate decarboxylase...    172   2e-47    
ref|XP_455548.1|  hypothetical protein                                  173   2e-47    
ref|XP_006860173.1|  PREDICTED: diphosphomevalonate decarboxylase       173   2e-47    
gb|KFH65647.1|  diphosphomevalonate decarboxylase                       173   2e-47    
ref|XP_008506971.1|  PREDICTED: diphosphomevalonate decarboxylase       173   2e-47    
ref|XP_002497180.1|  ZYRO0D17270p                                       173   2e-47    
ref|XP_001978042.1|  GG17907                                            172   2e-47    
ref|XP_007651118.1|  PREDICTED: diphosphomevalonate decarboxylase...    172   2e-47    
ref|XP_005592828.1|  PREDICTED: diphosphomevalonate decarboxylase...    172   2e-47    
ref|XP_003495141.1|  PREDICTED: diphosphomevalonate decarboxylase...    173   2e-47    
ref|XP_011257108.1|  PREDICTED: diphosphomevalonate decarboxylase       172   2e-47    
ref|XP_005073260.1|  PREDICTED: diphosphomevalonate decarboxylase       173   2e-47    
ref|XP_005769632.1|  mevalonate-5-diphosphate decarboxylase             174   2e-47    
dbj|BAO38704.1|  diphosphomevalonate decarboxylase                      172   3e-47    
dbj|GAA95012.1|  hypothetical protein E5Q_01667                         172   3e-47    
ref|XP_001648384.1|  AAEL004050-PA                                      172   3e-47    
ref|XP_011924200.1|  PREDICTED: diphosphomevalonate decarboxylase...    172   3e-47    
ref|XP_008613422.1|  hypothetical protein SDRG_09280                    174   3e-47    
ref|XP_005592827.1|  PREDICTED: diphosphomevalonate decarboxylase...    172   3e-47    
ref|NP_001247472.1|  diphosphomevalonate decarboxylase                  172   3e-47    
ref|XP_003917347.1|  PREDICTED: diphosphomevalonate decarboxylase       172   3e-47    
gb|KDO31253.1|  diphosphomevalonate decarboxylase                       172   3e-47    
ref|XP_007992525.1|  PREDICTED: diphosphomevalonate decarboxylase...    172   3e-47    
ref|XP_002761300.1|  PREDICTED: diphosphomevalonate decarboxylase       172   3e-47    
ref|XP_003460964.1|  PREDICTED: diphosphomevalonate decarboxylase       172   4e-47    
gb|AJT16805.1|  Mvd1p                                                   172   4e-47    
ref|XP_007992523.1|  PREDICTED: diphosphomevalonate decarboxylase...    172   5e-47    
ref|XP_004645091.1|  PREDICTED: diphosphomevalonate decarboxylase       172   5e-47    
gb|EDZ69577.1|  YNR043Wp-like protein                                   172   6e-47    
gb|AJT25337.1|  Mvd1p                                                   172   6e-47    
ref|XP_006987448.1|  PREDICTED: diphosphomevalonate decarboxylase       172   6e-47    
ref|XP_010625831.1|  PREDICTED: diphosphomevalonate decarboxylase       172   7e-47    
gb|KIL66419.1|  hypothetical protein M378DRAFT_389057                   172   7e-47    
ref|XP_002044182.1|  GM22575                                            170   8e-47    
ref|XP_004989623.1|  diphosphomevalonate decarboxylase                  171   9e-47    
ref|XP_003922886.1|  PREDICTED: diphosphomevalonate decarboxylase       171   9e-47    
ref|XP_004704798.1|  PREDICTED: diphosphomevalonate decarboxylase       171   1e-46    
gb|AJT07024.1|  Mvd1p                                                   171   1e-46    
gb|AJT30847.1|  Mvd1p                                                   171   1e-46    
gb|AJT22350.1|  Mvd1p                                                   171   1e-46    
dbj|GAA26136.1|  K7_Mvd1p                                               171   1e-46    
gb|EDV12224.1|  mevalonate pyrophosphate decarboxylase                  171   1e-46    
ref|NP_014441.1|  diphosphomevalonate decarboxylase MVD1                171   1e-46    
gb|EEU08298.1|  Mvd1p                                                   171   1e-46    
gb|AJT04410.1|  Mvd1p                                                   171   1e-46    
gb|AJT02547.1|  Mvd1p                                                   171   1e-46    
gb|EDN62849.1|  mevalonate pyrophosphate decarboxylase                  171   1e-46    
gb|AJT04035.1|  Mvd1p                                                   171   1e-46    
gb|KDQ21756.1|  hypothetical protein BOTBODRAFT_26181                   171   1e-46    
gb|AEY98585.1|  FAGL232Cp                                               171   1e-46    
ref|XP_003688208.1|  hypothetical protein TPHA_0M01990                  171   2e-46    
ref|NP_986435.2|  AGL232Cp                                              171   2e-46    
ref|XP_007851999.1|  diphosphomevalonate decarboxylase                  171   2e-46    
ref|XP_005956369.1|  PREDICTED: diphosphomevalonate decarboxylase       171   2e-46    
ref|XP_011585736.1|  PREDICTED: diphosphomevalonate decarboxylase       170   3e-46    
ref|XP_007317911.1|  hypothetical protein SERLADRAFT_466408             170   4e-46    
gb|AJT18309.1|  Mvd1p                                                   169   4e-46    
gb|KIJ49692.1|  hypothetical protein M422DRAFT_205223                   169   4e-46    
dbj|GAN02670.1|  diphosphomevalonate decarboxylase                      169   5e-46    
ref|XP_010577890.1|  PREDICTED: diphosphomevalonate decarboxylase       169   5e-46    
ref|XP_004842741.1|  PREDICTED: diphosphomevalonate decarboxylase       170   5e-46    
gb|EHN00406.1|  Mvd1p                                                   169   5e-46    
ref|XP_011275729.1|  Diphosphomevalonate decarboxylase                  169   6e-46    
emb|CDO95793.1|  unnamed protein product                                169   6e-46    
gb|AJT26802.1|  Mvd1p                                                   169   7e-46    
ref|XP_010716493.1|  PREDICTED: diphosphomevalonate decarboxylase       169   7e-46    
ref|XP_002551773.1|  KLTH0A07238p                                       169   8e-46    
ref|XP_008034164.1|  Diphosphomevalonate decarboxylase                  169   9e-46    
ref|XP_007371446.1|  Diphosphomevalonate decarboxylase                  169   1e-45    
ref|XP_004584295.1|  PREDICTED: diphosphomevalonate decarboxylase       168   1e-45    
gb|ACO11575.1|  Diphosphomevalonate decarboxylase                       168   1e-45    
gb|AAT93171.1|  YNR043W                                                 168   1e-45    
ref|XP_423130.3|  PREDICTED: diphosphomevalonate decarboxylase is...    168   2e-45    
gb|KII92627.1|  hypothetical protein PLICRDRAFT_102539                  168   2e-45    
ref|NP_573068.3|  CG8239, isoform A                                     167   2e-45    
ref|XP_009066482.1|  hypothetical protein LOTGIDRAFT_211321             167   2e-45    
ref|XP_007339537.1|  Diphosphomevalonate decarboxylase                  167   2e-45    
gb|KIR85269.1|  diphosphomevalonate decarboxylase                       167   2e-45    
ref|XP_009547604.1|  hypothetical protein HETIRDRAFT_440521             167   3e-45    
ref|XP_004944354.1|  PREDICTED: diphosphomevalonate decarboxylase...    167   3e-45    
gb|EPB83704.1|  diphosphomevalonate decarboxylase                       167   3e-45    
ref|XP_006686867.1|  hypothetical protein CANTEDRAFT_122822             167   3e-45    
ref|XP_003743316.1|  PREDICTED: diphosphomevalonate decarboxylase...    166   4e-45    
emb|CDO69145.1|  hypothetical protein BN946_scf185042.g47               167   4e-45    
ref|XP_970108.1|  PREDICTED: diphosphomevalonate decarboxylase is...    166   5e-45    
ref|XP_003424007.1|  PREDICTED: diphosphomevalonate decarboxylase...    166   5e-45    
ref|XP_011105331.1|  mvd1p                                              166   5e-45    
ref|XP_445335.1|  hypothetical protein                                  166   6e-45    
gb|EMG46004.1|  Diphosphomevalonate decarboxylase                       166   6e-45    
emb|CCL99644.1|  predicted protein                                      166   6e-45    
emb|CEI98959.1|  Putative Diphosphomevalonate decarboxylase             167   6e-45    
gb|KEZ44709.1|  Diphosphomevalonate decarboxylase                       166   7e-45    
ref|XP_009821609.1|  diphosphomevalonate decarboxylase, variant         165   7e-45    
gb|KIO19559.1|  hypothetical protein M407DRAFT_16104                    166   7e-45    
gb|AEB00646.1|  mevalonate pyrophosphate decarboxylase                  166   8e-45    
gb|ETN57980.1|  diphosphomevalonate decarboxylase                       166   9e-45    
ref|XP_003193399.1|  diphosphomevalonate decarboxylase                  166   1e-44    
ref|XP_001844728.1|  diphosphomevalonate decarboxylase                  165   1e-44    
pdb|1FI4|A  Chain A, The X-Ray Crystal Structure Of Mevalonate 5-...    166   1e-44    
gb|KIR53986.1|  diphosphomevalonate decarboxylase                       166   1e-44    
ref|XP_001646609.1|  hypothetical protein Kpol_1028p24                  166   1e-44    
ref|XP_002287031.1|  mevalonate disphosphate decarboxylase-like p...    164   1e-44    
emb|CEP12016.1|  hypothetical protein                                   166   1e-44    
ref|XP_001386025.1|  hypothetical protein PICST_90752                   165   1e-44    
emb|CEJ91790.1|  Putative Diphosphomevalonate decarboxylase             165   1e-44    
ref|XP_009821608.1|  diphosphomevalonate decarboxylase                  165   2e-44    
ref|XP_011153018.1|  PREDICTED: diphosphomevalonate decarboxylase...    165   2e-44    
ref|XP_006122792.1|  PREDICTED: LOW QUALITY PROTEIN: diphosphomev...    166   2e-44    
gb|KIS02378.1|  diphosphomevalonate decarboxylase                       165   2e-44    
emb|CCA67606.1|  probable MVD1-mevalonate pyrophosphate decarboxy...    165   2e-44    
gb|KGB78727.1|  diphosphomevalonate decarboxylase                       165   2e-44    
ref|XP_008862510.1|  diphosphomevalonate decarboxylase                  165   2e-44    
ref|XP_007381587.1|  Diphosphomevalonate decarboxylase                  165   3e-44    
gb|AAF19399.1|AF203779_1  diphosphomevalonate decarboxylase MVD1        164   3e-44    
gb|ESA02764.1|  hypothetical protein GLOINDRAFT_337188                  165   3e-44    
gb|KGU33407.1|  diphosphomevalonate decarboxylase                       164   3e-44    
gb|EEQ43122.1|  diphosphomevalonate decarboxylase                       164   3e-44    
gb|KGQ99147.1|  diphosphomevalonate decarboxylase                       164   3e-44    
ref|XP_002416688.1|  diphosphomevalonate decarboxylase, putative;...    164   3e-44    
ref|XP_003418108.1|  PREDICTED: LOW QUALITY PROTEIN: diphosphomev...    164   4e-44    
emb|CCG83278.1|  Diphosphomevalonate decarboxylase                      164   6e-44    
ref|XP_002075379.1|  GK17667                                            164   6e-44    
gb|KIM31275.1|  hypothetical protein M408DRAFT_64547                    164   6e-44    
ref|XP_004015005.1|  PREDICTED: diphosphomevalonate decarboxylase...    163   7e-44    
ref|XP_001830848.1|  diphosphomevalonate decarboxylase                  164   7e-44    
ref|XP_505041.1|  YALI0F05632p                                          163   8e-44    
gb|KDN43409.1|  putative MVD1-mevalonate pyrophosphate decarboxylase    164   8e-44    
ref|XP_002413928.1|  diphosphomevalonate decarboxylase, putative        162   8e-44    
emb|CDK26220.1|  unnamed protein product                                163   9e-44    
ref|XP_003383859.1|  PREDICTED: diphosphomevalonate decarboxylase...    163   1e-43    
gb|KFG78069.1|  diphosphomevalonate decarboxylase                       163   1e-43    
ref|XP_012048727.1|  diphosphomevalonate decarboxylase                  163   1e-43    
ref|XP_321487.3|  AGAP001611-PA                                         162   1e-43    
gb|KID80423.1|  diphosphomevalonate decarboxylase                       163   1e-43    
gb|EFX83630.1|  hypothetical protein DAPPUDRAFT_301631                  162   1e-43    
gb|AEE63249.1|  unknown                                                 162   1e-43    
gb|KIK91362.1|  hypothetical protein PAXRUDRAFT_830905                  163   1e-43    
ref|XP_003673492.1|  hypothetical protein NCAS_0A05510                  162   1e-43    
ref|XP_007864729.1|  hypothetical protein GLOTRDRAFT_127445             163   2e-43    
ref|XP_002050863.1|  GJ19966                                            162   2e-43    
gb|KDQ27550.1|  hypothetical protein PLEOSDRAFT_1093271                 162   2e-43    
gb|EHJ66886.1|  diphosphomevalonate decarboxylase                       162   2e-43    
gb|KIW05370.1|  diphosphomevalonate decarboxylase                       162   2e-43    
gb|KDQ55805.1|  hypothetical protein JAAARDRAFT_195621                  162   2e-43    
ref|XP_002837299.1|  hypothetical protein                               162   2e-43    
gb|EJK65080.1|  hypothetical protein THAOC_14117                        160   2e-43    
ref|XP_002549983.1|  diphosphomevalonate decarboxylase                  161   3e-43    
ref|XP_008190498.1|  PREDICTED: diphosphomevalonate decarboxylase...    162   3e-43    
ref|XP_007821634.1|  Diphosphomevalonate decarboxylase                  162   3e-43    
emb|CCK69779.1|  hypothetical protein KNAG_0D00260                      162   3e-43    
gb|EMS47869.1|  Diphosphomevalonate decarboxylase                       161   3e-43    
ref|XP_003956599.1|  hypothetical protein KAFR_0C04730                  162   3e-43    
gb|KID99722.1|  diphosphomevalonate decarboxylase                       161   4e-43    
gb|KGR23081.1|  diphosphomevalonate decarboxylase                       161   4e-43    
ref|XP_004535245.1|  PREDICTED: diphosphomevalonate decarboxylase...    161   4e-43    
ref|XP_004535244.1|  PREDICTED: diphosphomevalonate decarboxylase...    161   4e-43    
ref|XP_002005564.1|  GI19000                                            160   5e-43    
gb|ERL86359.1|  hypothetical protein D910_03767                         161   5e-43    
gb|KID90538.1|  diphosphomevalonate decarboxylase                       161   5e-43    
gb|ENN75638.1|  hypothetical protein YQE_07816                          161   6e-43    
ref|XP_007308164.1|  Diphosphomevalonate decarboxylase                  161   6e-43    
ref|XP_004204654.1|  Piso0_000514                                       160   7e-43    
ref|XP_011521388.1|  PREDICTED: diphosphomevalonate decarboxylase...    161   7e-43    
gb|KIM69548.1|  hypothetical protein SCLCIDRAFT_1208005                 160   1e-42    
gb|AFI45055.1|  diphosphomevalonate decarboxylase                       160   1e-42    
ref|XP_001628780.1|  predicted protein                                  160   1e-42    
gb|KGQ07524.1|  Diphosphomevalonate decarboxylase                       160   1e-42    
ref|XP_008602812.1|  diphosphomevalonate decarboxylase                  160   1e-42    
ref|XP_568247.1|  diphosphomevalonate decarboxylase                     160   1e-42    
ref|XP_456912.2|  DEHA2A13398p                                          160   1e-42    
emb|CEP61092.1|  LALA0S02e06546g1_1                                     160   2e-42    
ref|XP_006960000.1|  Diphosphomevalonate decarboxylase                  159   2e-42    
ref|XP_007372031.1|  hypothetical protein SPAPADRAFT_132255             159   2e-42    
ref|XP_773574.1|  hypothetical protein CNBI1880                         159   2e-42    
ref|XP_007431690.1|  PREDICTED: diphosphomevalonate decarboxylase       159   2e-42    
ref|XP_007808090.1|  diphosphomevalonate decarboxylase                  159   4e-42    
ref|XP_007670945.1|  PREDICTED: diphosphomevalonate decarboxylase       159   4e-42    
gb|ESW97073.1|  Diphosphomevalonate decarboxylase                       158   5e-42    
gb|EJT51120.1|  diphosphomevalonate decarboxylase                       159   6e-42    
gb|EKC98468.1|  diphosphomevalonate decarboxylase                       158   7e-42    
ref|XP_003868196.1|  Mvd mevalonate diphosphate decarboxylase           157   7e-42    
ref|XP_002028521.1|  GL14496                                            158   7e-42    
ref|XP_002616213.1|  hypothetical protein CLUG_03454                    157   8e-42    
ref|XP_001595868.1|  hypothetical protein SS1G_03958                    157   1e-41    
ref|XP_007295922.1|  diphosphomevalonate decarboxylase                  157   1e-41    
gb|EPT04682.1|  hypothetical protein FOMPIDRAFT_1140388                 157   1e-41    
gb|ESZ97096.1|  diphosphomevalonate decarboxylase                       157   2e-41    
gb|KEQ78066.1|  MVD1, mevalonate pyrophosphate decarboxylase            157   2e-41    
ref|XP_003654883.1|  diphosphomevalonate decarboxylase                  156   3e-41    
gb|KEQ90927.1|  hypothetical protein AUEXF2481DRAFT_70677               156   3e-41    
ref|XP_006673782.1|  diphosphomevalonate decarboxylase                  156   4e-41    
ref|XP_003800873.1|  PREDICTED: LOW QUALITY PROTEIN: diphosphomev...    156   4e-41    
gb|KIR59630.1|  diphosphomevalonate decarboxylase                       156   4e-41    
ref|XP_001546687.1|  hypothetical protein BC1G_14194                    155   4e-41    
dbj|GAM82807.1|  hypothetical protein ANO11243_007930                   156   5e-41    
gb|KIR46285.1|  diphosphomevalonate decarboxylase                       156   5e-41    
gb|KDN71936.1|  putative diphosphomevalonate decarboxylase              155   5e-41    
emb|CCX09629.1|  Similar to Diphosphomevalonate decarboxylase; ac...    155   5e-41    
gb|KHN93725.1|  diphosphomevalonate decarboxylase                       155   5e-41    
gb|KEQ88453.1|  MVD1, mevalonate pyrophosphate decarboxylase            155   6e-41    
ref|XP_005105464.1|  PREDICTED: diphosphomevalonate decarboxylase...    155   7e-41    
gb|EQB56153.1|  diphosphomevalonate decarboxylase                       155   8e-41    
emb|CCE40915.1|  hypothetical protein CPAR2_109530                      155   8e-41    



>ref|XP_002521172.1| diphosphomevalonate decarboxylase, putative [Ricinus communis]
 gb|EEF41203.1| diphosphomevalonate decarboxylase, putative [Ricinus communis]
Length=415

 Score =   344 bits (883),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 175/192 (91%), Positives = 185/192 (96%), Gaps = 0/192 (0%)
 Frame = +1

Query  178  MAEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFD  357
            MAE+WV MVTAQTPTNIAVIKYWGKRDETLILP+NDSISVTLDPAHLCTTTTVAVSPAFD
Sbjct  1    MAERWVRMVTAQTPTNIAVIKYWGKRDETLILPVNDSISVTLDPAHLCTTTTVAVSPAFD  60

Query  358  QDRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFP  537
            QDRMWLNGKE+SLSG RYQNCL+EIRARACDVED++KGIKI KKDWE LHVHIAS+NNFP
Sbjct  61   QDRMWLNGKEISLSGGRYQNCLREIRARACDVEDKEKGIKIAKKDWEKLHVHIASFNNFP  120

Query  538  TaaglassaagfaCLVFALGKLMNVKEDNSQLSAIARQGSGSACRSLFGGFVKWIMGKEE  717
            TAAGLASSAAGFACLVFAL KLMN +EDNS+LSAIARQGSGSACRSLFGGFVKWIMGK +
Sbjct  121  TAAGLASSAAGFACLVFALAKLMNAREDNSELSAIARQGSGSACRSLFGGFVKWIMGKVD  180

Query  718  DGSDSLAVQLVD  753
            DGSDSLAVQLVD
Sbjct  181  DGSDSLAVQLVD  192



>ref|XP_011024216.1| PREDICTED: diphosphomevalonate decarboxylase-like [Populus euphratica]
Length=416

 Score =   343 bits (881),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 177/193 (92%), Positives = 185/193 (96%), Gaps = 1/193 (1%)
 Frame = +1

Query  178  MAEK-WVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAF  354
            MAEK WV MVTAQTPTNIAVIKYWGKRDETLILP+NDSISVTLDPAHLCTTTTVAVSP+F
Sbjct  1    MAEKPWVRMVTAQTPTNIAVIKYWGKRDETLILPVNDSISVTLDPAHLCTTTTVAVSPSF  60

Query  355  DQDRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNF  534
            DQDRMWLNGKE+SLSG RYQNCL+EIRA+ACDVEDE+KGIKI KKDWE LHVH+ASYNNF
Sbjct  61   DQDRMWLNGKEISLSGGRYQNCLREIRAQACDVEDEEKGIKIAKKDWEKLHVHVASYNNF  120

Query  535  PTaaglassaagfaCLVFALGKLMNVKEDNSQLSAIARQGSGSACRSLFGGFVKWIMGKE  714
            PTAAGLASSAAGFACLVFAL KLMN KEDNS+LSAIARQGSGSACRSLFGGFVKWIMGK 
Sbjct  121  PTAAGLASSAAGFACLVFALAKLMNAKEDNSELSAIARQGSGSACRSLFGGFVKWIMGKA  180

Query  715  EDGSDSLAVQLVD  753
            EDGSDSLAVQLVD
Sbjct  181  EDGSDSLAVQLVD  193



>ref|XP_002315441.1| mevalonate disphosphate decarboxylase family protein [Populus 
trichocarpa]
 gb|EEF01612.1| mevalonate disphosphate decarboxylase family protein [Populus 
trichocarpa]
Length=416

 Score =   341 bits (874),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 176/193 (91%), Positives = 184/193 (95%), Gaps = 1/193 (1%)
 Frame = +1

Query  178  MAEK-WVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAF  354
            MA K WV MVTAQTPTNIAVIKYWGKRDETLILP+NDSISVTLDPAHLCTTTTVAVSP+F
Sbjct  1    MAGKPWVRMVTAQTPTNIAVIKYWGKRDETLILPVNDSISVTLDPAHLCTTTTVAVSPSF  60

Query  355  DQDRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNF  534
            DQDRMWLNGKE+SLSG RYQNCL+EIRA+ACD EDE+KGIKITKKDWE LHVH+ASYNNF
Sbjct  61   DQDRMWLNGKEISLSGGRYQNCLREIRAQACDAEDEEKGIKITKKDWEKLHVHVASYNNF  120

Query  535  PTaaglassaagfaCLVFALGKLMNVKEDNSQLSAIARQGSGSACRSLFGGFVKWIMGKE  714
            PTAAGLASSAAGFACLVFAL KLMN KEDNS+LSAIARQGSGSACRSLFGGFVKWIMGK 
Sbjct  121  PTAAGLASSAAGFACLVFALAKLMNAKEDNSELSAIARQGSGSACRSLFGGFVKWIMGKA  180

Query  715  EDGSDSLAVQLVD  753
            EDGSDSLAVQLVD
Sbjct  181  EDGSDSLAVQLVD  193



>gb|KJB78631.1| hypothetical protein B456_013G012400 [Gossypium raimondii]
Length=293

 Score =   336 bits (862),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 172/192 (90%), Positives = 181/192 (94%), Gaps = 0/192 (0%)
 Frame = +1

Query  178  MAEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFD  357
            M EKWVLM TAQTPTNIAVIKYWGKRDETLILP+NDSISVTLDPAHLCTTTTVAVSPAF 
Sbjct  1    MGEKWVLMKTAQTPTNIAVIKYWGKRDETLILPVNDSISVTLDPAHLCTTTTVAVSPAFQ  60

Query  358  QDRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFP  537
            QDRMWLNGKE+SLSG RYQNCL+EIR RA +VED+++GIKI KKDWE LH+HIASYNNFP
Sbjct  61   QDRMWLNGKEISLSGGRYQNCLREIRTRAREVEDKERGIKIEKKDWEKLHLHIASYNNFP  120

Query  538  TaaglassaagfaCLVFALGKLMNVKEDNSQLSAIARQGSGSACRSLFGGFVKWIMGKEE  717
            TAAGLASSAAGFACLVFAL KLMNV ED SQLSAIARQGSGSACRSLFGGFVKWIMGKE+
Sbjct  121  TAAGLASSAAGFACLVFALAKLMNVSEDESQLSAIARQGSGSACRSLFGGFVKWIMGKED  180

Query  718  DGSDSLAVQLVD  753
            DGSDSLAVQLVD
Sbjct  181  DGSDSLAVQLVD  192



>gb|AID51442.1| mevalonate diphosphate decarboxylase [Astragalus membranaceus]
Length=420

 Score =   340 bits (873),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 172/191 (90%), Positives = 184/191 (96%), Gaps = 0/191 (0%)
 Frame = +1

Query  181  AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  360
            ++ WVLMVTAQTPTNIAVIKYWGKRDETLILP+NDSISVTLDP HLCTTTTVAVSPAF+Q
Sbjct  5    SQNWVLMVTAQTPTNIAVIKYWGKRDETLILPVNDSISVTLDPNHLCTTTTVAVSPAFNQ  64

Query  361  DRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPT  540
            DRMWLNGKE+SLSG R+Q+CL+EIRARACDVED KKG+KITK+DW  LHVHIASYNNFPT
Sbjct  65   DRMWLNGKEISLSGGRFQSCLREIRARACDVEDTKKGVKITKEDWSKLHVHIASYNNFPT  124

Query  541  aaglassaagfaCLVFALGKLMNVKEDNSQLSAIARQGSGSACRSLFGGFVKWIMGKEED  720
            AAGLASSAAGFACLV+ALGKLMNVKEDNSQLSAIARQGSGSACRSLFGGFVKWIMGKEE+
Sbjct  125  AAGLASSAAGFACLVYALGKLMNVKEDNSQLSAIARQGSGSACRSLFGGFVKWIMGKEEN  184

Query  721  GSDSLAVQLVD  753
            GSDSLAVQL D
Sbjct  185  GSDSLAVQLAD  195



>ref|XP_011032862.1| PREDICTED: diphosphomevalonate decarboxylase-like [Populus euphratica]
Length=416

 Score =   340 bits (871),  Expect = 9e-112, Method: Compositional matrix adjust.
 Identities = 175/193 (91%), Positives = 185/193 (96%), Gaps = 1/193 (1%)
 Frame = +1

Query  178  MAEK-WVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAF  354
            MAEK WV MVTAQTPTNIAVIKYWGKRDETLILP+NDSISVTLDPAHLCTTTTVAVSP+F
Sbjct  1    MAEKTWVRMVTAQTPTNIAVIKYWGKRDETLILPVNDSISVTLDPAHLCTTTTVAVSPSF  60

Query  355  DQDRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNF  534
            DQDRMWLNGKE+SLSG RYQNCL+EIRARAC+VED++KGIKI KKDWE LH+H+ASYNNF
Sbjct  61   DQDRMWLNGKEISLSGGRYQNCLREIRARACEVEDKEKGIKIAKKDWEKLHLHVASYNNF  120

Query  535  PTaaglassaagfaCLVFALGKLMNVKEDNSQLSAIARQGSGSACRSLFGGFVKWIMGKE  714
            PTAAGLASSAAGFACLVFAL KLMN KEDNS+LSAIARQGSGSACRSLFGGFVKWIMGK 
Sbjct  121  PTAAGLASSAAGFACLVFALAKLMNAKEDNSELSAIARQGSGSACRSLFGGFVKWIMGKA  180

Query  715  EDGSDSLAVQLVD  753
            EDGSDSLAVQLVD
Sbjct  181  EDGSDSLAVQLVD  193



>gb|KJB78632.1| hypothetical protein B456_013G012400 [Gossypium raimondii]
Length=345

 Score =   337 bits (864),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 172/192 (90%), Positives = 181/192 (94%), Gaps = 0/192 (0%)
 Frame = +1

Query  178  MAEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFD  357
            M EKWVLM TAQTPTNIAVIKYWGKRDETLILP+NDSISVTLDPAHLCTTTTVAVSPAF 
Sbjct  1    MGEKWVLMKTAQTPTNIAVIKYWGKRDETLILPVNDSISVTLDPAHLCTTTTVAVSPAFQ  60

Query  358  QDRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFP  537
            QDRMWLNGKE+SLSG RYQNCL+EIR RA +VED+++GIKI KKDWE LH+HIASYNNFP
Sbjct  61   QDRMWLNGKEISLSGGRYQNCLREIRTRAREVEDKERGIKIEKKDWEKLHLHIASYNNFP  120

Query  538  TaaglassaagfaCLVFALGKLMNVKEDNSQLSAIARQGSGSACRSLFGGFVKWIMGKEE  717
            TAAGLASSAAGFACLVFAL KLMNV ED SQLSAIARQGSGSACRSLFGGFVKWIMGKE+
Sbjct  121  TAAGLASSAAGFACLVFALAKLMNVSEDESQLSAIARQGSGSACRSLFGGFVKWIMGKED  180

Query  718  DGSDSLAVQLVD  753
            DGSDSLAVQLVD
Sbjct  181  DGSDSLAVQLVD  192



>ref|XP_002311015.1| mevalonate disphosphate decarboxylase family protein [Populus 
trichocarpa]
 gb|EEE88382.1| mevalonate disphosphate decarboxylase family protein [Populus 
trichocarpa]
Length=416

 Score =   338 bits (868),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 175/193 (91%), Positives = 184/193 (95%), Gaps = 1/193 (1%)
 Frame = +1

Query  178  MAEK-WVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAF  354
            MAEK WV MVTAQTPTNIAVIKYWGKRDETLILP+NDSISVTLDPAHLCTTTTVAVSP+F
Sbjct  1    MAEKTWVRMVTAQTPTNIAVIKYWGKRDETLILPVNDSISVTLDPAHLCTTTTVAVSPSF  60

Query  355  DQDRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNF  534
            DQDRMWLNGKE+SLSG RYQNCL+EIRARAC VED++KGIKI KKDWE LH+H+ASYNNF
Sbjct  61   DQDRMWLNGKEISLSGGRYQNCLREIRARACAVEDKEKGIKIAKKDWEKLHLHVASYNNF  120

Query  535  PTaaglassaagfaCLVFALGKLMNVKEDNSQLSAIARQGSGSACRSLFGGFVKWIMGKE  714
            PTAAGLASSAAGFACLVFAL KLMN KEDNS+LSAIARQGSGSACRSLFGGFVKWIMGK 
Sbjct  121  PTAAGLASSAAGFACLVFALAKLMNAKEDNSELSAIARQGSGSACRSLFGGFVKWIMGKA  180

Query  715  EDGSDSLAVQLVD  753
            EDGSDSLAVQLVD
Sbjct  181  EDGSDSLAVQLVD  193



>gb|KDO47061.1| hypothetical protein CISIN_1g014714mg [Citrus sinensis]
Length=254

 Score =   332 bits (851),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 169/191 (88%), Positives = 182/191 (95%), Gaps = 0/191 (0%)
 Frame = +1

Query  181  AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  360
            AEKWVLMVTAQTPTNIAVIKYWGKRDETLILP+NDSISVTLDP HLCTTTTVAVSP+FDQ
Sbjct  3    AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPVNDSISVTLDPDHLCTTTTVAVSPSFDQ  62

Query  361  DRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPT  540
            DRMWLNGKE+SL G RYQNCLKEIR+RACDVED +KGIKI KKDW+ LH+HIAS+NNFPT
Sbjct  63   DRMWLNGKEISLGGGRYQNCLKEIRSRACDVEDTEKGIKIEKKDWQKLHLHIASFNNFPT  122

Query  541  aaglassaagfaCLVFALGKLMNVKEDNSQLSAIARQGSGSACRSLFGGFVKWIMGKEED  720
            AAGLASSAAGFACLVF+L KLMN+KE+ SQLSAIARQGSGSACRSLFGGFVKWI+GKE +
Sbjct  123  AAGLASSAAGFACLVFSLAKLMNLKENQSQLSAIARQGSGSACRSLFGGFVKWILGKEGN  182

Query  721  GSDSLAVQLVD  753
            GSDSLAVQLVD
Sbjct  183  GSDSLAVQLVD  193



>gb|KHG20400.1| Mvd [Gossypium arboreum]
Length=459

 Score =   338 bits (867),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 173/192 (90%), Positives = 181/192 (94%), Gaps = 0/192 (0%)
 Frame = +1

Query  178  MAEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFD  357
            M EKWVLM TAQTPTNIAVIKYWGKRDETLILP+NDSISVTLDPAHLCTTTTVAVSPAF 
Sbjct  37   MGEKWVLMKTAQTPTNIAVIKYWGKRDETLILPVNDSISVTLDPAHLCTTTTVAVSPAFQ  96

Query  358  QDRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFP  537
            QDRMWLNGKEMSLSG RYQNCL+EIR RA +VED+++GIKI KKDWE LH+HIASYNNFP
Sbjct  97   QDRMWLNGKEMSLSGGRYQNCLREIRKRAREVEDKERGIKIEKKDWEKLHLHIASYNNFP  156

Query  538  TaaglassaagfaCLVFALGKLMNVKEDNSQLSAIARQGSGSACRSLFGGFVKWIMGKEE  717
            TAAGLASSAAGFACLVFAL KLMNV ED SQLSAIARQGSGSACRSLFGGFVKWIMGKE+
Sbjct  157  TAAGLASSAAGFACLVFALAKLMNVSEDESQLSAIARQGSGSACRSLFGGFVKWIMGKED  216

Query  718  DGSDSLAVQLVD  753
            DGSDSLAVQLVD
Sbjct  217  DGSDSLAVQLVD  228



>gb|KHG20401.1| Mvd [Gossypium arboreum]
Length=423

 Score =   337 bits (863),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 173/192 (90%), Positives = 181/192 (94%), Gaps = 0/192 (0%)
 Frame = +1

Query  178  MAEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFD  357
            M EKWVLM TAQTPTNIAVIKYWGKRDETLILP+NDSISVTLDPAHLCTTTTVAVSPAF 
Sbjct  1    MGEKWVLMKTAQTPTNIAVIKYWGKRDETLILPVNDSISVTLDPAHLCTTTTVAVSPAFQ  60

Query  358  QDRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFP  537
            QDRMWLNGKEMSLSG RYQNCL+EIR RA +VED+++GIKI KKDWE LH+HIASYNNFP
Sbjct  61   QDRMWLNGKEMSLSGGRYQNCLREIRKRAREVEDKERGIKIEKKDWEKLHLHIASYNNFP  120

Query  538  TaaglassaagfaCLVFALGKLMNVKEDNSQLSAIARQGSGSACRSLFGGFVKWIMGKEE  717
            TAAGLASSAAGFACLVFAL KLMNV ED SQLSAIARQGSGSACRSLFGGFVKWIMGKE+
Sbjct  121  TAAGLASSAAGFACLVFALAKLMNVSEDESQLSAIARQGSGSACRSLFGGFVKWIMGKED  180

Query  718  DGSDSLAVQLVD  753
            DGSDSLAVQLVD
Sbjct  181  DGSDSLAVQLVD  192



>gb|KJB78629.1| hypothetical protein B456_013G012400 [Gossypium raimondii]
 gb|KJB78630.1| hypothetical protein B456_013G012400 [Gossypium raimondii]
Length=415

 Score =   337 bits (863),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 172/192 (90%), Positives = 181/192 (94%), Gaps = 0/192 (0%)
 Frame = +1

Query  178  MAEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFD  357
            M EKWVLM TAQTPTNIAVIKYWGKRDETLILP+NDSISVTLDPAHLCTTTTVAVSPAF 
Sbjct  1    MGEKWVLMKTAQTPTNIAVIKYWGKRDETLILPVNDSISVTLDPAHLCTTTTVAVSPAFQ  60

Query  358  QDRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFP  537
            QDRMWLNGKE+SLSG RYQNCL+EIR RA +VED+++GIKI KKDWE LH+HIASYNNFP
Sbjct  61   QDRMWLNGKEISLSGGRYQNCLREIRTRAREVEDKERGIKIEKKDWEKLHLHIASYNNFP  120

Query  538  TaaglassaagfaCLVFALGKLMNVKEDNSQLSAIARQGSGSACRSLFGGFVKWIMGKEE  717
            TAAGLASSAAGFACLVFAL KLMNV ED SQLSAIARQGSGSACRSLFGGFVKWIMGKE+
Sbjct  121  TAAGLASSAAGFACLVFALAKLMNVSEDESQLSAIARQGSGSACRSLFGGFVKWIMGKED  180

Query  718  DGSDSLAVQLVD  753
            DGSDSLAVQLVD
Sbjct  181  DGSDSLAVQLVD  192



>gb|ADR65113.1| mevalonate 5-diphosphate decarboxylase [Catharanthus roseus]
Length=421

 Score =   337 bits (863),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 175/195 (90%), Positives = 183/195 (94%), Gaps = 3/195 (2%)
 Frame = +1

Query  178  MAEK---WVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSP  348
            MAEK   WVLMVTAQTPTNIAVIKYWGKRDE LILPINDSISVTLDPAHLCTTTTVAVSP
Sbjct  1    MAEKNDSWVLMVTAQTPTNIAVIKYWGKRDENLILPINDSISVTLDPAHLCTTTTVAVSP  60

Query  349  AFDQDRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYN  528
            AF QDRMWLNGKE+SLSG RYQNCL+EIR+RA DVEDEKKGIKITKKDWE LH+HIASYN
Sbjct  61   AFTQDRMWLNGKEISLSGGRYQNCLREIRSRANDVEDEKKGIKITKKDWEKLHLHIASYN  120

Query  529  NFPTaaglassaagfaCLVFALGKLMNVKEDNSQLSAIARQGSGSACRSLFGGFVKWIMG  708
            NFPTAAGLASSAAGFACLVF+L KLMN KEDN QLSAIARQGSGSACRSL+GGFVKWIMG
Sbjct  121  NFPTAAGLASSAAGFACLVFSLAKLMNAKEDNGQLSAIARQGSGSACRSLYGGFVKWIMG  180

Query  709  KEEDGSDSLAVQLVD  753
            KEE+GSDS+A QLVD
Sbjct  181  KEENGSDSIAAQLVD  195



>ref|XP_007010317.1| Mevalonate diphosphate decarboxylase 1 isoform 4 [Theobroma cacao]
 gb|EOY19127.1| Mevalonate diphosphate decarboxylase 1 isoform 4 [Theobroma cacao]
Length=288

 Score =   332 bits (851),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 169/192 (88%), Positives = 180/192 (94%), Gaps = 0/192 (0%)
 Frame = +1

Query  178  MAEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFD  357
            M E WVLM TAQTPTNIAVIKYWGKRDE+LILP+NDSISVTLDPAHLCTTTTVAVSP F 
Sbjct  1    MGETWVLMKTAQTPTNIAVIKYWGKRDESLILPVNDSISVTLDPAHLCTTTTVAVSPVFQ  60

Query  358  QDRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFP  537
            QDRMWLNGKE+SLSG R+Q+CL+EIR RA +VED++KG+KI KKDWE LHVHIASYNNFP
Sbjct  61   QDRMWLNGKEISLSGGRFQSCLREIRRRASEVEDKEKGVKIEKKDWEKLHVHIASYNNFP  120

Query  538  TaaglassaagfaCLVFALGKLMNVKEDNSQLSAIARQGSGSACRSLFGGFVKWIMGKEE  717
            TAAGLASSAAGFACLVFAL KLMNVKED SQLSAIARQGSGSACRSLFGGFVKWIMGKEE
Sbjct  121  TAAGLASSAAGFACLVFALAKLMNVKEDESQLSAIARQGSGSACRSLFGGFVKWIMGKEE  180

Query  718  DGSDSLAVQLVD  753
            DGSDS+AVQLVD
Sbjct  181  DGSDSVAVQLVD  192



>gb|AAL18927.1|AF429386_1 mevalonate disphosphate decarboxylase [Hevea brasiliensis]
Length=415

 Score =   336 bits (862),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 171/192 (89%), Positives = 183/192 (95%), Gaps = 0/192 (0%)
 Frame = +1

Query  178  MAEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFD  357
            MAE WV+MVTAQTPTNIAVIKYWGKRDE LILP+NDSISVTLDPAHLCTTTTVAVSP+F 
Sbjct  1    MAESWVIMVTAQTPTNIAVIKYWGKRDEKLILPVNDSISVTLDPAHLCTTTTVAVSPSFA  60

Query  358  QDRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFP  537
            QDRMWLNGKE+SLSG RYQNCL+EIRARACDVED+++GIKI+KKDWE L+VHIASYNNFP
Sbjct  61   QDRMWLNGKEISLSGGRYQNCLREIRARACDVEDKERGIKISKKDWEKLYVHIASYNNFP  120

Query  538  TaaglassaagfaCLVFALGKLMNVKEDNSQLSAIARQGSGSACRSLFGGFVKWIMGKEE  717
            TAAGLASSAAGFACLVFAL KLMN KEDNS+LSAIARQGSGSACRSLFGGFVKW MGK E
Sbjct  121  TAAGLASSAAGFACLVFALAKLMNAKEDNSELSAIARQGSGSACRSLFGGFVKWKMGKVE  180

Query  718  DGSDSLAVQLVD  753
            DGSDSLAVQ+VD
Sbjct  181  DGSDSLAVQVVD  192



>ref|XP_009792788.1| PREDICTED: diphosphomevalonate decarboxylase-like [Nicotiana 
sylvestris]
Length=421

 Score =   335 bits (860),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 170/191 (89%), Positives = 184/191 (96%), Gaps = 0/191 (0%)
 Frame = +1

Query  181  AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  360
            ++KWVLMVTAQTPTNIAVIKYWGKRDE LIL INDSISVTLDPAHLCTTTTVAVSPAF+Q
Sbjct  5    SQKWVLMVTAQTPTNIAVIKYWGKRDENLILAINDSISVTLDPAHLCTTTTVAVSPAFNQ  64

Query  361  DRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPT  540
            DRMWLNGKE+SLSG RYQNCL+EIRARA DVEDEK+GIKI KKDWENLHVHIASYNNFPT
Sbjct  65   DRMWLNGKEISLSGGRYQNCLREIRARANDVEDEKRGIKIVKKDWENLHVHIASYNNFPT  124

Query  541  aaglassaagfaCLVFALGKLMNVKEDNSQLSAIARQGSGSACRSLFGGFVKWIMGKEED  720
            AAGLASSAAGFACLV++L KLMNV+EDN +LSAIARQGSGSACRSL+GGFVKW+MGKEE+
Sbjct  125  AAGLASSAAGFACLVYSLAKLMNVQEDNGKLSAIARQGSGSACRSLYGGFVKWVMGKEEN  184

Query  721  GSDSLAVQLVD  753
            GSDS+AVQLVD
Sbjct  185  GSDSVAVQLVD  195



>gb|AII99848.1| mevalonate disphosphate decarboxylase [Nicotiana tabacum]
Length=418

 Score =   335 bits (860),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 170/191 (89%), Positives = 184/191 (96%), Gaps = 0/191 (0%)
 Frame = +1

Query  181  AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  360
            ++KWVLMVTAQTPTNIAVIKYWGKRDE LIL INDSISVTLDPAHLCTTTTVAVSPAF+Q
Sbjct  5    SQKWVLMVTAQTPTNIAVIKYWGKRDENLILAINDSISVTLDPAHLCTTTTVAVSPAFNQ  64

Query  361  DRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPT  540
            DRMWLNGKE+SLSG RYQNCL+EIRARA DVEDEK+GIKI KKDWENLHVHIASYNNFPT
Sbjct  65   DRMWLNGKEISLSGGRYQNCLREIRARANDVEDEKRGIKIVKKDWENLHVHIASYNNFPT  124

Query  541  aaglassaagfaCLVFALGKLMNVKEDNSQLSAIARQGSGSACRSLFGGFVKWIMGKEED  720
            AAGLASSAAGFACLV++L KLMNV+EDN +LSAIARQGSGSACRSL+GGFVKW+MGKEE+
Sbjct  125  AAGLASSAAGFACLVYSLAKLMNVQEDNGKLSAIARQGSGSACRSLYGGFVKWVMGKEEN  184

Query  721  GSDSLAVQLVD  753
            GSDS+AVQLVD
Sbjct  185  GSDSVAVQLVD  195



>gb|KDO47060.1| hypothetical protein CISIN_1g014714mg [Citrus sinensis]
Length=344

 Score =   332 bits (852),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 169/191 (88%), Positives = 182/191 (95%), Gaps = 0/191 (0%)
 Frame = +1

Query  181  AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  360
            AEKWVLMVTAQTPTNIAVIKYWGKRDETLILP+NDSISVTLDP HLCTTTTVAVSP+FDQ
Sbjct  3    AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPVNDSISVTLDPDHLCTTTTVAVSPSFDQ  62

Query  361  DRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPT  540
            DRMWLNGKE+SL G RYQNCLKEIR+RACDVED +KGIKI KKDW+ LH+HIAS+NNFPT
Sbjct  63   DRMWLNGKEISLGGGRYQNCLKEIRSRACDVEDTEKGIKIEKKDWQKLHLHIASFNNFPT  122

Query  541  aaglassaagfaCLVFALGKLMNVKEDNSQLSAIARQGSGSACRSLFGGFVKWIMGKEED  720
            AAGLASSAAGFACLVF+L KLMN+KE+ SQLSAIARQGSGSACRSLFGGFVKWI+GKE +
Sbjct  123  AAGLASSAAGFACLVFSLAKLMNLKENQSQLSAIARQGSGSACRSLFGGFVKWILGKEGN  182

Query  721  GSDSLAVQLVD  753
            GSDSLAVQLVD
Sbjct  183  GSDSLAVQLVD  193



>ref|XP_009619582.1| PREDICTED: diphosphomevalonate decarboxylase-like [Nicotiana 
tomentosiformis]
Length=421

 Score =   335 bits (859),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 169/191 (88%), Positives = 184/191 (96%), Gaps = 0/191 (0%)
 Frame = +1

Query  181  AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  360
            ++KWVLMVTAQTPTNIAVIKYWGKRDE LIL INDSISVTLDPAHLCTTTTVAVSPAF+Q
Sbjct  5    SQKWVLMVTAQTPTNIAVIKYWGKRDENLILAINDSISVTLDPAHLCTTTTVAVSPAFNQ  64

Query  361  DRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPT  540
            DRMWLNGKE+SLSG RYQNCL+EIRARA DVEDEK+GIKITK DWENLHVHIASYNNFPT
Sbjct  65   DRMWLNGKEISLSGGRYQNCLREIRARANDVEDEKRGIKITKNDWENLHVHIASYNNFPT  124

Query  541  aaglassaagfaCLVFALGKLMNVKEDNSQLSAIARQGSGSACRSLFGGFVKWIMGKEED  720
            AAGLASSAAGFACLV++L KLMNV+EDN +LSAIARQGSGSACRSL+GGFVKW+MGKEE+
Sbjct  125  AAGLASSAAGFACLVYSLAKLMNVQEDNGKLSAIARQGSGSACRSLYGGFVKWVMGKEEN  184

Query  721  GSDSLAVQLVD  753
            GSDS+A+QLVD
Sbjct  185  GSDSVAIQLVD  195



>emb|CDO99902.1| unnamed protein product [Coffea canephora]
Length=424

 Score =   335 bits (859),  Expect = 9e-110, Method: Compositional matrix adjust.
 Identities = 172/194 (89%), Positives = 185/194 (95%), Gaps = 2/194 (1%)
 Frame = +1

Query  178  MAEK--WVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPA  351
            MAEK  WVLMVTAQTPTNIAVIKYWGKRDE+LILPINDSISVTLDP+HLCTTTTVAVSP 
Sbjct  1    MAEKKSWVLMVTAQTPTNIAVIKYWGKRDESLILPINDSISVTLDPSHLCTTTTVAVSPG  60

Query  352  FDQDRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNN  531
            F  DRMWLNGKE+SLSG RYQNCL+EIR+RA DVEDEKKGIKI KKDWENLH+HIASYNN
Sbjct  61   FTHDRMWLNGKEISLSGGRYQNCLREIRSRASDVEDEKKGIKIAKKDWENLHLHIASYNN  120

Query  532  FPTaaglassaagfaCLVFALGKLMNVKEDNSQLSAIARQGSGSACRSLFGGFVKWIMGK  711
            FPTAAGLASSAAGFACLV++L KLMNVKEDNSQLSAIARQGSGSACRSL+GGFVKWIMGK
Sbjct  121  FPTAAGLASSAAGFACLVYSLAKLMNVKEDNSQLSAIARQGSGSACRSLYGGFVKWIMGK  180

Query  712  EEDGSDSLAVQLVD  753
            +++GSDS+AVQLVD
Sbjct  181  DDNGSDSIAVQLVD  194



>ref|XP_007010316.1| GHMP kinase family protein isoform 3 [Theobroma cacao]
 gb|EOY19126.1| GHMP kinase family protein isoform 3 [Theobroma cacao]
Length=315

 Score =   331 bits (849),  Expect = 9e-110, Method: Compositional matrix adjust.
 Identities = 169/192 (88%), Positives = 180/192 (94%), Gaps = 0/192 (0%)
 Frame = +1

Query  178  MAEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFD  357
            M E WVLM TAQTPTNIAVIKYWGKRDE+LILP+NDSISVTLDPAHLCTTTTVAVSP F 
Sbjct  1    MGETWVLMKTAQTPTNIAVIKYWGKRDESLILPVNDSISVTLDPAHLCTTTTVAVSPVFQ  60

Query  358  QDRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFP  537
            QDRMWLNGKE+SLSG R+Q+CL+EIR RA +VED++KG+KI KKDWE LHVHIASYNNFP
Sbjct  61   QDRMWLNGKEISLSGGRFQSCLREIRRRASEVEDKEKGVKIEKKDWEKLHVHIASYNNFP  120

Query  538  TaaglassaagfaCLVFALGKLMNVKEDNSQLSAIARQGSGSACRSLFGGFVKWIMGKEE  717
            TAAGLASSAAGFACLVFAL KLMNVKED SQLSAIARQGSGSACRSLFGGFVKWIMGKEE
Sbjct  121  TAAGLASSAAGFACLVFALAKLMNVKEDESQLSAIARQGSGSACRSLFGGFVKWIMGKEE  180

Query  718  DGSDSLAVQLVD  753
            DGSDS+AVQLVD
Sbjct  181  DGSDSVAVQLVD  192



>dbj|BAF98285.1| diphosphomevelonate decarboxylase [Hevea brasiliensis]
Length=415

 Score =   334 bits (857),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 170/192 (89%), Positives = 182/192 (95%), Gaps = 0/192 (0%)
 Frame = +1

Query  178  MAEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFD  357
            MAE WV+MVTAQTPTNIAVIKYWGKRDE LILP+NDSISVTLDP HLCTTTTVAVSP+F 
Sbjct  1    MAESWVIMVTAQTPTNIAVIKYWGKRDEKLILPVNDSISVTLDPVHLCTTTTVAVSPSFA  60

Query  358  QDRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFP  537
            QDRMWLNGKE+SLSG RYQNCL+EIRARACDVED+++GIKI+KKDWE LHVHIASYNNFP
Sbjct  61   QDRMWLNGKEISLSGGRYQNCLREIRARACDVEDKERGIKISKKDWEKLHVHIASYNNFP  120

Query  538  TaaglassaagfaCLVFALGKLMNVKEDNSQLSAIARQGSGSACRSLFGGFVKWIMGKEE  717
            TAAGLASSAAGFACLVFAL KLMN KED+S+LSAIARQGSGSACRSLFGGFVKW MGK E
Sbjct  121  TAAGLASSAAGFACLVFALAKLMNAKEDHSELSAIARQGSGSACRSLFGGFVKWKMGKVE  180

Query  718  DGSDSLAVQLVD  753
            DGSDSLAVQ+VD
Sbjct  181  DGSDSLAVQVVD  192



>ref|XP_007142839.1| hypothetical protein PHAVU_007G021200g [Phaseolus vulgaris]
 gb|ESW14833.1| hypothetical protein PHAVU_007G021200g [Phaseolus vulgaris]
Length=420

 Score =   334 bits (857),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 168/191 (88%), Positives = 181/191 (95%), Gaps = 0/191 (0%)
 Frame = +1

Query  181  AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  360
            ++ WV+MVTAQTPTNIAVIKYWGKRDETLILP+NDSISVTLDPAHLCTTTTVAVSP F Q
Sbjct  5    SQNWVVMVTAQTPTNIAVIKYWGKRDETLILPVNDSISVTLDPAHLCTTTTVAVSPTFQQ  64

Query  361  DRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPT  540
            DRMWLNGKE+SLSG R+QNCL+EIR+RACDVEDEKKGIKI K+DW  LHVHIASYNNFPT
Sbjct  65   DRMWLNGKEISLSGGRFQNCLREIRSRACDVEDEKKGIKIRKEDWSKLHVHIASYNNFPT  124

Query  541  aaglassaagfaCLVFALGKLMNVKEDNSQLSAIARQGSGSACRSLFGGFVKWIMGKEED  720
            AAGLASSAAGFACL +ALGKLMNVKED SQLSAIARQGSGSACRSLFGGFVKW+MGKE++
Sbjct  125  AAGLASSAAGFACLAYALGKLMNVKEDESQLSAIARQGSGSACRSLFGGFVKWVMGKEDN  184

Query  721  GSDSLAVQLVD  753
            GSDSLAVQL D
Sbjct  185  GSDSLAVQLAD  195



>ref|XP_004497159.1| PREDICTED: diphosphomevalonate decarboxylase-like [Cicer arietinum]
Length=421

 Score =   333 bits (853),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 169/194 (87%), Positives = 181/194 (93%), Gaps = 0/194 (0%)
 Frame = +1

Query  172  GTMAEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPA  351
            G   + WVLMVTAQTPTNIAVIKYWGKRDETLILP+NDSISVTLDP HLCTTTTVAVSP+
Sbjct  3    GDSQQNWVLMVTAQTPTNIAVIKYWGKRDETLILPVNDSISVTLDPNHLCTTTTVAVSPS  62

Query  352  FDQDRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNN  531
            F QDRMWLNGKE+SLSG R+Q+CL+EIRARAC+VED KKGIKITK+DW   H+HIASYNN
Sbjct  63   FQQDRMWLNGKEISLSGGRFQSCLREIRARACEVEDNKKGIKITKEDWGKFHIHIASYNN  122

Query  532  FPTaaglassaagfaCLVFALGKLMNVKEDNSQLSAIARQGSGSACRSLFGGFVKWIMGK  711
            FPTAAGLASSAAGFACLV+ALGKLMNVKED SQLSAIARQGSGSACRSLFGGFVKWIMGK
Sbjct  123  FPTAAGLASSAAGFACLVYALGKLMNVKEDESQLSAIARQGSGSACRSLFGGFVKWIMGK  182

Query  712  EEDGSDSLAVQLVD  753
            EE+GSDSLAVQL D
Sbjct  183  EENGSDSLAVQLAD  196



>ref|XP_009630346.1| PREDICTED: diphosphomevalonate decarboxylase-like [Nicotiana 
tomentosiformis]
Length=422

 Score =   333 bits (853),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 169/190 (89%), Positives = 180/190 (95%), Gaps = 0/190 (0%)
 Frame = +1

Query  184  EKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQD  363
            + WVLMVTAQTPTNIAVIKYWGKRDE LIL INDSISVTLDPAHLCTTTTVAVSPAFDQD
Sbjct  7    QNWVLMVTAQTPTNIAVIKYWGKRDEDLILAINDSISVTLDPAHLCTTTTVAVSPAFDQD  66

Query  364  RMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTa  543
            RMWLNGKE+SLSG RYQNCL+EIRARA DVEDE KGIKI KKDW+NLHVH+ASYNNFPTA
Sbjct  67   RMWLNGKEISLSGGRYQNCLREIRARASDVEDENKGIKIAKKDWQNLHVHVASYNNFPTA  126

Query  544  aglassaagfaCLVFALGKLMNVKEDNSQLSAIARQGSGSACRSLFGGFVKWIMGKEEDG  723
            AGLASSAAGFACLVF+L KLMNV+EDN +LSAIARQGSGSACRSL+GGFVKWIMGKEE+G
Sbjct  127  AGLASSAAGFACLVFSLAKLMNVQEDNGKLSAIARQGSGSACRSLYGGFVKWIMGKEENG  186

Query  724  SDSLAVQLVD  753
             DS+AVQLVD
Sbjct  187  GDSIAVQLVD  196



>gb|KDO47059.1| hypothetical protein CISIN_1g014714mg [Citrus sinensis]
Length=420

 Score =   332 bits (852),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 169/191 (88%), Positives = 182/191 (95%), Gaps = 0/191 (0%)
 Frame = +1

Query  181  AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  360
            AEKWVLMVTAQTPTNIAVIKYWGKRDETLILP+NDSISVTLDP HLCTTTTVAVSP+FDQ
Sbjct  3    AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPVNDSISVTLDPDHLCTTTTVAVSPSFDQ  62

Query  361  DRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPT  540
            DRMWLNGKE+SL G RYQNCLKEIR+RACDVED +KGIKI KKDW+ LH+HIAS+NNFPT
Sbjct  63   DRMWLNGKEISLGGGRYQNCLKEIRSRACDVEDTEKGIKIEKKDWQKLHLHIASFNNFPT  122

Query  541  aaglassaagfaCLVFALGKLMNVKEDNSQLSAIARQGSGSACRSLFGGFVKWIMGKEED  720
            AAGLASSAAGFACLVF+L KLMN+KE+ SQLSAIARQGSGSACRSLFGGFVKWI+GKE +
Sbjct  123  AAGLASSAAGFACLVFSLAKLMNLKENQSQLSAIARQGSGSACRSLFGGFVKWILGKEGN  182

Query  721  GSDSLAVQLVD  753
            GSDSLAVQLVD
Sbjct  183  GSDSLAVQLVD  193



>gb|KHN11470.1| Diphosphomevalonate decarboxylase [Glycine soja]
Length=421

 Score =   332 bits (852),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 169/191 (88%), Positives = 180/191 (94%), Gaps = 0/191 (0%)
 Frame = +1

Query  181  AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  360
            ++ WV MVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDP+HLCTTTT AVSPAF Q
Sbjct  6    SQNWVFMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPSHLCTTTTAAVSPAFHQ  65

Query  361  DRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPT  540
            DRMWLNGKE+SLSG R+Q+CL+EIRARACDVEDE KGIKITK+DW  LHVHIASYNNFPT
Sbjct  66   DRMWLNGKEISLSGGRFQSCLREIRARACDVEDETKGIKITKEDWGKLHVHIASYNNFPT  125

Query  541  aaglassaagfaCLVFALGKLMNVKEDNSQLSAIARQGSGSACRSLFGGFVKWIMGKEED  720
            AAGLASSAAGFACL +ALGKLMNVKED SQLSAIARQGSGSACRSLFGGFVKWIMGKE++
Sbjct  126  AAGLASSAAGFACLAYALGKLMNVKEDESQLSAIARQGSGSACRSLFGGFVKWIMGKEDN  185

Query  721  GSDSLAVQLVD  753
            GSDSLAVQL D
Sbjct  186  GSDSLAVQLTD  196



>ref|XP_003555870.1| PREDICTED: diphosphomevalonate decarboxylase-like [Glycine max]
Length=421

 Score =   332 bits (851),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 168/191 (88%), Positives = 180/191 (94%), Gaps = 0/191 (0%)
 Frame = +1

Query  181  AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  360
            ++ WV MVTAQTPTNIAVIKYWGKRDETLILP+NDSISVTLDP+HLCTTTT AVSPAF Q
Sbjct  6    SQNWVFMVTAQTPTNIAVIKYWGKRDETLILPVNDSISVTLDPSHLCTTTTAAVSPAFHQ  65

Query  361  DRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPT  540
            DRMWLNGKE+SLSG R+Q+CL+EIRARACDVEDE KGIKITK+DW  LHVHIASYNNFPT
Sbjct  66   DRMWLNGKEISLSGGRFQSCLREIRARACDVEDETKGIKITKEDWGKLHVHIASYNNFPT  125

Query  541  aaglassaagfaCLVFALGKLMNVKEDNSQLSAIARQGSGSACRSLFGGFVKWIMGKEED  720
            AAGLASSAAGFACL +ALGKLMNVKED SQLSAIARQGSGSACRSLFGGFVKWIMGKE++
Sbjct  126  AAGLASSAAGFACLAYALGKLMNVKEDESQLSAIARQGSGSACRSLFGGFVKWIMGKEDN  185

Query  721  GSDSLAVQLVD  753
            GSDSLAVQL D
Sbjct  186  GSDSLAVQLTD  196



>ref|XP_009795010.1| PREDICTED: diphosphomevalonate decarboxylase-like [Nicotiana 
sylvestris]
Length=421

 Score =   332 bits (850),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 172/195 (88%), Positives = 183/195 (94%), Gaps = 3/195 (2%)
 Frame = +1

Query  178  MAEK---WVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSP  348
            MAE+   WVLMVTAQTPTNIAVIKYWGKRDE LIL INDSISVTLDPAHLCTTTTVAVSP
Sbjct  1    MAEQLQNWVLMVTAQTPTNIAVIKYWGKRDEDLILAINDSISVTLDPAHLCTTTTVAVSP  60

Query  349  AFDQDRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYN  528
            AF+QDRMWLNGKE+SLSG RYQNCL+EIRARA DVEDE KGIKI KKDW+NLHVHI SYN
Sbjct  61   AFNQDRMWLNGKEISLSGGRYQNCLREIRARASDVEDENKGIKIAKKDWQNLHVHIVSYN  120

Query  529  NFPTaaglassaagfaCLVFALGKLMNVKEDNSQLSAIARQGSGSACRSLFGGFVKWIMG  708
            NFPTAAGLASSAAGFACLVF+L KLMNV+EDN +LSAIARQGSGSACRSL+GGFVKWIMG
Sbjct  121  NFPTAAGLASSAAGFACLVFSLAKLMNVQEDNGKLSAIARQGSGSACRSLYGGFVKWIMG  180

Query  709  KEEDGSDSLAVQLVD  753
            KEE+GSDS+AVQLVD
Sbjct  181  KEENGSDSIAVQLVD  195



>ref|XP_007010315.1| GHMP kinase family protein isoform 2 [Theobroma cacao]
 gb|EOY19125.1| GHMP kinase family protein isoform 2 [Theobroma cacao]
Length=417

 Score =   332 bits (850),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 169/192 (88%), Positives = 180/192 (94%), Gaps = 0/192 (0%)
 Frame = +1

Query  178  MAEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFD  357
            M E WVLM TAQTPTNIAVIKYWGKRDE+LILP+NDSISVTLDPAHLCTTTTVAVSP F 
Sbjct  1    MGETWVLMKTAQTPTNIAVIKYWGKRDESLILPVNDSISVTLDPAHLCTTTTVAVSPVFQ  60

Query  358  QDRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFP  537
            QDRMWLNGKE+SLSG R+Q+CL+EIR RA +VED++KG+KI KKDWE LHVHIASYNNFP
Sbjct  61   QDRMWLNGKEISLSGGRFQSCLREIRRRASEVEDKEKGVKIEKKDWEKLHVHIASYNNFP  120

Query  538  TaaglassaagfaCLVFALGKLMNVKEDNSQLSAIARQGSGSACRSLFGGFVKWIMGKEE  717
            TAAGLASSAAGFACLVFAL KLMNVKED SQLSAIARQGSGSACRSLFGGFVKWIMGKEE
Sbjct  121  TAAGLASSAAGFACLVFALAKLMNVKEDESQLSAIARQGSGSACRSLFGGFVKWIMGKEE  180

Query  718  DGSDSLAVQLVD  753
            DGSDS+AVQLVD
Sbjct  181  DGSDSVAVQLVD  192



>gb|KEH44325.1| mevalonate diphosphate decarboxylase [Medicago truncatula]
Length=418

 Score =   332 bits (850),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 168/191 (88%), Positives = 181/191 (95%), Gaps = 0/191 (0%)
 Frame = +1

Query  181  AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  360
             + WVLMVTAQTPTNIAVIKYWGKRDETLILP+NDSISVTLDPAHLCTTTTV+VSP+F Q
Sbjct  3    GDSWVLMVTAQTPTNIAVIKYWGKRDETLILPVNDSISVTLDPAHLCTTTTVSVSPSFQQ  62

Query  361  DRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPT  540
            DRMWLNGKE+SLSG R+Q+CL+EIRARACDVED KKGIKITK+DW  L+VHIASYNNFPT
Sbjct  63   DRMWLNGKEISLSGGRFQSCLREIRARACDVEDNKKGIKITKEDWSKLYVHIASYNNFPT  122

Query  541  aaglassaagfaCLVFALGKLMNVKEDNSQLSAIARQGSGSACRSLFGGFVKWIMGKEED  720
            AAGLASSAAGFACLV++LGKLMNVKED SQLSAIARQGSGSACRSLFGGFVKW MGKEE+
Sbjct  123  AAGLASSAAGFACLVYSLGKLMNVKEDESQLSAIARQGSGSACRSLFGGFVKWKMGKEEN  182

Query  721  GSDSLAVQLVD  753
            GSDSLAVQL D
Sbjct  183  GSDSLAVQLAD  193



>ref|XP_007010314.1| GHMP kinase family protein isoform 1 [Theobroma cacao]
 gb|EOY19124.1| GHMP kinase family protein isoform 1 [Theobroma cacao]
Length=418

 Score =   331 bits (849),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 169/192 (88%), Positives = 180/192 (94%), Gaps = 0/192 (0%)
 Frame = +1

Query  178  MAEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFD  357
            M E WVLM TAQTPTNIAVIKYWGKRDE+LILP+NDSISVTLDPAHLCTTTTVAVSP F 
Sbjct  1    MGETWVLMKTAQTPTNIAVIKYWGKRDESLILPVNDSISVTLDPAHLCTTTTVAVSPVFQ  60

Query  358  QDRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFP  537
            QDRMWLNGKE+SLSG R+Q+CL+EIR RA +VED++KG+KI KKDWE LHVHIASYNNFP
Sbjct  61   QDRMWLNGKEISLSGGRFQSCLREIRRRASEVEDKEKGVKIEKKDWEKLHVHIASYNNFP  120

Query  538  TaaglassaagfaCLVFALGKLMNVKEDNSQLSAIARQGSGSACRSLFGGFVKWIMGKEE  717
            TAAGLASSAAGFACLVFAL KLMNVKED SQLSAIARQGSGSACRSLFGGFVKWIMGKEE
Sbjct  121  TAAGLASSAAGFACLVFALAKLMNVKEDESQLSAIARQGSGSACRSLFGGFVKWIMGKEE  180

Query  718  DGSDSLAVQLVD  753
            DGSDS+AVQLVD
Sbjct  181  DGSDSVAVQLVD  192



>ref|XP_012074674.1| PREDICTED: diphosphomevalonate decarboxylase [Jatropha curcas]
 gb|KDP35789.1| hypothetical protein JCGZ_10425 [Jatropha curcas]
Length=415

 Score =   331 bits (848),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 169/192 (88%), Positives = 181/192 (94%), Gaps = 0/192 (0%)
 Frame = +1

Query  178  MAEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFD  357
            MAEKWV MVTAQTPTNIAVIKYWGKRDETLILP+NDSISVTLDP+HLCTTTTVAVSP FD
Sbjct  1    MAEKWVRMVTAQTPTNIAVIKYWGKRDETLILPVNDSISVTLDPSHLCTTTTVAVSPTFD  60

Query  358  QDRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFP  537
            QDRMWLNGKE+SLSG R+Q+CL+EIRARACDVED++KGIKI KKDW+ LHVH+ASYNNFP
Sbjct  61   QDRMWLNGKEISLSGGRFQSCLREIRARACDVEDKEKGIKIVKKDWDKLHVHMASYNNFP  120

Query  538  TaaglassaagfaCLVFALGKLMNVKEDNSQLSAIARQGSGSACRSLFGGFVKWIMGKEE  717
            TAAGLASSAAGFACLVFAL KLMN KEDN +LSAIARQGSGSACRSLFGGFVKW MGK E
Sbjct  121  TAAGLASSAAGFACLVFALAKLMNAKEDNGELSAIARQGSGSACRSLFGGFVKWNMGKVE  180

Query  718  DGSDSLAVQLVD  753
            DGSDS AVQ+VD
Sbjct  181  DGSDSRAVQVVD  192



>ref|XP_006359351.1| PREDICTED: diphosphomevalonate decarboxylase-like [Solanum tuberosum]
Length=429

 Score =   328 bits (841),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 168/191 (88%), Positives = 182/191 (95%), Gaps = 0/191 (0%)
 Frame = +1

Query  181  AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  360
            ++KWVLMVTAQTPTNIAVIKYWGKRDE LIL INDSISVTLDPAHLCTTTTVAVSPAF+Q
Sbjct  5    SQKWVLMVTAQTPTNIAVIKYWGKRDENLILAINDSISVTLDPAHLCTTTTVAVSPAFNQ  64

Query  361  DRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPT  540
            DRMWL GKE+SLSG RYQNCL+EIRARA DVEDEKKGIKITKKDWENL VH+ASYNNFPT
Sbjct  65   DRMWLLGKEISLSGGRYQNCLREIRARANDVEDEKKGIKITKKDWENLRVHVASYNNFPT  124

Query  541  aaglassaagfaCLVFALGKLMNVKEDNSQLSAIARQGSGSACRSLFGGFVKWIMGKEED  720
            AAGLASSAAGFACLV++L KLMNV+EDN +LSAIARQGSGSACRSL+GGFVKW+MGKEE+
Sbjct  125  AAGLASSAAGFACLVYSLAKLMNVQEDNGRLSAIARQGSGSACRSLYGGFVKWVMGKEEN  184

Query  721  GSDSLAVQLVD  753
            GSDS+AV LVD
Sbjct  185  GSDSIAVPLVD  195



>ref|XP_010032077.1| PREDICTED: diphosphomevalonate decarboxylase-like [Eucalyptus 
grandis]
 gb|KCW51467.1| hypothetical protein EUGRSUZ_J00991 [Eucalyptus grandis]
Length=418

 Score =   327 bits (839),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 163/192 (85%), Positives = 184/192 (96%), Gaps = 0/192 (0%)
 Frame = +1

Query  178  MAEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFD  357
            MA +W+L +TAQTPTNIAVIKYWGKRDE+LILP+NDSISVTLDP HLCTTTTVAVSPAF+
Sbjct  1    MAGEWILTLTAQTPTNIAVIKYWGKRDESLILPVNDSISVTLDPGHLCTTTTVAVSPAFE  60

Query  358  QDRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFP  537
            QDRMWLNGKE+SLSG R+Q+CL+EIRARA DVE+++KGIKI+KKDWE LH+HI+S+NNFP
Sbjct  61   QDRMWLNGKEISLSGDRFQSCLREIRARATDVENKEKGIKISKKDWEKLHLHISSFNNFP  120

Query  538  TaaglassaagfaCLVFALGKLMNVKEDNSQLSAIARQGSGSACRSLFGGFVKWIMGKEE  717
            TAAGLASSAAG ACLVFALGKLMNV+ED+SQLSAIARQGSGSACRSL+GGFVKWIMGKEE
Sbjct  121  TAAGLASSAAGLACLVFALGKLMNVREDHSQLSAIARQGSGSACRSLYGGFVKWIMGKEE  180

Query  718  DGSDSLAVQLVD  753
            +GSDSLAVQL D
Sbjct  181  NGSDSLAVQLAD  192



>gb|EPS58761.1| hypothetical protein M569_16051, partial [Genlisea aurea]
Length=207

 Score =   318 bits (814),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 161/191 (84%), Positives = 175/191 (92%), Gaps = 0/191 (0%)
 Frame = +1

Query  181  AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  360
            AEKW+L VTA+TPTNIAVIKYWGKRDE LILPINDSISVTLDP HLCTTT+VAVSPAFD+
Sbjct  3    AEKWILTVTARTPTNIAVIKYWGKRDEDLILPINDSISVTLDPDHLCTTTSVAVSPAFDR  62

Query  361  DRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPT  540
            DRMWLNGKE+SLSG RYQNCL+E+R+RA D EDE KGIKI+ +DW+ LHVHI SYNNFPT
Sbjct  63   DRMWLNGKEVSLSGKRYQNCLRELRSRASDYEDENKGIKISSEDWQKLHVHIVSYNNFPT  122

Query  541  aaglassaagfaCLVFALGKLMNVKEDNSQLSAIARQGSGSACRSLFGGFVKWIMGKEED  720
            AAGLASSAAG ACLVFAL KLMNVKED S+LSAIARQGSGSACRSL+GGFVKWIMGKEE 
Sbjct  123  AAGLASSAAGLACLVFALAKLMNVKEDYSKLSAIARQGSGSACRSLYGGFVKWIMGKEES  182

Query  721  GSDSLAVQLVD  753
            G DS+AVQL D
Sbjct  183  GHDSIAVQLAD  193



>ref|XP_003536712.1| PREDICTED: diphosphomevalonate decarboxylase-like [Glycine max]
Length=420

 Score =   324 bits (831),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 164/191 (86%), Positives = 179/191 (94%), Gaps = 0/191 (0%)
 Frame = +1

Query  181  AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  360
            ++ WV MVTAQTPTNIAVIKYWGKRDETLILP+NDSIS+TLDP+HLCTTTTVAVS AF Q
Sbjct  5    SQNWVFMVTAQTPTNIAVIKYWGKRDETLILPVNDSISLTLDPSHLCTTTTVAVSSAFHQ  64

Query  361  DRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPT  540
            DRMWLN KE+SLSG R+Q+CL+EIRARACDVEDE KGIKITK+DW  LH+HIASYNNFPT
Sbjct  65   DRMWLNAKEISLSGGRFQSCLREIRARACDVEDENKGIKITKEDWAKLHLHIASYNNFPT  124

Query  541  aaglassaagfaCLVFALGKLMNVKEDNSQLSAIARQGSGSACRSLFGGFVKWIMGKEED  720
            AAGLASSAAGFACL +ALGKLM+VKED SQLSAIARQGSGSACRSLFGGFVKWIMGKE++
Sbjct  125  AAGLASSAAGFACLAYALGKLMDVKEDESQLSAIARQGSGSACRSLFGGFVKWIMGKEDN  184

Query  721  GSDSLAVQLVD  753
            GSDSLAVQL D
Sbjct  185  GSDSLAVQLAD  195



>ref|XP_006361468.1| PREDICTED: diphosphomevalonate decarboxylase-like [Solanum tuberosum]
Length=421

 Score =   324 bits (831),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 165/191 (86%), Positives = 178/191 (93%), Gaps = 0/191 (0%)
 Frame = +1

Query  181  AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  360
            ++KW+LMVTAQTPTNIAVIKYWGKRDE LIL INDSISVTLDPAHLCTTTTVAVSP+F Q
Sbjct  5    SKKWILMVTAQTPTNIAVIKYWGKRDENLILAINDSISVTLDPAHLCTTTTVAVSPSFQQ  64

Query  361  DRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPT  540
            DRMWLN KE+SL G RYQNCL+EIRARA D EDEKKGIKI+K DW+NLHVHI SYNNFPT
Sbjct  65   DRMWLNKKEISLDGARYQNCLREIRARANDYEDEKKGIKISKNDWQNLHVHIDSYNNFPT  124

Query  541  aaglassaagfaCLVFALGKLMNVKEDNSQLSAIARQGSGSACRSLFGGFVKWIMGKEED  720
            AAGLASSAAGFACLVF+L KLMNV+EDN +LSAIARQGSGSACRSLFGGFVKW+MGKEED
Sbjct  125  AAGLASSAAGFACLVFSLAKLMNVQEDNGRLSAIARQGSGSACRSLFGGFVKWVMGKEED  184

Query  721  GSDSLAVQLVD  753
            GSDS+AV LVD
Sbjct  185  GSDSIAVPLVD  195



>ref|XP_011469322.1| PREDICTED: diphosphomevalonate decarboxylase [Fragaria vesca 
subsp. vesca]
Length=418

 Score =   323 bits (829),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 164/190 (86%), Positives = 177/190 (93%), Gaps = 0/190 (0%)
 Frame = +1

Query  184  EKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQD  363
            +KWVLMVTAQTPTNIAVIKYWGKRDE+LILP+NDSISVTLDP HLCTTTTV+VSP+F  D
Sbjct  7    QKWVLMVTAQTPTNIAVIKYWGKRDESLILPVNDSISVTLDPDHLCTTTTVSVSPSFSHD  66

Query  364  RMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTa  543
            RMWLNG E+SLSG R+Q CL+EIR+RACDV DE KGI ITKKDWE LHVHIASYNNFPTA
Sbjct  67   RMWLNGDEISLSGGRFQRCLREIRSRACDVHDESKGIHITKKDWEKLHVHIASYNNFPTA  126

Query  544  aglassaagfaCLVFALGKLMNVKEDNSQLSAIARQGSGSACRSLFGGFVKWIMGKEEDG  723
            AGLASSAAGFACLVFALGKLMNVKED SQLSAIARQGSGSACRSL+GGFVKWIMGK++ G
Sbjct  127  AGLASSAAGFACLVFALGKLMNVKEDQSQLSAIARQGSGSACRSLYGGFVKWIMGKDDKG  186

Query  724  SDSLAVQLVD  753
            +DSLAVQL D
Sbjct  187  TDSLAVQLAD  196



>ref|XP_008232018.1| PREDICTED: diphosphomevalonate decarboxylase-like [Prunus mume]
Length=419

 Score =   323 bits (828),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 164/191 (86%), Positives = 181/191 (95%), Gaps = 0/191 (0%)
 Frame = +1

Query  181  AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  360
            ++KWVLMVTAQTPTNIAVIKYWGKRDETLILP+NDSISVTLDP HLCTTTTV+VSPAFDQ
Sbjct  5    SQKWVLMVTAQTPTNIAVIKYWGKRDETLILPVNDSISVTLDPEHLCTTTTVSVSPAFDQ  64

Query  361  DRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPT  540
            DRMWLNGKE+SLSG R+Q+CL+EIR+RA DV D++KGIKITKKDWE L+VHIASYNNFPT
Sbjct  65   DRMWLNGKEISLSGGRFQSCLREIRSRATDVHDKEKGIKITKKDWEKLNVHIASYNNFPT  124

Query  541  aaglassaagfaCLVFALGKLMNVKEDNSQLSAIARQGSGSACRSLFGGFVKWIMGKEED  720
            AAGLASSAAGFACLVFAL KLMN  ED+SQLSAIAR+GSGSACRSL+GGFVKWIMGK+E 
Sbjct  125  AAGLASSAAGFACLVFALAKLMNANEDHSQLSAIARRGSGSACRSLYGGFVKWIMGKDEK  184

Query  721  GSDSLAVQLVD  753
            G+DSLAVQL D
Sbjct  185  GTDSLAVQLAD  195



>ref|XP_007211744.1| hypothetical protein PRUPE_ppa006290mg [Prunus persica]
 gb|EMJ12943.1| hypothetical protein PRUPE_ppa006290mg [Prunus persica]
Length=419

 Score =   322 bits (826),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 163/191 (85%), Positives = 181/191 (95%), Gaps = 0/191 (0%)
 Frame = +1

Query  181  AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  360
            ++KWVLMVTAQTPTNIAVIKYWGKRDETLILP+NDSISVTLDP HLCTTTTV+VSP+FDQ
Sbjct  5    SQKWVLMVTAQTPTNIAVIKYWGKRDETLILPVNDSISVTLDPEHLCTTTTVSVSPSFDQ  64

Query  361  DRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPT  540
            DRMWLNGKE+SLSG R+Q+CL+EIR+RA DV D++KGIKITKKDWE L+VHIASYNNFPT
Sbjct  65   DRMWLNGKEISLSGGRFQSCLREIRSRATDVHDKEKGIKITKKDWEKLNVHIASYNNFPT  124

Query  541  aaglassaagfaCLVFALGKLMNVKEDNSQLSAIARQGSGSACRSLFGGFVKWIMGKEED  720
            AAGLASSAAGFACLVFAL KLMN  ED+SQLSAIAR+GSGSACRSL+GGFVKWIMGK+E 
Sbjct  125  AAGLASSAAGFACLVFALAKLMNANEDHSQLSAIARRGSGSACRSLYGGFVKWIMGKDEK  184

Query  721  GSDSLAVQLVD  753
            G+DSLAVQL D
Sbjct  185  GTDSLAVQLAD  195



>ref|NP_001234815.1| mevalonate disphosphate decarboxylase [Solanum lycopersicum]
 gb|ABW87316.1| mevalonate disphosphate decarboxylase [Solanum lycopersicum]
Length=422

 Score =   322 bits (826),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 164/191 (86%), Positives = 177/191 (93%), Gaps = 0/191 (0%)
 Frame = +1

Query  181  AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  360
            ++KW+LMVTAQTPTNIAVIKYWGKRDE LIL INDSISVTLDPAHLCTTTTVAVSP+F Q
Sbjct  6    SKKWILMVTAQTPTNIAVIKYWGKRDENLILAINDSISVTLDPAHLCTTTTVAVSPSFQQ  65

Query  361  DRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPT  540
            DRMWLN KE+SL G RYQNCL+EIRARA D EDEKKGIKI+K DW+NLHVHI SYNNFPT
Sbjct  66   DRMWLNKKEISLDGARYQNCLREIRARANDYEDEKKGIKISKNDWQNLHVHIDSYNNFPT  125

Query  541  aaglassaagfaCLVFALGKLMNVKEDNSQLSAIARQGSGSACRSLFGGFVKWIMGKEED  720
            AAGLASSAAGFACLVF+L KLMNV+EDN +LSAIARQGSGSACRSLFGGFVKW+MGKEED
Sbjct  126  AAGLASSAAGFACLVFSLAKLMNVQEDNGRLSAIARQGSGSACRSLFGGFVKWVMGKEED  185

Query  721  GSDSLAVQLVD  753
            GSDS+AV L D
Sbjct  186  GSDSIAVPLAD  196



>gb|ABG24207.2| mevalonate disphosphate decarboxylase [Arnebia euchroma]
Length=421

 Score =   321 bits (823),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 163/194 (84%), Positives = 177/194 (91%), Gaps = 0/194 (0%)
 Frame = +1

Query  172  GTMAEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPA  351
            G   E W+LMVTAQTPTNIAVIKYWGKRDE+LILPIN SISVTLDP+HLCTTTTV+VSP+
Sbjct  2    GEQGENWILMVTAQTPTNIAVIKYWGKRDESLILPINSSISVTLDPSHLCTTTTVSVSPS  61

Query  352  FDQDRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNN  531
            F QD MWLNGKE+SLSG R+Q CL+EIR+RACDVEDEKKG KI KKDWE LHVHIASYNN
Sbjct  62   FKQDCMWLNGKEISLSGGRFQRCLREIRSRACDVEDEKKGFKIAKKDWEKLHVHIASYNN  121

Query  532  FPTaaglassaagfaCLVFALGKLMNVKEDNSQLSAIARQGSGSACRSLFGGFVKWIMGK  711
            FPTAAGLASSAAGFACLVF+L KLMN+KED+ QLSAIARQGSGSACRSLFGGFVKW MGK
Sbjct  122  FPTAAGLASSAAGFACLVFSLAKLMNLKEDHGQLSAIARQGSGSACRSLFGGFVKWDMGK  181

Query  712  EEDGSDSLAVQLVD  753
            E DGSDS+A+ LVD
Sbjct  182  ESDGSDSIAIPLVD  195



>ref|XP_006445714.1| hypothetical protein CICLE_v10015368mg [Citrus clementina]
 gb|ESR58954.1| hypothetical protein CICLE_v10015368mg [Citrus clementina]
Length=344

 Score =   318 bits (814),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 170/191 (89%), Positives = 183/191 (96%), Gaps = 0/191 (0%)
 Frame = +1

Query  181  AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  360
            AEKWVLMVTAQTPTNIAVIKYWGKRDETLILP+NDSISVTLDP HLCTTTTVAVSP+FDQ
Sbjct  3    AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPVNDSISVTLDPDHLCTTTTVAVSPSFDQ  62

Query  361  DRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPT  540
            DRMWLNGKE+SL G RYQNCLKEIR+RACDVED++KGIKI KKDW+ LH+HIAS+NNFPT
Sbjct  63   DRMWLNGKEISLGGGRYQNCLKEIRSRACDVEDKEKGIKIEKKDWQKLHLHIASFNNFPT  122

Query  541  aaglassaagfaCLVFALGKLMNVKEDNSQLSAIARQGSGSACRSLFGGFVKWIMGKEED  720
            AAGLASSAAGFACLVF+L KLMN+KE+ SQLSAIARQGSGSACRSLFGGFVKWIMGKE +
Sbjct  123  AAGLASSAAGFACLVFSLAKLMNLKENQSQLSAIARQGSGSACRSLFGGFVKWIMGKEGN  182

Query  721  GSDSLAVQLVD  753
            GSDSLAVQLVD
Sbjct  183  GSDSLAVQLVD  193



>gb|AEM42974.1| diphosphomevalonate decarboxylase [Siraitia grosvenorii]
Length=418

 Score =   320 bits (821),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 163/191 (85%), Positives = 176/191 (92%), Gaps = 0/191 (0%)
 Frame = +1

Query  181  AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  360
             EKWVLM TAQTPTNIAVIKYWGKRDE LILP+NDSISVTLDP+HLCT TTVAVSPAF+Q
Sbjct  3    GEKWVLMATAQTPTNIAVIKYWGKRDEELILPVNDSISVTLDPSHLCTITTVAVSPAFEQ  62

Query  361  DRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPT  540
            DRMWLN KE+SLSG RYQNCL+EIR+RA DVED++KGIKI KKDWE LHV+I SYNNFPT
Sbjct  63   DRMWLNRKEISLSGARYQNCLREIRSRANDVEDKEKGIKIAKKDWEKLHVYIDSYNNFPT  122

Query  541  aaglassaagfaCLVFALGKLMNVKEDNSQLSAIARQGSGSACRSLFGGFVKWIMGKEED  720
            AAGLASSAAGFACLVFAL  LMNVKED S+LSAIARQGSGSACRSL+GGFVKW MGKE+D
Sbjct  123  AAGLASSAAGFACLVFALANLMNVKEDQSKLSAIARQGSGSACRSLYGGFVKWSMGKEKD  182

Query  721  GSDSLAVQLVD  753
            GSDSLA+QL D
Sbjct  183  GSDSLAIQLAD  193



>ref|NP_181404.1| mevalonate diphosphate decarboxylase 1 [Arabidopsis thaliana]
 emb|CAA74700.1| mevalonate diphosphate decarboxylase [Arabidopsis thaliana]
 emb|CAA76803.1| mevalonate diphosphate decarboxylase [Arabidopsis thaliana]
 gb|AAC67348.1| mevalonate diphosphate decarboxylase [Arabidopsis thaliana]
 gb|AAP68208.1| At2g38700 [Arabidopsis thaliana]
 dbj|BAF00296.1| mevalonate diphosphate decarboxylase [Arabidopsis thaliana]
 gb|AEC09574.1| mevalonate diphosphate decarboxylase 1 [Arabidopsis thaliana]
Length=412

 Score =   320 bits (820),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 165/190 (87%), Positives = 177/190 (93%), Gaps = 0/190 (0%)
 Frame = +1

Query  184  EKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQD  363
            EKWV+MVTAQTPTNIAVIKYWGKRDE  ILPINDSISVTLDP HLCT TTVAVSP+FD+D
Sbjct  4    EKWVVMVTAQTPTNIAVIKYWGKRDEVRILPINDSISVTLDPDHLCTLTTVAVSPSFDRD  63

Query  364  RMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTa  543
            RMWLNGKE+SLSG RYQNCL+EIR+RA DVED++KGIKI KKDWE LH+HIAS+NNFPTA
Sbjct  64   RMWLNGKEISLSGSRYQNCLREIRSRADDVEDKEKGIKIAKKDWEKLHLHIASHNNFPTA  123

Query  544  aglassaagfaCLVFALGKLMNVKEDNSQLSAIARQGSGSACRSLFGGFVKWIMGKEEDG  723
            AGLASSAAGFACLVFAL KLMNV ED SQLSAIARQGSGSACRSLFGGFVKW MG +EDG
Sbjct  124  AGLASSAAGFACLVFALAKLMNVNEDPSQLSAIARQGSGSACRSLFGGFVKWNMGNKEDG  183

Query  724  SDSLAVQLVD  753
            SDS+AVQLVD
Sbjct  184  SDSVAVQLVD  193



>ref|XP_006411092.1| hypothetical protein EUTSA_v10016888mg [Eutrema salsugineum]
 gb|ESQ52545.1| hypothetical protein EUTSA_v10016888mg [Eutrema salsugineum]
Length=341

 Score =   317 bits (813),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 165/190 (87%), Positives = 174/190 (92%), Gaps = 0/190 (0%)
 Frame = +1

Query  184  EKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQD  363
            EKWVLMVTAQTPTNIAVIKYWGKRDE  ILPINDSISVTLDP HLCT TTVAVSP+FD+D
Sbjct  4    EKWVLMVTAQTPTNIAVIKYWGKRDEVRILPINDSISVTLDPDHLCTLTTVAVSPSFDRD  63

Query  364  RMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTa  543
            RMWLNGKE+SLSG RYQNCL+EIR RA DVED+ KGIKI KKDWE LH+HIASYNNFPTA
Sbjct  64   RMWLNGKEISLSGSRYQNCLREIRCRADDVEDKVKGIKIAKKDWEKLHLHIASYNNFPTA  123

Query  544  aglassaagfaCLVFALGKLMNVKEDNSQLSAIARQGSGSACRSLFGGFVKWIMGKEEDG  723
            AGLASSAAGFACLVFAL KLMNV ED SQLSAIARQGSGSACRSLFGGFVKW MG +EDG
Sbjct  124  AGLASSAAGFACLVFALAKLMNVHEDPSQLSAIARQGSGSACRSLFGGFVKWNMGSKEDG  183

Query  724  SDSLAVQLVD  753
            SDS+AVQ+ D
Sbjct  184  SDSVAVQVAD  193



>ref|XP_010676219.1| PREDICTED: diphosphomevalonate decarboxylase-like [Beta vulgaris 
subsp. vulgaris]
Length=420

 Score =   320 bits (820),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 162/190 (85%), Positives = 173/190 (91%), Gaps = 0/190 (0%)
 Frame = +1

Query  184  EKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQD  363
            E WV +VTA+TPTNIAVIKYWGKRDETLILPINDSISVTLDP HLCTTTTVAVSP F +D
Sbjct  5    EDWVRIVTAKTPTNIAVIKYWGKRDETLILPINDSISVTLDPNHLCTTTTVAVSPTFVED  64

Query  364  RMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTa  543
            RMWLNGKE+SL+G RYQNCL+EIR RA DVE+E+KGIKI KKDW+NLHVHIASYNNFPTA
Sbjct  65   RMWLNGKEISLAGERYQNCLREIRKRASDVEEEEKGIKIAKKDWQNLHVHIASYNNFPTA  124

Query  544  aglassaagfaCLVFALGKLMNVKEDNSQLSAIARQGSGSACRSLFGGFVKWIMGKEEDG  723
            AGLASSAAG ACLVFAL KLMNVKED  QLS IARQGSGSACRSL+GGFVKWIMGK EDG
Sbjct  125  AGLASSAAGLACLVFALAKLMNVKEDQGQLSTIARQGSGSACRSLYGGFVKWIMGKNEDG  184

Query  724  SDSLAVQLVD  753
             DSLAVQ+ D
Sbjct  185  RDSLAVQVAD  194



>ref|XP_011084229.1| PREDICTED: diphosphomevalonate decarboxylase-like [Sesamum indicum]
Length=422

 Score =   320 bits (820),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 161/191 (84%), Positives = 176/191 (92%), Gaps = 0/191 (0%)
 Frame = +1

Query  181  AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  360
             + WVL VTAQTPTNIAVIKYWGKRDE LILPINDSISVTLDP HLCTTT+VAVSPAF  
Sbjct  6    GKSWVLAVTAQTPTNIAVIKYWGKRDEELILPINDSISVTLDPEHLCTTTSVAVSPAFTH  65

Query  361  DRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPT  540
            DRMWLNGKE+SLSG RYQNCL+E+R+RA DVEDE+KG+KITKKDWE LHVHI SYNNFPT
Sbjct  66   DRMWLNGKEVSLSGGRYQNCLRELRSRASDVEDEQKGVKITKKDWEKLHVHIVSYNNFPT  125

Query  541  aaglassaagfaCLVFALGKLMNVKEDNSQLSAIARQGSGSACRSLFGGFVKWIMGKEED  720
            AAGLASSAAG ACLVF+L KLMNVK+D+ +LSAIARQGSGSACRSL+GGFVKWIMGKEE+
Sbjct  126  AAGLASSAAGLACLVFSLAKLMNVKDDHGRLSAIARQGSGSACRSLYGGFVKWIMGKEEN  185

Query  721  GSDSLAVQLVD  753
            GSDS+AVQL D
Sbjct  186  GSDSIAVQLAD  196



>gb|KFK36776.1| hypothetical protein AALP_AA4G169000 [Arabis alpina]
Length=414

 Score =   319 bits (818),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 167/194 (86%), Positives = 176/194 (91%), Gaps = 2/194 (1%)
 Frame = +1

Query  178  MAE--KWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPA  351
            MAE  KWVLMVTAQTPTNIAVIKYWGKRDE  ILPINDSISVTLDP HLCT TTVAVSP+
Sbjct  1    MAEEKKWVLMVTAQTPTNIAVIKYWGKRDEVRILPINDSISVTLDPDHLCTLTTVAVSPS  60

Query  352  FDQDRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNN  531
            FD+DRMWLNGKE+SLSG RYQNCL+EIR+R  DVEDE KGIKI KKDWE LH+HIASYNN
Sbjct  61   FDRDRMWLNGKEISLSGSRYQNCLREIRSRGDDVEDEVKGIKIEKKDWETLHLHIASYNN  120

Query  532  FPTaaglassaagfaCLVFALGKLMNVKEDNSQLSAIARQGSGSACRSLFGGFVKWIMGK  711
            FPTAAGLASSAAGFACLVF+L KLMNV ED SQLSAIARQGSGSACRSLFGGFVKW MG 
Sbjct  121  FPTAAGLASSAAGFACLVFSLAKLMNVNEDQSQLSAIARQGSGSACRSLFGGFVKWNMGN  180

Query  712  EEDGSDSLAVQLVD  753
            +EDGSDS+AVQL D
Sbjct  181  KEDGSDSVAVQLAD  194



>ref|XP_010088787.1| Diphosphomevalonate decarboxylase [Morus notabilis]
 gb|EXB36970.1| Diphosphomevalonate decarboxylase [Morus notabilis]
Length=400

 Score =   318 bits (816),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 160/194 (82%), Positives = 181/194 (93%), Gaps = 0/194 (0%)
 Frame = +1

Query  172  GTMAEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPA  351
             + ++ WVL+VTA+TPTNIAVIKYWGKRDE LILP+NDSISVTLDP HLCTTTTVAVSP+
Sbjct  2    ASESQNWVLVVTARTPTNIAVIKYWGKRDEKLILPVNDSISVTLDPDHLCTTTTVAVSPS  61

Query  352  FDQDRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNN  531
            FDQDRMWLNGKE+SLSG R+Q+CL+EIR+RA DVED++KGIKI+K+DWE LHVHIASYNN
Sbjct  62   FDQDRMWLNGKEISLSGGRFQSCLREIRSRASDVEDKEKGIKISKEDWEKLHVHIASYNN  121

Query  532  FPTaaglassaagfaCLVFALGKLMNVKEDNSQLSAIARQGSGSACRSLFGGFVKWIMGK  711
            FPTAAGLASSAAGFAC VF+L KLMNV ED S+LSAIARQGSGSACRSLFGGFVKWIMGK
Sbjct  122  FPTAAGLASSAAGFACFVFSLAKLMNVNEDQSKLSAIARQGSGSACRSLFGGFVKWIMGK  181

Query  712  EEDGSDSLAVQLVD  753
            +++GSDSLAVQL D
Sbjct  182  DKNGSDSLAVQLAD  195



>ref|XP_006403598.1| hypothetical protein EUTSA_v10010411mg [Eutrema salsugineum]
 gb|ESQ45051.1| hypothetical protein EUTSA_v10010411mg [Eutrema salsugineum]
Length=316

 Score =   315 bits (808),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 161/191 (84%), Positives = 174/191 (91%), Gaps = 0/191 (0%)
 Frame = +1

Query  181  AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  360
            AEKWV MVTAQTPTNIAVIKYWGKRDE  ILP+NDSISVTLDP HLCT TTVAVSPAFD+
Sbjct  3    AEKWVYMVTAQTPTNIAVIKYWGKRDEVRILPVNDSISVTLDPDHLCTVTTVAVSPAFDR  62

Query  361  DRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPT  540
            DRMWLNGKE+SLSG RYQNCL+EIR RA DVED++KGI+I KKDWE LH+HIAS+NNFPT
Sbjct  63   DRMWLNGKEISLSGSRYQNCLREIRGRAGDVEDKEKGIRIEKKDWEKLHLHIASHNNFPT  122

Query  541  aaglassaagfaCLVFALGKLMNVKEDNSQLSAIARQGSGSACRSLFGGFVKWIMGKEED  720
            AAGLASSAAGFACLVF+L KLMNV ED+S LSAIARQGSGSACRSLFGGFVKW MG + D
Sbjct  123  AAGLASSAAGFACLVFSLAKLMNVDEDSSHLSAIARQGSGSACRSLFGGFVKWTMGSKGD  182

Query  721  GSDSLAVQLVD  753
            GSDS+AVQL D
Sbjct  183  GSDSVAVQLAD  193



>ref|XP_006294305.1| hypothetical protein CARUB_v10023314mg [Capsella rubella]
 gb|EOA27203.1| hypothetical protein CARUB_v10023314mg [Capsella rubella]
Length=412

 Score =   318 bits (815),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 164/190 (86%), Positives = 176/190 (93%), Gaps = 0/190 (0%)
 Frame = +1

Query  184  EKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQD  363
            EKWV+MVTAQTPTNIAVIKYWGKRDE  ILPINDSISVTLDP HLCT TTVAVSP+FD+D
Sbjct  4    EKWVVMVTAQTPTNIAVIKYWGKRDEVRILPINDSISVTLDPEHLCTLTTVAVSPSFDRD  63

Query  364  RMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTa  543
            RMWLNGKE+SLSG RYQNCL+EIR+RA DVED+ KGIKI KKDWE LH+HIAS+NNFPTA
Sbjct  64   RMWLNGKEISLSGSRYQNCLREIRSRADDVEDKVKGIKIAKKDWEKLHLHIASHNNFPTA  123

Query  544  aglassaagfaCLVFALGKLMNVKEDNSQLSAIARQGSGSACRSLFGGFVKWIMGKEEDG  723
            AGLASSAAGFACLVF+L KLMNV ED SQLSAIARQGSGSACRSLFGGFVKW MG +EDG
Sbjct  124  AGLASSAAGFACLVFSLAKLMNVNEDPSQLSAIARQGSGSACRSLFGGFVKWNMGNKEDG  183

Query  724  SDSLAVQLVD  753
            SDS+AVQLVD
Sbjct  184  SDSVAVQLVD  193



>ref|XP_002266399.1| PREDICTED: diphosphomevalonate decarboxylase [Vitis vinifera]
 emb|CBI35263.3| unnamed protein product [Vitis vinifera]
Length=422

 Score =   318 bits (815),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 160/191 (84%), Positives = 175/191 (92%), Gaps = 0/191 (0%)
 Frame = +1

Query  181  AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  360
            ++KW+LM TAQTPTNIAVIKYWGKRDE LIL +NDSISVTLDP HLCTTTTVAVSP F  
Sbjct  6    SQKWILMTTAQTPTNIAVIKYWGKRDEALILAVNDSISVTLDPQHLCTTTTVAVSPMFQS  65

Query  361  DRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPT  540
            DRMWLNGKE+SLSG RYQNCL+EIR+RA  +EDEKKGIKITKKDWE LHVHIASYNNFPT
Sbjct  66   DRMWLNGKEISLSGGRYQNCLREIRSRASKIEDEKKGIKITKKDWEKLHVHIASYNNFPT  125

Query  541  aaglassaagfaCLVFALGKLMNVKEDNSQLSAIARQGSGSACRSLFGGFVKWIMGKEED  720
            AAGLASSAAGFACLVF+L KLMNV+ED  +LSAIARQGSGSACRSL+GGFVKW+MG EE+
Sbjct  126  AAGLASSAAGFACLVFSLAKLMNVQEDQGKLSAIARQGSGSACRSLYGGFVKWVMGNEEN  185

Query  721  GSDSLAVQLVD  753
            GSDS+AVQL D
Sbjct  186  GSDSIAVQLQD  196



>ref|XP_006445713.1| hypothetical protein CICLE_v10015368mg [Citrus clementina]
 ref|XP_006485205.1| PREDICTED: diphosphomevalonate decarboxylase-like [Citrus sinensis]
 gb|ESR58953.1| hypothetical protein CICLE_v10015368mg [Citrus clementina]
Length=420

 Score =   318 bits (814),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 170/191 (89%), Positives = 183/191 (96%), Gaps = 0/191 (0%)
 Frame = +1

Query  181  AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  360
            AEKWVLMVTAQTPTNIAVIKYWGKRDETLILP+NDSISVTLDP HLCTTTTVAVSP+FDQ
Sbjct  3    AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPVNDSISVTLDPDHLCTTTTVAVSPSFDQ  62

Query  361  DRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPT  540
            DRMWLNGKE+SL G RYQNCLKEIR+RACDVED++KGIKI KKDW+ LH+HIAS+NNFPT
Sbjct  63   DRMWLNGKEISLGGGRYQNCLKEIRSRACDVEDKEKGIKIEKKDWQKLHLHIASFNNFPT  122

Query  541  aaglassaagfaCLVFALGKLMNVKEDNSQLSAIARQGSGSACRSLFGGFVKWIMGKEED  720
            AAGLASSAAGFACLVF+L KLMN+KE+ SQLSAIARQGSGSACRSLFGGFVKWIMGKE +
Sbjct  123  AAGLASSAAGFACLVFSLAKLMNLKENQSQLSAIARQGSGSACRSLFGGFVKWIMGKEGN  182

Query  721  GSDSLAVQLVD  753
            GSDSLAVQLVD
Sbjct  183  GSDSLAVQLVD  193



>gb|AFM77982.1| mevalonate diphosphate decarboxylase [Eleutherococcus senticosus]
Length=420

 Score =   318 bits (814),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 160/190 (84%), Positives = 177/190 (93%), Gaps = 0/190 (0%)
 Frame = +1

Query  184  EKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQD  363
            +KWV+MVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDP HLCTTTTVAVSP+F+QD
Sbjct  6    QKWVVMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPDHLCTTTTVAVSPSFEQD  65

Query  364  RMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTa  543
            RMWLNG E+SL G R+Q+CL+EIR+RA D+EDEKKGIKI K DWE LH+HIASYNNFPTA
Sbjct  66   RMWLNGMEISLLGGRFQSCLREIRSRARDLEDEKKGIKIKKMDWEKLHLHIASYNNFPTA  125

Query  544  aglassaagfaCLVFALGKLMNVKEDNSQLSAIARQGSGSACRSLFGGFVKWIMGKEEDG  723
            AGLASSAAG AC VFAL KLMN+KEDN QLSAIAR+GSGSACRSL+GGFVKWIMGKEE+G
Sbjct  126  AGLASSAAGLACFVFALAKLMNLKEDNGQLSAIARRGSGSACRSLYGGFVKWIMGKEENG  185

Query  724  SDSLAVQLVD  753
            SDS+A+QL D
Sbjct  186  SDSIAIQLAD  195



>gb|AEZ55675.1| mevalonate diphosphate decarboxylase [Salvia miltiorrhiza]
Length=422

 Score =   317 bits (813),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 161/191 (84%), Positives = 175/191 (92%), Gaps = 0/191 (0%)
 Frame = +1

Query  181  AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  360
             EKWVL VTAQTPTNIAVIKYWGKRDE LILPINDSISVTLDP HLCTTT+VAVSPAF  
Sbjct  6    GEKWVLSVTAQTPTNIAVIKYWGKRDEELILPINDSISVTLDPGHLCTTTSVAVSPAFTH  65

Query  361  DRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPT  540
            DR+WLNGKE+SLSG R+QNCL+E+R+RA D EDEKKGIKI KKDWE L VHI SYNNFPT
Sbjct  66   DRIWLNGKEVSLSGGRFQNCLRELRSRATDFEDEKKGIKINKKDWEKLRVHIVSYNNFPT  125

Query  541  aaglassaagfaCLVFALGKLMNVKEDNSQLSAIARQGSGSACRSLFGGFVKWIMGKEED  720
            AAGLASSAAG ACLVF+L KLMNVKED+S+LSAIARQGSGSACRSL+GGFVKWIMGKE++
Sbjct  126  AAGLASSAAGLACLVFSLAKLMNVKEDHSKLSAIARQGSGSACRSLYGGFVKWIMGKEDN  185

Query  721  GSDSLAVQLVD  753
            GSDS+AVQL D
Sbjct  186  GSDSIAVQLAD  196



>ref|XP_010536297.1| PREDICTED: diphosphomevalonate decarboxylase-like isoform X3 
[Tarenaya hassleriana]
 ref|XP_010536298.1| PREDICTED: diphosphomevalonate decarboxylase-like isoform X4 
[Tarenaya hassleriana]
Length=416

 Score =   317 bits (811),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 164/192 (85%), Positives = 175/192 (91%), Gaps = 1/192 (1%)
 Frame = +1

Query  181  AEK-WVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFD  357
            AEK WVLMVTAQTPTNIAVIKYWGKRDE+ ILPINDSISVTLDP HLCT TT AVSPAFD
Sbjct  3    AEKPWVLMVTAQTPTNIAVIKYWGKRDESRILPINDSISVTLDPDHLCTVTTAAVSPAFD  62

Query  358  QDRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFP  537
            +DRMWLNGKE+SLSG R+QNCL+EIR RACDVED+ K +KI KKDWE LH+HIASYNNFP
Sbjct  63   RDRMWLNGKEISLSGSRFQNCLREIRTRACDVEDKGKCVKIEKKDWEKLHLHIASYNNFP  122

Query  538  TaaglassaagfaCLVFALGKLMNVKEDNSQLSAIARQGSGSACRSLFGGFVKWIMGKEE  717
            TAAGLASSAAGFACLVFAL KLMNV ED SQLSAIARQGSGSACRSLFGGFVKW MG +E
Sbjct  123  TAAGLASSAAGFACLVFALSKLMNVNEDQSQLSAIARQGSGSACRSLFGGFVKWTMGNKE  182

Query  718  DGSDSLAVQLVD  753
            DG+DS+AVQL D
Sbjct  183  DGTDSVAVQLTD  194



>ref|XP_010536296.1| PREDICTED: diphosphomevalonate decarboxylase-like isoform X2 
[Tarenaya hassleriana]
Length=423

 Score =   317 bits (811),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 164/192 (85%), Positives = 175/192 (91%), Gaps = 1/192 (1%)
 Frame = +1

Query  181  AEK-WVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFD  357
            AEK WVLMVTAQTPTNIAVIKYWGKRDE+ ILPINDSISVTLDP HLCT TT AVSPAFD
Sbjct  3    AEKPWVLMVTAQTPTNIAVIKYWGKRDESRILPINDSISVTLDPDHLCTVTTAAVSPAFD  62

Query  358  QDRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFP  537
            +DRMWLNGKE+SLSG R+QNCL+EIR RACDVED+ K +KI KKDWE LH+HIASYNNFP
Sbjct  63   RDRMWLNGKEISLSGSRFQNCLREIRTRACDVEDKGKCVKIEKKDWEKLHLHIASYNNFP  122

Query  538  TaaglassaagfaCLVFALGKLMNVKEDNSQLSAIARQGSGSACRSLFGGFVKWIMGKEE  717
            TAAGLASSAAGFACLVFAL KLMNV ED SQLSAIARQGSGSACRSLFGGFVKW MG +E
Sbjct  123  TAAGLASSAAGFACLVFALSKLMNVNEDQSQLSAIARQGSGSACRSLFGGFVKWTMGNKE  182

Query  718  DGSDSLAVQLVD  753
            DG+DS+AVQL D
Sbjct  183  DGTDSVAVQLTD  194



>ref|XP_009139253.1| PREDICTED: diphosphomevalonate decarboxylase-like [Brassica rapa]
Length=419

 Score =   316 bits (810),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 161/191 (84%), Positives = 174/191 (91%), Gaps = 0/191 (0%)
 Frame = +1

Query  181  AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  360
            AEKWV MVTAQTPTNIAVIKYWGKRDE  ILP+NDSISVTLDP HLCT TTVAVSP+FD+
Sbjct  3    AEKWVYMVTAQTPTNIAVIKYWGKRDEVRILPVNDSISVTLDPDHLCTVTTVAVSPSFDR  62

Query  361  DRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPT  540
            DRMWLNGKE+SLSG RYQNCL+EIR RA DVED++KG+KI KKDWE LH+HIAS+NNFPT
Sbjct  63   DRMWLNGKEISLSGSRYQNCLREIRGRAGDVEDKEKGVKIDKKDWEKLHLHIASHNNFPT  122

Query  541  aaglassaagfaCLVFALGKLMNVKEDNSQLSAIARQGSGSACRSLFGGFVKWIMGKEED  720
            AAGLASSAAGFACLVF+L KLMNV ED S LSAIARQGSGSACRSLFGGFVKW MG +ED
Sbjct  123  AAGLASSAAGFACLVFSLAKLMNVDEDASHLSAIARQGSGSACRSLFGGFVKWEMGSKED  182

Query  721  GSDSLAVQLVD  753
            GSDS+AVQL D
Sbjct  183  GSDSIAVQLAD  193



>emb|CDY65399.1| BnaCnng46900D [Brassica napus]
Length=419

 Score =   316 bits (810),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 161/191 (84%), Positives = 174/191 (91%), Gaps = 0/191 (0%)
 Frame = +1

Query  181  AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  360
            AEKWV MVTAQTPTNIAVIKYWGKRDE  ILP+NDSISVTLDP HLCT TTVAVSP+FD+
Sbjct  3    AEKWVYMVTAQTPTNIAVIKYWGKRDEVRILPVNDSISVTLDPDHLCTVTTVAVSPSFDR  62

Query  361  DRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPT  540
            DRMWLNGKE+SLSG RYQNCL+EIR RA DVED++KG+KI KKDWE LH+HIAS+NNFPT
Sbjct  63   DRMWLNGKEISLSGSRYQNCLREIRGRAGDVEDKEKGVKIEKKDWEKLHLHIASHNNFPT  122

Query  541  aaglassaagfaCLVFALGKLMNVKEDNSQLSAIARQGSGSACRSLFGGFVKWIMGKEED  720
            AAGLASSAAGFACLVF+L KLMNV ED S LSAIARQGSGSACRSLFGGFVKW MG +ED
Sbjct  123  AAGLASSAAGFACLVFSLAKLMNVDEDASHLSAIARQGSGSACRSLFGGFVKWEMGSKED  182

Query  721  GSDSLAVQLVD  753
            GSDS+AVQL D
Sbjct  183  GSDSVAVQLAD  193



>gb|AGZ15316.1| mevalonate decarboxylase [Platycodon grandiflorus]
Length=417

 Score =   316 bits (810),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 161/194 (83%), Positives = 176/194 (91%), Gaps = 0/194 (0%)
 Frame = +1

Query  172  GTMAEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPA  351
            G  +EKW LMVT +TPTNIAVIKYWGKRDETLILPINDSISVTLDP HLCTTTTV+VSP+
Sbjct  2    GGESEKWALMVTGRTPTNIAVIKYWGKRDETLILPINDSISVTLDPDHLCTTTTVSVSPS  61

Query  352  FDQDRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNN  531
            FDQDRMWLNGKE+SLS   +Q+CL+EIR+RA D ED+KKGIKITK DW+ LH+HIASYNN
Sbjct  62   FDQDRMWLNGKEISLSVGEFQSCLREIRSRATDFEDKKKGIKITKDDWQKLHLHIASYNN  121

Query  532  FPTaaglassaagfaCLVFALGKLMNVKEDNSQLSAIARQGSGSACRSLFGGFVKWIMGK  711
            FPTAAGLASSAAG ACLVF+L KLMNVKED  QLSAIARQGSGSACRSL+GGFVKWIMGK
Sbjct  122  FPTAAGLASSAAGLACLVFSLAKLMNVKEDYGQLSAIARQGSGSACRSLYGGFVKWIMGK  181

Query  712  EEDGSDSLAVQLVD  753
            E DGSDS+AVQL D
Sbjct  182  EGDGSDSIAVQLAD  195



>gb|EYU19776.1| hypothetical protein MIMGU_mgv1a007068mg [Erythranthe guttata]
Length=324

 Score =   313 bits (801),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 158/191 (83%), Positives = 174/191 (91%), Gaps = 0/191 (0%)
 Frame = +1

Query  181  AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  360
             +KW+L VTAQTPTNIAVIKYWGKR E LILPINDSISVTLDP HLCTTT+VAVSPAF  
Sbjct  6    GDKWILTVTAQTPTNIAVIKYWGKRHEELILPINDSISVTLDPDHLCTTTSVAVSPAFTH  65

Query  361  DRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPT  540
            DRMWLNGKE+SLSG R+QNCL+E+R+RA DVEDEKKGIKI+KKDWE L +HI S+NNFPT
Sbjct  66   DRMWLNGKEVSLSGDRFQNCLRELRSRASDVEDEKKGIKISKKDWEKLRLHIVSFNNFPT  125

Query  541  aaglassaagfaCLVFALGKLMNVKEDNSQLSAIARQGSGSACRSLFGGFVKWIMGKEED  720
            AAGLASSAAG ACLVF+L  LMNVKED+S+LSAIARQGSGSACRSLFGGF KWIMGKEE+
Sbjct  126  AAGLASSAAGLACLVFSLANLMNVKEDHSKLSAIARQGSGSACRSLFGGFAKWIMGKEEN  185

Query  721  GSDSLAVQLVD  753
            GSDS+AVQL D
Sbjct  186  GSDSIAVQLAD  196



>emb|CAN82519.1| hypothetical protein VITISV_042700 [Vitis vinifera]
Length=451

 Score =   317 bits (812),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 160/191 (84%), Positives = 175/191 (92%), Gaps = 0/191 (0%)
 Frame = +1

Query  181  AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  360
            ++KW+LM TAQTPTNIAVIKYWGKRDE LIL +NDSISVTLDP HLCTTTTVAVSP F  
Sbjct  6    SQKWILMTTAQTPTNIAVIKYWGKRDEGLILAVNDSISVTLDPQHLCTTTTVAVSPMFQS  65

Query  361  DRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPT  540
            DRMWLNGKE+SLSG RYQNCL+EIR+RA  +EDEKKGIKITKKDWE LHVHIASYNNFPT
Sbjct  66   DRMWLNGKEISLSGGRYQNCLREIRSRASKIEDEKKGIKITKKDWEKLHVHIASYNNFPT  125

Query  541  aaglassaagfaCLVFALGKLMNVKEDNSQLSAIARQGSGSACRSLFGGFVKWIMGKEED  720
            AAGLASSAAGFACLVF+L KLMNV+ED  +LSAIARQGSGSACRSL+GGFVKW+MG EE+
Sbjct  126  AAGLASSAAGFACLVFSLAKLMNVQEDQGKLSAIARQGSGSACRSLYGGFVKWVMGNEEN  185

Query  721  GSDSLAVQLVD  753
            GSDS+AVQL D
Sbjct  186  GSDSIAVQLQD  196



>gb|ADI80345.1| mevalonate diphosphate decarboxylase [Panax ginseng]
Length=420

 Score =   316 bits (809),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 159/190 (84%), Positives = 176/190 (93%), Gaps = 0/190 (0%)
 Frame = +1

Query  184  EKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQD  363
            +KWV+MVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDP HLCTTTTV+VSP+F+QD
Sbjct  6    QKWVVMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPDHLCTTTTVSVSPSFEQD  65

Query  364  RMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTa  543
            RMWLNGKE+SL G R+Q+CL+EIR+RACD+EDEKKGIKI K DWE L +HIASYNNFPTA
Sbjct  66   RMWLNGKEISLLGGRFQSCLREIRSRACDLEDEKKGIKIKKMDWEKLRLHIASYNNFPTA  125

Query  544  aglassaagfaCLVFALGKLMNVKEDNSQLSAIARQGSGSACRSLFGGFVKWIMGKEEDG  723
            AGLASSAAG AC VFAL KLMN+ EDN QLSAIAR+GSGSACRSL+GGFVKWIMGKEE+G
Sbjct  126  AGLASSAAGLACFVFALAKLMNLNEDNGQLSAIARRGSGSACRSLYGGFVKWIMGKEENG  185

Query  724  SDSLAVQLVD  753
            SDS+A QL D
Sbjct  186  SDSIAFQLAD  195



>ref|XP_006403599.1| hypothetical protein EUTSA_v10010411mg [Eutrema salsugineum]
 gb|ESQ45052.1| hypothetical protein EUTSA_v10010411mg [Eutrema salsugineum]
Length=419

 Score =   316 bits (809),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 161/191 (84%), Positives = 174/191 (91%), Gaps = 0/191 (0%)
 Frame = +1

Query  181  AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  360
            AEKWV MVTAQTPTNIAVIKYWGKRDE  ILP+NDSISVTLDP HLCT TTVAVSPAFD+
Sbjct  3    AEKWVYMVTAQTPTNIAVIKYWGKRDEVRILPVNDSISVTLDPDHLCTVTTVAVSPAFDR  62

Query  361  DRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPT  540
            DRMWLNGKE+SLSG RYQNCL+EIR RA DVED++KGI+I KKDWE LH+HIAS+NNFPT
Sbjct  63   DRMWLNGKEISLSGSRYQNCLREIRGRAGDVEDKEKGIRIEKKDWEKLHLHIASHNNFPT  122

Query  541  aaglassaagfaCLVFALGKLMNVKEDNSQLSAIARQGSGSACRSLFGGFVKWIMGKEED  720
            AAGLASSAAGFACLVF+L KLMNV ED+S LSAIARQGSGSACRSLFGGFVKW MG + D
Sbjct  123  AAGLASSAAGFACLVFSLAKLMNVDEDSSHLSAIARQGSGSACRSLFGGFVKWTMGSKGD  182

Query  721  GSDSLAVQLVD  753
            GSDS+AVQL D
Sbjct  183  GSDSVAVQLAD  193



>ref|XP_010536295.1| PREDICTED: diphosphomevalonate decarboxylase-like isoform X1 
[Tarenaya hassleriana]
Length=439

 Score =   316 bits (810),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 164/192 (85%), Positives = 175/192 (91%), Gaps = 1/192 (1%)
 Frame = +1

Query  181  AEK-WVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFD  357
            AEK WVLMVTAQTPTNIAVIKYWGKRDE+ ILPINDSISVTLDP HLCT TT AVSPAFD
Sbjct  3    AEKPWVLMVTAQTPTNIAVIKYWGKRDESRILPINDSISVTLDPDHLCTVTTAAVSPAFD  62

Query  358  QDRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFP  537
            +DRMWLNGKE+SLSG R+QNCL+EIR RACDVED+ K +KI KKDWE LH+HIASYNNFP
Sbjct  63   RDRMWLNGKEISLSGSRFQNCLREIRTRACDVEDKGKCVKIEKKDWEKLHLHIASYNNFP  122

Query  538  TaaglassaagfaCLVFALGKLMNVKEDNSQLSAIARQGSGSACRSLFGGFVKWIMGKEE  717
            TAAGLASSAAGFACLVFAL KLMNV ED SQLSAIARQGSGSACRSLFGGFVKW MG +E
Sbjct  123  TAAGLASSAAGFACLVFALSKLMNVNEDQSQLSAIARQGSGSACRSLFGGFVKWTMGNKE  182

Query  718  DGSDSLAVQLVD  753
            DG+DS+AVQL D
Sbjct  183  DGTDSVAVQLTD  194



>ref|XP_008446768.1| PREDICTED: diphosphomevalonate decarboxylase [Cucumis melo]
Length=424

 Score =   316 bits (809),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 159/191 (83%), Positives = 175/191 (92%), Gaps = 0/191 (0%)
 Frame = +1

Query  181  AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  360
             +KWVL+ TAQTPTNIAVIKYWGKRDE LILP+NDSISVTLDP+HLCT TTVAVSP F++
Sbjct  9    GQKWVLLTTAQTPTNIAVIKYWGKRDEDLILPVNDSISVTLDPSHLCTITTVAVSPDFEK  68

Query  361  DRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPT  540
            DRMWLN KE+SLSG RYQNCL+EIR+RA DVED++KGIKI KKDWE LHV+I SYNNFPT
Sbjct  69   DRMWLNRKEISLSGARYQNCLREIRSRANDVEDKEKGIKIAKKDWEKLHVYIDSYNNFPT  128

Query  541  aaglassaagfaCLVFALGKLMNVKEDNSQLSAIARQGSGSACRSLFGGFVKWIMGKEED  720
            AAGLASSAAG ACLVFAL  LMNVKED+SQLSAIARQGSGSACRSL+GGFVKW MGKE+D
Sbjct  129  AAGLASSAAGLACLVFALANLMNVKEDHSQLSAIARQGSGSACRSLYGGFVKWCMGKEKD  188

Query  721  GSDSLAVQLVD  753
            GSDSLA+QL D
Sbjct  189  GSDSLAIQLAD  199



>gb|ABV02028.1| mevalonate diphosphate decarboxylase [Nicotiana langsdorffii 
x Nicotiana sanderae]
Length=406

 Score =   314 bits (805),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 161/180 (89%), Positives = 171/180 (95%), Gaps = 0/180 (0%)
 Frame = +1

Query  214  TPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDRMWLNGKEMS  393
            TPTNIAVIKYWGKRDE LIL INDSI VTLDPAHLCTTTTVAVSPAF+QDRMWLNGKE+S
Sbjct  1    TPTNIAVIKYWGKRDEDLILAINDSIGVTLDPAHLCTTTTVAVSPAFNQDRMWLNGKEIS  60

Query  394  LSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTaaglassaagf  573
            LSG RYQNCL+EIRARA DVEDE KGIKI KKDW+NLHVHIASYNNFPTAAGLASSAAGF
Sbjct  61   LSGGRYQNCLREIRARASDVEDENKGIKIAKKDWQNLHVHIASYNNFPTAAGLASSAAGF  120

Query  574  aCLVFALGKLMNVKEDNSQLSAIARQGSGSACRSLFGGFVKWIMGKEEDGSDSLAVQLVD  753
            ACLVF+L KLMNV+EDN +LSAIARQGSGSACRSL+GGFVKWIMGKEE+GSDS+AVQLVD
Sbjct  121  ACLVFSLAKLMNVQEDNGKLSAIARQGSGSACRSLYGGFVKWIMGKEENGSDSIAVQLVD  180



>emb|CDX76157.1| BnaA04g04210D [Brassica napus]
Length=419

 Score =   315 bits (806),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 160/191 (84%), Positives = 174/191 (91%), Gaps = 0/191 (0%)
 Frame = +1

Query  181  AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  360
            AEKWV MVTAQTPTNIAVIKYWGKRDE  ILP+NDSISVTLDP HLCT TTVAVSP+FD+
Sbjct  3    AEKWVYMVTAQTPTNIAVIKYWGKRDEVRILPVNDSISVTLDPDHLCTVTTVAVSPSFDR  62

Query  361  DRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPT  540
            DRMWLNGKE+SLSG RYQNCL+EIR RA DVED++KG+KI KKDWE LH+HIAS+NNFPT
Sbjct  63   DRMWLNGKEISLSGSRYQNCLREIRGRAGDVEDKEKGVKIDKKDWEKLHLHIASHNNFPT  122

Query  541  aaglassaagfaCLVFALGKLMNVKEDNSQLSAIARQGSGSACRSLFGGFVKWIMGKEED  720
            AAGLASSAAGFACLVF+L KLMNV ED S LSAIARQGSGSACRSLFGGFVKW MG ++D
Sbjct  123  AAGLASSAAGFACLVFSLAKLMNVDEDASHLSAIARQGSGSACRSLFGGFVKWEMGSKDD  182

Query  721  GSDSLAVQLVD  753
            GSDS+AVQL D
Sbjct  183  GSDSIAVQLAD  193



>gb|KHN37414.1| Diphosphomevalonate decarboxylase [Glycine soja]
Length=658

 Score =   322 bits (824),  Expect = 8e-102, Method: Compositional matrix adjust.
 Identities = 164/191 (86%), Positives = 178/191 (93%), Gaps = 0/191 (0%)
 Frame = +1

Query  181  AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  360
            ++ WV MVTAQTPTNIAVIKYWGKRDETLILP+NDSIS+TLDP+HLCTTTTVAVS AF Q
Sbjct  5    SQNWVFMVTAQTPTNIAVIKYWGKRDETLILPVNDSISLTLDPSHLCTTTTVAVSSAFHQ  64

Query  361  DRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPT  540
            DRMWLN KE+SLSG R+ +CL+EIRARACDVEDE KGIKITK+DW  LH+HIASYNNFPT
Sbjct  65   DRMWLNAKEISLSGGRFHSCLREIRARACDVEDENKGIKITKEDWAKLHLHIASYNNFPT  124

Query  541  aaglassaagfaCLVFALGKLMNVKEDNSQLSAIARQGSGSACRSLFGGFVKWIMGKEED  720
            AAGLASSAAGFACL +ALGKLMNVKED SQLSAIARQGSGSACRSLFGGFVKWIMGKE++
Sbjct  125  AAGLASSAAGFACLAYALGKLMNVKEDESQLSAIARQGSGSACRSLFGGFVKWIMGKEDN  184

Query  721  GSDSLAVQLVD  753
            GSDSLAVQL D
Sbjct  185  GSDSLAVQLAD  195



>emb|CDX73494.1| BnaC08g25090D [Brassica napus]
Length=419

 Score =   314 bits (805),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 160/191 (84%), Positives = 176/191 (92%), Gaps = 0/191 (0%)
 Frame = +1

Query  181  AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  360
            AEKWV MVTAQTPTNIAVIKYWGKRDE  ILP+NDSISVTLDP HLCT TTVAVSPAFD+
Sbjct  3    AEKWVYMVTAQTPTNIAVIKYWGKRDEVRILPVNDSISVTLDPDHLCTVTTVAVSPAFDR  62

Query  361  DRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPT  540
            DRMWLNGKE+SLSG RYQNCL+EIR+R  DVED++KG+KI KKDWE L++HIAS+NNFPT
Sbjct  63   DRMWLNGKEISLSGSRYQNCLREIRSRGGDVEDKEKGVKIEKKDWERLNLHIASHNNFPT  122

Query  541  aaglassaagfaCLVFALGKLMNVKEDNSQLSAIARQGSGSACRSLFGGFVKWIMGKEED  720
            AAGLASSAAGFACLVF+L KLMNV+ED SQLSAIARQGSGSACRSLFGGFVKW MG ++D
Sbjct  123  AAGLASSAAGFACLVFSLAKLMNVEEDPSQLSAIARQGSGSACRSLFGGFVKWKMGSKDD  182

Query  721  GSDSLAVQLVD  753
            GSDS+AVQL D
Sbjct  183  GSDSVAVQLAD  193



>ref|XP_004236810.1| PREDICTED: diphosphomevalonate decarboxylase-like [Solanum lycopersicum]
Length=421

 Score =   314 bits (805),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 168/191 (88%), Positives = 183/191 (96%), Gaps = 0/191 (0%)
 Frame = +1

Query  181  AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  360
            ++KWVLMVTAQTPTNIAVIKYWGKRDE LIL INDSISVTLDPAHLCTTTTVAVSPAFDQ
Sbjct  5    SQKWVLMVTAQTPTNIAVIKYWGKRDENLILAINDSISVTLDPAHLCTTTTVAVSPAFDQ  64

Query  361  DRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPT  540
            DRMWLNGKE+SLSG RYQNCL+EIRARA DVED+KKG+KI KKDWENLHVH+ASYNNFPT
Sbjct  65   DRMWLNGKEISLSGGRYQNCLREIRARANDVEDKKKGVKIAKKDWENLHVHVASYNNFPT  124

Query  541  aaglassaagfaCLVFALGKLMNVKEDNSQLSAIARQGSGSACRSLFGGFVKWIMGKEED  720
            AAGLASSAAGFACLV++L KLMNV+EDN +LSAIARQGSGSACRSL+GGFVKW+MGKEE+
Sbjct  125  AAGLASSAAGFACLVYSLAKLMNVQEDNGRLSAIARQGSGSACRSLYGGFVKWVMGKEEN  184

Query  721  GSDSLAVQLVD  753
            GSDS+AV LVD
Sbjct  185  GSDSIAVPLVD  195



>emb|CAB70999.1| DIPHOSPHOMEVALONATE DECARBOXYLASE-like protein [Arabidopsis thaliana]
Length=413

 Score =   313 bits (801),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 161/190 (85%), Positives = 172/190 (91%), Gaps = 0/190 (0%)
 Frame = +1

Query  184  EKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQD  363
            EKWV MVTAQTPTNIAVIKYWGKRDE  ILP+NDSISVTLDP HLCT TTVAVSPAFD+D
Sbjct  4    EKWVFMVTAQTPTNIAVIKYWGKRDEVRILPVNDSISVTLDPDHLCTVTTVAVSPAFDRD  63

Query  364  RMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTa  543
            RMWLNGKE+SLSG RYQNCL+EIR RA DVED +KGIKI KKDWE L++HIAS+NNFPTA
Sbjct  64   RMWLNGKEISLSGSRYQNCLREIRGRAGDVEDMEKGIKIRKKDWEKLNLHIASHNNFPTA  123

Query  544  aglassaagfaCLVFALGKLMNVKEDNSQLSAIARQGSGSACRSLFGGFVKWIMGKEEDG  723
            AGLASSAAGFACLVF+L KLMNV ED S LSAIARQGSGSACRSLFGGFVKW MG +EDG
Sbjct  124  AGLASSAAGFACLVFSLAKLMNVDEDPSHLSAIARQGSGSACRSLFGGFVKWTMGSKEDG  183

Query  724  SDSLAVQLVD  753
            SDS+AVQL D
Sbjct  184  SDSVAVQLAD  193



>gb|EYU19775.1| hypothetical protein MIMGU_mgv1a007068mg [Erythranthe guttata]
Length=421

 Score =   313 bits (802),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 158/191 (83%), Positives = 174/191 (91%), Gaps = 0/191 (0%)
 Frame = +1

Query  181  AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  360
             +KW+L VTAQTPTNIAVIKYWGKR E LILPINDSISVTLDP HLCTTT+VAVSPAF  
Sbjct  6    GDKWILTVTAQTPTNIAVIKYWGKRHEELILPINDSISVTLDPDHLCTTTSVAVSPAFTH  65

Query  361  DRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPT  540
            DRMWLNGKE+SLSG R+QNCL+E+R+RA DVEDEKKGIKI+KKDWE L +HI S+NNFPT
Sbjct  66   DRMWLNGKEVSLSGDRFQNCLRELRSRASDVEDEKKGIKISKKDWEKLRLHIVSFNNFPT  125

Query  541  aaglassaagfaCLVFALGKLMNVKEDNSQLSAIARQGSGSACRSLFGGFVKWIMGKEED  720
            AAGLASSAAG ACLVF+L  LMNVKED+S+LSAIARQGSGSACRSLFGGF KWIMGKEE+
Sbjct  126  AAGLASSAAGLACLVFSLANLMNVKEDHSKLSAIARQGSGSACRSLFGGFAKWIMGKEEN  185

Query  721  GSDSLAVQLVD  753
            GSDS+AVQL D
Sbjct  186  GSDSIAVQLAD  196



>ref|XP_010515945.1| PREDICTED: diphosphomevalonate decarboxylase-like [Camelina sativa]
 ref|XP_010515946.1| PREDICTED: diphosphomevalonate decarboxylase-like [Camelina sativa]
 ref|XP_010515947.1| PREDICTED: diphosphomevalonate decarboxylase-like [Camelina sativa]
Length=419

 Score =   313 bits (801),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 159/190 (84%), Positives = 174/190 (92%), Gaps = 0/190 (0%)
 Frame = +1

Query  184  EKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQD  363
            EKWV MVTAQTPTNIAVIKYWGKRDE  ILP+NDSISVTLDP HLCT TTVAVSPAFD+D
Sbjct  4    EKWVFMVTAQTPTNIAVIKYWGKRDEVRILPVNDSISVTLDPDHLCTVTTVAVSPAFDRD  63

Query  364  RMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTa  543
            RMWLNGKE+SLSG RYQNCL+EIR+RA DVED++KG+KI KKDW+ LH+HIAS+NNFPTA
Sbjct  64   RMWLNGKEISLSGSRYQNCLREIRSRAGDVEDKEKGVKIGKKDWDKLHLHIASHNNFPTA  123

Query  544  aglassaagfaCLVFALGKLMNVKEDNSQLSAIARQGSGSACRSLFGGFVKWIMGKEEDG  723
            AGLASSAAGFACLVF+L KLMNV ED S LSAIARQGSGSACRSLFGGFVKW MG ++DG
Sbjct  124  AGLASSAAGFACLVFSLAKLMNVDEDPSHLSAIARQGSGSACRSLFGGFVKWEMGSKDDG  183

Query  724  SDSLAVQLVD  753
            SDS+AVQL D
Sbjct  184  SDSVAVQLAD  193



>ref|XP_009116111.1| PREDICTED: diphosphomevalonate decarboxylase [Brassica rapa]
 emb|CDX78223.1| BnaA09g34180D [Brassica napus]
Length=419

 Score =   313 bits (801),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 159/191 (83%), Positives = 176/191 (92%), Gaps = 0/191 (0%)
 Frame = +1

Query  181  AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  360
            AEKWV MVTAQTPTNIAVIKYWGKRDE  ILP+NDSISVTLDP HLCT TTVAVSP+FD+
Sbjct  3    AEKWVYMVTAQTPTNIAVIKYWGKRDEVRILPVNDSISVTLDPDHLCTVTTVAVSPSFDR  62

Query  361  DRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPT  540
            DRMWLNGKE+SLSG RYQNCL+EIR+R  DVED++KG+KI KKDWE L++HIAS+NNFPT
Sbjct  63   DRMWLNGKEISLSGSRYQNCLREIRSRGGDVEDKEKGVKIEKKDWERLNLHIASHNNFPT  122

Query  541  aaglassaagfaCLVFALGKLMNVKEDNSQLSAIARQGSGSACRSLFGGFVKWIMGKEED  720
            AAGLASSAAGFACLVF+L KLMNV+ED SQLSAIARQGSGSACRSLFGGFVKW MG ++D
Sbjct  123  AAGLASSAAGFACLVFSLAKLMNVEEDPSQLSAIARQGSGSACRSLFGGFVKWKMGSKDD  182

Query  721  GSDSLAVQLVD  753
            GSDS+AVQL D
Sbjct  183  GSDSVAVQLAD  193



>ref|XP_006391873.1| hypothetical protein EUTSA_v10023484mg [Eutrema salsugineum]
 gb|ESQ29159.1| hypothetical protein EUTSA_v10023484mg [Eutrema salsugineum]
Length=419

 Score =   313 bits (801),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 159/191 (83%), Positives = 175/191 (92%), Gaps = 0/191 (0%)
 Frame = +1

Query  181  AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  360
            AE WV MVTAQTPTNIAVIKYWGKRDE  ILP+NDSISVTLDP HLCT TTVAVSP+FD+
Sbjct  3    AENWVYMVTAQTPTNIAVIKYWGKRDEVRILPVNDSISVTLDPDHLCTVTTVAVSPSFDR  62

Query  361  DRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPT  540
            DRMWLNGKE+SLSG RYQNCL+EIR+RA DVED++KG+KI KKDWE LH+HIAS+NNFPT
Sbjct  63   DRMWLNGKEISLSGSRYQNCLREIRSRAGDVEDKEKGVKIGKKDWEKLHLHIASHNNFPT  122

Query  541  aaglassaagfaCLVFALGKLMNVKEDNSQLSAIARQGSGSACRSLFGGFVKWIMGKEED  720
            AAGLASSAAGFACLVF+L KLMNV ED SQLSAIARQGSGSACRSLFGGFV+W MG ++D
Sbjct  123  AAGLASSAAGFACLVFSLAKLMNVDEDPSQLSAIARQGSGSACRSLFGGFVEWKMGSKDD  182

Query  721  GSDSLAVQLVD  753
            GSDS+AVQL D
Sbjct  183  GSDSVAVQLTD  193



>ref|NP_566995.1| diphosphomevalonate decarboxylase [Arabidopsis thaliana]
 gb|AEE79204.1| diphosphomevalonate decarboxylase [Arabidopsis thaliana]
Length=419

 Score =   313 bits (801),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 161/190 (85%), Positives = 172/190 (91%), Gaps = 0/190 (0%)
 Frame = +1

Query  184  EKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQD  363
            EKWV MVTAQTPTNIAVIKYWGKRDE  ILP+NDSISVTLDP HLCT TTVAVSPAFD+D
Sbjct  4    EKWVFMVTAQTPTNIAVIKYWGKRDEVRILPVNDSISVTLDPDHLCTVTTVAVSPAFDRD  63

Query  364  RMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTa  543
            RMWLNGKE+SLSG RYQNCL+EIR RA DVED +KGIKI KKDWE L++HIAS+NNFPTA
Sbjct  64   RMWLNGKEISLSGSRYQNCLREIRGRAGDVEDMEKGIKIRKKDWEKLNLHIASHNNFPTA  123

Query  544  aglassaagfaCLVFALGKLMNVKEDNSQLSAIARQGSGSACRSLFGGFVKWIMGKEEDG  723
            AGLASSAAGFACLVF+L KLMNV ED S LSAIARQGSGSACRSLFGGFVKW MG +EDG
Sbjct  124  AGLASSAAGFACLVFSLAKLMNVDEDPSHLSAIARQGSGSACRSLFGGFVKWTMGSKEDG  183

Query  724  SDSLAVQLVD  753
            SDS+AVQL D
Sbjct  184  SDSVAVQLAD  193



>gb|AIK21783.1| mevalonate diphosphate decarboxylase [Panax notoginseng]
Length=420

 Score =   311 bits (798),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 158/190 (83%), Positives = 175/190 (92%), Gaps = 0/190 (0%)
 Frame = +1

Query  184  EKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQD  363
            +KWV+MVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDP HLCTTTTV+VSP+F+QD
Sbjct  6    QKWVVMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPDHLCTTTTVSVSPSFEQD  65

Query  364  RMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTa  543
            RMWLNGKE+SL G R+Q+CL+EIR+RA D+ED+KKGI I K DWE LH HIASYNNFPTA
Sbjct  66   RMWLNGKEISLLGGRFQSCLREIRSRARDLEDKKKGIVIKKMDWEKLHFHIASYNNFPTA  125

Query  544  aglassaagfaCLVFALGKLMNVKEDNSQLSAIARQGSGSACRSLFGGFVKWIMGKEEDG  723
            AGLASSAAG AC VFAL KLMN+ EDN QLSAIAR+GSGSACRSL+GGFVKWIMGKEE+G
Sbjct  126  AGLASSAAGLACFVFALAKLMNLNEDNGQLSAIARRGSGSACRSLYGGFVKWIMGKEENG  185

Query  724  SDSLAVQLVD  753
            SDS+AVQL D
Sbjct  186  SDSIAVQLAD  195



>gb|AAM64988.1| mevalonate diphosphate decarboxylase [Arabidopsis thaliana]
Length=404

 Score =   310 bits (795),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 161/185 (87%), Positives = 172/185 (93%), Gaps = 0/185 (0%)
 Frame = +1

Query  199  MVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDRMWLN  378
            MVTAQTPTNIAVIKYWGKRDE  ILPINDSISVTLDP HLCT TTVAVSP+FD+DRMWLN
Sbjct  1    MVTAQTPTNIAVIKYWGKRDEVRILPINDSISVTLDPDHLCTLTTVAVSPSFDRDRMWLN  60

Query  379  GKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTaaglas  558
            GKE+SLSG RYQNCL+EIR+RA DVED++KGIKI KKDWE LH+HIAS+NNFPTAAGLAS
Sbjct  61   GKEISLSGSRYQNCLREIRSRADDVEDKEKGIKIAKKDWEKLHLHIASHNNFPTAAGLAS  120

Query  559  saagfaCLVFALGKLMNVKEDNSQLSAIARQGSGSACRSLFGGFVKWIMGKEEDGSDSLA  738
            SAAGFACLVFAL KLMNV ED SQLSAIARQGSGSACRSLFGGFVKW MG +EDGSDS+A
Sbjct  121  SAAGFACLVFALAKLMNVNEDPSQLSAIARQGSGSACRSLFGGFVKWNMGNKEDGSDSVA  180

Query  739  VQLVD  753
            VQLVD
Sbjct  181  VQLVD  185



>gb|AAM65192.1| diphosphomevalonate decarboxylase-like protein [Arabidopsis thaliana]
Length=419

 Score =   310 bits (794),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 160/190 (84%), Positives = 171/190 (90%), Gaps = 0/190 (0%)
 Frame = +1

Query  184  EKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQD  363
            EKWV MVTAQTPTNIAVIKYWGKR E  ILP+NDSISVTLDP HLCT TTVAVSPAFD+D
Sbjct  4    EKWVFMVTAQTPTNIAVIKYWGKRHEVRILPVNDSISVTLDPDHLCTVTTVAVSPAFDRD  63

Query  364  RMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTa  543
            RMWLNGKE+SLSG RYQNCL+EIR RA DVED +KGIKI KKDWE L++HIAS+NNFPTA
Sbjct  64   RMWLNGKEISLSGSRYQNCLREIRGRAGDVEDMEKGIKIRKKDWEKLNLHIASHNNFPTA  123

Query  544  aglassaagfaCLVFALGKLMNVKEDNSQLSAIARQGSGSACRSLFGGFVKWIMGKEEDG  723
            AGLASSAAGFACLVF+L KLMNV ED S LSAIARQGSGSACRSLFGGFVKW MG +EDG
Sbjct  124  AGLASSAAGFACLVFSLAKLMNVDEDPSHLSAIARQGSGSACRSLFGGFVKWTMGSKEDG  183

Query  724  SDSLAVQLVD  753
            SDS+AVQL D
Sbjct  184  SDSVAVQLAD  193



>ref|XP_008345749.1| PREDICTED: diphosphomevalonate decarboxylase-like [Malus domestica]
Length=418

 Score =   310 bits (793),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 165/191 (86%), Positives = 183/191 (96%), Gaps = 0/191 (0%)
 Frame = +1

Query  181  AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  360
            + KWVLMVTAQTPTNIAVIKYWGKRDE LILP+NDSISVTLDPAHLCTTTTV+VSP FDQ
Sbjct  5    SRKWVLMVTAQTPTNIAVIKYWGKRDEKLILPVNDSISVTLDPAHLCTTTTVSVSPTFDQ  64

Query  361  DRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPT  540
            DRMWLNG+E+S+SG R+Q+CL+EIR+RA DV+D++KGIKITKKDWENLHVHI+SYNNFPT
Sbjct  65   DRMWLNGEEISISGGRFQSCLREIRSRATDVDDKEKGIKITKKDWENLHVHISSYNNFPT  124

Query  541  aaglassaagfaCLVFALGKLMNVKEDNSQLSAIARQGSGSACRSLFGGFVKWIMGKEED  720
            AAGLASSAAGFACLVFALGKLMNVKED SQLSAIARQGSGSACRSL+GGFVKWIMGK+E 
Sbjct  125  AAGLASSAAGFACLVFALGKLMNVKEDXSQLSAIARQGSGSACRSLYGGFVKWIMGKDEK  184

Query  721  GSDSLAVQLVD  753
            G+DSLAVQ+ D
Sbjct  185  GTDSLAVQVAD  195



>ref|XP_009356125.1| PREDICTED: diphosphomevalonate decarboxylase [Pyrus x bretschneideri]
Length=418

 Score =   309 bits (791),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 164/191 (86%), Positives = 183/191 (96%), Gaps = 0/191 (0%)
 Frame = +1

Query  181  AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  360
            ++KWVLMVTAQTPTNIAVIKYWGKRDE LILP+NDSISVTLDPAHLCTTTTV+VSP FDQ
Sbjct  5    SQKWVLMVTAQTPTNIAVIKYWGKRDEKLILPVNDSISVTLDPAHLCTTTTVSVSPTFDQ  64

Query  361  DRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPT  540
            DRMWLNG+E+S+SG R+Q+CL+EIR+RA D++D++KGI ITKKDWE LHVHI+SYNNFPT
Sbjct  65   DRMWLNGEEISISGGRFQSCLREIRSRATDIDDKEKGINITKKDWEKLHVHISSYNNFPT  124

Query  541  aaglassaagfaCLVFALGKLMNVKEDNSQLSAIARQGSGSACRSLFGGFVKWIMGKEED  720
            AAGLASSAAGFACLVFALGKLMNVKED+SQLSAIARQGSGSACRSL+GGFVKWIMGKEE 
Sbjct  125  AAGLASSAAGFACLVFALGKLMNVKEDHSQLSAIARQGSGSACRSLYGGFVKWIMGKEEK  184

Query  721  GSDSLAVQLVD  753
            G+DSLAVQL D
Sbjct  185  GTDSLAVQLAD  195



>gb|ACW83616.2| mevalonate diphosphate decarboxylase [Panax ginseng]
Length=417

 Score =   307 bits (786),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 155/192 (81%), Positives = 173/192 (90%), Gaps = 0/192 (0%)
 Frame = +1

Query  178  MAEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFD  357
            MAE WV+MVTAQTP NIAVIKYWGKRDETLILPINDSI V+LDP HLCTTTTV+V P+F+
Sbjct  1    MAESWVIMVTAQTPINIAVIKYWGKRDETLILPINDSIRVSLDPDHLCTTTTVSVRPSFE  60

Query  358  QDRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFP  537
            QDRMWLNGKE+SL G R+Q+CL+EIR+RA D+EDEKKGI I K DWE LH HIASYNNFP
Sbjct  61   QDRMWLNGKEISLLGGRFQSCLREIRSRARDLEDEKKGIVIKKMDWEKLHFHIASYNNFP  120

Query  538  TaaglassaagfaCLVFALGKLMNVKEDNSQLSAIARQGSGSACRSLFGGFVKWIMGKEE  717
            TAAGLASSAAG AC VFAL KL+ ++EDN QLSAIAR+GSGSACRSL+GGFVKWIMGKEE
Sbjct  121  TAAGLASSAAGLACFVFALAKLLTLQEDNGQLSAIARRGSGSACRSLYGGFVKWIMGKEE  180

Query  718  DGSDSLAVQLVD  753
            +GSDS+AVQL D
Sbjct  181  NGSDSIAVQLAD  192



>ref|XP_008356850.1| PREDICTED: diphosphomevalonate decarboxylase-like [Malus domestica]
Length=418

 Score =   306 bits (784),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 163/191 (85%), Positives = 183/191 (96%), Gaps = 0/191 (0%)
 Frame = +1

Query  181  AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  360
            ++KWVLMVTAQTPTNIAVIKYWGKRDE LILP+NDSISVTLDPAHLCTTTTV+VSP FDQ
Sbjct  5    SQKWVLMVTAQTPTNIAVIKYWGKRDEKLILPVNDSISVTLDPAHLCTTTTVSVSPTFDQ  64

Query  361  DRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPT  540
            DRMWLNG+E+S+SG R+Q+CL+EIR+RA DV+D++ GIKITKKDWE LHVHI+SYNNFPT
Sbjct  65   DRMWLNGEEISISGGRFQSCLREIRSRATDVDDKEXGIKITKKDWEKLHVHISSYNNFPT  124

Query  541  aaglassaagfaCLVFALGKLMNVKEDNSQLSAIARQGSGSACRSLFGGFVKWIMGKEED  720
            AAGLASSAAGFACLVFALGKLMNVKED+SQLSAIARQGSGSACRSL+GGFVKWIMGK++ 
Sbjct  125  AAGLASSAAGFACLVFALGKLMNVKEDHSQLSAIARQGSGSACRSLYGGFVKWIMGKDDK  184

Query  721  GSDSLAVQLVD  753
            G+DSLAVQL D
Sbjct  185  GTDSLAVQLAD  195



>ref|XP_008364764.1| PREDICTED: diphosphomevalonate decarboxylase-like [Malus domestica]
Length=418

 Score =   306 bits (784),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 163/191 (85%), Positives = 183/191 (96%), Gaps = 0/191 (0%)
 Frame = +1

Query  181  AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  360
            ++KWVLMVTAQTPTNIAVIKYWGKRDE LILP+NDSISVTLDPAHLCTTTTV+VSP FDQ
Sbjct  5    SQKWVLMVTAQTPTNIAVIKYWGKRDEKLILPVNDSISVTLDPAHLCTTTTVSVSPTFDQ  64

Query  361  DRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPT  540
            DRMWLNG+E+S+SG R+Q+CL+EIR+RA DV+D++ GIKITKKDWE LHVHI+SYNNFPT
Sbjct  65   DRMWLNGEEISISGGRFQSCLREIRSRATDVDDKENGIKITKKDWEKLHVHISSYNNFPT  124

Query  541  aaglassaagfaCLVFALGKLMNVKEDNSQLSAIARQGSGSACRSLFGGFVKWIMGKEED  720
            AAGLASSAAGFACLVFALGKLMNVKED+SQLSAIARQGSGSACRSL+GGFVKWIMGK++ 
Sbjct  125  AAGLASSAAGFACLVFALGKLMNVKEDHSQLSAIARQGSGSACRSLYGGFVKWIMGKDDK  184

Query  721  GSDSLAVQLVD  753
            G+DSLAVQL D
Sbjct  185  GTDSLAVQLAD  195



>ref|XP_010244659.1| PREDICTED: diphosphomevalonate decarboxylase-like [Nelumbo nucifera]
Length=421

 Score =   306 bits (783),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 154/190 (81%), Positives = 173/190 (91%), Gaps = 0/190 (0%)
 Frame = +1

Query  184  EKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQD  363
            + WVLMVTAQTPTNIAVIKYWGKRDETLILP+NDSISVTLDP HLCTTTTVAVSP+F+ D
Sbjct  6    QNWVLMVTAQTPTNIAVIKYWGKRDETLILPVNDSISVTLDPEHLCTTTTVAVSPSFEND  65

Query  364  RMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTa  543
            RMWLNGKE+SLSG R+QNCL+EIR RA  V+DE KGI I K+DW+ LHVHIASYNNFPTA
Sbjct  66   RMWLNGKEISLSGGRFQNCLREIRCRANSVDDEDKGIHIKKEDWDRLHVHIASYNNFPTA  125

Query  544  aglassaagfaCLVFALGKLMNVKEDNSQLSAIARQGSGSACRSLFGGFVKWIMGKEEDG  723
            AGLASSAAGFACLVF+L KLMN+KED   LSAIARQGSGSACRSL+GGFVKW+MG +++G
Sbjct  126  AGLASSAAGFACLVFSLAKLMNLKEDQGALSAIARQGSGSACRSLYGGFVKWVMGNDDNG  185

Query  724  SDSLAVQLVD  753
            SDS+AVQL +
Sbjct  186  SDSIAVQLAN  195



>gb|AFJ93089.1| mevalonate diphosphate decarboxylase, partial [Bacopa monnieri]
Length=254

 Score =   300 bits (767),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 153/177 (86%), Positives = 165/177 (93%), Gaps = 0/177 (0%)
 Frame = +1

Query  223  NIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDRMWLNGKEMSLSG  402
            NIAVIKYWGKRDE LILPINDSISVTLDP HLCTTT+VAVSPAF  DRMWLNGKE+ LSG
Sbjct  1    NIAVIKYWGKRDEDLILPINDSISVTLDPDHLCTTTSVAVSPAFTHDRMWLNGKEVPLSG  60

Query  403  VRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTaaglassaagfaCL  582
            VRYQNCLKE+R+ A DVE+E+KGIKI+KKDWE LHVHI SYNNFPTAAGLASSAAG ACL
Sbjct  61   VRYQNCLKELRSLANDVEEEEKGIKISKKDWEKLHVHIVSYNNFPTAAGLASSAAGLACL  120

Query  583  VFALGKLMNVKEDNSQLSAIARQGSGSACRSLFGGFVKWIMGKEEDGSDSLAVQLVD  753
            VF+L KLMNVKEDNS+LSAIARQGSGSACRSL+GGFVKWIMGKEE+GSDS+AVQL D
Sbjct  121  VFSLAKLMNVKEDNSRLSAIARQGSGSACRSLYGGFVKWIMGKEENGSDSIAVQLAD  177



>ref|XP_010907122.1| PREDICTED: diphosphomevalonate decarboxylase-like [Elaeis guineensis]
Length=421

 Score =   303 bits (775),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 153/188 (81%), Positives = 168/188 (89%), Gaps = 0/188 (0%)
 Frame = +1

Query  184  EKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQD  363
            + WVLM TA+ PTNIAVIKYWGKRDE LILPINDSISVTLDP HL  TTTVAVSP+F QD
Sbjct  6    QSWVLMATARAPTNIAVIKYWGKRDEALILPINDSISVTLDPDHLSATTTVAVSPSFKQD  65

Query  364  RMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTa  543
            RMWLNGKE+SLSG RYQNCL+EIR RA DVEDEKKGI+I K+DWE +H+HIASYNNFPTA
Sbjct  66   RMWLNGKEISLSGGRYQNCLREIRKRAGDVEDEKKGIRIKKEDWEKMHLHIASYNNFPTA  125

Query  544  aglassaagfaCLVFALGKLMNVKEDNSQLSAIARQGSGSACRSLFGGFVKWIMGKEEDG  723
            AGLASSAAGFACLVF L KLMNVKE++  LSAIARQGSGSACRS++GGFVKW MG + DG
Sbjct  126  AGLASSAAGFACLVFTLAKLMNVKEEHGDLSAIARQGSGSACRSMYGGFVKWTMGNDADG  185

Query  724  SDSLAVQL  747
            SDS+AVQL
Sbjct  186  SDSIAVQL  193



>ref|XP_010554524.1| PREDICTED: diphosphomevalonate decarboxylase-like [Tarenaya hassleriana]
Length=412

 Score =   302 bits (773),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 167/194 (86%), Positives = 176/194 (91%), Gaps = 2/194 (1%)
 Frame = +1

Query  178  MAEK--WVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPA  351
            MAEK  WV+MVTAQTPTNIAVIKYWGKRDE  ILPINDSISVTLDP HLCT TTVAVSPA
Sbjct  1    MAEKKQWVVMVTAQTPTNIAVIKYWGKRDEARILPINDSISVTLDPDHLCTVTTVAVSPA  60

Query  352  FDQDRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNN  531
            FD D+MWLNGKE+SLSG RYQNCL+EIR RA DVED++KGIKI KKDWE LH+HIASYNN
Sbjct  61   FDHDQMWLNGKEISLSGSRYQNCLREIRNRAGDVEDKEKGIKIEKKDWEKLHLHIASYNN  120

Query  532  FPTaaglassaagfaCLVFALGKLMNVKEDNSQLSAIARQGSGSACRSLFGGFVKWIMGK  711
            FPTAAGLASSAAGFACLVFAL KLMNV ED SQLSAIARQGSGSACRSLFGGFVKW MG 
Sbjct  121  FPTAAGLASSAAGFACLVFALSKLMNVNEDPSQLSAIARQGSGSACRSLFGGFVKWTMGN  180

Query  712  EEDGSDSLAVQLVD  753
            +EDG+DSLAVQL D
Sbjct  181  KEDGTDSLAVQLTD  194



>ref|XP_010505522.1| PREDICTED: diphosphomevalonate decarboxylase-like [Camelina sativa]
Length=412

 Score =   301 bits (772),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 164/190 (86%), Positives = 176/190 (93%), Gaps = 0/190 (0%)
 Frame = +1

Query  184  EKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQD  363
            EKWV+MVTAQTPTNIAVIKYWGKRDE  ILPINDSISVTLDP HLCT TTVAVSP+FD+D
Sbjct  4    EKWVMMVTAQTPTNIAVIKYWGKRDEVRILPINDSISVTLDPDHLCTLTTVAVSPSFDRD  63

Query  364  RMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTa  543
            RMWLNGKE+SLSG RYQNCL+EIR+R  DVED++KGIKI KKDWE LH+HIAS+NNFPTA
Sbjct  64   RMWLNGKEISLSGSRYQNCLREIRSRGDDVEDKEKGIKIEKKDWEKLHLHIASHNNFPTA  123

Query  544  aglassaagfaCLVFALGKLMNVKEDNSQLSAIARQGSGSACRSLFGGFVKWIMGKEEDG  723
            AGLASSAAGFACLVFAL KLMNV ED SQLSAIARQGSGSACRSLFGGFVKW MG +EDG
Sbjct  124  AGLASSAAGFACLVFALAKLMNVNEDPSQLSAIARQGSGSACRSLFGGFVKWNMGNKEDG  183

Query  724  SDSLAVQLVD  753
            SDS+AVQLVD
Sbjct  184  SDSVAVQLVD  193



>ref|XP_010509167.1| PREDICTED: diphosphomevalonate decarboxylase-like [Camelina sativa]
Length=412

 Score =   301 bits (772),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 164/190 (86%), Positives = 176/190 (93%), Gaps = 0/190 (0%)
 Frame = +1

Query  184  EKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQD  363
            EKWV+MVTAQTPTNIAVIKYWGKRDE  ILPINDSISVTLDP HLCT TTVAVSP+FD+D
Sbjct  4    EKWVMMVTAQTPTNIAVIKYWGKRDEVRILPINDSISVTLDPDHLCTLTTVAVSPSFDRD  63

Query  364  RMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTa  543
            RMWLNGKE+SLSG RYQNCL+EIR+R  DVED++KGIKI KKDWE LH+HIAS+NNFPTA
Sbjct  64   RMWLNGKEISLSGSRYQNCLREIRSRGDDVEDKEKGIKIEKKDWEKLHLHIASHNNFPTA  123

Query  544  aglassaagfaCLVFALGKLMNVKEDNSQLSAIARQGSGSACRSLFGGFVKWIMGKEEDG  723
            AGLASSAAGFACLVFAL KLMNV ED SQLSAIARQGSGSACRSLFGGFVKW MG +EDG
Sbjct  124  AGLASSAAGFACLVFALAKLMNVNEDPSQLSAIARQGSGSACRSLFGGFVKWNMGNKEDG  183

Query  724  SDSLAVQLVD  753
            SDS+AVQLVD
Sbjct  184  SDSVAVQLVD  193



>gb|ACO35355.1| mevalonate pyrophosphate decarboxylase [Elaeis oleifera]
Length=206

 Score =   294 bits (753),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 150/189 (79%), Positives = 165/189 (87%), Gaps = 0/189 (0%)
 Frame = +1

Query  184  EKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQD  363
            + WVLM TA+ PTNIAVIKYWGKRDE LILPINDSISVTLDP HL  TTTVAVSP+F QD
Sbjct  6    QSWVLMATARAPTNIAVIKYWGKRDEALILPINDSISVTLDPDHLSATTTVAVSPSFKQD  65

Query  364  RMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTa  543
            RMWLNGKE+SLSG RYQNCL+EIR RA DVEDEKKGI+I K+DWE +H+HIASYNNFPTA
Sbjct  66   RMWLNGKEISLSGGRYQNCLREIRKRAGDVEDEKKGIRIKKEDWEKMHLHIASYNNFPTA  125

Query  544  aglassaagfaCLVFALGKLMNVKEDNSQLSAIARQGSGSACRSLFGGFVKWIMGKEEDG  723
            AGLASSAAGFACLVF   KLMNVKE++   SAIARQGSGSAC S++GGFVKW MG + DG
Sbjct  126  AGLASSAAGFACLVFTPAKLMNVKEEHGNFSAIARQGSGSACPSMYGGFVKWKMGNDADG  185

Query  724  SDSLAVQLV  750
            SDS+AVQL 
Sbjct  186  SDSIAVQLA  194



>ref|XP_008788072.1| PREDICTED: diphosphomevalonate decarboxylase-like [Phoenix dactylifera]
Length=421

 Score =   300 bits (769),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 151/188 (80%), Positives = 166/188 (88%), Gaps = 0/188 (0%)
 Frame = +1

Query  184  EKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQD  363
            + WVLM TA+ PTNIA+IKYWGKRDE LILP NDSISVTLDP HL  TTTVAVSP+F QD
Sbjct  6    QSWVLMATARAPTNIALIKYWGKRDEALILPTNDSISVTLDPDHLSATTTVAVSPSFKQD  65

Query  364  RMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTa  543
            RMWLNGKE+SLSG RYQNCL+EIR RA DVEDEKKG++I K+DWE  H+HIASYNNFPTA
Sbjct  66   RMWLNGKEISLSGGRYQNCLREIRKRAGDVEDEKKGVRIKKEDWEKFHLHIASYNNFPTA  125

Query  544  aglassaagfaCLVFALGKLMNVKEDNSQLSAIARQGSGSACRSLFGGFVKWIMGKEEDG  723
            AGLASSAAGFACLVF L KLMNVKE+N  LSAIARQGSGSACRS++GGFVKW MG + DG
Sbjct  126  AGLASSAAGFACLVFTLAKLMNVKEENGDLSAIARQGSGSACRSMYGGFVKWTMGNDADG  185

Query  724  SDSLAVQL  747
            SDS+AVQL
Sbjct  186  SDSIAVQL  193



>ref|XP_002881611.1| hypothetical protein ARALYDRAFT_482881 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57870.1| hypothetical protein ARALYDRAFT_482881 [Arabidopsis lyrata subsp. 
lyrata]
Length=412

 Score =   299 bits (766),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 162/190 (85%), Positives = 177/190 (93%), Gaps = 0/190 (0%)
 Frame = +1

Query  184  EKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQD  363
            EKWV+MVTAQTPTNIAVIKYWGKRDE  ILPINDSISVTLDP HLCT TTV+VSP+FD+D
Sbjct  4    EKWVMMVTAQTPTNIAVIKYWGKRDEVRILPINDSISVTLDPDHLCTLTTVSVSPSFDRD  63

Query  364  RMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTa  543
            RMWLNGKE+SLSG RYQNCL+EIR+RA D+ED++KGIKI KKDW+ LH+HIAS+NNFPTA
Sbjct  64   RMWLNGKEISLSGSRYQNCLREIRSRADDLEDKEKGIKIEKKDWQKLHLHIASHNNFPTA  123

Query  544  aglassaagfaCLVFALGKLMNVKEDNSQLSAIARQGSGSACRSLFGGFVKWIMGKEEDG  723
            AGLASSAAGFACLVFAL KLMNV ED SQLSAIARQGSGSACRSLFGGFVKW MG +EDG
Sbjct  124  AGLASSAAGFACLVFALAKLMNVNEDPSQLSAIARQGSGSACRSLFGGFVKWNMGNKEDG  183

Query  724  SDSLAVQLVD  753
            SDS+AVQLVD
Sbjct  184  SDSVAVQLVD  193



>gb|EAZ21434.1| hypothetical protein OsJ_05037 [Oryza sativa Japonica Group]
Length=493

 Score =   302 bits (773),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 162/245 (66%), Positives = 188/245 (77%), Gaps = 9/245 (4%)
 Frame = +1

Query  34   HSADARKK--CLYNCKDLISLVHSRSLPVSINSLCSQQRLLFFSFPFPGTMAE---KWVL  198
            HS D  +K  C+Y  + L  L+H ++ P+ +  L  +   L  +  FP   A    +WVL
Sbjct  209  HSDDYARKGVCMYTWEQLHLLIHGKN-PLVLPDLHLK---LMRADRFPSMAAAEEGQWVL  264

Query  199  MVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDRMWLN  378
            M T ++PTNIAVIKYWGKRDE LILP+NDSISVTLDP HL  TTTVAVSP+F  DRMWLN
Sbjct  265  MATGRSPTNIAVIKYWGKRDEALILPVNDSISVTLDPDHLSATTTVAVSPSFPSDRMWLN  324

Query  379  GKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTaaglas  558
            GKE+SLSG R+Q+CL+EIR RA DVEDEKKGI+I K+DW  LHVHIASYNNFPTAAGLAS
Sbjct  325  GKEISLSGGRFQSCLREIRKRAQDVEDEKKGIRIKKEDWGKLHVHIASYNNFPTAAGLAS  384

Query  559  saagfaCLVFALGKLMNVKEDNSQLSAIARQGSGSACRSLFGGFVKWIMGKEEDGSDSLA  738
            S AG  C VF LG LMNVKED  +LS+IARQGSGSACRS++GGFVKW MGK  DGSDS+A
Sbjct  385  SVAGLVCFVFTLGNLMNVKEDYGELSSIARQGSGSACRSIYGGFVKWCMGKNNDGSDSIA  444

Query  739  VQLVD  753
            VQL D
Sbjct  445  VQLAD  449



>ref|XP_002877963.1| hypothetical protein ARALYDRAFT_906831 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH54222.1| hypothetical protein ARALYDRAFT_906831 [Arabidopsis lyrata subsp. 
lyrata]
Length=419

 Score =   299 bits (766),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 161/190 (85%), Positives = 174/190 (92%), Gaps = 0/190 (0%)
 Frame = +1

Query  184  EKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQD  363
            EKWV MVTA+TPTNIAVIKYWGKRDE  ILP+NDSISVTLDP HLCT TTVAVSPAFD+D
Sbjct  4    EKWVFMVTAKTPTNIAVIKYWGKRDEVRILPVNDSISVTLDPDHLCTVTTVAVSPAFDRD  63

Query  364  RMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTa  543
            RMWLNGKE+SLSG RYQNCL+EIR+RA DVED++KGIKI KKDWE LH+HIAS+NNFPTA
Sbjct  64   RMWLNGKEISLSGSRYQNCLREIRSRAGDVEDKEKGIKIGKKDWEKLHLHIASHNNFPTA  123

Query  544  aglassaagfaCLVFALGKLMNVKEDNSQLSAIARQGSGSACRSLFGGFVKWIMGKEEDG  723
            AGLASSAAGFACLVF+L KLMNV ED S LSAIARQGSGSACRSLFGGFVKW MG +EDG
Sbjct  124  AGLASSAAGFACLVFSLAKLMNVDEDPSHLSAIARQGSGSACRSLFGGFVKWTMGSKEDG  183

Query  724  SDSLAVQLVD  753
            SDS+AVQL D
Sbjct  184  SDSVAVQLAD  193



>ref|XP_004150845.1| PREDICTED: diphosphomevalonate decarboxylase [Cucumis sativus]
 gb|KGN52198.1| hypothetical protein Csa_5G615210 [Cucumis sativus]
Length=424

 Score =   299 bits (765),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 160/191 (84%), Positives = 175/191 (92%), Gaps = 0/191 (0%)
 Frame = +1

Query  181  AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  360
             +KWVL+ TAQTPTNIAVIKYWGKRDE LILP+NDSISVTLDP+HLCT TTVAVSP F++
Sbjct  9    GQKWVLLTTAQTPTNIAVIKYWGKRDEDLILPVNDSISVTLDPSHLCTITTVAVSPNFEK  68

Query  361  DRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPT  540
            DRMWLN KE+SLSG RYQNCL+EIR+RA DVED++KGIKI KKDWE LHV+I SYNNFPT
Sbjct  69   DRMWLNRKEISLSGARYQNCLREIRSRANDVEDKEKGIKIEKKDWEKLHVYIDSYNNFPT  128

Query  541  aaglassaagfaCLVFALGKLMNVKEDNSQLSAIARQGSGSACRSLFGGFVKWIMGKEED  720
            AAGLASSAAG ACLVFAL  LMNVKED+SQLSAIARQGSGSACRSL+GGFVKW MGKE+D
Sbjct  129  AAGLASSAAGLACLVFALANLMNVKEDHSQLSAIARQGSGSACRSLYGGFVKWCMGKEKD  188

Query  721  GSDSLAVQLVD  753
            GSDSLAVQL D
Sbjct  189  GSDSLAVQLAD  199



>ref|XP_010427097.1| PREDICTED: diphosphomevalonate decarboxylase-like [Camelina sativa]
 ref|XP_010427098.1| PREDICTED: diphosphomevalonate decarboxylase-like [Camelina sativa]
Length=419

 Score =   298 bits (763),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 161/190 (85%), Positives = 174/190 (92%), Gaps = 0/190 (0%)
 Frame = +1

Query  184  EKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQD  363
            EKWV MVTAQTPTNIAVIKYWGKRDE  ILP+NDSISVTLDP HLCT TTVAVSPAFD+D
Sbjct  4    EKWVFMVTAQTPTNIAVIKYWGKRDEVRILPVNDSISVTLDPDHLCTVTTVAVSPAFDRD  63

Query  364  RMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTa  543
            RMWLNGKE+SLSG RYQNCL+EIR+RA DVED++KGIKI KKDWE LH+HIAS+NNFPTA
Sbjct  64   RMWLNGKEISLSGSRYQNCLREIRSRAGDVEDKEKGIKIGKKDWEKLHLHIASHNNFPTA  123

Query  544  aglassaagfaCLVFALGKLMNVKEDNSQLSAIARQGSGSACRSLFGGFVKWIMGKEEDG  723
            AGLASSAAGFACLVF+L KLMNV ED S LSAIARQGSGSACRSLFGGFVKW MG ++DG
Sbjct  124  AGLASSAAGFACLVFSLAKLMNVDEDPSHLSAIARQGSGSACRSLFGGFVKWEMGSKDDG  183

Query  724  SDSLAVQLVD  753
            SDS+AVQL D
Sbjct  184  SDSVAVQLAD  193



>gb|EMT01953.1| Diphosphomevalonate decarboxylase [Aegilops tauschii]
Length=456

 Score =   299 bits (765),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 151/189 (80%), Positives = 168/189 (89%), Gaps = 0/189 (0%)
 Frame = +1

Query  187  KWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDR  366
            +WVL  T ++PTNIAVIKYWGKRDE LILP+NDSISVTLDP HL  TTTVA SPAF  DR
Sbjct  8    QWVLTATGRSPTNIAVIKYWGKRDEALILPVNDSISVTLDPDHLSATTTVAASPAFPSDR  67

Query  367  MWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTaa  546
            MWLNGKE++LSG R+Q+CL+EIR RA DVEDEK+GIKI K+DWE LHVHIASYNNFPTAA
Sbjct  68   MWLNGKEIALSGGRFQSCLREIRKRARDVEDEKRGIKIKKEDWEKLHVHIASYNNFPTAA  127

Query  547  glassaagfaCLVFALGKLMNVKEDNSQLSAIARQGSGSACRSLFGGFVKWIMGKEEDGS  726
            GLASSAAGFACLVF LGKLMNV ED  +LS+IARQGSGSACRS++GGFVKW MGK +DGS
Sbjct  128  GLASSAAGFACLVFTLGKLMNVNEDYGELSSIARQGSGSACRSIYGGFVKWCMGKSDDGS  187

Query  727  DSLAVQLVD  753
            DS+AVQLVD
Sbjct  188  DSMAVQLVD  196



>dbj|BAD27942.1| putative mevalonate disphosphate decarboxylase [Oryza sativa 
Japonica Group]
 dbj|BAH01424.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE56155.1| hypothetical protein OsJ_05052 [Oryza sativa Japonica Group]
Length=421

 Score =   298 bits (762),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 149/189 (79%), Positives = 167/189 (88%), Gaps = 0/189 (0%)
 Frame = +1

Query  187  KWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDR  366
            +WVLM T ++PTNIAVIKYWGKRDE LILP+NDSISVTLDP HL  TTTVAVSP+F  DR
Sbjct  8    QWVLMATGRSPTNIAVIKYWGKRDEALILPVNDSISVTLDPDHLSATTTVAVSPSFPSDR  67

Query  367  MWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTaa  546
            MWLNGKE+SLSG R+Q+CL+EIR RA DVEDEKKGI+I K+DW  LHVHIAS+NNFPTAA
Sbjct  68   MWLNGKEISLSGGRFQSCLREIRKRAQDVEDEKKGIRIKKEDWGKLHVHIASFNNFPTAA  127

Query  547  glassaagfaCLVFALGKLMNVKEDNSQLSAIARQGSGSACRSLFGGFVKWIMGKEEDGS  726
            GLASSAAG AC VF LGKLMNVKED+ +LS+IARQGSGSACRS++GGFVKW MGK  DGS
Sbjct  128  GLASSAAGLACFVFTLGKLMNVKEDHGELSSIARQGSGSACRSIYGGFVKWCMGKNNDGS  187

Query  727  DSLAVQLVD  753
            DS+AVQL D
Sbjct  188  DSIAVQLAD  196



>gb|EEC72312.1| hypothetical protein OsI_05503 [Oryza sativa Indica Group]
Length=311

 Score =   294 bits (752),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 147/189 (78%), Positives = 163/189 (86%), Gaps = 0/189 (0%)
 Frame = +1

Query  187  KWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDR  366
            +WVLM T ++PTNIAVIKYWGKRDE LILP+NDSISVTLDP HL  TTTVAVSP+F  DR
Sbjct  8    QWVLMATGRSPTNIAVIKYWGKRDEALILPVNDSISVTLDPDHLSATTTVAVSPSFPSDR  67

Query  367  MWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTaa  546
            MWLNGKE+SLSG R+Q+CL+EIR RA DVEDEKKGI+I K+DW  LHVHIASYNNFPTAA
Sbjct  68   MWLNGKEISLSGGRFQSCLREIRKRAQDVEDEKKGIRIKKEDWGKLHVHIASYNNFPTAA  127

Query  547  glassaagfaCLVFALGKLMNVKEDNSQLSAIARQGSGSACRSLFGGFVKWIMGKEEDGS  726
            GLASS AG  C VF LG LMNVKED  +LS+IARQGSGSACRS++GGFVKW MGK  DGS
Sbjct  128  GLASSVAGLVCFVFTLGNLMNVKEDYGELSSIARQGSGSACRSIYGGFVKWCMGKNNDGS  187

Query  727  DSLAVQLVD  753
            DS+AVQL D
Sbjct  188  DSIAVQLAD  196



>ref|XP_006291202.1| hypothetical protein CARUB_v10017330mg [Capsella rubella]
 gb|EOA24100.1| hypothetical protein CARUB_v10017330mg [Capsella rubella]
Length=419

 Score =   297 bits (761),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 160/191 (84%), Positives = 175/191 (92%), Gaps = 0/191 (0%)
 Frame = +1

Query  181  AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  360
            +EKWV MVTAQTPTNIAVIKYWGKRDE  ILP+NDSISVTLDP HLCT TTVAVSPAFD+
Sbjct  3    SEKWVFMVTAQTPTNIAVIKYWGKRDEVRILPVNDSISVTLDPDHLCTVTTVAVSPAFDR  62

Query  361  DRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPT  540
            DRMWLNGKE+SLSG RYQNCL+EIR+RA DV+D++KGIKI KKDWE LH+HIAS+NNFPT
Sbjct  63   DRMWLNGKEISLSGSRYQNCLREIRSRAGDVDDKEKGIKIGKKDWEKLHLHIASHNNFPT  122

Query  541  aaglassaagfaCLVFALGKLMNVKEDNSQLSAIARQGSGSACRSLFGGFVKWIMGKEED  720
            AAGLASSAAGFACLVF+L KLMNV ED S LSAIARQGSGSACRSLFGGFVKW MG ++D
Sbjct  123  AAGLASSAAGFACLVFSLAKLMNVDEDASHLSAIARQGSGSACRSLFGGFVKWEMGSKDD  182

Query  721  GSDSLAVQLVD  753
            GSDS+AVQL D
Sbjct  183  GSDSVAVQLAD  193



>ref|XP_010504223.1| PREDICTED: diphosphomevalonate decarboxylase-like [Camelina sativa]
 ref|XP_010504224.1| PREDICTED: diphosphomevalonate decarboxylase-like [Camelina sativa]
 ref|XP_010504225.1| PREDICTED: diphosphomevalonate decarboxylase-like [Camelina sativa]
Length=419

 Score =   296 bits (759),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 160/190 (84%), Positives = 174/190 (92%), Gaps = 0/190 (0%)
 Frame = +1

Query  184  EKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQD  363
            EKWV MVTAQTPTNIAVIKYWGKRDE  ILP+NDSISVTLDP HLCT TTVAVSPAFD+D
Sbjct  4    EKWVFMVTAQTPTNIAVIKYWGKRDEVRILPVNDSISVTLDPDHLCTVTTVAVSPAFDRD  63

Query  364  RMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTa  543
            RMWLNGKE+SL+G RYQNCL+EIR+RA DVED++KGIKI KKDWE LH+HIAS+NNFPTA
Sbjct  64   RMWLNGKEISLTGSRYQNCLREIRSRADDVEDKEKGIKIGKKDWEKLHLHIASHNNFPTA  123

Query  544  aglassaagfaCLVFALGKLMNVKEDNSQLSAIARQGSGSACRSLFGGFVKWIMGKEEDG  723
            AGLASSAAGFACLVF+L KLMNV ED S LSAIARQGSGSACRSLFGGFVKW MG ++DG
Sbjct  124  AGLASSAAGFACLVFSLAKLMNVDEDPSHLSAIARQGSGSACRSLFGGFVKWEMGSKDDG  183

Query  724  SDSLAVQLVD  753
            SDS+AVQL D
Sbjct  184  SDSVAVQLAD  193



>emb|CDM86983.1| unnamed protein product [Triticum aestivum]
Length=419

 Score =   295 bits (756),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 150/189 (79%), Positives = 167/189 (88%), Gaps = 0/189 (0%)
 Frame = +1

Query  187  KWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDR  366
            +WVL  T ++PTNIAVIKYWGKRD+ LILP+NDSISVTLDP HL  TTTVA SPAF  DR
Sbjct  6    QWVLTATGRSPTNIAVIKYWGKRDDALILPVNDSISVTLDPDHLSATTTVAASPAFPSDR  65

Query  367  MWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTaa  546
            MWLNGKE++LSG R+Q+CL+EIR RA DVEDEK+GIKI K+DWE LHVHIASYNNFPTAA
Sbjct  66   MWLNGKEIALSGGRFQSCLREIRKRARDVEDEKRGIKIKKEDWEKLHVHIASYNNFPTAA  125

Query  547  glassaagfaCLVFALGKLMNVKEDNSQLSAIARQGSGSACRSLFGGFVKWIMGKEEDGS  726
            GLASSAAGFACLVF LGKLMNV ED  +LS+IARQGSGSACRS +GGFVKW MGK +DGS
Sbjct  126  GLASSAAGFACLVFTLGKLMNVNEDYGELSSIARQGSGSACRSTYGGFVKWCMGKNDDGS  185

Query  727  DSLAVQLVD  753
            DS+AVQLVD
Sbjct  186  DSMAVQLVD  194



>ref|XP_006646770.1| PREDICTED: diphosphomevalonate decarboxylase-like [Oryza brachyantha]
Length=419

 Score =   295 bits (754),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 151/189 (80%), Positives = 169/189 (89%), Gaps = 1/189 (1%)
 Frame = +1

Query  187  KWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDR  366
            +WVLM T ++PTNIAVIKYWGKRDE LILP+NDSISVTLDP HL  TTTVAVSP+F  DR
Sbjct  7    QWVLMATGRSPTNIAVIKYWGKRDEALILPVNDSISVTLDPDHLSATTTVAVSPSFPSDR  66

Query  367  MWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTaa  546
            MWLNG+E+SLSG R+Q+CL+EIR RA DVEDE KGI+I K+DWE LHVHIASYNNFPTAA
Sbjct  67   MWLNGQEISLSGGRFQSCLREIRKRAQDVEDE-KGIRIKKEDWEKLHVHIASYNNFPTAA  125

Query  547  glassaagfaCLVFALGKLMNVKEDNSQLSAIARQGSGSACRSLFGGFVKWIMGKEEDGS  726
            GLASSAAGFACLVF LGKLMNVKED  +LS+IARQGSGSACRS++GGFVKW MGK +DGS
Sbjct  126  GLASSAAGFACLVFTLGKLMNVKEDYGELSSIARQGSGSACRSIYGGFVKWCMGKNDDGS  185

Query  727  DSLAVQLVD  753
            DS+AVQL D
Sbjct  186  DSIAVQLAD  194



>ref|XP_008665378.1| PREDICTED: diphosphomevalonate decarboxylase-like isoform X2 
[Zea mays]
 gb|ACF86239.1| unknown [Zea mays]
 gb|ACN26377.1| unknown [Zea mays]
 tpg|DAA51251.1| TPA: hypothetical protein ZEAMMB73_408503 [Zea mays]
Length=420

 Score =   293 bits (749),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 147/189 (78%), Positives = 167/189 (88%), Gaps = 0/189 (0%)
 Frame = +1

Query  187  KWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDR  366
            +WVLM T +TPTNIAVIKYWGKRDE LILPINDSISVTLDP HL  TTTVAVSP+F  DR
Sbjct  7    QWVLMATGRTPTNIAVIKYWGKRDEALILPINDSISVTLDPDHLSATTTVAVSPSFPSDR  66

Query  367  MWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTaa  546
            MWLNGKE+SL G R+Q+CL+EIR RA D ED++KG+KI K+DW+ LHVHIASYNNFPTAA
Sbjct  67   MWLNGKEISLLGGRFQSCLREIRKRARDFEDKEKGVKIKKEDWDKLHVHIASYNNFPTAA  126

Query  547  glassaagfaCLVFALGKLMNVKEDNSQLSAIARQGSGSACRSLFGGFVKWIMGKEEDGS  726
            GLASSAAG AC VF LGKLMNVKED  +LS+IARQGSGSACRS++GGFVKW MG+++DGS
Sbjct  127  GLASSAAGLACFVFTLGKLMNVKEDYGELSSIARQGSGSACRSIYGGFVKWCMGEKDDGS  186

Query  727  DSLAVQLVD  753
            DS+AVQL D
Sbjct  187  DSIAVQLAD  195



>gb|KFK34679.1| hypothetical protein AALP_AA5G177200 [Arabis alpina]
Length=419

 Score =   292 bits (748),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 159/191 (83%), Positives = 173/191 (91%), Gaps = 0/191 (0%)
 Frame = +1

Query  181  AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  360
            AEKW+ MVTAQTPTNIAVIKYWGKRDE  ILP+NDSISVTLDP HLCT TTVAVSPAFD+
Sbjct  3    AEKWIFMVTAQTPTNIAVIKYWGKRDEVRILPVNDSISVTLDPDHLCTVTTVAVSPAFDR  62

Query  361  DRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPT  540
            DRMWLNGKE+SLSG RYQNCL+EIR+ A DVED++K IKI KKDWE L++HIAS+NNFPT
Sbjct  63   DRMWLNGKEISLSGSRYQNCLREIRSCAGDVEDKEKNIKIEKKDWEKLNLHIASHNNFPT  122

Query  541  aaglassaagfaCLVFALGKLMNVKEDNSQLSAIARQGSGSACRSLFGGFVKWIMGKEED  720
            AAGLASSAAGFACLVF+L KLMNV ED S LSAIARQGSGSACRSLFGGFVKW MG +ED
Sbjct  123  AAGLASSAAGFACLVFSLAKLMNVDEDLSHLSAIARQGSGSACRSLFGGFVKWKMGSKED  182

Query  721  GSDSLAVQLVD  753
            GSDS+AVQL D
Sbjct  183  GSDSVAVQLED  193



>ref|XP_002452980.1| hypothetical protein SORBIDRAFT_04g035950 [Sorghum bicolor]
 gb|EES05956.1| hypothetical protein SORBIDRAFT_04g035950 [Sorghum bicolor]
Length=420

 Score =   292 bits (747),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 146/189 (77%), Positives = 166/189 (88%), Gaps = 0/189 (0%)
 Frame = +1

Query  187  KWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDR  366
            +W+LM T +TPTNIAVIKYWGKRDE LILP+NDSISVTLDP HL  TTTVAVSP+F  DR
Sbjct  7    QWLLMATGRTPTNIAVIKYWGKRDEALILPVNDSISVTLDPDHLSATTTVAVSPSFPSDR  66

Query  367  MWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTaa  546
            MWLNGKE+SL G R+Q+CL+EIR RA D EDE+KG+KI K+DW  LHVHIASYNNFPTAA
Sbjct  67   MWLNGKEISLLGGRFQSCLREIRKRARDFEDEEKGVKIKKEDWGKLHVHIASYNNFPTAA  126

Query  547  glassaagfaCLVFALGKLMNVKEDNSQLSAIARQGSGSACRSLFGGFVKWIMGKEEDGS  726
            GLASSAAG AC VF LGKLMNVKED  +LS+IARQGSGSACRS++GGFVKW MG+++DGS
Sbjct  127  GLASSAAGLACFVFTLGKLMNVKEDYGELSSIARQGSGSACRSIYGGFVKWCMGEKDDGS  186

Query  727  DSLAVQLVD  753
            DS+AVQL D
Sbjct  187  DSIAVQLAD  195



>ref|NP_001149256.1| LOC100282878 [Zea mays]
 ref|XP_008643692.1| PREDICTED: LOC100282878 isoform X1 [Zea mays]
 gb|ACG34742.1| diphosphomevalonate decarboxylase [Zea mays]
 gb|ACR36666.1| unknown [Zea mays]
 gb|AFW73865.1| diphosphomevalonate decarboxylase [Zea mays]
Length=420

 Score =   291 bits (746),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 146/189 (77%), Positives = 166/189 (88%), Gaps = 0/189 (0%)
 Frame = +1

Query  187  KWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDR  366
            +WVLM T +TPTNIAVIKYWGKRDE LILPINDSISVTLDP HL  TTTVAVSP+F  DR
Sbjct  7    QWVLMATGRTPTNIAVIKYWGKRDEALILPINDSISVTLDPDHLSATTTVAVSPSFPSDR  66

Query  367  MWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTaa  546
            MWLNGKE+SL G R+Q+CL+EIR RA D ED++KG+KI K+DW+ LHVHIASYNNFPTAA
Sbjct  67   MWLNGKEISLLGGRFQSCLREIRKRARDFEDKEKGVKIKKEDWDKLHVHIASYNNFPTAA  126

Query  547  glassaagfaCLVFALGKLMNVKEDNSQLSAIARQGSGSACRSLFGGFVKWIMGKEEDGS  726
            GLASSAAG AC VF LGKLMN KED  +LS+IARQGSGSACRS++GGFVKW MG+++DGS
Sbjct  127  GLASSAAGLACFVFTLGKLMNAKEDYGELSSIARQGSGSACRSIYGGFVKWCMGEKDDGS  186

Query  727  DSLAVQLVD  753
            DS+AVQL D
Sbjct  187  DSIAVQLAD  195



>ref|XP_008665377.1| PREDICTED: diphosphomevalonate decarboxylase-like isoform X1 
[Zea mays]
Length=497

 Score =   294 bits (752),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 150/196 (77%), Positives = 170/196 (87%), Gaps = 1/196 (1%)
 Frame = +1

Query  169  PGTMAE-KWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVS  345
            P   AE +WVLM T +TPTNIAVIKYWGKRDE LILPINDSISVTLDP HL  TTTVAVS
Sbjct  77   PMAAAEGQWVLMATGRTPTNIAVIKYWGKRDEALILPINDSISVTLDPDHLSATTTVAVS  136

Query  346  PAFDQDRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASY  525
            P+F  DRMWLNGKE+SL G R+Q+CL+EIR RA D ED++KG+KI K+DW+ LHVHIASY
Sbjct  137  PSFPSDRMWLNGKEISLLGGRFQSCLREIRKRARDFEDKEKGVKIKKEDWDKLHVHIASY  196

Query  526  NNFPTaaglassaagfaCLVFALGKLMNVKEDNSQLSAIARQGSGSACRSLFGGFVKWIM  705
            NNFPTAAGLASSAAG AC VF LGKLMNVKED  +LS+IARQGSGSACRS++GGFVKW M
Sbjct  197  NNFPTAAGLASSAAGLACFVFTLGKLMNVKEDYGELSSIARQGSGSACRSIYGGFVKWCM  256

Query  706  GKEEDGSDSLAVQLVD  753
            G+++DGSDS+AVQL D
Sbjct  257  GEKDDGSDSIAVQLAD  272



>ref|XP_009404708.1| PREDICTED: diphosphomevalonate decarboxylase-like [Musa acuminata 
subsp. malaccensis]
Length=421

 Score =   290 bits (741),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 147/188 (78%), Positives = 163/188 (87%), Gaps = 0/188 (0%)
 Frame = +1

Query  184  EKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQD  363
            E W+LM T +TPTNIAVIKYWGKRDE LILP+NDSISVTLDP HL  TTTVAVSP FD+D
Sbjct  6    ESWILMATGRTPTNIAVIKYWGKRDEALILPVNDSISVTLDPDHLSATTTVAVSPTFDRD  65

Query  364  RMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTa  543
            RMWLNGKE+ LSG R+Q+CL+EIR  A DVEDEKKGI+I K DW+ LHVHIASYNNFPTA
Sbjct  66   RMWLNGKEIPLSGDRFQSCLREIRKLADDVEDEKKGIRIRKDDWQKLHVHIASYNNFPTA  125

Query  544  aglassaagfaCLVFALGKLMNVKEDNSQLSAIARQGSGSACRSLFGGFVKWIMGKEEDG  723
            AGLASSAAG AC VF L KLMNVKED  +LS+IARQGSGSACRS++GGFVKW MGK+  G
Sbjct  126  AGLASSAAGLACFVFTLAKLMNVKEDCGKLSSIARQGSGSACRSMYGGFVKWTMGKDACG  185

Query  724  SDSLAVQL  747
            SDS+AVQL
Sbjct  186  SDSIAVQL  193



>gb|AEA72605.1| mevalonate 5-diphosphate decarboxylase [Houttuynia cordata]
Length=421

 Score =   289 bits (740),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 150/189 (79%), Positives = 168/189 (89%), Gaps = 0/189 (0%)
 Frame = +1

Query  181  AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  360
            ++ W+LMVTA++PTNIAVIKYWGKRDE+LILPINDSISVTLDP HLCTTTTVAVSP+F  
Sbjct  6    SKDWILMVTAKSPTNIAVIKYWGKRDESLILPINDSISVTLDPDHLCTTTTVAVSPSFRS  65

Query  361  DRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPT  540
            DRMWLNGKE+SL+G RYQNCL+EIR+RA   EDEKKGI I K+DWENLH+HIASYNNFPT
Sbjct  66   DRMWLNGKEISLAGGRYQNCLREIRSRASCFEDEKKGISIRKEDWENLHLHIASYNNFPT  125

Query  541  aaglassaagfaCLVFALGKLMNVKEDNSQLSAIARQGSGSACRSLFGGFVKWIMGKEED  720
            AAGLASSAAGFACLVFALG LM VKED   +SAIARQGSGSACRSL+GGFVKW  G +  
Sbjct  126  AAGLASSAAGFACLVFALGNLMCVKEDLGAISAIARQGSGSACRSLYGGFVKWNTGYDVS  185

Query  721  GSDSLAVQL  747
            G DS+A+QL
Sbjct  186  GRDSIAMQL  194



>gb|EEC72316.1| hypothetical protein OsI_05509 [Oryza sativa Indica Group]
Length=188

 Score =   276 bits (707),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 137/175 (78%), Positives = 152/175 (87%), Gaps = 0/175 (0%)
 Frame = +1

Query  187  KWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDR  366
            +WVLM T ++PTNIAVIKYWGKRDE LILP+NDSISVTLDP HL  TTTVAVSP+F  DR
Sbjct  8    QWVLMATGRSPTNIAVIKYWGKRDEALILPVNDSISVTLDPDHLSATTTVAVSPSFPSDR  67

Query  367  MWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTaa  546
            MWLNGKE+SLSG R+Q+CL+EIR RA DVEDEKKGI+I K+DW  LHVHIASYNNFPTAA
Sbjct  68   MWLNGKEISLSGGRFQSCLREIRKRAQDVEDEKKGIRIKKEDWGKLHVHIASYNNFPTAA  127

Query  547  glassaagfaCLVFALGKLMNVKEDNSQLSAIARQGSGSACRSLFGGFVKWIMGK  711
            GLASS AG  C VF LG LMNVKED  +LS+IARQGSGSACRS++GGFVKW MGK
Sbjct  128  GLASSVAGLVCFVFTLGNLMNVKEDYGELSSIARQGSGSACRSIYGGFVKWCMGK  182



>ref|XP_006836043.1| PREDICTED: diphosphomevalonate decarboxylase [Amborella trichopoda]
 gb|ERM98896.1| hypothetical protein AMTR_s00114p00051110 [Amborella trichopoda]
Length=419

 Score =   281 bits (720),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 149/185 (81%), Positives = 165/185 (89%), Gaps = 1/185 (1%)
 Frame = +1

Query  193  VLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDRMW  372
            +LMVTA+ PTNIAVIKYWGKRDE+LILPINDSISVTLDP HLCTTTTVAVSP F+ DRMW
Sbjct  9    MLMVTARAPTNIAVIKYWGKRDESLILPINDSISVTLDPDHLCTTTTVAVSPNFESDRMW  68

Query  373  LNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTaagl  552
            LNGKE+SLSG RYQ+CLKEIR +A DV DE KGI I  +DW+ LHVHIASYNNFPTAAGL
Sbjct  69   LNGKEISLSGGRYQSCLKEIRQQAGDVIDENKGICIKGEDWQKLHVHIASYNNFPTAAGL  128

Query  553  assaagfaCLVFALGKLMNVKEDNSQLSAIARQGSGSACRSLFGGFVKWIMGKEEDGSDS  732
            ASSAAGFACLV+AL KLMNVKE   +LSAIARQGSGSACRSL+GGFVKW MG + +GSDS
Sbjct  129  ASSAAGFACLVYALSKLMNVKE-QYELSAIARQGSGSACRSLYGGFVKWAMGNDVNGSDS  187

Query  733  LAVQL  747
            +A+QL
Sbjct  188  IAIQL  192



>ref|XP_003565147.1| PREDICTED: diphosphomevalonate decarboxylase-like [Brachypodium 
distachyon]
Length=417

 Score =   281 bits (719),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 154/192 (80%), Positives = 171/192 (89%), Gaps = 0/192 (0%)
 Frame = +1

Query  178  MAEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFD  357
            MA +W+LM T +TPTNIAVIKYWGKRDE LILP+NDSISVTLDP HL  TTTVAVSP+F 
Sbjct  1    MAAEWLLMATGRTPTNIAVIKYWGKRDEALILPVNDSISVTLDPDHLSATTTVAVSPSFP  60

Query  358  QDRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFP  537
             DRMWLNGKE++LSG R+Q+CL+EIR RA DVEDEKKGIKI K+DWE LHVHIASYNNFP
Sbjct  61   SDRMWLNGKEIALSGGRFQSCLREIRKRARDVEDEKKGIKIKKEDWEKLHVHIASYNNFP  120

Query  538  TaaglassaagfaCLVFALGKLMNVKEDNSQLSAIARQGSGSACRSLFGGFVKWIMGKEE  717
            TAAGLASSAAG ACLVF LGKLMNVKED  +LS+IARQGSGSACRS++GGFVKW MGK +
Sbjct  121  TAAGLASSAAGLACLVFTLGKLMNVKEDYGELSSIARQGSGSACRSIYGGFVKWCMGKND  180

Query  718  DGSDSLAVQLVD  753
            DGSDS+AVQL D
Sbjct  181  DGSDSIAVQLAD  192



>gb|ACN41090.1| unknown [Picea sitchensis]
Length=422

 Score =   281 bits (719),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 146/193 (76%), Positives = 165/193 (85%), Gaps = 1/193 (1%)
 Frame = +1

Query  172  GTMAEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPA  351
            G   ++W+LMVTA+ PTNIAVIKYWGKRDE LILPINDSIS TLDP HL  TTTVAVSP+
Sbjct  2    GEELQRWILMVTARAPTNIAVIKYWGKRDEKLILPINDSISFTLDPDHLSATTTVAVSPS  61

Query  352  FDQDRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNN  531
            F  DRMWLNGKE+SL G RYQNCL+EIR+R  DV DEK GI I K+DW+ LH+HIASYNN
Sbjct  62   FTSDRMWLNGKEVSLGGERYQNCLREIRSRGNDVVDEKNGIVIRKEDWQRLHLHIASYNN  121

Query  532  FPTaaglassaagfaCLVFALGKLMNVKED-NSQLSAIARQGSGSACRSLFGGFVKWIMG  708
            FPTAAGLASSAAGFACLV++L KLM+VKE    +L+AIAR+GSGSACRSL+GG VKW MG
Sbjct  122  FPTAAGLASSAAGFACLVYSLAKLMDVKEKYQGELTAIARRGSGSACRSLYGGVVKWQMG  181

Query  709  KEEDGSDSLAVQL  747
            KE DGSDS+AVQL
Sbjct  182  KETDGSDSIAVQL  194



>ref|XP_004954217.1| PREDICTED: diphosphomevalonate decarboxylase-like [Setaria italica]
Length=420

 Score =   281 bits (718),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 154/189 (81%), Positives = 170/189 (90%), Gaps = 0/189 (0%)
 Frame = +1

Query  187  KWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDR  366
            +WVLM T ++PTNIAVIKYWGKRDE LILP+NDSISVTLDP HL  TTTVAVSP+F  DR
Sbjct  7    QWVLMATGRSPTNIAVIKYWGKRDEALILPVNDSISVTLDPDHLSATTTVAVSPSFPSDR  66

Query  367  MWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTaa  546
            MWLNGKE+SLSG R+Q+CL+EIR RAC+ EDEKKGIKI K+DWE LHVHIASYNNFPTAA
Sbjct  67   MWLNGKEISLSGGRFQSCLREIRKRACEFEDEKKGIKIKKEDWEKLHVHIASYNNFPTAA  126

Query  547  glassaagfaCLVFALGKLMNVKEDNSQLSAIARQGSGSACRSLFGGFVKWIMGKEEDGS  726
            GLASSAAGFACLVF LGKLMNVKED  +LS+IARQGSGSACRSL+GGFVKW MGK++DGS
Sbjct  127  GLASSAAGFACLVFTLGKLMNVKEDYGELSSIARQGSGSACRSLYGGFVKWCMGKKDDGS  186

Query  727  DSLAVQLVD  753
            DS AVQL D
Sbjct  187  DSFAVQLAD  195



>gb|AAV32433.1| mevalonate disphosphate decarboxylase [Ginkgo biloba]
Length=430

 Score =   280 bits (717),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 146/187 (78%), Positives = 163/187 (87%), Gaps = 1/187 (1%)
 Frame = +1

Query  190  WVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDRM  369
            WV MVTA+ PTNIAVIKYWGKRDE LILPINDSISVTLDP HL  TTTVAVSP+F  DRM
Sbjct  11   WVFMVTARAPTNIAVIKYWGKRDEKLILPINDSISVTLDPDHLSATTTVAVSPSFSSDRM  70

Query  370  WLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTaag  549
            WLNGKE+SL G RYQNCL+EIR+R  DV DEK G  I K+DW+ LH+HIAS+NNFPTAAG
Sbjct  71   WLNGKEVSLGGERYQNCLREIRSRGRDVVDEKSGTLIKKEDWQTLHLHIASHNNFPTAAG  130

Query  550  lassaagfaCLVFALGKLMNVKEDNS-QLSAIARQGSGSACRSLFGGFVKWIMGKEEDGS  726
            LASSAAGFACLV+AL KLM+++E  + +LSAIARQGSGSACRSL+GGFVKW MGKE DGS
Sbjct  131  LASSAAGFACLVYALAKLMDIEERYAGELSAIARQGSGSACRSLYGGFVKWDMGKERDGS  190

Query  727  DSLAVQL  747
            DS+AVQL
Sbjct  191  DSIAVQL  197



>ref|XP_004963234.1| PREDICTED: diphosphomevalonate decarboxylase-like [Setaria italica]
Length=425

 Score =   279 bits (714),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 152/189 (80%), Positives = 170/189 (90%), Gaps = 0/189 (0%)
 Frame = +1

Query  187  KWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDR  366
            +WVLM T ++PTNIAVIKYWGKRDE LILP+NDS+SVTLDP HL  TTTVAVSP+F  DR
Sbjct  10   QWVLMATGRSPTNIAVIKYWGKRDEALILPVNDSVSVTLDPDHLSATTTVAVSPSFSSDR  69

Query  367  MWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTaa  546
            MWLNGKE+SLSG R+Q+CL+EIR RACD EDEKKGIKI K+DWE LHVHIASY NFPTAA
Sbjct  70   MWLNGKEISLSGGRFQSCLREIRKRACDFEDEKKGIKIKKEDWEKLHVHIASYKNFPTAA  129

Query  547  glassaagfaCLVFALGKLMNVKEDNSQLSAIARQGSGSACRSLFGGFVKWIMGKEEDGS  726
            GLASSAAGFACLVF LGKLMNVKED  +LS+IARQGSGSACRS++GGFVKW MGK++DGS
Sbjct  130  GLASSAAGFACLVFTLGKLMNVKEDYGELSSIARQGSGSACRSIYGGFVKWCMGKKDDGS  189

Query  727  DSLAVQLVD  753
            DS+AVQL D
Sbjct  190  DSIAVQLAD  198



>tpg|DAA51253.1| TPA: hypothetical protein ZEAMMB73_408503 [Zea mays]
Length=1460

 Score =   294 bits (752),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 150/196 (77%), Positives = 170/196 (87%), Gaps = 1/196 (1%)
 Frame = +1

Query  169   PGTMAE-KWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVS  345
             P   AE +WVLM T +TPTNIAVIKYWGKRDE LILPINDSISVTLDP HL  TTTVAVS
Sbjct  1040  PMAAAEGQWVLMATGRTPTNIAVIKYWGKRDEALILPINDSISVTLDPDHLSATTTVAVS  1099

Query  346   PAFDQDRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASY  525
             P+F  DRMWLNGKE+SL G R+Q+CL+EIR RA D ED++KG+KI K+DW+ LHVHIASY
Sbjct  1100  PSFPSDRMWLNGKEISLLGGRFQSCLREIRKRARDFEDKEKGVKIKKEDWDKLHVHIASY  1159

Query  526   NNFPTaaglassaagfaCLVFALGKLMNVKEDNSQLSAIARQGSGSACRSLFGGFVKWIM  705
             NNFPTAAGLASSAAG AC VF LGKLMNVKED  +LS+IARQGSGSACRS++GGFVKW M
Sbjct  1160  NNFPTAAGLASSAAGLACFVFTLGKLMNVKEDYGELSSIARQGSGSACRSIYGGFVKWCM  1219

Query  706   GKEEDGSDSLAVQLVD  753
             G+++DGSDS+AVQL D
Sbjct  1220  GEKDDGSDSIAVQLAD  1235



>gb|AGT17596.1| mevalonate diphosphate decarboxylase [Picrorhiza kurrooa]
Length=421

 Score =   272 bits (695),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 146/191 (76%), Positives = 164/191 (86%), Gaps = 0/191 (0%)
 Frame = +1

Query  181  AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  360
            AEKWVL VTAQTPTNIAVIKYWGK DE LILPINDSISVTLDP HLCTTT+VAVSPAF  
Sbjct  4    AEKWVLTVTAQTPTNIAVIKYWGKGDEDLILPINDSISVTLDPDHLCTTTSVAVSPAFTH  63

Query  361  DRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPT  540
            DRMWLNGKE+SLSG R+QNCL+E+R+ A DVEDEK+G+  + K   +LHVH+    +FPT
Sbjct  64   DRMWLNGKEVSLSGGRFQNCLREVRSCANDVEDEKEGVLKSLKGLGDLHVHMCPTIDFPT  123

Query  541  aaglassaagfaCLVFALGKLMNVKEDNSQLSAIARQGSGSACRSLFGGFVKWIMGKEED  720
            AAGLASSAAG ACLVF+L KLMNVKED+S+LSAIARQGSGSACRSL+GGFV     KEE+
Sbjct  124  AAGLASSAAGLACLVFSLAKLMNVKEDHSRLSAIARQGSGSACRSLYGGFVNGSFLKEEN  183

Query  721  GSDSLAVQLVD  753
            GSDS+AVQL D
Sbjct  184  GSDSIAVQLAD  194



>ref|XP_010067138.1| PREDICTED: diphosphomevalonate decarboxylase-like isoform X2 
[Eucalyptus grandis]
Length=354

 Score =   269 bits (688),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 138/193 (72%), Positives = 162/193 (84%), Gaps = 1/193 (1%)
 Frame = +1

Query  178  MAEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFD  357
            M  +WVLMVTA+ P+NI+VIKYWGKR+E LIL +N+SIS+TLD  HLC TTTVAVSP F+
Sbjct  1    MEGEWVLMVTAKAPSNISVIKYWGKRNEALILAVNESISITLDLDHLCATTTVAVSPKFE  60

Query  358  QDRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFP  537
            +DR+WLNGKEMSLS  RYQN L+EIR+R  + ED++KGIKI K+DW  LH HIAS+NNFP
Sbjct  61   KDRLWLNGKEMSLSSDRYQNTLREIRSRGDNFEDDEKGIKIMKEDWMRLHFHIASHNNFP  120

Query  538  TaaglassaagfaCLVFALGKLMNVKEDNSQLSAIARQGSGSACRSLFGGFVKWIMGKEE  717
            T  GLASSAAGFACLVFAL KLMNVK+D SQLS +AR GSGSACRSL GGFVKW++GK+E
Sbjct  121  TGTGLASSAAGFACLVFALAKLMNVKDDMSQLSTVARLGSGSACRSLHGGFVKWVLGKDE  180

Query  718  -DGSDSLAVQLVD  753
              G DS A+QL D
Sbjct  181  KKGKDSFAIQLED  193



>ref|XP_010067136.1| PREDICTED: diphosphomevalonate decarboxylase-like isoform X1 
[Eucalyptus grandis]
 ref|XP_010067137.1| PREDICTED: diphosphomevalonate decarboxylase-like isoform X1 
[Eucalyptus grandis]
 gb|KCW65201.1| hypothetical protein EUGRSUZ_G02693 [Eucalyptus grandis]
Length=419

 Score =   268 bits (685),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 138/193 (72%), Positives = 162/193 (84%), Gaps = 1/193 (1%)
 Frame = +1

Query  178  MAEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFD  357
            M  +WVLMVTA+ P+NI+VIKYWGKR+E LIL +N+SIS+TLD  HLC TTTVAVSP F+
Sbjct  1    MEGEWVLMVTAKAPSNISVIKYWGKRNEALILAVNESISITLDLDHLCATTTVAVSPKFE  60

Query  358  QDRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFP  537
            +DR+WLNGKEMSLS  RYQN L+EIR+R  + ED++KGIKI K+DW  LH HIAS+NNFP
Sbjct  61   KDRLWLNGKEMSLSSDRYQNTLREIRSRGDNFEDDEKGIKIMKEDWMRLHFHIASHNNFP  120

Query  538  TaaglassaagfaCLVFALGKLMNVKEDNSQLSAIARQGSGSACRSLFGGFVKWIMGKEE  717
            T  GLASSAAGFACLVFAL KLMNVK+D SQLS +AR GSGSACRSL GGFVKW++GK+E
Sbjct  121  TGTGLASSAAGFACLVFALAKLMNVKDDMSQLSTVARLGSGSACRSLHGGFVKWVLGKDE  180

Query  718  -DGSDSLAVQLVD  753
              G DS A+QL D
Sbjct  181  KKGKDSFAIQLED  193



>ref|XP_001773902.1| predicted protein [Physcomitrella patens]
 gb|EDQ61250.1| predicted protein [Physcomitrella patens]
Length=423

 Score =   264 bits (674),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 137/195 (70%), Positives = 162/195 (83%), Gaps = 1/195 (1%)
 Frame = +1

Query  172  GTMAEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPA  351
            G   E WV+M TA+ P+NIAVIKYWGKRDE LILPIN SISVTLDP HL  TTTVA SPA
Sbjct  2    GNEEETWVVMKTARAPSNIAVIKYWGKRDEKLILPINSSISVTLDPEHLSATTTVAASPA  61

Query  352  FDQDRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNN  531
            F++DR+WLNGKE+S+ GVRY+NCL+E+RARA DV  E  G  I K+DW +LH+HIAS NN
Sbjct  62   FEKDRLWLNGKEVSVEGVRYKNCLREMRARATDVVIESSGKVIRKEDWNSLHIHIASENN  121

Query  532  FPTaaglassaagfaCLVFALGKLMNVKED-NSQLSAIARQGSGSACRSLFGGFVKWIMG  708
            FPTAAGLASSAAGFACLV+AL +LM V+E    +L+AIAR GSGSACRSL+GGFV+W MG
Sbjct  122  FPTAAGLASSAAGFACLVYALAQLMGVQEKYEGELTAIARLGSGSACRSLYGGFVEWKMG  181

Query  709  KEEDGSDSLAVQLVD  753
            +E DG+DS+AVQL +
Sbjct  182  QEIDGTDSIAVQLAE  196



>ref|XP_001774493.1| predicted protein [Physcomitrella patens]
 gb|EDQ60717.1| predicted protein [Physcomitrella patens]
Length=426

 Score =   261 bits (666),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 136/191 (71%), Positives = 158/191 (83%), Gaps = 1/191 (1%)
 Frame = +1

Query  184  EKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQD  363
            + WV+M TA+ P+NIAVIKYWGKRDE LILPIN SISVTLDP HL  TTTVA SPAF++D
Sbjct  7    DAWVVMKTARAPSNIAVIKYWGKRDEKLILPINSSISVTLDPEHLSATTTVAASPAFERD  66

Query  364  RMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTa  543
            R+WLNGKE+S+ G RY+NCL+E+RARA DV  E  G  ITK+ W  LH+HIAS NNFPTA
Sbjct  67   RLWLNGKEVSVEGERYRNCLREMRARATDVVIESSGKVITKEVWSTLHIHIASENNFPTA  126

Query  544  aglassaagfaCLVFALGKLMNVKED-NSQLSAIARQGSGSACRSLFGGFVKWIMGKEED  720
            AGLASSAAGFACLV++L +LMNVKE    +L+AIAR GSGSACRSL+GGFVKW MGKE D
Sbjct  127  AGLASSAAGFACLVYSLAQLMNVKEKYEGELTAIARLGSGSACRSLYGGFVKWNMGKEAD  186

Query  721  GSDSLAVQLVD  753
            G DS+A QL +
Sbjct  187  GKDSIATQLAE  197



>ref|XP_002979347.1| hypothetical protein SELMODRAFT_268244 [Selaginella moellendorffii]
 gb|EFJ19755.1| hypothetical protein SELMODRAFT_268244 [Selaginella moellendorffii]
Length=403

 Score =   243 bits (620),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 131/195 (67%), Positives = 154/195 (79%), Gaps = 1/195 (1%)
 Frame = +1

Query  172  GTMAEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPA  351
            GT    W++  TA+ P+NIAVIKYWGKRDE LILP+N SISVTLDP  L  TTTV+ SP 
Sbjct  2    GTDGSAWIVSRTARAPSNIAVIKYWGKRDEDLILPLNSSISVTLDPNDLSATTTVSTSPD  61

Query  352  FDQDRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNN  531
            FD DR+WLN KE+SLS  RY +CLKE+R RA DV+DEK GI ITK+DW++L +HI S NN
Sbjct  62   FDADRLWLNDKEVSLSSHRYVSCLKELRDRATDVKDEKTGIVITKEDWKHLKLHIVSKNN  121

Query  532  FPTaaglassaagfaCLVFALGKLMNVKED-NSQLSAIARQGSGSACRSLFGGFVKWIMG  708
            FPTAAGLASSAAGFACLVF + +LM +KE    +LS IAR+GSGSACRSL GGFVKW MG
Sbjct  122  FPTAAGLASSAAGFACLVFTVAQLMGIKESFPGELSTIARRGSGSACRSLHGGFVKWEMG  181

Query  709  KEEDGSDSLAVQLVD  753
            K +DG DS+AV L +
Sbjct  182  KRDDGKDSIAVPLAE  196



>ref|XP_006367129.1| PREDICTED: diphosphomevalonate decarboxylase-like [Solanum tuberosum]
Length=151

 Score =   234 bits (598),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 124/135 (92%), Positives = 130/135 (96%), Gaps = 0/135 (0%)
 Frame = +1

Query  181  AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  360
            ++KWVLMVTAQTPTNIAVIKYWGKRDE LIL INDSISVTLDPAHLCTTTTVAVSPAF+Q
Sbjct  5    SQKWVLMVTAQTPTNIAVIKYWGKRDENLILAINDSISVTLDPAHLCTTTTVAVSPAFNQ  64

Query  361  DRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPT  540
            DRMWLNGKE+SLSG RYQNCL+EIRARA DVEDEKKGIKI KKDWENLHVH+ASYNNFPT
Sbjct  65   DRMWLNGKEISLSGDRYQNCLREIRARANDVEDEKKGIKIAKKDWENLHVHVASYNNFPT  124

Query  541  aaglassaagfaCLV  585
            AAGLASSAAGFACLV
Sbjct  125  AAGLASSAAGFACLV  139



>ref|XP_002992344.1| hypothetical protein SELMODRAFT_135101 [Selaginella moellendorffii]
 gb|EFJ06620.1| hypothetical protein SELMODRAFT_135101 [Selaginella moellendorffii]
Length=403

 Score =   242 bits (617),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 131/195 (67%), Positives = 153/195 (78%), Gaps = 1/195 (1%)
 Frame = +1

Query  172  GTMAEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPA  351
            GT    W++  TA+ P+NIAVIKYWGKRDE LILP+N SISVTLDP  L  TTTV+ SP 
Sbjct  2    GTDGSAWIVSRTARAPSNIAVIKYWGKRDEDLILPLNSSISVTLDPNDLSATTTVSTSPD  61

Query  352  FDQDRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNN  531
            FD DR+WLN KE+SLS  RY +CLKE+R RA DV+DEK GI ITK+DW++L +HI S NN
Sbjct  62   FDADRLWLNDKEVSLSSHRYVSCLKELRDRATDVKDEKTGIVITKEDWKHLKLHIVSKNN  121

Query  532  FPTaaglassaagfaCLVFALGKLMNVKED-NSQLSAIARQGSGSACRSLFGGFVKWIMG  708
            FPTAAGLASSAAGFACLVF + +LM +KE    +LS IAR+GSGSACRSL GGFVKW MG
Sbjct  122  FPTAAGLASSAAGFACLVFTVAELMGIKESFPGELSTIARRGSGSACRSLHGGFVKWEMG  181

Query  709  KEEDGSDSLAVQLVD  753
            K  DG DS+AV L +
Sbjct  182  KRADGKDSIAVPLAE  196



>gb|AFW73866.1| hypothetical protein ZEAMMB73_421648 [Zea mays]
Length=173

 Score =   230 bits (586),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 119/154 (77%), Positives = 133/154 (86%), Gaps = 0/154 (0%)
 Frame = +1

Query  187  KWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDR  366
            +WVLM T +TPTNIAVIKYWGKRDE LILPINDSISVTLDP HL  TTTVAVSP+F  DR
Sbjct  7    QWVLMATGRTPTNIAVIKYWGKRDEALILPINDSISVTLDPDHLSATTTVAVSPSFPSDR  66

Query  367  MWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTaa  546
            MWLNGKE+SL G R+Q+CL+EIR RA D ED++KG+KI K+DW+ LHVHIASYNNFPTAA
Sbjct  67   MWLNGKEISLLGGRFQSCLREIRKRARDFEDKEKGVKIKKEDWDKLHVHIASYNNFPTAA  126

Query  547  glassaagfaCLVFALGKLMNVKEDNSQLSAIAR  648
            GLASSAAG AC VF LGKLMN KED  +LS+IAR
Sbjct  127  GLASSAAGLACFVFTLGKLMNAKEDYGELSSIAR  160



>gb|AFW73864.1| hypothetical protein ZEAMMB73_421648 [Zea mays]
Length=390

 Score =   225 bits (574),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 122/189 (65%), Positives = 141/189 (75%), Gaps = 30/189 (16%)
 Frame = +1

Query  187  KWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDR  366
            +WVLM T +TPTNIAVIKYWGKRDE LILPINDSIS                        
Sbjct  7    QWVLMATGRTPTNIAVIKYWGKRDEALILPINDSIS------------------------  42

Query  367  MWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTaa  546
                  E+SL G R+Q+CL+EIR RA D ED++KG+KI K+DW+ LHVHIASYNNFPTAA
Sbjct  43   ------EISLLGGRFQSCLREIRKRARDFEDKEKGVKIKKEDWDKLHVHIASYNNFPTAA  96

Query  547  glassaagfaCLVFALGKLMNVKEDNSQLSAIARQGSGSACRSLFGGFVKWIMGKEEDGS  726
            GLASSAAG AC VF LGKLMN KED  +LS+IARQGSGSACRS++GGFVKW MG+++DGS
Sbjct  97   GLASSAAGLACFVFTLGKLMNAKEDYGELSSIARQGSGSACRSIYGGFVKWCMGEKDDGS  156

Query  727  DSLAVQLVD  753
            DS+AVQL D
Sbjct  157  DSIAVQLAD  165



>tpg|DAA51252.1| TPA: hypothetical protein ZEAMMB73_408503 [Zea mays]
Length=1213

 Score =   233 bits (595),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 123/161 (76%), Positives = 137/161 (85%), Gaps = 1/161 (1%)
 Frame = +1

Query  169   PGTMAE-KWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVS  345
             P   AE +WVLM T +TPTNIAVIKYWGKRDE LILPINDSISVTLDP HL  TTTVAVS
Sbjct  1040  PMAAAEGQWVLMATGRTPTNIAVIKYWGKRDEALILPINDSISVTLDPDHLSATTTVAVS  1099

Query  346   PAFDQDRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASY  525
             P+F  DRMWLNGKE+SL G R+Q+CL+EIR RA D ED++KG+KI K+DW+ LHVHIASY
Sbjct  1100  PSFPSDRMWLNGKEISLLGGRFQSCLREIRKRARDFEDKEKGVKIKKEDWDKLHVHIASY  1159

Query  526   NNFPTaaglassaagfaCLVFALGKLMNVKEDNSQLSAIAR  648
             NNFPTAAGLASSAAG AC VF LGKLMNVKED  +LS+IAR
Sbjct  1160  NNFPTAAGLASSAAGLACFVFTLGKLMNVKEDYGELSSIAR  1200



>ref|NP_001045633.2| Os02g0107200 [Oryza sativa Japonica Group]
 dbj|BAF07547.2| Os02g0107200 [Oryza sativa Japonica Group]
Length=145

 Score =   205 bits (521),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 103/132 (78%), Positives = 114/132 (86%), Gaps = 0/132 (0%)
 Frame = +1

Query  187  KWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDR  366
            +WVLM T ++PTNIAVIKYWGKRDE LILP+NDSISVTLDP HL  TTTVAVSP+F  DR
Sbjct  8    QWVLMATGRSPTNIAVIKYWGKRDEALILPVNDSISVTLDPDHLSATTTVAVSPSFPSDR  67

Query  367  MWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTaa  546
            MWLNGKE+SLSG R+Q+CL+EIR RA DVEDEKKGI+I K+DW  LHVHIASYNNFPTAA
Sbjct  68   MWLNGKEISLSGGRFQSCLREIRKRAQDVEDEKKGIRIKKEDWGKLHVHIASYNNFPTAA  127

Query  547  glassaagfaCL  582
            GLASS AG  C 
Sbjct  128  GLASSVAGLVCF  139



>ref|XP_008668933.1| PREDICTED: diphosphomevalonate decarboxylase-like isoform X1 
[Zea mays]
Length=161

 Score =   197 bits (500),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 100/132 (76%), Positives = 113/132 (86%), Gaps = 0/132 (0%)
 Frame = +1

Query  187  KWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDR  366
            +WVLM T +TPTNIAVIKYWGKRDE LILPINDSISVTLDP HL  TTT+AVSP+F  DR
Sbjct  7    QWVLMATGRTPTNIAVIKYWGKRDEALILPINDSISVTLDPDHLSATTTIAVSPSFPSDR  66

Query  367  MWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTaa  546
            MWLNGKE+SL G R+Q+CLKEIR RA D+ED++K +KI K+DW  LHVHIASYNNFPT+A
Sbjct  67   MWLNGKEISLLGGRFQSCLKEIRKRARDIEDKEKDVKIKKEDWGKLHVHIASYNNFPTSA  126

Query  547  glassaagfaCL  582
            GLASSAA  AC 
Sbjct  127  GLASSAADLACF  138



>ref|XP_008668934.1| PREDICTED: diphosphomevalonate decarboxylase-like isoform X2 
[Zea mays]
Length=159

 Score =   196 bits (499),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 100/132 (76%), Positives = 113/132 (86%), Gaps = 0/132 (0%)
 Frame = +1

Query  187  KWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDR  366
            +WVLM T +TPTNIAVIKYWGKRDE LILPINDSISVTLDP HL  TTT+AVSP+F  DR
Sbjct  7    QWVLMATGRTPTNIAVIKYWGKRDEALILPINDSISVTLDPDHLSATTTIAVSPSFPSDR  66

Query  367  MWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTaa  546
            MWLNGKE+SL G R+Q+CLKEIR RA D+ED++K +KI K+DW  LHVHIASYNNFPT+A
Sbjct  67   MWLNGKEISLLGGRFQSCLKEIRKRARDIEDKEKDVKIKKEDWGKLHVHIASYNNFPTSA  126

Query  547  glassaagfaCL  582
            GLASSAA  AC 
Sbjct  127  GLASSAADLACF  138



>ref|NP_001045642.2| Os02g0109100 [Oryza sativa Japonica Group]
 dbj|BAF07556.2| Os02g0109100, partial [Oryza sativa Japonica Group]
Length=147

 Score =   189 bits (481),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 87/110 (79%), Positives = 98/110 (89%), Gaps = 0/110 (0%)
 Frame = +1

Query  211  QTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDRMWLNGKEM  390
            ++PTNIAVIKYWGKRDE LILP+NDSISVTLDP HL  TTTVAVSP+F  DRMWLNGKE+
Sbjct  18   RSPTNIAVIKYWGKRDEALILPVNDSISVTLDPDHLSATTTVAVSPSFPSDRMWLNGKEI  77

Query  391  SLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPT  540
            SLSG R+Q+CL+EIR RA DVEDEKKGI+I K+DW  LHVHIAS+NNFPT
Sbjct  78   SLSGGRFQSCLREIRKRAQDVEDEKKGIRIKKEDWGKLHVHIASFNNFPT  127



>gb|KDO47062.1| hypothetical protein CISIN_1g014714mg [Citrus sinensis]
Length=378

 Score =   196 bits (498),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 104/123 (85%), Positives = 115/123 (93%), Gaps = 0/123 (0%)
 Frame = +1

Query  385  EMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTaaglassa  564
            E+SL G RYQNCLKEIR+RACDVED +KGIKI KKDW+ LH+HIAS+NNFPTAAGLASSA
Sbjct  29   EISLGGGRYQNCLKEIRSRACDVEDTEKGIKIEKKDWQKLHLHIASFNNFPTAAGLASSA  88

Query  565  agfaCLVFALGKLMNVKEDNSQLSAIARQGSGSACRSLFGGFVKWIMGKEEDGSDSLAVQ  744
            AGFACLVF+L KLMN+KE+ SQLSAIARQGSGSACRSLFGGFVKWI+GKE +GSDSLAVQ
Sbjct  89   AGFACLVFSLAKLMNLKENQSQLSAIARQGSGSACRSLFGGFVKWILGKEGNGSDSLAVQ  148

Query  745  LVD  753
            LVD
Sbjct  149  LVD  151



>ref|XP_001121619.2| PREDICTED: diphosphomevalonate decarboxylase-like isoform X1 
[Apis mellifera]
Length=386

 Score =   194 bits (494),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 109/184 (59%), Positives = 130/184 (71%), Gaps = 14/184 (8%)
 Frame = +1

Query  199  MVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDRMWLN  378
            +VT   P NIAV+KYWGKRDETLILP NDSIS TLD  HLC  TTV +SP F  DR+WLN
Sbjct  3    IVTCIAPINIAVVKYWGKRDETLILPANDSISATLDTDHLCAKTTVMISPNFKHDRIWLN  62

Query  379  GKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTaaglas  558
            G+E  +  +R QNCL EI+ RA D     +        W+   +HI S NNFPT+AGLAS
Sbjct  63   GREEDIMNIRLQNCLTEIKKRAGDSNHMDQ--------WK---IHICSENNFPTSAGLAS  111

Query  559  saagfaCLVFALGKLMNVKEDNSQLSAIARQGSGSACRSLFGGFVKWIMGKEEDGSDSLA  738
            SAAG+ACLV AL KL  VK D   ++AIAR GSGSACRS+ GGFV+W MG + DG+DS+A
Sbjct  112  SAAGYACLVIALAKLYEVKGD---ITAIARVGSGSACRSILGGFVRWYMGSQTDGTDSIA  168

Query  739  VQLV  750
             Q+V
Sbjct  169  KQIV  172



>ref|XP_006623086.1| PREDICTED: diphosphomevalonate decarboxylase-like [Apis dorsata]
Length=386

 Score =   194 bits (494),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 109/184 (59%), Positives = 130/184 (71%), Gaps = 14/184 (8%)
 Frame = +1

Query  199  MVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDRMWLN  378
            +VT   P NIAV+KYWGKRDETLILP NDSIS TLD  HLC  TTV +SP F  DR+WLN
Sbjct  3    IVTCIAPINIAVVKYWGKRDETLILPANDSISATLDTDHLCAKTTVMISPNFKHDRIWLN  62

Query  379  GKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTaaglas  558
            G+E  +  +R QNCL EI+ RA        G       W+   +HI S NNFPT+AGLAS
Sbjct  63   GREEDIKNIRLQNCLTEIKKRA--------GNSNHMNQWK---IHICSENNFPTSAGLAS  111

Query  559  saagfaCLVFALGKLMNVKEDNSQLSAIARQGSGSACRSLFGGFVKWIMGKEEDGSDSLA  738
            SAAG+ACLV AL KL  VK+D   ++AIAR GSGSACRS+ GGFV+W MG + DG+DS+A
Sbjct  112  SAAGYACLVIALAKLYEVKDD---ITAIARVGSGSACRSILGGFVRWYMGSQIDGTDSIA  168

Query  739  VQLV  750
             Q+V
Sbjct  169  KQIV  172



>ref|XP_003693647.1| PREDICTED: diphosphomevalonate decarboxylase-like [Apis florea]
Length=386

 Score =   194 bits (492),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 108/184 (59%), Positives = 130/184 (71%), Gaps = 14/184 (8%)
 Frame = +1

Query  199  MVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDRMWLN  378
            +VT   P NIAV+KYWGKRDETLILP NDSIS TLD  HLC  TTV +SP F  DR+WLN
Sbjct  3    IVTCIAPINIAVVKYWGKRDETLILPANDSISATLDTDHLCAKTTVMISPNFKHDRIWLN  62

Query  379  GKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTaaglas  558
            G+E  +  +R QNCL EIR R  +     +        W+   +HI S NNFPT+AGLAS
Sbjct  63   GREEDIKNIRLQNCLTEIRKRTGNSNHMDQ--------WK---IHICSENNFPTSAGLAS  111

Query  559  saagfaCLVFALGKLMNVKEDNSQLSAIARQGSGSACRSLFGGFVKWIMGKEEDGSDSLA  738
            SAAG+ACLV AL KL +VK D   ++AIAR GSGSACRS+ GGFV+W MG + DG+DS+A
Sbjct  112  SAAGYACLVIALAKLYDVKGD---ITAIARIGSGSACRSILGGFVRWYMGSQTDGTDSIA  168

Query  739  VQLV  750
             Q+V
Sbjct  169  KQIV  172



>gb|EMS63646.1| Diphosphomevalonate decarboxylase [Triticum urartu]
Length=290

 Score =   187 bits (474),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 100/124 (81%), Positives = 111/124 (90%), Gaps = 0/124 (0%)
 Frame = +1

Query  382  KEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTaaglass  561
            +E++LSG R+QNCL+EIR RA DVEDEKKGI I K+DWE LHVHIASYNNFPTAAGLASS
Sbjct  25   QEIALSGGRFQNCLREIRKRARDVEDEKKGINIKKEDWEKLHVHIASYNNFPTAAGLASS  84

Query  562  aagfaCLVFALGKLMNVKEDNSQLSAIARQGSGSACRSLFGGFVKWIMGKEEDGSDSLAV  741
            AAGFACLVF LGKLMNV ED  +LS+IARQGSGSACRS++GGFVKW MGK  DGSDS+AV
Sbjct  85   AAGFACLVFTLGKLMNVNEDYGELSSIARQGSGSACRSIYGGFVKWCMGKNNDGSDSMAV  144

Query  742  QLVD  753
            QLVD
Sbjct  145  QLVD  148



>ref|NP_001133968.1| Diphosphomevalonate decarboxylase [Salmo salar]
 gb|ACI34234.1| Diphosphomevalonate decarboxylase [Salmo salar]
Length=402

 Score =   188 bits (478),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 110/191 (58%), Positives = 137/191 (72%), Gaps = 13/191 (7%)
 Frame = +1

Query  187  KWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDR  366
            K + MVT   P NIAVIKYWGKRDE LILPIN S+SVTL    L TTTTVA S +F +DR
Sbjct  7    KKLTMVTCSAPVNIAVIKYWGKRDEELILPINSSLSVTLHQDQLKTTTTVACSRSFQEDR  66

Query  367  MWLNGKEMSLSGVRYQNCLKEI----RARACDVEDEKKGIKITKKDWENLHVHIASYNNF  534
            +WLNGKE  ++  R Q+CL+EI    R R  D E +     ++ K      VHI S NNF
Sbjct  67   IWLNGKEEDITQPRLQSCLREIRCLSRKRRSDGEADVDAAGLSHK------VHICSVNNF  120

Query  535  PTaaglassaagfaCLVFALGKLMNVKEDNSQLSAIARQGSGSACRSLFGGFVKWIMGKE  714
            PTAAGLASSAAG+ACLV+ L ++M V+    +LSA++RQGSGSACRS++GGFV+W+MG++
Sbjct  121  PTAAGLASSAAGYACLVYTLSRVMGVE---GELSAVSRQGSGSACRSMYGGFVQWLMGQQ  177

Query  715  EDGSDSLAVQL  747
             DG DSLA Q+
Sbjct  178  GDGKDSLAQQV  188



>emb|CDQ87522.1| unnamed protein product [Oncorhynchus mykiss]
Length=402

 Score =   187 bits (475),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 110/191 (58%), Positives = 136/191 (71%), Gaps = 13/191 (7%)
 Frame = +1

Query  187  KWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDR  366
            K + MVT   P NIAVIKYWGKRDE LILPIN S+SVTL    L TTTTVA S +F +DR
Sbjct  7    KKLTMVTCSAPVNIAVIKYWGKRDEELILPINSSLSVTLHQDQLKTTTTVACSRSFQEDR  66

Query  367  MWLNGKEMSLSGVRYQNCLKEI----RARACDVEDEKKGIKITKKDWENLHVHIASYNNF  534
            +WLNGKE  ++  R Q+CL+EI    R R  D E +     ++ K      VHI S NNF
Sbjct  67   IWLNGKEEDITQPRLQSCLREIRRLARKRRSDGEADVDTAGLSHK------VHICSVNNF  120

Query  535  PTaaglassaagfaCLVFALGKLMNVKEDNSQLSAIARQGSGSACRSLFGGFVKWIMGKE  714
            PTAAGLASSAAG+ACLV+ L ++M V+    +LS ++RQGSGSACRS++GGFV+WIMG++
Sbjct  121  PTAAGLASSAAGYACLVYTLSRVMGVE---GELSVVSRQGSGSACRSMYGGFVQWIMGQQ  177

Query  715  EDGSDSLAVQL  747
             DG DSLA Q+
Sbjct  178  GDGKDSLAQQV  188



>gb|ELU01936.1| hypothetical protein CAPTEDRAFT_176844 [Capitella teleta]
Length=398

 Score =   187 bits (474),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 115/185 (62%), Positives = 129/185 (70%), Gaps = 7/185 (4%)
 Frame = +1

Query  193  VLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDRMW  372
            ++  T   P NIAVIKYWGKRDE LILPIN S+S TLD   L   TTVA S  F +DRMW
Sbjct  5    IISKTCTGPVNIAVIKYWGKRDEKLILPINASLSGTLDQQQLRAKTTVAASAGFTKDRMW  64

Query  373  LNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTaagl  552
            LNG+E SL   R QN LKEIR RA      K G +    D     VHI S NNFPTAAGL
Sbjct  65   LNGQEQSLDNPRLQNVLKEIRRRA---RKRKSGCE-DDLDMLTWRVHICSENNFPTAAGL  120

Query  553  assaagfaCLVFALGKLMNVKEDNSQLSAIARQGSGSACRSLFGGFVKWIMGKEEDGSDS  732
            ASSAAG ACLVF+L KL NV  D   +S IARQGSGSACRS++GGFV+W MGKE+DGSDS
Sbjct  121  ASSAAGLACLVFSLSKLFNVDGD---ISDIARQGSGSACRSVYGGFVEWEMGKEKDGSDS  177

Query  733  LAVQL  747
            +A Q+
Sbjct  178  VARQV  182



>ref|XP_003758532.1| PREDICTED: diphosphomevalonate decarboxylase [Sarcophilus harrisii]
Length=398

 Score =   187 bits (474),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 111/191 (58%), Positives = 136/191 (71%), Gaps = 11/191 (6%)
 Frame = +1

Query  181  AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  360
            AEK ++ VT   PTNIAVIKYWGKRDE LILPIN S+SVTL    L TTTT A+S  F +
Sbjct  3    AEKALVAVTCTAPTNIAVIKYWGKRDEKLILPINSSLSVTLHQNQLKTTTTAAISRDFKE  62

Query  361  DRMWLNGKEMSLSGVRYQNCLKEIR--ARACDVEDEKKGIKITKKDWENLHVHIASYNNF  534
            DR+WLNGKE  +   R Q+CL+EIR  AR      E   + ++ K      VHIAS N+F
Sbjct  63   DRIWLNGKEEDVGHPRLQSCLREIRRLARKRRSGSEGDSVPLSYK------VHIASVNDF  116

Query  535  PTaaglassaagfaCLVFALGKLMNVKEDNSQLSAIARQGSGSACRSLFGGFVKWIMGKE  714
            PTAAGLASSAAG+ACLV+ L +L  V+   S+LS +ARQGSGSACRS+ GGFV+W+MG+ 
Sbjct  117  PTAAGLASSAAGYACLVYTLAQLYGVE---SELSEVARQGSGSACRSMLGGFVQWLMGER  173

Query  715  EDGSDSLAVQL  747
             DG DS+A Q+
Sbjct  174  PDGKDSIAQQV  184



>ref|NP_001093300.1| diphosphomevalonate decarboxylase [Bombyx mori]
 dbj|BAF62111.1| diphosphomevalonate decarboxylase [Bombyx mori]
Length=390

 Score =   186 bits (473),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 105/185 (57%), Positives = 132/185 (71%), Gaps = 10/185 (5%)
 Frame = +1

Query  199  MVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDRMWLN  378
            +VT   P NIAVIKYWGKRDE LILP+NDS+S T D + +C  T+V+  P F +D++WLN
Sbjct  4    IVTVIAPVNIAVIKYWGKRDEKLILPLNDSVSATFDTSVMCAKTSVSTHPDFVEDQIWLN  63

Query  379  GKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTaaglas  558
            GKE S S  R QNCL+EI++RA          K   +D  +  VH++S NNFPTAAGLAS
Sbjct  64   GKEESFSNPRLQNCLREIKSRAV-------AEKTIAEDVLSWKVHVSSENNFPTAAGLAS  116

Query  559  saagfaCLVFALGKLMNVKEDNSQLSAIARQGSGSACRSLFGGFVKWIMGKEEDGSDSLA  738
            SAAG+ACLV AL KL  +K D   +S+IAR GSGSACRS++GGFV+W  G + DGSDS+A
Sbjct  117  SAAGYACLVSALAKLYKIKSD---VSSIARLGSGSACRSVYGGFVRWHAGSKPDGSDSIA  173

Query  739  VQLVD  753
             Q+ D
Sbjct  174  TQIAD  178



>ref|XP_010739786.1| PREDICTED: diphosphomevalonate decarboxylase [Larimichthys crocea]
Length=397

 Score =   187 bits (474),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 111/185 (60%), Positives = 134/185 (72%), Gaps = 9/185 (5%)
 Frame = +1

Query  199  MVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDRMWLN  378
            +VT   P NIAVIKYWGKRDE LILPIN S+SVTL    L TTTTVA S +F +DR+WLN
Sbjct  6    IVTCTAPVNIAVIKYWGKRDEELILPINSSLSVTLHQEQLKTTTTVATSRSFQEDRIWLN  65

Query  379  GKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENL--HVHIASYNNFPTaagl  552
            GKE  ++  R Q+CL+EIR  A     +++G      D   L   VHI S NNFPTAAGL
Sbjct  66   GKEEDITHPRLQSCLREIRRLA----RKRRGDGDPSVDSTGLSHKVHICSVNNFPTAAGL  121

Query  553  assaagfaCLVFALGKLMNVKEDNSQLSAIARQGSGSACRSLFGGFVKWIMGKEEDGSDS  732
            ASSAAGFACLV+ L ++  V+    +LS IARQGSGSACRS++GGFV+WIMGK++DG DS
Sbjct  122  ASSAAGFACLVYTLARVFGVE---GELSGIARQGSGSACRSMYGGFVQWIMGKKDDGKDS  178

Query  733  LAVQL  747
            LA Q+
Sbjct  179  LAQQV  183



>ref|XP_010877776.1| PREDICTED: diphosphomevalonate decarboxylase [Esox lucius]
Length=402

 Score =   187 bits (474),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 109/184 (59%), Positives = 134/184 (73%), Gaps = 7/184 (4%)
 Frame = +1

Query  199  MVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDRMWLN  378
            MVT   P NIAVIKYWGKRDE  ILPIN S+SVTL    L TTTTVA S +F +DR+WLN
Sbjct  11   MVTCNAPVNIAVIKYWGKRDEECILPINSSLSVTLHQDQLKTTTTVACSRSFQEDRIWLN  70

Query  379  GKEMSLSGVRYQNCLKEIRARACDVE-DEKKGIKITKKDWENLHVHIASYNNFPTaagla  555
            GKE  ++  R Q+CL+EIR  A     D + G+ +     +   VHI S NNFPTAAGLA
Sbjct  71   GKEEDINQPRLQSCLREIRRLARKRRSDGEGGVDLAGLSHK---VHICSVNNFPTAAGLA  127

Query  556  ssaagfaCLVFALGKLMNVKEDNSQLSAIARQGSGSACRSLFGGFVKWIMGKEEDGSDSL  735
            SSAAG+ACLV+ L ++M V+    +LSA+ARQGSGSACRS++GGFV+WIMG+ EDG DS+
Sbjct  128  SSAAGYACLVYTLARVMGVE---GELSAVARQGSGSACRSMYGGFVQWIMGQREDGKDSV  184

Query  736  AVQL  747
            A Q+
Sbjct  185  AQQV  188



>ref|XP_004600545.1| PREDICTED: diphosphomevalonate decarboxylase [Sorex araneus]
Length=395

 Score =   186 bits (473),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 108/190 (57%), Positives = 133/190 (70%), Gaps = 6/190 (3%)
 Frame = +1

Query  178  MAEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFD  357
            MA   +L VT   P NIAVIKYWGKRDE LILPIN S+SVTL    L TTTT A+S AF 
Sbjct  1    MASGQLLAVTCTAPVNIAVIKYWGKRDEELILPINSSLSVTLHQDQLKTTTTAAISKAFT  60

Query  358  QDRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFP  537
            +DR+WLNG+E  ++  R Q CL+EIR  A        G      D++   VH+AS NNFP
Sbjct  61   KDRIWLNGREEDVTQPRLQACLREIRRLAEKRRRSSGGEDPLTHDYK---VHVASVNNFP  117

Query  538  TaaglassaagfaCLVFALGKLMNVKEDNSQLSAIARQGSGSACRSLFGGFVKWIMGKEE  717
            TAAGLASSAAG+ACL +AL ++  V +D   LS +AR+GSGSACRSL+GGFV+W MG++ 
Sbjct  118  TAAGLASSAAGYACLAYALARVYGVDDD---LSEVARRGSGSACRSLYGGFVEWQMGQQA  174

Query  718  DGSDSLAVQL  747
            DG DS+A Q+
Sbjct  175  DGKDSVARQV  184



>gb|KDR21975.1| Diphosphomevalonate decarboxylase [Zootermopsis nevadensis]
Length=338

 Score =   184 bits (468),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 109/185 (59%), Positives = 129/185 (70%), Gaps = 11/185 (6%)
 Frame = +1

Query  199  MVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDRMWLN  378
            +VT   P NIAVIKYWGKRDE LILP+NDS+S TL    +   T+V  SP F +D++WLN
Sbjct  3    IVTCIAPVNIAVIKYWGKRDENLILPLNDSVSATLSIKQMNAKTSVMASPNFTEDKIWLN  62

Query  379  GKEMSLSGVRYQNCLKEIRARACDVEDEK-KGIKITKKDWENLHVHIASYNNFPTaagla  555
            G+E +    R QNCL+EIR RA    D K  G+     DW    VH+ S NNFPTAAGLA
Sbjct  63   GREETFHSQRLQNCLQEIRRRAKQRADGKDDGV----SDWC---VHVCSENNFPTAAGLA  115

Query  556  ssaagfaCLVFALGKLMNVKEDNSQLSAIARQGSGSACRSLFGGFVKWIMGKEEDGSDSL  735
            SSAAG+ACLVFAL +L NV  D   +S IARQGSGSACRSL+GGFV+W  G   DGSDS+
Sbjct  116  SSAAGYACLVFALAQLYNVSGD---ISGIARQGSGSACRSLYGGFVRWHRGSASDGSDSI  172

Query  736  AVQLV  750
            A Q+V
Sbjct  173  ATQIV  177



>ref|XP_010996754.1| PREDICTED: diphosphomevalonate decarboxylase-like, partial [Camelus 
dromedarius]
Length=239

 Score =   181 bits (460),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 108/189 (57%), Positives = 129/189 (68%), Gaps = 5/189 (3%)
 Frame = +1

Query  181  AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  360
            AEK V+ VT   P NIAVIKYWGKRDE LILPIN S+SVTL    L TTTT A+S  F +
Sbjct  3    AEKPVVAVTCTAPVNIAVIKYWGKRDEKLILPINSSLSVTLHQDQLKTTTTAAISRDFTE  62

Query  361  DRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPT  540
            DR+WLNG+E  +   R Q CLKEIR  AC          +      +  VHIAS NNFPT
Sbjct  63   DRIWLNGREEDIGQPRLQACLKEIRRLACKRRSGSPEDPLPLS--HSCKVHIASENNFPT  120

Query  541  aaglassaagfaCLVFALGKLMNVKEDNSQLSAIARQGSGSACRSLFGGFVKWIMGKEED  720
            AAGLASSAAG+ACL + L ++  V+ D   LS +AR+GSGSACRSL+GGFV+W MG+  D
Sbjct  121  AAGLASSAAGYACLAYTLARVYGVESD---LSEVARRGSGSACRSLYGGFVEWQMGERAD  177

Query  721  GSDSLAVQL  747
            G DS+A Q+
Sbjct  178  GKDSIARQV  186



>gb|ELK31386.1| Diphosphomevalonate decarboxylase [Myotis davidii]
Length=363

 Score =   184 bits (468),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 107/191 (56%), Positives = 134/191 (70%), Gaps = 9/191 (5%)
 Frame = +1

Query  181  AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  360
            +EK  L VT   P NIAVIKYWGKRDE LILPIN S+SVTL    L TTTT  +S  F +
Sbjct  3    SEKPYLAVTCTAPVNIAVIKYWGKRDEELILPINSSLSVTLHQDQLKTTTTAVISKDFTE  62

Query  361  DRMWLNGKEMSLSGVRYQNCLKEIR--ARACDVEDEKKGIKITKKDWENLHVHIASYNNF  534
            DR+WLNG+E  +   R Q CL+EIR  AR     DE+  + ++     N  VH+AS NNF
Sbjct  63   DRIWLNGREEDIGQPRIQACLREIRRLARKRRSGDEEDPLPLSL----NYKVHVASVNNF  118

Query  535  PTaaglassaagfaCLVFALGKLMNVKEDNSQLSAIARQGSGSACRSLFGGFVKWIMGKE  714
            PTAAGLASSA+G+ACL +AL ++  V+ D   LS +AR+GSGSACRSL+GGFV+W MG++
Sbjct  119  PTAAGLASSASGYACLAYALARVYGVESD---LSEVARRGSGSACRSLYGGFVEWQMGEQ  175

Query  715  EDGSDSLAVQL  747
             DG DS+A Q+
Sbjct  176  ADGKDSVARQV  186



>ref|XP_008137975.1| PREDICTED: diphosphomevalonate decarboxylase [Eptesicus fuscus]
Length=400

 Score =   184 bits (468),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 109/191 (57%), Positives = 134/191 (70%), Gaps = 9/191 (5%)
 Frame = +1

Query  181  AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  360
            +EK  L VT   P NIAVIKYWGKRDE LILPIN S+SVTL    L TTTT  +S  F +
Sbjct  3    SEKPHLAVTCTAPVNIAVIKYWGKRDEELILPINSSLSVTLHQDQLKTTTTAVISKDFTE  62

Query  361  DRMWLNGKEMSLSGVRYQNCLKEIR--ARACDVEDEKKGIKITKKDWENLHVHIASYNNF  534
            DR+WLNG+E  +   R Q CL+EIR  AR     DE+  + ++     N  VHIAS NNF
Sbjct  63   DRIWLNGREEDIGQPRIQACLREIRRLARKRRSGDEEDLLPLSL----NYKVHIASVNNF  118

Query  535  PTaaglassaagfaCLVFALGKLMNVKEDNSQLSAIARQGSGSACRSLFGGFVKWIMGKE  714
            PTAAGLASSA+G+ACL +AL ++  VK D   LS +AR+GSGSACRSL+GGFV+W MG++
Sbjct  119  PTAAGLASSASGYACLAYALAQVYGVKSD---LSEVARRGSGSACRSLYGGFVEWQMGEQ  175

Query  715  EDGSDSLAVQL  747
             DG DS+A Q+
Sbjct  176  PDGKDSVARQV  186



>ref|XP_006762259.1| PREDICTED: diphosphomevalonate decarboxylase isoform X1 [Myotis 
davidii]
Length=400

 Score =   184 bits (468),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 107/191 (56%), Positives = 134/191 (70%), Gaps = 9/191 (5%)
 Frame = +1

Query  181  AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  360
            +EK  L VT   P NIAVIKYWGKRDE LILPIN S+SVTL    L TTTT  +S  F +
Sbjct  3    SEKPYLAVTCTAPVNIAVIKYWGKRDEELILPINSSLSVTLHQDQLKTTTTAVISKDFTE  62

Query  361  DRMWLNGKEMSLSGVRYQNCLKEIR--ARACDVEDEKKGIKITKKDWENLHVHIASYNNF  534
            DR+WLNG+E  +   R Q CL+EIR  AR     DE+  + ++     N  VH+AS NNF
Sbjct  63   DRIWLNGREEDIGQPRIQACLREIRRLARKRRSGDEEDPLPLSL----NYKVHVASVNNF  118

Query  535  PTaaglassaagfaCLVFALGKLMNVKEDNSQLSAIARQGSGSACRSLFGGFVKWIMGKE  714
            PTAAGLASSA+G+ACL +AL ++  V+ D   LS +AR+GSGSACRSL+GGFV+W MG++
Sbjct  119  PTAAGLASSASGYACLAYALARVYGVESD---LSEVARRGSGSACRSLYGGFVEWQMGEQ  175

Query  715  EDGSDSLAVQL  747
             DG DS+A Q+
Sbjct  176  ADGKDSVARQV  186



>gb|KJA27615.1| hypothetical protein HYPSUDRAFT_130498 [Hypholoma sublateritium 
FD-334 SS-4]
Length=411

 Score =   185 bits (469),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 109/192 (57%), Positives = 129/192 (67%), Gaps = 6/192 (3%)
 Frame = +1

Query  178  MAEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFD  357
            M+   +   TA  P NIAVIKYWGKRD  LILP N S+SVTLD  HL +TTT    P+F+
Sbjct  1    MSSAPIYEATASAPVNIAVIKYWGKRDTKLILPTNSSLSVTLDQDHLRSTTTSRADPSFE  60

Query  358  QDRMWLNGKEMSLS-GVRYQNCLKEI-RARACDVEDEKKGIKITKKDWENLHVHIASYNN  531
             DR+WLNGKE  ++ G R + C+KE+ R R   VED    +  +        VHIASYNN
Sbjct  61   ADRLWLNGKEDQITAGSRLETCIKEMKRLRKETVED----VDASAPKLSTYKVHIASYNN  116

Query  532  FPTaaglassaagfaCLVFALGKLMNVKEDNSQLSAIARQGSGSACRSLFGGFVKWIMGK  711
            FPTAAGLASSA+GFA LV +L  L  +    S LS IARQGSGSACRSLFGGFV W MG 
Sbjct  117  FPTAAGLASSASGFAALVASLAHLYALPASPSTLSLIARQGSGSACRSLFGGFVAWQMGS  176

Query  712  EEDGSDSLAVQL  747
            +  GSDSLAV++
Sbjct  177  DPSGSDSLAVEV  188



>ref|XP_004067388.1| PREDICTED: diphosphomevalonate decarboxylase [Oryzias latipes]
Length=364

 Score =   183 bits (465),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 108/185 (58%), Positives = 134/185 (72%), Gaps = 8/185 (4%)
 Frame = +1

Query  199  MVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDRMWLN  378
            +VT   P NIAVIKYWGKR+E LILPIN S+SVTL    L TTTTVA S +F +DR+WLN
Sbjct  6    LVTCTAPVNIAVIKYWGKRNEELILPINSSLSVTLHQDQLKTTTTVATSRSFKEDRIWLN  65

Query  379  GKEMSLSGVRYQNCLKEIR--ARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTaagl  552
            GKE  ++  R Q+CL+EIR  AR    + +    ++T    +   VHI S NNFPTAAGL
Sbjct  66   GKEEDITHPRLQSCLREIRRLARKRHNDGDATSTELTGLSQK---VHICSVNNFPTAAGL  122

Query  553  assaagfaCLVFALGKLMNVKEDNSQLSAIARQGSGSACRSLFGGFVKWIMGKEEDGSDS  732
            ASSAAGFACLV++L +   V+    +LS +ARQGSGSACRS++GGFV+WIMG +EDG DS
Sbjct  123  ASSAAGFACLVYSLAQAFGVE---GELSGVARQGSGSACRSMYGGFVQWIMGNQEDGKDS  179

Query  733  LAVQL  747
            LA Q+
Sbjct  180  LAQQV  184



>ref|XP_001376834.1| PREDICTED: diphosphomevalonate decarboxylase [Monodelphis domestica]
Length=398

 Score =   184 bits (467),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 111/191 (58%), Positives = 135/191 (71%), Gaps = 11/191 (6%)
 Frame = +1

Query  181  AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  360
            AEK ++ VT   PTNIAVIKYWGKRDE LILPIN S+SVTL    L TTTT A+S  F +
Sbjct  3    AEKPLVSVTCTAPTNIAVIKYWGKRDEKLILPINSSLSVTLHQNQLKTTTTAAISRDFKE  62

Query  361  DRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKG--IKITKKDWENLHVHIASYNNF  534
            DR+WLNGKE  +   R Q+CL+EIR  A        G  + ++ K      VHIAS N+F
Sbjct  63   DRIWLNGKEEDVGHHRLQSCLREIRRLARKRRSGSDGDLVPLSYK------VHIASVNDF  116

Query  535  PTaaglassaagfaCLVFALGKLMNVKEDNSQLSAIARQGSGSACRSLFGGFVKWIMGKE  714
            PTAAGLASSAAG+ACLV+ L +L  V+   S+LS +ARQGSGSACRS+FGGFV+W MG+ 
Sbjct  117  PTAAGLASSAAGYACLVYTLAQLYGVE---SELSEVARQGSGSACRSMFGGFVQWHMGER  173

Query  715  EDGSDSLAVQL  747
             DG DS+A Q+
Sbjct  174  PDGKDSIAQQV  184



>emb|CDQ81132.1| unnamed protein product [Oncorhynchus mykiss]
Length=402

 Score =   184 bits (467),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 110/191 (58%), Positives = 134/191 (70%), Gaps = 13/191 (7%)
 Frame = +1

Query  187  KWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDR  366
            K + MVT   P NIAVIKYWGKRDE LILPIN S+SVTL    L TTTTVA S  F +DR
Sbjct  7    KELTMVTCSAPVNIAVIKYWGKRDEELILPINSSLSVTLHQDQLKTTTTVACSRLFQEDR  66

Query  367  MWLNGKEMSLSGVRYQNCLKEI----RARACDVEDEKKGIKITKKDWENLHVHIASYNNF  534
            +WLNGKE  ++  R Q+CL+EI    R R  D E +     ++ K      VHI S NNF
Sbjct  67   IWLNGKEEDITQPRLQSCLREIRRLARKRRSDGEADVDTAGLSHK------VHICSVNNF  120

Query  535  PTaaglassaagfaCLVFALGKLMNVKEDNSQLSAIARQGSGSACRSLFGGFVKWIMGKE  714
            PTAAGLASSAAG+ACLV+ L ++M V+    +LS ++RQGSGSACRS+ GGFV+WIMG++
Sbjct  121  PTAAGLASSAAGYACLVYTLSRVMGVE---GELSVVSRQGSGSACRSMHGGFVQWIMGQQ  177

Query  715  EDGSDSLAVQL  747
             DG DSLA Q+
Sbjct  178  GDGKDSLAQQV  188



>ref|XP_007244091.1| PREDICTED: diphosphomevalonate decarboxylase [Astyanax mexicanus]
Length=404

 Score =   184 bits (466),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 109/200 (55%), Positives = 139/200 (70%), Gaps = 14/200 (7%)
 Frame = +1

Query  160  FPFPGTMAEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVA  339
             P   + + + + ++T   P NIAVIKYWGKRDE LILPIN S+SVTL    L TTTTVA
Sbjct  1    MPENSSSSSQRLTVITCTAPVNIAVIKYWGKRDEELILPINSSLSVTLHQDQLKTTTTVA  60

Query  340  VSPAFDQDRMWLNGKEMSLSGVRYQNCLKEI----RARACDVEDEKKGIKITKKDWENLH  507
             S +F +DR+WLNGKE  ++  R Q+CL+EI    R R  D +D    I ++ +      
Sbjct  61   CSRSFQEDRIWLNGKEEDINQPRLQSCLREIRRLARKRRSD-DDPSNDISLSHR------  113

Query  508  VHIASYNNFPTaaglassaagfaCLVFALGKLMNVKEDNSQLSAIARQGSGSACRSLFGG  687
            VHI S NNFPTAAGLASSAAG+ACLV++L +L  V+    +LS +ARQGSGSACRS++GG
Sbjct  114  VHICSVNNFPTAAGLASSAAGYACLVYSLSRLFGVE---GELSGVARQGSGSACRSMYGG  170

Query  688  FVKWIMGKEEDGSDSLAVQL  747
            FV+W MG+ EDG DSLA Q+
Sbjct  171  FVQWKMGEREDGKDSLAEQV  190



>dbj|GAM24015.1| hypothetical protein SAMD00019534_071900 [Acytostelium subglobosum 
LB1]
Length=402

 Score =   184 bits (466),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 106/183 (58%), Positives = 129/183 (70%), Gaps = 15/183 (8%)
 Frame = +1

Query  199  MVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDRMWLN  378
            +VT   P NIA IKYWGKRDE LILP+NDS+S TL    L TTTT   S +F +D +WLN
Sbjct  4    LVTCTAPVNIATIKYWGKRDEKLILPLNDSLSGTLHQDDLKTTTTAMASESFTEDALWLN  63

Query  379  GKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTaaglas  558
            GK+  ++  RYQN LK IR+RA  + D+K              VHI S NNFPTAAGLAS
Sbjct  64   GKKEDINTTRYQNVLKTIRSRATKLMDKKHC------------VHICSVNNFPTAAGLAS  111

Query  559  saagfaCLVFALGKLMNVKEDNSQLSAIARQGSGSACRSLFGGFVKWIMGKEEDGSDSLA  738
            SA+G+ACLV+ L +L  V+ D   +SAIAR GSGSACRS++GGFVKW+MG+  DGSDSLA
Sbjct  112  SASGYACLVYVLAQLYGVEGD---VSAIARIGSGSACRSVYGGFVKWVMGEHADGSDSLA  168

Query  739  VQL  747
            VQ+
Sbjct  169  VQV  171



>ref|XP_006097406.1| PREDICTED: diphosphomevalonate decarboxylase [Myotis lucifugus]
Length=400

 Score =   184 bits (466),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 107/191 (56%), Positives = 134/191 (70%), Gaps = 9/191 (5%)
 Frame = +1

Query  181  AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  360
            +EK  L VT   P NIAVIKYWGKRDE LILPIN S+SVTL    L TTTT  +S  F +
Sbjct  3    SEKPYLAVTCTAPVNIAVIKYWGKRDEELILPINSSLSVTLHQDQLKTTTTAVISKDFTE  62

Query  361  DRMWLNGKEMSLSGVRYQNCLKEIR--ARACDVEDEKKGIKITKKDWENLHVHIASYNNF  534
            DR+WLNG+E  +   R Q CL+EIR  AR    +DE+  + ++     N  VH+AS NNF
Sbjct  63   DRIWLNGREEDIGQPRIQACLREIRRLARKRRSDDEEDPLPLSL----NYKVHVASVNNF  118

Query  535  PTaaglassaagfaCLVFALGKLMNVKEDNSQLSAIARQGSGSACRSLFGGFVKWIMGKE  714
            PTAAGLASSA+G+ACL +AL ++  V+ D   LS +AR+GSGSACRSL+GGFV+W MG+ 
Sbjct  119  PTAAGLASSASGYACLAYALARVYGVESD---LSEVARRGSGSACRSLYGGFVEWQMGEL  175

Query  715  EDGSDSLAVQL  747
             DG DS+A Q+
Sbjct  176  ADGKDSVARQV  186



>ref|XP_002942038.1| PREDICTED: diphosphomevalonate decarboxylase isoform X1 [Xenopus 
(Silurana) tropicalis]
 ref|XP_004913619.1| PREDICTED: diphosphomevalonate decarboxylase isoform X3 [Xenopus 
(Silurana) tropicalis]
 ref|XP_004913620.1| PREDICTED: diphosphomevalonate decarboxylase isoform X4 [Xenopus 
(Silurana) tropicalis]
 ref|XP_004913621.1| PREDICTED: diphosphomevalonate decarboxylase isoform X5 [Xenopus 
(Silurana) tropicalis]
 ref|XP_004913622.1| PREDICTED: diphosphomevalonate decarboxylase isoform X6 [Xenopus 
(Silurana) tropicalis]
Length=394

 Score =   183 bits (465),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 107/182 (59%), Positives = 132/182 (73%), Gaps = 5/182 (3%)
 Frame = +1

Query  202  VTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDRMWLNG  381
            VT   P NIAVIKYWGKR+E LILPIN S+SVTL    L TTT+ A S  F +DR+WLNG
Sbjct  4    VTCTAPVNIAVIKYWGKRNEELILPINSSLSVTLHQDQLKTTTSAAASREFTEDRIWLNG  63

Query  382  KEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTaaglass  561
            KE ++S  R Q+CL+EIR  A    +E+    +++    N  VHI S NNFPTAAGLASS
Sbjct  64   KEENISHPRLQSCLREIRRLARKRRNEEGDENVSR--ILNDKVHICSVNNFPTAAGLASS  121

Query  562  aagfaCLVFALGKLMNVKEDNSQLSAIARQGSGSACRSLFGGFVKWIMGKEEDGSDSLAV  741
            AAG+ACLV+ L KL  V+    +LS IARQGSGSACRS++GGFV+W+MG+ +DG DSLA 
Sbjct  122  AAGYACLVYTLAKLYGVE---GELSEIARQGSGSACRSMYGGFVQWVMGERDDGKDSLAK  178

Query  742  QL  747
            Q+
Sbjct  179  QV  180



>ref|XP_005805001.1| PREDICTED: diphosphomevalonate decarboxylase-like [Xiphophorus 
maculatus]
Length=403

 Score =   183 bits (465),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 108/183 (59%), Positives = 132/183 (72%), Gaps = 4/183 (2%)
 Frame = +1

Query  199  MVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDRMWLN  378
            +VT   P NIAVIKYWGKRDE LILPIN S+SVTL    L TTTTVA+S +F +DR+WLN
Sbjct  11   IVTCTAPVNIAVIKYWGKRDEDLILPINSSMSVTLHQDQLKTTTTVAISRSFQEDRLWLN  70

Query  379  GKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTaaglas  558
            GKE  ++  R Q+CL+EIR  A    ++    + T     +  VHI S NNFPTAAGLAS
Sbjct  71   GKEEDITHQRLQSCLREIRRLARKRRNDGDA-RATDSVGLSHKVHICSVNNFPTAAGLAS  129

Query  559  saagfaCLVFALGKLMNVKEDNSQLSAIARQGSGSACRSLFGGFVKWIMGKEEDGSDSLA  738
            SAAGFACLV+ L +   V+    +LS IARQGSGSACRS++GGFV+WIMG +EDG DS+A
Sbjct  130  SAAGFACLVYTLAQAFGVE---GELSGIARQGSGSACRSMYGGFVQWIMGSKEDGKDSVA  186

Query  739  VQL  747
             Q+
Sbjct  187  QQV  189



>ref|XP_008308874.1| PREDICTED: diphosphomevalonate decarboxylase [Cynoglossus semilaevis]
 ref|XP_008308875.1| PREDICTED: diphosphomevalonate decarboxylase [Cynoglossus semilaevis]
Length=403

 Score =   183 bits (465),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 111/183 (61%), Positives = 131/183 (72%), Gaps = 7/183 (4%)
 Frame = +1

Query  202  VTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDRMWLNG  381
            VT   P NIAVIKYWGKRDE LILPIN S+SVTL    L TTTTVA S +F +DR+WLNG
Sbjct  13   VTCTAPVNIAVIKYWGKRDEDLILPINSSLSVTLHQDQLKTTTTVATSRSFLEDRLWLNG  72

Query  382  KEMSLSGVRYQNCLKEIRARACDVE-DEKKGIKITKKDWENLHVHIASYNNFPTaaglas  558
            KE  ++  R Q+CL+EIR  A     D   G+ +T        VHI S NNFPTAAGLAS
Sbjct  73   KEEDINHSRLQSCLREIRRLARKRRSDGDAGLNLTGLSQR---VHICSVNNFPTAAGLAS  129

Query  559  saagfaCLVFALGKLMNVKEDNSQLSAIARQGSGSACRSLFGGFVKWIMGKEEDGSDSLA  738
            SAAGFACLV+ L +   V+    +LS IARQGSGSACRS++GGFV+WIMGK++DG DSLA
Sbjct  130  SAAGFACLVYTLAQAFGVE---GELSGIARQGSGSACRSMYGGFVQWIMGKDDDGKDSLA  186

Query  739  VQL  747
             Q+
Sbjct  187  QQV  189



>ref|XP_004913618.1| PREDICTED: diphosphomevalonate decarboxylase isoform X2 [Xenopus 
(Silurana) tropicalis]
Length=417

 Score =   183 bits (465),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 107/182 (59%), Positives = 132/182 (73%), Gaps = 5/182 (3%)
 Frame = +1

Query  202  VTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDRMWLNG  381
            VT   P NIAVIKYWGKR+E LILPIN S+SVTL    L TTT+ A S  F +DR+WLNG
Sbjct  27   VTCTAPVNIAVIKYWGKRNEELILPINSSLSVTLHQDQLKTTTSAAASREFTEDRIWLNG  86

Query  382  KEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTaaglass  561
            KE ++S  R Q+CL+EIR  A    +E+    +++    N  VHI S NNFPTAAGLASS
Sbjct  87   KEENISHPRLQSCLREIRRLARKRRNEEGDENVSR--ILNDKVHICSVNNFPTAAGLASS  144

Query  562  aagfaCLVFALGKLMNVKEDNSQLSAIARQGSGSACRSLFGGFVKWIMGKEEDGSDSLAV  741
            AAG+ACLV+ L KL  V+    +LS IARQGSGSACRS++GGFV+W+MG+ +DG DSLA 
Sbjct  145  AAGYACLVYTLAKLYGVE---GELSEIARQGSGSACRSMYGGFVQWVMGERDDGKDSLAK  201

Query  742  QL  747
            Q+
Sbjct  202  QV  203



>ref|XP_002432413.1| Diphosphomevalonate decarboxylase, putative [Pediculus humanus 
corporis]
 gb|EEB19675.1| Diphosphomevalonate decarboxylase, putative [Pediculus humanus 
corporis]
Length=401

 Score =   183 bits (464),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 104/183 (57%), Positives = 129/183 (70%), Gaps = 3/183 (2%)
 Frame = +1

Query  199  MVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDRMWLN  378
            +VT + P NIA IKYWGKRDETLILP+NDSISVT++   +   TT+A SP F  DR+WLN
Sbjct  3    IVTCKAPVNIAAIKYWGKRDETLILPLNDSISVTINTNFMRAKTTIAASPHFKNDRIWLN  62

Query  379  GKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTaaglas  558
            G+E   +  R   C+ E + R        +G  I  +   N  +HIAS NNFPTAAGLAS
Sbjct  63   GREEDFTNPRLMACVNESKYRQHSNIKSMQGNAIIIEKAANWKIHIASENNFPTAAGLAS  122

Query  559  saagfaCLVFALGKLMNVKEDNSQLSAIARQGSGSACRSLFGGFVKWIMGKEEDGSDSLA  738
            SAAG+ACLV+AL +LM +  D   LS+IAR+GSGSACRS+ GGFV W MGKE+DGSDS+A
Sbjct  123  SAAGYACLVYALSRLMGIDGD---LSSIARKGSGSACRSMHGGFVMWKMGKEKDGSDSVA  179

Query  739  VQL  747
             Q+
Sbjct  180  EQI  182



>ref|XP_005862569.1| PREDICTED: diphosphomevalonate decarboxylase isoform X2 [Myotis 
brandtii]
Length=400

 Score =   183 bits (464),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 105/191 (55%), Positives = 135/191 (71%), Gaps = 9/191 (5%)
 Frame = +1

Query  181  AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  360
            +EK  L +T   P NIAVIKYWGKRDE LILPIN S+SVTL    L TTTT  +S  F +
Sbjct  3    SEKPYLAMTCTAPVNIAVIKYWGKRDEELILPINSSLSVTLHQDQLKTTTTAVISKDFTE  62

Query  361  DRMWLNGKEMSLSGVRYQNCLKEIR--ARACDVEDEKKGIKITKKDWENLHVHIASYNNF  534
            DR+WLNG+E  +   R Q CL+EIR  AR    ++E+  + ++     N  VH+AS NNF
Sbjct  63   DRIWLNGREEDIGQPRIQACLREIRRLARKRRSDEEEDPLPLSL----NYKVHVASVNNF  118

Query  535  PTaaglassaagfaCLVFALGKLMNVKEDNSQLSAIARQGSGSACRSLFGGFVKWIMGKE  714
            PTAAGLASSA+G+ACL +AL ++  V+ D   LS +AR+GSGSACRSL+GGFV+W MG++
Sbjct  119  PTAAGLASSASGYACLAYALARVYGVESD---LSEVARRGSGSACRSLYGGFVEWQMGEQ  175

Query  715  EDGSDSLAVQL  747
             DG DS+A Q+
Sbjct  176  ADGKDSVARQV  186



>ref|XP_005708031.1| diphosphomevalonate decarboxylase isoform 1 [Galdieria sulphuraria]
 gb|EME31511.1| diphosphomevalonate decarboxylase isoform 1 [Galdieria sulphuraria]
Length=394

 Score =   182 bits (463),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 102/185 (55%), Positives = 132/185 (71%), Gaps = 2/185 (1%)
 Frame = +1

Query  196  LMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDRMWL  375
            L VT   P NIA+IKYWGKR+E  ILP+N S+S+TLD A L T TTV  S  FD+DR+WL
Sbjct  8    LTVTCTAPVNIALIKYWGKREEDKILPLNPSLSITLDVADLRTKTTVVASKQFDRDRLWL  67

Query  376  NGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTaagla  555
            NGKE  ++  R Q C++++R  A D+  + K + I K++W+N  +HI S NNFPTAAGLA
Sbjct  68   NGKEHDINNKRMQTCIRKLRQGADDLWRDGK-LMIAKEEWKNYRLHIISENNFPTAAGLA  126

Query  556  ssaagfaCLVFALGKLMNVKED-NSQLSAIARQGSGSACRSLFGGFVKWIMGKEEDGSDS  732
            SSA+G AC V+++ +L+  KE    +L+ IARQGSGSACRSL GGFV W  G   DGSDS
Sbjct  127  SSASGLACFVYSIAQLLQFKETFPGELTTIARQGSGSACRSLLGGFVLWESGTALDGSDS  186

Query  733  LAVQL  747
            +A Q+
Sbjct  187  IARQI  191



>ref|XP_007549941.1| PREDICTED: diphosphomevalonate decarboxylase [Poecilia formosa]
Length=404

 Score =   183 bits (464),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 108/188 (57%), Positives = 135/188 (72%), Gaps = 14/188 (7%)
 Frame = +1

Query  199  MVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDRMWLN  378
            +VT   P NIAVIKYWGKRDE LILPIN S+SVTL    L TTTTVA+S +F +DR+WLN
Sbjct  11   IVTCTAPVNIAVIKYWGKRDEDLILPINSSLSVTLHQDQLKTTTTVAISRSFQEDRLWLN  70

Query  379  GKEMSLSGVRYQNCLKEIRARACDVEDE-----KKGIKITKKDWENLHVHIASYNNFPTa  543
            GKE  ++  R Q+CL+EIR  A    ++     +  + ++ K      VHI S NNFPTA
Sbjct  71   GKEEDITHQRLQSCLREIRRLARKRRNDGDARSEDSVGLSHK------VHICSVNNFPTA  124

Query  544  aglassaagfaCLVFALGKLMNVKEDNSQLSAIARQGSGSACRSLFGGFVKWIMGKEEDG  723
            AGLASSAAGFACLV+ L +   V+    +LS IARQGSGSACRS++GGFV+WIMG +EDG
Sbjct  125  AGLASSAAGFACLVYTLAQAFGVE---GELSGIARQGSGSACRSMYGGFVQWIMGSKEDG  181

Query  724  SDSLAVQL  747
            +DS+A Q+
Sbjct  182  NDSVAQQV  189



>ref|XP_006780089.1| PREDICTED: diphosphomevalonate decarboxylase-like [Neolamprologus 
brichardi]
Length=402

 Score =   182 bits (463),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 109/187 (58%), Positives = 133/187 (71%), Gaps = 13/187 (7%)
 Frame = +1

Query  199  MVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDRMWLN  378
            +VT   P NIAVIKYWGKR+E LILPIN S+SVTL    L TTTTVA S +F +DR+WLN
Sbjct  11   IVTCTAPVNIAVIKYWGKRNEDLILPINSSLSVTLHQDQLKTTTTVATSRSFQEDRIWLN  70

Query  379  GKEMSLSGVRYQNCLKEI----RARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTaa  546
            GKE  ++  R Q+CL+EI    R R  D +       ++ K      VHI S NNFPTAA
Sbjct  71   GKEEDITHPRLQSCLREIRRLARKRRNDGDSGVDSASLSHK------VHICSVNNFPTAA  124

Query  547  glassaagfaCLVFALGKLMNVKEDNSQLSAIARQGSGSACRSLFGGFVKWIMGKEEDGS  726
            GLASSAAGFACLV++L ++  V+    +LS IARQGSGSACRS++GGFV+WIMG +EDG 
Sbjct  125  GLASSAAGFACLVYSLARVFGVE---GELSGIARQGSGSACRSMYGGFVQWIMGNKEDGK  181

Query  727  DSLAVQL  747
            DSLA Q+
Sbjct  182  DSLAQQV  188



>ref|XP_005915248.1| PREDICTED: diphosphomevalonate decarboxylase-like [Haplochromis 
burtoni]
Length=402

 Score =   182 bits (463),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 109/187 (58%), Positives = 133/187 (71%), Gaps = 13/187 (7%)
 Frame = +1

Query  199  MVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDRMWLN  378
            +VT   P NIAVIKYWGKR+E LILPIN S+SVTL    L TTTTVA S +F +DR+WLN
Sbjct  11   IVTCTAPVNIAVIKYWGKRNEDLILPINSSLSVTLHQDQLKTTTTVATSRSFQEDRIWLN  70

Query  379  GKEMSLSGVRYQNCLKEI----RARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTaa  546
            GKE  ++  R Q+CL+EI    R R  D +       ++ K      VHI S NNFPTAA
Sbjct  71   GKEEDITHPRLQSCLREIRRLARKRRNDGDSGVDSASLSHK------VHICSVNNFPTAA  124

Query  547  glassaagfaCLVFALGKLMNVKEDNSQLSAIARQGSGSACRSLFGGFVKWIMGKEEDGS  726
            GLASSAAGFACLV++L ++  V+    +LS IARQGSGSACRS++GGFV+WIMG +EDG 
Sbjct  125  GLASSAAGFACLVYSLARVFGVE---GELSGIARQGSGSACRSMYGGFVQWIMGNKEDGK  181

Query  727  DSLAVQL  747
            DSLA Q+
Sbjct  182  DSLAQQV  188



>ref|XP_005753004.1| PREDICTED: diphosphomevalonate decarboxylase-like [Pundamilia 
nyererei]
Length=402

 Score =   182 bits (462),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 109/187 (58%), Positives = 133/187 (71%), Gaps = 13/187 (7%)
 Frame = +1

Query  199  MVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDRMWLN  378
            +VT   P NIAVIKYWGKR+E LILPIN S+SVTL    L TTTTVA S +F +DR+WLN
Sbjct  11   IVTCTAPVNIAVIKYWGKRNEDLILPINSSLSVTLHQDQLKTTTTVATSRSFQEDRIWLN  70

Query  379  GKEMSLSGVRYQNCLKEI----RARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTaa  546
            GKE  ++  R Q+CL+EI    R R  D +       ++ K      VHI S NNFPTAA
Sbjct  71   GKEEDITHPRLQSCLREIRRLARKRRNDGDSGVDSASLSHK------VHICSVNNFPTAA  124

Query  547  glassaagfaCLVFALGKLMNVKEDNSQLSAIARQGSGSACRSLFGGFVKWIMGKEEDGS  726
            GLASSAAGFACLV++L ++  V+    +LS IARQGSGSACRS++GGFV+WIMG +EDG 
Sbjct  125  GLASSAAGFACLVYSLARVFGVE---GELSGIARQGSGSACRSMYGGFVQWIMGNKEDGK  181

Query  727  DSLAVQL  747
            DSLA Q+
Sbjct  182  DSLAQQV  188



>ref|XP_002735076.1| PREDICTED: diphosphomevalonate decarboxylase-like [Saccoglossus 
kowalevskii]
Length=405

 Score =   182 bits (462),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 105/184 (57%), Positives = 133/184 (72%), Gaps = 7/184 (4%)
 Frame = +1

Query  202  VTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDRMWLNG  381
            VT   P NIAVIKYWGKRDE LILP N S+S +LD  HL +TTT ++S  F +DR+WLNG
Sbjct  15   VTCTAPINIAVIKYWGKRDEQLILPTNSSLSASLDQDHLKSTTTASISKEFKRDRLWLNG  74

Query  382  KEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTaaglass  561
            KE S+   R QNCL EIR RA     ++K    +K +  N  VHI S NNFPTAAGLASS
Sbjct  75   KEESIENPRIQNCLIEIRRRA----RKRKHNDDSKSEMLNWSVHICSENNFPTAAGLASS  130

Query  562  aagfaCLVFALGKLMNVKEDNSQLSAIARQGSGSACRSLFGGFVKWIMGKEEDGSDSLAV  741
            AAG+ACLV+ L KL ++   N  +S IAR+GSGSACRS++GGFV+W +G++++GSDS+A 
Sbjct  131  AAGYACLVYTLSKLYDI---NGDVSDIARRGSGSACRSIYGGFVQWTVGEKKNGSDSIAK  187

Query  742  QLVD  753
             + D
Sbjct  188  VVAD  191



>ref|XP_005708030.1| diphosphomevalonate decarboxylase isoform 2 [Galdieria sulphuraria]
 gb|EME31510.1| diphosphomevalonate decarboxylase isoform 2 [Galdieria sulphuraria]
Length=411

 Score =   182 bits (462),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 102/185 (55%), Positives = 132/185 (71%), Gaps = 2/185 (1%)
 Frame = +1

Query  196  LMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDRMWL  375
            L VT   P NIA+IKYWGKR+E  ILP+N S+S+TLD A L T TTV  S  FD+DR+WL
Sbjct  8    LTVTCTAPVNIALIKYWGKREEDKILPLNPSLSITLDVADLRTKTTVVASKQFDRDRLWL  67

Query  376  NGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTaagla  555
            NGKE  ++  R Q C++++R  A D+  + K + I K++W+N  +HI S NNFPTAAGLA
Sbjct  68   NGKEHDINNKRMQTCIRKLRQGADDLWRDGK-LMIAKEEWKNYRLHIISENNFPTAAGLA  126

Query  556  ssaagfaCLVFALGKLMNVKED-NSQLSAIARQGSGSACRSLFGGFVKWIMGKEEDGSDS  732
            SSA+G AC V+++ +L+  KE    +L+ IARQGSGSACRSL GGFV W  G   DGSDS
Sbjct  127  SSASGLACFVYSIAQLLQFKETFPGELTTIARQGSGSACRSLLGGFVLWESGTALDGSDS  186

Query  733  LAVQL  747
            +A Q+
Sbjct  187  IARQI  191



>ref|NP_001267865.1| diphosphomevalonate decarboxylase [Bombus terrestris]
 gb|AFI55102.1| diphosphomevalonate decarboxylase [Bombus terrestris]
Length=384

 Score =   182 bits (461),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 108/183 (59%), Positives = 129/183 (70%), Gaps = 14/183 (8%)
 Frame = +1

Query  202  VTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDRMWLNG  381
            VT     NIAVIKYWGKRDETLILP+NDSIS TLD  HL T TTV +SP F +D++WLNG
Sbjct  4    VTCIASVNIAVIKYWGKRDETLILPVNDSISATLDTDHLHTKTTVMISPTFKEDQIWLNG  63

Query  382  KEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTaaglass  561
            +E  +   R QNCL +IR RA +     +        W+   VHI S NNFPTAAGLASS
Sbjct  64   QEEDIKNPRLQNCLTQIRKRARNSNHIDQ--------WK---VHICSENNFPTAAGLASS  112

Query  562  aagfaCLVFALGKLMNVKEDNSQLSAIARQGSGSACRSLFGGFVKWIMGKEEDGSDSLAV  741
            AAG+ACLV AL KL  V+ D   +S+IAR GSGSACRS+ GGFV+W MG E +G+DS+A 
Sbjct  113  AAGYACLVAALAKLYQVEGD---ISSIARIGSGSACRSVMGGFVRWYMGSEPNGADSIAK  169

Query  742  QLV  750
            Q+V
Sbjct  170  QIV  172



>ref|XP_003442298.1| PREDICTED: diphosphomevalonate decarboxylase-like [Oreochromis 
niloticus]
Length=402

 Score =   182 bits (461),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 109/187 (58%), Positives = 132/187 (71%), Gaps = 13/187 (7%)
 Frame = +1

Query  199  MVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDRMWLN  378
            +VT   P NIAVIKYWGKR+E LILPIN S+SVTL    L TTTTVA S +F +DR+WLN
Sbjct  11   IVTCTAPVNIAVIKYWGKRNEDLILPINSSLSVTLHQDQLKTTTTVATSRSFQEDRIWLN  70

Query  379  GKEMSLSGVRYQNCLKEI----RARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTaa  546
            GKE  ++  R Q+CL+EI    R R  D +       ++ K      VHI S NNFPTAA
Sbjct  71   GKEEDITHPRLQSCLREIRRLARKRRNDGDSGVDSASLSHK------VHICSVNNFPTAA  124

Query  547  glassaagfaCLVFALGKLMNVKEDNSQLSAIARQGSGSACRSLFGGFVKWIMGKEEDGS  726
            GLASSAAGFACLV+ L ++  V+    +LS IARQGSGSACRS++GGFV+WIMG +EDG 
Sbjct  125  GLASSAAGFACLVYTLARVFGVE---GELSGIARQGSGSACRSMYGGFVQWIMGNKEDGK  181

Query  727  DSLAVQL  747
            DSLA Q+
Sbjct  182  DSLAQQV  188



>gb|ACO09861.1| Diphosphomevalonate decarboxylase [Osmerus mordax]
Length=398

 Score =   182 bits (461),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 103/183 (56%), Positives = 132/183 (72%), Gaps = 9/183 (5%)
 Frame = +1

Query  199  MVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDRMWLN  378
            MVT   P NIAVIKYWGKRDE LILPIN S+SVTL    L TTTTVA S +F++DR+WLN
Sbjct  11   MVTCSAPVNIAVIKYWGKRDEELILPINSSLSVTLHQDQLRTTTTVACSRSFEEDRIWLN  70

Query  379  GKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTaaglas  558
            G+E  ++  R Q+CL+E+R  A     +     ++ K       HI S NNFPTAAGLAS
Sbjct  71   GREEDITLPRLQSCLREVRRLARKRHSDGDPAGLSHK------FHICSVNNFPTAAGLAS  124

Query  559  saagfaCLVFALGKLMNVKEDNSQLSAIARQGSGSACRSLFGGFVKWIMGKEEDGSDSLA  738
            SAAG+ACLV++L +++ V+    +LS +ARQGSGSACRS++GGFV+W MG+ EDG DS+A
Sbjct  125  SAAGYACLVYSLARVLGVE---GELSVVARQGSGSACRSMYGGFVQWTMGQREDGKDSIA  181

Query  739  VQL  747
             Q+
Sbjct  182  QQV  184



>ref|XP_006008326.1| PREDICTED: diphosphomevalonate decarboxylase isoform X2 [Latimeria 
chalumnae]
Length=366

 Score =   181 bits (459),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 111/195 (57%), Positives = 136/195 (70%), Gaps = 14/195 (7%)
 Frame = +1

Query  178  MAEK-WVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAF  354
            MAEK  V  VT   P NIAVIKYWGKRD+ LILPIN S+SVTL    L TTTTV  S  F
Sbjct  1    MAEKKTVTRVTCTAPVNIAVIKYWGKRDDDLILPINSSLSVTLHQNQLKTTTTVVASREF  60

Query  355  DQDRMWLNGKEMSLSGVRYQNCLKEI----RARACDVEDEKKGIKITKKDWENLHVHIAS  522
             +DR+WLNGKE +++  R Q+CL+EI    R R  D E +   + ++ K      +HI S
Sbjct  61   KEDRIWLNGKEDNINQPRLQSCLREIQRLARKRRSDGEGDSSPLNLSYK------IHICS  114

Query  523  YNNFPTaaglassaagfaCLVFALGKLMNVKEDNSQLSAIARQGSGSACRSLFGGFVKWI  702
             NNFPTAAGLASSAAG+ACLV+AL KL +V+    ++S IARQGSGSACRS+ GGFV+W 
Sbjct  115  INNFPTAAGLASSAAGYACLVYALAKLYSVE---GEMSEIARQGSGSACRSMHGGFVQWN  171

Query  703  MGKEEDGSDSLAVQL  747
            MG+  DG DS+A Q+
Sbjct  172  MGERADGKDSIAQQV  186



>ref|XP_010792093.1| PREDICTED: diphosphomevalonate decarboxylase [Notothenia coriiceps]
Length=402

 Score =   182 bits (461),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 106/183 (58%), Positives = 132/183 (72%), Gaps = 5/183 (3%)
 Frame = +1

Query  199  MVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDRMWLN  378
            +VT   P NIAVIKYWGKR+E LILPIN S+SVTL    L TTTT+A S +F +DR+WLN
Sbjct  11   IVTCTAPVNIAVIKYWGKRNEELILPINSSLSVTLHQDQLKTTTTIATSRSFKEDRIWLN  70

Query  379  GKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTaaglas  558
            GKE  ++  R Q+CL+EIR  A    ++  G         +L VHI S NNFPTAAGLAS
Sbjct  71   GKEEDITHPRLQSCLREIRRLARKRRND--GDPALDPSVLSLKVHICSVNNFPTAAGLAS  128

Query  559  saagfaCLVFALGKLMNVKEDNSQLSAIARQGSGSACRSLFGGFVKWIMGKEEDGSDSLA  738
            SAAGFACLV+ L ++   +    +LS IARQGSGSACRS++GGFV+WIMG+++DG DSLA
Sbjct  129  SAAGFACLVYTLARVFGTE---GELSGIARQGSGSACRSMYGGFVQWIMGQKDDGKDSLA  185

Query  739  VQL  747
             Q+
Sbjct  186  QQV  188



>ref|XP_010966484.1| PREDICTED: diphosphomevalonate decarboxylase [Camelus bactrianus]
Length=400

 Score =   182 bits (461),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 108/189 (57%), Positives = 129/189 (68%), Gaps = 5/189 (3%)
 Frame = +1

Query  181  AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  360
            AEK V+ VT   P NIAVIKYWGKRDE LILPIN S+SVTL    L TTTT A+S  F +
Sbjct  3    AEKPVVAVTCTAPVNIAVIKYWGKRDEKLILPINSSLSVTLHQDQLKTTTTAAISRDFTE  62

Query  361  DRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPT  540
            DR+WLNG+E  +   R Q CLKEIR  AC          +      +  VHIAS NNFPT
Sbjct  63   DRIWLNGREEDIGQPRLQACLKEIRRLACKRRSGSPEDPLPLS--HSCKVHIASENNFPT  120

Query  541  aaglassaagfaCLVFALGKLMNVKEDNSQLSAIARQGSGSACRSLFGGFVKWIMGKEED  720
            AAGLASSAAG+ACL + L ++  V+ D   LS +AR+GSGSACRSL+GGFV+W MG+  D
Sbjct  121  AAGLASSAAGYACLAYTLARVYGVESD---LSEVARRGSGSACRSLYGGFVEWQMGERAD  177

Query  721  GSDSLAVQL  747
            G DS+A Q+
Sbjct  178  GKDSIARQV  186



>ref|XP_004539436.1| PREDICTED: diphosphomevalonate decarboxylase-like [Maylandia 
zebra]
Length=402

 Score =   181 bits (460),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 108/187 (58%), Positives = 133/187 (71%), Gaps = 13/187 (7%)
 Frame = +1

Query  199  MVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDRMWLN  378
            +VT   P NIAVIKYWGKR+E +ILPIN S+SVTL    L TTTTVA S +F +DR+WLN
Sbjct  11   IVTCTAPVNIAVIKYWGKRNEDIILPINSSLSVTLHQDQLKTTTTVATSRSFQEDRIWLN  70

Query  379  GKEMSLSGVRYQNCLKEI----RARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTaa  546
            GKE  ++  R Q+CL+EI    R R  D +       ++ K      VHI S NNFPTAA
Sbjct  71   GKEEDITHPRLQSCLREIRRLARKRRNDGDSGVDSASLSHK------VHICSVNNFPTAA  124

Query  547  glassaagfaCLVFALGKLMNVKEDNSQLSAIARQGSGSACRSLFGGFVKWIMGKEEDGS  726
            GLASSAAGFACLV++L ++  V+    +LS IARQGSGSACRS++GGFV+WIMG +EDG 
Sbjct  125  GLASSAAGFACLVYSLARVFGVE---GELSGIARQGSGSACRSMYGGFVQWIMGNKEDGK  181

Query  727  DSLAVQL  747
            DSLA Q+
Sbjct  182  DSLAQQV  188



>gb|AAH63907.1| mvd-prov protein, partial [Xenopus (Silurana) tropicalis]
Length=402

 Score =   181 bits (460),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 106/182 (58%), Positives = 132/182 (73%), Gaps = 5/182 (3%)
 Frame = +1

Query  202  VTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDRMWLNG  381
            VT   P NIAVIKYWGK++E LILPIN S+SVTL    L TTT+ A S  F +DR+WLNG
Sbjct  12   VTCTAPVNIAVIKYWGKQNEELILPINSSLSVTLHQDQLKTTTSAAASREFTEDRIWLNG  71

Query  382  KEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTaaglass  561
            KE ++S  R Q+CL+EIR  A    +E+    +++    N  VHI S NNFPTAAGLASS
Sbjct  72   KEENISHPRLQSCLREIRRLARKRRNEEGDENVSR--ILNDKVHICSVNNFPTAAGLASS  129

Query  562  aagfaCLVFALGKLMNVKEDNSQLSAIARQGSGSACRSLFGGFVKWIMGKEEDGSDSLAV  741
            AAG+ACLV+ L KL  V+    +LS IARQGSGSACRS++GGFV+W+MG+ +DG DSLA 
Sbjct  130  AAGYACLVYTLAKLYGVE---GELSEIARQGSGSACRSMYGGFVQWVMGERDDGKDSLAK  186

Query  742  QL  747
            Q+
Sbjct  187  QV  188



>ref|XP_004362385.1| diphosphomevalonate decarboxylase [Dictyostelium fasciculatum]
 gb|EGG24534.1| diphosphomevalonate decarboxylase [Dictyostelium fasciculatum]
Length=415

 Score =   181 bits (460),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 105/182 (58%), Positives = 128/182 (70%), Gaps = 15/182 (8%)
 Frame = +1

Query  202  VTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDRMWLNG  381
            VT   P NIA IKYWGKRDE LILP+N S+S TL    L TTTT   S +F++D +WLNG
Sbjct  28   VTCTAPVNIATIKYWGKRDENLILPLNSSLSGTLHQDDLKTTTTAVASESFEEDALWLNG  87

Query  382  KEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTaaglass  561
            K+  ++ VRYQN LK IR+RA  + D+K              VHI S NNFPTAAGLASS
Sbjct  88   KKEDVNSVRYQNVLKTIRSRATKLMDKKH------------FVHICSINNFPTAAGLASS  135

Query  562  aagfaCLVFALGKLMNVKEDNSQLSAIARQGSGSACRSLFGGFVKWIMGKEEDGSDSLAV  741
            A+G+ACLV+ L +L  V+ D   +S+IAR GSGSACRS+FGGFVKW MG + DGSDS+AV
Sbjct  136  ASGYACLVYVLAQLYGVEGD---VSSIARLGSGSACRSMFGGFVKWEMGTKADGSDSIAV  192

Query  742  QL  747
            Q+
Sbjct  193  QV  194



>ref|NP_001007423.1| diphosphomevalonate decarboxylase [Danio rerio]
 sp|Q5U403.1|MVD1_DANRE RecName: Full=Diphosphomevalonate decarboxylase; AltName: Full=Mevalonate 
(diphospho)decarboxylase; Short=MDDase; AltName: 
Full=Mevalonate pyrophosphate decarboxylase [Danio rerio]
 gb|AAH85325.1| Zgc:100824 [Danio rerio]
Length=400

 Score =   181 bits (459),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 108/183 (59%), Positives = 130/183 (71%), Gaps = 8/183 (4%)
 Frame = +1

Query  199  MVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDRMWLN  378
            MVT   P NIAVIKYWGKRDE LILP+N S+SVTL   HL TTTT+A S +F +D +WLN
Sbjct  11   MVTCTAPVNIAVIKYWGKRDEDLILPVNASLSVTLHQDHLRTTTTIACSRSFHKDCIWLN  70

Query  379  GKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTaaglas  558
            GKE  +S  R Q+CL EIR  A      +K       D  N  VHI S NNFPTAAGLAS
Sbjct  71   GKEQDISHPRLQSCLLEIRRLA----QRRKNTGDPASDVSN-KVHICSVNNFPTAAGLAS  125

Query  559  saagfaCLVFALGKLMNVKEDNSQLSAIARQGSGSACRSLFGGFVKWIMGKEEDGSDSLA  738
            SAAG+ACLV+ L +L NV+    +LS +ARQGSGSACRSL+GGFV+W +G++ DG DS+A
Sbjct  126  SAAGYACLVYTLSQLFNVE---GELSGVARQGSGSACRSLYGGFVQWKLGEQSDGKDSIA  182

Query  739  VQL  747
             Q+
Sbjct  183  EQV  185



>ref|XP_003228605.1| PREDICTED: diphosphomevalonate decarboxylase [Anolis carolinensis]
Length=406

 Score =   181 bits (459),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 113/200 (57%), Positives = 137/200 (69%), Gaps = 19/200 (10%)
 Frame = +1

Query  178  MAEKWVL-MVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAF  354
            MAE   L MVT   P NIAVIKYWGKRDE LILPIN S+SVTL    L TTTT A+S  F
Sbjct  1    MAEDHPLSMVTCTAPINIAVIKYWGKRDEKLILPINSSLSVTLHQDQLKTTTTAAISRDF  60

Query  355  DQDRMWLNGKEMSLSGVRYQNCLKEIR-----ARACDVEDEKKG----IKITKKDWENLH  507
             +DR+WLNGKE  +   R Q+CL+EIR      R+ D +  + G    + +T K      
Sbjct  61   TEDRLWLNGKESDIGHPRLQSCLREIRRLARKRRSGDTKGPEGGEPSPLSLTYK------  114

Query  508  VHIASYNNFPTaaglassaagfaCLVFALGKLMNVKEDNSQLSAIARQGSGSACRSLFGG  687
            VHIAS NNFPTAAGLASSAAG+ACLV+ L KL  V+ D   LS +AR GSGSACRS+FGG
Sbjct  115  VHIASENNFPTAAGLASSAAGYACLVYTLAKLYGVEGD---LSEVARMGSGSACRSMFGG  171

Query  688  FVKWIMGKEEDGSDSLAVQL  747
            FV+W+ G++ DG +S+A Q+
Sbjct  172  FVQWVKGEDADGKESIAEQV  191



>ref|XP_006008325.1| PREDICTED: diphosphomevalonate decarboxylase isoform X1 [Latimeria 
chalumnae]
Length=400

 Score =   181 bits (459),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 111/195 (57%), Positives = 136/195 (70%), Gaps = 14/195 (7%)
 Frame = +1

Query  178  MAEK-WVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAF  354
            MAEK  V  VT   P NIAVIKYWGKRD+ LILPIN S+SVTL    L TTTTV  S  F
Sbjct  1    MAEKKTVTRVTCTAPVNIAVIKYWGKRDDDLILPINSSLSVTLHQNQLKTTTTVVASREF  60

Query  355  DQDRMWLNGKEMSLSGVRYQNCLKEI----RARACDVEDEKKGIKITKKDWENLHVHIAS  522
             +DR+WLNGKE +++  R Q+CL+EI    R R  D E +   + ++ K      +HI S
Sbjct  61   KEDRIWLNGKEDNINQPRLQSCLREIQRLARKRRSDGEGDSSPLNLSYK------IHICS  114

Query  523  YNNFPTaaglassaagfaCLVFALGKLMNVKEDNSQLSAIARQGSGSACRSLFGGFVKWI  702
             NNFPTAAGLASSAAG+ACLV+AL KL +V+    ++S IARQGSGSACRS+ GGFV+W 
Sbjct  115  INNFPTAAGLASSAAGYACLVYALAKLYSVE---GEMSEIARQGSGSACRSMHGGFVQWN  171

Query  703  MGKEEDGSDSLAVQL  747
            MG+  DG DS+A Q+
Sbjct  172  MGERADGKDSIAQQV  186



>ref|XP_004310733.1| PREDICTED: diphosphomevalonate decarboxylase [Tursiops truncatus]
Length=400

 Score =   181 bits (459),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 107/193 (55%), Positives = 134/193 (69%), Gaps = 13/193 (7%)
 Frame = +1

Query  181  AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  360
            +EK + +VT   P NIAVIKYWGKRDE LILPIN S+SVTL    L TTTT A+S  F +
Sbjct  3    SEKRLEVVTCTAPVNIAVIKYWGKRDEELILPINSSLSVTLHQDQLKTTTTAAISRDFTE  62

Query  361  DRMWLNGKEMSLSGVRYQNCLKEI----RARACDVEDEKKGIKITKKDWENLHVHIASYN  528
            DR+WLNG+E  +   R Q CL+EI    R R  D  +E   + ++ K      VH+AS N
Sbjct  63   DRIWLNGREEDVGQPRLQACLREIRRLARKRRSDGHEEPLPLSLSYK------VHVASVN  116

Query  529  NFPTaaglassaagfaCLVFALGKLMNVKEDNSQLSAIARQGSGSACRSLFGGFVKWIMG  708
            NFPTAAGLASSAAG+ACL +AL ++  V+ D   LS +AR+GSGSACRSL+GGFV+W MG
Sbjct  117  NFPTAAGLASSAAGYACLAYALARVYGVESD---LSEVARRGSGSACRSLYGGFVEWQMG  173

Query  709  KEEDGSDSLAVQL  747
            +  DG DS+A Q+
Sbjct  174  ERADGKDSIARQV  186



>ref|XP_008403677.1| PREDICTED: diphosphomevalonate decarboxylase [Poecilia reticulata]
Length=403

 Score =   181 bits (459),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 107/183 (58%), Positives = 130/183 (71%), Gaps = 4/183 (2%)
 Frame = +1

Query  199  MVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDRMWLN  378
            +VT   P NIAVIKYWGKRDE LILPIN S+SVTL    L TTTTVA+S +F +DR+WLN
Sbjct  11   IVTCTAPVNIAVIKYWGKRDEDLILPINSSLSVTLHQDQLKTTTTVAISRSFQEDRLWLN  70

Query  379  GKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTaaglas  558
            GKE  ++  R Q+CL+EIR R           + T     +  VHI S NNFPTAAGLAS
Sbjct  71   GKEEDITHQRLQSCLREIR-RLTRKRRTDGDARSTDSVGLSHKVHICSVNNFPTAAGLAS  129

Query  559  saagfaCLVFALGKLMNVKEDNSQLSAIARQGSGSACRSLFGGFVKWIMGKEEDGSDSLA  738
            SAAGFACLV+ L +   V+    +LS IARQGSGSACRS++GGFV+WIMG ++DG DS+A
Sbjct  130  SAAGFACLVYTLAQAFGVE---GELSGIARQGSGSACRSMYGGFVQWIMGSKDDGKDSVA  186

Query  739  VQL  747
             Q+
Sbjct  187  QQV  189



>ref|XP_004356734.1| diphosphomevalonate decarboxylase [Acanthamoeba castellanii str. 
Neff]
 gb|ELR24834.1| diphosphomevalonate decarboxylase [Acanthamoeba castellanii str. 
Neff]
Length=412

 Score =   181 bits (458),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 106/190 (56%), Positives = 132/190 (69%), Gaps = 9/190 (5%)
 Frame = +1

Query  178  MAEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFD  357
            MA    L VTAQ P NIAVIKYWGK DE LILP+N S+S TL    LCTTTTV  S  F 
Sbjct  1    MATTKALCVTAQAPVNIAVIKYWGKTDEKLILPLNSSLSTTLSMTDLCTTTTVMASKEFK  60

Query  358  QDRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFP  537
            +DR+WLNGKE S+S  R QNC+ ++ AR+  +  ++ G  + +      H HI S NNFP
Sbjct  61   EDRLWLNGKEESVSSGRMQNCIGQLVARSGLL--KRLGENVEEGKAREYHFHIVSVNNFP  118

Query  538  TaaglassaagfaCLVFALGKLMNVKEDNSQLSAIARQGSGSACRSLFGGFVKWIMGKEE  717
            TAAGLASSA+GFACL + LG L+ V+ D   LSAIAR GSG    S++GGFVKW+ G++ 
Sbjct  119  TAAGLASSASGFACLTYTLGTLLEVEGD---LSAIARLGSG----SIYGGFVKWVKGEKA  171

Query  718  DGSDSLAVQL  747
            DG+DS+AVQ+
Sbjct  172  DGTDSIAVQV  181



>ref|XP_003970115.1| PREDICTED: diphosphomevalonate decarboxylase [Takifugu rubripes]
Length=397

 Score =   180 bits (457),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 106/183 (58%), Positives = 132/183 (72%), Gaps = 5/183 (3%)
 Frame = +1

Query  199  MVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDRMWLN  378
            +VT   P NIAVIKYWGKR+E LILPIN S+SVTL    L TTTTV  S +F +DR+WLN
Sbjct  6    IVTCTAPVNIAVIKYWGKRNEELILPINSSLSVTLHQDQLKTTTTVVASKSFQEDRIWLN  65

Query  379  GKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTaaglas  558
            GKE  +S  R Q+CL+E+R  A    ++  G         +  VHI S NNFPTAAGLAS
Sbjct  66   GKEEDISHPRLQSCLREVRRLARKRRND--GNPSLDSAVLSHKVHICSVNNFPTAAGLAS  123

Query  559  saagfaCLVFALGKLMNVKEDNSQLSAIARQGSGSACRSLFGGFVKWIMGKEEDGSDSLA  738
            SAAGFACLV+ L ++  V+    +LSAIARQGSGSACRS++GGFV+W+MG++EDG DS+A
Sbjct  124  SAAGFACLVYTLARVFGVE---GELSAIARQGSGSACRSMYGGFVQWLMGQKEDGKDSVA  180

Query  739  VQL  747
             Q+
Sbjct  181  QQV  183



>ref|XP_002592260.1| hypothetical protein BRAFLDRAFT_277163 [Branchiostoma floridae]
 gb|EEN48271.1| hypothetical protein BRAFLDRAFT_277163 [Branchiostoma floridae]
Length=409

 Score =   180 bits (457),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 108/187 (58%), Positives = 130/187 (70%), Gaps = 11/187 (6%)
 Frame = +1

Query  193  VLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDRMW  372
            +  VT   P NIAVIKYWGKRDE L+LPIN S+SVTL    LC  TTVA S  F +DR+W
Sbjct  14   ISQVTCTAPVNIAVIKYWGKRDEQLVLPINPSLSVTLSQDQLCARTTVAASADFKRDRVW  73

Query  373  LNGKEMSLSGVRYQNCLKEIR--ARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTaa  546
            LNG+E S+   R Q CL EIR  AR    +DE+ G      D     VH+ S NNFPTAA
Sbjct  74   LNGQEQSVDAPRLQKCLGEIRRLARKRKHKDERAG------DLLGSCVHVCSENNFPTAA  127

Query  547  glassaagfaCLVFALGKLMNVKEDNSQLSAIARQGSGSACRSLFGGFVKWIMGKEEDGS  726
            GLASSAAG+ACLV +L KL ++  D   +S IARQGSGSACRS++GGFV+W MG+ EDG+
Sbjct  128  GLASSAAGYACLVQSLAKLFHIDGD---VSHIARQGSGSACRSMYGGFVEWTMGRLEDGA  184

Query  727  DSLAVQL  747
            DS+A Q+
Sbjct  185  DSVAKQV  191



>gb|EUC58622.1| diphosphomevalonate decarboxylase [Rhizoctonia solani AG-3 Rhs1AP]
 gb|KEP49587.1| diphosphomevalonate decarboxylase [Rhizoctonia solani 123E]
Length=400

 Score =   180 bits (456),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 108/188 (57%), Positives = 129/188 (69%), Gaps = 7/188 (4%)
 Frame = +1

Query  193  VLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDRMW  372
            V   TA  P NIA IKYWGKRD  LILP N S+SVTLD  HL +TTT    P+F QD++W
Sbjct  3    VYQATATAPVNIACIKYWGKRDTKLILPTNSSLSVTLDQDHLRSTTTSRADPSFTQDQLW  62

Query  373  LNGKEMSL-SGVRYQNCLKEI-RARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTaa  546
            LNGKE  +  G R   C+ E+ R RA   E +    KI++      +VHIASYNNFPTAA
Sbjct  63   LNGKEDEIKPGGRLATCITEMKRLRAKLEESDSSKPKISE-----YNVHIASYNNFPTAA  117

Query  547  glassaagfaCLVFALGKLMNVKEDNSQLSAIARQGSGSACRSLFGGFVKWIMGKEEDGS  726
            GLASSA+GFA LV +L +L  +    S+LS+IARQGSGSACRSLFGG+V W MG + DGS
Sbjct  118  GLASSASGFAALVASLAQLYQLPSTPSELSSIARQGSGSACRSLFGGYVAWEMGTKPDGS  177

Query  727  DSLAVQLV  750
            DS AVQ+ 
Sbjct  178  DSFAVQVA  185



>ref|XP_011670280.1| PREDICTED: LOW QUALITY PROTEIN: diphosphomevalonate decarboxylase 
[Strongylocentrotus purpuratus]
Length=387

 Score =   179 bits (455),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 105/184 (57%), Positives = 131/184 (71%), Gaps = 8/184 (4%)
 Frame = +1

Query  202  VTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDRMWLNG  381
            VT + P NIAVIKYWGKRDE LILP+N S+S TL    LCTTT++A S  F +DR+WLNG
Sbjct  7    VTCKAPINIAVIKYWGKRDEKLILPVNSSLSATLHIDQLCTTTSIAGSKHFPEDRLWLNG  66

Query  382  KEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTaaglass  561
            KE SL   R + CL+EIR RA      K+ I   + + E+  +HI S NNFPTAAGLASS
Sbjct  67   KEESLENPRVKTCLQEIRKRA-----RKRKISDDESNPEDWKLHICSENNFPTAAGLASS  121

Query  562  aagfaCLVFALGKLMNVKEDNSQLSAIARQGSGSACRSLFGGFVKWIMGKEEDGSDSLAV  741
            AAG+ACLV  L ++  V+     +S IARQGSGSACRS++GGFV+W+ G+   GSDS+A 
Sbjct  122  AAGYACLVATLAQVYGVQ---GNVSDIARQGSGSACRSMYGGFVEWLDGESSCGSDSIAQ  178

Query  742  QLVD  753
            Q+VD
Sbjct  179  QVVD  182



>ref|XP_011497479.1| PREDICTED: diphosphomevalonate decarboxylase [Ceratosolen solmsi 
marchali]
Length=391

 Score =   180 bits (456),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 103/184 (56%), Positives = 126/184 (68%), Gaps = 14/184 (8%)
 Frame = +1

Query  199  MVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDRMWLN  378
            +VT   P NIAVIKYWGKRD+ LILP+NDSIS TLD  HLCT TT   S  F +DRMWLN
Sbjct  3    VVTCIAPINIAVIKYWGKRDDDLILPVNDSISTTLDKDHLCTKTTAMASSDFKEDRMWLN  62

Query  379  GKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTaaglas  558
            G E S+   R QNCL+E++ RA   E           + +N  +HI S NNFPTAAGLAS
Sbjct  63   GSEQSMDNPRLQNCLRELKKRAQISE-----------EMQNWKLHICSENNFPTAAGLAS  111

Query  559  saagfaCLVFALGKLMNVKEDNSQLSAIARQGSGSACRSLFGGFVKWIMGKEEDGSDSLA  738
            SAAG+ACLV  + KL  V+    ++S +AR GSGSACRS++GGFV+W MG +  GSDS+A
Sbjct  112  SAAGYACLVTTIAKLYKVE---GEVSELARVGSGSACRSMYGGFVRWFMGSDPKGSDSIA  168

Query  739  VQLV  750
              +V
Sbjct  169  KPIV  172



>ref|XP_003287684.1| hypothetical protein DICPUDRAFT_32847 [Dictyostelium purpureum]
 gb|EGC35790.1| hypothetical protein DICPUDRAFT_32847 [Dictyostelium purpureum]
Length=388

 Score =   179 bits (455),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 101/182 (55%), Positives = 127/182 (70%), Gaps = 15/182 (8%)
 Frame = +1

Query  202  VTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDRMWLNG  381
            +T   P NIAVIKYWGKRDE LILP+N S+S TL    L TTTT+  S  + +D +WLNG
Sbjct  6    ITCSAPVNIAVIKYWGKRDEKLILPLNSSLSGTLHQDDLKTTTTIVASEDYTEDAIWLNG  65

Query  382  KEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTaaglass  561
            K+  ++  RYQN LK IR+RA  ++D+K              VHI S NNFPTAAGLASS
Sbjct  66   KKEDINATRYQNVLKAIRSRATKLQDKKHC------------VHIVSINNFPTAAGLASS  113

Query  562  aagfaCLVFALGKLMNVKEDNSQLSAIARQGSGSACRSLFGGFVKWIMGKEEDGSDSLAV  741
            A+G+ CLV+ L ++  V  D   +S IAR GSGSACRS++GGFVKW MG++EDGSDS+AV
Sbjct  114  ASGYCCLVYTLAQIYGVDGD---ISGIARIGSGSACRSMYGGFVKWEMGEKEDGSDSIAV  170

Query  742  QL  747
            Q+
Sbjct  171  QV  172



>ref|XP_008553889.1| PREDICTED: diphosphomevalonate decarboxylase [Microplitis demolitor]
 gb|EZA44851.1| diphosphomevalonate decarboxylase [Microplitis demolitor]
Length=386

 Score =   179 bits (455),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 104/183 (57%), Positives = 127/183 (69%), Gaps = 14/183 (8%)
 Frame = +1

Query  199  MVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDRMWLN  378
            +VT   P NIAVIKYWGKRDE LILPINDSIS++LD   LCT TTV  SP F ++++WLN
Sbjct  3    IVTCIAPVNIAVIKYWGKRDEDLILPINDSISLSLDTKQLCTKTTVMASPNFKENKIWLN  62

Query  379  GKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTaaglas  558
            G+E S++  R QNCL++I+++A               + E   VHI S NNFPTAAGLAS
Sbjct  63   GREESMNNKRLQNCLEKIKSKAT-----------LTNEMEMWKVHICSNNNFPTAAGLAS  111

Query  559  saagfaCLVFALGKLMNVKEDNSQLSAIARQGSGSACRSLFGGFVKWIMGKEEDGSDSLA  738
            SAAG+ACL  AL KL N   D   +S IAR GSGSACRS+FGGFV+W MG +  G DS+A
Sbjct  112  SAAGYACLTAALAKLYNFTGD---ISEIARTGSGSACRSVFGGFVRWYMGSDPTGVDSIA  168

Query  739  VQL  747
             Q+
Sbjct  169  KQI  171



>ref|XP_004666010.1| PREDICTED: diphosphomevalonate decarboxylase [Jaculus jaculus]
Length=400

 Score =   180 bits (456),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 106/189 (56%), Positives = 131/189 (69%), Gaps = 5/189 (3%)
 Frame = +1

Query  181  AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  360
            +EK  +MVT   P NIAVIKYWGKRDE LILPIN S+SVTL    L TTTT A+S  F +
Sbjct  3    SEKPQVMVTCTAPVNIAVIKYWGKRDEALILPINSSLSVTLHQDQLKTTTTAAISKDFTE  62

Query  361  DRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPT  540
            DR+WLNG+E  +   R Q CL+EIR  A        G  +      +  VH+AS NNFPT
Sbjct  63   DRIWLNGREEDVRQPRLQACLREIRRLAQKQRTAGDGDALPLS--LSYKVHVASVNNFPT  120

Query  541  aaglassaagfaCLVFALGKLMNVKEDNSQLSAIARQGSGSACRSLFGGFVKWIMGKEED  720
            AAGLASSAAG+ACL + L ++  V+ D   LS +AR+GSGSACRSL+GGFV+W MGK+ D
Sbjct  121  AAGLASSAAGYACLAYTLAQVYGVEGD---LSEVARRGSGSACRSLYGGFVEWQMGKQAD  177

Query  721  GSDSLAVQL  747
            G+DS+A Q+
Sbjct  178  GTDSIAQQV  186



>ref|XP_002913420.1| PREDICTED: LOW QUALITY PROTEIN: diphosphomevalonate decarboxylase 
[Ailuropoda melanoleuca]
Length=400

 Score =   179 bits (455),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 106/191 (55%), Positives = 134/191 (70%), Gaps = 9/191 (5%)
 Frame = +1

Query  181  AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  360
            +EK ++ VT   P NIAVIKYWGKRDE L+LPIN S+SVTL    L TTTT A+S  F +
Sbjct  3    SEKSLVAVTCTAPVNIAVIKYWGKRDEDLVLPINSSLSVTLHQDQLKTTTTAAISKDFTE  62

Query  361  DRMWLNGKEMSLSGVRYQNCLKEIR--ARACDVEDEKKGIKITKKDWENLHVHIASYNNF  534
            DR+WLNG+E  +   R Q CL+EIR  AR      E+  + ++     +  VHIAS NNF
Sbjct  63   DRIWLNGREEDVGQPRLQACLREIRRLARKRSSAGEEXPLPLSL----SYKVHIASVNNF  118

Query  535  PTaaglassaagfaCLVFALGKLMNVKEDNSQLSAIARQGSGSACRSLFGGFVKWIMGKE  714
            PTAAGLASSAAG+ACL +AL ++  V+ D   LS +AR+GSGSACRSL+GGFV+W MG+ 
Sbjct  119  PTAAGLASSAAGYACLAYALARVYGVESD---LSEVARRGSGSACRSLYGGFVEWQMGER  175

Query  715  EDGSDSLAVQL  747
             DG DS+A Q+
Sbjct  176  ADGKDSIARQV  186



>dbj|BAC40852.1| unnamed protein product [Mus musculus]
 dbj|BAE32901.1| unnamed protein product [Mus musculus]
Length=401

 Score =   179 bits (455),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 105/184 (57%), Positives = 129/184 (70%), Gaps = 5/184 (3%)
 Frame = +1

Query  196  LMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDRMWL  375
            LMVT   P NIAVIKYWGKRDE LILPIN S+SVTL    L TTTTVA+S  F +DR+WL
Sbjct  9    LMVTCTAPVNIAVIKYWGKRDEALILPINSSLSVTLHQDQLKTTTTVAISKDFTEDRIWL  68

Query  376  NGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTaagla  555
            NG+E  +   R Q CL+EIR  A      + G  +      +  VH+AS NNFPTAAGLA
Sbjct  69   NGREEDVGQPRLQACLREIRRLARKRRSTEDGDTLPLS--LSYKVHVASVNNFPTAAGLA  126

Query  556  ssaagfaCLVFALGKLMNVKEDNSQLSAIARQGSGSACRSLFGGFVKWIMGKEEDGSDSL  735
            SSAAG+ACL + L ++  V+ D   LS +AR+GSGSACRSL+GGFV+W MG++ DG DS+
Sbjct  127  SSAAGYACLAYTLAQVYGVEGD---LSEVARRGSGSACRSLYGGFVEWQMGEQADGKDSI  183

Query  736  AVQL  747
            A Q+
Sbjct  184  ARQI  187



>ref|XP_008300019.1| PREDICTED: diphosphomevalonate decarboxylase [Stegastes partitus]
Length=402

 Score =   179 bits (455),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 108/184 (59%), Positives = 132/184 (72%), Gaps = 7/184 (4%)
 Frame = +1

Query  199  MVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDRMWLN  378
            +VT   P NIAVIKYWGKR+E LILPIN S+SVTL    L TTTTVA S +F +DR+WLN
Sbjct  11   IVTCTAPVNIAVIKYWGKRNEDLILPINSSLSVTLHQDQLKTTTTVATSRSFPEDRIWLN  70

Query  379  GKEMSLSGVRYQNCLKEIRARACDVE-DEKKGIKITKKDWENLHVHIASYNNFPTaagla  555
            GKE  ++  R Q+CL+EIR  A     DE   +  T    +   VHI S NNFPTAAGLA
Sbjct  71   GKEEDITHPRLQSCLREIRRLARKRRNDEDPSLDSTGLSHK---VHICSINNFPTAAGLA  127

Query  556  ssaagfaCLVFALGKLMNVKEDNSQLSAIARQGSGSACRSLFGGFVKWIMGKEEDGSDSL  735
            SSAAGFACLV+ L ++  V+    +LS IARQGSGSACRS++GGFV+WIMG ++DG DS+
Sbjct  128  SSAAGFACLVYTLARVFGVE---GELSGIARQGSGSACRSMYGGFVQWIMGDKDDGKDSV  184

Query  736  AVQL  747
            A Q+
Sbjct  185  AQQV  188



>ref|XP_011315112.1| PREDICTED: diphosphomevalonate decarboxylase isoform X1 [Fopius 
arisanus]
Length=386

 Score =   179 bits (454),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 104/184 (57%), Positives = 128/184 (70%), Gaps = 14/184 (8%)
 Frame = +1

Query  199  MVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDRMWLN  378
            +VT   P NIAVIKYWGKRDE LILP+NDSIS +LD   LC  TT+  S  FD DR+WLN
Sbjct  3    IVTCIAPVNIAVIKYWGKRDEQLILPVNDSISASLDTDQLCAKTTIMASADFDADRIWLN  62

Query  379  GKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTaaglas  558
            G+E S++  R QNCL+EI+ RA               + EN  +HI S NNFPTAAGLAS
Sbjct  63   GREESINNPRLQNCLREIKKRA-----------QLSPEMENWKLHICSKNNFPTAAGLAS  111

Query  559  saagfaCLVFALGKLMNVKEDNSQLSAIARQGSGSACRSLFGGFVKWIMGKEEDGSDSLA  738
            SAAG+ACL  AL KL  V+ D   +S+IAR GSGSACRS++GGFV+W  G + +G+DS+A
Sbjct  112  SAAGYACLSAALAKLYRVEGD---ISSIARCGSGSACRSVYGGFVRWYAGTDPNGNDSIA  168

Query  739  VQLV  750
             Q+V
Sbjct  169  KQIV  172



>gb|KIY47272.1| Diphosphomevalonate decarboxylase [Fistulina hepatica ATCC 64428]
Length=406

 Score =   179 bits (455),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 107/187 (57%), Positives = 127/187 (68%), Gaps = 6/187 (3%)
 Frame = +1

Query  193  VLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDRMW  372
            +   TA  P NIAVIKYWGKRD  LILP N S+SVTLD  HL +TTT    P+F++DR+W
Sbjct  4    IFQATASAPVNIAVIKYWGKRDTKLILPTNSSLSVTLDQDHLKSTTTSRADPSFEKDRLW  63

Query  373  LNGKEMSL-SGVRYQNCLKEI-RARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTaa  546
            LNGKE  + +G R   C+KE+ R R  +VED+        K      VHI+SYNNFPTAA
Sbjct  64   LNGKEEEIKAGGRTATCIKEMKRLRKVEVEDKDPSAPTISK----YPVHISSYNNFPTAA  119

Query  547  glassaagfaCLVFALGKLMNVKEDNSQLSAIARQGSGSACRSLFGGFVKWIMGKEEDGS  726
            GLASSAAGFA LV +LG L  +    S LS IARQGSGSACRSL+GG+V W MG    G 
Sbjct  120  GLASSAAGFAALVSSLGALYALPVSPSTLSLIARQGSGSACRSLYGGYVAWEMGSSPTGE  179

Query  727  DSLAVQL  747
            DS+AVQ+
Sbjct  180  DSIAVQV  186



>ref|XP_006734134.1| PREDICTED: diphosphomevalonate decarboxylase [Leptonychotes weddellii]
Length=400

 Score =   179 bits (455),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 107/191 (56%), Positives = 134/191 (70%), Gaps = 9/191 (5%)
 Frame = +1

Query  181  AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  360
            +EK ++ VT   P NIAVIKYWGKRDE LILPIN S+SVTL    L TTTT A+S  F +
Sbjct  3    SEKPLVAVTCTAPVNIAVIKYWGKRDEDLILPINSSLSVTLHQDQLKTTTTAAISKDFTE  62

Query  361  DRMWLNGKEMSLSGVRYQNCLKEIR--ARACDVEDEKKGIKITKKDWENLHVHIASYNNF  534
            DR+WLNG+E  +   R Q CL+EIR  AR      ++  + ++     +  VHIAS NNF
Sbjct  63   DRIWLNGREEDVGQPRLQACLREIRRLARKRRSAGDEDPLPLSL----SYKVHIASVNNF  118

Query  535  PTaaglassaagfaCLVFALGKLMNVKEDNSQLSAIARQGSGSACRSLFGGFVKWIMGKE  714
            PTAAGLASSAAG+ACL +AL +L  V+ D   LS +AR+GSGSACRSL+GGFV+W MG+ 
Sbjct  119  PTAAGLASSAAGYACLAYALARLYGVESD---LSEVARRGSGSACRSLYGGFVEWQMGER  175

Query  715  EDGSDSLAVQL  747
             DG DS+A Q+
Sbjct  176  ADGKDSIARQV  186



>ref|XP_003484695.1| PREDICTED: diphosphomevalonate decarboxylase-like [Bombus impatiens]
Length=446

 Score =   181 bits (458),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 106/182 (58%), Positives = 129/182 (71%), Gaps = 14/182 (8%)
 Frame = +1

Query  202  VTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDRMWLNG  381
            VT  T  NIAVIKYWGKRDETLILP+NDSIS TLD  HL T TTV +SP F +D++WLNG
Sbjct  66   VTCITSVNIAVIKYWGKRDETLILPVNDSISATLDTNHLHTKTTVMISPTFKEDQIWLNG  125

Query  382  KEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTaaglass  561
            ++  +   R QNCL +IR RA +     +        W+   VHI S NNFPTAAGLASS
Sbjct  126  QKEDIKNPRLQNCLTQIRKRARNSNHIDQ--------WK---VHICSENNFPTAAGLASS  174

Query  562  aagfaCLVFALGKLMNVKEDNSQLSAIARQGSGSACRSLFGGFVKWIMGKEEDGSDSLAV  741
            AAG+ACLV AL KL  ++ D   +S+IAR GSGSACRS+ GGFV+W MG E +G+DS+A 
Sbjct  175  AAGYACLVAALAKLYQIEGD---ISSIARIGSGSACRSVMGGFVRWYMGSEPNGADSIAK  231

Query  742  QL  747
            Q+
Sbjct  232  QI  233



>emb|CAC35731.1| diphosphomevalonate decarboxylase [Mus musculus]
Length=401

 Score =   179 bits (455),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 105/184 (57%), Positives = 129/184 (70%), Gaps = 5/184 (3%)
 Frame = +1

Query  196  LMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDRMWL  375
            LMVT   P NIAVIKYWGKRDE LILPIN S+SVTL    L TTTTVA+S  F +DR+WL
Sbjct  9    LMVTCTAPVNIAVIKYWGKRDEALILPINSSLSVTLHQDQLKTTTTVAISKDFTEDRIWL  68

Query  376  NGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTaagla  555
            NG+E  +   R Q CL+EIR  A      + G  +      +  VH+AS NNFPTAAGLA
Sbjct  69   NGREEDVGQPRLQACLREIRRLARKRRSTEDGDTLPLS--LSYKVHVASVNNFPTAAGLA  126

Query  556  ssaagfaCLVFALGKLMNVKEDNSQLSAIARQGSGSACRSLFGGFVKWIMGKEEDGSDSL  735
            SSAAG+ACL + L ++  V+ D   LS +AR+GSGSACRSL+GGFV+W MG++ DG DS+
Sbjct  127  SSAAGYACLAYTLAQVYGVEGD---LSEVARRGSGSACRSLYGGFVEWQMGEQADGKDSI  183

Query  736  AVQL  747
            A Q+
Sbjct  184  ARQI  187



>gb|AAH08526.1| Mevalonate (diphospho) decarboxylase [Mus musculus]
Length=401

 Score =   179 bits (455),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 105/184 (57%), Positives = 129/184 (70%), Gaps = 5/184 (3%)
 Frame = +1

Query  196  LMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDRMWL  375
            LMVT   P NIAVIKYWGKRDE LILPIN S+SVTL    L TTTTVA+S  F +DR+WL
Sbjct  9    LMVTCTAPVNIAVIKYWGKRDEALILPINSSLSVTLHQDQLKTTTTVAISKDFTEDRIWL  68

Query  376  NGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTaagla  555
            NG+E  +   R Q CL+EIR  A      + G  +      +  VH+AS NNFPTAAGLA
Sbjct  69   NGREEDVGQPRLQACLREIRRLARKRRSTEDGDTLPLS--LSYKVHVASVNNFPTAAGLA  126

Query  556  ssaagfaCLVFALGKLMNVKEDNSQLSAIARQGSGSACRSLFGGFVKWIMGKEEDGSDSL  735
            SSAAG+ACL + L ++  V+ D   LS +AR+GSGSACRSL+GGFV+W MG++ DG DS+
Sbjct  127  SSAAGYACLAYTLAQVYGVEGD---LSEVARRGSGSACRSLYGGFVEWQMGEQADGKDSI  183

Query  736  AVQL  747
            A Q+
Sbjct  184  ARQI  187



>ref|XP_005531982.1| PREDICTED: diphosphomevalonate decarboxylase [Pseudopodoces humilis]
Length=399

 Score =   179 bits (455),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 106/189 (56%), Positives = 131/189 (69%), Gaps = 6/189 (3%)
 Frame = +1

Query  181  AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  360
            AE+ + M T   P NIAVIKYWGKRD  LILPIN S+SVTL    L TTTT A S  F +
Sbjct  3    AERGLAMATCTAPVNIAVIKYWGKRDTDLILPINSSLSVTLHQDQLKTTTTAAASRDFTE  62

Query  361  DRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPT  540
            DR+WLNGKE  +   R Q CL+E+R  A      + G + T     +  +HIAS NNFPT
Sbjct  63   DRLWLNGKEADVGHPRVQACLREVRRLA---RKRRGGCEDTATLSLSYKIHIASENNFPT  119

Query  541  aaglassaagfaCLVFALGKLMNVKEDNSQLSAIARQGSGSACRSLFGGFVKWIMGKEED  720
            AAGLASSAAG+ACLV AL +L  ++E   +LS +AR+GSGSACRS+FGGFV+W  G+  D
Sbjct  120  AAGLASSAAGYACLVSALARLYGLEE---ELSEVARRGSGSACRSMFGGFVQWQRGERPD  176

Query  721  GSDSLAVQL  747
            G+DSLA+Q+
Sbjct  177  GTDSLALQV  185



>ref|NP_619597.2| diphosphomevalonate decarboxylase [Mus musculus]
 sp|Q99JF5.2|MVD1_MOUSE RecName: Full=Diphosphomevalonate decarboxylase; AltName: Full=Mevalonate 
(diphospho)decarboxylase; Short=MDDase; AltName: 
Full=Mevalonate pyrophosphate decarboxylase [Mus musculus]
 dbj|BAE22291.1| unnamed protein product [Mus musculus]
 gb|EDL11681.1| mevalonate (diphospho) decarboxylase [Mus musculus]
Length=401

 Score =   179 bits (455),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 105/184 (57%), Positives = 129/184 (70%), Gaps = 5/184 (3%)
 Frame = +1

Query  196  LMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDRMWL  375
            LMVT   P NIAVIKYWGKRDE LILPIN S+SVTL    L TTTTVA+S  F +DR+WL
Sbjct  9    LMVTCTAPVNIAVIKYWGKRDEALILPINSSLSVTLHQDQLKTTTTVAISKDFTEDRIWL  68

Query  376  NGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTaagla  555
            NG+E  +   R Q CL+EIR  A      + G  +      +  VH+AS NNFPTAAGLA
Sbjct  69   NGREEDVGQPRLQACLREIRRLARKRRSTEDGDTLPLS--LSYKVHVASVNNFPTAAGLA  126

Query  556  ssaagfaCLVFALGKLMNVKEDNSQLSAIARQGSGSACRSLFGGFVKWIMGKEEDGSDSL  735
            SSAAG+ACL + L ++  V+ D   LS +AR+GSGSACRSL+GGFV+W MG++ DG DS+
Sbjct  127  SSAAGYACLAYTLAQVYGVEGD---LSEVARRGSGSACRSLYGGFVEWQMGEQADGKDSI  183

Query  736  AVQL  747
            A Q+
Sbjct  184  ARQI  187



>dbj|BAE42019.1| unnamed protein product [Mus musculus]
Length=401

 Score =   179 bits (455),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 105/184 (57%), Positives = 129/184 (70%), Gaps = 5/184 (3%)
 Frame = +1

Query  196  LMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDRMWL  375
            LMVT   P NIAVIKYWGKRDE LILPIN S+SVTL    L TTTTVA+S  F +DR+WL
Sbjct  9    LMVTCTAPVNIAVIKYWGKRDEALILPINSSLSVTLHQDQLKTTTTVAISKDFTEDRIWL  68

Query  376  NGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTaagla  555
            NG+E  +   R Q CL+EIR  A      + G  +      +  VH+AS NNFPTAAGLA
Sbjct  69   NGREEDVGQPRLQACLREIRRLARKRRSTEDGDTLPLS--LSYKVHVASVNNFPTAAGLA  126

Query  556  ssaagfaCLVFALGKLMNVKEDNSQLSAIARQGSGSACRSLFGGFVKWIMGKEEDGSDSL  735
            SSAAG+ACL + L ++  V+ D   LS +AR+GSGSACRSL+GGFV+W MG++ DG DS+
Sbjct  127  SSAAGYACLAYTLAQVYGVEGD---LSEVARRGSGSACRSLYGGFVEWQMGEQADGKDSI  183

Query  736  AVQL  747
            A Q+
Sbjct  184  ARQI  187



>ref|XP_004280113.1| PREDICTED: diphosphomevalonate decarboxylase [Orcinus orca]
Length=400

 Score =   179 bits (455),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 106/193 (55%), Positives = 134/193 (69%), Gaps = 13/193 (7%)
 Frame = +1

Query  181  AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  360
            +EK + +VT   P NIAVIKYWGKRDE LILPIN S+SVTL    L TTTT A+S  F +
Sbjct  3    SEKRLEVVTCTAPVNIAVIKYWGKRDEELILPINSSLSVTLHQDQLKTTTTAAISRDFTE  62

Query  361  DRMWLNGKEMSLSGVRYQNCLKEI----RARACDVEDEKKGIKITKKDWENLHVHIASYN  528
            DR+WLNG+E  +   R Q CL+EI    R R  D  ++   + ++ K      VH+AS N
Sbjct  63   DRIWLNGREEDVGQPRLQACLREIRRLARKRRSDGHEDPLPLSLSYK------VHVASVN  116

Query  529  NFPTaaglassaagfaCLVFALGKLMNVKEDNSQLSAIARQGSGSACRSLFGGFVKWIMG  708
            NFPTAAGLASSAAG+ACL +AL ++  V+ D   LS +AR+GSGSACRSL+GGFV+W MG
Sbjct  117  NFPTAAGLASSAAGYACLAYALARVYGVESD---LSEVARRGSGSACRSLYGGFVEWQMG  173

Query  709  KEEDGSDSLAVQL  747
            +  DG DS+A Q+
Sbjct  174  ERADGKDSIARQV  186



>ref|XP_007266924.1| Diphosphomevalonate decarboxylase [Fomitiporia mediterranea MF3/22]
 gb|EJD03213.1| Diphosphomevalonate decarboxylase [Fomitiporia mediterranea MF3/22]
Length=402

 Score =   179 bits (454),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 106/186 (57%), Positives = 125/186 (67%), Gaps = 6/186 (3%)
 Frame = +1

Query  193  VLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDRMW  372
            V   TA  P NIA IKYWGKRD  LILP N S+SVTLD  HL +TTT    P+F  DR+W
Sbjct  3    VYQATASAPVNIACIKYWGKRDTKLILPTNSSLSVTLDQDHLRSTTTSRADPSFKHDRLW  62

Query  373  LNGKEMSL-SGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTaag  549
            LNGKE  +  G R   C+ E+R    +VE ++   KI      +  VHIAS+NNFPTAAG
Sbjct  63   LNGKEEEIKEGGRLATCIAEMRRLRREVEKKEGTPKIA-----DYPVHIASHNNFPTAAG  117

Query  550  lassaagfaCLVFALGKLMNVKEDNSQLSAIARQGSGSACRSLFGGFVKWIMGKEEDGSD  729
            LASSA+GFA LV +L  L  +    S+LS IARQGSGSACRSLFGGFV W MG + DGSD
Sbjct  118  LASSASGFAALVSSLAALYELPASPSELSLIARQGSGSACRSLFGGFVAWEMGSKADGSD  177

Query  730  SLAVQL  747
            S AV++
Sbjct  178  SFAVEV  183



>ref|XP_007125573.1| PREDICTED: diphosphomevalonate decarboxylase isoform X2 [Physeter 
catodon]
Length=400

 Score =   179 bits (454),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 106/193 (55%), Positives = 133/193 (69%), Gaps = 13/193 (7%)
 Frame = +1

Query  181  AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  360
            +EK + +VT   P NIAVIKYWGKRDE LILPIN S+SVTL    L TTTT A+S  F +
Sbjct  3    SEKRLEVVTCTAPVNIAVIKYWGKRDEELILPINSSLSVTLHQDQLKTTTTAAISRDFTE  62

Query  361  DRMWLNGKEMSLSGVRYQNCLKEI----RARACDVEDEKKGIKITKKDWENLHVHIASYN  528
            DR+WLNG+E      R Q CL+EI    R R  D  ++   + ++ K      VH+AS N
Sbjct  63   DRIWLNGREEDAGQPRLQACLREIRRLARKRRSDGHEDPLPLSLSYK------VHVASVN  116

Query  529  NFPTaaglassaagfaCLVFALGKLMNVKEDNSQLSAIARQGSGSACRSLFGGFVKWIMG  708
            NFPTAAGLASSAAG+ACL +AL ++  V+ D   LS +AR+GSGSACRSL+GGFV+W MG
Sbjct  117  NFPTAAGLASSAAGYACLAYALARVYGVESD---LSEVARRGSGSACRSLYGGFVEWQMG  173

Query  709  KEEDGSDSLAVQL  747
            +  DG DS+A Q+
Sbjct  174  ERADGKDSIARQV  186



>ref|XP_007468497.1| PREDICTED: diphosphomevalonate decarboxylase [Lipotes vexillifer]
Length=400

 Score =   179 bits (453),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 104/193 (54%), Positives = 133/193 (69%), Gaps = 13/193 (7%)
 Frame = +1

Query  181  AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  360
            +EK + +VT   P NIAVIKYWGKRDE LILPIN S+SVTL    L TTTT A++  F +
Sbjct  3    SEKRLEVVTCTAPVNIAVIKYWGKRDEELILPINSSLSVTLHQDQLKTTTTAAINRDFTE  62

Query  361  DRMWLNGKEMSLSGVRYQNCLKEI----RARACDVEDEKKGIKITKKDWENLHVHIASYN  528
            DR+WLNG+E  +   R Q CL+EI    R R  D  ++   + ++ K      VH+AS N
Sbjct  63   DRIWLNGREEDVGQPRLQACLREIRRLARKRRSDGHEDPLPLSLSYK------VHVASVN  116

Query  529  NFPTaaglassaagfaCLVFALGKLMNVKEDNSQLSAIARQGSGSACRSLFGGFVKWIMG  708
            NFPT AGLASSAAG+ACL +AL ++  V+ D   LS +AR+GSGSACRSL+GGFV+W MG
Sbjct  117  NFPTGAGLASSAAGYACLAYALAQVYGVESD---LSEVARRGSGSACRSLYGGFVEWQMG  173

Query  709  KEEDGSDSLAVQL  747
            +  DG DS+A Q+
Sbjct  174  ERADGKDSIARQV  186



>pdb|3F0N|A Chain A, Mus Musculus Mevalonate Pyrophosphate Decarboxylase
 pdb|3F0N|B Chain B, Mus Musculus Mevalonate Pyrophosphate Decarboxylase
Length=414

 Score =   179 bits (454),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 105/184 (57%), Positives = 129/184 (70%), Gaps = 5/184 (3%)
 Frame = +1

Query  196  LMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDRMWL  375
            LMVT   P NIAVIKYWGKRDE LILPIN S+SVTL    L TTTTVA+S  F +DR+WL
Sbjct  22   LMVTCTAPVNIAVIKYWGKRDEALILPINSSLSVTLHQDQLKTTTTVAISKDFTEDRIWL  81

Query  376  NGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTaagla  555
            NG+E  +   R Q CL+EIR  A      + G  +      +  VH+AS NNFPTAAGLA
Sbjct  82   NGREEDVGQPRLQACLREIRRLARKRRSTEDGDTLPLS--LSYKVHVASVNNFPTAAGLA  139

Query  556  ssaagfaCLVFALGKLMNVKEDNSQLSAIARQGSGSACRSLFGGFVKWIMGKEEDGSDSL  735
            SSAAG+ACL + L ++  V+ D   LS +AR+GSGSACRSL+GGFV+W MG++ DG DS+
Sbjct  140  SSAAGYACLAYTLAQVYGVEGD---LSEVARRGSGSACRSLYGGFVEWQMGEQADGKDSI  196

Query  736  AVQL  747
            A Q+
Sbjct  197  ARQI  200



>ref|XP_007172621.1| PREDICTED: diphosphomevalonate decarboxylase [Balaenoptera acutorostrata 
scammoni]
Length=400

 Score =   179 bits (453),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 106/193 (55%), Positives = 133/193 (69%), Gaps = 13/193 (7%)
 Frame = +1

Query  181  AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  360
            +E+ V +VT   P NIAVIKYWGKRDE LILPIN S+SVTL    L TTTT A+S  F +
Sbjct  3    SEEPVEVVTCTAPVNIAVIKYWGKRDEELILPINSSLSVTLHQDQLKTTTTAAISRDFTE  62

Query  361  DRMWLNGKEMSLSGVRYQNCLKEI----RARACDVEDEKKGIKITKKDWENLHVHIASYN  528
            DR+WLNG+E  +   R Q CL+EI    R R  D  +E   + ++ K      VH+AS N
Sbjct  63   DRIWLNGREEDVGQPRLQACLREIRRLARKRRSDGHEEPLPLSLSYK------VHVASVN  116

Query  529  NFPTaaglassaagfaCLVFALGKLMNVKEDNSQLSAIARQGSGSACRSLFGGFVKWIMG  708
            NFPTAAGLASSAAG+ACL + L ++  V+ D   LS +AR+GSGSACRSL+GGFV+W MG
Sbjct  117  NFPTAAGLASSAAGYACLAYTLARVYGVESD---LSEVARRGSGSACRSLYGGFVEWQMG  173

Query  709  KEEDGSDSLAVQL  747
            +  DG DS+A Q+
Sbjct  174  QRADGKDSVARQV  186



>ref|XP_011703654.1| PREDICTED: diphosphomevalonate decarboxylase [Wasmannia auropunctata]
Length=418

 Score =   179 bits (454),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 105/184 (57%), Positives = 128/184 (70%), Gaps = 13/184 (7%)
 Frame = +1

Query  199  MVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDRMWLN  378
            +VT   P NIAVIKYWGKRDE+LILP NDSIS TLD   L   TTV +SP F +D +WLN
Sbjct  3    IVTCIAPVNIAVIKYWGKRDESLILPTNDSISATLDTDQLHAKTTVMISPNFKEDCIWLN  62

Query  379  GKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTaaglas  558
            GKE  +  +R QNCLKEIR R+         +     +W+   +HI S NNFPTAAGLAS
Sbjct  63   GKEEDIKNIRLQNCLKEIRKRS--------QLSDCTNNWK---IHICSKNNFPTAAGLAS  111

Query  559  saagfaCLVFALGKLMNVKEDNSQLSAIARQGSGSACRSLFGGFVKWIMGKEEDGSDSLA  738
            SAAG+ACL  AL KL  ++ ++  +S IAR GSGSACRS+ GGFV+W MG  +DG+DSLA
Sbjct  112  SAAGYACLTAALAKLYKIEGED--ISIIARSGSGSACRSVMGGFVRWYMGSNKDGTDSLA  169

Query  739  VQLV  750
             Q+V
Sbjct  170  KQIV  173



>gb|ELR58766.1| Diphosphomevalonate decarboxylase, partial [Bos mutus]
Length=411

 Score =   179 bits (454),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 104/193 (54%), Positives = 134/193 (69%), Gaps = 13/193 (7%)
 Frame = +1

Query  181  AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  360
            +EK +++VT   P NIAV+KYWGKRDE LILPIN S+SVTL    L TTTT A+S  F +
Sbjct  5    SEKPIVVVTCTAPVNIAVVKYWGKRDEELILPINSSLSVTLHQDQLKTTTTAAISRDFTE  64

Query  361  DRMWLNGKEMSLSGVRYQNCLKEI----RARACDVEDEKKGIKITKKDWENLHVHIASYN  528
            DR+WLNG+E  +   R Q CL+EI    R R  D  ++   + ++ K      VH+AS N
Sbjct  65   DRIWLNGREEDMGHPRLQACLREIRRLARKRRSDGHEDPLPLSLSYK------VHVASEN  118

Query  529  NFPTaaglassaagfaCLVFALGKLMNVKEDNSQLSAIARQGSGSACRSLFGGFVKWIMG  708
            NFPTAAGLASSAAG+ACL + L ++  V   +S LS +AR+GSGSACRSL+GGFV+W MG
Sbjct  119  NFPTAAGLASSAAGYACLAYTLARVYGV---DSDLSEVARRGSGSACRSLYGGFVEWQMG  175

Query  709  KEEDGSDSLAVQL  747
            +  DG DS+A Q+
Sbjct  176  ERPDGKDSVARQV  188



>ref|NP_001068892.1| diphosphomevalonate decarboxylase [Bos taurus]
 sp|Q0P570.1|MVD1_BOVIN RecName: Full=Diphosphomevalonate decarboxylase; AltName: Full=Mevalonate 
(diphospho)decarboxylase; Short=MDDase; AltName: 
Full=Mevalonate pyrophosphate decarboxylase [Bos taurus]
 gb|AAI20433.1| Mevalonate (diphospho) decarboxylase [Bos taurus]
 tpg|DAA20052.1| TPA: diphosphomevalonate decarboxylase [Bos taurus]
Length=400

 Score =   179 bits (453),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 104/193 (54%), Positives = 134/193 (69%), Gaps = 13/193 (7%)
 Frame = +1

Query  181  AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  360
            +EK +++VT   P NIAV+KYWGKRDE LILPIN S+SVTL    L TTTT A+S  F +
Sbjct  3    SEKPIVVVTCTAPVNIAVVKYWGKRDEELILPINSSLSVTLHQDQLKTTTTAAISRDFTE  62

Query  361  DRMWLNGKEMSLSGVRYQNCLKEI----RARACDVEDEKKGIKITKKDWENLHVHIASYN  528
            DR+WLNG+E  +   R Q CL+EI    R R  D  ++   + ++ K      VH+AS N
Sbjct  63   DRIWLNGREEDMGHPRLQACLREIRRLARKRRSDGHEDPLPLSLSYK------VHVASEN  116

Query  529  NFPTaaglassaagfaCLVFALGKLMNVKEDNSQLSAIARQGSGSACRSLFGGFVKWIMG  708
            NFPTAAGLASSAAG+ACL + L ++  V   +S LS +AR+GSGSACRSL+GGFV+W MG
Sbjct  117  NFPTAAGLASSAAGYACLAYTLARVYGV---DSDLSEVARRGSGSACRSLYGGFVEWQMG  173

Query  709  KEEDGSDSLAVQL  747
            +  DG DS+A Q+
Sbjct  174  ERPDGKDSVACQV  186



>ref|XP_007887516.1| PREDICTED: diphosphomevalonate decarboxylase [Callorhinchus milii]
Length=399

 Score =   179 bits (453),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 110/193 (57%), Positives = 137/193 (71%), Gaps = 9/193 (5%)
 Frame = +1

Query  178  MAE-KWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAF  354
            MAE + + +VT   P NIAVIKYWGKRDE  ILPIN S+SVTL    L TTTTVAVS  F
Sbjct  1    MAEDRNMAVVTCSAPVNIAVIKYWGKRDEEAILPINSSLSVTLHQDQLKTTTTVAVSRDF  60

Query  355  DQDRMWLNGKEMSLSGVRYQNCLKEIR--ARACDVEDEKKGIKITKKDWENLHVHIASYN  528
             +DR+WLNG E +++  R Q CL+EIR  AR      ++         ++   VHI S N
Sbjct  61   KEDRIWLNGTEDNITHPRLQTCLREIRRLARKRRNSGDENCNTFPTVSYK---VHICSAN  117

Query  529  NFPTaaglassaagfaCLVFALGKLMNVKEDNSQLSAIARQGSGSACRSLFGGFVKWIMG  708
            NFPTAAGLASSAAG+ACLV+AL KL  ++    +LS IARQGSGSACRS++GGFV+W+MG
Sbjct  118  NFPTAAGLASSAAGYACLVYALAKLYGLE---GELSEIARQGSGSACRSMYGGFVQWVMG  174

Query  709  KEEDGSDSLAVQL  747
            ++ DGSDS+A Q+
Sbjct  175  EKTDGSDSIAQQI  187



>ref|XP_005892469.1| PREDICTED: diphosphomevalonate decarboxylase [Bos mutus]
Length=400

 Score =   179 bits (453),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 104/193 (54%), Positives = 134/193 (69%), Gaps = 13/193 (7%)
 Frame = +1

Query  181  AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  360
            +EK +++VT   P NIAV+KYWGKRDE LILPIN S+SVTL    L TTTT A+S  F +
Sbjct  3    SEKPIVVVTCTAPVNIAVVKYWGKRDEELILPINSSLSVTLHQDQLKTTTTAAISRDFTE  62

Query  361  DRMWLNGKEMSLSGVRYQNCLKEI----RARACDVEDEKKGIKITKKDWENLHVHIASYN  528
            DR+WLNG+E  +   R Q CL+EI    R R  D  ++   + ++ K      VH+AS N
Sbjct  63   DRIWLNGREEDMGHPRLQACLREIRRLARKRRSDGHEDPLPLSLSYK------VHVASEN  116

Query  529  NFPTaaglassaagfaCLVFALGKLMNVKEDNSQLSAIARQGSGSACRSLFGGFVKWIMG  708
            NFPTAAGLASSAAG+ACL + L ++  V   +S LS +AR+GSGSACRSL+GGFV+W MG
Sbjct  117  NFPTAAGLASSAAGYACLAYTLARVYGV---DSDLSEVARRGSGSACRSLYGGFVEWQMG  173

Query  709  KEEDGSDSLAVQL  747
            +  DG DS+A Q+
Sbjct  174  ERPDGKDSVARQV  186



>ref|XP_010842266.1| PREDICTED: diphosphomevalonate decarboxylase [Bison bison bison]
Length=400

 Score =   179 bits (453),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 104/193 (54%), Positives = 134/193 (69%), Gaps = 13/193 (7%)
 Frame = +1

Query  181  AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  360
            +EK +++VT   P NIAV+KYWGKRDE LILPIN S+SVTL    L TTTT A+S  F +
Sbjct  3    SEKPIVVVTCTAPVNIAVVKYWGKRDEELILPINSSLSVTLHQDQLKTTTTAAISRDFTE  62

Query  361  DRMWLNGKEMSLSGVRYQNCLKEI----RARACDVEDEKKGIKITKKDWENLHVHIASYN  528
            DR+WLNG+E  +   R Q CL+EI    R R  D  ++   + ++ K      VH+AS N
Sbjct  63   DRIWLNGREEDMGHPRLQACLREIRRLARKRRSDGHEDPLPLSLSYK------VHVASEN  116

Query  529  NFPTaaglassaagfaCLVFALGKLMNVKEDNSQLSAIARQGSGSACRSLFGGFVKWIMG  708
            NFPTAAGLASSAAG+ACL + L ++  V   +S LS +AR+GSGSACRSL+GGFV+W MG
Sbjct  117  NFPTAAGLASSAAGYACLAYTLARVYGV---DSDLSEVARRGSGSACRSLYGGFVEWQMG  173

Query  709  KEEDGSDSLAVQL  747
            +  DG DS+A Q+
Sbjct  174  ERPDGKDSVARQV  186



>ref|XP_642143.1| diphosphomevalonate decarboxylase [Dictyostelium discoideum AX4]
 sp|Q54YQ9.1|MVD1_DICDI RecName: Full=Diphosphomevalonate decarboxylase; AltName: Full=Mevalonate 
(diphospho)decarboxylase; Short=MDDase; AltName: 
Full=Mevalonate pyrophosphate decarboxylase [Dictyostelium 
discoideum]
 gb|EAL68476.1| diphosphomevalonate decarboxylase [Dictyostelium discoideum AX4]
Length=391

 Score =   178 bits (452),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 102/182 (56%), Positives = 127/182 (70%), Gaps = 15/182 (8%)
 Frame = +1

Query  202  VTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDRMWLNG  381
            VT   P NIAVIKYWGKRDE +ILP+N S+S TL    L TTTT+  S  + +D ++LNG
Sbjct  6    VTCTAPVNIAVIKYWGKRDENIILPLNSSLSGTLHQDDLKTTTTIVASEDYTEDELYLNG  65

Query  382  KEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTaaglass  561
            K+  ++ VRYQN LK IR+RA  + D+K              VHIAS NNFPTAAGLASS
Sbjct  66   KKEDINAVRYQNVLKMIRSRATKLMDKKHC------------VHIASINNFPTAAGLASS  113

Query  562  aagfaCLVFALGKLMNVKEDNSQLSAIARQGSGSACRSLFGGFVKWIMGKEEDGSDSLAV  741
            A+G+ CLVF L ++  V  D   +S IAR GSGSACRS++GGFVKW MG ++DGSDS+AV
Sbjct  114  ASGYCCLVFTLAQMYGVDGD---ISGIARLGSGSACRSMYGGFVKWEMGTKDDGSDSIAV  170

Query  742  QL  747
            Q+
Sbjct  171  QV  172



>ref|XP_546783.2| PREDICTED: diphosphomevalonate decarboxylase [Canis lupus familiaris]
Length=400

 Score =   178 bits (452),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 107/193 (55%), Positives = 133/193 (69%), Gaps = 13/193 (7%)
 Frame = +1

Query  181  AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  360
            +EK +L VT   P NIAVIKYWGKRDE L+LPIN S+SVTL    L TTTT AVS  F +
Sbjct  3    SEKPLLAVTCTAPVNIAVIKYWGKRDEDLVLPINSSLSVTLHQDQLKTTTTAAVSKDFTE  62

Query  361  DRMWLNGKEMSLSGVRYQNCLKEI----RARACDVEDEKKGIKITKKDWENLHVHIASYN  528
            DR+WLNG+E  +   R Q CL+EI    R R    +++   + +T K      VHIAS N
Sbjct  63   DRIWLNGREEDVEQPRLQACLREIRRLARKRRSTGDEDPLPLSLTYK------VHIASVN  116

Query  529  NFPTaaglassaagfaCLVFALGKLMNVKEDNSQLSAIARQGSGSACRSLFGGFVKWIMG  708
            NFPTAAGLASSAAG+ACL + L ++  V   +S LS +AR+GSGSACRSL+GGFV+W MG
Sbjct  117  NFPTAAGLASSAAGYACLAYTLAQVYGV---DSDLSEVARRGSGSACRSLYGGFVEWQMG  173

Query  709  KEEDGSDSLAVQL  747
            +  DG DS+A Q+
Sbjct  174  ERADGKDSIARQV  186



>ref|XP_008838768.1| PREDICTED: diphosphomevalonate decarboxylase [Nannospalax galili]
Length=406

 Score =   178 bits (452),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 105/191 (55%), Positives = 135/191 (71%), Gaps = 9/191 (5%)
 Frame = +1

Query  181  AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  360
            +EK  ++VT   P NIAVIKYWGKRDE LILPIN S+SVTL    L TTTT A+S  F +
Sbjct  9    SEKLQVVVTCTAPVNIAVIKYWGKRDEALILPINSSLSVTLHQDQLRTTTTAAISKDFTE  68

Query  361  DRMWLNGKEMSLSGVRYQNCLKEIR--ARACDVEDEKKGIKITKKDWENLHVHIASYNNF  534
            DR+WLNG+E ++   R Q CL+EIR  AR     + +  + ++     +  VH+AS NNF
Sbjct  69   DRIWLNGREEAVGQPRLQACLREIRRLARKRRSMEGEGALPLSL----SYKVHVASVNNF  124

Query  535  PTaaglassaagfaCLVFALGKLMNVKEDNSQLSAIARQGSGSACRSLFGGFVKWIMGKE  714
            PTAAGLASSAAG+ACL + L ++  V+ D   LS +ARQGSGSACRSL+GGFV+W MG++
Sbjct  125  PTAAGLASSAAGYACLAYTLAQVYGVEGD---LSEVARQGSGSACRSLYGGFVEWQMGEQ  181

Query  715  EDGSDSLAVQL  747
             DG DS+A Q+
Sbjct  182  ADGKDSIAQQV  192



>ref|XP_006027907.1| PREDICTED: diphosphomevalonate decarboxylase [Alligator sinensis]
Length=409

 Score =   178 bits (452),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 106/194 (55%), Positives = 131/194 (68%), Gaps = 13/194 (7%)
 Frame = +1

Query  181  AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  360
             E+    VT   P NIAVIKYWGKRD  LILPIN S+SVTL+   L TTTT A+S  F +
Sbjct  3    GEQGCCRVTCTAPVNIAVIKYWGKRDSELILPINSSLSVTLNQDQLKTTTTAAISRDFKE  62

Query  361  DRMWLNGKEMSLSGVRYQNCLKEI----RARACDVEDEKKGIKITKKDWENLHVHIASYN  528
            DR+WLNG+E  ++  R QNCL+E+    R R    E +   + +T K      +HIAS N
Sbjct  63   DRLWLNGEEADITHPRLQNCLREMRRLARKRRSGSEGDTAPLNLTHK------LHIASVN  116

Query  529  NFPTaaglassaagfaCLVFALGKLMNVKEDNSQLSAIARQGSGSACRSLFGGFVKWIMG  708
            NFPTAAGLASSAAG+ACLV+ L +L     D   LS +ARQGSGSACRSL GGFV+W+MG
Sbjct  117  NFPTAAGLASSAAGYACLVYTLARLYGADGD---LSEVARQGSGSACRSLSGGFVQWLMG  173

Query  709  KEEDGSDSLAVQLV  750
            +  DG DS+A Q++
Sbjct  174  ERPDGKDSVAQQVM  187



>ref|XP_005819249.1| mevalonate pyrophosphate decarboxylase [Guillardia theta CCMP2712]
 gb|EKX32269.1| mevalonate pyrophosphate decarboxylase [Guillardia theta CCMP2712]
Length=378

 Score =   177 bits (450),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 105/177 (59%), Positives = 129/177 (73%), Gaps = 16/177 (9%)
 Frame = +1

Query  220  TNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDRMWLNGKEMSLS  399
            +NIAVIKYWGKRD+  ILPIN S+SVTL P  + T T+ A +P++   ++WLNGKE   +
Sbjct  8    SNIAVIKYWGKRDKKKILPINSSLSVTLSPFDMGTCTSAAYNPSWKGVKLWLNGKEEDAN  67

Query  400  GVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTaaglassaagfaC  579
              R QNCL+EI+AR+ +  D K+GI+I             S NNFPTAAGLASSA+G+AC
Sbjct  68   TERIQNCLREIQARSGE-SDMKEGIRIV------------STNNFPTAAGLASSASGYAC  114

Query  580  LVFALGKLMNVKEDNSQLSAIARQGSGSACRSLFGGFVKWIMGKEEDGSDSLAVQLV  750
            LV ALG L  V+ D   LS IARQGSGSACRS++GGFVKW MGKEEDGSDS+AVQ+ 
Sbjct  115  LVAALGGLFKVEGD---LSVIARQGSGSACRSMYGGFVKWEMGKEEDGSDSIAVQVA  168



>ref|XP_011370192.1| PREDICTED: diphosphomevalonate decarboxylase [Pteropus vampyrus]
Length=400

 Score =   178 bits (451),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 106/191 (55%), Positives = 134/191 (70%), Gaps = 9/191 (5%)
 Frame = +1

Query  181  AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  360
            +EK V+ VT   P NIAVIKYWGKRDE LILPIN S+SVTL    L TTTT  +S  F +
Sbjct  3    SEKPVVTVTCTAPVNIAVIKYWGKRDEDLILPINSSLSVTLHQDQLKTTTTAVISKDFTE  62

Query  361  DRMWLNGKEMSLSGVRYQNCLKEIR--ARACDVEDEKKGIKITKKDWENLHVHIASYNNF  534
            D++WLNG+++ +   R Q CL+EIR  AR     D+K  + ++     +  VHIAS NNF
Sbjct  63   DQIWLNGQKVDVGQPRIQACLREIRRLARKRRSADDKDPLPLSL----SYKVHIASVNNF  118

Query  535  PTaaglassaagfaCLVFALGKLMNVKEDNSQLSAIARQGSGSACRSLFGGFVKWIMGKE  714
            PTAAGLASSAAG+ACL F L ++  V+ D   LS +AR+GSGSACRSL+GGFV+W MG+ 
Sbjct  119  PTAAGLASSAAGYACLAFTLAQVYGVESD---LSEVARRGSGSACRSLYGGFVEWQMGER  175

Query  715  EDGSDSLAVQL  747
             DG DS+A Q+
Sbjct  176  ADGKDSIARQV  186



>ref|XP_004392172.1| PREDICTED: diphosphomevalonate decarboxylase [Odobenus rosmarus 
divergens]
Length=400

 Score =   178 bits (451),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 106/190 (56%), Positives = 133/190 (70%), Gaps = 9/190 (5%)
 Frame = +1

Query  184  EKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQD  363
            EK ++ VT   P NIAVIKYWGKRDE LILPIN S+SVTL    L TTTT A+S  F +D
Sbjct  4    EKPLVAVTCTAPVNIAVIKYWGKRDEDLILPINSSLSVTLHQDQLKTTTTAAISKDFTED  63

Query  364  RMWLNGKEMSLSGVRYQNCLKEIR--ARACDVEDEKKGIKITKKDWENLHVHIASYNNFP  537
            R+WLNG+E  +   R Q CL+EIR  AR      ++  + ++     +  VHIAS NNFP
Sbjct  64   RIWLNGREEDVGQPRLQACLREIRRLARKRRSAGDEDPLPLSL----SYKVHIASVNNFP  119

Query  538  TaaglassaagfaCLVFALGKLMNVKEDNSQLSAIARQGSGSACRSLFGGFVKWIMGKEE  717
            TAAGLASSAAG+ACL +AL ++  V+ D   LS +AR+GSGSACRSL+GGFV+W MG+  
Sbjct  120  TAAGLASSAAGYACLAYALARVYGVESD---LSEVARRGSGSACRSLYGGFVEWQMGERA  176

Query  718  DGSDSLAVQL  747
            DG DS+A Q+
Sbjct  177  DGKDSIARQV  186



>gb|EIE86507.1| diphosphomevalonate decarboxylase [Rhizopus delemar RA 99-880]
Length=409

 Score =   178 bits (451),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 101/184 (55%), Positives = 123/184 (67%), Gaps = 1/184 (1%)
 Frame = +1

Query  202  VTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDRMWLNG  381
            VT   P NIAVIKYWGKRD  LILP N S+SVTL    L + TT++ +  + QDR+WLNG
Sbjct  4    VTCTAPVNIAVIKYWGKRDTELILPTNSSLSVTLSQDILHSKTTISAAKEYSQDRLWLNG  63

Query  382  KEMSLS-GVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTaaglas  558
            KE  ++   R  NC +E RA    +ED+        +     H+H+ S NNFPTAAGLAS
Sbjct  64   KEEDITKNRRMHNCFRETRAIRKAMEDKAGATGQPIEPLSTYHLHVCSENNFPTAAGLAS  123

Query  559  saagfaCLVFALGKLMNVKEDNSQLSAIARQGSGSACRSLFGGFVKWIMGKEEDGSDSLA  738
            SA+G A LVF L +L  +    S++S IARQGSGSACRSLFGGFV W MG+E DGSDSLA
Sbjct  124  SASGLAALVFTLSQLFELTISTSEISRIARQGSGSACRSLFGGFVAWEMGEEADGSDSLA  183

Query  739  VQLV  750
            VQ+ 
Sbjct  184  VQVA  187



>ref|XP_011564748.1| PREDICTED: diphosphomevalonate decarboxylase [Plutella xylostella]
Length=391

 Score =   177 bits (449),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 102/182 (56%), Positives = 127/182 (70%), Gaps = 10/182 (5%)
 Frame = +1

Query  202  VTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDRMWLNG  381
            VT   P NIAVIKYWGKRDE LILP+NDS+S TLD + +C  T+V+ SP F +D +WLNG
Sbjct  5    VTVVAPVNIAVIKYWGKRDEELILPLNDSVSATLDTSVMCAKTSVSASPEFTEDVIWLNG  64

Query  382  KEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTaaglass  561
            K+ S S  R QNCL+E++ RA              K++ +  VH+ S NNFPTAAGLASS
Sbjct  65   KKESFSNKRLQNCLREVKERAAAEGS-------VDKNFLSWKVHVCSENNFPTAAGLASS  117

Query  562  aagfaCLVFALGKLMNVKEDNSQLSAIARQGSGSACRSLFGGFVKWIMGKEEDGSDSLAV  741
            AAG+ACLV AL KL  VK D   +S+IAR GSGSACRS++GGFV+W  G +  G DS+A 
Sbjct  118  AAGYACLVTALAKLYKVKTD---VSSIARLGSGSACRSVYGGFVRWHAGSDPSGVDSIAT  174

Query  742  QL  747
            Q+
Sbjct  175  QI  176



>gb|ELK00496.1| Diphosphomevalonate decarboxylase [Pteropus alecto]
Length=310

 Score =   175 bits (444),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 105/191 (55%), Positives = 134/191 (70%), Gaps = 9/191 (5%)
 Frame = +1

Query  181  AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  360
            +EK ++ VT   P NIAVIKYWGKRDE LILPIN S+SVTL    L TTTT  +S  F +
Sbjct  3    SEKPLVTVTCTAPVNIAVIKYWGKRDEDLILPINSSLSVTLHQDQLKTTTTAVISKDFTE  62

Query  361  DRMWLNGKEMSLSGVRYQNCLKEIR--ARACDVEDEKKGIKITKKDWENLHVHIASYNNF  534
            D++WLNG+++ +   R Q CL+EIR  AR     D+K  + ++     +  VHIAS NNF
Sbjct  63   DQIWLNGQKVDVGQPRIQACLREIRRLARKRRSADDKDPLPLSL----SYKVHIASVNNF  118

Query  535  PTaaglassaagfaCLVFALGKLMNVKEDNSQLSAIARQGSGSACRSLFGGFVKWIMGKE  714
            PTAAGLASSAAG+ACL F L ++  V+ D   LS +AR+GSGSACRSL+GGFV+W MG+ 
Sbjct  119  PTAAGLASSAAGYACLAFTLAQVYGVEGD---LSEVARRGSGSACRSLYGGFVEWQMGER  175

Query  715  EDGSDSLAVQL  747
             DG DS+A Q+
Sbjct  176  ADGKDSIARQV  186



>ref|XP_012014998.1| PREDICTED: diphosphomevalonate decarboxylase isoform X2 [Ovis 
aries musimon]
Length=400

 Score =   177 bits (449),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 104/193 (54%), Positives = 135/193 (70%), Gaps = 13/193 (7%)
 Frame = +1

Query  181  AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  360
            +EK +++VT   P NIAV+KYWGKRDE LILPIN S+SVTL    L TTTT A+S  F +
Sbjct  3    SEKPIVVVTCTAPVNIAVVKYWGKRDEELILPINSSLSVTLHQDQLKTTTTAAISRDFTE  62

Query  361  DRMWLNGKEMSLSGVRYQNCLKEI----RARACDVEDEKKGIKITKKDWENLHVHIASYN  528
            DR+WLNG+E  +   R Q CL+EI    R R  +  ++   + ++ K      VH+AS N
Sbjct  63   DRIWLNGQEEDVGQPRLQACLREIRRLARKRRSNGHEDPLPLSLSYK------VHVASEN  116

Query  529  NFPTaaglassaagfaCLVFALGKLMNVKEDNSQLSAIARQGSGSACRSLFGGFVKWIMG  708
            NFPTAAGLASSAAG+ACL +AL ++  V   +S LS +AR+GSGSACRSL+GGFV+W MG
Sbjct  117  NFPTAAGLASSAAGYACLAYALAQVYGV---DSDLSEVARRGSGSACRSLYGGFVEWQMG  173

Query  709  KEEDGSDSLAVQL  747
            +  DG DS+A Q+
Sbjct  174  ERPDGKDSIAHQV  186



>ref|XP_006043222.1| PREDICTED: diphosphomevalonate decarboxylase [Bubalus bubalis]
Length=400

 Score =   177 bits (449),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 104/193 (54%), Positives = 133/193 (69%), Gaps = 13/193 (7%)
 Frame = +1

Query  181  AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  360
            +EK +++VT   P NIAV+KYWGKRDE LILPIN S+SVTL    L TTTT A+S  F +
Sbjct  3    SEKPIVVVTCTAPVNIAVVKYWGKRDEELILPINSSLSVTLHQDQLKTTTTAAISRDFTE  62

Query  361  DRMWLNGKEMSLSGVRYQNCLKEI----RARACDVEDEKKGIKITKKDWENLHVHIASYN  528
            DR+WLNG+E  +   R Q CL EI    R R  D  ++   + ++ K      VH+AS N
Sbjct  63   DRIWLNGREEDMGHPRLQACLTEIRRLARKRRSDGHEDPLPLSLSYK------VHVASEN  116

Query  529  NFPTaaglassaagfaCLVFALGKLMNVKEDNSQLSAIARQGSGSACRSLFGGFVKWIMG  708
            NFPTAAGLASSAAG+ACL + L ++  V   +S LS +AR+GSGSACRSL+GGFV+W MG
Sbjct  117  NFPTAAGLASSAAGYACLAYTLARVYGV---DSDLSEVARRGSGSACRSLYGGFVEWQMG  173

Query  709  KEEDGSDSLAVQL  747
            +  DG DS+A Q+
Sbjct  174  ERPDGKDSVARQV  186



>ref|XP_004753891.1| PREDICTED: diphosphomevalonate decarboxylase [Mustela putorius 
furo]
 ref|XP_004814744.1| PREDICTED: diphosphomevalonate decarboxylase [Mustela putorius 
furo]
Length=400

 Score =   177 bits (449),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 104/192 (54%), Positives = 132/192 (69%), Gaps = 13/192 (7%)
 Frame = +1

Query  184  EKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQD  363
            EK V+ VT   P NIAVIKYWGKRDE L+LPIN S+SVTL    L TTTT A+S  F +D
Sbjct  4    EKPVVAVTCTAPVNIAVIKYWGKRDEDLVLPINSSLSVTLHQDQLKTTTTAAISKDFTED  63

Query  364  RMWLNGKEMSLSGVRYQNCLKEI----RARACDVEDEKKGIKITKKDWENLHVHIASYNN  531
            R+WLNG+E  +   R Q CL+EI    R R    +++   + ++ K      VH+AS NN
Sbjct  64   RIWLNGREEDVEQPRLQACLREIRRLARKRRSAGDEDPAALGLSYK------VHVASVNN  117

Query  532  FPTaaglassaagfaCLVFALGKLMNVKEDNSQLSAIARQGSGSACRSLFGGFVKWIMGK  711
            FPTAAGLASSAAG+ACL + L ++  V+ D   LS +AR+GSGSACRSL+GGFV+W MG+
Sbjct  118  FPTAAGLASSAAGYACLAYTLAQVYGVESD---LSEVARRGSGSACRSLYGGFVEWQMGE  174

Query  712  EEDGSDSLAVQL  747
              DG DS+A Q+
Sbjct  175  RADGKDSIARQV  186



>gb|AAH81784.1| Mevalonate (diphospho) decarboxylase [Rattus norvegicus]
 gb|EDL92747.1| mevalonate (diphospho) decarboxylase [Rattus norvegicus]
Length=401

 Score =   177 bits (449),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 104/184 (57%), Positives = 126/184 (68%), Gaps = 5/184 (3%)
 Frame = +1

Query  196  LMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDRMWL  375
            LMVT   P NIAVIKYWGKRDE LILPIN S+SVTL    L TTTT A+S  F +DR+WL
Sbjct  9    LMVTCTAPVNIAVIKYWGKRDEALILPINSSLSVTLHQDQLKTTTTAAISKDFTEDRIWL  68

Query  376  NGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTaagla  555
            NG+E  +   R Q CL+EIR  A        G  +         VH+AS NNFPTAAGLA
Sbjct  69   NGREEDVGQPRLQACLREIRRLARKRRSTGDGDALPLS--LGYKVHVASVNNFPTAAGLA  126

Query  556  ssaagfaCLVFALGKLMNVKEDNSQLSAIARQGSGSACRSLFGGFVKWIMGKEEDGSDSL  735
            SSAAG+ACL + L ++  V+ D   LS +AR+GSGSACRSL+GGFV+W MG++ DG DS+
Sbjct  127  SSAAGYACLAYTLARVYGVEGD---LSEVARRGSGSACRSLYGGFVEWQMGEQADGKDSI  183

Query  736  AVQL  747
            A Q+
Sbjct  184  ARQI  187



>ref|XP_009089159.1| PREDICTED: diphosphomevalonate decarboxylase [Serinus canaria]
Length=399

 Score =   177 bits (448),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 105/189 (56%), Positives = 130/189 (69%), Gaps = 6/189 (3%)
 Frame = +1

Query  181  AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  360
            AE+ + M T   P NIAVIKYWGKRD  LILPIN S+SVTL    L TTTT A S  F +
Sbjct  3    AERALAMATCTAPVNIAVIKYWGKRDTDLILPINSSLSVTLHQDQLKTTTTAAASRDFTE  62

Query  361  DRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPT  540
            DR+WLNGKE  +   R Q CL+E+R  A      + G +       +  +HIAS NNFPT
Sbjct  63   DRLWLNGKEADVGHPRVQACLREVRRLA---RKRRGGGEDAAALSLSYKIHIASENNFPT  119

Query  541  aaglassaagfaCLVFALGKLMNVKEDNSQLSAIARQGSGSACRSLFGGFVKWIMGKEED  720
            AAGLASSAAG+ACLV AL +L  ++E   +LS +AR+GSGSACRS+FGGFV+W  G+  D
Sbjct  120  AAGLASSAAGYACLVSALARLYGLEE---ELSEVARRGSGSACRSMFGGFVQWQRGERPD  176

Query  721  GSDSLAVQL  747
            G+DSLA+Q+
Sbjct  177  GTDSLALQV  185



>ref|XP_004437181.1| PREDICTED: diphosphomevalonate decarboxylase [Ceratotherium simum 
simum]
Length=400

 Score =   177 bits (448),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 105/193 (54%), Positives = 133/193 (69%), Gaps = 13/193 (7%)
 Frame = +1

Query  181  AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  360
            +EK ++ VT   P NIAVIKYWGKRDE LILPIN S+SVTL    L TTTT A+S  F +
Sbjct  3    SEKPIVAVTCTAPVNIAVIKYWGKRDEELILPINSSLSVTLHQDQLKTTTTAAISKDFAE  62

Query  361  DRMWLNGKEMSLSGVRYQNCLKEI----RARACDVEDEKKGIKITKKDWENLHVHIASYN  528
            DR+WLNG+E  +   R Q CL+EI    R R    +++   + ++ K      VH+AS N
Sbjct  63   DRIWLNGQEEDVGQPRLQACLREIRRLARKRRSSGDEDPLPLSVSYK------VHVASVN  116

Query  529  NFPTaaglassaagfaCLVFALGKLMNVKEDNSQLSAIARQGSGSACRSLFGGFVKWIMG  708
            NFPTAAGLASSAAG+ACL +AL ++  V+ D   LS +AR+GSGSACRSL GGFV+W MG
Sbjct  117  NFPTAAGLASSAAGYACLAYALARVYGVESD---LSEVARRGSGSACRSLHGGFVEWQMG  173

Query  709  KEEDGSDSLAVQL  747
            +  DG DS+A Q+
Sbjct  174  ERADGKDSVARQV  186



>ref|NP_112324.1| diphosphomevalonate decarboxylase [Rattus norvegicus]
 sp|Q62967.1|MVD1_RAT RecName: Full=Diphosphomevalonate decarboxylase; AltName: Full=Mevalonate 
(diphospho)decarboxylase; Short=MDDase; AltName: 
Full=Mevalonate pyrophosphate decarboxylase [Rattus norvegicus]
 gb|AAB00192.1| mevalonate pyrophosphate decarboxylase [Rattus norvegicus]
Length=401

 Score =   177 bits (448),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 104/184 (57%), Positives = 126/184 (68%), Gaps = 5/184 (3%)
 Frame = +1

Query  196  LMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDRMWL  375
            LMVT   P NIAVIKYWGKRDE LILPIN S+SVTL    L TTTT A+S  F +DR+WL
Sbjct  9    LMVTCTAPVNIAVIKYWGKRDEALILPINPSLSVTLHQDQLKTTTTAAISKDFTEDRIWL  68

Query  376  NGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTaagla  555
            NG+E  +   R Q CL+EIR  A        G  +         VH+AS NNFPTAAGLA
Sbjct  69   NGREEDVGQPRLQACLREIRRLARKRRSTGDGDALPLS--LGYKVHVASVNNFPTAAGLA  126

Query  556  ssaagfaCLVFALGKLMNVKEDNSQLSAIARQGSGSACRSLFGGFVKWIMGKEEDGSDSL  735
            SSAAG+ACL + L ++  V+ D   LS +AR+GSGSACRSL+GGFV+W MG++ DG DS+
Sbjct  127  SSAAGYACLAYTLARVYGVEGD---LSEVARRGSGSACRSLYGGFVEWQMGEQADGKDSI  183

Query  736  AVQL  747
            A Q+
Sbjct  184  ARQI  187



>gb|AAA34506.2| ORF [Saccharomyces cerevisiae]
Length=194

 Score =   171 bits (433),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 99/187 (53%), Positives = 126/187 (67%), Gaps = 4/187 (2%)
 Frame = +1

Query  193  VLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDRMW  372
            V   +   P NIA +KYWGKRD  L LP N SISVTL    L T T+ A +P F++D +W
Sbjct  3    VYTASVTAPVNIATLKYWGKRDTKLNLPTNSSISVTLSQDDLRTLTSAATAPEFERDTLW  62

Query  373  LNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTaagl  552
            LNG+  S+   R QNCL+++R    ++E +   +  T   W+   +HI S NNFPTAAGL
Sbjct  63   LNGEPHSIDNERTQNCLRDLRQLRKEMESKDASLP-TLSQWK---LHIVSENNFPTAAGL  118

Query  553  assaagfaCLVFALGKLMNVKEDNSQLSAIARQGSGSACRSLFGGFVKWIMGKEEDGSDS  732
            ASSAAGFA LV A+ KL  + +  S++S IAR+GSGSACRSLFGG+V W MGK EDG DS
Sbjct  119  ASSAAGFAALVSAIAKLYQLPQSTSEISRIARKGSGSACRSLFGGYVAWEMGKAEDGHDS  178

Query  733  LAVQLVD  753
            +AVQ+ D
Sbjct  179  MAVQIAD  185



>gb|KIM44772.1| hypothetical protein M413DRAFT_442732 [Hebeloma cylindrosporum 
h7]
Length=409

 Score =   177 bits (448),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 106/187 (57%), Positives = 127/187 (68%), Gaps = 6/187 (3%)
 Frame = +1

Query  193  VLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDRMW  372
            +   TA  P NIAVIKYWGKRD  LILP N S+SVTLD  HL +TTT    P+F++D++W
Sbjct  3    IYQATASAPVNIAVIKYWGKRDTKLILPTNSSLSVTLDQDHLRSTTTSRADPSFERDQLW  62

Query  373  LNGKEMSLS-GVRYQNCLKEI-RARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTaa  546
            LNGKE  +  G R   C+ E+ R R   VED+       +    +  VHIASYNNFPTAA
Sbjct  63   LNGKEDEIKPGGRLATCIAEMKRLRKETVEDKNP----EEPKISDYKVHIASYNNFPTAA  118

Query  547  glassaagfaCLVFALGKLMNVKEDNSQLSAIARQGSGSACRSLFGGFVKWIMGKEEDGS  726
            GLASSA+GFA LV +L  L  +    S LSAIARQGSGSACRSLFGGFV W MG + +G+
Sbjct  119  GLASSASGFAALVASLAYLYALPSSPSVLSAIARQGSGSACRSLFGGFVAWDMGSQPNGA  178

Query  727  DSLAVQL  747
            DSLA Q+
Sbjct  179  DSLARQV  185



>ref|XP_011058925.1| PREDICTED: diphosphomevalonate decarboxylase [Acromyrmex echinatior]
Length=386

 Score =   176 bits (447),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 105/183 (57%), Positives = 127/183 (69%), Gaps = 14/183 (8%)
 Frame = +1

Query  202  VTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDRMWLNG  381
            VT   P NIAVIKYWGKR+E+LILP NDSIS TLD A L   TTV +S  F +DR+WLNG
Sbjct  5    VTCIAPVNIAVIKYWGKRNESLILPTNDSISATLDTAQLHAKTTVMLSSDFKEDRIWLNG  64

Query  382  KEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTaaglass  561
            KE  ++  R QNCLKEIR R+         +     DW+   + I S NNFPTAAGLASS
Sbjct  65   KEEDINNTRLQNCLKEIRKRS--------QLSGYTNDWK---IRICSKNNFPTAAGLASS  113

Query  562  aagfaCLVFALGKLMNVKEDNSQLSAIARQGSGSACRSLFGGFVKWIMGKEEDGSDSLAV  741
            AAG+ACL  AL KL  ++ D   +S IAR GSGSACRS+ GGFV+W MG +++G+DSLA 
Sbjct  114  AAGYACLTAALAKLYKIEGD---ISIIARSGSGSACRSVMGGFVRWYMGSDKNGTDSLAK  170

Query  742  QLV  750
            Q+V
Sbjct  171  QIV  173



>ref|XP_011880662.1| PREDICTED: diphosphomevalonate decarboxylase [Vollenhovia emeryi]
Length=387

 Score =   176 bits (447),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 105/183 (57%), Positives = 124/183 (68%), Gaps = 14/183 (8%)
 Frame = +1

Query  202  VTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDRMWLNG  381
            VT   P NIAVIKYWGKRDE+LILP NDSIS TLD   L   TTV +SP F +DR+WLNG
Sbjct  4    VTCIAPVNIAVIKYWGKRDESLILPTNDSISATLDTDQLHAKTTVMISPDFKEDRIWLNG  63

Query  382  KEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTaaglass  561
            KE  +   R QNCL EIR R+         +     DW+   +H+ S NNFPTAAGLASS
Sbjct  64   KEEDIKNARLQNCLIEIRKRS--------QLSGHTNDWK---IHVCSKNNFPTAAGLASS  112

Query  562  aagfaCLVFALGKLMNVKEDNSQLSAIARQGSGSACRSLFGGFVKWIMGKEEDGSDSLAV  741
            AAG+ACL  AL KL  ++ D   +S IAR GSGSACRS  GGFV+W MG ++ G+DSLA 
Sbjct  113  AAGYACLTTALAKLYKIEGD---ISVIARSGSGSACRSTMGGFVRWHMGSDKYGTDSLAK  169

Query  742  QLV  750
            Q+V
Sbjct  170  QIV  172



>ref|XP_004058175.1| PREDICTED: diphosphomevalonate decarboxylase [Gorilla gorilla 
gorilla]
Length=400

 Score =   177 bits (448),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 103/189 (54%), Positives = 129/189 (68%), Gaps = 5/189 (3%)
 Frame = +1

Query  181  AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  360
            +EK    VT   P NIAVIKYWGKRDE L+LPIN S+SVTL    L TTTT  +S  F +
Sbjct  3    SEKPQAAVTCTAPVNIAVIKYWGKRDEELVLPINSSLSVTLHQDQLKTTTTAVISKHFTK  62

Query  361  DRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPT  540
            DR+WLNG+E  +   R Q CL+EIR  A    D + G  +      +  VH+AS NNFPT
Sbjct  63   DRIWLNGREEDVGQPRLQACLREIRCLARKRRDSRDGDPLPSS--LSCKVHVASVNNFPT  120

Query  541  aaglassaagfaCLVFALGKLMNVKEDNSQLSAIARQGSGSACRSLFGGFVKWIMGKEED  720
            AAGLASSAAG+ACL + L ++  V+ D   LS +AR+GSGSACRSL+GGFV+W MG++ D
Sbjct  121  AAGLASSAAGYACLAYTLARVYGVESD---LSEVARRGSGSACRSLYGGFVEWQMGEQAD  177

Query  721  GSDSLAVQL  747
            G DS+A Q+
Sbjct  178  GKDSIARQV  186



>emb|CBJ48557.1| Diphosphomevalonate decarboxylase [Ectocarpus siliculosus]
Length=433

 Score =   177 bits (449),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 106/189 (56%), Positives = 128/189 (68%), Gaps = 3/189 (2%)
 Frame = +1

Query  196  LMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDRMWL  375
            L VT   PTNIAVIKYWGK    L  PIN S SVTL    L   TTVA S  F++D++WL
Sbjct  9    LCVTCSAPTNIAVIKYWGKDSVALNTPINSSASVTLSQDDLRAITTVAASKDFEKDQLWL  68

Query  376  NGKEMSLS-GVRYQNCLKEIRARACDVEDEKKG-IKITKKDWENLHVHIASYNNFPTaag  549
            NG E  +S   R+Q  ++++RA A +  DE  G + + + DW+   V IAS N FPTAAG
Sbjct  69   NGTEEDVSKNKRFQAVIRQVRALATEKRDEATGEVVVAEGDWDQYRVRIASRNTFPTAAG  128

Query  550  lassaagfaCLVFALGKLMNVKED-NSQLSAIARQGSGSACRSLFGGFVKWIMGKEEDGS  726
            LASSAAG ACL F+L KL N KE  + +LS+IARQGSGSACRSL+GGFVKW  G  ED  
Sbjct  129  LASSAAGLACLTFSLAKLFNAKESFDGELSSIARQGSGSACRSLYGGFVKWQKGVREDAR  188

Query  727  DSLAVQLVD  753
            DS+AVQ+ D
Sbjct  189  DSIAVQVAD  197



>ref|XP_011163917.1| PREDICTED: diphosphomevalonate decarboxylase isoform X2 [Solenopsis 
invicta]
Length=381

 Score =   176 bits (446),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 105/183 (57%), Positives = 126/183 (69%), Gaps = 14/183 (8%)
 Frame = +1

Query  202  VTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDRMWLNG  381
            VT   P NIAVIKYWGKRDE+LILP NDSIS TLD   L   TTV +SP F +D +WLNG
Sbjct  4    VTCIAPVNIAVIKYWGKRDESLILPTNDSISATLDTDQLHAKTTVMISPDFKEDCIWLNG  63

Query  382  KEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTaaglass  561
            +E  +  +R QNCLKEIR R+         +     DW+   +HI S NNFPTAAGLASS
Sbjct  64   REEDIKNIRLQNCLKEIRKRS--------QLSDYINDWK---IHICSKNNFPTAAGLASS  112

Query  562  aagfaCLVFALGKLMNVKEDNSQLSAIARQGSGSACRSLFGGFVKWIMGKEEDGSDSLAV  741
            AAG+ACL  AL KL  ++ D   +S IAR GSGSACRS+ GGFV+W MG ++ G+DSLA 
Sbjct  113  AAGYACLTAALAKLYKIEGD---ISIIARSGSGSACRSVMGGFVRWQMGSDKYGTDSLAK  169

Query  742  QLV  750
            Q+V
Sbjct  170  QIV  172



>emb|CEI99330.1| Putative Diphosphomevalonate decarboxylase [Rhizopus microsporus]
Length=411

 Score =   177 bits (448),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 100/184 (54%), Positives = 124/184 (67%), Gaps = 1/184 (1%)
 Frame = +1

Query  202  VTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDRMWLNG  381
            VT   P NIAVIKYWGKRD  LILP N S+SVTL    L + TT++ +  + QDR+WLNG
Sbjct  4    VTCTAPVNIAVIKYWGKRDTELILPTNSSLSVTLSQDILHSKTTISAAKEYTQDRLWLNG  63

Query  382  KEMSLS-GVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTaaglas  558
            KE  ++   R  NC +E RA    +ED+        +     H+H+ S NNFPTAAGLAS
Sbjct  64   KEEDITKNKRMHNCFRETRAIRKAMEDKAASEGNPIEPLSTYHLHVCSENNFPTAAGLAS  123

Query  559  saagfaCLVFALGKLMNVKEDNSQLSAIARQGSGSACRSLFGGFVKWIMGKEEDGSDSLA  738
            SA+G A LVF L +L  +    S++S IARQGSGSACRSLFGGFV W MG++EDGSDS+A
Sbjct  124  SASGLAALVFTLAQLFELTISTSEVSRIARQGSGSACRSLFGGFVAWEMGQKEDGSDSVA  183

Query  739  VQLV  750
            VQ+ 
Sbjct  184  VQVA  187



>ref|XP_011163916.1| PREDICTED: diphosphomevalonate decarboxylase isoform X1 [Solenopsis 
invicta]
Length=387

 Score =   176 bits (446),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 105/183 (57%), Positives = 126/183 (69%), Gaps = 14/183 (8%)
 Frame = +1

Query  202  VTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDRMWLNG  381
            VT   P NIAVIKYWGKRDE+LILP NDSIS TLD   L   TTV +SP F +D +WLNG
Sbjct  4    VTCIAPVNIAVIKYWGKRDESLILPTNDSISATLDTDQLHAKTTVMISPDFKEDCIWLNG  63

Query  382  KEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTaaglass  561
            +E  +  +R QNCLKEIR R+         +     DW+   +HI S NNFPTAAGLASS
Sbjct  64   REEDIKNIRLQNCLKEIRKRS--------QLSDYINDWK---IHICSKNNFPTAAGLASS  112

Query  562  aagfaCLVFALGKLMNVKEDNSQLSAIARQGSGSACRSLFGGFVKWIMGKEEDGSDSLAV  741
            AAG+ACL  AL KL  ++ D   +S IAR GSGSACRS+ GGFV+W MG ++ G+DSLA 
Sbjct  113  AAGYACLTAALAKLYKIEGD---ISIIARSGSGSACRSVMGGFVRWQMGSDKYGTDSLAK  169

Query  742  QLV  750
            Q+V
Sbjct  170  QIV  172



>emb|CDR37714.1| CYFA0S01e15566g1_1 [Cyberlindnera fabianii]
Length=397

 Score =   176 bits (447),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 107/186 (58%), Positives = 130/186 (70%), Gaps = 6/186 (3%)
 Frame = +1

Query  193  VLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDRMW  372
            V   T   P NIA +KYWGKRD+TL LP N SISVTL    L T T+VA S +F +DR+W
Sbjct  3    VYTATTTAPVNIATLKYWGKRDKTLNLPTNSSISVTLSQDDLRTLTSVATSESFPEDRLW  62

Query  373  LNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGI-KITKKDWENLHVHIASYNNFPTaag  549
            LNGKE SL+  R QNCLK++R     +E+    + KI    W+   +HI S NNFPTAAG
Sbjct  63   LNGKEESLASERTQNCLKDLRTLREKLEESDPSLPKIAT--WK---LHIVSENNFPTAAG  117

Query  550  lassaagfaCLVFALGKLMNVKEDNSQLSAIARQGSGSACRSLFGGFVKWIMGKEEDGSD  729
            LASSAAGFA LV A+ KL  + ED S++S IAR+GSGSACRS+FGG+V W MG E DGSD
Sbjct  118  LASSAAGFAALVCAIAKLYQLPEDMSEISKIARKGSGSACRSVFGGYVAWEMGDETDGSD  177

Query  730  SLAVQL  747
            S AV++
Sbjct  178  SKAVEV  183



>gb|EFA74532.1| diphosphomevalonate decarboxylase [Polysphondylium pallidum PN500]
Length=399

 Score =   176 bits (447),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 103/182 (57%), Positives = 124/182 (68%), Gaps = 15/182 (8%)
 Frame = +1

Query  202  VTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDRMWLNG  381
            +T   P NIA IKYWGKRDE LILP+N S+S TL    L TTTT   S  F +D +WLNG
Sbjct  5    ITCTAPVNIATIKYWGKRDEKLILPLNSSLSGTLHQDDLKTTTTAVASENFTEDAIWLNG  64

Query  382  KEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTaaglass  561
            K+  ++  RYQN L+ IR+RA  + D+K              VHI S NNFPTAAGLASS
Sbjct  65   KKEDINTTRYQNVLRMIRSRATKLMDKKH------------FVHICSINNFPTAAGLASS  112

Query  562  aagfaCLVFALGKLMNVKEDNSQLSAIARQGSGSACRSLFGGFVKWIMGKEEDGSDSLAV  741
            A+G+ACLV+ L +L  V  D   +SAIAR GSGSACRS++GGFVKW MG E DGSDS+AV
Sbjct  113  ASGYACLVYVLAQLYGVSGD---ISAIARIGSGSACRSVYGGFVKWEMGAESDGSDSIAV  169

Query  742  QL  747
            Q+
Sbjct  170  QV  171



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1455524718375