BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig187

Length=1031
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|AAA34099.1|  plasma membrane H+ ATPase                               515   1e-179   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
ref|XP_011087207.1|  PREDICTED: plasma membrane ATPase 3                523   4e-175   Sesamum indicum [beniseed]
gb|EYU35893.1|  hypothetical protein MIMGU_mgv1a0008591mg               514   1e-174   Erythranthe guttata [common monkey flower]
ref|NP_001234775.1|  plasma membrane ATPase 1                           519   3e-173   Solanum lycopersicum
ref|XP_006838797.1|  PREDICTED: plasma membrane ATPase 3                519   3e-173   Amborella trichopoda
ref|XP_006367061.1|  PREDICTED: plasma membrane ATPase 1-like           518   8e-173   Solanum tuberosum [potatoes]
ref|XP_009626987.1|  PREDICTED: plasma membrane ATPase 3                517   1e-172   Nicotiana tomentosiformis
sp|Q08436.1|PMA3_NICPL  RecName: Full=Plasma membrane ATPase 3; A...    517   1e-172   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
gb|KDO76027.1|  hypothetical protein CISIN_1g005866mg                   507   3e-172   Citrus sinensis [apfelsine]
ref|NP_001234477.1|  plasma membrane H+-ATPase                          516   3e-172   Solanum lycopersicum
ref|XP_009799220.1|  PREDICTED: plasma membrane ATPase 3                516   4e-172   Nicotiana sylvestris
ref|XP_006354801.1|  PREDICTED: plasma membrane ATPase 1-like           516   5e-172   Solanum tuberosum [potatoes]
gb|KDO76029.1|  hypothetical protein CISIN_1g005866mg                   506   6e-172   Citrus sinensis [apfelsine]
ref|XP_009793289.1|  PREDICTED: plasma membrane ATPase 2                514   2e-171   Nicotiana sylvestris
ref|NP_001274861.1|  plasma membrane ATPase 1-like                      513   3e-171   Solanum tuberosum [potatoes]
gb|AAA34052.1|  H+-translocating ATPase                                 513   5e-171   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
ref|XP_008437674.1|  PREDICTED: ATPase 11, plasma membrane-type         513   8e-171   Cucumis melo [Oriental melon]
ref|XP_009610426.1|  PREDICTED: plasma membrane ATPase 2                512   1e-170   
ref|XP_002270344.1|  PREDICTED: plasma membrane ATPase 1 isoform X1     512   2e-170   Vitis vinifera
ref|XP_004299601.1|  PREDICTED: ATPase 11, plasma membrane-type         511   2e-170   Fragaria vesca subsp. vesca
sp|Q08435.1|PMA1_NICPL  RecName: Full=Plasma membrane ATPase 1; A...    511   2e-170   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
ref|XP_011651238.1|  PREDICTED: ATPase 11, plasma membrane-type         511   3e-170   Cucumis sativus [cucumbers]
ref|XP_008374513.1|  PREDICTED: ATPase 11, plasma membrane-type         511   5e-170   
ref|XP_009607762.1|  PREDICTED: plasma membrane ATPase 1                510   5e-170   Nicotiana tomentosiformis
ref|XP_009369365.1|  PREDICTED: ATPase 11, plasma membrane-type         510   6e-170   Pyrus x bretschneideri [bai li]
ref|XP_008239652.1|  PREDICTED: ATPase 11, plasma membrane-type         510   8e-170   Prunus mume [ume]
ref|XP_010256132.1|  PREDICTED: ATPase 11, plasma membrane-type i...    510   9e-170   Nelumbo nucifera [Indian lotus]
ref|XP_010256122.1|  PREDICTED: ATPase 11, plasma membrane-type i...    510   9e-170   Nelumbo nucifera [Indian lotus]
ref|XP_009798932.1|  PREDICTED: plasma membrane ATPase 1                509   2e-169   Nicotiana sylvestris
ref|XP_007210395.1|  hypothetical protein PRUPE_ppa000934mg             509   2e-169   Prunus persica
gb|KJB19307.1|  hypothetical protein B456_003G094300                    506   3e-169   Gossypium raimondii
gb|KCW49372.1|  hypothetical protein EUGRSUZ_K02916                     507   4e-169   Eucalyptus grandis [rose gum]
ref|XP_010550649.1|  PREDICTED: ATPase 11, plasma membrane-type         508   4e-169   Tarenaya hassleriana [spider flower]
gb|KCW49373.1|  hypothetical protein EUGRSUZ_K02916                     507   5e-169   Eucalyptus grandis [rose gum]
ref|XP_009343433.1|  PREDICTED: ATPase 11, plasma membrane-type-like    508   7e-169   Pyrus x bretschneideri [bai li]
ref|XP_011028703.1|  PREDICTED: ATPase 11, plasma membrane-type-like    507   8e-169   Populus euphratica
ref|XP_010037634.1|  PREDICTED: ATPase 11, plasma membrane-type         507   8e-169   Eucalyptus grandis [rose gum]
gb|AFC88896.1|  plasma membrane H+-ATPase                               506   1e-168   Melastoma malabathricum
ref|XP_010678593.1|  PREDICTED: plasma membrane ATPase 1                506   2e-168   Beta vulgaris subsp. vulgaris [field beet]
gb|KJB19303.1|  hypothetical protein B456_003G094300                    505   2e-168   Gossypium raimondii
ref|XP_006476664.1|  PREDICTED: ATPase 11, plasma membrane-type-like    506   3e-168   Citrus sinensis [apfelsine]
ref|XP_006439665.1|  hypothetical protein CICLE_v10018737mg             506   3e-168   Citrus clementina [clementine]
gb|KJB19302.1|  hypothetical protein B456_003G094300                    506   4e-168   Gossypium raimondii
gb|AAQ55291.1|  plasma membrane H+-ATPase                               505   5e-168   Juglans regia
ref|XP_002282263.1|  PREDICTED: ATPase 4, plasma membrane-type          505   8e-168   Vitis vinifera
dbj|BAD16689.1|  plasma membrane H+-ATPase                              504   9e-168   Daucus carota [carrots]
gb|KJB19305.1|  hypothetical protein B456_003G094300                    504   1e-167   Gossypium raimondii
gb|EPS66977.1|  hypothetical protein M569_07799                         503   2e-167   Genlisea aurea
ref|XP_012080196.1|  PREDICTED: ATPase 11, plasma membrane-type         503   3e-167   Jatropha curcas
gb|KJB19306.1|  hypothetical protein B456_003G094300                    504   3e-167   Gossypium raimondii
ref|XP_003523043.1|  PREDICTED: ATPase 11, plasma membrane-type-l...    503   6e-167   Glycine max [soybeans]
gb|KHN19372.1|  ATPase 11, plasma membrane-type                         502   7e-167   Glycine soja [wild soybean]
ref|XP_003527056.1|  PREDICTED: ATPase 11, plasma membrane-type-l...    502   7e-167   Glycine max [soybeans]
ref|XP_008807875.1|  PREDICTED: ATPase 11, plasma membrane-type         502   1e-166   Phoenix dactylifera
dbj|BAD16686.1|  plasma membrane H+-ATPase                              501   2e-166   Daucus carota [carrots]
ref|XP_007155352.1|  hypothetical protein PHAVU_003G193800g             496   3e-166   Phaseolus vulgaris [French bean]
ref|XP_010459221.1|  PREDICTED: ATPase 11, plasma membrane-type-like    500   4e-166   
ref|XP_006279959.1|  hypothetical protein CARUB_v10025825mg             500   6e-166   Capsella rubella
gb|KEH31901.1|  plasma membrane H+-ATPase                               499   8e-166   Medicago truncatula
ref|XP_002322127.1|  putative plasma membrane H+ ATPase family pr...    500   9e-166   
ref|XP_002864812.1|  AHA11-ATPASE 11                                    499   2e-165   Arabidopsis lyrata subsp. lyrata
ref|XP_011659953.1|  PREDICTED: plasma membrane ATPase 3                499   2e-165   Cucumis sativus [cucumbers]
ref|XP_011042618.1|  PREDICTED: ATPase 11, plasma membrane-type         499   2e-165   Populus euphratica
ref|XP_008453171.1|  PREDICTED: plasma membrane ATPase 3                499   2e-165   Cucumis melo [Oriental melon]
ref|XP_009398402.1|  PREDICTED: plasma membrane ATPase 1-like           498   2e-165   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006394361.1|  hypothetical protein EUTSA_v10003603mg             498   2e-165   
ref|XP_009130230.1|  PREDICTED: ATPase 11, plasma membrane-type i...    498   3e-165   Brassica rapa
ref|XP_010444121.1|  PREDICTED: ATPase 11, plasma membrane-type i...    498   4e-165   
emb|CDP14881.1|  unnamed protein product                                498   4e-165   Coffea canephora [robusta coffee]
ref|XP_010444120.1|  PREDICTED: ATPase 11, plasma membrane-type i...    498   4e-165   
tpg|DAA54787.1|  TPA: hypothetical protein ZEAMMB73_074525              493   4e-165   
ref|XP_007138219.1|  hypothetical protein PHAVU_009G190500g             498   4e-165   Phaseolus vulgaris [French bean]
ref|XP_009130229.1|  PREDICTED: ATPase 11, plasma membrane-type i...    497   6e-165   Brassica rapa
ref|XP_011071717.1|  PREDICTED: LOW QUALITY PROTEIN: plasma membr...    497   7e-165   Sesamum indicum [beniseed]
ref|NP_201073.1|  H(+)-ATPase 11                                        497   7e-165   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009130228.1|  PREDICTED: ATPase 11, plasma membrane-type i...    498   8e-165   Brassica rapa
ref|XP_008796652.1|  PREDICTED: plasma membrane ATPase 3 isoform X1     497   1e-164   Phoenix dactylifera
ref|XP_010933786.1|  PREDICTED: plasma membrane ATPase 3                496   1e-164   Elaeis guineensis
ref|XP_004508789.1|  PREDICTED: ATPase 11, plasma membrane-type-l...    496   2e-164   Cicer arietinum [garbanzo]
gb|KHN13245.1|  Plasma membrane ATPase 1                                496   2e-164   Glycine soja [wild soybean]
ref|XP_007155353.1|  hypothetical protein PHAVU_003G193800g             496   3e-164   Phaseolus vulgaris [French bean]
emb|CAC29435.1|  P-type H+-ATPase                                       495   5e-164   Vicia faba [broad bean]
ref|XP_009398401.1|  PREDICTED: plasma membrane ATPase 1 isoform X2     495   6e-164   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004508788.1|  PREDICTED: ATPase 11, plasma membrane-type-l...    495   6e-164   
ref|XP_010923303.1|  PREDICTED: plasma membrane ATPase 3-like           494   8e-164   Elaeis guineensis
ref|NP_001059093.1|  Os07g0191200                                       494   8e-164   
ref|XP_002442618.1|  hypothetical protein SORBIDRAFT_08g023070          494   8e-164   Sorghum bicolor [broomcorn]
ref|NP_001067382.1|  Os12g0638700                                       494   9e-164   
ref|XP_006658357.1|  PREDICTED: plasma membrane ATPase 1-like           494   1e-163   Oryza brachyantha
ref|XP_009398400.1|  PREDICTED: plasma membrane ATPase 1 isoform X1     495   1e-163   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004508787.1|  PREDICTED: ATPase 11, plasma membrane-type-l...    495   1e-163   
ref|XP_010228254.1|  PREDICTED: plasma membrane ATPase 3-like iso...    494   1e-163   Brachypodium distachyon [annual false brome]
ref|XP_006290560.1|  hypothetical protein CARUB_v10016646mg             494   1e-163   Capsella rubella
dbj|BAA06629.1|  plasma membrane H+-ATPase                              493   2e-163   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010228253.1|  PREDICTED: plasma membrane ATPase 3-like iso...    494   2e-163   Brachypodium distachyon [annual false brome]
ref|XP_002318614.1|  putative plasma membrane H+ ATPase family pr...    493   2e-163   
ref|XP_003525017.1|  PREDICTED: ATPase 11, plasma membrane-type-l...    493   2e-163   Glycine max [soybeans]
ref|XP_004963335.1|  PREDICTED: plasma membrane ATPase 1-like           493   3e-163   Setaria italica
emb|CAB41144.1|  H+-transporting ATPase-like protein                    493   3e-163   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008673350.1|  PREDICTED: uncharacterized protein LOC100502...    493   4e-163   
ref|NP_190378.2|  H(+)-ATPase 4                                         493   4e-163   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004148685.1|  PREDICTED: ATPase 11, plasma membrane-type-like    492   7e-163   Cucumis sativus [cucumbers]
gb|KEH24965.1|  plasma membrane H+-ATPase                               492   7e-163   Medicago truncatula
ref|XP_004982139.1|  PREDICTED: plasma membrane ATPase 1-like           492   8e-163   Setaria italica
ref|XP_007037195.1|  H(+)-transporting atpase plant/fungi plasma ...    507   9e-163   
ref|XP_010029279.1|  PREDICTED: ATPase 11, plasma membrane-type-like    492   9e-163   Eucalyptus grandis [rose gum]
gb|KEH24964.1|  plasma membrane H+-ATPase                               491   1e-162   Medicago truncatula
ref|XP_006664787.1|  PREDICTED: plasma membrane ATPase 1-like           491   1e-162   Oryza brachyantha
gb|KCW56159.1|  hypothetical protein EUGRSUZ_I01911                     491   1e-162   Eucalyptus grandis [rose gum]
ref|XP_003549657.1|  PREDICTED: ATPase 11, plasma membrane-type-like    491   2e-162   Glycine max [soybeans]
gb|KJB33644.1|  hypothetical protein B456_006G023600                    486   4e-162   Gossypium raimondii
gb|KHN34200.1|  ATPase 11, plasma membrane-type                         490   5e-162   Glycine soja [wild soybean]
ref|XP_003554288.1|  PREDICTED: plasma membrane ATPase 1-like           489   5e-162   Glycine max [soybeans]
ref|XP_009417143.1|  PREDICTED: plasma membrane ATPase 1-like           489   8e-162   
ref|XP_007151191.1|  hypothetical protein PHAVU_004G025700g             489   9e-162   Phaseolus vulgaris [French bean]
gb|KDO72464.1|  hypothetical protein CISIN_1g0021762mg                  487   9e-162   Citrus sinensis [apfelsine]
ref|XP_007032428.1|  H(+)-ATPase 4 isoform 2                            489   1e-161   
ref|XP_008644894.1|  PREDICTED: uncharacterized protein LOC100383...    488   2e-161   
gb|KDO72462.1|  hypothetical protein CISIN_1g0021762mg                  487   2e-161   Citrus sinensis [apfelsine]
emb|CDY45757.1|  BnaC02g42250D                                          488   2e-161   Brassica napus [oilseed rape]
ref|XP_007032427.1|  H(+)-ATPase 4 isoform 1                            489   3e-161   
ref|XP_006482527.1|  PREDICTED: plasma membrane ATPase 1-like           488   3e-161   Citrus sinensis [apfelsine]
ref|XP_003561110.1|  PREDICTED: plasma membrane ATPase 1-like           488   4e-161   Brachypodium distachyon [annual false brome]
ref|XP_006431062.1|  hypothetical protein CICLE_v10011000mg             488   4e-161   Citrus clementina [clementine]
ref|XP_008459294.1|  PREDICTED: ATPase 11, plasma membrane-type-like    487   4e-161   Cucumis melo [Oriental melon]
gb|KJB33643.1|  hypothetical protein B456_006G023600                    484   7e-161   Gossypium raimondii
ref|XP_007214948.1|  hypothetical protein PRUPE_ppa000931mg             487   7e-161   
ref|XP_011098566.1|  PREDICTED: plasma membrane ATPase 1-like           486   9e-161   Sesamum indicum [beniseed]
ref|XP_002459489.1|  hypothetical protein SORBIDRAFT_02g005440          486   1e-160   Sorghum bicolor [broomcorn]
gb|KJB33642.1|  hypothetical protein B456_006G023600                    485   2e-160   Gossypium raimondii
gb|KJB33641.1|  hypothetical protein B456_006G023600                    485   3e-160   Gossypium raimondii
ref|XP_008650970.1|  PREDICTED: uncharacterized protein LOC100216...    485   4e-160   
ref|XP_008230721.1|  PREDICTED: plasma membrane ATPase 1-like           485   5e-160   Prunus mume [ume]
ref|XP_003578172.1|  PREDICTED: plasma membrane ATPase 1                485   5e-160   Brachypodium distachyon [annual false brome]
gb|EYU34115.1|  hypothetical protein MIMGU_mgv1a000867mg                484   5e-160   Erythranthe guttata [common monkey flower]
ref|XP_010272214.1|  PREDICTED: ATPase 11, plasma membrane-type-like    484   6e-160   Nelumbo nucifera [Indian lotus]
ref|XP_004955721.1|  PREDICTED: plasma membrane ATPase 1-like           484   1e-159   Setaria italica
ref|XP_010112580.1|  ATPase 11, plasma membrane-type                    483   3e-159   
gb|KCW83495.1|  hypothetical protein EUGRSUZ_B00400                     481   4e-159   Eucalyptus grandis [rose gum]
dbj|BAJ92653.1|  predicted protein                                      482   4e-159   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAK04567.1|  predicted protein                                      482   4e-159   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010028675.1|  PREDICTED: ATPase 11, plasma membrane-type         481   1e-158   Eucalyptus grandis [rose gum]
gb|KCW83494.1|  hypothetical protein EUGRSUZ_B00400                     481   1e-158   Eucalyptus grandis [rose gum]
gb|AEQ27823.1|  PM H+-ATPase L                                          481   1e-158   Eichhornia crassipes
ref|XP_011466246.1|  PREDICTED: plasma membrane ATPase 1-like iso...    480   3e-158   Fragaria vesca subsp. vesca
ref|XP_004302360.1|  PREDICTED: plasma membrane ATPase 1-like iso...    480   3e-158   Fragaria vesca subsp. vesca
dbj|BAA01058.1|  H-ATPase                                               479   7e-158   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001050947.1|  Os03g0689300                                       478   1e-157   
ref|XP_008341531.1|  PREDICTED: plasma membrane ATPase 1-like           478   3e-157   
ref|XP_009335819.1|  PREDICTED: plasma membrane ATPase 1-like           477   4e-157   Pyrus x bretschneideri [bai li]
ref|NP_001105360.1|  membrane H(+)-ATPase1                              474   3e-156   Zea mays [maize]
tpg|DAA42486.1|  TPA: H(+)-transporting ATPase                          474   5e-156   
gb|EEC81667.1|  hypothetical protein OsI_25220                          474   7e-156   Oryza sativa Indica Group [Indian rice]
ref|XP_012082827.1|  PREDICTED: plasma membrane ATPase 1-like           474   8e-156   Jatropha curcas
gb|EMT26085.1|  Plasma membrane ATPase 1                                473   3e-155   
ref|XP_010531800.1|  PREDICTED: ATPase 4, plasma membrane-type-like     471   7e-155   Tarenaya hassleriana [spider flower]
gb|EEC75974.1|  hypothetical protein OsI_13084                          471   1e-154   Oryza sativa Indica Group [Indian rice]
emb|CDP02191.1|  unnamed protein product                                470   2e-154   Coffea canephora [robusta coffee]
ref|XP_010430916.1|  PREDICTED: ATPase 8, plasma membrane-type-like     449   3e-154   Camelina sativa [gold-of-pleasure]
emb|CDY69631.1|  BnaCnng64550D                                          455   6e-154   Brassica napus [oilseed rape]
ref|XP_010496530.1|  PREDICTED: ATPase 8, plasma membrane-type-like     451   7e-154   Camelina sativa [gold-of-pleasure]
emb|CDY67606.1|  BnaAnng24780D                                          454   1e-153   Brassica napus [oilseed rape]
ref|XP_009396235.1|  PREDICTED: plasma membrane ATPase                  467   3e-153   Musa acuminata subsp. malaccensis [pisang utan]
gb|EPS73574.1|  hypothetical protein M569_01174                         460   4e-153   Genlisea aurea
ref|XP_011621190.1|  PREDICTED: plasma membrane ATPase 1 isoform X2     466   1e-152   
ref|XP_009384769.1|  PREDICTED: plasma membrane ATPase-like             466   1e-152   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011621189.1|  PREDICTED: plasma membrane ATPase 1 isoform X1     466   1e-152   Amborella trichopoda
emb|CDP09440.1|  unnamed protein product                                466   2e-152   Coffea canephora [robusta coffee]
ref|XP_011082991.1|  PREDICTED: LOW QUALITY PROTEIN: plasma membr...    465   2e-152   
ref|XP_006651704.1|  PREDICTED: plasma membrane ATPase 1-like           466   2e-152   
ref|XP_002263241.1|  PREDICTED: ATPase 8, plasma membrane-type          464   3e-152   Vitis vinifera
gb|EPS65442.1|  hypothetical protein M569_09334                         464   3e-152   Genlisea aurea
dbj|BAM20990.1|  plasma membrane H+-ATPase                              464   4e-152   Marchantia polymorpha
ref|XP_008781833.1|  PREDICTED: plasma membrane ATPase 4                464   4e-152   Phoenix dactylifera
gb|ERN00217.1|  hypothetical protein AMTR_s00111p00107570               466   4e-152   Amborella trichopoda
ref|XP_010928676.1|  PREDICTED: plasma membrane ATPase-like             464   4e-152   Elaeis guineensis
ref|XP_002325038.1|  plasma membrane H+ ATPase family protein           464   5e-152   
gb|EMS45119.1|  Plasma membrane ATPase 1                                464   5e-152   Triticum urartu
ref|XP_010913679.1|  PREDICTED: plasma membrane ATPase                  464   5e-152   Elaeis guineensis
ref|XP_010094202.1|  Plasma membrane ATPase 4                           464   5e-152   Morus notabilis
gb|EYU25317.1|  hypothetical protein MIMGU_mgv1a000893mg                464   6e-152   Erythranthe guttata [common monkey flower]
ref|XP_010545412.1|  PREDICTED: ATPase 2, plasma membrane-type-like     464   6e-152   Tarenaya hassleriana [spider flower]
emb|CAN64375.1|  hypothetical protein VITISV_014422                     464   6e-152   Vitis vinifera
ref|XP_002267501.1|  PREDICTED: plasma membrane ATPase 4                463   7e-152   Vitis vinifera
ref|XP_008443886.1|  PREDICTED: ATPase 8, plasma membrane-type          462   1e-151   Cucumis melo [Oriental melon]
ref|XP_003610081.1|  Plasma membrane H+-ATPase                          462   2e-151   
ref|XP_009347012.1|  PREDICTED: plasma membrane ATPase 4-like           462   2e-151   Pyrus x bretschneideri [bai li]
ref|XP_010942146.1|  PREDICTED: plasma membrane ATPase 4-like           462   2e-151   Elaeis guineensis
ref|XP_012083655.1|  PREDICTED: plasma membrane ATPase 1 isoform X2     462   3e-151   
ref|XP_012083654.1|  PREDICTED: plasma membrane ATPase 1 isoform X1     462   4e-151   Jatropha curcas
ref|XP_008223752.1|  PREDICTED: plasma membrane ATPase 4                462   4e-151   Prunus mume [ume]
ref|XP_003610080.1|  Plasma membrane H+-ATPase                          461   4e-151   Medicago truncatula
ref|XP_008789658.1|  PREDICTED: plasma membrane ATPase 4-like           461   4e-151   Phoenix dactylifera
ref|XP_010929278.1|  PREDICTED: plasma membrane ATPase-like             461   4e-151   Elaeis guineensis
ref|XP_002307856.1|  ATPase 6 family protein                            461   5e-151   Populus trichocarpa [western balsam poplar]
ref|XP_007225493.1|  hypothetical protein PRUPE_ppa000937mg             461   7e-151   Prunus persica
gb|KDO67286.1|  hypothetical protein CISIN_1g002203mg                   452   7e-151   Citrus sinensis [apfelsine]
gb|EYU31795.1|  hypothetical protein MIMGU_mgv1a000883mg                461   8e-151   Erythranthe guttata [common monkey flower]
gb|KJB82762.1|  hypothetical protein B456_013G212200                    455   9e-151   Gossypium raimondii
ref|XP_004146701.1|  PREDICTED: ATPase 8, plasma membrane-type          460   1e-150   Cucumis sativus [cucumbers]
gb|KDO61837.1|  hypothetical protein CISIN_1g002208mg                   460   1e-150   Citrus sinensis [apfelsine]
ref|NP_001292777.1|  proton-exporting ATPase4                           460   1e-150   Zea mays [maize]
gb|KCW80694.1|  hypothetical protein EUGRSUZ_C02092                     456   1e-150   Eucalyptus grandis [rose gum]
ref|XP_006845683.1|  PREDICTED: plasma membrane ATPase 4                460   2e-150   Amborella trichopoda
ref|XP_008784794.1|  PREDICTED: plasma membrane ATPase 4-like iso...    460   2e-150   Phoenix dactylifera
ref|XP_008451563.1|  PREDICTED: plasma membrane ATPase 4                459   2e-150   Cucumis melo [Oriental melon]
gb|AFW59711.1|  plasma membrane H+-transporting ATPase-like protein     459   3e-150   
ref|XP_011043940.1|  PREDICTED: LOW QUALITY PROTEIN: plasma membr...    459   3e-150   Populus euphratica
ref|XP_004507873.1|  PREDICTED: plasma membrane ATPase 4-like           459   3e-150   Cicer arietinum [garbanzo]
gb|AAB84202.2|  plasma membrane proton ATPase                           459   3e-150   Kosteletzkya pentacarpos [seashore mallow]
ref|XP_011017965.1|  PREDICTED: ATPase 8, plasma membrane-type-like     459   3e-150   Populus euphratica
gb|AEQ27822.1|  PM H+-ATPase R                                          459   3e-150   Eichhornia crassipes
ref|NP_001274848.1|  plasma membrane ATPase 4-like                      459   4e-150   Solanum tuberosum [potatoes]
ref|XP_002282619.1|  PREDICTED: plasma membrane ATPase 4                459   4e-150   Vitis vinifera
ref|XP_012075128.1|  PREDICTED: plasma membrane ATPase 4                459   4e-150   
ref|XP_008784793.1|  PREDICTED: plasma membrane ATPase 4-like iso...    459   5e-150   Phoenix dactylifera
ref|XP_011031934.1|  PREDICTED: plasma membrane ATPase 1                459   5e-150   Populus euphratica
ref|XP_008663679.1|  PREDICTED: plasma membrane ATPase isoform X1       459   6e-150   
ref|XP_002324564.1|  ATPase 6 family protein                            458   7e-150   Populus trichocarpa [western balsam poplar]
ref|XP_006453324.1|  hypothetical protein CICLE_v10007368mg             458   7e-150   Citrus clementina [clementine]
ref|XP_011084025.1|  PREDICTED: ATPase 8, plasma membrane-type          458   8e-150   Sesamum indicum [beniseed]
gb|AEO22063.1|  plasma membrane H+-ATPase                               458   9e-150   Aeluropus littoralis
ref|XP_004960134.1|  PREDICTED: plasma membrane ATPase-like             458   1e-149   Setaria italica
ref|XP_008804905.1|  PREDICTED: plasma membrane ATPase-like             458   1e-149   Phoenix dactylifera
ref|XP_009394581.1|  PREDICTED: plasma membrane ATPase-like             457   1e-149   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007014221.1|  Plasma membrane ATPase 4 isoform 1                 457   1e-149   
ref|XP_007014222.1|  Plasma membrane ATPase 4 isoform 2                 457   1e-149   
gb|AAB17186.1|  plasma membrane H+-ATPase                               457   1e-149   Solanum lycopersicum
ref|XP_004242908.1|  PREDICTED: plasma membrane ATPase 4                457   1e-149   
ref|XP_002447249.1|  hypothetical protein SORBIDRAFT_06g031240          457   2e-149   Sorghum bicolor [broomcorn]
gb|KHN17608.1|  Plasma membrane ATPase 4                                457   2e-149   Glycine soja [wild soybean]
ref|XP_009401466.1|  PREDICTED: plasma membrane ATPase-like             457   2e-149   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010431653.1|  PREDICTED: ATPase 9, plasma membrane-type-like     447   2e-149   Camelina sativa [gold-of-pleasure]
sp|Q03194.1|PMA4_NICPL  RecName: Full=Plasma membrane ATPase 4; A...    457   2e-149   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
ref|XP_011002373.1|  PREDICTED: ATPase 8, plasma membrane-type-like     457   2e-149   Populus euphratica
ref|XP_011084027.1|  PREDICTED: ATPase 8, plasma membrane-type-like     457   2e-149   Sesamum indicum [beniseed]
ref|XP_008810004.1|  PREDICTED: plasma membrane ATPase                  457   2e-149   Phoenix dactylifera
ref|XP_008378243.1|  PREDICTED: plasma membrane ATPase 4-like           457   2e-149   
ref|XP_003549363.1|  PREDICTED: plasma membrane ATPase 4-like iso...    457   2e-149   Glycine max [soybeans]
ref|XP_011033475.1|  PREDICTED: ATPase 8, plasma membrane-type          457   2e-149   Populus euphratica
ref|XP_011084028.1|  PREDICTED: ATPase 8, plasma membrane-type-like     457   3e-149   Sesamum indicum [beniseed]
dbj|BAD16684.1|  plasma membrane H+-ATPase                              457   3e-149   Daucus carota [carrots]
ref|XP_010929115.1|  PREDICTED: plasma membrane ATPase 4-like           457   3e-149   Elaeis guineensis
ref|XP_009588974.1|  PREDICTED: plasma membrane ATPase 4                457   3e-149   Nicotiana tomentosiformis
dbj|BAD16688.1|  plasma membrane H+-ATPase                              456   3e-149   Daucus carota [carrots]
emb|CDX72218.1|  BnaC07g42400D                                          455   3e-149   
gb|KJB82763.1|  hypothetical protein B456_013G212200                    456   4e-149   Gossypium raimondii
emb|CDX72217.1|  BnaC07g42390D                                          455   4e-149   
ref|XP_010049873.1|  PREDICTED: ATPase 8, plasma membrane-type is...    456   4e-149   Eucalyptus grandis [rose gum]
ref|XP_010526353.1|  PREDICTED: ATPase 2, plasma membrane-type-like     456   4e-149   Tarenaya hassleriana [spider flower]
gb|KJB22048.1|  hypothetical protein B456_004G027300                    456   4e-149   Gossypium raimondii
ref|XP_010520558.1|  PREDICTED: ATPase 8, plasma membrane-type-like     456   4e-149   Tarenaya hassleriana [spider flower]
ref|XP_010049874.1|  PREDICTED: ATPase 8, plasma membrane-type is...    456   4e-149   
ref|XP_008456775.1|  PREDICTED: ATPase 8, plasma membrane-type-like     456   4e-149   Cucumis melo [Oriental melon]
ref|XP_009397034.1|  PREDICTED: plasma membrane ATPase-like             456   4e-149   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007203995.1|  hypothetical protein PRUPE_ppa000965mg             456   4e-149   
gb|KHN22686.1|  Plasma membrane ATPase 4                                456   4e-149   Glycine soja [wild soybean]
emb|CDY51650.1|  BnaAnng10900D                                          455   4e-149   Brassica napus [oilseed rape]
ref|XP_011084023.1|  PREDICTED: ATPase 8, plasma membrane-type-like     456   4e-149   Sesamum indicum [beniseed]
ref|XP_010048446.1|  PREDICTED: plasma membrane ATPase 4                456   5e-149   Eucalyptus grandis [rose gum]
ref|XP_009798265.1|  PREDICTED: plasma membrane ATPase 4                456   5e-149   Nicotiana sylvestris
ref|XP_010932230.1|  PREDICTED: plasma membrane ATPase 4                456   6e-149   Elaeis guineensis
gb|EYU22075.1|  hypothetical protein MIMGU_mgv1a000872mg                456   6e-149   Erythranthe guttata [common monkey flower]
ref|XP_010033995.1|  PREDICTED: ATPase 9, plasma membrane-type is...    455   6e-149   
ref|XP_009137897.1|  PREDICTED: ATPase 2, plasma membrane-type-li...    456   6e-149   Brassica rapa
ref|XP_010548606.1|  PREDICTED: ATPase 2, plasma membrane-type          456   6e-149   Tarenaya hassleriana [spider flower]
tpg|DAA50741.1|  TPA: hypothetical protein ZEAMMB73_722190              461   6e-149   
ref|XP_008445089.1|  PREDICTED: plasma membrane ATPase 4-like           456   7e-149   Cucumis melo [Oriental melon]
gb|KDO67285.1|  hypothetical protein CISIN_1g002203mg                   452   7e-149   Citrus sinensis [apfelsine]
ref|XP_009137896.1|  PREDICTED: ATPase 2, plasma membrane-type-li...    456   7e-149   Brassica rapa
ref|XP_010539423.1|  PREDICTED: ATPase 2, plasma membrane-type is...    456   8e-149   Tarenaya hassleriana [spider flower]
ref|XP_011649762.1|  PREDICTED: plasma membrane ATPase 4                456   8e-149   Cucumis sativus [cucumbers]
ref|XP_010451109.1|  PREDICTED: ATPase 2, plasma membrane-type-like     454   8e-149   Camelina sativa [gold-of-pleasure]
ref|XP_009137895.1|  PREDICTED: ATPase 2, plasma membrane-type-like     455   8e-149   Brassica rapa
gb|ABO15469.2|  plasma membrane H+-ATPase LilHA2                        456   8e-149   Lilium longiflorum [Easter lily]
ref|XP_009128205.1|  PREDICTED: ATPase 8, plasma membrane-type          455   8e-149   Brassica rapa
gb|KDO45595.1|  hypothetical protein CISIN_1g044543mg                   456   9e-149   Citrus sinensis [apfelsine]
dbj|BAD16685.1|  plasma membrane H+-ATPase                              455   9e-149   Daucus carota [carrots]
ref|XP_006427547.1|  hypothetical protein CICLE_v10027127mg             456   9e-149   
dbj|BAC77531.1|  plasma membrane H+-ATPase                              456   9e-149   
ref|XP_006375124.1|  H+-ATPase family protein                           456   1e-148   
dbj|BAM20989.1|  plasma membrane H+-ATPase                              455   1e-148   
ref|XP_008372282.1|  PREDICTED: plasma membrane ATPase 4-like           455   1e-148   
ref|XP_009109000.1|  PREDICTED: ATPase 2, plasma membrane-type          455   1e-148   
ref|XP_007012006.1|  H(+)-ATPase 8                                      455   1e-148   
gb|EYU37313.1|  hypothetical protein MIMGU_mgv1a000870mg                455   1e-148   
ref|XP_006465284.1|  PREDICTED: ATPase 9, plasma membrane-type-like     455   1e-148   
ref|XP_011084026.1|  PREDICTED: ATPase 8, plasma membrane-type-like     455   1e-148   
gb|ACL54575.1|  unknown                                                 455   1e-148   
ref|NP_001292776.1|  plasma membrane ATPase                             455   1e-148   
ref|XP_010033994.1|  PREDICTED: ATPase 9, plasma membrane-type is...    454   1e-148   
ref|XP_010033996.1|  PREDICTED: ATPase 9, plasma membrane-type is...    454   2e-148   
ref|XP_009587248.1|  PREDICTED: ATPase 9, plasma membrane-type          455   2e-148   
ref|XP_010048663.1|  PREDICTED: plasma membrane ATPase 4                455   2e-148   
ref|NP_001292696.1|  plasma membrane ATPase 4                           455   2e-148   
ref|XP_002309321.1|  ATPase 6 family protein                            454   2e-148   
pdb|3B8C|A  Chain A, Crystal Structure Of A Plasma Membrane Proto...    453   2e-148   
ref|XP_011079289.1|  PREDICTED: plasma membrane ATPase 4-like           455   2e-148   
ref|XP_004291218.1|  PREDICTED: plasma membrane ATPase 4-like iso...    455   2e-148   
emb|CAN61424.1|  hypothetical protein VITISV_027272                     455   2e-148   
gb|KJB55189.1|  hypothetical protein B456_009G068100                    455   2e-148   
ref|XP_010539421.1|  PREDICTED: ATPase 2, plasma membrane-type is...    454   2e-148   
ref|XP_010525721.1|  PREDICTED: ATPase 2, plasma membrane-type-like     454   2e-148   
gb|KJB55190.1|  hypothetical protein B456_009G068100                    454   2e-148   
ref|XP_011459045.1|  PREDICTED: plasma membrane ATPase 4-like iso...    455   2e-148   
ref|XP_010103366.1|  ATPase 8, plasma membrane-type                     454   2e-148   
ref|XP_004973040.1|  PREDICTED: plasma membrane ATPase-like             454   2e-148   
ref|XP_010276726.1|  PREDICTED: plasma membrane ATPase 4-like           454   3e-148   
gb|AFM52333.1|  plasma membrane H+-ATPase                               454   3e-148   
ref|XP_009363612.1|  PREDICTED: plasma membrane ATPase 4-like           454   3e-148   
emb|CBW30211.1|  Plasma membrane ATPase                                 454   3e-148   
ref|XP_004486623.1|  PREDICTED: plasma membrane ATPase 4-like           454   3e-148   
dbj|BAL41366.1|  plasma membrane H+-ATPase                              454   3e-148   
gb|ABR26203.1|  plasma membrane atpase 1                                431   3e-148   
ref|XP_007011592.1|  Plasma membrane ATPase 4 isoform 1                 454   3e-148   
gb|AHK23067.1|  plasma membrane ATPase 4                                454   3e-148   
emb|CBW30173.1|  Plasma membrane ATPase 4                               454   3e-148   
ref|XP_006652940.1|  PREDICTED: plasma membrane ATPase-like             454   3e-148   
gb|AAK31799.2|  plasma membrane H+ ATPase                               454   4e-148   
ref|XP_008393957.1|  PREDICTED: plasma membrane ATPase 4                454   4e-148   
gb|KDO67283.1|  hypothetical protein CISIN_1g002203mg                   452   4e-148   
ref|XP_006282542.1|  hypothetical protein CARUB_v10004082mg             454   4e-148   
ref|NP_194748.1|  H(+)-ATPase 2                                         453   4e-148   
emb|CDP02997.1|  unnamed protein product                                454   5e-148   
gb|AAY42950.1|  plasma membrane H+ ATPase                               454   5e-148   
ref|NP_001105470.1|  plasma-membrane H+ATPase2                          453   5e-148   
emb|CDY67153.1|  BnaAnng23670D                                          452   5e-148   
ref|XP_010438207.1|  PREDICTED: ATPase 2, plasma membrane-type-like     453   6e-148   
ref|XP_006279360.1|  hypothetical protein CARUB_v10008027mg             453   6e-148   
ref|XP_009610942.1|  PREDICTED: ATPase 9, plasma membrane-type-like     452   6e-148   
ref|XP_011625064.1|  PREDICTED: plasma membrane ATPase 4 isoform X4     453   6e-148   
gb|KDO67282.1|  hypothetical protein CISIN_1g002203mg                   452   6e-148   
ref|XP_010046967.1|  PREDICTED: plasma membrane ATPase 4 isoform X2     453   6e-148   
ref|XP_007154742.1|  hypothetical protein PHAVU_003G143800g             453   6e-148   
ref|XP_010433017.1|  PREDICTED: ATPase 2, plasma membrane-type          453   6e-148   
ref|XP_009338825.1|  PREDICTED: plasma membrane ATPase 4 isoform X2     453   6e-148   
ref|XP_009338824.1|  PREDICTED: plasma membrane ATPase 4 isoform X1     453   7e-148   
ref|XP_010688454.1|  PREDICTED: plasma membrane ATPase 4                453   7e-148   
gb|KJB65971.1|  hypothetical protein B456_010G123000                    453   7e-148   
ref|NP_001054118.1|  Os04g0656100                                       453   7e-148   
ref|XP_006412736.1|  hypothetical protein EUTSA_v10024335mg             453   7e-148   
emb|CBI16656.3|  unnamed protein product                                453   8e-148   
ref|XP_006848753.2|  PREDICTED: LOW QUALITY PROTEIN: plasma membr...    453   8e-148   
ref|XP_003633895.1|  PREDICTED: plasma membrane ATPase 1                453   9e-148   
ref|XP_006419170.1|  hypothetical protein EUTSA_v10002391mg             452   9e-148   
ref|XP_010046966.1|  PREDICTED: plasma membrane ATPase 4 isoform X1     454   9e-148   
ref|XP_010429431.1|  PREDICTED: ATPase 5, plasma membrane-type-li...    447   1e-147   
ref|NP_001190870.1|  H(+)-ATPase 2                                      454   1e-147   
ref|XP_009398632.1|  PREDICTED: plasma membrane ATPase-like             452   1e-147   
ref|XP_004508384.1|  PREDICTED: ATPase 8, plasma membrane-type-li...    450   1e-147   
ref|XP_011625063.1|  PREDICTED: plasma membrane ATPase 4 isoform X3     452   1e-147   
gb|ABA18112.1|  putative plasma membrane ATPase                         452   1e-147   
ref|XP_009128001.1|  PREDICTED: ATPase 2, plasma membrane-type          452   1e-147   
ref|XP_006848755.1|  PREDICTED: plasma membrane ATPase 4 isoform X2     452   1e-147   
ref|XP_006389820.1|  hypothetical protein EUTSA_v10018080mg             452   1e-147   
gb|KFK29576.1|  h(+)-atpase 2                                           452   1e-147   
gb|KEH39623.1|  plasma membrane H+-ATPase                               452   1e-147   
ref|XP_002875581.1|  hypothetical protein ARALYDRAFT_323063             452   1e-147   
emb|CDX67957.1|  BnaA07g19970D                                          451   1e-147   
ref|XP_006597964.1|  PREDICTED: ATPase 8, plasma membrane-type-like     450   1e-147   
ref|XP_006450166.1|  hypothetical protein CICLE_v10007367mg             452   1e-147   
ref|XP_011625062.1|  PREDICTED: plasma membrane ATPase 4 isoform X1     453   1e-147   
gb|KFK33846.1|  hypothetical protein AALP_AA5G067500                    452   1e-147   
ref|XP_006483568.1|  PREDICTED: plasma membrane ATPase-like             452   2e-147   
ref|XP_003543699.1|  PREDICTED: ATPase 9, plasma membrane-type-like     452   2e-147   
ref|XP_006382164.1|  H+-ATPase family protein                           452   2e-147   
ref|XP_010259861.1|  PREDICTED: plasma membrane ATPase                  452   2e-147   
ref|XP_004296457.1|  PREDICTED: plasma membrane ATPase 4                452   2e-147   
ref|XP_010914190.1|  PREDICTED: plasma membrane ATPase-like             452   2e-147   
gb|EAZ32257.1|  hypothetical protein OsJ_16461                          451   3e-147   
ref|XP_007023381.1|  H(+)-ATPase 9                                      451   3e-147   
ref|XP_009390572.1|  PREDICTED: ATPase 9, plasma membrane-type          451   3e-147   
ref|XP_008242930.1|  PREDICTED: ATPase 8, plasma membrane-type          451   3e-147   
ref|XP_009381563.1|  PREDICTED: plasma membrane ATPase 4-like           451   3e-147   
ref|XP_011031360.1|  PREDICTED: plasma membrane ATPase 4-like           451   4e-147   
ref|XP_009419963.1|  PREDICTED: plasma membrane ATPase-like             451   4e-147   
ref|XP_009104474.1|  PREDICTED: ATPase 9, plasma membrane-type          451   4e-147   
ref|XP_002991931.1|  hypothetical protein SELMODRAFT_430150             449   4e-147   
ref|XP_009392149.1|  PREDICTED: plasma membrane ATPase 4-like           451   4e-147   
gb|ABA18090.1|  putative plasma membrane ATPase                         451   4e-147   
ref|XP_010687728.1|  PREDICTED: ATPase 8, plasma membrane-type-like     451   4e-147   
ref|XP_011089588.1|  PREDICTED: plasma membrane ATPase 1                451   5e-147   
gb|EPS57651.1|  hypothetical protein M569_17165                         451   5e-147   
ref|XP_008453588.1|  PREDICTED: plasma membrane ATPase 4-like           451   5e-147   
gb|KFK42449.1|  hypothetical protein AALP_AA2G258100                    451   6e-147   
ref|XP_004508383.1|  PREDICTED: ATPase 8, plasma membrane-type-li...    451   7e-147   
ref|XP_009775735.1|  PREDICTED: ATPase 9, plasma membrane-type-like     449   8e-147   
ref|XP_008384624.1|  PREDICTED: ATPase 8, plasma membrane-type          450   9e-147   
ref|XP_010526268.1|  PREDICTED: ATPase 5, plasma membrane-type is...    450   9e-147   
gb|AAV49159.1|  plasma membrane proton ATPase 5                         449   9e-147   
ref|XP_010468541.1|  PREDICTED: ATPase 6, plasma membrane-type-like     446   1e-146   
ref|XP_006300372.1|  hypothetical protein CARUB_v10022427mg             450   1e-146   
ref|XP_007225350.1|  hypothetical protein PRUPE_ppa000977mg             450   1e-146   
ref|XP_012067540.1|  PREDICTED: ATPase 9, plasma membrane-type          450   1e-146   
gb|EYU20899.1|  hypothetical protein MIMGU_mgv1a000880mg                450   1e-146   
emb|CAB69823.1|  plasma membrane H+ ATPase                              450   1e-146   
ref|XP_009766358.1|  PREDICTED: ATPase 8, plasma membrane-type          450   1e-146   
ref|XP_010669283.1|  PREDICTED: plasma membrane ATPase 4-like           450   1e-146   
gb|AAR32129.2|  proton P-ATPase                                         449   1e-146   
ref|XP_007204519.1|  hypothetical protein PRUPE_ppa018171mg             450   1e-146   
ref|XP_006594226.1|  PREDICTED: ATPase 8, plasma membrane-type-li...    447   2e-146   
ref|XP_007154926.1|  hypothetical protein PHAVU_003G159200g             449   2e-146   
ref|XP_009106729.1|  PREDICTED: ATPase 9, plasma membrane-type          449   2e-146   
ref|XP_010047150.1|  PREDICTED: ATPase 8, plasma membrane-type-like     449   2e-146   
gb|KEH37844.1|  plasma membrane H+-ATPase                               448   2e-146   
ref|NP_200545.1|  H(+)-ATPase 3                                         449   2e-146   
ref|XP_003547446.1|  PREDICTED: ATPase 9, plasma membrane-type-like     449   2e-146   
dbj|BAD16687.1|  plasma membrane H+-ATPase                              449   2e-146   
gb|AAL09726.1|  AT5g57350/MJB24_16                                      449   2e-146   
ref|XP_008454207.1|  PREDICTED: ATPase 9, plasma membrane-type          449   2e-146   
ref|XP_010425792.1|  PREDICTED: ATPase 8, plasma membrane-type-like     449   2e-146   
ref|XP_008659774.1|  PREDICTED: plasma membrane ATPase 4-like           449   2e-146   
ref|XP_009341817.1|  PREDICTED: ATPase 8, plasma membrane-type is...    449   3e-146   
ref|NP_179486.1|  H(+)-ATPase 1                                         449   3e-146   
ref|XP_009399554.1|  PREDICTED: plasma membrane ATPase isoform X4       449   3e-146   
ref|XP_010514696.1|  PREDICTED: ATPase 8, plasma membrane-type          449   3e-146   
ref|XP_009341818.1|  PREDICTED: ATPase 8, plasma membrane-type is...    449   3e-146   
dbj|BAF03589.1|  P-type H+-ATPase                                       449   3e-146   
ref|XP_003546412.1|  PREDICTED: plasma membrane ATPase 4-like iso...    449   3e-146   
ref|XP_006282289.1|  hypothetical protein CARUB_v10028575mg             449   3e-146   
sp|P83970.1|PMA1_WHEAT  RecName: Full=Plasma membrane ATPase; Alt...    449   3e-146   
gb|EMT26270.1|  Plasma membrane ATPase                                  449   4e-146   
ref|XP_012076337.1|  PREDICTED: plasma membrane ATPase 4                449   4e-146   
gb|AAA32813.1|  plasma membrane proton pump H+ ATPase                   449   4e-146   
ref|XP_004152192.1|  PREDICTED: ATPase 9, plasma membrane-type          449   4e-146   
ref|XP_002532086.1|  H(\+)-transporting atpase plant/fungi plasma...    448   4e-146   
ref|XP_009366133.1|  PREDICTED: ATPase 8, plasma membrane-type-like     448   4e-146   
ref|XP_004242977.2|  PREDICTED: ATPase 8, plasma membrane-type-like     448   4e-146   
gb|EMS60594.1|  Plasma membrane ATPase                                  448   4e-146   
ref|XP_006279406.1|  hypothetical protein CARUB_v10007959mg             448   5e-146   
dbj|BAA37150.1|  p-type H+-ATPase                                       448   5e-146   
ref|XP_004303259.1|  PREDICTED: ATPase 9, plasma membrane-type          448   5e-146   
ref|XP_010472896.1|  PREDICTED: ATPase 9, plasma membrane-type is...    448   6e-146   
ref|XP_010535849.1|  PREDICTED: ATPase 8, plasma membrane-type is...    448   6e-146   
gb|AAY42948.1|  plasma membrane H+ ATPase                               448   6e-146   
ref|XP_003542615.1|  PREDICTED: ATPase 8, plasma membrane-type-li...    448   6e-146   
ref|XP_011082086.1|  PREDICTED: plasma membrane ATPase 4-like           448   7e-146   
ref|XP_009399552.1|  PREDICTED: plasma membrane ATPase isoform X2       449   7e-146   
ref|XP_010417679.1|  PREDICTED: ATPase 9, plasma membrane-type-li...    447   8e-146   
ref|XP_010429432.1|  PREDICTED: ATPase 5, plasma membrane-type-li...    448   9e-146   
ref|XP_004965734.1|  PREDICTED: plasma membrane ATPase 4-like           447   9e-146   
ref|XP_003550136.1|  PREDICTED: plasma membrane ATPase 4-like iso...    447   1e-145   
dbj|BAO45902.1|  plasma membrane H+-ATPase                              447   1e-145   
gb|AFW04239.1|  plasma membrane H+-ATPase                               447   1e-145   
ref|XP_003580730.1|  PREDICTED: plasma membrane ATPase                  447   1e-145   
ref|XP_003529784.1|  PREDICTED: plasma membrane ATPase 4-like           447   1e-145   
gb|KHN18583.1|  ATPase 8, plasma membrane-type                          446   1e-145   
ref|XP_008381054.1|  PREDICTED: ATPase 9, plasma membrane-type          447   1e-145   
ref|NP_001185450.1|  H(+)-ATPase 9                                      447   1e-145   
ref|XP_010417678.1|  PREDICTED: ATPase 9, plasma membrane-type-li...    447   2e-145   
gb|KJB66333.1|  hypothetical protein B456_010G136300                    447   2e-145   
ref|XP_004488894.1|  PREDICTED: ATPase 8, plasma membrane-type-like     447   2e-145   
ref|XP_006343689.1|  PREDICTED: ATPase 8, plasma membrane-type-like     447   2e-145   
ref|NP_178181.1|  H(+)-ATPase 9                                         447   2e-145   
gb|KEH32174.1|  plasma membrane H+-ATPase                               447   2e-145   
emb|CDY51651.1|  BnaAnng10910D                                          445   2e-145   
ref|NP_189850.1|  H(+)-ATPase 8                                         447   2e-145   
ref|XP_003549696.1|  PREDICTED: ATPase 8, plasma membrane-type-li...    447   2e-145   
ref|XP_003544641.1|  PREDICTED: plasma membrane ATPase 4-like iso...    447   2e-145   
ref|XP_007138806.1|  hypothetical protein PHAVU_009G239000g             447   2e-145   
ref|XP_010265488.1|  PREDICTED: plasma membrane ATPase 4                447   2e-145   
gb|KHN15309.1|  Plasma membrane ATPase 4                                447   2e-145   
ref|XP_006343688.1|  PREDICTED: ATPase 8, plasma membrane-type-like     446   2e-145   
ref|XP_010496144.1|  PREDICTED: ATPase 6, plasma membrane-type-like     446   2e-145   
ref|XP_007217150.1|  hypothetical protein PRUPE_ppa000945mg             446   3e-145   
ref|XP_006586984.1|  PREDICTED: plasma membrane ATPase 4-like           446   3e-145   
ref|XP_007134481.1|  hypothetical protein PHAVU_010G050900g             447   3e-145   
ref|XP_010488815.1|  PREDICTED: ATPase 6, plasma membrane-type          446   3e-145   
ref|XP_009348377.1|  PREDICTED: plasma membrane ATPase 1-like           446   3e-145   
ref|XP_011010708.1|  PREDICTED: LOW QUALITY PROTEIN: plasma membr...    446   3e-145   
ref|XP_010533093.1|  PREDICTED: ATPase 6, plasma membrane-type          446   3e-145   
gb|EEC78976.1|  hypothetical protein OsI_19456                          447   3e-145   
gb|EMS59303.1|  Plasma membrane ATPase                                  448   4e-145   
ref|XP_004954231.1|  PREDICTED: ATPase 8, plasma membrane-type-like     446   4e-145   
ref|XP_010443420.1|  PREDICTED: ATPase 3, plasma membrane-type          446   5e-145   
ref|XP_002280201.1|  PREDICTED: plasma membrane ATPase-like             446   5e-145   
ref|XP_008228760.1|  PREDICTED: ATPase 9, plasma membrane-type          446   5e-145   
gb|KJB82864.1|  hypothetical protein B456_013G217900                    444   5e-145   
ref|NP_178762.1|  H(+)-ATPase 6                                         446   5e-145   
ref|XP_009334638.1|  PREDICTED: ATPase 9, plasma membrane-type          445   7e-145   
ref|XP_007161308.1|  hypothetical protein PHAVU_001G058900g             445   8e-145   
ref|XP_004253510.2|  PREDICTED: ATPase 8, plasma membrane-type-like     445   1e-144   
gb|KHN18251.1|  ATPase 8, plasma membrane-type                          442   1e-144   
ref|XP_010111939.1|  Plasma membrane ATPase 4                           444   1e-144   
ref|XP_010313836.1|  PREDICTED: ATPase 9, plasma membrane-type-li...    444   1e-144   
gb|EAZ06139.1|  hypothetical protein OsI_28373                          445   1e-144   
gb|KJB56561.1|  hypothetical protein B456_009G125200                    445   1e-144   
ref|XP_004251768.1|  PREDICTED: ATPase 9, plasma membrane-type-li...    444   1e-144   
ref|XP_010537896.1|  PREDICTED: ATPase 9, plasma membrane-type          446   1e-144   
gb|AAV71150.1|  plasma membrane H+-ATPase                               444   1e-144   
ref|XP_010529048.1|  PREDICTED: ATPase 7, plasma membrane-type          445   2e-144   
emb|CDY14186.1|  BnaA08g13170D                                          444   2e-144   
ref|XP_006350073.1|  PREDICTED: ATPase 8, plasma membrane-type-like     444   2e-144   
ref|XP_007150788.1|  hypothetical protein PHAVU_005G180700g             444   2e-144   
ref|XP_008677658.1|  PREDICTED: uncharacterized protein LOC100383...    444   2e-144   
emb|CAD29313.1|  plasma membrane H+-ATPase                              444   2e-144   
ref|XP_007039740.1|  H(+)-ATPase 11 isoform 1                           444   2e-144   
ref|XP_010483247.1|  PREDICTED: ATPase 3, plasma membrane-type-like     444   2e-144   
gb|KJB70727.1|  hypothetical protein B456_011G089100                    444   2e-144   
ref|NP_001169274.1|  uncharacterized protein LOC100383137               443   2e-144   



>gb|AAA34099.1| plasma membrane H+ ATPase, partial [Nicotiana plumbaginifolia]
Length=388

 Score =   515 bits (1327),  Expect = 1e-179, Method: Compositional matrix adjust.
 Identities = 297/315 (94%), Positives = 310/315 (98%), Gaps = 0/315 (0%)
 Frame = +2

Query  86    MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
             M EKPEVLDAVLKETVDLENIPIEEVFENLRCTK+GLT+ AAQERL IFG+NKLEEKKES
Sbjct  1     MGEKPEVLDAVLKETVDLENIPIEEVFENLRCTKEGLTATAAQERLSIFGYNKLEEKKES  60

Query  266   kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
             KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLL+INSTISFIEENN
Sbjct  61    KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLIINSTISFIEENN  120

Query  446   agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  625
             AGNAAAALMARLAPKAKVLRDG+W EEDA++LVPGDIIS+KLGDIIPADARLL+GDPLKI
Sbjct  121   AGNAAAALMARLAPKAKVLRDGKWKEEDAAVLVPGDIISIKLGDIIPADARLLEGDPLKI  180

Query  626   DQSALTGESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF  805
             DQSALTGESLPVTKGPGDG+YSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF
Sbjct  181   DQSALTGESLPVTKGPGDGVYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF  240

Query  806   QKVLTAIANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVT  985
             QKVLTAI NFCICSIAVGM+IEI+VMYPIQHR+YRPGIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  241   QKVLTAIGNFCICSIAVGMIIEIIVMYPIQHRKYRPGIDNLLVLLIGGIPIAMPTVLSVT  300

Query  986   MAIGSHRLAQQGAIT  1030
             MAIGSHRLAQQGAIT
Sbjct  301   MAIGSHRLAQQGAIT  315



>ref|XP_011087207.1| PREDICTED: plasma membrane ATPase 3 [Sesamum indicum]
Length=956

 Score =   523 bits (1348),  Expect = 4e-175, Method: Compositional matrix adjust.
 Identities = 304/315 (97%), Positives = 311/315 (99%), Gaps = 0/315 (0%)
 Frame = +2

Query  86    MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
             M EKPEVLDAVLKETVDLENIPIEEVFENLRCT++GLT+ AAQERL IFGHNKLEEKKES
Sbjct  1     MGEKPEVLDAVLKETVDLENIPIEEVFENLRCTREGLTTAAAQERLAIFGHNKLEEKKES  60

Query  266   kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
             KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN
Sbjct  61    KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN  120

Query  446   agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  625
             AGNAAAALMARLAPKAKVLRDGRWSEE+ASILVPGDIIS+KLGDIIPADARLL+GDPLKI
Sbjct  121   AGNAAAALMARLAPKAKVLRDGRWSEEEASILVPGDIISIKLGDIIPADARLLEGDPLKI  180

Query  626   DQSALTGESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF  805
             DQSALTGESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF
Sbjct  181   DQSALTGESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF  240

Query  806   QKVLTAIANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVT  985
             QKVLTAI NFCICSIAVGMVIEI+VMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  241   QKVLTAIGNFCICSIAVGMVIEIIVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVT  300

Query  986   MAIGSHRLAQQGAIT  1030
             MAIGSHRLAQQGAIT
Sbjct  301   MAIGSHRLAQQGAIT  315



>gb|EYU35893.1| hypothetical protein MIMGU_mgv1a0008591mg, partial [Erythranthe 
guttata]
Length=689

 Score =   514 bits (1323),  Expect = 1e-174, Method: Compositional matrix adjust.
 Identities = 295/313 (94%), Positives = 311/313 (99%), Gaps = 0/313 (0%)
 Frame = +2

Query  92    EKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskf  271
             EKPEVLDAVLKETVDLENIPI+EVFENLRCT++GLTS+AA+ERL IFGHNKLEEK+ESKF
Sbjct  4     EKPEVLDAVLKETVDLENIPIDEVFENLRCTREGLTSEAAEERLAIFGHNKLEEKRESKF  63

Query  272   lkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnag  451
             LKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENNAG
Sbjct  64    LKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENNAG  123

Query  452   naaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQ  631
             NAAAALMARLAPKAK+LRDGRW+EEDA++LVPGDIIS+KLGDIIPAD+RLLDGDPLKIDQ
Sbjct  124   NAAAALMARLAPKAKILRDGRWNEEDAAMLVPGDIISIKLGDIIPADSRLLDGDPLKIDQ  183

Query  632   SALTGESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQK  811
             SALTGESLPVTKGPGDG+YSGSTCKQGEIEA+VIATGVHTFFGKAAHLVDSTNQVGHFQK
Sbjct  184   SALTGESLPVTKGPGDGVYSGSTCKQGEIEAIVIATGVHTFFGKAAHLVDSTNQVGHFQK  243

Query  812   VLTAIANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVTMA  991
             VLT+I NFCICSIAVGMVIEIVVMYPIQHR+YRPGIDNLLVLLIGGIPIAMPTVLSVTMA
Sbjct  244   VLTSIGNFCICSIAVGMVIEIVVMYPIQHRKYRPGIDNLLVLLIGGIPIAMPTVLSVTMA  303

Query  992   IGSHRLAQQGAIT  1030
             IGSHRLAQQGAIT
Sbjct  304   IGSHRLAQQGAIT  316



>ref|NP_001234775.1| plasma membrane ATPase 1 [Solanum lycopersicum]
 sp|P22180.1|PMA1_SOLLC RecName: Full=Plasma membrane ATPase 1; AltName: Full=Proton 
pump 1 [Solanum lycopersicum]
 gb|AAA34173.1| H+-ATPase [Solanum lycopersicum]
 prf||1803518A H ATPase
Length=956

 Score =   519 bits (1336),  Expect = 3e-173, Method: Compositional matrix adjust.
 Identities = 298/315 (95%), Positives = 311/315 (99%), Gaps = 0/315 (0%)
 Frame = +2

Query  86    MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
             MAEKPEVLDAVLKETVDLENIPIEEVFENLRCT++GLT+ AAQERL IFG+NKLEEKKES
Sbjct  1     MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTREGLTATAAQERLSIFGYNKLEEKKES  60

Query  266   kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
             KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLL+INSTISFIEENN
Sbjct  61    KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLIINSTISFIEENN  120

Query  446   agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  625
             AGNAAAALMARLAPKAKVLRDG+W EEDAS+LVPGDIIS+KLGDIIPADARLL+GDPLKI
Sbjct  121   AGNAAAALMARLAPKAKVLRDGKWDEEDASVLVPGDIISIKLGDIIPADARLLEGDPLKI  180

Query  626   DQSALTGESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF  805
             DQSALTGESLPVTKGPGDG+YSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF
Sbjct  181   DQSALTGESLPVTKGPGDGVYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF  240

Query  806   QKVLTAIANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVT  985
             QKVLTAI NFCICSIAVGM+IEI+VMYPIQHR+YRPGIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  241   QKVLTAIGNFCICSIAVGMIIEIIVMYPIQHRKYRPGIDNLLVLLIGGIPIAMPTVLSVT  300

Query  986   MAIGSHRLAQQGAIT  1030
             MAIGSHRLAQQGAIT
Sbjct  301   MAIGSHRLAQQGAIT  315



>ref|XP_006838797.1| PREDICTED: plasma membrane ATPase 3 [Amborella trichopoda]
 gb|ERN01366.1| hypothetical protein AMTR_s00002p00260210 [Amborella trichopoda]
Length=956

 Score =   519 bits (1336),  Expect = 3e-173, Method: Compositional matrix adjust.
 Identities = 299/315 (95%), Positives = 308/315 (98%), Gaps = 0/315 (0%)
 Frame = +2

Query  86    MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
             M EK EVL+AVLKE VDLENIPIEEVFENLRCTK+GLTS AAQERL IFGHNKLEEKKES
Sbjct  1     MGEKAEVLEAVLKEAVDLENIPIEEVFENLRCTKEGLTSDAAQERLGIFGHNKLEEKKES  60

Query  266   kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
             K LKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLL+INSTISFIEENN
Sbjct  61    KVLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLIINSTISFIEENN  120

Query  446   agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  625
             AGNAAAALMARLAPKAKVLRDGRWSEEDAS+LVPGDIISVKLGDIIPADARLL+GDPLKI
Sbjct  121   AGNAAAALMARLAPKAKVLRDGRWSEEDASVLVPGDIISVKLGDIIPADARLLEGDPLKI  180

Query  626   DQSALTGESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF  805
             DQSALTGESLPVTKGPGDG+YSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF
Sbjct  181   DQSALTGESLPVTKGPGDGVYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF  240

Query  806   QKVLTAIANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVT  985
             QKVLTAI NFCICSIAVGM+IEI+VMYP+QHREYRPGIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  241   QKVLTAIGNFCICSIAVGMIIEIIVMYPVQHREYRPGIDNLLVLLIGGIPIAMPTVLSVT  300

Query  986   MAIGSHRLAQQGAIT  1030
             MAIGSHRLAQQGAIT
Sbjct  301   MAIGSHRLAQQGAIT  315



>ref|XP_006367061.1| PREDICTED: plasma membrane ATPase 1-like [Solanum tuberosum]
Length=956

 Score =   518 bits (1333),  Expect = 8e-173, Method: Compositional matrix adjust.
 Identities = 297/315 (94%), Positives = 311/315 (99%), Gaps = 0/315 (0%)
 Frame = +2

Query  86    MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
             MAEKPEVLDAVLKETVDLENIPIEEVFENLRCT++GLT+ AAQERL IFG+NKLEEKKES
Sbjct  1     MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTREGLTTTAAQERLSIFGYNKLEEKKES  60

Query  266   kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
             KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLL+INSTISFIEENN
Sbjct  61    KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLIINSTISFIEENN  120

Query  446   agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  625
             AGNAAAALMARLAPKAKVLRDG+W EEDA++LVPGDIIS+KLGDIIPADARLL+GDPLKI
Sbjct  121   AGNAAAALMARLAPKAKVLRDGKWDEEDAAVLVPGDIISIKLGDIIPADARLLEGDPLKI  180

Query  626   DQSALTGESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF  805
             DQSALTGESLPVTKGPGDG+YSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF
Sbjct  181   DQSALTGESLPVTKGPGDGVYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF  240

Query  806   QKVLTAIANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVT  985
             QKVLTAI NFCICSIAVGM+IEI+VMYPIQHR+YRPGIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  241   QKVLTAIGNFCICSIAVGMIIEIIVMYPIQHRKYRPGIDNLLVLLIGGIPIAMPTVLSVT  300

Query  986   MAIGSHRLAQQGAIT  1030
             MAIGSHRLAQQGAIT
Sbjct  301   MAIGSHRLAQQGAIT  315



>ref|XP_009626987.1| PREDICTED: plasma membrane ATPase 3 [Nicotiana tomentosiformis]
Length=956

 Score =   517 bits (1332),  Expect = 1e-172, Method: Compositional matrix adjust.
 Identities = 297/315 (94%), Positives = 310/315 (98%), Gaps = 0/315 (0%)
 Frame = +2

Query  86    MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
             M EKPEVLDAVLKETVDLENIPIEEVFENLRCTK+GLT+ AAQERL IFG+NKLEEKKES
Sbjct  1     MGEKPEVLDAVLKETVDLENIPIEEVFENLRCTKEGLTATAAQERLSIFGYNKLEEKKES  60

Query  266   kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
             KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLL+INSTISFIEENN
Sbjct  61    KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLIINSTISFIEENN  120

Query  446   agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  625
             AGNAAAALMARLAPKAKVLRDG+W EEDA++LVPGDIIS+KLGDIIPADARLL+GDPLKI
Sbjct  121   AGNAAAALMARLAPKAKVLRDGKWKEEDAAVLVPGDIISIKLGDIIPADARLLEGDPLKI  180

Query  626   DQSALTGESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF  805
             DQSALTGESLPVTKGPGDG+YSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF
Sbjct  181   DQSALTGESLPVTKGPGDGVYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF  240

Query  806   QKVLTAIANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVT  985
             QKVLTAI NFCICSIAVGM+IEI+VMYPIQHR+YRPGIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  241   QKVLTAIGNFCICSIAVGMIIEIIVMYPIQHRKYRPGIDNLLVLLIGGIPIAMPTVLSVT  300

Query  986   MAIGSHRLAQQGAIT  1030
             MAIGSHRLAQQGAIT
Sbjct  301   MAIGSHRLAQQGAIT  315



>sp|Q08436.1|PMA3_NICPL RecName: Full=Plasma membrane ATPase 3; AltName: Full=Proton 
pump 3 [Nicotiana plumbaginifolia]
 gb|AAA34098.1| plasma membrane H+ ATPase [Nicotiana plumbaginifolia]
Length=956

 Score =   517 bits (1332),  Expect = 1e-172, Method: Compositional matrix adjust.
 Identities = 296/315 (94%), Positives = 309/315 (98%), Gaps = 0/315 (0%)
 Frame = +2

Query  86    MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
             M EKPEVLDAVLKETVDLENIPIEEVFENLRCTK+GLT+ AAQERL IFG+NKLEEKKES
Sbjct  1     MGEKPEVLDAVLKETVDLENIPIEEVFENLRCTKEGLTATAAQERLSIFGYNKLEEKKES  60

Query  266   kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
             KF KFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLL+INSTISFIEENN
Sbjct  61    KFSKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLIINSTISFIEENN  120

Query  446   agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  625
             AGNAAAALMARLAPKAKVLRDG+W EEDA++LVPGDIIS+KLGDIIPADARLL+GDPLKI
Sbjct  121   AGNAAAALMARLAPKAKVLRDGKWKEEDAAVLVPGDIISIKLGDIIPADARLLEGDPLKI  180

Query  626   DQSALTGESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF  805
             DQSALTGESLPVTKGPGDG+YSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF
Sbjct  181   DQSALTGESLPVTKGPGDGVYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF  240

Query  806   QKVLTAIANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVT  985
             QKVLTAI NFCICSIAVGM+IEI+VMYPIQHR+YRPGIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  241   QKVLTAIGNFCICSIAVGMIIEIIVMYPIQHRKYRPGIDNLLVLLIGGIPIAMPTVLSVT  300

Query  986   MAIGSHRLAQQGAIT  1030
             MAIGSHRLAQQGAIT
Sbjct  301   MAIGSHRLAQQGAIT  315



>gb|KDO76027.1| hypothetical protein CISIN_1g005866mg [Citrus sinensis]
 gb|KDO76028.1| hypothetical protein CISIN_1g005866mg [Citrus sinensis]
Length=672

 Score =   507 bits (1305),  Expect = 3e-172, Method: Compositional matrix adjust.
 Identities = 291/315 (92%), Positives = 309/315 (98%), Gaps = 0/315 (0%)
 Frame = +2

Query  86    MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
             M +K EVL+AVLKETVDLENIPIEEVFENLRC+++GL+SQAA+ERL IFG+NKLEEKKES
Sbjct  1     MGDKEEVLEAVLKETVDLENIPIEEVFENLRCSREGLSSQAAEERLSIFGYNKLEEKKES  60

Query  266   kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
             KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN
Sbjct  61    KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN  120

Query  446   agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  625
             AGNAAAALMARLAPK KVLRDGRW+E+DASILVPGDIIS+KLGDIIPADARLL+GDPLKI
Sbjct  121   AGNAAAALMARLAPKGKVLRDGRWNEQDASILVPGDIISIKLGDIIPADARLLEGDPLKI  180

Query  626   DQSALTGESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF  805
             DQSALTGESLPVTKGPGDG+YSGSTCKQGEIEAVVIATGVHTFFGKAAHLVD+TNQVGHF
Sbjct  181   DQSALTGESLPVTKGPGDGVYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDTTNQVGHF  240

Query  806   QKVLTAIANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVT  985
             QKVLTAI NFCICSIAVGM++EI+VMYPIQ REYRPGIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  241   QKVLTAIGNFCICSIAVGMIVEIIVMYPIQDREYRPGIDNLLVLLIGGIPIAMPTVLSVT  300

Query  986   MAIGSHRLAQQGAIT  1030
             MAIGSHRL+QQGAIT
Sbjct  301   MAIGSHRLSQQGAIT  315



>ref|NP_001234477.1| plasma membrane H+-ATPase [Solanum lycopersicum]
 gb|AAD55399.1|AF179442_1 plasma membrane H+-ATPase isoform LHA2 [Solanum lycopersicum]
 gb|AAF98344.1|AF275745_1 plasma membrane H+-ATPase [Solanum lycopersicum]
Length=956

 Score =   516 bits (1329),  Expect = 3e-172, Method: Compositional matrix adjust.
 Identities = 298/315 (95%), Positives = 310/315 (98%), Gaps = 0/315 (0%)
 Frame = +2

Query  86    MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
             M EKPEVLDAVLKETVDLENIPIEEVFENLRCTK+GLT  AAQERL IFG+NKLEEKKES
Sbjct  1     MGEKPEVLDAVLKETVDLENIPIEEVFENLRCTKEGLTGTAAQERLAIFGYNKLEEKKES  60

Query  266   kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
             KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN
Sbjct  61    KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN  120

Query  446   agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  625
             AGNAAAALMARLAPKAKVLRDG+W+EEDA++LVPGDIIS+KLGDIIPADARLL+GDPLKI
Sbjct  121   AGNAAAALMARLAPKAKVLRDGKWNEEDAAVLVPGDIISIKLGDIIPADARLLEGDPLKI  180

Query  626   DQSALTGESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF  805
             DQSALTGESLPVTKGPGDG+YSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF
Sbjct  181   DQSALTGESLPVTKGPGDGVYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF  240

Query  806   QKVLTAIANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVT  985
             QKVLTAI NFCICSIAVGM+IEI+VMYPIQHR+YRPGIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  241   QKVLTAIGNFCICSIAVGMIIEIIVMYPIQHRKYRPGIDNLLVLLIGGIPIAMPTVLSVT  300

Query  986   MAIGSHRLAQQGAIT  1030
             MAIGSHRLAQQGAIT
Sbjct  301   MAIGSHRLAQQGAIT  315



>ref|XP_009799220.1| PREDICTED: plasma membrane ATPase 3 [Nicotiana sylvestris]
Length=956

 Score =   516 bits (1329),  Expect = 4e-172, Method: Compositional matrix adjust.
 Identities = 296/315 (94%), Positives = 310/315 (98%), Gaps = 0/315 (0%)
 Frame = +2

Query  86    MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
             M EKPEVLDAVLKETVDLENIP+EEVFENLRCTK+GLT+ AAQERL IFG+NKLEEKKES
Sbjct  1     MGEKPEVLDAVLKETVDLENIPVEEVFENLRCTKEGLTAAAAQERLSIFGYNKLEEKKES  60

Query  266   kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
             KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLL+INSTISFIEENN
Sbjct  61    KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLIINSTISFIEENN  120

Query  446   agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  625
             AGNAAAALMARLAPKAKVLRDG+W EEDA++LVPGDIIS+KLGDIIPADARLL+GDPLKI
Sbjct  121   AGNAAAALMARLAPKAKVLRDGKWMEEDAAVLVPGDIISIKLGDIIPADARLLEGDPLKI  180

Query  626   DQSALTGESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF  805
             DQSALTGESLPVTKGPGDG+YSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF
Sbjct  181   DQSALTGESLPVTKGPGDGVYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF  240

Query  806   QKVLTAIANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVT  985
             QKVLTAI NFCICSIAVGM+IEI+VMYPIQHR+YRPGIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  241   QKVLTAIGNFCICSIAVGMIIEIIVMYPIQHRKYRPGIDNLLVLLIGGIPIAMPTVLSVT  300

Query  986   MAIGSHRLAQQGAIT  1030
             MAIGSHRLAQQGAIT
Sbjct  301   MAIGSHRLAQQGAIT  315



>ref|XP_006354801.1| PREDICTED: plasma membrane ATPase 1-like [Solanum tuberosum]
Length=956

 Score =   516 bits (1328),  Expect = 5e-172, Method: Compositional matrix adjust.
 Identities = 297/315 (94%), Positives = 310/315 (98%), Gaps = 0/315 (0%)
 Frame = +2

Query  86    MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
             M EKPEVLDAVLKETVDLENIPIEEVFENLRCTK+GLT  AAQERL IFG+NKLEEKKES
Sbjct  1     MGEKPEVLDAVLKETVDLENIPIEEVFENLRCTKEGLTGTAAQERLAIFGYNKLEEKKES  60

Query  266   kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
             KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN
Sbjct  61    KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN  120

Query  446   agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  625
             AGNAAAALMARLAPKAKVLRDG+W+EEDA++LVPGDIIS+KLGDI+PADARLL+GDPLKI
Sbjct  121   AGNAAAALMARLAPKAKVLRDGKWNEEDAAVLVPGDIISIKLGDIVPADARLLEGDPLKI  180

Query  626   DQSALTGESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF  805
             DQSALTGESLPVTKGPGDG+YSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF
Sbjct  181   DQSALTGESLPVTKGPGDGVYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF  240

Query  806   QKVLTAIANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVT  985
             QKVLTAI NFCICSIAVGM+IEI+VMYPIQHR+YRPGIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  241   QKVLTAIGNFCICSIAVGMIIEIIVMYPIQHRKYRPGIDNLLVLLIGGIPIAMPTVLSVT  300

Query  986   MAIGSHRLAQQGAIT  1030
             MAIGSHRLAQQGAIT
Sbjct  301   MAIGSHRLAQQGAIT  315



>gb|KDO76029.1| hypothetical protein CISIN_1g005866mg [Citrus sinensis]
Length=673

 Score =   506 bits (1303),  Expect = 6e-172, Method: Compositional matrix adjust.
 Identities = 291/315 (92%), Positives = 309/315 (98%), Gaps = 0/315 (0%)
 Frame = +2

Query  86    MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
             M +K EVL+AVLKETVDLENIPIEEVFENLRC+++GL+SQAA+ERL IFG+NKLEEKKES
Sbjct  1     MGDKEEVLEAVLKETVDLENIPIEEVFENLRCSREGLSSQAAEERLSIFGYNKLEEKKES  60

Query  266   kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
             KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN
Sbjct  61    KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN  120

Query  446   agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  625
             AGNAAAALMARLAPK KVLRDGRW+E+DASILVPGDIIS+KLGDIIPADARLL+GDPLKI
Sbjct  121   AGNAAAALMARLAPKGKVLRDGRWNEQDASILVPGDIISIKLGDIIPADARLLEGDPLKI  180

Query  626   DQSALTGESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF  805
             DQSALTGESLPVTKGPGDG+YSGSTCKQGEIEAVVIATGVHTFFGKAAHLVD+TNQVGHF
Sbjct  181   DQSALTGESLPVTKGPGDGVYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDTTNQVGHF  240

Query  806   QKVLTAIANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVT  985
             QKVLTAI NFCICSIAVGM++EI+VMYPIQ REYRPGIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  241   QKVLTAIGNFCICSIAVGMIVEIIVMYPIQDREYRPGIDNLLVLLIGGIPIAMPTVLSVT  300

Query  986   MAIGSHRLAQQGAIT  1030
             MAIGSHRL+QQGAIT
Sbjct  301   MAIGSHRLSQQGAIT  315



>ref|XP_009793289.1| PREDICTED: plasma membrane ATPase 2 [Nicotiana sylvestris]
Length=956

 Score =   514 bits (1324),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 298/315 (95%), Positives = 309/315 (98%), Gaps = 0/315 (0%)
 Frame = +2

Query  86    MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
             M EKPEVLDAVLKETVDLENIPIEEVFENLRCTK+GLT  AAQERL IFG+NKLEEKKES
Sbjct  1     MGEKPEVLDAVLKETVDLENIPIEEVFENLRCTKEGLTGPAAQERLAIFGYNKLEEKKES  60

Query  266   kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
             KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN
Sbjct  61    KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN  120

Query  446   agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  625
             AGNAAAALMARLAPKAKVLRDG+W E+DA+ILVPGDIIS+KLGDIIPADARLL+GDPLKI
Sbjct  121   AGNAAAALMARLAPKAKVLRDGKWDEQDAAILVPGDIISIKLGDIIPADARLLEGDPLKI  180

Query  626   DQSALTGESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF  805
             DQSALTGESLPVTKGPGDG+YSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF
Sbjct  181   DQSALTGESLPVTKGPGDGVYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF  240

Query  806   QKVLTAIANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVT  985
             QKVLTAI NFCICSIAVGM+IEI+VMYPIQHR+YRPGIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  241   QKVLTAIGNFCICSIAVGMIIEIIVMYPIQHRKYRPGIDNLLVLLIGGIPIAMPTVLSVT  300

Query  986   MAIGSHRLAQQGAIT  1030
             MAIGSHRLAQQGAIT
Sbjct  301   MAIGSHRLAQQGAIT  315



>ref|NP_001274861.1| plasma membrane ATPase 1-like [Solanum tuberosum]
 emb|CAA54046.1| H(+)-transporting ATPase [Solanum tuberosum]
Length=956

 Score =   513 bits (1322),  Expect = 3e-171, Method: Compositional matrix adjust.
 Identities = 296/315 (94%), Positives = 309/315 (98%), Gaps = 0/315 (0%)
 Frame = +2

Query  86    MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
             M EKPEVLDAVLKETVDLENIPIEEVFENLRCTK+GLT  AAQERL IFG+NKLEEKKES
Sbjct  1     MGEKPEVLDAVLKETVDLENIPIEEVFENLRCTKEGLTGTAAQERLAIFGYNKLEEKKES  60

Query  266   kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
             KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN
Sbjct  61    KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN  120

Query  446   agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  625
             AGNAAAALMARLAPKAKVLRDG+W+EEDA++LVPGDIIS+KLGDI+PAD RLL+GDPLKI
Sbjct  121   AGNAAAALMARLAPKAKVLRDGKWNEEDAAVLVPGDIISIKLGDIVPADRRLLEGDPLKI  180

Query  626   DQSALTGESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF  805
             DQSALTGESLPVTKGPGDG+YSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF
Sbjct  181   DQSALTGESLPVTKGPGDGVYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF  240

Query  806   QKVLTAIANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVT  985
             QKVLTAI NFCICSIAVGM+IEI+VMYPIQHR+YRPGIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  241   QKVLTAIGNFCICSIAVGMIIEIIVMYPIQHRKYRPGIDNLLVLLIGGIPIAMPTVLSVT  300

Query  986   MAIGSHRLAQQGAIT  1030
             MAIGSHRLAQQGAIT
Sbjct  301   MAIGSHRLAQQGAIT  315



>gb|AAA34052.1| H+-translocating ATPase [Nicotiana plumbaginifolia]
Length=956

 Score =   513 bits (1321),  Expect = 5e-171, Method: Compositional matrix adjust.
 Identities = 297/315 (94%), Positives = 309/315 (98%), Gaps = 0/315 (0%)
 Frame = +2

Query  86    MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
             M EKPEVLDAVLKETVDLENIPIEEVFENLRCTK+GL+  AAQERL IFG+NKLEEKKES
Sbjct  1     MGEKPEVLDAVLKETVDLENIPIEEVFENLRCTKEGLSGPAAQERLAIFGYNKLEEKKES  60

Query  266   kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
             KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN
Sbjct  61    KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN  120

Query  446   agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  625
             AGNAAAALMARLAPKAKVLRDG+W E+DA+ILVPGDIIS+KLGDIIPADARLL+GDPLKI
Sbjct  121   AGNAAAALMARLAPKAKVLRDGKWDEQDAAILVPGDIISIKLGDIIPADARLLEGDPLKI  180

Query  626   DQSALTGESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF  805
             DQSALTGESLPVTKGPGDG+YSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF
Sbjct  181   DQSALTGESLPVTKGPGDGVYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF  240

Query  806   QKVLTAIANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVT  985
             QKVLTAI NFCICSIAVGM+IEI+VMYPIQHR+YRPGIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  241   QKVLTAIGNFCICSIAVGMIIEIIVMYPIQHRKYRPGIDNLLVLLIGGIPIAMPTVLSVT  300

Query  986   MAIGSHRLAQQGAIT  1030
             MAIGSHRLAQQGAIT
Sbjct  301   MAIGSHRLAQQGAIT  315



>ref|XP_008437674.1| PREDICTED: ATPase 11, plasma membrane-type [Cucumis melo]
Length=956

 Score =   513 bits (1320),  Expect = 8e-171, Method: Compositional matrix adjust.
 Identities = 296/315 (94%), Positives = 310/315 (98%), Gaps = 0/315 (0%)
 Frame = +2

Query  86    MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
             M EKPEVL+AVLKE VDLENIPI+EVFENLRC+K+GLTS+AA+ERL IFGHNKLEEKKES
Sbjct  1     MGEKPEVLEAVLKEAVDLENIPIDEVFENLRCSKEGLTSEAAEERLKIFGHNKLEEKKES  60

Query  266   kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
             KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLL+INSTISFIEENN
Sbjct  61    KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLIINSTISFIEENN  120

Query  446   agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  625
             AGNAAAALMARLAPKAKVLRDGRWSE+DASILVPGD+ISVKLGDIIPADARLLDGDPLKI
Sbjct  121   AGNAAAALMARLAPKAKVLRDGRWSEQDASILVPGDVISVKLGDIIPADARLLDGDPLKI  180

Query  626   DQSALTGESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF  805
             DQSALTGESLPVTKGPGDG+YSGSTCKQGEIEAVVIATGVHTFFGKAAHLVD+TNQVGHF
Sbjct  181   DQSALTGESLPVTKGPGDGVYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDTTNQVGHF  240

Query  806   QKVLTAIANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVT  985
             QKVLTAI NFCICSIA+GMVIEI+VMYPIQ REYRPGIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  241   QKVLTAIGNFCICSIALGMVIEIIVMYPIQDREYRPGIDNLLVLLIGGIPIAMPTVLSVT  300

Query  986   MAIGSHRLAQQGAIT  1030
             MAIGSHRL+QQGAIT
Sbjct  301   MAIGSHRLSQQGAIT  315



>ref|XP_009610426.1| PREDICTED: plasma membrane ATPase 2 [Nicotiana tomentosiformis]
Length=956

 Score =   512 bits (1319),  Expect = 1e-170, Method: Compositional matrix adjust.
 Identities = 296/315 (94%), Positives = 309/315 (98%), Gaps = 0/315 (0%)
 Frame = +2

Query  86    MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
             M EKPEVLDAVLKETVDLENIPIEEVFENLRCTK+GL+  AAQERL IFG+NKLEEKKES
Sbjct  1     MGEKPEVLDAVLKETVDLENIPIEEVFENLRCTKEGLSGPAAQERLAIFGYNKLEEKKES  60

Query  266   kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
             KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN
Sbjct  61    KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN  120

Query  446   agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  625
             AGNAAAALMARLAPKAKVLRDG+W E+DA+ILVPGDIIS+KLGDI+PADARLL+GDPLKI
Sbjct  121   AGNAAAALMARLAPKAKVLRDGKWDEQDAAILVPGDIISIKLGDIVPADARLLEGDPLKI  180

Query  626   DQSALTGESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF  805
             DQSALTGESLPVTKGPGDG+YSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF
Sbjct  181   DQSALTGESLPVTKGPGDGVYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF  240

Query  806   QKVLTAIANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVT  985
             QKVLTAI NFCICSIAVGM+IEI+VMYPIQHR+YRPGIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  241   QKVLTAIGNFCICSIAVGMIIEIIVMYPIQHRKYRPGIDNLLVLLIGGIPIAMPTVLSVT  300

Query  986   MAIGSHRLAQQGAIT  1030
             MAIGSHRLAQQGAIT
Sbjct  301   MAIGSHRLAQQGAIT  315



>ref|XP_002270344.1| PREDICTED: plasma membrane ATPase 1 isoform X1 [Vitis vinifera]
 ref|XP_010663416.1| PREDICTED: plasma membrane ATPase 1 isoform X2 [Vitis vinifera]
 emb|CBI15286.3| unnamed protein product [Vitis vinifera]
Length=956

 Score =   512 bits (1318),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 294/315 (93%), Positives = 312/315 (99%), Gaps = 0/315 (0%)
 Frame = +2

Query  86    MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
             MA+KPEVL+AVLKETVDLENIPIEEVFENLRC+++GLTS+AAQERL IFG+N+LEEKKES
Sbjct  1     MADKPEVLEAVLKETVDLENIPIEEVFENLRCSREGLTSEAAQERLAIFGYNRLEEKKES  60

Query  266   kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
             KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLL+INSTISFIEENN
Sbjct  61    KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLLINSTISFIEENN  120

Query  446   agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  625
             AGNAAAALMARLAPKAKVLRDGRWSEEDA++LVPGDIIS+KLGDIIPADARLL+GDPLKI
Sbjct  121   AGNAAAALMARLAPKAKVLRDGRWSEEDAAVLVPGDIISIKLGDIIPADARLLEGDPLKI  180

Query  626   DQSALTGESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF  805
             DQSALTGESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVD+TNQVGHF
Sbjct  181   DQSALTGESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDTTNQVGHF  240

Query  806   QKVLTAIANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVT  985
             QKVLTAI NFCICSIAVGM+IEI+VMYPIQ R+YRPGIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  241   QKVLTAIGNFCICSIAVGMIIEIIVMYPIQDRDYRPGIDNLLVLLIGGIPIAMPTVLSVT  300

Query  986   MAIGSHRLAQQGAIT  1030
             MAIGSHRL+QQGAIT
Sbjct  301   MAIGSHRLSQQGAIT  315



>ref|XP_004299601.1| PREDICTED: ATPase 11, plasma membrane-type [Fragaria vesca subsp. 
vesca]
Length=957

 Score =   511 bits (1317),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 294/313 (94%), Positives = 310/313 (99%), Gaps = 0/313 (0%)
 Frame = +2

Query  92    EKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskf  271
             EKPEVLDAVLKETVDLENIPIEEVFENLRC+K+GLTS+AA+ERL IFGHNKLEEK+ESKF
Sbjct  4     EKPEVLDAVLKETVDLENIPIEEVFENLRCSKEGLTSEAAEERLTIFGHNKLEEKQESKF  63

Query  272   lkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnag  451
             +KFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENNAG
Sbjct  64    IKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENNAG  123

Query  452   naaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQ  631
             NAAAALMARLAPKAKVLRDGRW+E+DA++LVPGDIIS+KLGDI+PADARLL+GDPLKIDQ
Sbjct  124   NAAAALMARLAPKAKVLRDGRWNEQDAAVLVPGDIISIKLGDIVPADARLLEGDPLKIDQ  183

Query  632   SALTGESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQK  811
             SALTGESLPVTKGPGDG+YSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQK
Sbjct  184   SALTGESLPVTKGPGDGVYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQK  243

Query  812   VLTAIANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVTMA  991
             VLTAI NFCICSIAVGMVIEI+VMYPIQ R+YRPGIDNLLVLLIGGIPIAMPTVLSVTMA
Sbjct  244   VLTAIGNFCICSIAVGMVIEIIVMYPIQDRDYRPGIDNLLVLLIGGIPIAMPTVLSVTMA  303

Query  992   IGSHRLAQQGAIT  1030
             IGSHRLAQQGAIT
Sbjct  304   IGSHRLAQQGAIT  316



>sp|Q08435.1|PMA1_NICPL RecName: Full=Plasma membrane ATPase 1; AltName: Full=Proton 
pump 1 [Nicotiana plumbaginifolia]
 gb|AAA34094.1| plasma membrane H+ ATPase [Nicotiana plumbaginifolia]
Length=957

 Score =   511 bits (1317),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 293/313 (94%), Positives = 306/313 (98%), Gaps = 0/313 (0%)
 Frame = +2

Query  92    EKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskf  271
             EKPEVLDAVLKE VDLENIPIEEVFENLRCTK+GLT+ AAQERL IFG+NKLEEKK+SK 
Sbjct  4     EKPEVLDAVLKEAVDLENIPIEEVFENLRCTKEGLTATAAQERLAIFGYNKLEEKKDSKL  63

Query  272   lkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnag  451
             LKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLL+INSTISFIEENNAG
Sbjct  64    LKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLIINSTISFIEENNAG  123

Query  452   naaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQ  631
             NAAAALMARLAPKAKVLRDGRW EEDA++LVPGDIIS+KLGDIIPADARLL+GDPLKIDQ
Sbjct  124   NAAAALMARLAPKAKVLRDGRWKEEDAAVLVPGDIISIKLGDIIPADARLLEGDPLKIDQ  183

Query  632   SALTGESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQK  811
             SALTGESLPVTKGPGDG+YSGSTCKQGEIEA+VIATGVHTFFGKAAHLVDSTNQVGHFQK
Sbjct  184   SALTGESLPVTKGPGDGVYSGSTCKQGEIEAIVIATGVHTFFGKAAHLVDSTNQVGHFQK  243

Query  812   VLTAIANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVTMA  991
             VLTAI NFCICSIAVGM+IEI+VMYPIQHR YRPGIDNLLVLLIGGIPIAMPTVLSVTMA
Sbjct  244   VLTAIGNFCICSIAVGMIIEIIVMYPIQHRAYRPGIDNLLVLLIGGIPIAMPTVLSVTMA  303

Query  992   IGSHRLAQQGAIT  1030
             IGSHRLAQQGAIT
Sbjct  304   IGSHRLAQQGAIT  316



>ref|XP_011651238.1| PREDICTED: ATPase 11, plasma membrane-type [Cucumis sativus]
Length=956

 Score =   511 bits (1316),  Expect = 3e-170, Method: Compositional matrix adjust.
 Identities = 294/315 (93%), Positives = 308/315 (98%), Gaps = 0/315 (0%)
 Frame = +2

Query  86    MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
             M EKPEVL+AVLKE VDLENIPI+EVFENLRC+K+GLTS+ A+ERL IFGHNKLEEKKES
Sbjct  1     MGEKPEVLEAVLKEAVDLENIPIDEVFENLRCSKEGLTSEGAEERLKIFGHNKLEEKKES  60

Query  266   kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
             K LKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLL+INSTISFIEENN
Sbjct  61    KVLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLIINSTISFIEENN  120

Query  446   agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  625
             AGNAAAALMARLAPKAKVLRDGRWSE+DASILVPGD+ISVKLGDIIPADARLLDGDPLKI
Sbjct  121   AGNAAAALMARLAPKAKVLRDGRWSEQDASILVPGDVISVKLGDIIPADARLLDGDPLKI  180

Query  626   DQSALTGESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF  805
             DQSALTGESLPVTKGPGDG+YSGSTCKQGEIEAVVIATGVHTFFGKAAHLVD+TNQVGHF
Sbjct  181   DQSALTGESLPVTKGPGDGVYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDTTNQVGHF  240

Query  806   QKVLTAIANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVT  985
             QKVLTAI NFCICSIA+GMVIEI+VMYPIQ REYRPGIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  241   QKVLTAIGNFCICSIALGMVIEIIVMYPIQDREYRPGIDNLLVLLIGGIPIAMPTVLSVT  300

Query  986   MAIGSHRLAQQGAIT  1030
             MAIGSHRL+QQGAIT
Sbjct  301   MAIGSHRLSQQGAIT  315



>ref|XP_008374513.1| PREDICTED: ATPase 11, plasma membrane-type [Malus domestica]
Length=956

 Score =   511 bits (1315),  Expect = 5e-170, Method: Compositional matrix adjust.
 Identities = 293/315 (93%), Positives = 310/315 (98%), Gaps = 0/315 (0%)
 Frame = +2

Query  86    MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
             M EKPEVLDAVLKETVDLENIPIEEVFENLRC+K+GL+S+AA+ERL IFGHNKLEEK+ES
Sbjct  1     MGEKPEVLDAVLKETVDLENIPIEEVFENLRCSKEGLSSEAAEERLTIFGHNKLEEKQES  60

Query  266   kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
             KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN
Sbjct  61    KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN  120

Query  446   agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  625
             AGNAAAALMARLAPKAKVLRDGRW+E+DA++LVPGDIIS+KLGDI+PADARLL+GDPLKI
Sbjct  121   AGNAAAALMARLAPKAKVLRDGRWNEQDAAVLVPGDIISIKLGDIVPADARLLEGDPLKI  180

Query  626   DQSALTGESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF  805
             DQSALTGESLPVTK PGDG+YSGSTCKQGEI+AVVIATGVHTFFGKAAHLVDSTNQVGHF
Sbjct  181   DQSALTGESLPVTKSPGDGVYSGSTCKQGEIDAVVIATGVHTFFGKAAHLVDSTNQVGHF  240

Query  806   QKVLTAIANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVT  985
             QKVLTAI NFCICSIAVGMVIEI+VMYPIQ R+YRPGIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  241   QKVLTAIGNFCICSIAVGMVIEIIVMYPIQDRQYRPGIDNLLVLLIGGIPIAMPTVLSVT  300

Query  986   MAIGSHRLAQQGAIT  1030
             MAIGSHRLAQQGAIT
Sbjct  301   MAIGSHRLAQQGAIT  315



>ref|XP_009607762.1| PREDICTED: plasma membrane ATPase 1 [Nicotiana tomentosiformis]
Length=957

 Score =   510 bits (1314),  Expect = 5e-170, Method: Compositional matrix adjust.
 Identities = 295/313 (94%), Positives = 306/313 (98%), Gaps = 0/313 (0%)
 Frame = +2

Query  92    EKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskf  271
             EKPEVLDAVLKE VDLENIPIEEVFENLRCTK+GLT  AAQERL IFG+NKLEEKKESKF
Sbjct  4     EKPEVLDAVLKEAVDLENIPIEEVFENLRCTKEGLTVTAAQERLAIFGYNKLEEKKESKF  63

Query  272   lkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnag  451
             LKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLL+INSTISFIEENNAG
Sbjct  64    LKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLIINSTISFIEENNAG  123

Query  452   naaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQ  631
             NAAAALMARLAPKAKVLRDGRW EEDA++LVPGDIIS+KLGDIIPADARLL+GDPLKIDQ
Sbjct  124   NAAAALMARLAPKAKVLRDGRWKEEDAAVLVPGDIISIKLGDIIPADARLLEGDPLKIDQ  183

Query  632   SALTGESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQK  811
             SALTGESLPVTKGPGDG+YSGSTCKQGEIEA+VIATGVHTFFGKAAHLVDSTNQVGHFQK
Sbjct  184   SALTGESLPVTKGPGDGVYSGSTCKQGEIEAIVIATGVHTFFGKAAHLVDSTNQVGHFQK  243

Query  812   VLTAIANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVTMA  991
             VLTAI NFCICSIAVGM+IEI+VMYPIQHR YRPGIDNLLVLLIGGIPIAMPTVLSVTMA
Sbjct  244   VLTAIGNFCICSIAVGMIIEIIVMYPIQHRAYRPGIDNLLVLLIGGIPIAMPTVLSVTMA  303

Query  992   IGSHRLAQQGAIT  1030
             IGSHRLAQQGAIT
Sbjct  304   IGSHRLAQQGAIT  316



>ref|XP_009369365.1| PREDICTED: ATPase 11, plasma membrane-type [Pyrus x bretschneideri]
Length=956

 Score =   510 bits (1314),  Expect = 6e-170, Method: Compositional matrix adjust.
 Identities = 293/315 (93%), Positives = 310/315 (98%), Gaps = 0/315 (0%)
 Frame = +2

Query  86    MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
             M EKPEVLDAVLKETVDLENIPIEEVFENLRC+K+GL+S+AA+ERL IFGHNKLEEK+ES
Sbjct  1     MGEKPEVLDAVLKETVDLENIPIEEVFENLRCSKEGLSSEAAEERLTIFGHNKLEEKQES  60

Query  266   kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
             KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN
Sbjct  61    KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN  120

Query  446   agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  625
             AGNAAAALMARLAPKAKVLRDGRW+E+DA++LVPGDIIS+KLGDI+PADARLL+GDPLKI
Sbjct  121   AGNAAAALMARLAPKAKVLRDGRWNEQDAAVLVPGDIISIKLGDIVPADARLLEGDPLKI  180

Query  626   DQSALTGESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF  805
             DQSALTGESLPVTK PGDG+YSGSTCKQGEI+AVVIATGVHTFFGKAAHLVDSTNQVGHF
Sbjct  181   DQSALTGESLPVTKSPGDGVYSGSTCKQGEIDAVVIATGVHTFFGKAAHLVDSTNQVGHF  240

Query  806   QKVLTAIANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVT  985
             QKVLTAI NFCICSIAVGMVIEI+VMYPIQ R+YRPGIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  241   QKVLTAIGNFCICSIAVGMVIEIIVMYPIQDRQYRPGIDNLLVLLIGGIPIAMPTVLSVT  300

Query  986   MAIGSHRLAQQGAIT  1030
             MAIGSHRLAQQGAIT
Sbjct  301   MAIGSHRLAQQGAIT  315



>ref|XP_008239652.1| PREDICTED: ATPase 11, plasma membrane-type [Prunus mume]
Length=956

 Score =   510 bits (1313),  Expect = 8e-170, Method: Compositional matrix adjust.
 Identities = 293/315 (93%), Positives = 311/315 (99%), Gaps = 0/315 (0%)
 Frame = +2

Query  86    MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
             MAEKPEVLDAVLKETVDLENIPIEEVFENLRC+K+GL+S+AA+ERL IFGHNKLEEK+ES
Sbjct  1     MAEKPEVLDAVLKETVDLENIPIEEVFENLRCSKEGLSSEAAEERLTIFGHNKLEEKQES  60

Query  266   kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
             KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN
Sbjct  61    KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN  120

Query  446   agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  625
             AGNAAAALMARLAPKAKVLRDGRW+E++A++LVPGDIIS+KLGDI+PADARLL+GDPLKI
Sbjct  121   AGNAAAALMARLAPKAKVLRDGRWNEQEAAVLVPGDIISIKLGDIVPADARLLEGDPLKI  180

Query  626   DQSALTGESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF  805
             DQSALTGESLPVTK PGDG+YSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF
Sbjct  181   DQSALTGESLPVTKSPGDGVYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF  240

Query  806   QKVLTAIANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVT  985
             QKVLTAI NFCICSIAVGMVIEI+VMYPIQ R+YRPGIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  241   QKVLTAIGNFCICSIAVGMVIEIIVMYPIQDRDYRPGIDNLLVLLIGGIPIAMPTVLSVT  300

Query  986   MAIGSHRLAQQGAIT  1030
             MAIGSHRL+QQGAIT
Sbjct  301   MAIGSHRLSQQGAIT  315



>ref|XP_010256132.1| PREDICTED: ATPase 11, plasma membrane-type isoform X2 [Nelumbo 
nucifera]
Length=956

 Score =   510 bits (1313),  Expect = 9e-170, Method: Compositional matrix adjust.
 Identities = 293/315 (93%), Positives = 308/315 (98%), Gaps = 0/315 (0%)
 Frame = +2

Query  86    MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
             M +K E+L+AVLKE VDLENIPIEEVFENLRC+KDGLT++AAQERL IFGHNKLEEKKES
Sbjct  1     MGDKAEILEAVLKEAVDLENIPIEEVFENLRCSKDGLTTEAAQERLAIFGHNKLEEKKES  60

Query  266   kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
             K LKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN
Sbjct  61    KVLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN  120

Query  446   agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  625
             AGNAAAALMARLAPKAKVLRDGRWSEEDASILVPGDIIS+KLGDIIPADARLL+GDPLKI
Sbjct  121   AGNAAAALMARLAPKAKVLRDGRWSEEDASILVPGDIISIKLGDIIPADARLLEGDPLKI  180

Query  626   DQSALTGESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF  805
             DQSALTGESLPVTKGPGDG+YSGSTCKQGEIEAVVIATGVHTFFGKAAHLVD+TNQVGHF
Sbjct  181   DQSALTGESLPVTKGPGDGVYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDTTNQVGHF  240

Query  806   QKVLTAIANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVT  985
             QKVLTAI NFCICSIAVGM++EI+VMYPIQ R+YRPGIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  241   QKVLTAIGNFCICSIAVGMIVEIIVMYPIQDRKYRPGIDNLLVLLIGGIPIAMPTVLSVT  300

Query  986   MAIGSHRLAQQGAIT  1030
             MAIGSHRL+QQGAIT
Sbjct  301   MAIGSHRLSQQGAIT  315



>ref|XP_010256122.1| PREDICTED: ATPase 11, plasma membrane-type isoform X1 [Nelumbo 
nucifera]
Length=970

 Score =   510 bits (1314),  Expect = 9e-170, Method: Compositional matrix adjust.
 Identities = 293/315 (93%), Positives = 308/315 (98%), Gaps = 0/315 (0%)
 Frame = +2

Query  86    MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
             M +K E+L+AVLKE VDLENIPIEEVFENLRC+KDGLT++AAQERL IFGHNKLEEKKES
Sbjct  1     MGDKAEILEAVLKEAVDLENIPIEEVFENLRCSKDGLTTEAAQERLAIFGHNKLEEKKES  60

Query  266   kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
             K LKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN
Sbjct  61    KVLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN  120

Query  446   agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  625
             AGNAAAALMARLAPKAKVLRDGRWSEEDASILVPGDIIS+KLGDIIPADARLL+GDPLKI
Sbjct  121   AGNAAAALMARLAPKAKVLRDGRWSEEDASILVPGDIISIKLGDIIPADARLLEGDPLKI  180

Query  626   DQSALTGESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF  805
             DQSALTGESLPVTKGPGDG+YSGSTCKQGEIEAVVIATGVHTFFGKAAHLVD+TNQVGHF
Sbjct  181   DQSALTGESLPVTKGPGDGVYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDTTNQVGHF  240

Query  806   QKVLTAIANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVT  985
             QKVLTAI NFCICSIAVGM++EI+VMYPIQ R+YRPGIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  241   QKVLTAIGNFCICSIAVGMIVEIIVMYPIQDRKYRPGIDNLLVLLIGGIPIAMPTVLSVT  300

Query  986   MAIGSHRLAQQGAIT  1030
             MAIGSHRL+QQGAIT
Sbjct  301   MAIGSHRLSQQGAIT  315



>ref|XP_009798932.1| PREDICTED: plasma membrane ATPase 1 [Nicotiana sylvestris]
Length=957

 Score =   509 bits (1311),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 294/313 (94%), Positives = 306/313 (98%), Gaps = 0/313 (0%)
 Frame = +2

Query  92    EKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskf  271
             EKPEVLDAVLKE VDLENIPIEEVFENLRCTK+GLT  AA+ERL IFG+NKLEEKK+SKF
Sbjct  4     EKPEVLDAVLKEAVDLENIPIEEVFENLRCTKEGLTVTAAEERLAIFGYNKLEEKKDSKF  63

Query  272   lkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnag  451
             LKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENNAG
Sbjct  64    LKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENNAG  123

Query  452   naaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQ  631
             NAAAALMARLAPKAKVLRDGRW EEDA++LVPGDIIS+KLGDIIPADARLL+GDPLKIDQ
Sbjct  124   NAAAALMARLAPKAKVLRDGRWKEEDAAVLVPGDIISIKLGDIIPADARLLEGDPLKIDQ  183

Query  632   SALTGESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQK  811
             SALTGESLPVTKGPGDG+YSGSTCKQGEIEA+VIATGVHTFFGKAAHLVDSTNQVGHFQK
Sbjct  184   SALTGESLPVTKGPGDGVYSGSTCKQGEIEAIVIATGVHTFFGKAAHLVDSTNQVGHFQK  243

Query  812   VLTAIANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVTMA  991
             VLTAI NFCICSIAVGM+IEI+VMYPIQHR YRPGIDNLLVLLIGGIPIAMPTVLSVTMA
Sbjct  244   VLTAIGNFCICSIAVGMIIEIIVMYPIQHRAYRPGIDNLLVLLIGGIPIAMPTVLSVTMA  303

Query  992   IGSHRLAQQGAIT  1030
             IGSHRLAQQGAIT
Sbjct  304   IGSHRLAQQGAIT  316



>ref|XP_007210395.1| hypothetical protein PRUPE_ppa000934mg [Prunus persica]
 emb|CAB69824.1| plasma membrane H+ ATPase [Prunus persica]
 gb|EMJ11594.1| hypothetical protein PRUPE_ppa000934mg [Prunus persica]
Length=956

 Score =   509 bits (1311),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 293/315 (93%), Positives = 310/315 (98%), Gaps = 0/315 (0%)
 Frame = +2

Query  86    MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
             MAEKPEVLDAVLKETVDLENIPIEEVFENLRC+K+GL+S+AA+ERL IFGHNKLEEK+ES
Sbjct  1     MAEKPEVLDAVLKETVDLENIPIEEVFENLRCSKEGLSSEAAEERLTIFGHNKLEEKQES  60

Query  266   kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
             KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN
Sbjct  61    KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN  120

Query  446   agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  625
             AGNAAAALMARLAPKAKVLRDGRW+E++A +LVPGDIIS+KLGDI+PADARLL+GDPLKI
Sbjct  121   AGNAAAALMARLAPKAKVLRDGRWNEQEAGVLVPGDIISIKLGDIVPADARLLEGDPLKI  180

Query  626   DQSALTGESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF  805
             DQSALTGESLPVTK PGDG+YSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF
Sbjct  181   DQSALTGESLPVTKSPGDGVYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF  240

Query  806   QKVLTAIANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVT  985
             QKVLTAI NFCICSIAVGMVIEI+VMYPIQ R+YRPGIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  241   QKVLTAIGNFCICSIAVGMVIEIIVMYPIQDRDYRPGIDNLLVLLIGGIPIAMPTVLSVT  300

Query  986   MAIGSHRLAQQGAIT  1030
             MAIGSHRL+QQGAIT
Sbjct  301   MAIGSHRLSQQGAIT  315



>gb|KJB19307.1| hypothetical protein B456_003G094300 [Gossypium raimondii]
Length=879

 Score =   506 bits (1303),  Expect = 3e-169, Method: Compositional matrix adjust.
 Identities = 293/315 (93%), Positives = 310/315 (98%), Gaps = 0/315 (0%)
 Frame = +2

Query  86    MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
             M +K EVL+AVLKETVDLENIPIEEVFENLRC+++GLT++AA+ERL IFGHNKLEEKKES
Sbjct  1     MGDKNEVLEAVLKETVDLENIPIEEVFENLRCSREGLTTEAAEERLTIFGHNKLEEKKES  60

Query  266   kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
             KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN
Sbjct  61    KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN  120

Query  446   agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  625
             AGNAAAALMARLAPKAKVLRDGRW+E+DA+ILVPGDIIS+KLGDIIPADARLL+GDPLKI
Sbjct  121   AGNAAAALMARLAPKAKVLRDGRWNEQDAAILVPGDIISIKLGDIIPADARLLEGDPLKI  180

Query  626   DQSALTGESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF  805
             DQSALTGESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVD+TNQVGHF
Sbjct  181   DQSALTGESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDTTNQVGHF  240

Query  806   QKVLTAIANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVT  985
             QKVLTAI NFCICSIAVGMVIEI+VMYPIQ R+YRPGIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  241   QKVLTAIGNFCICSIAVGMVIEIIVMYPIQDRDYRPGIDNLLVLLIGGIPIAMPTVLSVT  300

Query  986   MAIGSHRLAQQGAIT  1030
             MAIGSHRL+QQGAIT
Sbjct  301   MAIGSHRLSQQGAIT  315



>gb|KCW49372.1| hypothetical protein EUGRSUZ_K02916 [Eucalyptus grandis]
Length=920

 Score =   507 bits (1306),  Expect = 4e-169, Method: Compositional matrix adjust.
 Identities = 294/315 (93%), Positives = 310/315 (98%), Gaps = 0/315 (0%)
 Frame = +2

Query  86    MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
             MAE+PEVL+AVLKETVDLENIPIEEVFENLRC+K+GLT+QAA ERL IFGHNKLEEKKES
Sbjct  1     MAEQPEVLEAVLKETVDLENIPIEEVFENLRCSKEGLTTQAAAERLAIFGHNKLEEKKES  60

Query  266   kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
             KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN
Sbjct  61    KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN  120

Query  446   agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  625
             AGNAAAALMARLAPKAKVLRDGRW+E+DA+ LVPGDI+SVKLGDIIPADARLL+GDPLKI
Sbjct  121   AGNAAAALMARLAPKAKVLRDGRWNEQDAADLVPGDIVSVKLGDIIPADARLLEGDPLKI  180

Query  626   DQSALTGESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF  805
             DQSALTGESLPVTKGPGDG+YSGSTCKQGEIEAVVIATGVHTFFGKAAHLVD+TNQVGHF
Sbjct  181   DQSALTGESLPVTKGPGDGVYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDTTNQVGHF  240

Query  806   QKVLTAIANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVT  985
             QKVLT+I NFCICSIA+GMVIEI+VMYPIQ R+YRPGIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  241   QKVLTSIGNFCICSIALGMVIEIIVMYPIQDRKYRPGIDNLLVLLIGGIPIAMPTVLSVT  300

Query  986   MAIGSHRLAQQGAIT  1030
             MAIGSHRLAQQGAIT
Sbjct  301   MAIGSHRLAQQGAIT  315



>ref|XP_010550649.1| PREDICTED: ATPase 11, plasma membrane-type [Tarenaya hassleriana]
Length=956

 Score =   508 bits (1308),  Expect = 4e-169, Method: Compositional matrix adjust.
 Identities = 293/315 (93%), Positives = 308/315 (98%), Gaps = 0/315 (0%)
 Frame = +2

Query  86    MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
             M +K EVL+AVLKE VDLEN+PIEEVFENLRC+KDGLT+QAA ERL +FGHNKLEEKKES
Sbjct  1     MGDKTEVLEAVLKEAVDLENVPIEEVFENLRCSKDGLTTQAADERLALFGHNKLEEKKES  60

Query  266   kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
             KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN
Sbjct  61    KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN  120

Query  446   agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  625
             AGNAAAALMARLAPKAKVLRDGRWSE+DA+ILVPGDIIS+KLGDIIPADARLL+GDPLKI
Sbjct  121   AGNAAAALMARLAPKAKVLRDGRWSEQDAAILVPGDIISIKLGDIIPADARLLEGDPLKI  180

Query  626   DQSALTGESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF  805
             DQSALTGESLPVTKGPGDG+YSGSTCKQGEIEAVVIATGVHTFFGKAAHLVD+TNQVGHF
Sbjct  181   DQSALTGESLPVTKGPGDGVYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDTTNQVGHF  240

Query  806   QKVLTAIANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVT  985
             QKVLTAI NFCICSIAVGM+IEI+VMYPIQHR YRPGIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  241   QKVLTAIGNFCICSIAVGMIIEIIVMYPIQHRAYRPGIDNLLVLLIGGIPIAMPTVLSVT  300

Query  986   MAIGSHRLAQQGAIT  1030
             MAIGSHRL+QQGAIT
Sbjct  301   MAIGSHRLSQQGAIT  315



>gb|KCW49373.1| hypothetical protein EUGRSUZ_K02916 [Eucalyptus grandis]
Length=925

 Score =   507 bits (1305),  Expect = 5e-169, Method: Compositional matrix adjust.
 Identities = 294/315 (93%), Positives = 310/315 (98%), Gaps = 0/315 (0%)
 Frame = +2

Query  86    MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
             MAE+PEVL+AVLKETVDLENIPIEEVFENLRC+K+GLT+QAA ERL IFGHNKLEEKKES
Sbjct  1     MAEQPEVLEAVLKETVDLENIPIEEVFENLRCSKEGLTTQAAAERLAIFGHNKLEEKKES  60

Query  266   kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
             KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN
Sbjct  61    KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN  120

Query  446   agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  625
             AGNAAAALMARLAPKAKVLRDGRW+E+DA+ LVPGDI+SVKLGDIIPADARLL+GDPLKI
Sbjct  121   AGNAAAALMARLAPKAKVLRDGRWNEQDAADLVPGDIVSVKLGDIIPADARLLEGDPLKI  180

Query  626   DQSALTGESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF  805
             DQSALTGESLPVTKGPGDG+YSGSTCKQGEIEAVVIATGVHTFFGKAAHLVD+TNQVGHF
Sbjct  181   DQSALTGESLPVTKGPGDGVYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDTTNQVGHF  240

Query  806   QKVLTAIANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVT  985
             QKVLT+I NFCICSIA+GMVIEI+VMYPIQ R+YRPGIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  241   QKVLTSIGNFCICSIALGMVIEIIVMYPIQDRKYRPGIDNLLVLLIGGIPIAMPTVLSVT  300

Query  986   MAIGSHRLAQQGAIT  1030
             MAIGSHRLAQQGAIT
Sbjct  301   MAIGSHRLAQQGAIT  315



>ref|XP_009343433.1| PREDICTED: ATPase 11, plasma membrane-type-like [Pyrus x bretschneideri]
Length=956

 Score =   508 bits (1307),  Expect = 7e-169, Method: Compositional matrix adjust.
 Identities = 293/315 (93%), Positives = 309/315 (98%), Gaps = 0/315 (0%)
 Frame = +2

Query  86    MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
             M EKPEVLDAVLKETVDLENIPIEEVFENLRC+K+GL+S+AA+ERL IFGHNKLEEK+ES
Sbjct  1     MGEKPEVLDAVLKETVDLENIPIEEVFENLRCSKEGLSSEAAEERLTIFGHNKLEEKQES  60

Query  266   kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
             KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGI+TLLVINSTISFIEENN
Sbjct  61    KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIMTLLVINSTISFIEENN  120

Query  446   agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  625
             AGNAAAALMARLAPKAKVLRDGRW+E+DAS+LVPGDIIS+KLGDIIPADARLL+GDPLKI
Sbjct  121   AGNAAAALMARLAPKAKVLRDGRWNEQDASVLVPGDIISIKLGDIIPADARLLEGDPLKI  180

Query  626   DQSALTGESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF  805
             DQSALTGESL VTK PGDG+YSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF
Sbjct  181   DQSALTGESLAVTKSPGDGVYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF  240

Query  806   QKVLTAIANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVT  985
             QKVLTAI NFCICSIAVGMVIEI+VMYPIQ R+YRPGIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  241   QKVLTAIGNFCICSIAVGMVIEIIVMYPIQDRKYRPGIDNLLVLLIGGIPIAMPTVLSVT  300

Query  986   MAIGSHRLAQQGAIT  1030
             MAIGSHRL+QQGAIT
Sbjct  301   MAIGSHRLSQQGAIT  315



>ref|XP_011028703.1| PREDICTED: ATPase 11, plasma membrane-type-like [Populus euphratica]
 ref|XP_011028704.1| PREDICTED: ATPase 11, plasma membrane-type-like [Populus euphratica]
Length=956

 Score =   507 bits (1306),  Expect = 8e-169, Method: Compositional matrix adjust.
 Identities = 291/315 (92%), Positives = 309/315 (98%), Gaps = 0/315 (0%)
 Frame = +2

Query  86    MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
             M EK EVL+AVLKETVDLENIPIEEVFENLRC+++GLTSQAA+ERL IFGHNKLEEKKE 
Sbjct  1     MGEKAEVLEAVLKETVDLENIPIEEVFENLRCSREGLTSQAAEERLAIFGHNKLEEKKER  60

Query  266   kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
             KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLL+INSTISFIEENN
Sbjct  61    KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLIINSTISFIEENN  120

Query  446   agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  625
             AGNAAAALMARLAPKAKVLRDG+W+E+DAS+LVPGDIIS+KLGDIIPADARLL+GDPLKI
Sbjct  121   AGNAAAALMARLAPKAKVLRDGKWNEQDASVLVPGDIISIKLGDIIPADARLLEGDPLKI  180

Query  626   DQSALTGESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF  805
             DQSALTGESLPVTKGPGDG+YSGSTCKQGEIEAVVIATGVHTFFGKAAHLVD+TNQVGHF
Sbjct  181   DQSALTGESLPVTKGPGDGVYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDTTNQVGHF  240

Query  806   QKVLTAIANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVT  985
             QKVLTAI NFCICSIA+GMVIEI+VMYPIQ R+YRPGIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  241   QKVLTAIGNFCICSIAIGMVIEIIVMYPIQDRKYRPGIDNLLVLLIGGIPIAMPTVLSVT  300

Query  986   MAIGSHRLAQQGAIT  1030
             MAIGSHRL+QQGAIT
Sbjct  301   MAIGSHRLSQQGAIT  315



>ref|XP_010037634.1| PREDICTED: ATPase 11, plasma membrane-type [Eucalyptus grandis]
 gb|KCW49371.1| hypothetical protein EUGRSUZ_K02916 [Eucalyptus grandis]
Length=956

 Score =   507 bits (1306),  Expect = 8e-169, Method: Compositional matrix adjust.
 Identities = 294/315 (93%), Positives = 310/315 (98%), Gaps = 0/315 (0%)
 Frame = +2

Query  86    MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
             MAE+PEVL+AVLKETVDLENIPIEEVFENLRC+K+GLT+QAA ERL IFGHNKLEEKKES
Sbjct  1     MAEQPEVLEAVLKETVDLENIPIEEVFENLRCSKEGLTTQAAAERLAIFGHNKLEEKKES  60

Query  266   kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
             KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN
Sbjct  61    KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN  120

Query  446   agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  625
             AGNAAAALMARLAPKAKVLRDGRW+E+DA+ LVPGDI+SVKLGDIIPADARLL+GDPLKI
Sbjct  121   AGNAAAALMARLAPKAKVLRDGRWNEQDAADLVPGDIVSVKLGDIIPADARLLEGDPLKI  180

Query  626   DQSALTGESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF  805
             DQSALTGESLPVTKGPGDG+YSGSTCKQGEIEAVVIATGVHTFFGKAAHLVD+TNQVGHF
Sbjct  181   DQSALTGESLPVTKGPGDGVYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDTTNQVGHF  240

Query  806   QKVLTAIANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVT  985
             QKVLT+I NFCICSIA+GMVIEI+VMYPIQ R+YRPGIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  241   QKVLTSIGNFCICSIALGMVIEIIVMYPIQDRKYRPGIDNLLVLLIGGIPIAMPTVLSVT  300

Query  986   MAIGSHRLAQQGAIT  1030
             MAIGSHRLAQQGAIT
Sbjct  301   MAIGSHRLAQQGAIT  315



>gb|AFC88896.1| plasma membrane H+-ATPase [Melastoma malabathricum]
Length=956

 Score =   506 bits (1304),  Expect = 1e-168, Method: Compositional matrix adjust.
 Identities = 292/315 (93%), Positives = 308/315 (98%), Gaps = 0/315 (0%)
 Frame = +2

Query  86    MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
             M EKPEVL+AVLKE VDLENIPIEEVFENLRC+K+GLT+Q+A+ERL IFG NKLEEKKES
Sbjct  1     MGEKPEVLEAVLKEAVDLENIPIEEVFENLRCSKEGLTTQSAEERLAIFGQNKLEEKKES  60

Query  266   kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
             KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLL INSTISFIEENN
Sbjct  61    KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLFINSTISFIEENN  120

Query  446   agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  625
             AGNAAAALMARLAPKAKVLRDGRWSEEDA++LVPGDIIS+KLGDIIPADARLL+GDPLKI
Sbjct  121   AGNAAAALMARLAPKAKVLRDGRWSEEDAAVLVPGDIISIKLGDIIPADARLLEGDPLKI  180

Query  626   DQSALTGESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF  805
             DQSALTGESLPVTKGPGDG+YSGSTCKQGEIEAVVIATGVHTFFGKAAHLVD+TNQVGHF
Sbjct  181   DQSALTGESLPVTKGPGDGVYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDTTNQVGHF  240

Query  806   QKVLTAIANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVT  985
             QKVLTAI NFCICSIAVGM+IEI+VMYPIQ R+YRPGIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  241   QKVLTAIGNFCICSIAVGMIIEIIVMYPIQRRKYRPGIDNLLVLLIGGIPIAMPTVLSVT  300

Query  986   MAIGSHRLAQQGAIT  1030
             MAIGSHRL+QQGAIT
Sbjct  301   MAIGSHRLSQQGAIT  315



>ref|XP_010678593.1| PREDICTED: plasma membrane ATPase 1 [Beta vulgaris subsp. vulgaris]
Length=963

 Score =   506 bits (1304),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 291/315 (92%), Positives = 305/315 (97%), Gaps = 0/315 (0%)
 Frame = +2

Query  86    MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
             MAEK EVL+AVLKE VDLENIP+EEVFENLRC+K+GLTS AAQERL IFG NKLEEKKES
Sbjct  1     MAEKSEVLEAVLKEAVDLENIPLEEVFENLRCSKEGLTSDAAQERLAIFGPNKLEEKKES  60

Query  266   kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
             K LKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN
Sbjct  61    KVLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN  120

Query  446   agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  625
             AGNAAAALMA LAPKAK+LRDGRWSEEDA++LVPGDIIS+KLGDIIPADARLLDGDPLKI
Sbjct  121   AGNAAAALMASLAPKAKILRDGRWSEEDAAVLVPGDIISIKLGDIIPADARLLDGDPLKI  180

Query  626   DQSALTGESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF  805
             DQSALTGESLPVTK PGDG+YSGSTCKQGE+EAVVIATGVHTFFGKAAHLVDSTNQVGHF
Sbjct  181   DQSALTGESLPVTKNPGDGVYSGSTCKQGELEAVVIATGVHTFFGKAAHLVDSTNQVGHF  240

Query  806   QKVLTAIANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVT  985
             QKVLTAI NFCICSIAVGM++EI+VMYPIQHR YRPGIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  241   QKVLTAIGNFCICSIAVGMLVEIIVMYPIQHRAYRPGIDNLLVLLIGGIPIAMPTVLSVT  300

Query  986   MAIGSHRLAQQGAIT  1030
             MAIGSHRLA+QGAIT
Sbjct  301   MAIGSHRLAEQGAIT  315



>gb|KJB19303.1| hypothetical protein B456_003G094300 [Gossypium raimondii]
 gb|KJB19304.1| hypothetical protein B456_003G094300 [Gossypium raimondii]
Length=925

 Score =   505 bits (1301),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 293/315 (93%), Positives = 310/315 (98%), Gaps = 0/315 (0%)
 Frame = +2

Query  86    MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
             M +K EVL+AVLKETVDLENIPIEEVFENLRC+++GLT++AA+ERL IFGHNKLEEKKES
Sbjct  1     MGDKNEVLEAVLKETVDLENIPIEEVFENLRCSREGLTTEAAEERLTIFGHNKLEEKKES  60

Query  266   kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
             KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN
Sbjct  61    KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN  120

Query  446   agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  625
             AGNAAAALMARLAPKAKVLRDGRW+E+DA+ILVPGDIIS+KLGDIIPADARLL+GDPLKI
Sbjct  121   AGNAAAALMARLAPKAKVLRDGRWNEQDAAILVPGDIISIKLGDIIPADARLLEGDPLKI  180

Query  626   DQSALTGESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF  805
             DQSALTGESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVD+TNQVGHF
Sbjct  181   DQSALTGESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDTTNQVGHF  240

Query  806   QKVLTAIANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVT  985
             QKVLTAI NFCICSIAVGMVIEI+VMYPIQ R+YRPGIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  241   QKVLTAIGNFCICSIAVGMVIEIIVMYPIQDRDYRPGIDNLLVLLIGGIPIAMPTVLSVT  300

Query  986   MAIGSHRLAQQGAIT  1030
             MAIGSHRL+QQGAIT
Sbjct  301   MAIGSHRLSQQGAIT  315



>ref|XP_006476664.1| PREDICTED: ATPase 11, plasma membrane-type-like [Citrus sinensis]
Length=954

 Score =   506 bits (1302),  Expect = 3e-168, Method: Compositional matrix adjust.
 Identities = 291/315 (92%), Positives = 309/315 (98%), Gaps = 0/315 (0%)
 Frame = +2

Query  86    MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
             M +K EVL+AVLKETVDLENIPIEEVFENLRC+++GL+SQAA+ERL IFG+NKLEEKKES
Sbjct  1     MGDKEEVLEAVLKETVDLENIPIEEVFENLRCSREGLSSQAAEERLSIFGYNKLEEKKES  60

Query  266   kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
             KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN
Sbjct  61    KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN  120

Query  446   agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  625
             AGNAAAALMARLAPK KVLRDGRW+E+DASILVPGDIIS+KLGDIIPADARLL+GDPLKI
Sbjct  121   AGNAAAALMARLAPKGKVLRDGRWNEQDASILVPGDIISIKLGDIIPADARLLEGDPLKI  180

Query  626   DQSALTGESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF  805
             DQSALTGESLPVTKGPGDG+YSGSTCKQGEIEAVVIATGVHTFFGKAAHLVD+TNQVGHF
Sbjct  181   DQSALTGESLPVTKGPGDGVYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDTTNQVGHF  240

Query  806   QKVLTAIANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVT  985
             QKVLTAI NFCICSIAVGM++EI+VMYPIQ REYRPGIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  241   QKVLTAIGNFCICSIAVGMIVEIIVMYPIQDREYRPGIDNLLVLLIGGIPIAMPTVLSVT  300

Query  986   MAIGSHRLAQQGAIT  1030
             MAIGSHRL+QQGAIT
Sbjct  301   MAIGSHRLSQQGAIT  315



>ref|XP_006439665.1| hypothetical protein CICLE_v10018737mg [Citrus clementina]
 gb|ESR52905.1| hypothetical protein CICLE_v10018737mg [Citrus clementina]
Length=954

 Score =   506 bits (1302),  Expect = 3e-168, Method: Compositional matrix adjust.
 Identities = 291/315 (92%), Positives = 309/315 (98%), Gaps = 0/315 (0%)
 Frame = +2

Query  86    MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
             M +K EVL+AVLKETVDLENIPIEEVFENLRC+++GL+SQAA+ERL IFG+NKLEEKKES
Sbjct  1     MGDKEEVLEAVLKETVDLENIPIEEVFENLRCSREGLSSQAAEERLSIFGYNKLEEKKES  60

Query  266   kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
             KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN
Sbjct  61    KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN  120

Query  446   agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  625
             AGNAAAALMARLAPK KVLRDGRW+E+DASILVPGDIIS+KLGDIIPADARLL+GDPLKI
Sbjct  121   AGNAAAALMARLAPKGKVLRDGRWNEQDASILVPGDIISIKLGDIIPADARLLEGDPLKI  180

Query  626   DQSALTGESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF  805
             DQSALTGESLPVTKGPGDG+YSGSTCKQGEIEAVVIATGVHTFFGKAAHLVD+TNQVGHF
Sbjct  181   DQSALTGESLPVTKGPGDGVYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDTTNQVGHF  240

Query  806   QKVLTAIANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVT  985
             QKVLTAI NFCICSIAVGM++EI+VMYPIQ REYRPGIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  241   QKVLTAIGNFCICSIAVGMIVEIIVMYPIQDREYRPGIDNLLVLLIGGIPIAMPTVLSVT  300

Query  986   MAIGSHRLAQQGAIT  1030
             MAIGSHRL+QQGAIT
Sbjct  301   MAIGSHRLSQQGAIT  315



>gb|KJB19302.1| hypothetical protein B456_003G094300 [Gossypium raimondii]
Length=956

 Score =   506 bits (1302),  Expect = 4e-168, Method: Compositional matrix adjust.
 Identities = 293/315 (93%), Positives = 310/315 (98%), Gaps = 0/315 (0%)
 Frame = +2

Query  86    MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
             M +K EVL+AVLKETVDLENIPIEEVFENLRC+++GLT++AA+ERL IFGHNKLEEKKES
Sbjct  1     MGDKNEVLEAVLKETVDLENIPIEEVFENLRCSREGLTTEAAEERLTIFGHNKLEEKKES  60

Query  266   kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
             KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN
Sbjct  61    KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN  120

Query  446   agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  625
             AGNAAAALMARLAPKAKVLRDGRW+E+DA+ILVPGDIIS+KLGDIIPADARLL+GDPLKI
Sbjct  121   AGNAAAALMARLAPKAKVLRDGRWNEQDAAILVPGDIISIKLGDIIPADARLLEGDPLKI  180

Query  626   DQSALTGESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF  805
             DQSALTGESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVD+TNQVGHF
Sbjct  181   DQSALTGESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDTTNQVGHF  240

Query  806   QKVLTAIANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVT  985
             QKVLTAI NFCICSIAVGMVIEI+VMYPIQ R+YRPGIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  241   QKVLTAIGNFCICSIAVGMVIEIIVMYPIQDRDYRPGIDNLLVLLIGGIPIAMPTVLSVT  300

Query  986   MAIGSHRLAQQGAIT  1030
             MAIGSHRL+QQGAIT
Sbjct  301   MAIGSHRLSQQGAIT  315



>gb|AAQ55291.1| plasma membrane H+-ATPase [Juglans regia]
Length=956

 Score =   505 bits (1301),  Expect = 5e-168, Method: Compositional matrix adjust.
 Identities = 291/315 (92%), Positives = 307/315 (97%), Gaps = 0/315 (0%)
 Frame = +2

Query  86    MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
             MAEKPEVLDAVLKE VDLENIPIEEVFENLRC+K+GLT+ AA+ERL IFGHNKLEEKK+S
Sbjct  1     MAEKPEVLDAVLKEVVDLENIPIEEVFENLRCSKEGLTTVAAEERLAIFGHNKLEEKKDS  60

Query  266   kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
             KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGII LL INSTISFIEENN
Sbjct  61    KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIIVLLFINSTISFIEENN  120

Query  446   agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  625
             AGNAAAALMARLAPKAKVLRDG+WSE DA++LVPGDI+S+KLGDIIPADARLLDGDPLKI
Sbjct  121   AGNAAAALMARLAPKAKVLRDGKWSEYDAAVLVPGDIVSIKLGDIIPADARLLDGDPLKI  180

Query  626   DQSALTGESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF  805
             DQSALTGESLPVTKGPGDG+YSGSTCKQGEIEAVVIATGVHTFFGKAAHLVD+TNQVGHF
Sbjct  181   DQSALTGESLPVTKGPGDGVYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDTTNQVGHF  240

Query  806   QKVLTAIANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVT  985
             QKVLTAI NFCICSIAVGM+IEI+VMYPIQ R+YRPGIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  241   QKVLTAIGNFCICSIAVGMIIEIIVMYPIQDRKYRPGIDNLLVLLIGGIPIAMPTVLSVT  300

Query  986   MAIGSHRLAQQGAIT  1030
             MAIGSHRL+QQGAIT
Sbjct  301   MAIGSHRLSQQGAIT  315



>ref|XP_002282263.1| PREDICTED: ATPase 4, plasma membrane-type [Vitis vinifera]
 ref|XP_010661009.1| PREDICTED: ATPase 4, plasma membrane-type [Vitis vinifera]
 emb|CBI35033.3| unnamed protein product [Vitis vinifera]
Length=955

 Score =   505 bits (1300),  Expect = 8e-168, Method: Compositional matrix adjust.
 Identities = 289/315 (92%), Positives = 307/315 (97%), Gaps = 0/315 (0%)
 Frame = +2

Query  86    MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
             MA+KPEVL+AVLKE VDLENIPIEEVF+NLRC  +GL+++AA ERL IFGHNKLEEK+ES
Sbjct  1     MADKPEVLEAVLKEAVDLENIPIEEVFQNLRCNANGLSTEAANERLAIFGHNKLEEKEES  60

Query  266   kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
             K LKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLL INSTISFIEENN
Sbjct  61    KVLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLFINSTISFIEENN  120

Query  446   agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  625
             AGNAAAALMARLAPKAKVLRDG+WSEEDA+ILVPGDIIS+KLGDI+PADARLLDGDPLKI
Sbjct  121   AGNAAAALMARLAPKAKVLRDGKWSEEDAAILVPGDIISIKLGDILPADARLLDGDPLKI  180

Query  626   DQSALTGESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF  805
             DQSALTGESLPVTKGPGDG+YSGSTCKQGEIEAVVIATGVHTFFGKAAHLVD+TNQVGHF
Sbjct  181   DQSALTGESLPVTKGPGDGVYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDTTNQVGHF  240

Query  806   QKVLTAIANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVT  985
             QKVLTAI NFCICSIAVGMVIEI+VM+PIQHR+YRPGIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  241   QKVLTAIGNFCICSIAVGMVIEIIVMFPIQHRKYRPGIDNLLVLLIGGIPIAMPTVLSVT  300

Query  986   MAIGSHRLAQQGAIT  1030
             MAIGSHRL+QQGAIT
Sbjct  301   MAIGSHRLSQQGAIT  315



>dbj|BAD16689.1| plasma membrane H+-ATPase [Daucus carota]
Length=956

 Score =   504 bits (1299),  Expect = 9e-168, Method: Compositional matrix adjust.
 Identities = 289/315 (92%), Positives = 305/315 (97%), Gaps = 0/315 (0%)
 Frame = +2

Query  86    MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
             M +KPEVL+AVLKETVDLE+IPIEEVFENLRC+KDGLTS  A ERL IFGHNKLEE KE 
Sbjct  1     MEDKPEVLEAVLKETVDLESIPIEEVFENLRCSKDGLTSSGAAERLTIFGHNKLEEVKER  60

Query  266   kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
             KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN
Sbjct  61    KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN  120

Query  446   agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  625
             AGNAAAALMARLAPKAKVLRDG+W+EEDAS+LVPGDIIS+KLGDI+PADARLL+GDPLKI
Sbjct  121   AGNAAAALMARLAPKAKVLRDGKWNEEDASVLVPGDIISIKLGDIVPADARLLEGDPLKI  180

Query  626   DQSALTGESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF  805
             DQSALTGESLPVTKGPGDG+YSGSTCKQGE+EAVVIATGVHTFFGKAAHLVDSTNQVGHF
Sbjct  181   DQSALTGESLPVTKGPGDGVYSGSTCKQGELEAVVIATGVHTFFGKAAHLVDSTNQVGHF  240

Query  806   QKVLTAIANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVT  985
             QKVLTAI NFCICSIAVGM+IE++V YPIQ R+YRPGIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  241   QKVLTAIGNFCICSIAVGMIIEVIVQYPIQDRKYRPGIDNLLVLLIGGIPIAMPTVLSVT  300

Query  986   MAIGSHRLAQQGAIT  1030
             MAIGSHRLAQQGAIT
Sbjct  301   MAIGSHRLAQQGAIT  315



>gb|KJB19305.1| hypothetical protein B456_003G094300 [Gossypium raimondii]
Length=956

 Score =   504 bits (1298),  Expect = 1e-167, Method: Compositional matrix adjust.
 Identities = 293/315 (93%), Positives = 310/315 (98%), Gaps = 0/315 (0%)
 Frame = +2

Query  86    MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
             M +K EVL+AVLKETVDLENIPIEEVFENLRC+++GLT++AA+ERL IFGHNKLEEKKES
Sbjct  1     MGDKNEVLEAVLKETVDLENIPIEEVFENLRCSREGLTTEAAEERLTIFGHNKLEEKKES  60

Query  266   kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
             KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN
Sbjct  61    KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN  120

Query  446   agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  625
             AGNAAAALMARLAPKAKVLRDGRW+E+DA+ILVPGDIIS+KLGDIIPADARLL+GDPLKI
Sbjct  121   AGNAAAALMARLAPKAKVLRDGRWNEQDAAILVPGDIISIKLGDIIPADARLLEGDPLKI  180

Query  626   DQSALTGESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF  805
             DQSALTGESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVD+TNQVGHF
Sbjct  181   DQSALTGESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDTTNQVGHF  240

Query  806   QKVLTAIANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVT  985
             QKVLTAI NFCICSIAVGMVIEI+VMYPIQ R+YRPGIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  241   QKVLTAIGNFCICSIAVGMVIEIIVMYPIQDRDYRPGIDNLLVLLIGGIPIAMPTVLSVT  300

Query  986   MAIGSHRLAQQGAIT  1030
             MAIGSHRL+QQGAIT
Sbjct  301   MAIGSHRLSQQGAIT  315



>gb|EPS66977.1| hypothetical protein M569_07799, partial [Genlisea aurea]
Length=922

 Score =   503 bits (1294),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 291/312 (93%), Positives = 307/312 (98%), Gaps = 0/312 (0%)
 Frame = +2

Query  95    KPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskfl  274
             KPEVLDAVLKETVDLENIPI+EV ENLRC+++GL+S++AQERL IFGHNKLEEKKESKFL
Sbjct  1     KPEVLDAVLKETVDLENIPIDEVLENLRCSREGLSSESAQERLAIFGHNKLEEKKESKFL  60

Query  275   kflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnagn  454
             KFLGFMWNPLSWVMEAAAIMAIALANGG KPPDWQDFVGIITLL+INSTISFIEENNAGN
Sbjct  61    KFLGFMWNPLSWVMEAAAIMAIALANGGNKPPDWQDFVGIITLLMINSTISFIEENNAGN  120

Query  455   aaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQS  634
             AAAALMARLAPKAKVLRDG+WSEE+ASILVPGDIIS+KLGDIIPAD+RLL+GDPLKIDQS
Sbjct  121   AAAALMARLAPKAKVLRDGKWSEEEASILVPGDIISIKLGDIIPADSRLLEGDPLKIDQS  180

Query  635   ALTGESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKV  814
             ALTGESLPVTK PGDG+YSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKV
Sbjct  181   ALTGESLPVTKSPGDGVYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKV  240

Query  815   LTAIANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVTMAI  994
             LTAI NFCICSIAVGMVIEI+VMYPIQHR+YRPGIDNLLVLLIGGIPIAMPTVLSVTMAI
Sbjct  241   LTAIGNFCICSIAVGMVIEILVMYPIQHRQYRPGIDNLLVLLIGGIPIAMPTVLSVTMAI  300

Query  995   GSHRLAQQGAIT  1030
             GSHRLAQQGAIT
Sbjct  301   GSHRLAQQGAIT  312



>ref|XP_012080196.1| PREDICTED: ATPase 11, plasma membrane-type [Jatropha curcas]
 gb|KDP31195.1| hypothetical protein JCGZ_11571 [Jatropha curcas]
Length=956

 Score =   503 bits (1296),  Expect = 3e-167, Method: Compositional matrix adjust.
 Identities = 290/315 (92%), Positives = 309/315 (98%), Gaps = 0/315 (0%)
 Frame = +2

Query  86    MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
             M +K EVL+AVLKE VDLENIPIEEVFENLRC+K+GLT++AA+ERL IFGHNKLEEK+ES
Sbjct  1     MGDKSEVLEAVLKEAVDLENIPIEEVFENLRCSKEGLTTEAAEERLAIFGHNKLEEKQES  60

Query  266   kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
             KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLL+INSTISFIEENN
Sbjct  61    KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLLINSTISFIEENN  120

Query  446   agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  625
             AGNAAAALMARLAPKAKVLRDGRW+E+DA+ILVPGDIISVKLGDIIPADARLL+GDPLKI
Sbjct  121   AGNAAAALMARLAPKAKVLRDGRWTEQDAAILVPGDIISVKLGDIIPADARLLEGDPLKI  180

Query  626   DQSALTGESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF  805
             DQSALTGESLPVTKGPGDG+YSGSTCKQGEIEAVVIATGVHTFFGKAAHLVD+TNQVGHF
Sbjct  181   DQSALTGESLPVTKGPGDGVYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDTTNQVGHF  240

Query  806   QKVLTAIANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVT  985
             QKVLTAI NFCICSIAVGM+IEI+VMYPIQ R+YRPGIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  241   QKVLTAIGNFCICSIAVGMIIEIIVMYPIQDRKYRPGIDNLLVLLIGGIPIAMPTVLSVT  300

Query  986   MAIGSHRLAQQGAIT  1030
             MAIGSHRL+QQGAIT
Sbjct  301   MAIGSHRLSQQGAIT  315



>gb|KJB19306.1| hypothetical protein B456_003G094300 [Gossypium raimondii]
Length=987

 Score =   504 bits (1298),  Expect = 3e-167, Method: Compositional matrix adjust.
 Identities = 293/315 (93%), Positives = 310/315 (98%), Gaps = 0/315 (0%)
 Frame = +2

Query  86    MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
             M +K EVL+AVLKETVDLENIPIEEVFENLRC+++GLT++AA+ERL IFGHNKLEEKKES
Sbjct  1     MGDKNEVLEAVLKETVDLENIPIEEVFENLRCSREGLTTEAAEERLTIFGHNKLEEKKES  60

Query  266   kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
             KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN
Sbjct  61    KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN  120

Query  446   agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  625
             AGNAAAALMARLAPKAKVLRDGRW+E+DA+ILVPGDIIS+KLGDIIPADARLL+GDPLKI
Sbjct  121   AGNAAAALMARLAPKAKVLRDGRWNEQDAAILVPGDIISIKLGDIIPADARLLEGDPLKI  180

Query  626   DQSALTGESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF  805
             DQSALTGESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVD+TNQVGHF
Sbjct  181   DQSALTGESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDTTNQVGHF  240

Query  806   QKVLTAIANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVT  985
             QKVLTAI NFCICSIAVGMVIEI+VMYPIQ R+YRPGIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  241   QKVLTAIGNFCICSIAVGMVIEIIVMYPIQDRDYRPGIDNLLVLLIGGIPIAMPTVLSVT  300

Query  986   MAIGSHRLAQQGAIT  1030
             MAIGSHRL+QQGAIT
Sbjct  301   MAIGSHRLSQQGAIT  315



>ref|XP_003523043.1| PREDICTED: ATPase 11, plasma membrane-type-like isoform 1 [Glycine 
max]
 gb|KHN08862.1| ATPase 11, plasma membrane-type [Glycine soja]
Length=956

 Score =   503 bits (1294),  Expect = 6e-167, Method: Compositional matrix adjust.
 Identities = 290/315 (92%), Positives = 309/315 (98%), Gaps = 0/315 (0%)
 Frame = +2

Query  86    MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
             M +K +VL+AVLKE VDLENIPIEEVFENLRC+K+GL+S+AA+ERL IFGHNKLEEKKES
Sbjct  1     MGDKSQVLEAVLKEAVDLENIPIEEVFENLRCSKEGLSSEAAEERLVIFGHNKLEEKKES  60

Query  266   kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
             KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLL+INSTISFIEENN
Sbjct  61    KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLLINSTISFIEENN  120

Query  446   agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  625
             AGNAAAALMARLAPKAKVLRDGRW+E+DAS+LVPGDI+S+KLGDIIPADARLL+GDPLKI
Sbjct  121   AGNAAAALMARLAPKAKVLRDGRWNEQDASVLVPGDIVSIKLGDIIPADARLLEGDPLKI  180

Query  626   DQSALTGESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF  805
             DQSALTGESLPVTKGPGDG+YSGSTCKQGEIEAVVIATGVHTFFGKAAHLVD+TNQVGHF
Sbjct  181   DQSALTGESLPVTKGPGDGVYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDTTNQVGHF  240

Query  806   QKVLTAIANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVT  985
             QKVLTAI NFCICSIAVGMVIEI+VMYPIQ REYRPGIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  241   QKVLTAIGNFCICSIAVGMVIEIIVMYPIQDREYRPGIDNLLVLLIGGIPIAMPTVLSVT  300

Query  986   MAIGSHRLAQQGAIT  1030
             MAIGSHRL+QQGAIT
Sbjct  301   MAIGSHRLSQQGAIT  315



>gb|KHN19372.1| ATPase 11, plasma membrane-type [Glycine soja]
Length=956

 Score =   502 bits (1293),  Expect = 7e-167, Method: Compositional matrix adjust.
 Identities = 290/315 (92%), Positives = 309/315 (98%), Gaps = 0/315 (0%)
 Frame = +2

Query  86    MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
             M +K +VL+AVLKE VDLENIPIEEVFENLRC+K+GL+S+AA+ERL IFGHNKLEEKKES
Sbjct  1     MGDKSQVLEAVLKEAVDLENIPIEEVFENLRCSKEGLSSEAAEERLVIFGHNKLEEKKES  60

Query  266   kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
             KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLL+INSTISFIEENN
Sbjct  61    KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLIINSTISFIEENN  120

Query  446   agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  625
             AGNAAAALMARLAPKAKVLRDGRW+E+DAS+LVPGDI+S+KLGDIIPADARLL+GDPLKI
Sbjct  121   AGNAAAALMARLAPKAKVLRDGRWNEQDASVLVPGDIVSIKLGDIIPADARLLEGDPLKI  180

Query  626   DQSALTGESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF  805
             DQSALTGESLPVTKGPGDG+YSGSTCKQGEIEAVVIATGVHTFFGKAAHLVD+TNQVGHF
Sbjct  181   DQSALTGESLPVTKGPGDGVYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDTTNQVGHF  240

Query  806   QKVLTAIANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVT  985
             QKVLTAI NFCICSIAVGMVIEI+VMYPIQ REYRPGIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  241   QKVLTAIGNFCICSIAVGMVIEIIVMYPIQDREYRPGIDNLLVLLIGGIPIAMPTVLSVT  300

Query  986   MAIGSHRLAQQGAIT  1030
             MAIGSHRL+QQGAIT
Sbjct  301   MAIGSHRLSQQGAIT  315



>ref|XP_003527056.1| PREDICTED: ATPase 11, plasma membrane-type-like isoform 1 [Glycine 
max]
Length=956

 Score =   502 bits (1293),  Expect = 7e-167, Method: Compositional matrix adjust.
 Identities = 290/315 (92%), Positives = 309/315 (98%), Gaps = 0/315 (0%)
 Frame = +2

Query  86    MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
             M +K +VL+AVLKE VDLENIPIEEVFENLRC+K+GL+S+AA+ERL IFGHNKLEEKKES
Sbjct  1     MGDKSQVLEAVLKEAVDLENIPIEEVFENLRCSKEGLSSEAAEERLVIFGHNKLEEKKES  60

Query  266   kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
             KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLL+INSTISFIEENN
Sbjct  61    KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLIINSTISFIEENN  120

Query  446   agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  625
             AGNAAAALMARLAPKAKVLRDGRW+E+DAS+LVPGDI+S+KLGDIIPADARLL+GDPLKI
Sbjct  121   AGNAAAALMARLAPKAKVLRDGRWNEQDASVLVPGDIVSIKLGDIIPADARLLEGDPLKI  180

Query  626   DQSALTGESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF  805
             DQSALTGESLPVTKGPGDG+YSGSTCKQGEIEAVVIATGVHTFFGKAAHLVD+TNQVGHF
Sbjct  181   DQSALTGESLPVTKGPGDGVYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDTTNQVGHF  240

Query  806   QKVLTAIANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVT  985
             QKVLTAI NFCICSIAVGMVIEI+VMYPIQ REYRPGIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  241   QKVLTAIGNFCICSIAVGMVIEIIVMYPIQDREYRPGIDNLLVLLIGGIPIAMPTVLSVT  300

Query  986   MAIGSHRLAQQGAIT  1030
             MAIGSHRL+QQGAIT
Sbjct  301   MAIGSHRLSQQGAIT  315



>ref|XP_008807875.1| PREDICTED: ATPase 11, plasma membrane-type [Phoenix dactylifera]
 ref|XP_008807876.1| PREDICTED: ATPase 11, plasma membrane-type [Phoenix dactylifera]
 ref|XP_008807878.1| PREDICTED: ATPase 11, plasma membrane-type [Phoenix dactylifera]
 ref|XP_008807879.1| PREDICTED: ATPase 11, plasma membrane-type [Phoenix dactylifera]
Length=956

 Score =   502 bits (1292),  Expect = 1e-166, Method: Compositional matrix adjust.
 Identities = 288/315 (91%), Positives = 304/315 (97%), Gaps = 0/315 (0%)
 Frame = +2

Query  86    MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
             M +K   LDAVLKE VDLENIP+EEVF+NLRCT++GLT++ A+ERL IFGHNKLEEK+ES
Sbjct  1     MGDKAATLDAVLKEAVDLENIPLEEVFDNLRCTREGLTTEQAEERLAIFGHNKLEEKEES  60

Query  266   kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
             K LKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN
Sbjct  61    KILKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN  120

Query  446   agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  625
             AGNAAAALMARLAPKAKVLRDGRWSEE+++ILVPGDIIS+KLGDIIPADARLLDGDPLKI
Sbjct  121   AGNAAAALMARLAPKAKVLRDGRWSEEESAILVPGDIISIKLGDIIPADARLLDGDPLKI  180

Query  626   DQSALTGESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF  805
             DQSALTGESLPVTKGPGDG+YSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF
Sbjct  181   DQSALTGESLPVTKGPGDGVYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF  240

Query  806   QKVLTAIANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVT  985
             QKVLTAI NFCICSIAVGM +EI+VMYPIQHR YRPGIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  241   QKVLTAIGNFCICSIAVGMCVEIIVMYPIQHRAYRPGIDNLLVLLIGGIPIAMPTVLSVT  300

Query  986   MAIGSHRLAQQGAIT  1030
             MAIGSHRLAQQGAIT
Sbjct  301   MAIGSHRLAQQGAIT  315



>dbj|BAD16686.1| plasma membrane H+-ATPase [Daucus carota]
Length=956

 Score =   501 bits (1291),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 291/315 (92%), Positives = 306/315 (97%), Gaps = 0/315 (0%)
 Frame = +2

Query  86    MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
             M +K EVL+AVLKETVDLE+IPIEEVFENLRC+KDGLTS  A ERL IFGHNKLEEKKES
Sbjct  1     MEDKSEVLEAVLKETVDLESIPIEEVFENLRCSKDGLTSSGALERLTIFGHNKLEEKKES  60

Query  266   kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
             KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN
Sbjct  61    KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN  120

Query  446   agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  625
             AGNAAAALMARLAPKAKVLRDG+W+EEDA++LVPGDIIS+KLGDI+PADARLL+GDPLKI
Sbjct  121   AGNAAAALMARLAPKAKVLRDGKWNEEDAAVLVPGDIISIKLGDIVPADARLLEGDPLKI  180

Query  626   DQSALTGESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF  805
             DQSALTGESLPVTKGPGDG+YSGSTCKQGE+EAVVIATGVHTFFGKAAHLVDSTNQVGHF
Sbjct  181   DQSALTGESLPVTKGPGDGVYSGSTCKQGELEAVVIATGVHTFFGKAAHLVDSTNQVGHF  240

Query  806   QKVLTAIANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVT  985
             QKVLTAI NFCICSIAVGMVIEI+V YPIQ R+YRPGIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  241   QKVLTAIGNFCICSIAVGMVIEIIVQYPIQDRKYRPGIDNLLVLLIGGIPIAMPTVLSVT  300

Query  986   MAIGSHRLAQQGAIT  1030
             MAIGSHRLAQQGAIT
Sbjct  301   MAIGSHRLAQQGAIT  315



>ref|XP_007155352.1| hypothetical protein PHAVU_003G193800g [Phaseolus vulgaris]
 gb|ESW27346.1| hypothetical protein PHAVU_003G193800g [Phaseolus vulgaris]
Length=810

 Score =   496 bits (1277),  Expect = 3e-166, Method: Compositional matrix adjust.
 Identities = 286/315 (91%), Positives = 307/315 (97%), Gaps = 0/315 (0%)
 Frame = +2

Query  86    MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
             M +K +VL+AVLKETVDLENIPIEEV ENLRC+++GL+S+AA+ERL IFGHNKLEEK+ES
Sbjct  1     MGDKSQVLEAVLKETVDLENIPIEEVLENLRCSREGLSSEAAEERLTIFGHNKLEEKRES  60

Query  266   kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
             KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGK PDWQDFVGIITLLVINSTISFIEENN
Sbjct  61    KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKAPDWQDFVGIITLLVINSTISFIEENN  120

Query  446   agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  625
             AGNAAAALMARLAPKAKVLRDGRW+E+DA++LVPGDIIS+KLGDIIPADARLL+GDPLKI
Sbjct  121   AGNAAAALMARLAPKAKVLRDGRWNEQDAAVLVPGDIISIKLGDIIPADARLLEGDPLKI  180

Query  626   DQSALTGESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF  805
             DQSALTGESLPVTKGPGDG+YSGSTCKQGEIEAVVIATGVHTFFGKAAHLVD+TNQVGHF
Sbjct  181   DQSALTGESLPVTKGPGDGVYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDTTNQVGHF  240

Query  806   QKVLTAIANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVT  985
             QKVLTAI NFCICSIA+GMVIEI+VMYPIQ R YRPGIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  241   QKVLTAIGNFCICSIAIGMVIEIIVMYPIQDRPYRPGIDNLLVLLIGGIPIAMPTVLSVT  300

Query  986   MAIGSHRLAQQGAIT  1030
             MAIGSHRL+QQGAIT
Sbjct  301   MAIGSHRLSQQGAIT  315



>ref|XP_010459221.1| PREDICTED: ATPase 11, plasma membrane-type-like [Camelina sativa]
Length=956

 Score =   500 bits (1288),  Expect = 4e-166, Method: Compositional matrix adjust.
 Identities = 287/315 (91%), Positives = 309/315 (98%), Gaps = 0/315 (0%)
 Frame = +2

Query  86    MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
             M +K EVL+AVLKETVDLEN+PIEEVFE+LRC+++GLTS+AA ERL +FGHNKLEEKKES
Sbjct  1     MGDKEEVLEAVLKETVDLENVPIEEVFESLRCSREGLTSEAADERLALFGHNKLEEKKES  60

Query  266   kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
             KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN
Sbjct  61    KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN  120

Query  446   agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  625
             AGNAAAALMARLAPKAKVLRDGRW E+DA+ILVPGDIIS+KLGDI+PADARLL+GDPLKI
Sbjct  121   AGNAAAALMARLAPKAKVLRDGRWGEQDAAILVPGDIISIKLGDIVPADARLLEGDPLKI  180

Query  626   DQSALTGESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF  805
             DQS+LTGESLPVTKGPGDG+YSGSTCKQGE+EAVVIATGVHTFFGKAAHLVD+TNQVGHF
Sbjct  181   DQSSLTGESLPVTKGPGDGVYSGSTCKQGELEAVVIATGVHTFFGKAAHLVDTTNQVGHF  240

Query  806   QKVLTAIANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVT  985
             Q+VLTAI NFCICSIAVGM+IEIVVMYPIQHR+YRPGIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  241   QQVLTAIGNFCICSIAVGMIIEIVVMYPIQHRDYRPGIDNLLVLLIGGIPIAMPTVLSVT  300

Query  986   MAIGSHRLAQQGAIT  1030
             MAIGSHRL+QQGAIT
Sbjct  301   MAIGSHRLSQQGAIT  315



>ref|XP_006279959.1| hypothetical protein CARUB_v10025825mg [Capsella rubella]
 gb|EOA12857.1| hypothetical protein CARUB_v10025825mg [Capsella rubella]
Length=956

 Score =   500 bits (1287),  Expect = 6e-166, Method: Compositional matrix adjust.
 Identities = 285/315 (90%), Positives = 307/315 (97%), Gaps = 0/315 (0%)
 Frame = +2

Query  86    MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
             M +K EVL+AVLKETVDLEN+PIEEVFE+LRC+++GLT++AA ERL +FGHNKLEEKKES
Sbjct  1     MGDKEEVLEAVLKETVDLENVPIEEVFESLRCSREGLTTEAADERLALFGHNKLEEKKES  60

Query  266   kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
             KFLKFLGFMWNPLSWVMEAAAIMAI LANGGGKPPDWQDFVGIITLLVINSTISFIEENN
Sbjct  61    KFLKFLGFMWNPLSWVMEAAAIMAIVLANGGGKPPDWQDFVGIITLLVINSTISFIEENN  120

Query  446   agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  625
             AGNAAAALMARLAPKAKVLRDGRW E+DA+ILVPGDIIS+KLGDI+PADARLL+GDPLKI
Sbjct  121   AGNAAAALMARLAPKAKVLRDGRWGEQDAAILVPGDIISIKLGDIVPADARLLEGDPLKI  180

Query  626   DQSALTGESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF  805
             DQS+LTGESLPVTKGPGDG+YSGSTCKQGE+EAVVIATGVHTFFGKAAHLVD+TNQVGHF
Sbjct  181   DQSSLTGESLPVTKGPGDGVYSGSTCKQGELEAVVIATGVHTFFGKAAHLVDTTNQVGHF  240

Query  806   QKVLTAIANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVT  985
             Q+VLT+I NFCICSIAVGMVIEIVVMYPIQHR YRPGIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  241   QQVLTSIGNFCICSIAVGMVIEIVVMYPIQHRAYRPGIDNLLVLLIGGIPIAMPTVLSVT  300

Query  986   MAIGSHRLAQQGAIT  1030
             MAIGSHRL+QQGAIT
Sbjct  301   MAIGSHRLSQQGAIT  315



>gb|KEH31901.1| plasma membrane H+-ATPase [Medicago truncatula]
Length=958

 Score =   499 bits (1286),  Expect = 8e-166, Method: Compositional matrix adjust.
 Identities = 285/313 (91%), Positives = 307/313 (98%), Gaps = 0/313 (0%)
 Frame = +2

Query  92    EKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskf  271
             EKPE L+AVLKETVDLENIPIEEVFENLRC+++GLTS+AA++RL IFGHNKLEEK+ESKF
Sbjct  5     EKPETLEAVLKETVDLENIPIEEVFENLRCSREGLTSEAAEQRLTIFGHNKLEEKRESKF  64

Query  272   lkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnag  451
             LKFLGFMWNPLSWVMEAAAIMAIALANGGGK PDWQDFVGIITLL+INSTISFIEENNAG
Sbjct  65    LKFLGFMWNPLSWVMEAAAIMAIALANGGGKAPDWQDFVGIITLLIINSTISFIEENNAG  124

Query  452   naaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQ  631
             NAAAALMARLAPKAKVLRDGRW+E+DA+ILVPGDIIS+KLGDI+PADARLL+GDPLKIDQ
Sbjct  125   NAAAALMARLAPKAKVLRDGRWNEQDAAILVPGDIISIKLGDIVPADARLLEGDPLKIDQ  184

Query  632   SALTGESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQK  811
             SALTGESLPVTKGPGDG+YSGSTCKQGEIE VVIATGVHTFFGKAAHLVD+TNQVGHFQ+
Sbjct  185   SALTGESLPVTKGPGDGVYSGSTCKQGEIEGVVIATGVHTFFGKAAHLVDTTNQVGHFQQ  244

Query  812   VLTAIANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVTMA  991
             VLTAI NFCICSIAVGM++E+VVMYPIQHR YRPGIDNLLVLLIGGIPIAMPTVLSVTMA
Sbjct  245   VLTAIGNFCICSIAVGMLVELVVMYPIQHRRYRPGIDNLLVLLIGGIPIAMPTVLSVTMA  304

Query  992   IGSHRLAQQGAIT  1030
             IGSHRL+QQGAIT
Sbjct  305   IGSHRLSQQGAIT  317



>ref|XP_002322127.1| putative plasma membrane H+ ATPase family protein [Populus trichocarpa]
 gb|EEF06254.1| putative plasma membrane H+ ATPase family protein [Populus trichocarpa]
Length=967

 Score =   500 bits (1287),  Expect = 9e-166, Method: Compositional matrix adjust.
 Identities = 290/325 (89%), Positives = 308/325 (95%), Gaps = 10/325 (3%)
 Frame = +2

Query  86    MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
             M EK EVL+AVLKETVDLENIPIEEVFENLRC+++GLTSQAA+ERL IFGHNKLEEKKE 
Sbjct  1     MGEKAEVLEAVLKETVDLENIPIEEVFENLRCSREGLTSQAAEERLSIFGHNKLEEKKER  60

Query  266   kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
             KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLL INSTISFIEENN
Sbjct  61    KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLFINSTISFIEENN  120

Query  446   agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  625
             AGNAAAALMARLAPKAKVLRDGRWSE+DA++LVPGDIIS+KLGDIIPADARLL+GDPLKI
Sbjct  121   AGNAAAALMARLAPKAKVLRDGRWSEQDAAVLVPGDIISIKLGDIIPADARLLEGDPLKI  180

Query  626   DQSALTGESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF  805
             DQSALTGESLPVTKGPGDG+YSGSTCKQGEIEAVVIATGVHTFFGKAAHLVD+TNQVGHF
Sbjct  181   DQSALTGESLPVTKGPGDGVYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDTTNQVGHF  240

Query  806   QK----------VLTAIANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIP  955
             QK          VLTAI NFCICSIA+GM+IE++VMYPIQ R+YRPGIDNLLVLLIGGIP
Sbjct  241   QKARRYNCYMFFVLTAIGNFCICSIAIGMIIELIVMYPIQDRQYRPGIDNLLVLLIGGIP  300

Query  956   IAMPTVLSVTMAIGSHRLAQQGAIT  1030
             IAMPTVLSVTMAIGSHRL+QQGAIT
Sbjct  301   IAMPTVLSVTMAIGSHRLSQQGAIT  325



>ref|XP_002864812.1| AHA11-ATPASE 11 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH41071.1| AHA11-ATPASE 11 [Arabidopsis lyrata subsp. lyrata]
Length=956

 Score =   499 bits (1284),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 283/315 (90%), Positives = 307/315 (97%), Gaps = 0/315 (0%)
 Frame = +2

Query  86    MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
             M +K EVL+A+LKETVDLEN+PIEEVFE+LRC+++GLT++AA ERL +FGHNKLEEKKES
Sbjct  1     MGDKEEVLEAILKETVDLENVPIEEVFESLRCSREGLTTEAADERLALFGHNKLEEKKES  60

Query  266   kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
             KFLKFLGFMWNPLSWVMEAAAIMAI LANGGGKPPDWQDFVGIITLLVINSTISFIEENN
Sbjct  61    KFLKFLGFMWNPLSWVMEAAAIMAIVLANGGGKPPDWQDFVGIITLLVINSTISFIEENN  120

Query  446   agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  625
             AGNAAAALMARLAPKAKVLRDGRW E+DA+ILVPGDI+S+KLGDI+PADARLL+GDPLKI
Sbjct  121   AGNAAAALMARLAPKAKVLRDGRWGEQDAAILVPGDIVSIKLGDIVPADARLLEGDPLKI  180

Query  626   DQSALTGESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF  805
             DQS+LTGESLPVTKGPGDG+YSGSTCKQGE+EAVVIATGVHTFFGKAAHLVD+TNQVGHF
Sbjct  181   DQSSLTGESLPVTKGPGDGVYSGSTCKQGELEAVVIATGVHTFFGKAAHLVDTTNQVGHF  240

Query  806   QKVLTAIANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVT  985
             Q+VLTAI NFCICSIAVGM+IEIVVMYPIQHR YRPGIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  241   QQVLTAIGNFCICSIAVGMIIEIVVMYPIQHRAYRPGIDNLLVLLIGGIPIAMPTVLSVT  300

Query  986   MAIGSHRLAQQGAIT  1030
             MAIGSHRL+QQGAIT
Sbjct  301   MAIGSHRLSQQGAIT  315



>ref|XP_011659953.1| PREDICTED: plasma membrane ATPase 3 [Cucumis sativus]
Length=959

 Score =   499 bits (1284),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 286/313 (91%), Positives = 304/313 (97%), Gaps = 0/313 (0%)
 Frame = +2

Query  92    EKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskf  271
             EKPEVL+AVLKETVDLENIPIEEVF+NLRC+K+GLT+ AA+ERL IFGHNKLEEKKESK 
Sbjct  6     EKPEVLEAVLKETVDLENIPIEEVFDNLRCSKEGLTTAAAEERLVIFGHNKLEEKKESKV  65

Query  272   lkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnag  451
             LKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGII LL+INSTISFIEENNAG
Sbjct  66    LKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIIALLLINSTISFIEENNAG  125

Query  452   naaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQ  631
             NAAAALMA LAP+AK+LRDGRWS +DAS+LVPGDIIS+KLGDIIPADARLLDGDPLKIDQ
Sbjct  126   NAAAALMASLAPQAKILRDGRWSVQDASVLVPGDIISIKLGDIIPADARLLDGDPLKIDQ  185

Query  632   SALTGESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQK  811
             SALTGESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVD+TNQVGHFQK
Sbjct  186   SALTGESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDTTNQVGHFQK  245

Query  812   VLTAIANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVTMA  991
             VLTAI NFCICSIA+GM+ EI+VMYPIQ R+YRPGIDNLLVLLIGGIPIAMPTVLSVTMA
Sbjct  246   VLTAIGNFCICSIALGMITEIIVMYPIQDRDYRPGIDNLLVLLIGGIPIAMPTVLSVTMA  305

Query  992   IGSHRLAQQGAIT  1030
             IGSHRL+QQGAIT
Sbjct  306   IGSHRLSQQGAIT  318



>ref|XP_011042618.1| PREDICTED: ATPase 11, plasma membrane-type [Populus euphratica]
 ref|XP_011042619.1| PREDICTED: ATPase 11, plasma membrane-type [Populus euphratica]
Length=956

 Score =   499 bits (1284),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 288/315 (91%), Positives = 307/315 (97%), Gaps = 0/315 (0%)
 Frame = +2

Query  86    MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
             M +K EVL+AVLKETVDLENIPIEEV ENLRC+++GLT+QAA+ERL IFGHNKLEEKKE 
Sbjct  1     MGDKGEVLEAVLKETVDLENIPIEEVLENLRCSREGLTTQAAEERLAIFGHNKLEEKKER  60

Query  266   kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
             KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN
Sbjct  61    KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN  120

Query  446   agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  625
             AGNAAAALMARLAPKAKVLRDG+W+E+DAS+LVPGDIIS+KLGDIIPADARLL+GDPLKI
Sbjct  121   AGNAAAALMARLAPKAKVLRDGKWNEQDASVLVPGDIISIKLGDIIPADARLLEGDPLKI  180

Query  626   DQSALTGESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF  805
             DQSALTGESLPVTKGPGDG+YSGSTCKQGEIEAVVIATGVHTFFGKAAHLVD+TNQVGHF
Sbjct  181   DQSALTGESLPVTKGPGDGVYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDTTNQVGHF  240

Query  806   QKVLTAIANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVT  985
             QKVLTAI NFCICSIA+GMVIEI+VMYPIQ R+YRPGIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  241   QKVLTAIGNFCICSIAIGMVIEIIVMYPIQDRKYRPGIDNLLVLLIGGIPIAMPTVLSVT  300

Query  986   MAIGSHRLAQQGAIT  1030
             MAIGSHRL+ QGAIT
Sbjct  301   MAIGSHRLSLQGAIT  315



>ref|XP_008453171.1| PREDICTED: plasma membrane ATPase 3 [Cucumis melo]
Length=959

 Score =   499 bits (1284),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 286/313 (91%), Positives = 304/313 (97%), Gaps = 0/313 (0%)
 Frame = +2

Query  92    EKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskf  271
             EKPEVL+AVLKETVDLENIPIEEVF+NLRC+K+GLT+ AA+ERL IFGHNKLEEKKESK 
Sbjct  6     EKPEVLEAVLKETVDLENIPIEEVFDNLRCSKEGLTTAAAEERLVIFGHNKLEEKKESKI  65

Query  272   lkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnag  451
             LKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGII LL+INSTISFIEENNAG
Sbjct  66    LKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIIALLLINSTISFIEENNAG  125

Query  452   naaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQ  631
             NAAAALMA LAP+AK+LRDGRWS +DAS+LVPGDIIS+KLGDIIPADARLL+GDPLKIDQ
Sbjct  126   NAAAALMASLAPQAKILRDGRWSVQDASVLVPGDIISIKLGDIIPADARLLEGDPLKIDQ  185

Query  632   SALTGESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQK  811
             SALTGESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVD+TNQVGHFQK
Sbjct  186   SALTGESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDTTNQVGHFQK  245

Query  812   VLTAIANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVTMA  991
             VLTAI NFCICSIAVGM+ EI+VMYPIQ R+YRPGIDNLLVLLIGGIPIAMPTVLSVTMA
Sbjct  246   VLTAIGNFCICSIAVGMITEIIVMYPIQDRDYRPGIDNLLVLLIGGIPIAMPTVLSVTMA  305

Query  992   IGSHRLAQQGAIT  1030
             IGSHRL+QQGAIT
Sbjct  306   IGSHRLSQQGAIT  318



>ref|XP_009398402.1| PREDICTED: plasma membrane ATPase 1-like [Musa acuminata subsp. 
malaccensis]
Length=961

 Score =   498 bits (1283),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 285/308 (93%), Positives = 301/308 (98%), Gaps = 0/308 (0%)
 Frame = +2

Query  107   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  286
             +DA+LKE VDLENIP+EEVFENLRCT++GLT+Q A+ERL IFGHNKLEEKKESK LKFLG
Sbjct  13    MDALLKEAVDLENIPLEEVFENLRCTREGLTTQQAEERLAIFGHNKLEEKKESKILKFLG  72

Query  287   fMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaa  466
             FMWNPLSWVMEAAA+MAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENNAGNAAAA
Sbjct  73    FMWNPLSWVMEAAAVMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENNAGNAAAA  132

Query  467   lmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTG  646
             LMARLAPKAKVLRDGRW+EE+A+ILVPGDIIS+KLGDIIPADARLLDGDPLKIDQSALTG
Sbjct  133   LMARLAPKAKVLRDGRWNEEEAAILVPGDIISIKLGDIIPADARLLDGDPLKIDQSALTG  192

Query  647   ESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAI  826
             ESLPVTKGPGDG+YSGSTCKQGE+EAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAI
Sbjct  193   ESLPVTKGPGDGVYSGSTCKQGELEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAI  252

Query  827   ANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR  1006
              NFCICSIAVGM +EI+VMYPIQHR YRPGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR
Sbjct  253   GNFCICSIAVGMFVEIIVMYPIQHRAYRPGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR  312

Query  1007  LAQQGAIT  1030
             LAQQGAIT
Sbjct  313   LAQQGAIT  320



>ref|XP_006394361.1| hypothetical protein EUTSA_v10003603mg [Eutrema salsugineum]
 dbj|BAJ34039.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ31647.1| hypothetical protein EUTSA_v10003603mg [Eutrema salsugineum]
Length=956

 Score =   498 bits (1283),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 286/315 (91%), Positives = 308/315 (98%), Gaps = 0/315 (0%)
 Frame = +2

Query  86    MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
             M +K EVL+AVLKETVDLEN+PIEEVFE+LRC+++GLT++AA ERL +FGHNKLEEKKES
Sbjct  1     MGDKEEVLEAVLKETVDLENVPIEEVFESLRCSREGLTTEAADERLALFGHNKLEEKKES  60

Query  266   kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
             KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN
Sbjct  61    KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN  120

Query  446   agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  625
             AGNAAAALMARLAPKAKVLRDGRW E+DA+ILVPGDIIS+KLGDI+PADARLL+GDPLKI
Sbjct  121   AGNAAAALMARLAPKAKVLRDGRWGEQDAAILVPGDIISIKLGDIVPADARLLEGDPLKI  180

Query  626   DQSALTGESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF  805
             DQS+LTGESLPVTKGPGDG+YSGSTCKQGE+EAVVIATGVHTFFGKAAHLVD+TNQVGHF
Sbjct  181   DQSSLTGESLPVTKGPGDGVYSGSTCKQGELEAVVIATGVHTFFGKAAHLVDTTNQVGHF  240

Query  806   QKVLTAIANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVT  985
             Q+VLTAI NFCICSIAVGM+IEIVVMYPIQHR YRPGIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  241   QQVLTAIGNFCICSIAVGMLIEIVVMYPIQHRAYRPGIDNLLVLLIGGIPIAMPTVLSVT  300

Query  986   MAIGSHRLAQQGAIT  1030
             MAIGSHRL+QQGAIT
Sbjct  301   MAIGSHRLSQQGAIT  315



>ref|XP_009130230.1| PREDICTED: ATPase 11, plasma membrane-type isoform X3 [Brassica 
rapa]
Length=939

 Score =   498 bits (1281),  Expect = 3e-165, Method: Compositional matrix adjust.
 Identities = 286/315 (91%), Positives = 307/315 (97%), Gaps = 0/315 (0%)
 Frame = +2

Query  86    MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
             M +K EVL+AVLKETVDLEN+PIEEVFE+LRC+++GLT+ AA ERL +FGHNKLEEKKES
Sbjct  1     MGDKEEVLEAVLKETVDLENVPIEEVFESLRCSREGLTTAAADERLALFGHNKLEEKKES  60

Query  266   kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
             KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN
Sbjct  61    KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN  120

Query  446   agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  625
             AGNAAAALMARLAPKAKVLRDGRW E+DA+ILVPGDIIS+KLGDI+PADARLL+GDPLKI
Sbjct  121   AGNAAAALMARLAPKAKVLRDGRWGEQDAAILVPGDIISIKLGDIVPADARLLEGDPLKI  180

Query  626   DQSALTGESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF  805
             DQS+LTGESLPVTKGPGDG+YSGSTCKQGE+EAVVIATGVHTFFGKAAHLVD+TNQVGHF
Sbjct  181   DQSSLTGESLPVTKGPGDGVYSGSTCKQGELEAVVIATGVHTFFGKAAHLVDTTNQVGHF  240

Query  806   QKVLTAIANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVT  985
             Q+VLTAI NFCICSIAVGM+IEIVVMYPIQHR YRPGIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  241   QQVLTAIGNFCICSIAVGMLIEIVVMYPIQHRAYRPGIDNLLVLLIGGIPIAMPTVLSVT  300

Query  986   MAIGSHRLAQQGAIT  1030
             MAIGSHRL+QQGAIT
Sbjct  301   MAIGSHRLSQQGAIT  315



>ref|XP_010444121.1| PREDICTED: ATPase 11, plasma membrane-type isoform X2 [Camelina 
sativa]
Length=956

 Score =   498 bits (1282),  Expect = 4e-165, Method: Compositional matrix adjust.
 Identities = 285/315 (90%), Positives = 309/315 (98%), Gaps = 0/315 (0%)
 Frame = +2

Query  86    MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
             M +K EVL+AVLKETVDLEN+PI+EVFE+LRC+++GLT++AA ERL +FGHNKLEEKKES
Sbjct  1     MGDKEEVLEAVLKETVDLENVPIDEVFESLRCSREGLTTEAADERLALFGHNKLEEKKES  60

Query  266   kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
             KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN
Sbjct  61    KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN  120

Query  446   agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  625
             AGNAAAALMARLAPKAKVLRDGRW E+DA+ILVPGDIIS+KLGDI+PADARLL+GDPLKI
Sbjct  121   AGNAAAALMARLAPKAKVLRDGRWGEQDAAILVPGDIISIKLGDIVPADARLLEGDPLKI  180

Query  626   DQSALTGESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF  805
             DQS+LTGESLPVTKGPGDG+YSGSTCKQGE+EAVVIATGVHTFFGKAAHLVD+TNQVGHF
Sbjct  181   DQSSLTGESLPVTKGPGDGVYSGSTCKQGELEAVVIATGVHTFFGKAAHLVDTTNQVGHF  240

Query  806   QKVLTAIANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVT  985
             Q+VLTAI NFCICSIAVGM+IEIVVMYPIQHR+YRPGIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  241   QQVLTAIGNFCICSIAVGMIIEIVVMYPIQHRDYRPGIDNLLVLLIGGIPIAMPTVLSVT  300

Query  986   MAIGSHRLAQQGAIT  1030
             MAIGSHRL+QQGAIT
Sbjct  301   MAIGSHRLSQQGAIT  315



>emb|CDP14881.1| unnamed protein product [Coffea canephora]
Length=950

 Score =   498 bits (1281),  Expect = 4e-165, Method: Compositional matrix adjust.
 Identities = 291/315 (92%), Positives = 304/315 (97%), Gaps = 6/315 (2%)
 Frame = +2

Query  86    MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
             MA+KPEVL+AV+KETVDLENIPIEEVFENLRCTK+GLTS+ AQERL IFG+NKLEEKKES
Sbjct  1     MADKPEVLEAVVKETVDLENIPIEEVFENLRCTKEGLTSEGAQERLAIFGYNKLEEKKES  60

Query  266   kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
             K LK+LGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLL+INSTISFIEENN
Sbjct  61    KLLKYLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLLINSTISFIEENN  120

Query  446   agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  625
             AGNAAAALMARLAPKAKVLRDGRWSEEDA++LVPGDIIS+KLGDIIPADARLLDGDPLKI
Sbjct  121   AGNAAAALMARLAPKAKVLRDGRWSEEDAAVLVPGDIISIKLGDIIPADARLLDGDPLKI  180

Query  626   DQSALTGESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF  805
             DQSALTGESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQ    
Sbjct  181   DQSALTGESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQ----  236

Query  806   QKVLTAIANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVT  985
               VLTAI NFCICSIA+GM+IEIVVMYPIQHR YRPGIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  237   --VLTAIGNFCICSIAIGMIIEIVVMYPIQHRRYRPGIDNLLVLLIGGIPIAMPTVLSVT  294

Query  986   MAIGSHRLAQQGAIT  1030
             MAIGSHRLAQQGAIT
Sbjct  295   MAIGSHRLAQQGAIT  309



>ref|XP_010444120.1| PREDICTED: ATPase 11, plasma membrane-type isoform X1 [Camelina 
sativa]
Length=959

 Score =   498 bits (1282),  Expect = 4e-165, Method: Compositional matrix adjust.
 Identities = 285/315 (90%), Positives = 309/315 (98%), Gaps = 0/315 (0%)
 Frame = +2

Query  86    MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
             M +K EVL+AVLKETVDLEN+PI+EVFE+LRC+++GLT++AA ERL +FGHNKLEEKKES
Sbjct  1     MGDKEEVLEAVLKETVDLENVPIDEVFESLRCSREGLTTEAADERLALFGHNKLEEKKES  60

Query  266   kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
             KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN
Sbjct  61    KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN  120

Query  446   agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  625
             AGNAAAALMARLAPKAKVLRDGRW E+DA+ILVPGDIIS+KLGDI+PADARLL+GDPLKI
Sbjct  121   AGNAAAALMARLAPKAKVLRDGRWGEQDAAILVPGDIISIKLGDIVPADARLLEGDPLKI  180

Query  626   DQSALTGESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF  805
             DQS+LTGESLPVTKGPGDG+YSGSTCKQGE+EAVVIATGVHTFFGKAAHLVD+TNQVGHF
Sbjct  181   DQSSLTGESLPVTKGPGDGVYSGSTCKQGELEAVVIATGVHTFFGKAAHLVDTTNQVGHF  240

Query  806   QKVLTAIANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVT  985
             Q+VLTAI NFCICSIAVGM+IEIVVMYPIQHR+YRPGIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  241   QQVLTAIGNFCICSIAVGMIIEIVVMYPIQHRDYRPGIDNLLVLLIGGIPIAMPTVLSVT  300

Query  986   MAIGSHRLAQQGAIT  1030
             MAIGSHRL+QQGAIT
Sbjct  301   MAIGSHRLSQQGAIT  315



>tpg|DAA54787.1| TPA: hypothetical protein ZEAMMB73_074525 [Zea mays]
Length=812

 Score =   493 bits (1270),  Expect = 4e-165, Method: Compositional matrix adjust.
 Identities = 285/315 (90%), Positives = 305/315 (97%), Gaps = 0/315 (0%)
 Frame = +2

Query  86    MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
             MAEK   L+AVLKE VDLENIP+EEVFENLRC+++GL+++ AQ+RL+IFG NKLEEK+ES
Sbjct  1     MAEKEGNLEAVLKEAVDLENIPLEEVFENLRCSREGLSTEQAQQRLEIFGPNKLEEKEES  60

Query  266   kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
             KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN
Sbjct  61    KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN  120

Query  446   agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  625
             AGNAAAALMARLAPKAKVLRDGRW+EEDA+ILVPGDI+S+KLGDIIPADARLL+GDPLKI
Sbjct  121   AGNAAAALMARLAPKAKVLRDGRWTEEDAAILVPGDIVSIKLGDIIPADARLLEGDPLKI  180

Query  626   DQSALTGESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF  805
             DQSALTGESLPVTKGPGDG+YSGST KQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF
Sbjct  181   DQSALTGESLPVTKGPGDGVYSGSTVKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF  240

Query  806   QKVLTAIANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVT  985
             QKVLTAI NFCICSIAVGM +EI+VMYPIQHR YRPGIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  241   QKVLTAIGNFCICSIAVGMFVEIIVMYPIQHRAYRPGIDNLLVLLIGGIPIAMPTVLSVT  300

Query  986   MAIGSHRLAQQGAIT  1030
             MAIGSHRL+QQGAIT
Sbjct  301   MAIGSHRLSQQGAIT  315



>ref|XP_007138219.1| hypothetical protein PHAVU_009G190500g [Phaseolus vulgaris]
 gb|ESW10213.1| hypothetical protein PHAVU_009G190500g [Phaseolus vulgaris]
Length=956

 Score =   498 bits (1281),  Expect = 4e-165, Method: Compositional matrix adjust.
 Identities = 286/315 (91%), Positives = 308/315 (98%), Gaps = 0/315 (0%)
 Frame = +2

Query  86    MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
             M +K +VL+AVLKETVDLENIP+EEVFENLRC+K+GL+S+AA+ERL IFGHNKLEEKKE 
Sbjct  1     MGDKSQVLEAVLKETVDLENIPVEEVFENLRCSKEGLSSEAAEERLVIFGHNKLEEKKER  60

Query  266   kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
             KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN
Sbjct  61    KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN  120

Query  446   agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  625
             AGNAAAALMARLAPKAKVLRDGRWSE+DA++LVPGDI+S+KLGDIIPAD+RLL+GDPLKI
Sbjct  121   AGNAAAALMARLAPKAKVLRDGRWSEQDAAVLVPGDIVSIKLGDIIPADSRLLEGDPLKI  180

Query  626   DQSALTGESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF  805
             DQSALTGESLPV+KGPGDG+YSGSTCKQGEIEAVVIATGVHTFFGKAAHLVD+TNQVGHF
Sbjct  181   DQSALTGESLPVSKGPGDGVYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDTTNQVGHF  240

Query  806   QKVLTAIANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVT  985
             QKVLTAI NFCICSIAVGMVIEI+VMYPIQ R+YRPGIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  241   QKVLTAIGNFCICSIAVGMVIEIIVMYPIQDRKYRPGIDNLLVLLIGGIPIAMPTVLSVT  300

Query  986   MAIGSHRLAQQGAIT  1030
             MAIGSHRL+ QGAIT
Sbjct  301   MAIGSHRLSLQGAIT  315



>ref|XP_009130229.1| PREDICTED: ATPase 11, plasma membrane-type isoform X2 [Brassica 
rapa]
Length=956

 Score =   497 bits (1280),  Expect = 6e-165, Method: Compositional matrix adjust.
 Identities = 286/315 (91%), Positives = 307/315 (97%), Gaps = 0/315 (0%)
 Frame = +2

Query  86    MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
             M +K EVL+AVLKETVDLEN+PIEEVFE+LRC+++GLT+ AA ERL +FGHNKLEEKKES
Sbjct  1     MGDKEEVLEAVLKETVDLENVPIEEVFESLRCSREGLTTAAADERLALFGHNKLEEKKES  60

Query  266   kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
             KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN
Sbjct  61    KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN  120

Query  446   agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  625
             AGNAAAALMARLAPKAKVLRDGRW E+DA+ILVPGDIIS+KLGDI+PADARLL+GDPLKI
Sbjct  121   AGNAAAALMARLAPKAKVLRDGRWGEQDAAILVPGDIISIKLGDIVPADARLLEGDPLKI  180

Query  626   DQSALTGESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF  805
             DQS+LTGESLPVTKGPGDG+YSGSTCKQGE+EAVVIATGVHTFFGKAAHLVD+TNQVGHF
Sbjct  181   DQSSLTGESLPVTKGPGDGVYSGSTCKQGELEAVVIATGVHTFFGKAAHLVDTTNQVGHF  240

Query  806   QKVLTAIANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVT  985
             Q+VLTAI NFCICSIAVGM+IEIVVMYPIQHR YRPGIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  241   QQVLTAIGNFCICSIAVGMLIEIVVMYPIQHRAYRPGIDNLLVLLIGGIPIAMPTVLSVT  300

Query  986   MAIGSHRLAQQGAIT  1030
             MAIGSHRL+QQGAIT
Sbjct  301   MAIGSHRLSQQGAIT  315



>ref|XP_011071717.1| PREDICTED: LOW QUALITY PROTEIN: plasma membrane ATPase 3 [Sesamum 
indicum]
Length=952

 Score =   497 bits (1280),  Expect = 7e-165, Method: Compositional matrix adjust.
 Identities = 292/315 (93%), Positives = 303/315 (96%), Gaps = 4/315 (1%)
 Frame = +2

Query  86    MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
             M E+PEVLDAVLKETVDLENIPIEEVFENLRCT++GLT++AAQERL IFGHNKLEEKKES
Sbjct  1     MGEEPEVLDAVLKETVDLENIPIEEVFENLRCTREGLTTEAAQERLAIFGHNKLEEKKES  60

Query  266   kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
             KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN
Sbjct  61    KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN  120

Query  446   agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  625
             AGNAAAALMARLAPKAKVLRDGRWSEE+ASILVPGDIISVKLGD         +GDPLKI
Sbjct  121   AGNAAAALMARLAPKAKVLRDGRWSEEEASILVPGDIISVKLGDX----XXXXEGDPLKI  176

Query  626   DQSALTGESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF  805
             DQSALTGESLPVTKGPGDG+YSGSTCKQGEIEA+VIATGVHTFFGKAAHLVDSTNQVGHF
Sbjct  177   DQSALTGESLPVTKGPGDGVYSGSTCKQGEIEAIVIATGVHTFFGKAAHLVDSTNQVGHF  236

Query  806   QKVLTAIANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVT  985
             QKVLTAI NFCICSIAVGM+IEI+VMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  237   QKVLTAIGNFCICSIAVGMIIEIIVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVT  296

Query  986   MAIGSHRLAQQGAIT  1030
             MAIGSHRLAQQGAIT
Sbjct  297   MAIGSHRLAQQGAIT  311



>ref|NP_201073.1| H(+)-ATPase 11 [Arabidopsis thaliana]
 sp|Q9LV11.1|PMA11_ARATH RecName: Full=ATPase 11, plasma membrane-type; AltName: Full=Proton 
pump 11 [Arabidopsis thaliana]
 dbj|BAA97214.1| plasma membrane proton ATPase-like [Arabidopsis thaliana]
 gb|AAM78085.1| AT5g62670/MRG21_9 [Arabidopsis thaliana]
 gb|AAR23718.1| At5g62670/MRG21_9 [Arabidopsis thaliana]
 gb|AED97641.1| H(+)-ATPase 11 [Arabidopsis thaliana]
Length=956

 Score =   497 bits (1280),  Expect = 7e-165, Method: Compositional matrix adjust.
 Identities = 285/315 (90%), Positives = 307/315 (97%), Gaps = 0/315 (0%)
 Frame = +2

Query  86    MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
             M +K EVL+AVLKETVDLEN+PIEEVFE+LRC+++GLT++AA ERL +FGHNKLEEKKES
Sbjct  1     MGDKEEVLEAVLKETVDLENVPIEEVFESLRCSREGLTTEAADERLALFGHNKLEEKKES  60

Query  266   kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
             KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN
Sbjct  61    KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN  120

Query  446   agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  625
             AGNAAAALMARLAPKAKVLRDGRW E+DA+ILVPGDIIS+KLGDI+PADARLL+GDPLKI
Sbjct  121   AGNAAAALMARLAPKAKVLRDGRWGEQDAAILVPGDIISIKLGDIVPADARLLEGDPLKI  180

Query  626   DQSALTGESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF  805
             DQS+LTGESLPVTKGPGDG+YSGSTCKQGE+EAVVIATGVHTFFGKAAHLVD+TN VGHF
Sbjct  181   DQSSLTGESLPVTKGPGDGVYSGSTCKQGELEAVVIATGVHTFFGKAAHLVDTTNHVGHF  240

Query  806   QKVLTAIANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVT  985
             Q+VLTAI NFCICSIAVGM+IEIVVMYPIQHR YRPGIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  241   QQVLTAIGNFCICSIAVGMIIEIVVMYPIQHRAYRPGIDNLLVLLIGGIPIAMPTVLSVT  300

Query  986   MAIGSHRLAQQGAIT  1030
             MAIGSHRL+QQGAIT
Sbjct  301   MAIGSHRLSQQGAIT  315



>ref|XP_009130228.1| PREDICTED: ATPase 11, plasma membrane-type isoform X1 [Brassica 
rapa]
Length=979

 Score =   498 bits (1281),  Expect = 8e-165, Method: Compositional matrix adjust.
 Identities = 286/315 (91%), Positives = 307/315 (97%), Gaps = 0/315 (0%)
 Frame = +2

Query  86    MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
             M +K EVL+AVLKETVDLEN+PIEEVFE+LRC+++GLT+ AA ERL +FGHNKLEEKKES
Sbjct  1     MGDKEEVLEAVLKETVDLENVPIEEVFESLRCSREGLTTAAADERLALFGHNKLEEKKES  60

Query  266   kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
             KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN
Sbjct  61    KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN  120

Query  446   agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  625
             AGNAAAALMARLAPKAKVLRDGRW E+DA+ILVPGDIIS+KLGDI+PADARLL+GDPLKI
Sbjct  121   AGNAAAALMARLAPKAKVLRDGRWGEQDAAILVPGDIISIKLGDIVPADARLLEGDPLKI  180

Query  626   DQSALTGESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF  805
             DQS+LTGESLPVTKGPGDG+YSGSTCKQGE+EAVVIATGVHTFFGKAAHLVD+TNQVGHF
Sbjct  181   DQSSLTGESLPVTKGPGDGVYSGSTCKQGELEAVVIATGVHTFFGKAAHLVDTTNQVGHF  240

Query  806   QKVLTAIANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVT  985
             Q+VLTAI NFCICSIAVGM+IEIVVMYPIQHR YRPGIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  241   QQVLTAIGNFCICSIAVGMLIEIVVMYPIQHRAYRPGIDNLLVLLIGGIPIAMPTVLSVT  300

Query  986   MAIGSHRLAQQGAIT  1030
             MAIGSHRL+QQGAIT
Sbjct  301   MAIGSHRLSQQGAIT  315



>ref|XP_008796652.1| PREDICTED: plasma membrane ATPase 3 isoform X1 [Phoenix dactylifera]
 ref|XP_008796653.1| PREDICTED: plasma membrane ATPase 3 isoform X2 [Phoenix dactylifera]
Length=956

 Score =   497 bits (1279),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 287/315 (91%), Positives = 304/315 (97%), Gaps = 0/315 (0%)
 Frame = +2

Query  86    MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
             M +K   L+AVLKE VDLENIP+EEVF+NLRCT++GLT++ A+ERL IFGHNKLEEKKES
Sbjct  1     MGDKAATLEAVLKEAVDLENIPLEEVFDNLRCTREGLTTEQAEERLAIFGHNKLEEKKES  60

Query  266   kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
             KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLL+INSTISFIEENN
Sbjct  61    KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLLINSTISFIEENN  120

Query  446   agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  625
             AGNAAAALMARLAPKAKVLRDGRW EE+A+ILVPGDIIS+KLGDIIPADARLLDGDPLKI
Sbjct  121   AGNAAAALMARLAPKAKVLRDGRWKEEEAAILVPGDIISIKLGDIIPADARLLDGDPLKI  180

Query  626   DQSALTGESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF  805
             DQSALTGESLPVTKGPGDG+YSGSTCKQGEIEA+VIATGVHTFFGKAAHLVDSTNQVGHF
Sbjct  181   DQSALTGESLPVTKGPGDGVYSGSTCKQGEIEAIVIATGVHTFFGKAAHLVDSTNQVGHF  240

Query  806   QKVLTAIANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVT  985
             QKVLTAI NFCICSIAVGM IEI+VMYPIQ R+YRPGIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  241   QKVLTAIGNFCICSIAVGMCIEIIVMYPIQDRDYRPGIDNLLVLLIGGIPIAMPTVLSVT  300

Query  986   MAIGSHRLAQQGAIT  1030
             MAIGSHRLAQQGAIT
Sbjct  301   MAIGSHRLAQQGAIT  315



>ref|XP_010933786.1| PREDICTED: plasma membrane ATPase 3 [Elaeis guineensis]
Length=956

 Score =   496 bits (1278),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 286/315 (91%), Positives = 303/315 (96%), Gaps = 0/315 (0%)
 Frame = +2

Query  86    MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
             M +K   LDAVLKE VDLENIP+EEVF+NLRCT++GLT++ A+ERL IFGHNKLEEKKES
Sbjct  1     MGDKATNLDAVLKEVVDLENIPLEEVFDNLRCTREGLTTEQAEERLAIFGHNKLEEKKES  60

Query  266   kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
             K LKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLL+INSTISFIEENN
Sbjct  61    KILKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLLINSTISFIEENN  120

Query  446   agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  625
             AGNAAAALMARLAPKAKVLRDGRW EE+++ILVPGDIIS+KLGDIIPADARLL+GDPLKI
Sbjct  121   AGNAAAALMARLAPKAKVLRDGRWREEESAILVPGDIISIKLGDIIPADARLLEGDPLKI  180

Query  626   DQSALTGESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF  805
             DQSALTGESLPVTKGPGDG+YSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF
Sbjct  181   DQSALTGESLPVTKGPGDGVYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF  240

Query  806   QKVLTAIANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVT  985
             QKVLTAI NFCICSIAVGM +EI+VMYPIQHR YRPGIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  241   QKVLTAIGNFCICSIAVGMCVEIIVMYPIQHRAYRPGIDNLLVLLIGGIPIAMPTVLSVT  300

Query  986   MAIGSHRLAQQGAIT  1030
             MAIGSHRLAQQGAIT
Sbjct  301   MAIGSHRLAQQGAIT  315



>ref|XP_004508789.1| PREDICTED: ATPase 11, plasma membrane-type-like isoform X3 [Cicer 
arietinum]
Length=958

 Score =   496 bits (1278),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 284/313 (91%), Positives = 307/313 (98%), Gaps = 0/313 (0%)
 Frame = +2

Query  92    EKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskf  271
             +KPE+L+AVLKETVDLENIPIEEVFENLRC+++GLTS+ A++RL IFG+NKLEEK+ESKF
Sbjct  5     DKPEMLEAVLKETVDLENIPIEEVFENLRCSREGLTSEGAEQRLTIFGYNKLEEKRESKF  64

Query  272   lkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnag  451
             LKFLGFMWNPLSWVMEAAAIMAIALANGGGK PDWQDFVGIITLL+INSTISFIEENNAG
Sbjct  65    LKFLGFMWNPLSWVMEAAAIMAIALANGGGKAPDWQDFVGIITLLIINSTISFIEENNAG  124

Query  452   naaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQ  631
             NAAAALMARLAPKAKVLRDGRW+E+DA++LVPGDIIS+KLGDI+PADARLL+GDPLKIDQ
Sbjct  125   NAAAALMARLAPKAKVLRDGRWNEQDAAVLVPGDIISIKLGDIVPADARLLEGDPLKIDQ  184

Query  632   SALTGESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQK  811
             SALTGESLPVTKGPGDG+YSGSTCKQGEIE VVIATGVHTFFGKAAHLVD+TNQVGHFQK
Sbjct  185   SALTGESLPVTKGPGDGVYSGSTCKQGEIEGVVIATGVHTFFGKAAHLVDTTNQVGHFQK  244

Query  812   VLTAIANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVTMA  991
             VLTAI NFCICSIAVGM+IEIVVMYPIQHR YRPGIDNLLVLLIGGIPIAMPTVLSVTMA
Sbjct  245   VLTAIGNFCICSIAVGMLIEIVVMYPIQHRPYRPGIDNLLVLLIGGIPIAMPTVLSVTMA  304

Query  992   IGSHRLAQQGAIT  1030
             IGSHRL+QQGAIT
Sbjct  305   IGSHRLSQQGAIT  317



>gb|KHN13245.1| Plasma membrane ATPase 1 [Glycine soja]
Length=956

 Score =   496 bits (1277),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 284/315 (90%), Positives = 301/315 (96%), Gaps = 0/315 (0%)
 Frame = +2

Query  86    MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
             MAEK E + AVLKE VDLEN+P+EEVF+ LRC  +GLT+++A+ERL IFGHNKLEEKKES
Sbjct  1     MAEKEEAMHAVLKEAVDLENVPLEEVFQTLRCDSNGLTTESAEERLVIFGHNKLEEKKES  60

Query  266   kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
             K LKFLGFMWNPLSWVMEAAAIM+IALANGGGKPPDWQDFVGIITLL+INSTISFIEENN
Sbjct  61    KVLKFLGFMWNPLSWVMEAAAIMSIALANGGGKPPDWQDFVGIITLLIINSTISFIEENN  120

Query  446   agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  625
             AGNAAAALMARLAPKAK LRDG+W EEDASILVPGDIISVKLGDIIPADARLL+GDPLKI
Sbjct  121   AGNAAAALMARLAPKAKFLRDGKWIEEDASILVPGDIISVKLGDIIPADARLLEGDPLKI  180

Query  626   DQSALTGESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF  805
             DQSALTGESLPVTKGPGD +YSGSTCKQGEI AVVIATGVHTFFGKAAHLVDSTNQVGHF
Sbjct  181   DQSALTGESLPVTKGPGDSVYSGSTCKQGEINAVVIATGVHTFFGKAAHLVDSTNQVGHF  240

Query  806   QKVLTAIANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVT  985
             QKVLTAI NFCICSIAVGM++EI+VMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  241   QKVLTAIGNFCICSIAVGMIVEIIVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVT  300

Query  986   MAIGSHRLAQQGAIT  1030
             MAIGSHRLAQQGAIT
Sbjct  301   MAIGSHRLAQQGAIT  315



>ref|XP_007155353.1| hypothetical protein PHAVU_003G193800g [Phaseolus vulgaris]
 gb|ESW27347.1| hypothetical protein PHAVU_003G193800g [Phaseolus vulgaris]
Length=955

 Score =   496 bits (1276),  Expect = 3e-164, Method: Compositional matrix adjust.
 Identities = 286/315 (91%), Positives = 307/315 (97%), Gaps = 0/315 (0%)
 Frame = +2

Query  86    MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
             M +K +VL+AVLKETVDLENIPIEEV ENLRC+++GL+S+AA+ERL IFGHNKLEEK+ES
Sbjct  1     MGDKSQVLEAVLKETVDLENIPIEEVLENLRCSREGLSSEAAEERLTIFGHNKLEEKRES  60

Query  266   kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
             KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGK PDWQDFVGIITLLVINSTISFIEENN
Sbjct  61    KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKAPDWQDFVGIITLLVINSTISFIEENN  120

Query  446   agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  625
             AGNAAAALMARLAPKAKVLRDGRW+E+DA++LVPGDIIS+KLGDIIPADARLL+GDPLKI
Sbjct  121   AGNAAAALMARLAPKAKVLRDGRWNEQDAAVLVPGDIISIKLGDIIPADARLLEGDPLKI  180

Query  626   DQSALTGESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF  805
             DQSALTGESLPVTKGPGDG+YSGSTCKQGEIEAVVIATGVHTFFGKAAHLVD+TNQVGHF
Sbjct  181   DQSALTGESLPVTKGPGDGVYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDTTNQVGHF  240

Query  806   QKVLTAIANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVT  985
             QKVLTAI NFCICSIA+GMVIEI+VMYPIQ R YRPGIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  241   QKVLTAIGNFCICSIAIGMVIEIIVMYPIQDRPYRPGIDNLLVLLIGGIPIAMPTVLSVT  300

Query  986   MAIGSHRLAQQGAIT  1030
             MAIGSHRL+QQGAIT
Sbjct  301   MAIGSHRLSQQGAIT  315



>emb|CAC29435.1| P-type H+-ATPase [Vicia faba]
Length=958

 Score =   495 bits (1274),  Expect = 5e-164, Method: Compositional matrix adjust.
 Identities = 279/313 (89%), Positives = 301/313 (96%), Gaps = 0/313 (0%)
 Frame = +2

Query  92    EKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskf  271
             +KPE L AVLKETVDLENIPI+EVFENLRC+++GLTS+AA++RL IFGHNKLEEK+ESK 
Sbjct  5     QKPETLQAVLKETVDLENIPIDEVFENLRCSREGLTSEAAEQRLTIFGHNKLEEKRESKL  64

Query  272   lkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnag  451
             LKFLGFMWNPLSWVMEAA IMAIALANGG K PDWQDFVGIITLL+INSTISFI++NNAG
Sbjct  65    LKFLGFMWNPLSWVMEAARIMAIALANGGNKAPDWQDFVGIITLLIINSTISFIDQNNAG  124

Query  452   naaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQ  631
             NAAAALMA LAPKAKVLRDGRWSE+DA+ILVPGDIIS+KLGDI+PADARLL+GDPLKIDQ
Sbjct  125   NAAAALMASLAPKAKVLRDGRWSEQDAAILVPGDIISIKLGDIVPADARLLEGDPLKIDQ  184

Query  632   SALTGESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQK  811
             SALTGESLPVTK PGDG+YSGSTCKQGEIE VVIATGVHTFFGKAAHLVD+TNQVGHFQK
Sbjct  185   SALTGESLPVTKAPGDGVYSGSTCKQGEIECVVIATGVHTFFGKAAHLVDTTNQVGHFQK  244

Query  812   VLTAIANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVTMA  991
             VLTAI NFCICSIAVGM+IE+VVMYPIQHR YRPGIDNLLVLLIGGIPIAMPTVLSVTMA
Sbjct  245   VLTAIGNFCICSIAVGMLIELVVMYPIQHRRYRPGIDNLLVLLIGGIPIAMPTVLSVTMA  304

Query  992   IGSHRLAQQGAIT  1030
             IGSHRL+QQGAIT
Sbjct  305   IGSHRLSQQGAIT  317



>ref|XP_009398401.1| PREDICTED: plasma membrane ATPase 1 isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=961

 Score =   495 bits (1274),  Expect = 6e-164, Method: Compositional matrix adjust.
 Identities = 283/308 (92%), Positives = 299/308 (97%), Gaps = 0/308 (0%)
 Frame = +2

Query  107   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  286
             +DA+LKE VDLENIP+EEVFENLRCT++GLT+Q A+ERL IFGHNKLEEKKESK LKFLG
Sbjct  13    MDALLKEAVDLENIPLEEVFENLRCTREGLTTQQAEERLAIFGHNKLEEKKESKILKFLG  72

Query  287   fMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaa  466
             FMWNPLSWVMEAAA+MAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENNAGNAAAA
Sbjct  73    FMWNPLSWVMEAAAVMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENNAGNAAAA  132

Query  467   lmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTG  646
             LMARLAPKAKVLRDGRW EE+++ILVPGDIIS+KLGDIIPAD+RLLDGDPLKIDQSALTG
Sbjct  133   LMARLAPKAKVLRDGRWKEEESAILVPGDIISIKLGDIIPADSRLLDGDPLKIDQSALTG  192

Query  647   ESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAI  826
             ESLPVTKGPGDG+YSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAI
Sbjct  193   ESLPVTKGPGDGVYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAI  252

Query  827   ANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR  1006
              NFCICSI VGM +EI+VMYPIQHR YRPGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR
Sbjct  253   GNFCICSIVVGMFVEIIVMYPIQHRAYRPGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR  312

Query  1007  LAQQGAIT  1030
             LAQQGAIT
Sbjct  313   LAQQGAIT  320



>ref|XP_004508788.1| PREDICTED: ATPase 11, plasma membrane-type-like isoform X2 [Cicer 
arietinum]
Length=960

 Score =   495 bits (1274),  Expect = 6e-164, Method: Compositional matrix adjust.
 Identities = 284/313 (91%), Positives = 307/313 (98%), Gaps = 0/313 (0%)
 Frame = +2

Query  92    EKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskf  271
             +KPE+L+AVLKETVDLENIPIEEVFENLRC+++GLTS+ A++RL IFG+NKLEEK+ESKF
Sbjct  5     DKPEMLEAVLKETVDLENIPIEEVFENLRCSREGLTSEGAEQRLTIFGYNKLEEKRESKF  64

Query  272   lkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnag  451
             LKFLGFMWNPLSWVMEAAAIMAIALANGGGK PDWQDFVGIITLL+INSTISFIEENNAG
Sbjct  65    LKFLGFMWNPLSWVMEAAAIMAIALANGGGKAPDWQDFVGIITLLIINSTISFIEENNAG  124

Query  452   naaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQ  631
             NAAAALMARLAPKAKVLRDGRW+E+DA++LVPGDIIS+KLGDI+PADARLL+GDPLKIDQ
Sbjct  125   NAAAALMARLAPKAKVLRDGRWNEQDAAVLVPGDIISIKLGDIVPADARLLEGDPLKIDQ  184

Query  632   SALTGESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQK  811
             SALTGESLPVTKGPGDG+YSGSTCKQGEIE VVIATGVHTFFGKAAHLVD+TNQVGHFQK
Sbjct  185   SALTGESLPVTKGPGDGVYSGSTCKQGEIEGVVIATGVHTFFGKAAHLVDTTNQVGHFQK  244

Query  812   VLTAIANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVTMA  991
             VLTAI NFCICSIAVGM+IEIVVMYPIQHR YRPGIDNLLVLLIGGIPIAMPTVLSVTMA
Sbjct  245   VLTAIGNFCICSIAVGMLIEIVVMYPIQHRPYRPGIDNLLVLLIGGIPIAMPTVLSVTMA  304

Query  992   IGSHRLAQQGAIT  1030
             IGSHRL+QQGAIT
Sbjct  305   IGSHRLSQQGAIT  317



>ref|XP_010923303.1| PREDICTED: plasma membrane ATPase 3-like [Elaeis guineensis]
Length=956

 Score =   494 bits (1273),  Expect = 8e-164, Method: Compositional matrix adjust.
 Identities = 286/315 (91%), Positives = 302/315 (96%), Gaps = 0/315 (0%)
 Frame = +2

Query  86    MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
             M +K   L+AVLKE VDLENIP+EEVFENLRCT++GLT++ A+ERL IFGHNKLEEKKES
Sbjct  1     MGDKAATLEAVLKEAVDLENIPLEEVFENLRCTREGLTTEQAEERLAIFGHNKLEEKKES  60

Query  266   kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
             K LKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLL+INSTISFIEENN
Sbjct  61    KILKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLLINSTISFIEENN  120

Query  446   agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  625
             AGNAAAALMARLAPKAKVLRDGRW+EE+A+ILVPGDIIS+KLGDIIPADARLLDGDPLKI
Sbjct  121   AGNAAAALMARLAPKAKVLRDGRWTEEEAAILVPGDIISIKLGDIIPADARLLDGDPLKI  180

Query  626   DQSALTGESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF  805
             DQSALTGESLPVTKGPGDG+YSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF
Sbjct  181   DQSALTGESLPVTKGPGDGVYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF  240

Query  806   QKVLTAIANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVT  985
             QKVLTAI NFCICSIA+GM  EI+VMYPIQ R YRPGIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  241   QKVLTAIGNFCICSIAMGMCTEIIVMYPIQDRPYRPGIDNLLVLLIGGIPIAMPTVLSVT  300

Query  986   MAIGSHRLAQQGAIT  1030
             MAIGSHRLAQQGAIT
Sbjct  301   MAIGSHRLAQQGAIT  315



>ref|NP_001059093.1| Os07g0191200 [Oryza sativa Japonica Group]
 emb|CAD29295.1| plasma membrane H+ ATPase [Oryza sativa Japonica Group]
 dbj|BAC83861.1| plasma membrane H+ ATPase [Oryza sativa Japonica Group]
 dbj|BAF21007.1| Os07g0191200 [Oryza sativa Japonica Group]
Length=957

 Score =   494 bits (1273),  Expect = 8e-164, Method: Compositional matrix adjust.
 Identities = 285/315 (90%), Positives = 307/315 (97%), Gaps = 0/315 (0%)
 Frame = +2

Query  86    MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
             MAEK + L+AVL E+VDLENIP+EEVFE+LRC ++GLTS  A++RL++FG N+LEEKKES
Sbjct  1     MAEKGDNLEAVLNESVDLENIPLEEVFEHLRCNREGLTSANAEQRLNLFGPNRLEEKKES  60

Query  266   kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
             KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLL+INSTISFIEENN
Sbjct  61    KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLIINSTISFIEENN  120

Query  446   agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  625
             AGNAAAALMARLAPKAKVLR+GRWSEE+A+ILVPGDIISVKLGDIIPADARLL+GDPLKI
Sbjct  121   AGNAAAALMARLAPKAKVLRNGRWSEEEAAILVPGDIISVKLGDIIPADARLLEGDPLKI  180

Query  626   DQSALTGESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF  805
             DQSALTGESLPVTKGPGDG+YSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF
Sbjct  181   DQSALTGESLPVTKGPGDGVYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF  240

Query  806   QKVLTAIANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVT  985
             QKVLTAI NFCICSIA+GMV+EI+VMYPIQHR+YRPGIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  241   QKVLTAIGNFCICSIAIGMVVEIIVMYPIQHRDYRPGIDNLLVLLIGGIPIAMPTVLSVT  300

Query  986   MAIGSHRLAQQGAIT  1030
             MAIGSHRLAQQGAIT
Sbjct  301   MAIGSHRLAQQGAIT  315



>ref|XP_002442618.1| hypothetical protein SORBIDRAFT_08g023070 [Sorghum bicolor]
 gb|EES16456.1| hypothetical protein SORBIDRAFT_08g023070 [Sorghum bicolor]
Length=956

 Score =   494 bits (1273),  Expect = 8e-164, Method: Compositional matrix adjust.
 Identities = 286/315 (91%), Positives = 305/315 (97%), Gaps = 0/315 (0%)
 Frame = +2

Query  86    MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
             MAEK   L+AVLKE VDLENIP+EEVFENLRC+++GL++Q AQ+RL+IFG NKLEEK+ES
Sbjct  1     MAEKEGNLEAVLKEAVDLENIPLEEVFENLRCSREGLSTQQAQQRLEIFGPNKLEEKEES  60

Query  266   kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
             KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN
Sbjct  61    KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN  120

Query  446   agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  625
             AGNAAAALMARLAPKAKVLRDGRW+EEDA+ILVPGDI+S+KLGDIIPADARLL+GDPLKI
Sbjct  121   AGNAAAALMARLAPKAKVLRDGRWTEEDAAILVPGDIVSIKLGDIIPADARLLEGDPLKI  180

Query  626   DQSALTGESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF  805
             DQSALTGESLPVTKGPGDG+YSGST KQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF
Sbjct  181   DQSALTGESLPVTKGPGDGVYSGSTVKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF  240

Query  806   QKVLTAIANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVT  985
             QKVLTAI NFCICSIAVGM +EI+VMYPIQHR YRPGIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  241   QKVLTAIGNFCICSIAVGMFVEIIVMYPIQHRAYRPGIDNLLVLLIGGIPIAMPTVLSVT  300

Query  986   MAIGSHRLAQQGAIT  1030
             MAIGSHRL+QQGAIT
Sbjct  301   MAIGSHRLSQQGAIT  315



>ref|NP_001067382.1| Os12g0638700 [Oryza sativa Japonica Group]
 emb|CAD29296.1| plasma membrane H+ ATPase [Oryza sativa Japonica Group]
 gb|ABA99607.1| Plasma membrane ATPase 1, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF30401.1| Os12g0638700 [Oryza sativa Japonica Group]
Length=956

 Score =   494 bits (1272),  Expect = 9e-164, Method: Compositional matrix adjust.
 Identities = 286/315 (91%), Positives = 305/315 (97%), Gaps = 0/315 (0%)
 Frame = +2

Query  86    MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
             MAEK   LDAVLKE VDLENIP+EEVFENLRC+++GLT+Q AQ+RL+IFG NKLEEK+ES
Sbjct  1     MAEKEGNLDAVLKEAVDLENIPLEEVFENLRCSREGLTTQQAQQRLEIFGPNKLEEKEES  60

Query  266   kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
             KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN
Sbjct  61    KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN  120

Query  446   agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  625
             AGNAAAALMARLAPKAKVLRDGRW+EE+A+ILVPGDI+S+KLGDIIPADARLL+GDPLKI
Sbjct  121   AGNAAAALMARLAPKAKVLRDGRWTEEEAAILVPGDIVSIKLGDIIPADARLLEGDPLKI  180

Query  626   DQSALTGESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF  805
             DQSALTGESLPVTKGPGDG+YSGST KQGEIEA+VIATGVHTFFGKAAHLVDSTNQVGHF
Sbjct  181   DQSALTGESLPVTKGPGDGVYSGSTVKQGEIEAIVIATGVHTFFGKAAHLVDSTNQVGHF  240

Query  806   QKVLTAIANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVT  985
             QKVLTAI NFCICSIAVGM +EI+VMYPIQHR YRPGIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  241   QKVLTAIGNFCICSIAVGMFVEIIVMYPIQHRAYRPGIDNLLVLLIGGIPIAMPTVLSVT  300

Query  986   MAIGSHRLAQQGAIT  1030
             MAIGSHRL+QQGAIT
Sbjct  301   MAIGSHRLSQQGAIT  315



>ref|XP_006658357.1| PREDICTED: plasma membrane ATPase 1-like [Oryza brachyantha]
Length=957

 Score =   494 bits (1272),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 285/315 (90%), Positives = 306/315 (97%), Gaps = 0/315 (0%)
 Frame = +2

Query  86    MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
             MAEK + L+AVL E+VDLENIP+EEVFE+LRC ++GLTS  A++RL++FG N+LEEKKES
Sbjct  1     MAEKADNLEAVLNESVDLENIPLEEVFEHLRCNREGLTSANAEQRLNLFGPNRLEEKKES  60

Query  266   kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
             KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLL+INSTISFIEENN
Sbjct  61    KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLIINSTISFIEENN  120

Query  446   agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  625
             AGNAAAALMARLAPKAKVLR+GRWSEE+A+ILVPGDIISVKLGDIIPADARLL+GDPLKI
Sbjct  121   AGNAAAALMARLAPKAKVLRNGRWSEEEAAILVPGDIISVKLGDIIPADARLLEGDPLKI  180

Query  626   DQSALTGESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF  805
             DQSALTGESLPVTKGPGDG+YSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF
Sbjct  181   DQSALTGESLPVTKGPGDGVYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF  240

Query  806   QKVLTAIANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVT  985
             QKVLTAI NFCICSIA+GMV+EI+VMYPIQHR YRPGIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  241   QKVLTAIGNFCICSIAIGMVVEIIVMYPIQHRAYRPGIDNLLVLLIGGIPIAMPTVLSVT  300

Query  986   MAIGSHRLAQQGAIT  1030
             MAIGSHRLAQQGAIT
Sbjct  301   MAIGSHRLAQQGAIT  315



>ref|XP_009398400.1| PREDICTED: plasma membrane ATPase 1 isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=989

 Score =   495 bits (1274),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 283/308 (92%), Positives = 299/308 (97%), Gaps = 0/308 (0%)
 Frame = +2

Query  107   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  286
             +DA+LKE VDLENIP+EEVFENLRCT++GLT+Q A+ERL IFGHNKLEEKKESK LKFLG
Sbjct  13    MDALLKEAVDLENIPLEEVFENLRCTREGLTTQQAEERLAIFGHNKLEEKKESKILKFLG  72

Query  287   fMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaa  466
             FMWNPLSWVMEAAA+MAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENNAGNAAAA
Sbjct  73    FMWNPLSWVMEAAAVMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENNAGNAAAA  132

Query  467   lmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTG  646
             LMARLAPKAKVLRDGRW EE+++ILVPGDIIS+KLGDIIPAD+RLLDGDPLKIDQSALTG
Sbjct  133   LMARLAPKAKVLRDGRWKEEESAILVPGDIISIKLGDIIPADSRLLDGDPLKIDQSALTG  192

Query  647   ESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAI  826
             ESLPVTKGPGDG+YSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAI
Sbjct  193   ESLPVTKGPGDGVYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAI  252

Query  827   ANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR  1006
              NFCICSI VGM +EI+VMYPIQHR YRPGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR
Sbjct  253   GNFCICSIVVGMFVEIIVMYPIQHRAYRPGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR  312

Query  1007  LAQQGAIT  1030
             LAQQGAIT
Sbjct  313   LAQQGAIT  320



>ref|XP_004508787.1| PREDICTED: ATPase 11, plasma membrane-type-like isoform X1 [Cicer 
arietinum]
Length=979

 Score =   495 bits (1274),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 284/313 (91%), Positives = 307/313 (98%), Gaps = 0/313 (0%)
 Frame = +2

Query  92    EKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskf  271
             +KPE+L+AVLKETVDLENIPIEEVFENLRC+++GLTS+ A++RL IFG+NKLEEK+ESKF
Sbjct  5     DKPEMLEAVLKETVDLENIPIEEVFENLRCSREGLTSEGAEQRLTIFGYNKLEEKRESKF  64

Query  272   lkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnag  451
             LKFLGFMWNPLSWVMEAAAIMAIALANGGGK PDWQDFVGIITLL+INSTISFIEENNAG
Sbjct  65    LKFLGFMWNPLSWVMEAAAIMAIALANGGGKAPDWQDFVGIITLLIINSTISFIEENNAG  124

Query  452   naaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQ  631
             NAAAALMARLAPKAKVLRDGRW+E+DA++LVPGDIIS+KLGDI+PADARLL+GDPLKIDQ
Sbjct  125   NAAAALMARLAPKAKVLRDGRWNEQDAAVLVPGDIISIKLGDIVPADARLLEGDPLKIDQ  184

Query  632   SALTGESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQK  811
             SALTGESLPVTKGPGDG+YSGSTCKQGEIE VVIATGVHTFFGKAAHLVD+TNQVGHFQK
Sbjct  185   SALTGESLPVTKGPGDGVYSGSTCKQGEIEGVVIATGVHTFFGKAAHLVDTTNQVGHFQK  244

Query  812   VLTAIANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVTMA  991
             VLTAI NFCICSIAVGM+IEIVVMYPIQHR YRPGIDNLLVLLIGGIPIAMPTVLSVTMA
Sbjct  245   VLTAIGNFCICSIAVGMLIEIVVMYPIQHRPYRPGIDNLLVLLIGGIPIAMPTVLSVTMA  304

Query  992   IGSHRLAQQGAIT  1030
             IGSHRL+QQGAIT
Sbjct  305   IGSHRLSQQGAIT  317



>ref|XP_010228254.1| PREDICTED: plasma membrane ATPase 3-like isoform X2 [Brachypodium 
distachyon]
Length=956

 Score =   494 bits (1272),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 288/315 (91%), Positives = 305/315 (97%), Gaps = 0/315 (0%)
 Frame = +2

Query  86    MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
             M EK   LDAVLKE+VDLENIP+EEVFENLRC+++GL+S  A++RL IFG NKLEEKKES
Sbjct  1     MDEKASNLDAVLKESVDLENIPLEEVFENLRCSREGLSSTQAEQRLAIFGPNKLEEKKES  60

Query  266   kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
             KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLL+INSTISFIEENN
Sbjct  61    KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLIINSTISFIEENN  120

Query  446   agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  625
             AGNAAAALMARLAPKAKVLR+GRW+EE+++ILVPGDIISVKLGDIIPADARLL+GDPLKI
Sbjct  121   AGNAAAALMARLAPKAKVLRNGRWNEEESAILVPGDIISVKLGDIIPADARLLEGDPLKI  180

Query  626   DQSALTGESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF  805
             DQS+LTGESLPVTKGPGDG+YSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF
Sbjct  181   DQSSLTGESLPVTKGPGDGVYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF  240

Query  806   QKVLTAIANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVT  985
             QKVLTAI NFCICSIAVGMVIEIVVMYPIQHR YRPGIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  241   QKVLTAIGNFCICSIAVGMVIEIVVMYPIQHRAYRPGIDNLLVLLIGGIPIAMPTVLSVT  300

Query  986   MAIGSHRLAQQGAIT  1030
             MAIGSHRLAQQGAIT
Sbjct  301   MAIGSHRLAQQGAIT  315



>ref|XP_006290560.1| hypothetical protein CARUB_v10016646mg [Capsella rubella]
 gb|EOA23458.1| hypothetical protein CARUB_v10016646mg [Capsella rubella]
Length=956

 Score =   494 bits (1271),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 285/315 (90%), Positives = 304/315 (97%), Gaps = 0/315 (0%)
 Frame = +2

Query  86    MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
             M +  EVL+AVLKE VDLEN+PIEEVFE LRC+K+GLT+QAA +RL +FGHNKLEEKKES
Sbjct  1     MEDNNEVLEAVLKEAVDLENVPIEEVFETLRCSKEGLTTQAADDRLALFGHNKLEEKKES  60

Query  266   kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
             KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN
Sbjct  61    KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN  120

Query  446   agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  625
             AGNAAAALMARLAPKAKVLRDGRW+E+DA+ILVPGDIIS+KLGDI+PADARLL+GDPLKI
Sbjct  121   AGNAAAALMARLAPKAKVLRDGRWNEQDAAILVPGDIISIKLGDIVPADARLLEGDPLKI  180

Query  626   DQSALTGESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF  805
             DQS LTGESLPVTK PGDG+YSGSTCKQGEIEAVVIATGVHTFFGKAAHLVD+TNQVGHF
Sbjct  181   DQSTLTGESLPVTKSPGDGVYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDTTNQVGHF  240

Query  806   QKVLTAIANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVT  985
             Q+VLTAI NFCICSIAVGM+IEIVVMYPIQHR YRPGIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  241   QQVLTAIGNFCICSIAVGMIIEIVVMYPIQHRAYRPGIDNLLVLLIGGIPIAMPTVLSVT  300

Query  986   MAIGSHRLAQQGAIT  1030
             MAIGSHRL+QQGAIT
Sbjct  301   MAIGSHRLSQQGAIT  315



>dbj|BAA06629.1| plasma membrane H+-ATPase [Oryza sativa Japonica Group]
Length=957

 Score =   493 bits (1270),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 283/315 (90%), Positives = 305/315 (97%), Gaps = 0/315 (0%)
 Frame = +2

Query  86    MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
             MAEK + L+AVL E+VDLENIP+EEVFE+LRC ++GLTS  A++RL++FG N+LEEKKES
Sbjct  1     MAEKGDNLEAVLNESVDLENIPLEEVFEHLRCNREGLTSANAEQRLNLFGLNRLEEKKES  60

Query  266   kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
             KFLKFLGFMWNPLSWVMEAAAIMAI LANGGGKPPDWQDFVGIITLL+INSTISFIEENN
Sbjct  61    KFLKFLGFMWNPLSWVMEAAAIMAIVLANGGGKPPDWQDFVGIITLLIINSTISFIEENN  120

Query  446   agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  625
             AGNAAAALMARLAPKAKVLR+GRWSEE+A+ILVPGDIISVK GDIIPADARLL+GDPLKI
Sbjct  121   AGNAAAALMARLAPKAKVLRNGRWSEEEAAILVPGDIISVKRGDIIPADARLLEGDPLKI  180

Query  626   DQSALTGESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF  805
             DQSALTGESLPVTKGPGDG+YSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF
Sbjct  181   DQSALTGESLPVTKGPGDGVYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF  240

Query  806   QKVLTAIANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVT  985
             QKVLTAI NFCICSIA+GMV+EI+VMYPIQHR+YRPGIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  241   QKVLTAIGNFCICSIAIGMVVEIIVMYPIQHRDYRPGIDNLLVLLIGGIPIAMPTVLSVT  300

Query  986   MAIGSHRLAQQGAIT  1030
             MAIGSHRLAQQGAIT
Sbjct  301   MAIGSHRLAQQGAIT  315



>ref|XP_010228253.1| PREDICTED: plasma membrane ATPase 3-like isoform X1 [Brachypodium 
distachyon]
Length=991

 Score =   494 bits (1272),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 288/315 (91%), Positives = 305/315 (97%), Gaps = 0/315 (0%)
 Frame = +2

Query  86    MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
             M EK   LDAVLKE+VDLENIP+EEVFENLRC+++GL+S  A++RL IFG NKLEEKKES
Sbjct  1     MDEKASNLDAVLKESVDLENIPLEEVFENLRCSREGLSSTQAEQRLAIFGPNKLEEKKES  60

Query  266   kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
             KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLL+INSTISFIEENN
Sbjct  61    KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLIINSTISFIEENN  120

Query  446   agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  625
             AGNAAAALMARLAPKAKVLR+GRW+EE+++ILVPGDIISVKLGDIIPADARLL+GDPLKI
Sbjct  121   AGNAAAALMARLAPKAKVLRNGRWNEEESAILVPGDIISVKLGDIIPADARLLEGDPLKI  180

Query  626   DQSALTGESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF  805
             DQS+LTGESLPVTKGPGDG+YSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF
Sbjct  181   DQSSLTGESLPVTKGPGDGVYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF  240

Query  806   QKVLTAIANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVT  985
             QKVLTAI NFCICSIAVGMVIEIVVMYPIQHR YRPGIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  241   QKVLTAIGNFCICSIAVGMVIEIVVMYPIQHRAYRPGIDNLLVLLIGGIPIAMPTVLSVT  300

Query  986   MAIGSHRLAQQGAIT  1030
             MAIGSHRLAQQGAIT
Sbjct  301   MAIGSHRLAQQGAIT  315



>ref|XP_002318614.1| putative plasma membrane H+ ATPase family protein [Populus trichocarpa]
 gb|EEE96834.1| putative plasma membrane H+ ATPase family protein [Populus trichocarpa]
Length=966

 Score =   493 bits (1270),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 288/325 (89%), Positives = 308/325 (95%), Gaps = 10/325 (3%)
 Frame = +2

Query  86    MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
             M +K EVL+AVLKETVDLENIPIEEV ENLRC+++GLT+QAA+ERL IFGHNKLEEKKE 
Sbjct  1     MGDKGEVLEAVLKETVDLENIPIEEVLENLRCSREGLTTQAAEERLAIFGHNKLEEKKER  60

Query  266   kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
             KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN
Sbjct  61    KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN  120

Query  446   agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  625
             AGNAAAALMARLAPKAKVLRDGRW+E+DA++LVPGDIIS+KLGDIIPADARLL+GDPLKI
Sbjct  121   AGNAAAALMARLAPKAKVLRDGRWNEQDAAVLVPGDIISIKLGDIIPADARLLEGDPLKI  180

Query  626   DQSALTGESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF  805
             DQSALTGESLPVTKGPGDG+YSGSTCKQGEIEAVVIATGVHTFFGKAAHLVD+TNQVGHF
Sbjct  181   DQSALTGESLPVTKGPGDGVYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDTTNQVGHF  240

Query  806   QK----------VLTAIANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIP  955
             QK          VLTAI NFCICSIA+GMVIE++VMYPIQ R+YRPGIDNLLVLLIGGIP
Sbjct  241   QKARRYNCYMIFVLTAIGNFCICSIAIGMVIELIVMYPIQDRKYRPGIDNLLVLLIGGIP  300

Query  956   IAMPTVLSVTMAIGSHRLAQQGAIT  1030
             IAMPTVLSVTMAIGSHRL+QQGAIT
Sbjct  301   IAMPTVLSVTMAIGSHRLSQQGAIT  325



>ref|XP_003525017.1| PREDICTED: ATPase 11, plasma membrane-type-like isoform 1 [Glycine 
max]
 gb|KHN48653.1| ATPase 11, plasma membrane-type [Glycine soja]
Length=955

 Score =   493 bits (1270),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 286/315 (91%), Positives = 306/315 (97%), Gaps = 0/315 (0%)
 Frame = +2

Query  86    MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
             M +K +VL+AVLKETVDLENIPIEEV ENLRC ++GL+S+AA+ERL IFGHNKLEEKKES
Sbjct  1     MGDKSQVLEAVLKETVDLENIPIEEVLENLRCGREGLSSEAAEERLTIFGHNKLEEKKES  60

Query  266   kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
             KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGK PDWQDFVGIITLL+INSTISFIEENN
Sbjct  61    KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKAPDWQDFVGIITLLLINSTISFIEENN  120

Query  446   agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  625
             AGNAAAALMARLAPKAKVLRDGRW+E+DA+ILVPGDIIS+KLGDIIPADARLL+GDPLKI
Sbjct  121   AGNAAAALMARLAPKAKVLRDGRWNEQDAAILVPGDIISIKLGDIIPADARLLEGDPLKI  180

Query  626   DQSALTGESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF  805
             DQSALTGESLPVTKGPGDG+YSGSTCKQGEIEAVVIATGVHTFFGKAAHLVD+TNQVGHF
Sbjct  181   DQSALTGESLPVTKGPGDGVYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDTTNQVGHF  240

Query  806   QKVLTAIANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVT  985
             QKVLTAI NFCICSIA+GMV+EI+VMYPIQ R YRPGIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  241   QKVLTAIGNFCICSIALGMVVEIIVMYPIQDRPYRPGIDNLLVLLIGGIPIAMPTVLSVT  300

Query  986   MAIGSHRLAQQGAIT  1030
             MAIGSHRL+QQGAIT
Sbjct  301   MAIGSHRLSQQGAIT  315



>ref|XP_004963335.1| PREDICTED: plasma membrane ATPase 1-like [Setaria italica]
Length=956

 Score =   493 bits (1269),  Expect = 3e-163, Method: Compositional matrix adjust.
 Identities = 284/315 (90%), Positives = 305/315 (97%), Gaps = 0/315 (0%)
 Frame = +2

Query  86    MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
             MAEK   LDAVLKE VDLENIP+EEVFENLRC+++GL++Q AQ+RL+IFG NKLEEK+ES
Sbjct  1     MAEKEGNLDAVLKEAVDLENIPLEEVFENLRCSREGLSTQQAQQRLEIFGPNKLEEKEES  60

Query  266   kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
             KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN
Sbjct  61    KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN  120

Query  446   agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  625
             AGNAAAALMARLAPKAKVLRDGRW+EE+A+ILVPGD++S+KLGDIIPADARLL+GDPLKI
Sbjct  121   AGNAAAALMARLAPKAKVLRDGRWTEEEAAILVPGDVVSIKLGDIIPADARLLEGDPLKI  180

Query  626   DQSALTGESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF  805
             DQSALTGESLPVTKGPGDG+YSGST KQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF
Sbjct  181   DQSALTGESLPVTKGPGDGVYSGSTVKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF  240

Query  806   QKVLTAIANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVT  985
             QKVLT+I NFCICSIAVGM +EI+VMYPIQHR YRPGIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  241   QKVLTSIGNFCICSIAVGMFVEIIVMYPIQHRAYRPGIDNLLVLLIGGIPIAMPTVLSVT  300

Query  986   MAIGSHRLAQQGAIT  1030
             MAIGSHRL+QQGAIT
Sbjct  301   MAIGSHRLSQQGAIT  315



>emb|CAB41144.1| H+-transporting ATPase-like protein [Arabidopsis thaliana]
Length=960

 Score =   493 bits (1269),  Expect = 3e-163, Method: Compositional matrix adjust.
 Identities = 285/310 (92%), Positives = 302/310 (97%), Gaps = 0/310 (0%)
 Frame = +2

Query  101   EVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkf  280
             EVL+AVLKE VDLEN+PIEEVFENLRC+K+GLT+QAA ERL +FGHNKLEEKKESKFLKF
Sbjct  10    EVLEAVLKEAVDLENVPIEEVFENLRCSKEGLTTQAADERLALFGHNKLEEKKESKFLKF  69

Query  281   lgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaa  460
             LGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENNAGNAA
Sbjct  70    LGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENNAGNAA  129

Query  461   aalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSAL  640
             AALMARLAPKAKVLRDGRW E+DA+ILVPGDIIS+KLGDI+PADARLL+GDPLKIDQSAL
Sbjct  130   AALMARLAPKAKVLRDGRWGEQDAAILVPGDIISIKLGDIVPADARLLEGDPLKIDQSAL  189

Query  641   TGESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLT  820
             TGESLPVTK  GDG+YSGSTCKQGEIEAVVIATGVHTFFGKAAHLVD+TNQ+GHFQ+VLT
Sbjct  190   TGESLPVTKSSGDGVYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDTTNQIGHFQQVLT  249

Query  821   AIANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  1000
             AI NFCICSIAVGM+IEIVVMYPIQHR YRPGIDNLLVLLIGGIPIAMPTVLSVTMAIGS
Sbjct  250   AIGNFCICSIAVGMLIEIVVMYPIQHRAYRPGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  309

Query  1001  HRLAQQGAIT  1030
             HRL+QQGAIT
Sbjct  310   HRLSQQGAIT  319



>ref|XP_008673350.1| PREDICTED: uncharacterized protein LOC100502231 isoform X1 [Zea 
mays]
 tpg|DAA54786.1| TPA: hypothetical protein ZEAMMB73_074525 [Zea mays]
Length=956

 Score =   493 bits (1268),  Expect = 4e-163, Method: Compositional matrix adjust.
 Identities = 285/315 (90%), Positives = 305/315 (97%), Gaps = 0/315 (0%)
 Frame = +2

Query  86    MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
             MAEK   L+AVLKE VDLENIP+EEVFENLRC+++GL+++ AQ+RL+IFG NKLEEK+ES
Sbjct  1     MAEKEGNLEAVLKEAVDLENIPLEEVFENLRCSREGLSTEQAQQRLEIFGPNKLEEKEES  60

Query  266   kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
             KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN
Sbjct  61    KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN  120

Query  446   agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  625
             AGNAAAALMARLAPKAKVLRDGRW+EEDA+ILVPGDI+S+KLGDIIPADARLL+GDPLKI
Sbjct  121   AGNAAAALMARLAPKAKVLRDGRWTEEDAAILVPGDIVSIKLGDIIPADARLLEGDPLKI  180

Query  626   DQSALTGESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF  805
             DQSALTGESLPVTKGPGDG+YSGST KQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF
Sbjct  181   DQSALTGESLPVTKGPGDGVYSGSTVKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF  240

Query  806   QKVLTAIANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVT  985
             QKVLTAI NFCICSIAVGM +EI+VMYPIQHR YRPGIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  241   QKVLTAIGNFCICSIAVGMFVEIIVMYPIQHRAYRPGIDNLLVLLIGGIPIAMPTVLSVT  300

Query  986   MAIGSHRLAQQGAIT  1030
             MAIGSHRL+QQGAIT
Sbjct  301   MAIGSHRLSQQGAIT  315



>ref|NP_190378.2| H(+)-ATPase 4 [Arabidopsis thaliana]
 sp|Q9SU58.2|PMA4_ARATH RecName: Full=ATPase 4, plasma membrane-type; AltName: Full=Proton 
pump 4 [Arabidopsis thaliana]
 dbj|BAC42716.1| putative H+-transporting ATPase [Arabidopsis thaliana]
 gb|AEE78350.1| H(+)-ATPase 4 [Arabidopsis thaliana]
Length=960

 Score =   493 bits (1268),  Expect = 4e-163, Method: Compositional matrix adjust.
 Identities = 285/310 (92%), Positives = 302/310 (97%), Gaps = 0/310 (0%)
 Frame = +2

Query  101   EVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkf  280
             EVL+AVLKE VDLEN+PIEEVFENLRC+K+GLT+QAA ERL +FGHNKLEEKKESKFLKF
Sbjct  10    EVLEAVLKEAVDLENVPIEEVFENLRCSKEGLTTQAADERLALFGHNKLEEKKESKFLKF  69

Query  281   lgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaa  460
             LGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENNAGNAA
Sbjct  70    LGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENNAGNAA  129

Query  461   aalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSAL  640
             AALMARLAPKAKVLRDGRW E+DA+ILVPGDIIS+KLGDI+PADARLL+GDPLKIDQSAL
Sbjct  130   AALMARLAPKAKVLRDGRWGEQDAAILVPGDIISIKLGDIVPADARLLEGDPLKIDQSAL  189

Query  641   TGESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLT  820
             TGESLPVTK  GDG+YSGSTCKQGEIEAVVIATGVHTFFGKAAHLVD+TNQ+GHFQ+VLT
Sbjct  190   TGESLPVTKSSGDGVYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDTTNQIGHFQQVLT  249

Query  821   AIANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  1000
             AI NFCICSIAVGM+IEIVVMYPIQHR YRPGIDNLLVLLIGGIPIAMPTVLSVTMAIGS
Sbjct  250   AIGNFCICSIAVGMLIEIVVMYPIQHRAYRPGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  309

Query  1001  HRLAQQGAIT  1030
             HRL+QQGAIT
Sbjct  310   HRLSQQGAIT  319



>ref|XP_004148685.1| PREDICTED: ATPase 11, plasma membrane-type-like [Cucumis sativus]
Length=956

 Score =   492 bits (1267),  Expect = 7e-163, Method: Compositional matrix adjust.
 Identities = 282/315 (90%), Positives = 301/315 (96%), Gaps = 0/315 (0%)
 Frame = +2

Query  86    MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
             M +K EVL+AV+KE VDLEN+P+EEVF+ LRC K+GLT++AA ERL IFGHNKLEEKKES
Sbjct  1     MGDKDEVLEAVVKEAVDLENVPLEEVFQTLRCNKNGLTTEAAHERLAIFGHNKLEEKKES  60

Query  266   kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
             K LKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLL+INSTISFIEENN
Sbjct  61    KLLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLLINSTISFIEENN  120

Query  446   agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  625
             AGNAAAALMA LAPKAKVLRDG+W EE+AS+LVPGDIISVKLGDIIPADARLL+GDPLKI
Sbjct  121   AGNAAAALMAHLAPKAKVLRDGKWVEEEASVLVPGDIISVKLGDIIPADARLLEGDPLKI  180

Query  626   DQSALTGESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF  805
             DQSALTGESLPVTKGPGD +YSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF
Sbjct  181   DQSALTGESLPVTKGPGDSVYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF  240

Query  806   QKVLTAIANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVT  985
             QKVLTAI NFCICSI VGMV+EI+VMYPIQHR YRPGIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  241   QKVLTAIGNFCICSIVVGMVVEIIVMYPIQHRPYRPGIDNLLVLLIGGIPIAMPTVLSVT  300

Query  986   MAIGSHRLAQQGAIT  1030
             MAIGSHRL++QGAIT
Sbjct  301   MAIGSHRLSEQGAIT  315



>gb|KEH24965.1| plasma membrane H+-ATPase [Medicago truncatula]
Length=951

 Score =   492 bits (1266),  Expect = 7e-163, Method: Compositional matrix adjust.
 Identities = 283/315 (90%), Positives = 302/315 (96%), Gaps = 0/315 (0%)
 Frame = +2

Query  86    MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
             MA+K E + AVL E VDLEN+PIEEVF+ LRC  +GLT++AA+ERL IFGHNKLEEK+ES
Sbjct  1     MADKEEAMHAVLTEAVDLENVPIEEVFQTLRCDSNGLTTKAAEERLAIFGHNKLEEKQES  60

Query  266   kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
             KFLKFLGFMWNPLSWVMEAAAIMAIALANGG KPPDWQDFVGIITLL+INSTISFIEENN
Sbjct  61    KFLKFLGFMWNPLSWVMEAAAIMAIALANGGNKPPDWQDFVGIITLLIINSTISFIEENN  120

Query  446   agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  625
             AGNAAAALMARLAPKAKVLRDGRW EEDASILVPGDIISVKLGDIIPADARLL+GDPLKI
Sbjct  121   AGNAAAALMARLAPKAKVLRDGRWVEEDASILVPGDIISVKLGDIIPADARLLEGDPLKI  180

Query  626   DQSALTGESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF  805
             DQSALTGESLPVTKGPGD +YSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF
Sbjct  181   DQSALTGESLPVTKGPGDSVYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF  240

Query  806   QKVLTAIANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVT  985
             Q+VLT+I NFCICSIA+GM++EI+VMYPIQHR+YRPGIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  241   QQVLTSIGNFCICSIAIGMIVEIIVMYPIQHRKYRPGIDNLLVLLIGGIPIAMPTVLSVT  300

Query  986   MAIGSHRLAQQGAIT  1030
             MAIGSHRLAQQGAIT
Sbjct  301   MAIGSHRLAQQGAIT  315



>ref|XP_004982139.1| PREDICTED: plasma membrane ATPase 1-like [Setaria italica]
Length=954

 Score =   492 bits (1266),  Expect = 8e-163, Method: Compositional matrix adjust.
 Identities = 287/315 (91%), Positives = 302/315 (96%), Gaps = 0/315 (0%)
 Frame = +2

Query  86    MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
             MA+K   LDAVLKE VDLENIP+EEVFENLRC+  GLTS+ AQ+RL IFG NKLEEK+ES
Sbjct  1     MADKEGNLDAVLKEAVDLENIPLEEVFENLRCSHGGLTSEQAQQRLQIFGPNKLEEKEES  60

Query  266   kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
             KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLL+INSTISFIEENN
Sbjct  61    KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLLINSTISFIEENN  120

Query  446   agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  625
             AGNAAAALMARLAPKAKVLRDGRW+EE+A+ILVPGDI+S+KLGDIIPADARLLDGDPLKI
Sbjct  121   AGNAAAALMARLAPKAKVLRDGRWTEEEAAILVPGDIVSIKLGDIIPADARLLDGDPLKI  180

Query  626   DQSALTGESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF  805
             DQSALTGESLPVTKGPGDG+YSGST KQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF
Sbjct  181   DQSALTGESLPVTKGPGDGVYSGSTVKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF  240

Query  806   QKVLTAIANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVT  985
             QKVLTAI NFCICSIAVGM +EI+VMYPIQHR YRPGIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  241   QKVLTAIGNFCICSIAVGMFVEIIVMYPIQHRAYRPGIDNLLVLLIGGIPIAMPTVLSVT  300

Query  986   MAIGSHRLAQQGAIT  1030
             MAIGSHRLAQQGAIT
Sbjct  301   MAIGSHRLAQQGAIT  315



>ref|XP_007037195.1| H(+)-transporting atpase plant/fungi plasma membrane type [Theobroma 
cacao]
 gb|EOY21696.1| H(+)-transporting atpase plant/fungi plasma membrane type [Theobroma 
cacao]
Length=1607

 Score =   507 bits (1305),  Expect = 9e-163, Method: Compositional matrix adjust.
 Identities = 289/315 (92%), Positives = 310/315 (98%), Gaps = 0/315 (0%)
 Frame = +2

Query  86    MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
             M +K EVLDAVLKETVDLENIPIEEVFENLRC+++GLT++AA+ERL IFGHNKLEEKKES
Sbjct  1     MGDKNEVLDAVLKETVDLENIPIEEVFENLRCSREGLTTEAAEERLVIFGHNKLEEKKES  60

Query  266   kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
             KFLK+LGFMWNPLSWVME+AAIMAIALANGGGKPPDWQDFVGIITLL+INSTISFIEENN
Sbjct  61    KFLKYLGFMWNPLSWVMESAAIMAIALANGGGKPPDWQDFVGIITLLLINSTISFIEENN  120

Query  446   agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  625
             AGNAAAALMARLAPKAKVLRDGRWSE+DA+ILVPGD+IS+KLGDIIPADARLL+GDPLKI
Sbjct  121   AGNAAAALMARLAPKAKVLRDGRWSEQDAAILVPGDVISIKLGDIIPADARLLEGDPLKI  180

Query  626   DQSALTGESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF  805
             DQSALTGESLPVTKGPGDG+YSGSTCKQGEIEAVVIATGVHTFFGKAAHLVD+TNQVGHF
Sbjct  181   DQSALTGESLPVTKGPGDGVYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDTTNQVGHF  240

Query  806   QKVLTAIANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVT  985
             QKVLTAI NFCICSIAVGM+IEI+VMYPIQ R+YRPGIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  241   QKVLTAIGNFCICSIAVGMIIEIIVMYPIQDRQYRPGIDNLLVLLIGGIPIAMPTVLSVT  300

Query  986   MAIGSHRLAQQGAIT  1030
             MAIGSHRL+QQGAIT
Sbjct  301   MAIGSHRLSQQGAIT  315



>ref|XP_010029279.1| PREDICTED: ATPase 11, plasma membrane-type-like [Eucalyptus grandis]
 ref|XP_010029280.1| PREDICTED: ATPase 11, plasma membrane-type-like [Eucalyptus grandis]
 gb|KCW56160.1| hypothetical protein EUGRSUZ_I01911 [Eucalyptus grandis]
Length=954

 Score =   492 bits (1266),  Expect = 9e-163, Method: Compositional matrix adjust.
 Identities = 285/315 (90%), Positives = 301/315 (96%), Gaps = 0/315 (0%)
 Frame = +2

Query  86    MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
             M +K   L+AVLKE VDLEN+PI EVF+ LRC  +GLTS+AAQERL IFGHNKLEEK+ES
Sbjct  1     MGDKDVTLEAVLKEAVDLENVPIAEVFQTLRCQPNGLTSEAAQERLAIFGHNKLEEKEES  60

Query  266   kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
             KFLKFLGFMWNPLSWVMEAAAIMAIA+ANGGGKPPDWQDFVGIITLL INSTISFIEENN
Sbjct  61    KFLKFLGFMWNPLSWVMEAAAIMAIAMANGGGKPPDWQDFVGIITLLFINSTISFIEENN  120

Query  446   agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  625
             AGNAAAALMARLAPKAKVLRDG+W EEDASILVPGDIISVKLGDIIPADARLL+GDPLKI
Sbjct  121   AGNAAAALMARLAPKAKVLRDGKWIEEDASILVPGDIISVKLGDIIPADARLLEGDPLKI  180

Query  626   DQSALTGESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF  805
             DQSALTGESLPVTKGPGD +YSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF
Sbjct  181   DQSALTGESLPVTKGPGDSVYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF  240

Query  806   QKVLTAIANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVT  985
             QKVLTAI NFCICSIAVGM++EI+VM+PIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  241   QKVLTAIGNFCICSIAVGMIVEIIVMFPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVT  300

Query  986   MAIGSHRLAQQGAIT  1030
             MAIGSHRL+QQGAIT
Sbjct  301   MAIGSHRLSQQGAIT  315



>gb|KEH24964.1| plasma membrane H+-ATPase [Medicago truncatula]
Length=956

 Score =   491 bits (1265),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 283/315 (90%), Positives = 302/315 (96%), Gaps = 0/315 (0%)
 Frame = +2

Query  86    MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
             MA+K E + AVL E VDLEN+PIEEVF+ LRC  +GLT++AA+ERL IFGHNKLEEK+ES
Sbjct  1     MADKEEAMHAVLTEAVDLENVPIEEVFQTLRCDSNGLTTKAAEERLAIFGHNKLEEKQES  60

Query  266   kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
             KFLKFLGFMWNPLSWVMEAAAIMAIALANGG KPPDWQDFVGIITLL+INSTISFIEENN
Sbjct  61    KFLKFLGFMWNPLSWVMEAAAIMAIALANGGNKPPDWQDFVGIITLLIINSTISFIEENN  120

Query  446   agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  625
             AGNAAAALMARLAPKAKVLRDGRW EEDASILVPGDIISVKLGDIIPADARLL+GDPLKI
Sbjct  121   AGNAAAALMARLAPKAKVLRDGRWVEEDASILVPGDIISVKLGDIIPADARLLEGDPLKI  180

Query  626   DQSALTGESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF  805
             DQSALTGESLPVTKGPGD +YSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF
Sbjct  181   DQSALTGESLPVTKGPGDSVYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF  240

Query  806   QKVLTAIANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVT  985
             Q+VLT+I NFCICSIA+GM++EI+VMYPIQHR+YRPGIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  241   QQVLTSIGNFCICSIAIGMIVEIIVMYPIQHRKYRPGIDNLLVLLIGGIPIAMPTVLSVT  300

Query  986   MAIGSHRLAQQGAIT  1030
             MAIGSHRLAQQGAIT
Sbjct  301   MAIGSHRLAQQGAIT  315



>ref|XP_006664787.1| PREDICTED: plasma membrane ATPase 1-like [Oryza brachyantha]
Length=956

 Score =   491 bits (1265),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 285/315 (90%), Positives = 304/315 (97%), Gaps = 0/315 (0%)
 Frame = +2

Query  86    MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
             MAEK   LDAVLKE VDLENIP+EEVFENLRC+++GLT+Q AQ+RL+IFG NKLEEK+ES
Sbjct  1     MAEKEGNLDAVLKEAVDLENIPLEEVFENLRCSREGLTTQQAQQRLEIFGPNKLEEKEES  60

Query  266   kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
             KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN
Sbjct  61    KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN  120

Query  446   agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  625
             AGNAAAALMARLAPKAKVLRDGRW+EE+A+ILVPGDI+S+KLGDIIPADARLL+GDPLKI
Sbjct  121   AGNAAAALMARLAPKAKVLRDGRWTEEEAAILVPGDIVSIKLGDIIPADARLLEGDPLKI  180

Query  626   DQSALTGESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF  805
             DQSALTGESLPVTKG GDG+YSGST KQGEIEA+VIATGVHTFFGKAAHLVDSTNQVGHF
Sbjct  181   DQSALTGESLPVTKGAGDGVYSGSTVKQGEIEAIVIATGVHTFFGKAAHLVDSTNQVGHF  240

Query  806   QKVLTAIANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVT  985
             QKVLTAI NFCICSIAVGM +EI+VMYPIQHR YRPGIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  241   QKVLTAIGNFCICSIAVGMFVEIIVMYPIQHRAYRPGIDNLLVLLIGGIPIAMPTVLSVT  300

Query  986   MAIGSHRLAQQGAIT  1030
             MAIGSHRL+QQGAIT
Sbjct  301   MAIGSHRLSQQGAIT  315



>gb|KCW56159.1| hypothetical protein EUGRSUZ_I01911 [Eucalyptus grandis]
Length=963

 Score =   491 bits (1265),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 285/315 (90%), Positives = 301/315 (96%), Gaps = 0/315 (0%)
 Frame = +2

Query  86    MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
             M +K   L+AVLKE VDLEN+PI EVF+ LRC  +GLTS+AAQERL IFGHNKLEEK+ES
Sbjct  1     MGDKDVTLEAVLKEAVDLENVPIAEVFQTLRCQPNGLTSEAAQERLAIFGHNKLEEKEES  60

Query  266   kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
             KFLKFLGFMWNPLSWVMEAAAIMAIA+ANGGGKPPDWQDFVGIITLL INSTISFIEENN
Sbjct  61    KFLKFLGFMWNPLSWVMEAAAIMAIAMANGGGKPPDWQDFVGIITLLFINSTISFIEENN  120

Query  446   agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  625
             AGNAAAALMARLAPKAKVLRDG+W EEDASILVPGDIISVKLGDIIPADARLL+GDPLKI
Sbjct  121   AGNAAAALMARLAPKAKVLRDGKWIEEDASILVPGDIISVKLGDIIPADARLLEGDPLKI  180

Query  626   DQSALTGESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF  805
             DQSALTGESLPVTKGPGD +YSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF
Sbjct  181   DQSALTGESLPVTKGPGDSVYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF  240

Query  806   QKVLTAIANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVT  985
             QKVLTAI NFCICSIAVGM++EI+VM+PIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  241   QKVLTAIGNFCICSIAVGMIVEIIVMFPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVT  300

Query  986   MAIGSHRLAQQGAIT  1030
             MAIGSHRL+QQGAIT
Sbjct  301   MAIGSHRLSQQGAIT  315



>ref|XP_003549657.1| PREDICTED: ATPase 11, plasma membrane-type-like [Glycine max]
 gb|KHN18516.1| ATPase 11, plasma membrane-type [Glycine soja]
Length=955

 Score =   491 bits (1264),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 286/315 (91%), Positives = 305/315 (97%), Gaps = 0/315 (0%)
 Frame = +2

Query  86    MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
             M +K +VL+AVLKETVDLENIPIEEV ENLRC ++GL+S+AA+ERL IFGHNKLEEKKES
Sbjct  1     MGDKSQVLEAVLKETVDLENIPIEEVLENLRCGREGLSSEAAEERLTIFGHNKLEEKKES  60

Query  266   kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
             KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGK PDWQDFVGIITLL+INSTISFIEENN
Sbjct  61    KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKAPDWQDFVGIITLLLINSTISFIEENN  120

Query  446   agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  625
             AGNAAAALMARLAPKAKVLRDGRW+E+DA++LVPGDIIS+KLGDIIPADARLL+GDPLKI
Sbjct  121   AGNAAAALMARLAPKAKVLRDGRWNEQDAAVLVPGDIISIKLGDIIPADARLLEGDPLKI  180

Query  626   DQSALTGESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF  805
             DQSALTGESLPVTKGPGDG+YSGSTCKQGEIEAVVIATGVHTFFGKAAHLVD+TNQVGHF
Sbjct  181   DQSALTGESLPVTKGPGDGVYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDTTNQVGHF  240

Query  806   QKVLTAIANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVT  985
             QKVLTAI NFCICSIA+GMVIEI+VMYPIQ R YR GIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  241   QKVLTAIGNFCICSIALGMVIEIIVMYPIQDRPYRSGIDNLLVLLIGGIPIAMPTVLSVT  300

Query  986   MAIGSHRLAQQGAIT  1030
             MAIGSHRLAQQGAIT
Sbjct  301   MAIGSHRLAQQGAIT  315



>gb|KJB33644.1| hypothetical protein B456_006G023600 [Gossypium raimondii]
Length=811

 Score =   486 bits (1250),  Expect = 4e-162, Method: Compositional matrix adjust.
 Identities = 279/315 (89%), Positives = 298/315 (95%), Gaps = 0/315 (0%)
 Frame = +2

Query  86    MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
             M  K E +DAVLKE VDLEN+P+EEVF+ LRC +DGLT++AA++RL IFG+NKLEEK+ES
Sbjct  1     MENKDETMDAVLKEAVDLENVPLEEVFQTLRCNRDGLTTEAAEQRLSIFGYNKLEEKQES  60

Query  266   kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
             K LKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLL INSTISFIEENN
Sbjct  61    KILKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLTINSTISFIEENN  120

Query  446   agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  625
             AGNAAAALMARLAPKAKV RDG+WSEE+ASILVPGDIIS+KLGDIIPADARLLDGDPLKI
Sbjct  121   AGNAAAALMARLAPKAKVFRDGKWSEEEASILVPGDIISIKLGDIIPADARLLDGDPLKI  180

Query  626   DQSALTGESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF  805
             DQS+LTGESLPVTKGPGD IYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQ GHF
Sbjct  181   DQSSLTGESLPVTKGPGDSIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQQGHF  240

Query  806   QKVLTAIANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVT  985
             QKVLTAI NFCICSIAVGM+ EI+VMYPIQ R+YRPGIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  241   QKVLTAIGNFCICSIAVGMITEIIVMYPIQDRDYRPGIDNLLVLLIGGIPIAMPTVLSVT  300

Query  986   MAIGSHRLAQQGAIT  1030
             MAIGSHRL+ QGAIT
Sbjct  301   MAIGSHRLSLQGAIT  315



>gb|KHN34200.1| ATPase 11, plasma membrane-type [Glycine soja]
Length=956

 Score =   490 bits (1261),  Expect = 5e-162, Method: Compositional matrix adjust.
 Identities = 283/315 (90%), Positives = 299/315 (95%), Gaps = 0/315 (0%)
 Frame = +2

Query  86    MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
             MAEK E +  VLKE VDLEN+P+EEVF+ LRC  +GLT+++A+ERL IFGHNKLEEKKES
Sbjct  1     MAEKEEAMRVVLKEAVDLENVPLEEVFQTLRCDSNGLTTESAEERLAIFGHNKLEEKKES  60

Query  266   kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
             K LKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLL+INSTISFIEENN
Sbjct  61    KVLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLIINSTISFIEENN  120

Query  446   agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  625
             AGNAAAALMARLAPKAK LRDG+W EEDASILVPGDIISVKLGDIIPADARLL+GDPLKI
Sbjct  121   AGNAAAALMARLAPKAKFLRDGKWVEEDASILVPGDIISVKLGDIIPADARLLEGDPLKI  180

Query  626   DQSALTGESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF  805
             DQSALTGESLPVTKG GD +YSGSTCKQGEI AVVIATGVHTFFGKAAHLVDSTNQVGHF
Sbjct  181   DQSALTGESLPVTKGHGDSVYSGSTCKQGEINAVVIATGVHTFFGKAAHLVDSTNQVGHF  240

Query  806   QKVLTAIANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVT  985
             QKVLTAI NFCICSIAVGM++EI+VMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  241   QKVLTAIGNFCICSIAVGMIVEIIVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVT  300

Query  986   MAIGSHRLAQQGAIT  1030
             MAIGSHRLAQQGAIT
Sbjct  301   MAIGSHRLAQQGAIT  315



>ref|XP_003554288.1| PREDICTED: plasma membrane ATPase 1-like [Glycine max]
Length=956

 Score =   489 bits (1260),  Expect = 5e-162, Method: Compositional matrix adjust.
 Identities = 283/315 (90%), Positives = 299/315 (95%), Gaps = 0/315 (0%)
 Frame = +2

Query  86    MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
             MAEK E +  VLKE VDLEN+P+EEVF+ LRC  +GLT+++A+ERL IFGHNKLEEKKES
Sbjct  1     MAEKEEAMRVVLKEAVDLENVPLEEVFQTLRCDSNGLTTESAEERLAIFGHNKLEEKKES  60

Query  266   kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
             K LKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLL+INSTISFIEENN
Sbjct  61    KVLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLIINSTISFIEENN  120

Query  446   agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  625
             AGNAAAALMARLAPKAK LRDG+W EEDASILVPGDIISVKLGDIIPADARLL+GDPLKI
Sbjct  121   AGNAAAALMARLAPKAKFLRDGKWVEEDASILVPGDIISVKLGDIIPADARLLEGDPLKI  180

Query  626   DQSALTGESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF  805
             DQSALTGESLPVTKG GD +YSGSTCKQGEI AVVIATGVHTFFGKAAHLVDSTNQVGHF
Sbjct  181   DQSALTGESLPVTKGHGDSVYSGSTCKQGEINAVVIATGVHTFFGKAAHLVDSTNQVGHF  240

Query  806   QKVLTAIANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVT  985
             QKVLTAI NFCICSIAVGM++EI+VMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  241   QKVLTAIGNFCICSIAVGMIVEIIVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVT  300

Query  986   MAIGSHRLAQQGAIT  1030
             MAIGSHRLAQQGAIT
Sbjct  301   MAIGSHRLAQQGAIT  315



>ref|XP_009417143.1| PREDICTED: plasma membrane ATPase 1-like [Musa acuminata subsp. 
malaccensis]
Length=955

 Score =   489 bits (1259),  Expect = 8e-162, Method: Compositional matrix adjust.
 Identities = 285/315 (90%), Positives = 302/315 (96%), Gaps = 0/315 (0%)
 Frame = +2

Query  86    MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
             MA+K   ++AVLKE VDLENIP+EEVFENLRC ++GLT++ AQ+RL+IFG NKLEEKKES
Sbjct  1     MADKSVDMEAVLKEAVDLENIPLEEVFENLRCGREGLTAEQAQQRLEIFGPNKLEEKKES  60

Query  266   kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
             K LKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN
Sbjct  61    KVLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN  120

Query  446   agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  625
             AGNAAAALMARLAPKAKVLR G+WSEE+A+ILVPGDIIS+KLGDIIPADARLL GDPLKI
Sbjct  121   AGNAAAALMARLAPKAKVLRGGKWSEEEAAILVPGDIISIKLGDIIPADARLLGGDPLKI  180

Query  626   DQSALTGESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF  805
             DQSALTGESLPVTKGPGDG+YSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF
Sbjct  181   DQSALTGESLPVTKGPGDGVYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF  240

Query  806   QKVLTAIANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVT  985
             QKVLTAI NFCICSIAVGM IEI+VMYPIQHR YRPGIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  241   QKVLTAIGNFCICSIAVGMFIEIIVMYPIQHRAYRPGIDNLLVLLIGGIPIAMPTVLSVT  300

Query  986   MAIGSHRLAQQGAIT  1030
             MAIGSHRL+QQGAIT
Sbjct  301   MAIGSHRLSQQGAIT  315



>ref|XP_007151191.1| hypothetical protein PHAVU_004G025700g [Phaseolus vulgaris]
 gb|ESW23185.1| hypothetical protein PHAVU_004G025700g [Phaseolus vulgaris]
Length=956

 Score =   489 bits (1259),  Expect = 9e-162, Method: Compositional matrix adjust.
 Identities = 279/315 (89%), Positives = 301/315 (96%), Gaps = 0/315 (0%)
 Frame = +2

Query  86    MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
             MA+K E + AVLKE VDLEN+P+EEVF+ LRC  +GLT+++A+ERL IFGHNKLEEK+ES
Sbjct  1     MADKEEAMHAVLKEAVDLENVPLEEVFQTLRCDSNGLTTKSAEERLSIFGHNKLEEKQES  60

Query  266   kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
             K LKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLL+INSTISFIEENN
Sbjct  61    KVLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLIINSTISFIEENN  120

Query  446   agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  625
             AGNAAAALMARLAPKAKVLRDG+W EEDA +LVPGDI+SVKLGDIIPAD+RLL+GDPLKI
Sbjct  121   AGNAAAALMARLAPKAKVLRDGKWIEEDACVLVPGDIVSVKLGDIIPADSRLLEGDPLKI  180

Query  626   DQSALTGESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF  805
             DQSALTGESLPVTKGPGD +YSGSTCKQGEI AVVIATGVHTFFGKAAHLVDSTNQVGHF
Sbjct  181   DQSALTGESLPVTKGPGDSVYSGSTCKQGEINAVVIATGVHTFFGKAAHLVDSTNQVGHF  240

Query  806   QKVLTAIANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVT  985
             QKVLTAI NFCICSIA+GM+IEI+VMYPIQHR+YRPGIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  241   QKVLTAIGNFCICSIALGMIIEIIVMYPIQHRQYRPGIDNLLVLLIGGIPIAMPTVLSVT  300

Query  986   MAIGSHRLAQQGAIT  1030
             MAIGSHRLAQQGAIT
Sbjct  301   MAIGSHRLAQQGAIT  315



>gb|KDO72464.1| hypothetical protein CISIN_1g0021762mg [Citrus sinensis]
Length=875

 Score =   487 bits (1253),  Expect = 9e-162, Method: Compositional matrix adjust.
 Identities = 277/315 (88%), Positives = 300/315 (95%), Gaps = 0/315 (0%)
 Frame = +2

Query  86    MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
             M  K E ++AVLKE VDLEN+P+EEVFE LRC K+GL+++AA+ERL IFG+NKLEEK+ES
Sbjct  1     MDSKAETMEAVLKEAVDLENVPMEEVFETLRCNKEGLSTEAAEERLTIFGYNKLEEKQES  60

Query  266   kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
             K LKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGI+TLL+INSTISFIEENN
Sbjct  61    KILKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIVTLLLINSTISFIEENN  120

Query  446   agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  625
             AGNAAAALMA LAPK+KVLRDG+W EEDA+ILVPGDIISVKLGDIIPADARLL+GDPLKI
Sbjct  121   AGNAAAALMASLAPKSKVLRDGKWMEEDAAILVPGDIISVKLGDIIPADARLLEGDPLKI  180

Query  626   DQSALTGESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF  805
             DQSALTGESLPVTKGPGD +YSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQ GHF
Sbjct  181   DQSALTGESLPVTKGPGDSVYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQQGHF  240

Query  806   QKVLTAIANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVT  985
             QKVLTAI NFCICSIAVGM++EI+VMYPIQHR+YRPGIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  241   QKVLTAIGNFCICSIAVGMIVEIIVMYPIQHRKYRPGIDNLLVLLIGGIPIAMPTVLSVT  300

Query  986   MAIGSHRLAQQGAIT  1030
             MAIGSHRL+ QGAIT
Sbjct  301   MAIGSHRLSLQGAIT  315



>ref|XP_007032428.1| H(+)-ATPase 4 isoform 2 [Theobroma cacao]
 gb|EOY03354.1| H(+)-ATPase 4 isoform 2 [Theobroma cacao]
Length=956

 Score =   489 bits (1258),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 283/315 (90%), Positives = 297/315 (94%), Gaps = 0/315 (0%)
 Frame = +2

Query  86    MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
             M    E LDAVLKE VDLEN+P+EEVF+ LRC KDGLT++AA++RL IFG+NKLEEKKES
Sbjct  1     MENNNETLDAVLKEAVDLENVPLEEVFQTLRCNKDGLTTEAAEQRLAIFGYNKLEEKKES  60

Query  266   kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
             K LKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLL INSTISFIEENN
Sbjct  61    KILKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLFINSTISFIEENN  120

Query  446   agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  625
             AGNAAAALMARLAPKAKV RDG+W EEDA+ILVPGDIIS+KLGDIIPADARLLDGDPLKI
Sbjct  121   AGNAAAALMARLAPKAKVFRDGKWIEEDAAILVPGDIISIKLGDIIPADARLLDGDPLKI  180

Query  626   DQSALTGESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF  805
             DQSALTGESLPVTKGPGD IYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQ GHF
Sbjct  181   DQSALTGESLPVTKGPGDSIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQQGHF  240

Query  806   QKVLTAIANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVT  985
             QKVLTAI NFCICSIAVGM+ EI+VMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  241   QKVLTAIGNFCICSIAVGMITEIIVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVT  300

Query  986   MAIGSHRLAQQGAIT  1030
             MAIGSHRL+ QGAIT
Sbjct  301   MAIGSHRLSLQGAIT  315



>ref|XP_008644894.1| PREDICTED: uncharacterized protein LOC100383411 isoform X1 [Zea 
mays]
Length=954

 Score =   488 bits (1256),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 283/315 (90%), Positives = 301/315 (96%), Gaps = 0/315 (0%)
 Frame = +2

Query  86    MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
             MA+    LDAVLKE VDLENIP+EEVFENLRC++ GLTS+ AQ+RL +FG NKLEEK+ES
Sbjct  1     MADNEGTLDAVLKEAVDLENIPLEEVFENLRCSRGGLTSEQAQQRLQLFGPNKLEEKEES  60

Query  266   kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
             KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLL+INSTISFIEENN
Sbjct  61    KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLLINSTISFIEENN  120

Query  446   agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  625
             AGNAAAALMARLAPKAKVLRDGRW+EE+A++LVPGD+IS+KLGDIIPADARLLDGDPLKI
Sbjct  121   AGNAAAALMARLAPKAKVLRDGRWAEEEAAVLVPGDVISIKLGDIIPADARLLDGDPLKI  180

Query  626   DQSALTGESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF  805
             DQS+LTGESLPVTKGPGDG YSGST KQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF
Sbjct  181   DQSSLTGESLPVTKGPGDGAYSGSTVKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF  240

Query  806   QKVLTAIANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVT  985
             QKVLTAI NFCICSIAVGM +EI+VMYPIQHR YRPGIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  241   QKVLTAIGNFCICSIAVGMFVEIIVMYPIQHRAYRPGIDNLLVLLIGGIPIAMPTVLSVT  300

Query  986   MAIGSHRLAQQGAIT  1030
             MAIGSHRLAQQGAIT
Sbjct  301   MAIGSHRLAQQGAIT  315



>gb|KDO72462.1| hypothetical protein CISIN_1g0021762mg, partial [Citrus sinensis]
 gb|KDO72463.1| hypothetical protein CISIN_1g0021762mg, partial [Citrus sinensis]
Length=924

 Score =   487 bits (1254),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 277/315 (88%), Positives = 300/315 (95%), Gaps = 0/315 (0%)
 Frame = +2

Query  86    MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
             M  K E ++AVLKE VDLEN+P+EEVFE LRC K+GL+++AA+ERL IFG+NKLEEK+ES
Sbjct  1     MDSKAETMEAVLKEAVDLENVPMEEVFETLRCNKEGLSTEAAEERLTIFGYNKLEEKQES  60

Query  266   kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
             K LKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGI+TLL+INSTISFIEENN
Sbjct  61    KILKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIVTLLLINSTISFIEENN  120

Query  446   agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  625
             AGNAAAALMA LAPK+KVLRDG+W EEDA+ILVPGDIISVKLGDIIPADARLL+GDPLKI
Sbjct  121   AGNAAAALMASLAPKSKVLRDGKWMEEDAAILVPGDIISVKLGDIIPADARLLEGDPLKI  180

Query  626   DQSALTGESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF  805
             DQSALTGESLPVTKGPGD +YSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQ GHF
Sbjct  181   DQSALTGESLPVTKGPGDSVYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQQGHF  240

Query  806   QKVLTAIANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVT  985
             QKVLTAI NFCICSIAVGM++EI+VMYPIQHR+YRPGIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  241   QKVLTAIGNFCICSIAVGMIVEIIVMYPIQHRKYRPGIDNLLVLLIGGIPIAMPTVLSVT  300

Query  986   MAIGSHRLAQQGAIT  1030
             MAIGSHRL+ QGAIT
Sbjct  301   MAIGSHRLSLQGAIT  315



>emb|CDY45757.1| BnaC02g42250D [Brassica napus]
Length=962

 Score =   488 bits (1257),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 285/321 (89%), Positives = 306/321 (95%), Gaps = 6/321 (2%)
 Frame = +2

Query  86    MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
             M +K EVL+AVLKETVDLEN+ IEEVFE+LRC+++GLT+ AA ERL +FGHNKLEEKKES
Sbjct  1     MGDKEEVLEAVLKETVDLENVAIEEVFESLRCSREGLTTAAADERLALFGHNKLEEKKES  60

Query  266   kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
             KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN
Sbjct  61    KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN  120

Query  446   agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  625
             AGNAAAALMARLAPKAKVLRDGRW E+DA+ILVPGDIIS+KLGDI+PADARLL+GDPLKI
Sbjct  121   AGNAAAALMARLAPKAKVLRDGRWGEQDAAILVPGDIISIKLGDIVPADARLLEGDPLKI  180

Query  626   DQSALTGESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF  805
             DQS+LTGESLPVTKGPGDG+YSGSTCKQGE+EAVVIATGVHTFFGKAAHLVD+TNQVGHF
Sbjct  181   DQSSLTGESLPVTKGPGDGVYSGSTCKQGELEAVVIATGVHTFFGKAAHLVDTTNQVGHF  240

Query  806   QK------VLTAIANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMP  967
             Q+      VLTAI NFCICSIAVGM+IEIVVMYPIQHR YRPGIDNLLVLLIGGIPIAMP
Sbjct  241   QQASILHMVLTAIGNFCICSIAVGMLIEIVVMYPIQHRAYRPGIDNLLVLLIGGIPIAMP  300

Query  968   TVLSVTMAIGSHRLAQQGAIT  1030
             TVLSVTMAIGSHRL+QQGAIT
Sbjct  301   TVLSVTMAIGSHRLSQQGAIT  321



>ref|XP_007032427.1| H(+)-ATPase 4 isoform 1 [Theobroma cacao]
 gb|EOY03353.1| H(+)-ATPase 4 isoform 1 [Theobroma cacao]
Length=994

 Score =   489 bits (1259),  Expect = 3e-161, Method: Compositional matrix adjust.
 Identities = 283/315 (90%), Positives = 297/315 (94%), Gaps = 0/315 (0%)
 Frame = +2

Query  86    MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
             M    E LDAVLKE VDLEN+P+EEVF+ LRC KDGLT++AA++RL IFG+NKLEEKKES
Sbjct  1     MENNNETLDAVLKEAVDLENVPLEEVFQTLRCNKDGLTTEAAEQRLAIFGYNKLEEKKES  60

Query  266   kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
             K LKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLL INSTISFIEENN
Sbjct  61    KILKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLFINSTISFIEENN  120

Query  446   agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  625
             AGNAAAALMARLAPKAKV RDG+W EEDA+ILVPGDIIS+KLGDIIPADARLLDGDPLKI
Sbjct  121   AGNAAAALMARLAPKAKVFRDGKWIEEDAAILVPGDIISIKLGDIIPADARLLDGDPLKI  180

Query  626   DQSALTGESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF  805
             DQSALTGESLPVTKGPGD IYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQ GHF
Sbjct  181   DQSALTGESLPVTKGPGDSIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQQGHF  240

Query  806   QKVLTAIANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVT  985
             QKVLTAI NFCICSIAVGM+ EI+VMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  241   QKVLTAIGNFCICSIAVGMITEIIVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVT  300

Query  986   MAIGSHRLAQQGAIT  1030
             MAIGSHRL+ QGAIT
Sbjct  301   MAIGSHRLSLQGAIT  315



>ref|XP_006482527.1| PREDICTED: plasma membrane ATPase 1-like [Citrus sinensis]
Length=956

 Score =   488 bits (1255),  Expect = 3e-161, Method: Compositional matrix adjust.
 Identities = 278/315 (88%), Positives = 300/315 (95%), Gaps = 0/315 (0%)
 Frame = +2

Query  86    MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
             M  K E ++AVLKE VDLEN+P+EEVFE LRC K+GL+++AA+ERL IFG+NKLEEK+ES
Sbjct  1     MDSKAETMEAVLKEAVDLENVPMEEVFETLRCNKEGLSTEAAEERLTIFGYNKLEEKQES  60

Query  266   kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
             K LKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLL+INSTISFIEENN
Sbjct  61    KILKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLLINSTISFIEENN  120

Query  446   agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  625
             AGNAAAALMA LAPK+KVLRDG+W EEDA+ILVPGDIISVKLGDIIPADARLL+GDPLKI
Sbjct  121   AGNAAAALMASLAPKSKVLRDGKWMEEDAAILVPGDIISVKLGDIIPADARLLEGDPLKI  180

Query  626   DQSALTGESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF  805
             DQSALTGESLPVTKGPGD +YSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQ GHF
Sbjct  181   DQSALTGESLPVTKGPGDSVYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQQGHF  240

Query  806   QKVLTAIANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVT  985
             QKVLTAI NFCICSIAVGM++EI+VMYPIQHR+YRPGIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  241   QKVLTAIGNFCICSIAVGMIVEIIVMYPIQHRKYRPGIDNLLVLLIGGIPIAMPTVLSVT  300

Query  986   MAIGSHRLAQQGAIT  1030
             MAIGSHRL+ QGAIT
Sbjct  301   MAIGSHRLSLQGAIT  315



>ref|XP_003561110.1| PREDICTED: plasma membrane ATPase 1-like [Brachypodium distachyon]
Length=956

 Score =   488 bits (1255),  Expect = 4e-161, Method: Compositional matrix adjust.
 Identities = 283/315 (90%), Positives = 302/315 (96%), Gaps = 0/315 (0%)
 Frame = +2

Query  86    MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
             MA+K   LDAVLKE VDLENIP++EVFENLRC ++GLTSQ AQ+RL IFG NKLEEK+ES
Sbjct  1     MADKEGNLDAVLKEVVDLENIPVDEVFENLRCGREGLTSQQAQQRLQIFGPNKLEEKEES  60

Query  266   kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
             KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLL+INSTISFIEENN
Sbjct  61    KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLLINSTISFIEENN  120

Query  446   agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  625
             AGNAAAALMARLAPKAKVLRDGRW+EE+A++LVPGDIIS+KLGDIIPADARLLDGDPLKI
Sbjct  121   AGNAAAALMARLAPKAKVLRDGRWTEEEAAVLVPGDIISIKLGDIIPADARLLDGDPLKI  180

Query  626   DQSALTGESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF  805
             DQSALTGESLP TKGPGDG+YSGST KQGEI+AVVIATGVHTFFGKAAHLVDSTNQVGHF
Sbjct  181   DQSALTGESLPATKGPGDGVYSGSTVKQGEIKAVVIATGVHTFFGKAAHLVDSTNQVGHF  240

Query  806   QKVLTAIANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVT  985
             Q+VLTAI NFCICSIAVGM +EI+VMYPIQHR YRPGIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  241   QQVLTAIGNFCICSIAVGMFVEIIVMYPIQHRAYRPGIDNLLVLLIGGIPIAMPTVLSVT  300

Query  986   MAIGSHRLAQQGAIT  1030
             MAIGSHRL+QQGAIT
Sbjct  301   MAIGSHRLSQQGAIT  315



>ref|XP_006431062.1| hypothetical protein CICLE_v10011000mg [Citrus clementina]
 gb|ESR44302.1| hypothetical protein CICLE_v10011000mg [Citrus clementina]
Length=956

 Score =   488 bits (1255),  Expect = 4e-161, Method: Compositional matrix adjust.
 Identities = 277/315 (88%), Positives = 300/315 (95%), Gaps = 0/315 (0%)
 Frame = +2

Query  86    MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
             M  K E ++AVLKE VDLEN+P+EEVFE LRC K+GL+++AA+ERL IFG+NKLEEK+ES
Sbjct  1     MDSKAETMEAVLKEAVDLENVPMEEVFETLRCNKEGLSTEAAEERLTIFGYNKLEEKQES  60

Query  266   kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
             K LKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGI+TLL+INSTISFIEENN
Sbjct  61    KILKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIVTLLLINSTISFIEENN  120

Query  446   agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  625
             AGNAAAALMA LAPK+KVLRDG+W EEDA+ILVPGDIISVKLGDIIPADARLL+GDPLKI
Sbjct  121   AGNAAAALMASLAPKSKVLRDGKWMEEDAAILVPGDIISVKLGDIIPADARLLEGDPLKI  180

Query  626   DQSALTGESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF  805
             DQSALTGESLPVTKGPGD +YSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQ GHF
Sbjct  181   DQSALTGESLPVTKGPGDSVYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQQGHF  240

Query  806   QKVLTAIANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVT  985
             QKVLTAI NFCICSIAVGM++EI+VMYPIQHR+YRPGIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  241   QKVLTAIGNFCICSIAVGMIVEIIVMYPIQHRKYRPGIDNLLVLLIGGIPIAMPTVLSVT  300

Query  986   MAIGSHRLAQQGAIT  1030
             MAIGSHRL+ QGAIT
Sbjct  301   MAIGSHRLSLQGAIT  315



>ref|XP_008459294.1| PREDICTED: ATPase 11, plasma membrane-type-like [Cucumis melo]
Length=956

 Score =   487 bits (1254),  Expect = 4e-161, Method: Compositional matrix adjust.
 Identities = 280/315 (89%), Positives = 300/315 (95%), Gaps = 0/315 (0%)
 Frame = +2

Query  86    MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
             M +K EVL+AV+KE VDLEN+P+EEVF+ LRC K+GLT++AA ERL IFG NKLEEKKES
Sbjct  1     MGDKDEVLEAVVKEAVDLENVPLEEVFQTLRCNKNGLTTEAAHERLAIFGQNKLEEKKES  60

Query  266   kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
             K LKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLL+INSTISFIEENN
Sbjct  61    KVLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLLINSTISFIEENN  120

Query  446   agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  625
             AGNAAAALMA LAPKAKVLRDG+W EE+AS+LVPGDIISVKLGDIIPADARLL+GDPLKI
Sbjct  121   AGNAAAALMAHLAPKAKVLRDGKWVEEEASVLVPGDIISVKLGDIIPADARLLEGDPLKI  180

Query  626   DQSALTGESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF  805
             DQSALTGESLPVTKGPGD +YSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF
Sbjct  181   DQSALTGESLPVTKGPGDSVYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF  240

Query  806   QKVLTAIANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVT  985
             QKVLTAI NFCICSI VGM++EI+VMYPIQHR YRPGIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  241   QKVLTAIGNFCICSIVVGMIVEIIVMYPIQHRPYRPGIDNLLVLLIGGIPIAMPTVLSVT  300

Query  986   MAIGSHRLAQQGAIT  1030
             MAIGSHRL++QGAIT
Sbjct  301   MAIGSHRLSEQGAIT  315



>gb|KJB33643.1| hypothetical protein B456_006G023600 [Gossypium raimondii]
Length=871

 Score =   484 bits (1247),  Expect = 7e-161, Method: Compositional matrix adjust.
 Identities = 279/315 (89%), Positives = 298/315 (95%), Gaps = 0/315 (0%)
 Frame = +2

Query  86    MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
             M  K E +DAVLKE VDLEN+P+EEVF+ LRC +DGLT++AA++RL IFG+NKLEEK+ES
Sbjct  1     MENKDETMDAVLKEAVDLENVPLEEVFQTLRCNRDGLTTEAAEQRLSIFGYNKLEEKQES  60

Query  266   kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
             K LKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLL INSTISFIEENN
Sbjct  61    KILKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLTINSTISFIEENN  120

Query  446   agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  625
             AGNAAAALMARLAPKAKV RDG+WSEE+ASILVPGDIIS+KLGDIIPADARLLDGDPLKI
Sbjct  121   AGNAAAALMARLAPKAKVFRDGKWSEEEASILVPGDIISIKLGDIIPADARLLDGDPLKI  180

Query  626   DQSALTGESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF  805
             DQS+LTGESLPVTKGPGD IYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQ GHF
Sbjct  181   DQSSLTGESLPVTKGPGDSIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQQGHF  240

Query  806   QKVLTAIANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVT  985
             QKVLTAI NFCICSIAVGM+ EI+VMYPIQ R+YRPGIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  241   QKVLTAIGNFCICSIAVGMITEIIVMYPIQDRDYRPGIDNLLVLLIGGIPIAMPTVLSVT  300

Query  986   MAIGSHRLAQQGAIT  1030
             MAIGSHRL+ QGAIT
Sbjct  301   MAIGSHRLSLQGAIT  315



>ref|XP_007214948.1| hypothetical protein PRUPE_ppa000931mg [Prunus persica]
 gb|EMJ16147.1| hypothetical protein PRUPE_ppa000931mg [Prunus persica]
Length=956

 Score =   487 bits (1253),  Expect = 7e-161, Method: Compositional matrix adjust.
 Identities = 282/315 (90%), Positives = 297/315 (94%), Gaps = 0/315 (0%)
 Frame = +2

Query  86    MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
             M  K E LDAVLKE VDLEN+P+EEVF  LRC + GLTS+AA++RL IFG+NKLEEKKES
Sbjct  1     MDGKSETLDAVLKEAVDLENVPLEEVFLTLRCNRHGLTSEAAEQRLVIFGYNKLEEKKES  60

Query  266   kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
             K LKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLL+INSTISFIEENN
Sbjct  61    KVLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLIINSTISFIEENN  120

Query  446   agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  625
             AGNAAAALMA LAPKAKV R GRW EEDASILVPGDIIS+KLGDIIPADARLLDGDPLKI
Sbjct  121   AGNAAAALMAHLAPKAKVFRGGRWIEEDASILVPGDIISIKLGDIIPADARLLDGDPLKI  180

Query  626   DQSALTGESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF  805
             DQSALTGESLPVTKGPGD +YSGSTCKQGEIEAVVIATGVHTFFGKAAHLVD+TNQ GHF
Sbjct  181   DQSALTGESLPVTKGPGDSVYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDTTNQQGHF  240

Query  806   QKVLTAIANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVT  985
             QKVLTAI NFCICSIAVGM+IEI+VMYPIQHR+YRPGIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  241   QKVLTAIGNFCICSIAVGMIIEIIVMYPIQHRKYRPGIDNLLVLLIGGIPIAMPTVLSVT  300

Query  986   MAIGSHRLAQQGAIT  1030
             MAIGSHRL+QQGAIT
Sbjct  301   MAIGSHRLSQQGAIT  315



>ref|XP_011098566.1| PREDICTED: plasma membrane ATPase 1-like [Sesamum indicum]
 ref|XP_011098567.1| PREDICTED: plasma membrane ATPase 1-like [Sesamum indicum]
Length=955

 Score =   486 bits (1252),  Expect = 9e-161, Method: Compositional matrix adjust.
 Identities = 279/315 (89%), Positives = 302/315 (96%), Gaps = 0/315 (0%)
 Frame = +2

Query  86    MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
             MA K E ++A+ +E VDLEN+P+EEVFENLRCT++GL+S+ A  RL+IFG NKLEEK+ES
Sbjct  1     MAAKDEAMEALKREAVDLENVPLEEVFENLRCTREGLSSEDANRRLEIFGQNKLEEKEES  60

Query  266   kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
             K LKFLGFMWNPLSWVMEAAAIMAIALANGGG+PPDWQDFVGIITLLVINSTISFIEENN
Sbjct  61    KILKFLGFMWNPLSWVMEAAAIMAIALANGGGRPPDWQDFVGIITLLVINSTISFIEENN  120

Query  446   agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  625
             AGNAAAALMARLAPKAKVLRDG W+EEDA++LVPGDIIS+KLGDIIPADARLL+GDPLKI
Sbjct  121   AGNAAAALMARLAPKAKVLRDGHWNEEDAAVLVPGDIISIKLGDIIPADARLLEGDPLKI  180

Query  626   DQSALTGESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF  805
             DQSALTGESLPVTKGPGDG+YSGST KQGEIEA+VIATGVHTFFGKAAHLVDSTNQVGHF
Sbjct  181   DQSALTGESLPVTKGPGDGVYSGSTVKQGEIEALVIATGVHTFFGKAAHLVDSTNQVGHF  240

Query  806   QKVLTAIANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVT  985
             QKVLTAI NFCICSIAVGMVIEI+VMYPIQHR+YRPGIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  241   QKVLTAIGNFCICSIAVGMVIEIIVMYPIQHRDYRPGIDNLLVLLIGGIPIAMPTVLSVT  300

Query  986   MAIGSHRLAQQGAIT  1030
             MAIGSHRL+QQGAIT
Sbjct  301   MAIGSHRLSQQGAIT  315



>ref|XP_002459489.1| hypothetical protein SORBIDRAFT_02g005440 [Sorghum bicolor]
 gb|EER96010.1| hypothetical protein SORBIDRAFT_02g005440 [Sorghum bicolor]
Length=956

 Score =   486 bits (1251),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 280/315 (89%), Positives = 300/315 (95%), Gaps = 0/315 (0%)
 Frame = +2

Query  86    MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
             M +K   LDAVLKE VDLENIPIEEVFENLRC+  GL+++ A++RL IFG NKLEEK+ES
Sbjct  1     MEDKASNLDAVLKEAVDLENIPIEEVFENLRCSPQGLSTEQAEQRLAIFGPNKLEEKQES  60

Query  266   kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
             K  KFLGFMWNPLSWVMEAAAIMAIALANGG KPPDWQDFVGIITLL+INSTISFIEENN
Sbjct  61    KIFKFLGFMWNPLSWVMEAAAIMAIALANGGNKPPDWQDFVGIITLLIINSTISFIEENN  120

Query  446   agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  625
             AGNAAAALMARLAPKAKVLR+GRW+EE+++ILVPGDIISVKLGDIIPADARLL+GDPLKI
Sbjct  121   AGNAAAALMARLAPKAKVLRNGRWTEEESAILVPGDIISVKLGDIIPADARLLEGDPLKI  180

Query  626   DQSALTGESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF  805
             DQSALTGESLPVTKGPGDG+YSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF
Sbjct  181   DQSALTGESLPVTKGPGDGVYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF  240

Query  806   QKVLTAIANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVT  985
             QKVLTAI NFCICSIAVGMV+E++VMYPIQHR YRPGIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  241   QKVLTAIGNFCICSIAVGMVVELIVMYPIQHRGYRPGIDNLLVLLIGGIPIAMPTVLSVT  300

Query  986   MAIGSHRLAQQGAIT  1030
             MAIG+HRLAQQGAIT
Sbjct  301   MAIGAHRLAQQGAIT  315



>gb|KJB33642.1| hypothetical protein B456_006G023600 [Gossypium raimondii]
Length=946

 Score =   485 bits (1249),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 279/315 (89%), Positives = 298/315 (95%), Gaps = 0/315 (0%)
 Frame = +2

Query  86    MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
             M  K E +DAVLKE VDLEN+P+EEVF+ LRC +DGLT++AA++RL IFG+NKLEEK+ES
Sbjct  1     MENKDETMDAVLKEAVDLENVPLEEVFQTLRCNRDGLTTEAAEQRLSIFGYNKLEEKQES  60

Query  266   kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
             K LKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLL INSTISFIEENN
Sbjct  61    KILKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLTINSTISFIEENN  120

Query  446   agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  625
             AGNAAAALMARLAPKAKV RDG+WSEE+ASILVPGDIIS+KLGDIIPADARLLDGDPLKI
Sbjct  121   AGNAAAALMARLAPKAKVFRDGKWSEEEASILVPGDIISIKLGDIIPADARLLDGDPLKI  180

Query  626   DQSALTGESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF  805
             DQS+LTGESLPVTKGPGD IYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQ GHF
Sbjct  181   DQSSLTGESLPVTKGPGDSIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQQGHF  240

Query  806   QKVLTAIANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVT  985
             QKVLTAI NFCICSIAVGM+ EI+VMYPIQ R+YRPGIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  241   QKVLTAIGNFCICSIAVGMITEIIVMYPIQDRDYRPGIDNLLVLLIGGIPIAMPTVLSVT  300

Query  986   MAIGSHRLAQQGAIT  1030
             MAIGSHRL+ QGAIT
Sbjct  301   MAIGSHRLSLQGAIT  315



>gb|KJB33641.1| hypothetical protein B456_006G023600 [Gossypium raimondii]
Length=956

 Score =   485 bits (1248),  Expect = 3e-160, Method: Compositional matrix adjust.
 Identities = 279/315 (89%), Positives = 298/315 (95%), Gaps = 0/315 (0%)
 Frame = +2

Query  86    MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
             M  K E +DAVLKE VDLEN+P+EEVF+ LRC +DGLT++AA++RL IFG+NKLEEK+ES
Sbjct  1     MENKDETMDAVLKEAVDLENVPLEEVFQTLRCNRDGLTTEAAEQRLSIFGYNKLEEKQES  60

Query  266   kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
             K LKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLL INSTISFIEENN
Sbjct  61    KILKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLTINSTISFIEENN  120

Query  446   agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  625
             AGNAAAALMARLAPKAKV RDG+WSEE+ASILVPGDIIS+KLGDIIPADARLLDGDPLKI
Sbjct  121   AGNAAAALMARLAPKAKVFRDGKWSEEEASILVPGDIISIKLGDIIPADARLLDGDPLKI  180

Query  626   DQSALTGESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF  805
             DQS+LTGESLPVTKGPGD IYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQ GHF
Sbjct  181   DQSSLTGESLPVTKGPGDSIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQQGHF  240

Query  806   QKVLTAIANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVT  985
             QKVLTAI NFCICSIAVGM+ EI+VMYPIQ R+YRPGIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  241   QKVLTAIGNFCICSIAVGMITEIIVMYPIQDRDYRPGIDNLLVLLIGGIPIAMPTVLSVT  300

Query  986   MAIGSHRLAQQGAIT  1030
             MAIGSHRL+ QGAIT
Sbjct  301   MAIGSHRLSLQGAIT  315



>ref|XP_008650970.1| PREDICTED: uncharacterized protein LOC100216710 isoform X1 [Zea 
mays]
 tpg|DAA59903.1| TPA: membrane H(+)-ATPase1 [Zea mays]
Length=956

 Score =   485 bits (1248),  Expect = 4e-160, Method: Compositional matrix adjust.
 Identities = 282/315 (90%), Positives = 301/315 (96%), Gaps = 0/315 (0%)
 Frame = +2

Query  86    MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
             M +K   LDAVLKE VDLENIPIEEVFENLRC+  GLT++ A++RL IFG NKLEEK+ES
Sbjct  1     MEDKASNLDAVLKEAVDLENIPIEEVFENLRCSPQGLTTEQAEQRLAIFGPNKLEEKQES  60

Query  266   kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
             KFLKFLGFMWNPLSWVMEAAAIMAIALANGG KPPDWQDFVGIITLL+INSTISFIEENN
Sbjct  61    KFLKFLGFMWNPLSWVMEAAAIMAIALANGGNKPPDWQDFVGIITLLIINSTISFIEENN  120

Query  446   agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  625
             AGNAAAALMARLAPKAKVLR+GRW+EE+++ILVPGDIISVKLGDIIPADARLL+GDPLKI
Sbjct  121   AGNAAAALMARLAPKAKVLRNGRWTEEESAILVPGDIISVKLGDIIPADARLLEGDPLKI  180

Query  626   DQSALTGESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF  805
             DQSALTGESLPVTKGPGDG+YSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF
Sbjct  181   DQSALTGESLPVTKGPGDGVYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF  240

Query  806   QKVLTAIANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVT  985
             QKVLTAI NFCICSIAVGM++E+VVMY IQHR YRPGIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  241   QKVLTAIGNFCICSIAVGMLVELVVMYAIQHRAYRPGIDNLLVLLIGGIPIAMPTVLSVT  300

Query  986   MAIGSHRLAQQGAIT  1030
             MAIG+HRLAQQGAIT
Sbjct  301   MAIGAHRLAQQGAIT  315



>ref|XP_008230721.1| PREDICTED: plasma membrane ATPase 1-like [Prunus mume]
Length=959

 Score =   485 bits (1248),  Expect = 5e-160, Method: Compositional matrix adjust.
 Identities = 280/315 (89%), Positives = 297/315 (94%), Gaps = 0/315 (0%)
 Frame = +2

Query  86    MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
             M  K   LDAVLKE VDLEN+P+EEVF  LRC + GLTS+AA++RL IFG+NKLEEKKES
Sbjct  4     MDGKSGALDAVLKEAVDLENVPLEEVFLTLRCNRHGLTSEAAEQRLVIFGYNKLEEKKES  63

Query  266   kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
             K LKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLL+INSTISFIEENN
Sbjct  64    KVLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLIINSTISFIEENN  123

Query  446   agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  625
             AGNAAAALMA LAPKAKV RDGRW E+DASILVPGDIIS+KLGDIIPADARLLDGDPLKI
Sbjct  124   AGNAAAALMAHLAPKAKVFRDGRWIEQDASILVPGDIISIKLGDIIPADARLLDGDPLKI  183

Query  626   DQSALTGESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF  805
             DQSALTGESLPVTKGPGD +YSGSTCKQGEIEAVVIATGVHTFFGKAAHLVD+TNQ GHF
Sbjct  184   DQSALTGESLPVTKGPGDSVYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDTTNQQGHF  243

Query  806   QKVLTAIANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVT  985
             QKVLTAI NFCICSIA+GM+IEI+VMYPIQHR+YRPGIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  244   QKVLTAIGNFCICSIALGMIIEIIVMYPIQHRKYRPGIDNLLVLLIGGIPIAMPTVLSVT  303

Query  986   MAIGSHRLAQQGAIT  1030
             MAIGSHRL+QQGAIT
Sbjct  304   MAIGSHRLSQQGAIT  318



>ref|XP_003578172.1| PREDICTED: plasma membrane ATPase 1 [Brachypodium distachyon]
Length=959

 Score =   485 bits (1248),  Expect = 5e-160, Method: Compositional matrix adjust.
 Identities = 278/308 (90%), Positives = 300/308 (97%), Gaps = 0/308 (0%)
 Frame = +2

Query  107   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  286
             L+AVLKE+VDLENIP+EEVFENLRC++ GL++Q AQ+RL+IFG NKLEE++ESKFLKFLG
Sbjct  11    LEAVLKESVDLENIPLEEVFENLRCSRQGLSAQQAQQRLEIFGPNKLEEEEESKFLKFLG  70

Query  287   fMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaa  466
             FMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENNAGNAAAA
Sbjct  71    FMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENNAGNAAAA  130

Query  467   lmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTG  646
             LMARLAPKAK+LRDGRW+EEDA+ILVPGD++S+KLGDIIPADARLL+GDPLKIDQSALTG
Sbjct  131   LMARLAPKAKILRDGRWTEEDAAILVPGDVVSIKLGDIIPADARLLEGDPLKIDQSALTG  190

Query  647   ESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAI  826
             ESLP TKGPGDG+YSGST KQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQ+VLTAI
Sbjct  191   ESLPATKGPGDGVYSGSTVKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQQVLTAI  250

Query  827   ANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR  1006
              NFCICSIAVGM IEI+VMYPIQHR YRPGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR
Sbjct  251   GNFCICSIAVGMFIEIIVMYPIQHRAYRPGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR  310

Query  1007  LAQQGAIT  1030
             L+QQGAIT
Sbjct  311   LSQQGAIT  318



>gb|EYU34115.1| hypothetical protein MIMGU_mgv1a000867mg [Erythranthe guttata]
Length=955

 Score =   484 bits (1247),  Expect = 5e-160, Method: Compositional matrix adjust.
 Identities = 279/315 (89%), Positives = 300/315 (95%), Gaps = 0/315 (0%)
 Frame = +2

Query  86    MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
             MA   E ++A+ +E VDLENIPIEEVF+NLRCTK+GL+S+ A  RL+IFG+NKLEEK+ES
Sbjct  1     MAANDEAMEALKREAVDLENIPIEEVFDNLRCTKEGLSSEDAIRRLEIFGYNKLEEKEES  60

Query  266   kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
             K LKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN
Sbjct  61    KVLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN  120

Query  446   agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  625
             AGNAAAALMARLAPKAKVLRDG W+EEDA++LVPGD++S+KLGDIIPADARLLDGDPLKI
Sbjct  121   AGNAAAALMARLAPKAKVLRDGHWNEEDAAVLVPGDVVSIKLGDIIPADARLLDGDPLKI  180

Query  626   DQSALTGESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF  805
             DQSALTGESLP TK PGDG+YSGST KQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF
Sbjct  181   DQSALTGESLPATKSPGDGVYSGSTVKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF  240

Query  806   QKVLTAIANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVT  985
             QKVLTAI NFCICSIAVGMVIEI+VMYPIQHR+YRPGIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  241   QKVLTAIGNFCICSIAVGMVIEIIVMYPIQHRDYRPGIDNLLVLLIGGIPIAMPTVLSVT  300

Query  986   MAIGSHRLAQQGAIT  1030
             MAIGSHRL+QQGAIT
Sbjct  301   MAIGSHRLSQQGAIT  315



>ref|XP_010272214.1| PREDICTED: ATPase 11, plasma membrane-type-like [Nelumbo nucifera]
Length=955

 Score =   484 bits (1247),  Expect = 6e-160, Method: Compositional matrix adjust.
 Identities = 287/315 (91%), Positives = 306/315 (97%), Gaps = 0/315 (0%)
 Frame = +2

Query  86    MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
             M +K  +L+AVLKE VDLENIPIEEVFENLRC K+GLT++AAQERL IFGHNKLEEK+ES
Sbjct  1     MGDKATILEAVLKEAVDLENIPIEEVFENLRCNKEGLTTEAAQERLVIFGHNKLEEKQES  60

Query  266   kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
             K LKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLL+INSTISFIEENN
Sbjct  61    KILKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLLINSTISFIEENN  120

Query  446   agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  625
             AGNAAAALMARLAPK KVLRDG+WSEE+ASILVPGDIIS+KLGDIIPADARLL+GDPLKI
Sbjct  121   AGNAAAALMARLAPKGKVLRDGKWSEEEASILVPGDIISIKLGDIIPADARLLEGDPLKI  180

Query  626   DQSALTGESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF  805
             DQSALTGESLPVTKGPGDG+YSGSTCKQGEIEAVVIATGVHTFFGKAAHLVD+TNQVGHF
Sbjct  181   DQSALTGESLPVTKGPGDGVYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDTTNQVGHF  240

Query  806   QKVLTAIANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVT  985
             QKVLTAI NFCICSIA+GM+IEI+VMYPIQHR+YRPGIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  241   QKVLTAIGNFCICSIAIGMIIEIIVMYPIQHRKYRPGIDNLLVLLIGGIPIAMPTVLSVT  300

Query  986   MAIGSHRLAQQGAIT  1030
             MAIGSHRL+QQGAIT
Sbjct  301   MAIGSHRLSQQGAIT  315



>ref|XP_004955721.1| PREDICTED: plasma membrane ATPase 1-like [Setaria italica]
Length=956

 Score =   484 bits (1245),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 279/315 (89%), Positives = 301/315 (96%), Gaps = 0/315 (0%)
 Frame = +2

Query  86    MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
             M +K   LDAVLKE VDLENIPIEEVFENLRC+  GL+++ A++RL IFG NKLEEK+ES
Sbjct  1     MEDKAANLDAVLKEAVDLENIPIEEVFENLRCSPQGLSTEQAEQRLAIFGPNKLEEKQES  60

Query  266   kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
             K LKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLL+INSTISFIEENN
Sbjct  61    KVLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLIINSTISFIEENN  120

Query  446   agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  625
             AGNAAAALMARLAPKAKVLR+GRW+EE+++ILVPGDIISVKLGDIIPADARLL+GDPLKI
Sbjct  121   AGNAAAALMARLAPKAKVLRNGRWTEEESAILVPGDIISVKLGDIIPADARLLEGDPLKI  180

Query  626   DQSALTGESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF  805
             DQSALTGESLPVTKGPGDG+YSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF
Sbjct  181   DQSALTGESLPVTKGPGDGVYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF  240

Query  806   QKVLTAIANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVT  985
             QKVLTAI NFCICSIA+GM++E++VMYPIQ R YRPGIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  241   QKVLTAIGNFCICSIALGMLVELIVMYPIQRRAYRPGIDNLLVLLIGGIPIAMPTVLSVT  300

Query  986   MAIGSHRLAQQGAIT  1030
             MAIG+HRLAQQGAIT
Sbjct  301   MAIGAHRLAQQGAIT  315



>ref|XP_010112580.1| ATPase 11, plasma membrane-type [Morus notabilis]
 gb|EXC34215.1| ATPase 11, plasma membrane-type [Morus notabilis]
Length=950

 Score =   483 bits (1242),  Expect = 3e-159, Method: Compositional matrix adjust.
 Identities = 284/315 (90%), Positives = 302/315 (96%), Gaps = 6/315 (2%)
 Frame = +2

Query  86    MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
             M EKPE L+AVLKETVDLENIPIEEVFENLRC+K+GLT++AA++RL IFG+NKLEEKKES
Sbjct  1     MGEKPEALEAVLKETVDLENIPIEEVFENLRCSKEGLTTEAAEQRLTIFGYNKLEEKKES  60

Query  266   kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
             KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLL INSTISFIEENN
Sbjct  61    KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLFINSTISFIEENN  120

Query  446   agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  625
             AGNAAAALMARLAPKAKVLRDGRWSE+DA++LVPGDIIS+KLGDI+ ADARLL+GDPLKI
Sbjct  121   AGNAAAALMARLAPKAKVLRDGRWSEQDAAVLVPGDIISIKLGDIVAADARLLEGDPLKI  180

Query  626   DQSALTGESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF  805
             DQSALTGESLPVTKGPGDG+YSGSTCKQGEIEAVVIATGVHTFFGKAAHLVD+TNQ    
Sbjct  181   DQSALTGESLPVTKGPGDGVYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDTTNQ----  236

Query  806   QKVLTAIANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVT  985
               VLTAI NFCICSIAVGM+IEIVVMYPIQ REYRPGIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  237   --VLTAIGNFCICSIAVGMIIEIVVMYPIQDREYRPGIDNLLVLLIGGIPIAMPTVLSVT  294

Query  986   MAIGSHRLAQQGAIT  1030
             MAIGSHRL+QQGAIT
Sbjct  295   MAIGSHRLSQQGAIT  309



>gb|KCW83495.1| hypothetical protein EUGRSUZ_B00400 [Eucalyptus grandis]
Length=924

 Score =   481 bits (1239),  Expect = 4e-159, Method: Compositional matrix adjust.
 Identities = 275/315 (87%), Positives = 297/315 (94%), Gaps = 0/315 (0%)
 Frame = +2

Query  86    MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
             M EK  VL+AVL E VDLEN+PIEEVF++L C + GLT  AA++RL++FGHNKLEEKKES
Sbjct  1     MEEKAPVLEAVLNEAVDLENVPIEEVFQSLVCNRGGLTLAAAEQRLELFGHNKLEEKKES  60

Query  266   kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
             KF KFLGFMWNPLSWVME AAIMAIAL NGGGKPPDWQDF+GI+TLL INSTISFIEENN
Sbjct  61    KFFKFLGFMWNPLSWVMELAAIMAIALTNGGGKPPDWQDFIGIVTLLFINSTISFIEENN  120

Query  446   agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  625
             AGNAAAALMARLAPKAKVLRDGRW E+DASILVPGDIIS+KLGDI+PADARLL+GDPLKI
Sbjct  121   AGNAAAALMARLAPKAKVLRDGRWGEQDASILVPGDIISIKLGDIVPADARLLEGDPLKI  180

Query  626   DQSALTGESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF  805
             DQSALTGESLPVTKGPGDG+YSGSTCKQGEIEAVVIATGVHTFFGKAAHLVD+TNQVGHF
Sbjct  181   DQSALTGESLPVTKGPGDGVYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDTTNQVGHF  240

Query  806   QKVLTAIANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVT  985
             QKVLTAI NFCICSIA+GM++EI+VMYPIQ REYR GIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  241   QKVLTAIGNFCICSIALGMIVEIIVMYPIQDREYRSGIDNLLVLLIGGIPIAMPTVLSVT  300

Query  986   MAIGSHRLAQQGAIT  1030
             MAIGSHRL+QQGAIT
Sbjct  301   MAIGSHRLSQQGAIT  315



>dbj|BAJ92653.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=958

 Score =   482 bits (1241),  Expect = 4e-159, Method: Compositional matrix adjust.
 Identities = 280/308 (91%), Positives = 298/308 (97%), Gaps = 0/308 (0%)
 Frame = +2

Query  107   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  286
             L+AVLKE VDLENIP+EEV +NLRC+++GLT++ AQ+RL IFG NKLEEK+ESKFLKFLG
Sbjct  9     LEAVLKEVVDLENIPLEEVLDNLRCSREGLTAEQAQQRLQIFGPNKLEEKEESKFLKFLG  68

Query  287   fMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaa  466
             FMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENNAGNAAAA
Sbjct  69    FMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENNAGNAAAA  128

Query  467   lmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTG  646
             LMARLAPKAK+LRDGRW+EEDA+ILVPGD+IS+KLGDIIPADARLL+GDPLKIDQSALTG
Sbjct  129   LMARLAPKAKILRDGRWTEEDAAILVPGDVISIKLGDIIPADARLLEGDPLKIDQSALTG  188

Query  647   ESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAI  826
             ESLP TKGPGDGIYSGST KQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAI
Sbjct  189   ESLPATKGPGDGIYSGSTVKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAI  248

Query  827   ANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR  1006
              NFCICSIAVGM IEI+VMYPIQHR YRPGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR
Sbjct  249   GNFCICSIAVGMFIEIIVMYPIQHRAYRPGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR  308

Query  1007  LAQQGAIT  1030
             L+QQGAIT
Sbjct  309   LSQQGAIT  316



>dbj|BAK04567.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=958

 Score =   482 bits (1241),  Expect = 4e-159, Method: Compositional matrix adjust.
 Identities = 280/308 (91%), Positives = 298/308 (97%), Gaps = 0/308 (0%)
 Frame = +2

Query  107   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  286
             L+AVLKE VDLENIP+EEV +NLRC+++GLT++ AQ+RL IFG NKLEEK+ESKFLKFLG
Sbjct  9     LEAVLKEVVDLENIPLEEVLDNLRCSREGLTAEQAQQRLQIFGPNKLEEKEESKFLKFLG  68

Query  287   fMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaa  466
             FMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENNAGNAAAA
Sbjct  69    FMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENNAGNAAAA  128

Query  467   lmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTG  646
             LMARLAPKAK+LRDGRW+EEDA+ILVPGD+IS+KLGDIIPADARLL+GDPLKIDQSALTG
Sbjct  129   LMARLAPKAKILRDGRWTEEDAAILVPGDVISIKLGDIIPADARLLEGDPLKIDQSALTG  188

Query  647   ESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAI  826
             ESLP TKGPGDGIYSGST KQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAI
Sbjct  189   ESLPATKGPGDGIYSGSTVKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAI  248

Query  827   ANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR  1006
              NFCICSIAVGM IEI+VMYPIQHR YRPGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR
Sbjct  249   GNFCICSIAVGMFIEIIVMYPIQHRAYRPGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR  308

Query  1007  LAQQGAIT  1030
             L+QQGAIT
Sbjct  309   LSQQGAIT  316



>ref|XP_010028675.1| PREDICTED: ATPase 11, plasma membrane-type [Eucalyptus grandis]
 gb|KCW83493.1| hypothetical protein EUGRSUZ_B00400 [Eucalyptus grandis]
Length=955

 Score =   481 bits (1238),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 275/315 (87%), Positives = 297/315 (94%), Gaps = 0/315 (0%)
 Frame = +2

Query  86    MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
             M EK  VL+AVL E VDLEN+PIEEVF++L C + GLT  AA++RL++FGHNKLEEKKES
Sbjct  1     MEEKAPVLEAVLNEAVDLENVPIEEVFQSLVCNRGGLTLAAAEQRLELFGHNKLEEKKES  60

Query  266   kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
             KF KFLGFMWNPLSWVME AAIMAIAL NGGGKPPDWQDF+GI+TLL INSTISFIEENN
Sbjct  61    KFFKFLGFMWNPLSWVMELAAIMAIALTNGGGKPPDWQDFIGIVTLLFINSTISFIEENN  120

Query  446   agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  625
             AGNAAAALMARLAPKAKVLRDGRW E+DASILVPGDIIS+KLGDI+PADARLL+GDPLKI
Sbjct  121   AGNAAAALMARLAPKAKVLRDGRWGEQDASILVPGDIISIKLGDIVPADARLLEGDPLKI  180

Query  626   DQSALTGESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF  805
             DQSALTGESLPVTKGPGDG+YSGSTCKQGEIEAVVIATGVHTFFGKAAHLVD+TNQVGHF
Sbjct  181   DQSALTGESLPVTKGPGDGVYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDTTNQVGHF  240

Query  806   QKVLTAIANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVT  985
             QKVLTAI NFCICSIA+GM++EI+VMYPIQ REYR GIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  241   QKVLTAIGNFCICSIALGMIVEIIVMYPIQDREYRSGIDNLLVLLIGGIPIAMPTVLSVT  300

Query  986   MAIGSHRLAQQGAIT  1030
             MAIGSHRL+QQGAIT
Sbjct  301   MAIGSHRLSQQGAIT  315



>gb|KCW83494.1| hypothetical protein EUGRSUZ_B00400 [Eucalyptus grandis]
Length=954

 Score =   481 bits (1238),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 275/315 (87%), Positives = 297/315 (94%), Gaps = 0/315 (0%)
 Frame = +2

Query  86    MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
             M EK  VL+AVL E VDLEN+PIEEVF++L C + GLT  AA++RL++FGHNKLEEKKES
Sbjct  1     MEEKAPVLEAVLNEAVDLENVPIEEVFQSLVCNRGGLTLAAAEQRLELFGHNKLEEKKES  60

Query  266   kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
             KF KFLGFMWNPLSWVME AAIMAIAL NGGGKPPDWQDF+GI+TLL INSTISFIEENN
Sbjct  61    KFFKFLGFMWNPLSWVMELAAIMAIALTNGGGKPPDWQDFIGIVTLLFINSTISFIEENN  120

Query  446   agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  625
             AGNAAAALMARLAPKAKVLRDGRW E+DASILVPGDIIS+KLGDI+PADARLL+GDPLKI
Sbjct  121   AGNAAAALMARLAPKAKVLRDGRWGEQDASILVPGDIISIKLGDIVPADARLLEGDPLKI  180

Query  626   DQSALTGESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF  805
             DQSALTGESLPVTKGPGDG+YSGSTCKQGEIEAVVIATGVHTFFGKAAHLVD+TNQVGHF
Sbjct  181   DQSALTGESLPVTKGPGDGVYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDTTNQVGHF  240

Query  806   QKVLTAIANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVT  985
             QKVLTAI NFCICSIA+GM++EI+VMYPIQ REYR GIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  241   QKVLTAIGNFCICSIALGMIVEIIVMYPIQDREYRSGIDNLLVLLIGGIPIAMPTVLSVT  300

Query  986   MAIGSHRLAQQGAIT  1030
             MAIGSHRL+QQGAIT
Sbjct  301   MAIGSHRLSQQGAIT  315



>gb|AEQ27823.1| PM H+-ATPase L [Eichhornia crassipes]
Length=956

 Score =   481 bits (1238),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 281/315 (89%), Positives = 299/315 (95%), Gaps = 0/315 (0%)
 Frame = +2

Query  86    MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
             M EK   ++AVLKE VDLENI +EEVF+NLRC ++GLTSQ AQERL IFG NKLEEKKES
Sbjct  1     MGEKAVEMEAVLKEVVDLENISLEEVFDNLRCNREGLTSQQAQERLTIFGQNKLEEKKES  60

Query  266   kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
             KFLKFLGFMWNPLSWVMEAAAIMAIALANGGG+PPDWQDFVGII LL+INSTISFIEENN
Sbjct  61    KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGEPPDWQDFVGIIALLMINSTISFIEENN  120

Query  446   agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  625
             AGNAAAALMARLAPKAKVLRDGRWSEE+A+ILVPGDIIS+KLGDI+PADARLL+GDPLKI
Sbjct  121   AGNAAAALMARLAPKAKVLRDGRWSEEEAAILVPGDIISIKLGDIVPADARLLEGDPLKI  180

Query  626   DQSALTGESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF  805
             DQSALTGESLPVTKG GDG+YSGST KQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF
Sbjct  181   DQSALTGESLPVTKGAGDGVYSGSTRKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF  240

Query  806   QKVLTAIANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVT  985
             QKVLT+I NFCICSIAVGM +EI+VMYPIQHR YRPGIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  241   QKVLTSIGNFCICSIAVGMFVEIIVMYPIQHRNYRPGIDNLLVLLIGGIPIAMPTVLSVT  300

Query  986   MAIGSHRLAQQGAIT  1030
             MAIGSHRL+QQGAIT
Sbjct  301   MAIGSHRLSQQGAIT  315



>ref|XP_011466246.1| PREDICTED: plasma membrane ATPase 1-like isoform X2 [Fragaria 
vesca subsp. vesca]
Length=966

 Score =   480 bits (1236),  Expect = 3e-158, Method: Compositional matrix adjust.
 Identities = 279/315 (89%), Positives = 297/315 (94%), Gaps = 0/315 (0%)
 Frame = +2

Query  86    MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
             M EK E L+ V+KE VDLE++PIEEVF  LRC + GLTS+AAQ+RL +FG+NKLEEKKES
Sbjct  1     MDEKAEGLEVVVKEAVDLEHVPIEEVFLTLRCDEHGLTSEAAQQRLALFGYNKLEEKKES  60

Query  266   kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
             K LKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN
Sbjct  61    KVLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN  120

Query  446   agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  625
             AGNAAAALMARLAP AKVLRDG+W EEDASILVPGDIIS+KLGDI+PADARLLDGDPLKI
Sbjct  121   AGNAAAALMARLAPTAKVLRDGKWIEEDASILVPGDIISIKLGDILPADARLLDGDPLKI  180

Query  626   DQSALTGESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF  805
             DQS+LTGESLPVTK PGD +YSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQ GHF
Sbjct  181   DQSSLTGESLPVTKSPGDSVYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQQGHF  240

Query  806   QKVLTAIANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVT  985
             Q+VLTAI NFCICSIAVGM+IEI+VMYPIQHR YRPGIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  241   QQVLTAIGNFCICSIAVGMIIEIIVMYPIQHRSYRPGIDNLLVLLIGGIPIAMPTVLSVT  300

Query  986   MAIGSHRLAQQGAIT  1030
             MAIGSHRLA+QGAIT
Sbjct  301   MAIGSHRLAEQGAIT  315



>ref|XP_004302360.1| PREDICTED: plasma membrane ATPase 1-like isoform X1 [Fragaria 
vesca subsp. vesca]
Length=956

 Score =   480 bits (1235),  Expect = 3e-158, Method: Compositional matrix adjust.
 Identities = 279/315 (89%), Positives = 297/315 (94%), Gaps = 0/315 (0%)
 Frame = +2

Query  86    MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
             M EK E L+ V+KE VDLE++PIEEVF  LRC + GLTS+AAQ+RL +FG+NKLEEKKES
Sbjct  1     MDEKAEGLEVVVKEAVDLEHVPIEEVFLTLRCDEHGLTSEAAQQRLALFGYNKLEEKKES  60

Query  266   kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
             K LKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN
Sbjct  61    KVLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN  120

Query  446   agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  625
             AGNAAAALMARLAP AKVLRDG+W EEDASILVPGDIIS+KLGDI+PADARLLDGDPLKI
Sbjct  121   AGNAAAALMARLAPTAKVLRDGKWIEEDASILVPGDIISIKLGDILPADARLLDGDPLKI  180

Query  626   DQSALTGESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF  805
             DQS+LTGESLPVTK PGD +YSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQ GHF
Sbjct  181   DQSSLTGESLPVTKSPGDSVYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQQGHF  240

Query  806   QKVLTAIANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVT  985
             Q+VLTAI NFCICSIAVGM+IEI+VMYPIQHR YRPGIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  241   QQVLTAIGNFCICSIAVGMIIEIIVMYPIQHRSYRPGIDNLLVLLIGGIPIAMPTVLSVT  300

Query  986   MAIGSHRLAQQGAIT  1030
             MAIGSHRLA+QGAIT
Sbjct  301   MAIGSHRLAEQGAIT  315



>dbj|BAA01058.1| H-ATPase [Oryza sativa Japonica Group]
 prf||1906387A H ATPase
Length=956

 Score =   479 bits (1233),  Expect = 7e-158, Method: Compositional matrix adjust.
 Identities = 281/315 (89%), Positives = 299/315 (95%), Gaps = 0/315 (0%)
 Frame = +2

Query  86    MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
             MAE    LDAVLKE+VDLENIPIEEVF+NL+C + GLTS+ AQ RL +FG NKLEEK+ES
Sbjct  1     MAEDKGGLDAVLKESVDLENIPIEEVFQNLKCCRQGLTSEEAQLRLQLFGPNKLEEKEES  60

Query  266   kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
             KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLL+INSTISFIEENN
Sbjct  61    KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLLINSTISFIEENN  120

Query  446   agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  625
             AGNAAAALMARLAPKAKVLR+G W+EE+A+ILVPGDIIS+KLGDIIPADARLL+GDPLKI
Sbjct  121   AGNAAAALMARLAPKAKVLRNGSWTEEEAAILVPGDIISIKLGDIIPADARLLEGDPLKI  180

Query  626   DQSALTGESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF  805
             DQSALTGESLP TKGPGDG+YSGST KQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF
Sbjct  181   DQSALTGESLPATKGPGDGVYSGSTVKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF  240

Query  806   QKVLTAIANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVT  985
             QKVLTAI NFCICSIAVGM +EI+VMYPIQHR YRPGIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  241   QKVLTAIGNFCICSIAVGMFVEIIVMYPIQHRPYRPGIDNLLVLLIGGIPIAMPTVLSVT  300

Query  986   MAIGSHRLAQQGAIT  1030
             MAIGSHRL+QQGAIT
Sbjct  301   MAIGSHRLSQQGAIT  315



>ref|NP_001050947.1| Os03g0689300 [Oryza sativa Japonica Group]
 emb|CAD29294.1| plasma membrane H+ ATPase [Oryza sativa Japonica Group]
 gb|AAT81733.1| H-ATPase [Oryza sativa Japonica Group]
 gb|ABF98274.1| Plasma membrane ATPase 3, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF12861.1| Os03g0689300 [Oryza sativa Japonica Group]
Length=956

 Score =   478 bits (1231),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 281/315 (89%), Positives = 299/315 (95%), Gaps = 0/315 (0%)
 Frame = +2

Query  86    MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
             MAE    LDAVLKE+VDLENIPIEEVF+NL+C + GLTS+ AQ RL +FG NKLEEK+ES
Sbjct  1     MAEDKGGLDAVLKESVDLENIPIEEVFQNLKCCRQGLTSEEAQLRLQLFGPNKLEEKEES  60

Query  266   kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
             KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLL+INSTISFIEENN
Sbjct  61    KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLLINSTISFIEENN  120

Query  446   agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  625
             AGNAAAALMARLAPKAKVLR+G W+EE+A+ILVPGDIIS+KLGDIIPADARLL+GDPLKI
Sbjct  121   AGNAAAALMARLAPKAKVLRNGSWTEEEAAILVPGDIISIKLGDIIPADARLLEGDPLKI  180

Query  626   DQSALTGESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF  805
             DQSALTGESLP TKGPGDG+YSGST KQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF
Sbjct  181   DQSALTGESLPATKGPGDGVYSGSTVKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF  240

Query  806   QKVLTAIANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVT  985
             QKVLTAI NFCICSIAVGM +EI+VMYPIQHR YRPGIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  241   QKVLTAIGNFCICSIAVGMFVEIIVMYPIQHRPYRPGIDNLLVLLIGGIPIAMPTVLSVT  300

Query  986   MAIGSHRLAQQGAIT  1030
             MAIGSHRL+QQGAIT
Sbjct  301   MAIGSHRLSQQGAIT  315



>ref|XP_008341531.1| PREDICTED: plasma membrane ATPase 1-like [Malus domestica]
Length=956

 Score =   478 bits (1229),  Expect = 3e-157, Method: Compositional matrix adjust.
 Identities = 277/315 (88%), Positives = 294/315 (93%), Gaps = 0/315 (0%)
 Frame = +2

Query  86    MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
             M EK   LDAVLKE VDLE++P+EEVF  LRC K GLTS+A ++RL IFG NKLEEKKES
Sbjct  1     MDEKAVDLDAVLKEAVDLEHVPLEEVFVTLRCNKHGLTSEAVEQRLAIFGFNKLEEKKES  60

Query  266   kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
             K LKFLGFMWNPL+WVMEAAAIMAIALANGGGKPPDWQDF+GII LL+INSTISFIEENN
Sbjct  61    KVLKFLGFMWNPLAWVMEAAAIMAIALANGGGKPPDWQDFIGIIALLIINSTISFIEENN  120

Query  446   agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  625
             AGNAAAALMARLAPKAKV RDGRW EEDAS+LVPGD+IS+KLGDIIPADARLLDGD LKI
Sbjct  121   AGNAAAALMARLAPKAKVFRDGRWIEEDASVLVPGDVISIKLGDIIPADARLLDGDALKI  180

Query  626   DQSALTGESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF  805
             DQSALTGESLPVTKGPG  +YSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQ GHF
Sbjct  181   DQSALTGESLPVTKGPGSSVYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQQGHF  240

Query  806   QKVLTAIANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVT  985
             QKVLTAI NFCICSIAVGM++EI+VMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  241   QKVLTAIGNFCICSIAVGMIVEIIVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVT  300

Query  986   MAIGSHRLAQQGAIT  1030
             MAIGSHRL+QQGAIT
Sbjct  301   MAIGSHRLSQQGAIT  315



>ref|XP_009335819.1| PREDICTED: plasma membrane ATPase 1-like [Pyrus x bretschneideri]
Length=956

 Score =   477 bits (1228),  Expect = 4e-157, Method: Compositional matrix adjust.
 Identities = 277/315 (88%), Positives = 294/315 (93%), Gaps = 0/315 (0%)
 Frame = +2

Query  86    MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
             M EK   LDAVLKE VDLE++P+EEV+  LRC K GLTS+A ++RL IFG NKLEEKKES
Sbjct  1     MDEKAVDLDAVLKEAVDLEHVPLEEVYVTLRCNKHGLTSEAVEQRLAIFGFNKLEEKKES  60

Query  266   kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
             K LKFLGFMWNPL+WVMEAAAIMAIALANGGGKPPDWQDF+GII LL+INSTISFIEENN
Sbjct  61    KVLKFLGFMWNPLAWVMEAAAIMAIALANGGGKPPDWQDFIGIIALLIINSTISFIEENN  120

Query  446   agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  625
             AGNAAAALMARLAPKAKV RDGRW EEDAS+LVPGDIIS+KLGDIIPADARLLDGD LKI
Sbjct  121   AGNAAAALMARLAPKAKVFRDGRWIEEDASVLVPGDIISIKLGDIIPADARLLDGDALKI  180

Query  626   DQSALTGESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF  805
             DQSALTGESLPVTK PGD +YSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQ GHF
Sbjct  181   DQSALTGESLPVTKSPGDSVYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQQGHF  240

Query  806   QKVLTAIANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVT  985
             QKVLTAI NFCICSIAVGM++EI+VMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  241   QKVLTAIGNFCICSIAVGMIVEIIVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVT  300

Query  986   MAIGSHRLAQQGAIT  1030
             MAIGSHRL+QQGAIT
Sbjct  301   MAIGSHRLSQQGAIT  315



>ref|NP_001105360.1| membrane H(+)-ATPase1 [Zea mays]
 gb|AAB60276.1| H(+)-transporting ATPase [Zea mays]
Length=949

 Score =   474 bits (1221),  Expect = 3e-156, Method: Compositional matrix adjust.
 Identities = 277/313 (88%), Positives = 299/313 (96%), Gaps = 0/313 (0%)
 Frame = +2

Query  92    EKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskf  271
             +K   LDAVLKE VDLENI I+EVFE+LRC+  GL+++ A++RL IFG NKLEEK+ESKF
Sbjct  6     DKASNLDAVLKEAVDLENIAIQEVFESLRCSPQGLSTEQAEQRLAIFGPNKLEEKQESKF  65

Query  272   lkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnag  451
             LKFLGFMWNPLSWVMEAAAIMAIALANGG KPPDWQDFVGIITLL+INSTISFIEENNAG
Sbjct  66    LKFLGFMWNPLSWVMEAAAIMAIALANGGNKPPDWQDFVGIITLLIINSTISFIEENNAG  125

Query  452   naaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQ  631
             NAAAALMARLAPKAKVLR+GRW+EE+++ILVPGDIISVKLGDIIPADARLL+GDPLKIDQ
Sbjct  126   NAAAALMARLAPKAKVLRNGRWAEEESAILVPGDIISVKLGDIIPADARLLEGDPLKIDQ  185

Query  632   SALTGESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQK  811
             SALTGESLPVTKGPGDG+YSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQK
Sbjct  186   SALTGESLPVTKGPGDGVYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQK  245

Query  812   VLTAIANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVTMA  991
             VLTAI NFCICSIAVGM++EI+VMYPIQHR YR GIDNLLVLLIGGIPIAMPTVLSVTMA
Sbjct  246   VLTAIGNFCICSIAVGMLVEIIVMYPIQHRAYRSGIDNLLVLLIGGIPIAMPTVLSVTMA  305

Query  992   IGSHRLAQQGAIT  1030
             IG+HRLAQQGAIT
Sbjct  306   IGAHRLAQQGAIT  318



>tpg|DAA42486.1| TPA: H(+)-transporting ATPase [Zea mays]
Length=949

 Score =   474 bits (1220),  Expect = 5e-156, Method: Compositional matrix adjust.
 Identities = 277/313 (88%), Positives = 299/313 (96%), Gaps = 0/313 (0%)
 Frame = +2

Query  92    EKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskf  271
             +K   LDAVLKE VDLENI I+EVFE+LRC+  GL+++ A++RL IFG NKLEEK+ESKF
Sbjct  6     DKASNLDAVLKEAVDLENIAIQEVFESLRCSPQGLSTEQAEQRLAIFGPNKLEEKQESKF  65

Query  272   lkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnag  451
             LKFLGFMWNPLSWVMEAAAIMAIALANGG KPPDWQDFVGIITLL+INSTISFIEENNAG
Sbjct  66    LKFLGFMWNPLSWVMEAAAIMAIALANGGNKPPDWQDFVGIITLLIINSTISFIEENNAG  125

Query  452   naaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQ  631
             NAAAALMARLAPKAKVLR+GRW+EE+++ILVPGDIISVKLGDIIPADARLL+GDPLKIDQ
Sbjct  126   NAAAALMARLAPKAKVLRNGRWAEEESAILVPGDIISVKLGDIIPADARLLEGDPLKIDQ  185

Query  632   SALTGESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQK  811
             SALTGESLPVTKGPGDG+YSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQK
Sbjct  186   SALTGESLPVTKGPGDGVYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQK  245

Query  812   VLTAIANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVTMA  991
             VLTAI NFCICSIAVGM++EI+VMYPIQHR YR GIDNLLVLLIGGIPIAMPTVLSVTMA
Sbjct  246   VLTAIGNFCICSIAVGMLVEIIVMYPIQHRAYRSGIDNLLVLLIGGIPIAMPTVLSVTMA  305

Query  992   IGSHRLAQQGAIT  1030
             IG+HRLAQQGAIT
Sbjct  306   IGAHRLAQQGAIT  318



>gb|EEC81667.1| hypothetical protein OsI_25220 [Oryza sativa Indica Group]
 gb|EEE66722.1| hypothetical protein OsJ_23404 [Oryza sativa Japonica Group]
Length=951

 Score =   474 bits (1219),  Expect = 7e-156, Method: Compositional matrix adjust.
 Identities = 279/315 (89%), Positives = 301/315 (96%), Gaps = 6/315 (2%)
 Frame = +2

Query  86    MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
             MAEK + L+AVL E+VDLENIP+EEVFE+LRC ++GLTS  A++RL++FG N+LEEKKES
Sbjct  1     MAEKGDNLEAVLNESVDLENIPLEEVFEHLRCNREGLTSANAEQRLNLFGPNRLEEKKES  60

Query  266   kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
             KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLL+INSTISFIEENN
Sbjct  61    KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLIINSTISFIEENN  120

Query  446   agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  625
             AGNAAAALMARLAPKAKVLR+GRWSEE+A+ILVPGDIISVKLGDIIPADARLL+GDPLKI
Sbjct  121   AGNAAAALMARLAPKAKVLRNGRWSEEEAAILVPGDIISVKLGDIIPADARLLEGDPLKI  180

Query  626   DQSALTGESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF  805
             DQSALTGESLPVTKGPGDG+YSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQ    
Sbjct  181   DQSALTGESLPVTKGPGDGVYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQ----  236

Query  806   QKVLTAIANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVT  985
               VLTAI NFCICSIA+GMV+EI+VMYPIQHR+YRPGIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  237   --VLTAIGNFCICSIAIGMVVEIIVMYPIQHRDYRPGIDNLLVLLIGGIPIAMPTVLSVT  294

Query  986   MAIGSHRLAQQGAIT  1030
             MAIGSHRLAQQGAIT
Sbjct  295   MAIGSHRLAQQGAIT  309



>ref|XP_012082827.1| PREDICTED: plasma membrane ATPase 1-like [Jatropha curcas]
 ref|XP_012082835.1| PREDICTED: plasma membrane ATPase 1-like [Jatropha curcas]
 gb|KDP45466.1| hypothetical protein JCGZ_09715 [Jatropha curcas]
Length=956

 Score =   474 bits (1219),  Expect = 8e-156, Method: Compositional matrix adjust.
 Identities = 284/315 (90%), Positives = 303/315 (96%), Gaps = 0/315 (0%)
 Frame = +2

Query  86    MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
             M EK E L+AVLKE VDLEN+PIEEVF+ LRC  +GLT++AA++RL IFG+NKLEEK+ES
Sbjct  1     MVEKAETLEAVLKEVVDLENVPIEEVFQTLRCNSNGLTTEAAEQRLTIFGYNKLEEKQES  60

Query  266   kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
             KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLL+INSTISFIEENN
Sbjct  61    KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLLINSTISFIEENN  120

Query  446   agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  625
             AGNAAAALMARLAPKAKVLRD RW EEDASILVPGDIISVKLGDIIPADARLL+GDPLKI
Sbjct  121   AGNAAAALMARLAPKAKVLRDERWIEEDASILVPGDIISVKLGDIIPADARLLEGDPLKI  180

Query  626   DQSALTGESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF  805
             DQSALTGESLPVTKGPGD +YSGSTCKQGEIEAVVIATGVHTFFGKAAHLVD+TNQVGHF
Sbjct  181   DQSALTGESLPVTKGPGDSVYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDTTNQVGHF  240

Query  806   QKVLTAIANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVT  985
             QKVLTAI NFCICSIA+GM+IEI+VMYPIQHR+YRPGIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  241   QKVLTAIGNFCICSIAIGMIIEIIVMYPIQHRKYRPGIDNLLVLLIGGIPIAMPTVLSVT  300

Query  986   MAIGSHRLAQQGAIT  1030
             MAIGSHRL+QQGAIT
Sbjct  301   MAIGSHRLSQQGAIT  315



>gb|EMT26085.1| Plasma membrane ATPase 1 [Aegilops tauschii]
Length=969

 Score =   473 bits (1217),  Expect = 3e-155, Method: Compositional matrix adjust.
 Identities = 283/328 (86%), Positives = 301/328 (92%), Gaps = 13/328 (4%)
 Frame = +2

Query  86    MAEKPE-VLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekke  262
             MA + E  LDAVLKE VDLE+IPI+EVFENLRC+  GLTS+ AQ+RL IFG NKLEEK+E
Sbjct  1     MASRQEGNLDAVLKEAVDLEHIPIDEVFENLRCSHQGLTSEQAQQRLQIFGPNKLEEKEE  60

Query  263   skflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEn  442
             SKFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLL+INSTISFIEEN
Sbjct  61    SKFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLLINSTISFIEEN  120

Query  443   nagnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLK  622
             NAGNAAAALMARLAPKAKVLRDGRW+EE+A++LVPGDI+S+KLGDIIPADARLLDGDPLK
Sbjct  121   NAGNAAAALMARLAPKAKVLRDGRWTEEEAAVLVPGDIVSIKLGDIIPADARLLDGDPLK  180

Query  623   IDQSALTGESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGH  802
             IDQSALTGESLP TKGPGDG+YSGST KQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGH
Sbjct  181   IDQSALTGESLPATKGPGDGVYSGSTVKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGH  240

Query  803   FQK------------VLTAIANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIG  946
             FQ+            VLTAI NFCICSIAVGM IEI+VMYPIQHR YRPGIDNLLVLLIG
Sbjct  241   FQQASLTGLGYFYRIVLTAIGNFCICSIAVGMFIEIIVMYPIQHRAYRPGIDNLLVLLIG  300

Query  947   GIPIAMPTVLSVTMAIGSHRLAQQGAIT  1030
             GIPIAMPTVLSVTMAIGSHRL+QQGAIT
Sbjct  301   GIPIAMPTVLSVTMAIGSHRLSQQGAIT  328



>ref|XP_010531800.1| PREDICTED: ATPase 4, plasma membrane-type-like [Tarenaya hassleriana]
Length=954

 Score =   471 bits (1213),  Expect = 7e-155, Method: Compositional matrix adjust.
 Identities = 275/315 (87%), Positives = 296/315 (94%), Gaps = 1/315 (0%)
 Frame = +2

Query  86    MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
             M +K E +DAVLKE VDLEN+P+ EVFE LRC  +GL+++AA++RL IFGHNKLEEK+ES
Sbjct  1     MDDKGE-MDAVLKEAVDLENVPMAEVFETLRCDTNGLSTKAAEQRLAIFGHNKLEEKQES  59

Query  266   kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
             KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGII LL+INSTISFIEENN
Sbjct  60    KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIIVLLLINSTISFIEENN  119

Query  446   agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  625
             AGNAAAALMA LAPK KVLRDG+W EEDASILVPGDIIS+KLGDIIPADARLL+GDPLKI
Sbjct  120   AGNAAAALMAHLAPKTKVLRDGKWIEEDASILVPGDIISIKLGDIIPADARLLEGDPLKI  179

Query  626   DQSALTGESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF  805
             DQSALTGESLPVTKG GD +YSGSTCKQGE++AVVIATGVHTFFGKAAHLVD+TNQVGHF
Sbjct  180   DQSALTGESLPVTKGSGDSVYSGSTCKQGEVKAVVIATGVHTFFGKAAHLVDTTNQVGHF  239

Query  806   QKVLTAIANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVT  985
             QKVLTAI NFCICSIAVGMV+EIVVMYPIQ R YR GIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  240   QKVLTAIGNFCICSIAVGMVVEIVVMYPIQQRGYRAGIDNLLVLLIGGIPIAMPTVLSVT  299

Query  986   MAIGSHRLAQQGAIT  1030
             MAIGSHRL+QQGAIT
Sbjct  300   MAIGSHRLSQQGAIT  314



>gb|EEC75974.1| hypothetical protein OsI_13084 [Oryza sativa Indica Group]
 gb|EEE59727.1| hypothetical protein OsJ_12166 [Oryza sativa Japonica Group]
Length=966

 Score =   471 bits (1213),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 281/325 (86%), Positives = 299/325 (92%), Gaps = 10/325 (3%)
 Frame = +2

Query  86    MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
             MAE    LDAVLKE+VDLENIPIEEVF+NL+C + GLTS+ AQ RL +FG NKLEEK+ES
Sbjct  1     MAEDKGGLDAVLKESVDLENIPIEEVFQNLKCCRQGLTSEEAQLRLQLFGPNKLEEKEES  60

Query  266   kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
             KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLL+INSTISFIEENN
Sbjct  61    KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLLINSTISFIEENN  120

Query  446   agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  625
             AGNAAAALMARLAPKAKVLR+G W+EE+A+ILVPGDIIS+KLGDIIPADARLL+GDPLKI
Sbjct  121   AGNAAAALMARLAPKAKVLRNGSWTEEEAAILVPGDIISIKLGDIIPADARLLEGDPLKI  180

Query  626   DQSALTGESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF  805
             DQSALTGESLP TKGPGDG+YSGST KQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF
Sbjct  181   DQSALTGESLPATKGPGDGVYSGSTVKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF  240

Query  806   QK----------VLTAIANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIP  955
             QK          VLTAI NFCICSIAVGM +EI+VMYPIQHR YRPGIDNLLVLLIGGIP
Sbjct  241   QKARLRSLTSVHVLTAIGNFCICSIAVGMFVEIIVMYPIQHRPYRPGIDNLLVLLIGGIP  300

Query  956   IAMPTVLSVTMAIGSHRLAQQGAIT  1030
             IAMPTVLSVTMAIGSHRL+QQGAIT
Sbjct  301   IAMPTVLSVTMAIGSHRLSQQGAIT  325



>emb|CDP02191.1| unnamed protein product [Coffea canephora]
Length=967

 Score =   470 bits (1210),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 271/315 (86%), Positives = 295/315 (94%), Gaps = 0/315 (0%)
 Frame = +2

Query  86    MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
             MA + E ++A+ KE VDLENIP+EEVFENLRCTK+GL+S+ AQ RL IFG+NKLEEK+ES
Sbjct  1     MAAQDEAMEALKKEAVDLENIPLEEVFENLRCTKEGLSSEDAQRRLQIFGYNKLEEKEES  60

Query  266   kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
             K LKFLGFMWNPLSWVMEAAA+MAIALANGGGKPPDWQDFVGI  LL+INS+ISF EENN
Sbjct  61    KVLKFLGFMWNPLSWVMEAAAVMAIALANGGGKPPDWQDFVGITILLLINSSISFYEENN  120

Query  446   agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  625
             AGNAAAALMARL+PKAKVLRDG WSE+DASILVPGDIIS+KLGDIIPADARLLDGDPLKI
Sbjct  121   AGNAAAALMARLSPKAKVLRDGSWSEQDASILVPGDIISIKLGDIIPADARLLDGDPLKI  180

Query  626   DQSALTGESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF  805
             DQSALTGESLPV+K P +G+YSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQ GHF
Sbjct  181   DQSALTGESLPVSKAPREGVYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQQGHF  240

Query  806   QKVLTAIANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVT  985
             QKVLTAI NFCICSIAVGM+ E++VMYPIQ+R YRPGIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  241   QKVLTAIGNFCICSIAVGMITEVIVMYPIQNRPYRPGIDNLLVLLIGGIPIAMPTVLSVT  300

Query  986   MAIGSHRLAQQGAIT  1030
             MAIGSHRL+ QGAIT
Sbjct  301   MAIGSHRLSLQGAIT  315



>ref|XP_010430916.1| PREDICTED: ATPase 8, plasma membrane-type-like [Camelina sativa]
Length=334

 Score =   449 bits (1155),  Expect = 3e-154, Method: Compositional matrix adjust.
 Identities = 255/307 (83%), Positives = 284/307 (93%), Gaps = 0/307 (0%)
 Frame = +2

Query  110   DAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflgf  289
             D + KE VDLE IP+EEVFE L+C+K+GL+S   ++RL+IFG NKLEEK E+KFLKFLGF
Sbjct  8     DEIKKENVDLERIPVEEVFEQLKCSKEGLSSDEGKKRLEIFGANKLEEKSENKFLKFLGF  67

Query  290   MWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaal  469
             MWNPLSWVME+AAIMAI LANGGGKPPDWQDF+GI+ LL+INSTISFIEENNAGNAAAAL
Sbjct  68    MWNPLSWVMESAAIMAIVLANGGGKPPDWQDFIGIMVLLIINSTISFIEENNAGNAAAAL  127

Query  470   marlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGE  649
             MA LAPK KVLRDG+W E++A+ILVPGD+IS+KLGDI+PADARLL GDPLKIDQSALTGE
Sbjct  128   MANLAPKTKVLRDGKWGEQEAAILVPGDLISIKLGDIVPADARLLQGDPLKIDQSALTGE  187

Query  650   SLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIA  829
             SLPVTK PGD ++SGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTN VGHFQKVLT+I 
Sbjct  188   SLPVTKHPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNNVGHFQKVLTSIG  247

Query  830   NFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRL  1009
             NFCICSI +GM+IEI++MYPIQHR YR GIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRL
Sbjct  248   NFCICSIGLGMLIEILIMYPIQHRTYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRL  307

Query  1010  AQQGAIT  1030
             +QQGAIT
Sbjct  308   SQQGAIT  314



>emb|CDY69631.1| BnaCnng64550D, partial [Brassica napus]
Length=524

 Score =   455 bits (1171),  Expect = 6e-154, Method: Compositional matrix adjust.
 Identities = 261/307 (85%), Positives = 284/307 (93%), Gaps = 0/307 (0%)
 Frame = +2

Query  110   DAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflgf  289
             D +  E VDLE IP+EEVF+ L+CTK+GL+S   ++RL+IFG NKLEEK E+KFLKFLGF
Sbjct  8     DEIKNENVDLERIPVEEVFKQLKCTKEGLSSDEGKKRLEIFGANKLEEKSENKFLKFLGF  67

Query  290   MWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaal  469
             MWNPLSWVME+AAIMAI LANGGGKPPDWQDF+GI+ LLVINSTISFIEENNAGNAAAAL
Sbjct  68    MWNPLSWVMESAAIMAIVLANGGGKPPDWQDFIGIMVLLVINSTISFIEENNAGNAAAAL  127

Query  470   marlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGE  649
             MA LAPK KVLRDG+W E+DASILVPGD+ISVKLGDI+PADARLL+GDPLKIDQSALTGE
Sbjct  128   MANLAPKTKVLRDGKWGEQDASILVPGDLISVKLGDIVPADARLLEGDPLKIDQSALTGE  187

Query  650   SLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIA  829
             SLPVTK PGD ++SGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTN VGHFQKVLTAI 
Sbjct  188   SLPVTKHPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNNVGHFQKVLTAIG  247

Query  830   NFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRL  1009
             NFCICSI +GM+IEIVVMYPIQHR YR GIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRL
Sbjct  248   NFCICSIGIGMLIEIVVMYPIQHRTYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRL  307

Query  1010  AQQGAIT  1030
             +QQGAIT
Sbjct  308   SQQGAIT  314



>ref|XP_010496530.1| PREDICTED: ATPase 8, plasma membrane-type-like, partial [Camelina 
sativa]
Length=400

 Score =   451 bits (1159),  Expect = 7e-154, Method: Compositional matrix adjust.
 Identities = 255/307 (83%), Positives = 284/307 (93%), Gaps = 0/307 (0%)
 Frame = +2

Query  110   DAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflgf  289
             D + KE VDLE IP+EEVFE L+C+K+GL+S   ++RL+IFG NKLEEK E+KFLKFLGF
Sbjct  8     DEIKKENVDLERIPVEEVFEQLKCSKEGLSSDEGKKRLEIFGANKLEEKSENKFLKFLGF  67

Query  290   MWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaal  469
             MWNPLSWVME+AAIMAI LANGGGKPPDWQDF+GI+ LL+INSTISFIEENNAGNAAAAL
Sbjct  68    MWNPLSWVMESAAIMAIVLANGGGKPPDWQDFIGIMVLLIINSTISFIEENNAGNAAAAL  127

Query  470   marlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGE  649
             MA LAPK KVLRDG+W E++A+ILVPGD+IS+KLGDI+PADARLL GDPLKIDQSALTGE
Sbjct  128   MANLAPKTKVLRDGKWGEQEAAILVPGDLISIKLGDIVPADARLLQGDPLKIDQSALTGE  187

Query  650   SLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIA  829
             SLPVTK PGD ++SGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTN VGHFQKVLT+I 
Sbjct  188   SLPVTKHPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNNVGHFQKVLTSIG  247

Query  830   NFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRL  1009
             NFCICSI +GM+IEI++MYPIQHR YR GIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRL
Sbjct  248   NFCICSIGLGMLIEILIMYPIQHRTYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRL  307

Query  1010  AQQGAIT  1030
             +QQGAIT
Sbjct  308   SQQGAIT  314



>emb|CDY67606.1| BnaAnng24780D, partial [Brassica napus]
Length=507

 Score =   454 bits (1168),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 261/307 (85%), Positives = 283/307 (92%), Gaps = 0/307 (0%)
 Frame = +2

Query  110   DAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflgf  289
             D +  E VDLE IP+EEVF+ L+CTK+GL+S   ++RL+IFG NKLEEK E+KFLKFLGF
Sbjct  8     DEIKNENVDLERIPVEEVFQQLKCTKEGLSSDEGKKRLEIFGANKLEEKSENKFLKFLGF  67

Query  290   MWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaal  469
             MWNPLSWVME+AAIMAI LANGGGKPPDWQDF+GI+ LLVINSTISFIEENNAGNAAAAL
Sbjct  68    MWNPLSWVMESAAIMAIVLANGGGKPPDWQDFIGIMVLLVINSTISFIEENNAGNAAAAL  127

Query  470   marlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGE  649
             MA LAPK KVLRDG+W E+DASILVPGD+ISVKLGDI+PADARLL GDPLKIDQSALTGE
Sbjct  128   MANLAPKTKVLRDGKWGEQDASILVPGDLISVKLGDIVPADARLLQGDPLKIDQSALTGE  187

Query  650   SLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIA  829
             SLPVTK PGD ++SGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTN VGHFQKVLTAI 
Sbjct  188   SLPVTKHPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNNVGHFQKVLTAIG  247

Query  830   NFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRL  1009
             NFCICSI +GM+IEIVVMYPIQHR YR GIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRL
Sbjct  248   NFCICSIGIGMLIEIVVMYPIQHRTYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRL  307

Query  1010  AQQGAIT  1030
             +QQGAIT
Sbjct  308   SQQGAIT  314



>ref|XP_009396235.1| PREDICTED: plasma membrane ATPase [Musa acuminata subsp. malaccensis]
Length=954

 Score =   467 bits (1202),  Expect = 3e-153, Method: Compositional matrix adjust.
 Identities = 267/308 (87%), Positives = 286/308 (93%), Gaps = 0/308 (0%)
 Frame = +2

Query  107   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  286
             L+ +  E VDLE +PIEEVFE L+CT++GLTSQ    RL IFG NKLEEKKESK LKFLG
Sbjct  9     LEEIKNENVDLERVPIEEVFEQLKCTREGLTSQEGANRLQIFGPNKLEEKKESKVLKFLG  68

Query  287   fMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaa  466
             FMWNPLSWVME AA+MAIALANGGGKPPDWQDFVGII LLVINSTISFIEENNAGNAAAA
Sbjct  69    FMWNPLSWVMEMAAVMAIALANGGGKPPDWQDFVGIIVLLVINSTISFIEENNAGNAAAA  128

Query  467   lmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTG  646
             LMA LAPK KVLRDGRWSE+DA+ILVPGDIIS+KLGDI+PADARLL+GDPLKIDQSALTG
Sbjct  129   LMAGLAPKTKVLRDGRWSEQDAAILVPGDIISIKLGDIVPADARLLEGDPLKIDQSALTG  188

Query  647   ESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAI  826
             ESLPVTK PGD ++SGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAI
Sbjct  189   ESLPVTKNPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAI  248

Query  827   ANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR  1006
              NFCICSIAVGM++EI+VMYPIQHR YR GIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR
Sbjct  249   GNFCICSIAVGMIVEIIVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR  308

Query  1007  LAQQGAIT  1030
             L++QGAIT
Sbjct  309   LSEQGAIT  316



>gb|EPS73574.1| hypothetical protein M569_01174, partial [Genlisea aurea]
Length=743

 Score =   460 bits (1184),  Expect = 4e-153, Method: Compositional matrix adjust.
 Identities = 269/316 (85%), Positives = 292/316 (92%), Gaps = 1/316 (0%)
 Frame = +2

Query  86    MAEKPEV-LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekke  262
             MAEK  + L+ +  ETVDLE +PIEEVFE LRCT++GL+S+  + RL IFG NKLEEKKE
Sbjct  1     MAEKESISLEEIKNETVDLEKVPIEEVFEKLRCTREGLSSEEGETRLHIFGPNKLEEKKE  60

Query  263   skflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEn  442
             SK LKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDF+GII LL+INSTISFIEEN
Sbjct  61    SKILKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFMGIICLLIINSTISFIEEN  120

Query  443   nagnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLK  622
             NAGNAAAALMA LAPK KVLRDGRWSE++A+ILVPGDI+S+KLGDIIPADARLL+GDPLK
Sbjct  121   NAGNAAAALMAGLAPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLK  180

Query  623   IDQSALTGESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGH  802
             +DQSALTGESLPVTK   D ++SGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGH
Sbjct  181   VDQSALTGESLPVTKESYDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGH  240

Query  803   FQKVLTAIANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSV  982
             FQKVLTAI NFCICSIAVGM+ EI+VMYPIQHREYR GIDNLLVLLIGGIPIAMPTVLSV
Sbjct  241   FQKVLTAIGNFCICSIAVGMLTEIIVMYPIQHREYRKGIDNLLVLLIGGIPIAMPTVLSV  300

Query  983   TMAIGSHRLAQQGAIT  1030
             TMAIGSHRL+QQGAIT
Sbjct  301   TMAIGSHRLSQQGAIT  316



>ref|XP_011621190.1| PREDICTED: plasma membrane ATPase 1 isoform X2 [Amborella trichopoda]
Length=953

 Score =   466 bits (1198),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 275/315 (87%), Positives = 293/315 (93%), Gaps = 0/315 (0%)
 Frame = +2

Query  86    MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
             M EK   LDAV KE VDLENIPIEEVFE+L CT++GLTS+A QERL++FG+NKLEEKKES
Sbjct  1     MDEKSIALDAVNKEAVDLENIPIEEVFESLECTQEGLTSEAVQERLELFGYNKLEEKKES  60

Query  266   kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
             K LKFLGFMWNPLSWVME+AAIMAIALANGGGK PD+ DF GI+ LLVINSTISFIEENN
Sbjct  61    KLLKFLGFMWNPLSWVMESAAIMAIALANGGGKDPDYIDFCGIVILLVINSTISFIEENN  120

Query  446   agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  625
             AGNAAAALMARLAPKAKVLRDGRWSEEDAS+LVPGDIIS+KLGDI+PADARLL+GDPLKI
Sbjct  121   AGNAAAALMARLAPKAKVLRDGRWSEEDASVLVPGDIISIKLGDIVPADARLLEGDPLKI  180

Query  626   DQSALTGESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF  805
             DQSALTGESLPVTK PGDG+YSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDST  VGHF
Sbjct  181   DQSALTGESLPVTKNPGDGVYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTTHVGHF  240

Query  806   QKVLTAIANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVT  985
             QKVLTAI NFCICSIAVGM IEIVV+Y +Q R YR GIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  241   QKVLTAIGNFCICSIAVGMAIEIVVIYGLQGRGYRVGIDNLLVLLIGGIPIAMPTVLSVT  300

Query  986   MAIGSHRLAQQGAIT  1030
             MAIGSHRL+QQGAIT
Sbjct  301   MAIGSHRLSQQGAIT  315



>ref|XP_009384769.1| PREDICTED: plasma membrane ATPase-like [Musa acuminata subsp. 
malaccensis]
Length=954

 Score =   466 bits (1198),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 267/313 (85%), Positives = 288/313 (92%), Gaps = 0/313 (0%)
 Frame = +2

Query  92    EKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskf  271
             +K   L+ +  ETVDLE IP++EVFE L+CT++GL+S     RL IFG NKLEEKKESK 
Sbjct  4     DKAISLEEIKNETVDLERIPVDEVFEQLKCTREGLSSAEGANRLQIFGPNKLEEKKESKI  63

Query  272   lkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnag  451
             LKFLGFMWNPLSWVME AA+MAIALANGGGKPPDWQDFVGI+ LLVINSTISFIEENNAG
Sbjct  64    LKFLGFMWNPLSWVMEMAAVMAIALANGGGKPPDWQDFVGIVVLLVINSTISFIEENNAG  123

Query  452   naaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQ  631
             NAAAALMA LAPK KVLRDGRWSEEDA+ILVPGDIIS+KLGDI+PADARLLDGDPLKIDQ
Sbjct  124   NAAAALMAGLAPKTKVLRDGRWSEEDAAILVPGDIISIKLGDIVPADARLLDGDPLKIDQ  183

Query  632   SALTGESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQK  811
             SALTGESLPVTK PGD ++SGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQK
Sbjct  184   SALTGESLPVTKNPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQK  243

Query  812   VLTAIANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVTMA  991
             VLTAI NFCICSIAVGM++EI+VMYPIQHR YR GIDNLLVLLIGGIPIAMPTVLSVTMA
Sbjct  244   VLTAIGNFCICSIAVGMIVEIIVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMA  303

Query  992   IGSHRLAQQGAIT  1030
             IGSHRL++QGAIT
Sbjct  304   IGSHRLSEQGAIT  316



>ref|XP_011621189.1| PREDICTED: plasma membrane ATPase 1 isoform X1 [Amborella trichopoda]
Length=963

 Score =   466 bits (1198),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 275/315 (87%), Positives = 293/315 (93%), Gaps = 0/315 (0%)
 Frame = +2

Query  86    MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
             M EK   LDAV KE VDLENIPIEEVFE+L CT++GLTS+A QERL++FG+NKLEEKKES
Sbjct  1     MDEKSIALDAVNKEAVDLENIPIEEVFESLECTQEGLTSEAVQERLELFGYNKLEEKKES  60

Query  266   kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
             K LKFLGFMWNPLSWVME+AAIMAIALANGGGK PD+ DF GI+ LLVINSTISFIEENN
Sbjct  61    KLLKFLGFMWNPLSWVMESAAIMAIALANGGGKDPDYIDFCGIVILLVINSTISFIEENN  120

Query  446   agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  625
             AGNAAAALMARLAPKAKVLRDGRWSEEDAS+LVPGDIIS+KLGDI+PADARLL+GDPLKI
Sbjct  121   AGNAAAALMARLAPKAKVLRDGRWSEEDASVLVPGDIISIKLGDIVPADARLLEGDPLKI  180

Query  626   DQSALTGESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF  805
             DQSALTGESLPVTK PGDG+YSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDST  VGHF
Sbjct  181   DQSALTGESLPVTKNPGDGVYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTTHVGHF  240

Query  806   QKVLTAIANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVT  985
             QKVLTAI NFCICSIAVGM IEIVV+Y +Q R YR GIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  241   QKVLTAIGNFCICSIAVGMAIEIVVIYGLQGRGYRVGIDNLLVLLIGGIPIAMPTVLSVT  300

Query  986   MAIGSHRLAQQGAIT  1030
             MAIGSHRL+QQGAIT
Sbjct  301   MAIGSHRLSQQGAIT  315



>emb|CDP09440.1| unnamed protein product [Coffea canephora]
Length=966

 Score =   466 bits (1198),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 270/315 (86%), Positives = 294/315 (93%), Gaps = 0/315 (0%)
 Frame = +2

Query  86    MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
             M EK   LDAV+KE VDLENIP+EEVF+NL+CT+ GL+S A +ERLD+FG NKLEEKKES
Sbjct  1     MYEKSVALDAVIKEAVDLENIPLEEVFDNLKCTRKGLSSDAVKERLDLFGFNKLEEKKES  60

Query  266   kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
             K LKFLGFMWNPLSWVMEAAAIM+IALANGGGK PD QDFVGI+ LL+INSTISFIEENN
Sbjct  61    KVLKFLGFMWNPLSWVMEAAAIMSIALANGGGKGPDIQDFVGILLLLIINSTISFIEENN  120

Query  446   agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  625
             AGNAAAALMARLAPKAKVLRDG+WSEEDAS+LVPGDIIS+KLGDI+PADARLL+GDPLKI
Sbjct  121   AGNAAAALMARLAPKAKVLRDGKWSEEDASVLVPGDIISIKLGDIVPADARLLEGDPLKI  180

Query  626   DQSALTGESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF  805
             DQSALTGESLPVTK PGDG+YSGSTCKQGEI+AVVIATGVHTFFGKAAHLV++T  VGHF
Sbjct  181   DQSALTGESLPVTKNPGDGVYSGSTCKQGEIDAVVIATGVHTFFGKAAHLVENTTHVGHF  240

Query  806   QKVLTAIANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVT  985
             QKVLTAI NFCICSIAVGM+IEI+V+Y IQ R YR GIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  241   QKVLTAIGNFCICSIAVGMLIEIIVIYAIQERSYRTGIDNLLVLLIGGIPIAMPTVLSVT  300

Query  986   MAIGSHRLAQQGAIT  1030
             MAIGSHRL+QQGAIT
Sbjct  301   MAIGSHRLSQQGAIT  315



>ref|XP_011082991.1| PREDICTED: LOW QUALITY PROTEIN: plasma membrane ATPase 1-like 
[Sesamum indicum]
Length=951

 Score =   465 bits (1196),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 273/315 (87%), Positives = 294/315 (93%), Gaps = 4/315 (1%)
 Frame = +2

Query  86    MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
             MA K E ++A+ +E VDLENIP+EEVFENLRCT++GL+S+ A  RL+IFG NKLEEK+ES
Sbjct  1     MAAKDEAMEALKREAVDLENIPLEEVFENLRCTREGLSSEDANRRLEIFGQNKLEEKEES  60

Query  266   kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
             K LKFLGFMWNPLSWVMEAAAIMAIALANGGG+PPDWQDFVGIITLLVINSTISFIEENN
Sbjct  61    KILKFLGFMWNPLSWVMEAAAIMAIALANGGGRPPDWQDFVGIITLLVINSTISFIEENN  120

Query  446   agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  625
             AGNAAAALMARLAPKAKVLRDG W+EEDA++LVPGDIIS+KLG        LL+GDPLKI
Sbjct  121   AGNAAAALMARLAPKAKVLRDGHWNEEDAAVLVPGDIISIKLG----XXXXLLEGDPLKI  176

Query  626   DQSALTGESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF  805
             DQSALTGESLPVTKGPGDG+YSGST KQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF
Sbjct  177   DQSALTGESLPVTKGPGDGVYSGSTVKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF  236

Query  806   QKVLTAIANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVT  985
             QKVLTAI NFCICSIAVGMVIEI+VMYPIQHR+YRPGIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  237   QKVLTAIGNFCICSIAVGMVIEIIVMYPIQHRDYRPGIDNLLVLLIGGIPIAMPTVLSVT  296

Query  986   MAIGSHRLAQQGAIT  1030
             MAIGSHRL+QQGAIT
Sbjct  297   MAIGSHRLSQQGAIT  311



>ref|XP_006651704.1| PREDICTED: plasma membrane ATPase 1-like [Oryza brachyantha]
Length=997

 Score =   466 bits (1199),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 283/356 (79%), Positives = 303/356 (85%), Gaps = 41/356 (12%)
 Frame = +2

Query  86    MAEKPEVLDAVLKETVDL-----------------------------------------E  142
             MAEK   LDAVLKE+VDL                                         E
Sbjct  1     MAEKEGGLDAVLKESVDLVTHASSWDGSCRVQCGFQFRVTVSARDDWSPSCAAAVRRILE  60

Query  143   NIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflgfMWNPLSWVMEa  322
             NIPIEEVF+NLRC++ GLTS+ A+ RL++FG NKLEEK+ESKFLKFLGFMWNPLSWVMEA
Sbjct  61    NIPIEEVFQNLRCSRHGLTSEEAKLRLELFGPNKLEEKEESKFLKFLGFMWNPLSWVMEA  120

Query  323   aaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVL  502
             AAIMAIALANGGGKPPDWQDFVGIITLL+INSTISFIEENNAGNAAAALMARLAPKAKVL
Sbjct  121   AAIMAIALANGGGKPPDWQDFVGIITLLLINSTISFIEENNAGNAAAALMARLAPKAKVL  180

Query  503   RDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDG  682
             RDGRW+EE+A+ILVPGDI+S+KLGDIIPADARLL+GDPLKIDQSALTGESLP TKGPGDG
Sbjct  181   RDGRWTEEEAAILVPGDIVSIKLGDIIPADARLLEGDPLKIDQSALTGESLPATKGPGDG  240

Query  683   IYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIANFCICSIAVGM  862
             +YSGST KQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAI NFCICSIAVGM
Sbjct  241   VYSGSTVKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICSIAVGM  300

Query  863   VIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLAQQGAIT  1030
              +EI+VMYPIQHR YRPGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRL+QQGAIT
Sbjct  301   FVEIIVMYPIQHRAYRPGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAIT  356



>ref|XP_002263241.1| PREDICTED: ATPase 8, plasma membrane-type [Vitis vinifera]
 emb|CBI25616.3| unnamed protein product [Vitis vinifera]
Length=952

 Score =   464 bits (1195),  Expect = 3e-152, Method: Compositional matrix adjust.
 Identities = 265/308 (86%), Positives = 287/308 (93%), Gaps = 0/308 (0%)
 Frame = +2

Query  107   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  286
             L+ +  E+VDLE IPIEEVFE L+CTKDGLTS+  + RL IFGHNKLEEKKESK LKFLG
Sbjct  7     LEEIKNESVDLERIPIEEVFEQLKCTKDGLTSEEGEHRLQIFGHNKLEEKKESKILKFLG  66

Query  287   fMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaa  466
             FMWNPLSWVME AAIMAI LANGGGKPPDWQDFVGI  LL+INSTISFIEENNAGNAAAA
Sbjct  67    FMWNPLSWVMECAAIMAIVLANGGGKPPDWQDFVGITVLLIINSTISFIEENNAGNAAAA  126

Query  467   lmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTG  646
             LMA LAPK KVLRDG+WSE++A+ILVPGD+IS+KLGDI+PADARLL+GDPLKIDQSALTG
Sbjct  127   LMAGLAPKTKVLRDGKWSEQEAAILVPGDVISIKLGDIVPADARLLEGDPLKIDQSALTG  186

Query  647   ESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAI  826
             ESLPVTK PGD ++SGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAI
Sbjct  187   ESLPVTKNPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAI  246

Query  827   ANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR  1006
              NFCICSIAVGM++EIVVMYPIQ R+YR GIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR
Sbjct  247   GNFCICSIAVGMLVEIVVMYPIQQRKYREGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR  306

Query  1007  LAQQGAIT  1030
             L++QGAIT
Sbjct  307   LSEQGAIT  314



>gb|EPS65442.1| hypothetical protein M569_09334 [Genlisea aurea]
Length=954

 Score =   464 bits (1195),  Expect = 3e-152, Method: Compositional matrix adjust.
 Identities = 273/316 (86%), Positives = 292/316 (92%), Gaps = 1/316 (0%)
 Frame = +2

Query  86    MAEKPEV-LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekke  262
             MAEK  + L+ +  ETVDLE IPIEEVFENLRCT++GL+S+  + RL IFG NKLEEKKE
Sbjct  1     MAEKASISLEEIKNETVDLEKIPIEEVFENLRCTREGLSSEEGETRLQIFGPNKLEEKKE  60

Query  263   skflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEn  442
             SK LKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGII LL+INSTISFIEEN
Sbjct  61    SKILKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIICLLLINSTISFIEEN  120

Query  443   nagnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLK  622
             NAGNAAAALMA LAPK KVLRDGRWSE+DA+ILVPGDIIS+KLGDIIPADARLL+GD LK
Sbjct  121   NAGNAAAALMAGLAPKTKVLRDGRWSEQDAAILVPGDIISIKLGDIIPADARLLEGDSLK  180

Query  623   IDQSALTGESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGH  802
             +DQSALTGESLPVTK   D ++SGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGH
Sbjct  181   VDQSALTGESLPVTKDAHDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGH  240

Query  803   FQKVLTAIANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSV  982
             FQKVLTAI NFCICSIAVGM+ EI+VMYPIQHREYR GIDNLLVLLIGGIPIAMPTVLSV
Sbjct  241   FQKVLTAIGNFCICSIAVGMLTEILVMYPIQHREYRKGIDNLLVLLIGGIPIAMPTVLSV  300

Query  983   TMAIGSHRLAQQGAIT  1030
             TMAIGSHRL+QQGAIT
Sbjct  301   TMAIGSHRLSQQGAIT  316



>dbj|BAM20990.1| plasma membrane H+-ATPase [Marchantia polymorpha]
Length=954

 Score =   464 bits (1194),  Expect = 4e-152, Method: Compositional matrix adjust.
 Identities = 270/313 (86%), Positives = 292/313 (93%), Gaps = 0/313 (0%)
 Frame = +2

Query  92    EKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskf  271
             EK    +++  ETVDLE+IP+EEVFE LRCT+ GLTS   +ERL IFGHNKLEEK ESK 
Sbjct  5     EKMSKFESINNETVDLEHIPLEEVFEQLRCTRQGLTSAEGEERLVIFGHNKLEEKSESKV  64

Query  272   lkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnag  451
             LKFLGFMWNPLSWVMEAAAIMAIALANGGG+PPDWQDFVGIITLLVINSTISFIEENNAG
Sbjct  65    LKFLGFMWNPLSWVMEAAAIMAIALANGGGRPPDWQDFVGIITLLVINSTISFIEENNAG  124

Query  452   naaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQ  631
             NAAAALMARLAPK+KVLRDG W+E+DA ILVPGDI+S+KLGDIIPADARLL+GDPLKIDQ
Sbjct  125   NAAAALMARLAPKSKVLRDGVWAEQDAVILVPGDIVSIKLGDIIPADARLLEGDPLKIDQ  184

Query  632   SALTGESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQK  811
             SALTGESLPVTK PGDG+YSGSTCKQGE+EAVVIATGVH+FFGKAAHLVDSTNQVGHFQK
Sbjct  185   SALTGESLPVTKHPGDGVYSGSTCKQGEVEAVVIATGVHSFFGKAAHLVDSTNQVGHFQK  244

Query  812   VLTAIANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVTMA  991
             VLTAI NFCICSIA+GM++EIVVM+ IQ R+YR GIDNLLVLLIGGIPIAMPTVLSVTMA
Sbjct  245   VLTAIGNFCICSIAIGMLVEIVVMFAIQDRKYRAGIDNLLVLLIGGIPIAMPTVLSVTMA  304

Query  992   IGSHRLAQQGAIT  1030
             IGSHRLAQQGAIT
Sbjct  305   IGSHRLAQQGAIT  317



>ref|XP_008781833.1| PREDICTED: plasma membrane ATPase 4 [Phoenix dactylifera]
 ref|XP_008781834.1| PREDICTED: plasma membrane ATPase 4 [Phoenix dactylifera]
Length=954

 Score =   464 bits (1194),  Expect = 4e-152, Method: Compositional matrix adjust.
 Identities = 267/308 (87%), Positives = 288/308 (94%), Gaps = 0/308 (0%)
 Frame = +2

Query  107   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  286
             L+ +  ETVDLE IPIEEVFE L+CTK+GLTS+    RL IFG NKLEEKKESK LKFLG
Sbjct  9     LEEIKNETVDLERIPIEEVFEQLKCTKEGLTSEEGANRLQIFGPNKLEEKKESKILKFLG  68

Query  287   fMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaa  466
             FMWNPLSWVME+AA+MAIALANG GKPPDWQDFVGII LLVINSTISFIEENNAGNAAAA
Sbjct  69    FMWNPLSWVMESAAVMAIALANGSGKPPDWQDFVGIIVLLVINSTISFIEENNAGNAAAA  128

Query  467   lmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTG  646
             LMA LAPK KVLRDGRWSE+DA+ILVPGDIIS+KLGDI+PADARLL+GDPLKIDQSALTG
Sbjct  129   LMAGLAPKTKVLRDGRWSEQDAAILVPGDIISIKLGDIVPADARLLEGDPLKIDQSALTG  188

Query  647   ESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAI  826
             ESLPVTK PGD ++SGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAI
Sbjct  189   ESLPVTKNPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAI  248

Query  827   ANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR  1006
              NFCICSIAVG+++EI+VMYPIQHR+YR GIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR
Sbjct  249   GNFCICSIAVGILVEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR  308

Query  1007  LAQQGAIT  1030
             L++QGAIT
Sbjct  309   LSEQGAIT  316



>gb|ERN00217.1| hypothetical protein AMTR_s00111p00107570 [Amborella trichopoda]
Length=1007

 Score =   466 bits (1198),  Expect = 4e-152, Method: Compositional matrix adjust.
 Identities = 275/315 (87%), Positives = 293/315 (93%), Gaps = 0/315 (0%)
 Frame = +2

Query  86    MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
             M EK   LDAV KE VDLENIPIEEVFE+L CT++GLTS+A QERL++FG+NKLEEKKES
Sbjct  45    MDEKSIALDAVNKEAVDLENIPIEEVFESLECTQEGLTSEAVQERLELFGYNKLEEKKES  104

Query  266   kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
             K LKFLGFMWNPLSWVME+AAIMAIALANGGGK PD+ DF GI+ LLVINSTISFIEENN
Sbjct  105   KLLKFLGFMWNPLSWVMESAAIMAIALANGGGKDPDYIDFCGIVILLVINSTISFIEENN  164

Query  446   agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  625
             AGNAAAALMARLAPKAKVLRDGRWSEEDAS+LVPGDIIS+KLGDI+PADARLL+GDPLKI
Sbjct  165   AGNAAAALMARLAPKAKVLRDGRWSEEDASVLVPGDIISIKLGDIVPADARLLEGDPLKI  224

Query  626   DQSALTGESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF  805
             DQSALTGESLPVTK PGDG+YSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDST  VGHF
Sbjct  225   DQSALTGESLPVTKNPGDGVYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTTHVGHF  284

Query  806   QKVLTAIANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVT  985
             QKVLTAI NFCICSIAVGM IEIVV+Y +Q R YR GIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  285   QKVLTAIGNFCICSIAVGMAIEIVVIYGLQGRGYRVGIDNLLVLLIGGIPIAMPTVLSVT  344

Query  986   MAIGSHRLAQQGAIT  1030
             MAIGSHRL+QQGAIT
Sbjct  345   MAIGSHRLSQQGAIT  359



>ref|XP_010928676.1| PREDICTED: plasma membrane ATPase-like [Elaeis guineensis]
Length=954

 Score =   464 bits (1194),  Expect = 4e-152, Method: Compositional matrix adjust.
 Identities = 267/308 (87%), Positives = 289/308 (94%), Gaps = 0/308 (0%)
 Frame = +2

Query  107   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  286
             L+ +  ETVDLENIPIEEVF+ L+CT++GLTS     RL +FG NKLEEKKESKFLKFLG
Sbjct  9     LEEIKNETVDLENIPIEEVFQQLKCTREGLTSDEGAHRLQLFGPNKLEEKKESKFLKFLG  68

Query  287   fMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaa  466
             FMWNPLSWVME+AAIMAIALANGGGKPPDWQDFVGI+ LLVINSTISFIEENNAGNAAAA
Sbjct  69    FMWNPLSWVMESAAIMAIALANGGGKPPDWQDFVGIVVLLVINSTISFIEENNAGNAAAA  128

Query  467   lmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTG  646
             LMA LAPK KVLRDGRW EE+A+ILVPGDIIS+KLGDI+PADARLL+GDPLKIDQSALTG
Sbjct  129   LMAGLAPKTKVLRDGRWCEEEAAILVPGDIISIKLGDIVPADARLLEGDPLKIDQSALTG  188

Query  647   ESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAI  826
             ESLPVTK PGD ++SGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAI
Sbjct  189   ESLPVTKNPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAI  248

Query  827   ANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR  1006
              NFCICSIAVGM++EI+VMYPIQHR+YR GIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR
Sbjct  249   GNFCICSIAVGMIVEIIVMYPIQHRKYRNGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR  308

Query  1007  LAQQGAIT  1030
             L++QGAIT
Sbjct  309   LSEQGAIT  316



>ref|XP_002325038.1| plasma membrane H+ ATPase family protein [Populus trichocarpa]
 gb|EEF03603.1| plasma membrane H+ ATPase family protein [Populus trichocarpa]
Length=952

 Score =   464 bits (1194),  Expect = 5e-152, Method: Compositional matrix adjust.
 Identities = 273/313 (87%), Positives = 290/313 (93%), Gaps = 0/313 (0%)
 Frame = +2

Query  92    EKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskf  271
             EK   L+ +  ETVDLE IP+EEVFE L+CTK+GL+S+    R+ IFG NKLEEKKESKF
Sbjct  2     EKATSLEEIKNETVDLERIPVEEVFEQLKCTKEGLSSEEGASRIQIFGPNKLEEKKESKF  61

Query  272   lkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnag  451
             LKFLGFMWNPLSWVMEAAAIMAIALANG GKPPDWQDFVGII LLVINSTISFIEENNAG
Sbjct  62    LKFLGFMWNPLSWVMEAAAIMAIALANGSGKPPDWQDFVGIICLLVINSTISFIEENNAG  121

Query  452   naaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQ  631
             NAAAALMA LAPK KVLRDG+W+EEDA+ILVPGDIISVKLGDIIPADARLL+GDPLKIDQ
Sbjct  122   NAAAALMAGLAPKTKVLRDGKWTEEDAAILVPGDIISVKLGDIIPADARLLEGDPLKIDQ  181

Query  632   SALTGESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQK  811
             SALTGESLPVTK PGD ++SGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQK
Sbjct  182   SALTGESLPVTKHPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQK  241

Query  812   VLTAIANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVTMA  991
             VLTAI NFCICSIAVGMVIE+VVMYPIQHR YR GIDNLLVLLIGGIPIAMPTVLSVTMA
Sbjct  242   VLTAIGNFCICSIAVGMVIELVVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMA  301

Query  992   IGSHRLAQQGAIT  1030
             IGSH+L+QQGAIT
Sbjct  302   IGSHKLSQQGAIT  314



>gb|EMS45119.1| Plasma membrane ATPase 1 [Triticum urartu]
Length=973

 Score =   464 bits (1195),  Expect = 5e-152, Method: Compositional matrix adjust.
 Identities = 281/330 (85%), Positives = 299/330 (91%), Gaps = 15/330 (5%)
 Frame = +2

Query  86    MAEKPE-VLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekke  262
             MA + E  LDAVLKE VDLE+IPI+EVFENLRC+ +GLTS+ AQ+RL IFG NKLEEK+E
Sbjct  3     MASRQEGSLDAVLKEAVDLEHIPIDEVFENLRCSHEGLTSEQAQQRLQIFGPNKLEEKEE  62

Query  263   skflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEn  442
             SKFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKP DWQDFVGIITLL+INSTISFIEEN
Sbjct  63    SKFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPSDWQDFVGIITLLLINSTISFIEEN  122

Query  443   nagnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLK  622
             NAGNAAAALMARLAPKAKVLRDGRW+EE+A++LVPGDIIS+KLGDIIPADARLLDGDPLK
Sbjct  123   NAGNAAAALMARLAPKAKVLRDGRWTEEEAAVLVPGDIISIKLGDIIPADARLLDGDPLK  182

Query  623   IDQSALTGESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGH  802
             IDQSALTGESLP TKG GDG+YSGST KQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGH
Sbjct  183   IDQSALTGESLPATKGLGDGVYSGSTVKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGH  242

Query  803   FQK--------------VLTAIANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLL  940
             FQ+              VLTAI NFCICSIAVGM IEI+VMYPIQHR YRPGIDNLLVLL
Sbjct  243   FQQASLTSLGCFHRSGTVLTAIGNFCICSIAVGMFIEIIVMYPIQHRAYRPGIDNLLVLL  302

Query  941   IGGIPIAMPTVLSVTMAIGSHRLAQQGAIT  1030
             IG IPIAMPTVLSVTMAIGSHRL+QQGAIT
Sbjct  303   IGDIPIAMPTVLSVTMAIGSHRLSQQGAIT  332



>ref|XP_010913679.1| PREDICTED: plasma membrane ATPase [Elaeis guineensis]
Length=954

 Score =   464 bits (1193),  Expect = 5e-152, Method: Compositional matrix adjust.
 Identities = 268/308 (87%), Positives = 288/308 (94%), Gaps = 0/308 (0%)
 Frame = +2

Query  107   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  286
             L+ +  ETVDLE IPIEEVFE L+CT++GLTS+    RL IFG NKLEEKKESK LKFLG
Sbjct  9     LEEIKNETVDLERIPIEEVFEQLKCTQEGLTSEEGANRLQIFGPNKLEEKKESKILKFLG  68

Query  287   fMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaa  466
             FMWNPLSWVME AAIMAIALANGGGKPPDWQDFVGII LLVINSTISFIEENNAGNAAAA
Sbjct  69    FMWNPLSWVMEMAAIMAIALANGGGKPPDWQDFVGIIALLVINSTISFIEENNAGNAAAA  128

Query  467   lmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTG  646
             LMA LAPK KVLRDGRWSE+DA+ILVPGDIIS+KLGDI+PADARLL+GDPLKIDQSALTG
Sbjct  129   LMAGLAPKTKVLRDGRWSEQDAAILVPGDIISIKLGDIVPADARLLEGDPLKIDQSALTG  188

Query  647   ESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAI  826
             ESLPVTK PGD ++SGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAI
Sbjct  189   ESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAI  248

Query  827   ANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR  1006
              NFCICSIAVG+++EI+VMYPIQHR+YR GIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR
Sbjct  249   GNFCICSIAVGIIVEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR  308

Query  1007  LAQQGAIT  1030
             L++QGAIT
Sbjct  309   LSEQGAIT  316



>ref|XP_010094202.1| Plasma membrane ATPase 4 [Morus notabilis]
 gb|EXB55378.1| Plasma membrane ATPase 4 [Morus notabilis]
Length=957

 Score =   464 bits (1194),  Expect = 5e-152, Method: Compositional matrix adjust.
 Identities = 266/308 (86%), Positives = 287/308 (93%), Gaps = 0/308 (0%)
 Frame = +2

Query  107   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  286
             L+ +  ETVDLE IPIEEVFE L+CT++GLTS+    RL IFG NKLEEKKESK LKFLG
Sbjct  9     LEEIKNETVDLERIPIEEVFEQLKCTREGLTSEEGASRLQIFGPNKLEEKKESKLLKFLG  68

Query  287   fMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaa  466
             FMWNPLSWVMEAAA+MAI LANG GKPPDWQDFVGI+ LLVINSTISFIEENNAGNAAAA
Sbjct  69    FMWNPLSWVMEAAALMAIVLANGDGKPPDWQDFVGIVCLLVINSTISFIEENNAGNAAAA  128

Query  467   lmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTG  646
             LMA LAPK KVLRDG+WSEE+A+ILVPGDIIS+KLGDIIPADARLL+GDPLK+DQSALTG
Sbjct  129   LMAGLAPKTKVLRDGKWSEEEAAILVPGDIISIKLGDIIPADARLLEGDPLKVDQSALTG  188

Query  647   ESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAI  826
             ESLPVTK PGD ++SGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAI
Sbjct  189   ESLPVTKNPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAI  248

Query  827   ANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR  1006
              NFCICSIAVGM++EI+VMYPIQHR+YR GIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR
Sbjct  249   GNFCICSIAVGMLVEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR  308

Query  1007  LAQQGAIT  1030
             L+QQGAIT
Sbjct  309   LSQQGAIT  316



>gb|EYU25317.1| hypothetical protein MIMGU_mgv1a000893mg [Erythranthe guttata]
Length=949

 Score =   464 bits (1193),  Expect = 6e-152, Method: Compositional matrix adjust.
 Identities = 268/308 (87%), Positives = 289/308 (94%), Gaps = 0/308 (0%)
 Frame = +2

Query  107   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  286
             L+ +  ETVDLE IPIEEVF  L+C+K+GLTS    +RL+IFG NKLEEKKESKFLKFLG
Sbjct  5     LEDIRNETVDLETIPIEEVFTQLKCSKEGLTSDEGAKRLEIFGPNKLEEKKESKFLKFLG  64

Query  287   fMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaa  466
             FMWNPLSWVME+AAIMAI LANGGGKPPDWQDFVGI+TLLVINSTISFIEENNAGNAAAA
Sbjct  65    FMWNPLSWVMESAAIMAIVLANGGGKPPDWQDFVGIMTLLVINSTISFIEENNAGNAAAA  124

Query  467   lmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTG  646
             LMA LAPK KVLRDG+WSE+DASILVPGD+ISVKLGDIIPADARLL+GDPLKIDQSALTG
Sbjct  125   LMAGLAPKTKVLRDGKWSEQDASILVPGDLISVKLGDIIPADARLLEGDPLKIDQSALTG  184

Query  647   ESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAI  826
             ESLPVTK PGD ++SGSTCKQGE+EAVVIATGVHTFFGKAAHLVDSTN VGHFQKVLT+I
Sbjct  185   ESLPVTKHPGDEVFSGSTCKQGELEAVVIATGVHTFFGKAAHLVDSTNNVGHFQKVLTSI  244

Query  827   ANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR  1006
              NFCICSIAVGM+IE+VVMYPIQHR+YR GIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR
Sbjct  245   GNFCICSIAVGMLIEVVVMYPIQHRKYREGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR  304

Query  1007  LAQQGAIT  1030
             L+QQGAIT
Sbjct  305   LSQQGAIT  312



>ref|XP_010545412.1| PREDICTED: ATPase 2, plasma membrane-type-like [Tarenaya hassleriana]
Length=957

 Score =   464 bits (1193),  Expect = 6e-152, Method: Compositional matrix adjust.
 Identities = 268/308 (87%), Positives = 291/308 (94%), Gaps = 0/308 (0%)
 Frame = +2

Query  107   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  286
             L+ +  ETVDLE IP+EEVF+ L+CTK+GLT+   + RL IFG NKLEEKKESKFLKFLG
Sbjct  12    LEDIRNETVDLEKIPVEEVFQQLKCTKEGLTTAEGENRLQIFGPNKLEEKKESKFLKFLG  71

Query  287   fMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaa  466
             FMWNPLSWVMEAAAIMAIALANGGG+PPDWQDFVGI+ LLVINSTISFIEENNAGNAAAA
Sbjct  72    FMWNPLSWVMEAAAIMAIALANGGGRPPDWQDFVGIVCLLVINSTISFIEENNAGNAAAA  131

Query  467   lmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTG  646
             LMA LAPK KVLRDG+WSE++A+ILVPGDI+S+KLGDIIPADARLL+GDPLK+DQSALTG
Sbjct  132   LMAGLAPKTKVLRDGKWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSALTG  191

Query  647   ESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAI  826
             ESLPVTKGPGD ++SGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAI
Sbjct  192   ESLPVTKGPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAI  251

Query  827   ANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR  1006
              NFCICSIAVGMVIEI+VMYPIQHR+YR GIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR
Sbjct  252   GNFCICSIAVGMVIEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR  311

Query  1007  LAQQGAIT  1030
             L+QQGAIT
Sbjct  312   LSQQGAIT  319



>emb|CAN64375.1| hypothetical protein VITISV_014422 [Vitis vinifera]
Length=954

 Score =   464 bits (1193),  Expect = 6e-152, Method: Compositional matrix adjust.
 Identities = 268/308 (87%), Positives = 288/308 (94%), Gaps = 0/308 (0%)
 Frame = +2

Query  107   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  286
             L+ +  ETVDLE IPIEEVFE L+CTK+GLTSQ  + RL IFG NKLEEKKESKFLKFLG
Sbjct  9     LEEIKNETVDLEKIPIEEVFEQLKCTKEGLTSQEGEARLQIFGPNKLEEKKESKFLKFLG  68

Query  287   fMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaa  466
             FMWNPLSWVMEAAA+MAI LANG G+PPDWQDFVGI+ LLVINSTISFIEENNAGNAAAA
Sbjct  69    FMWNPLSWVMEAAALMAIVLANGDGQPPDWQDFVGIVCLLVINSTISFIEENNAGNAAAA  128

Query  467   lmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTG  646
             LMA LAPK KVLRDGRWSE+DA+ILVPGDIIS+KLGDIIPADARLL+GDPLK+DQSALTG
Sbjct  129   LMAGLAPKTKVLRDGRWSEQDAAILVPGDIISIKLGDIIPADARLLEGDPLKVDQSALTG  188

Query  647   ESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAI  826
             ESLPVTK P D ++SGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAI
Sbjct  189   ESLPVTKHPSDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAI  248

Query  827   ANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR  1006
              NFCICSIAVGM++EI+VMYPIQHR+YR GIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR
Sbjct  249   GNFCICSIAVGMLVEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR  308

Query  1007  LAQQGAIT  1030
             L+QQGAIT
Sbjct  309   LSQQGAIT  316



>ref|XP_002267501.1| PREDICTED: plasma membrane ATPase 4 [Vitis vinifera]
 emb|CBI17862.3| unnamed protein product [Vitis vinifera]
Length=954

 Score =   463 bits (1192),  Expect = 7e-152, Method: Compositional matrix adjust.
 Identities = 268/308 (87%), Positives = 288/308 (94%), Gaps = 0/308 (0%)
 Frame = +2

Query  107   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  286
             L+ +  ETVDLE IPIEEVFE L+CTK+GLTSQ  + RL IFG NKLEEKKESKFLKFLG
Sbjct  9     LEEIKNETVDLEKIPIEEVFEQLKCTKEGLTSQEGEARLQIFGPNKLEEKKESKFLKFLG  68

Query  287   fMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaa  466
             FMWNPLSWVMEAAA+MAI LANG G+PPDWQDFVGI+ LLVINSTISFIEENNAGNAAAA
Sbjct  69    FMWNPLSWVMEAAALMAIVLANGDGQPPDWQDFVGIVCLLVINSTISFIEENNAGNAAAA  128

Query  467   lmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTG  646
             LMA LAPK KVLRDGRWSE+DA+ILVPGDIIS+KLGDIIPADARLL+GDPLK+DQSALTG
Sbjct  129   LMAGLAPKTKVLRDGRWSEQDAAILVPGDIISIKLGDIIPADARLLEGDPLKVDQSALTG  188

Query  647   ESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAI  826
             ESLPVTK P D ++SGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAI
Sbjct  189   ESLPVTKHPSDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAI  248

Query  827   ANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR  1006
              NFCICSIAVGM++EI+VMYPIQHR+YR GIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR
Sbjct  249   GNFCICSIAVGMLVEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR  308

Query  1007  LAQQGAIT  1030
             L+QQGAIT
Sbjct  309   LSQQGAIT  316



>ref|XP_008443886.1| PREDICTED: ATPase 8, plasma membrane-type [Cucumis melo]
Length=948

 Score =   462 bits (1190),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 268/308 (87%), Positives = 286/308 (93%), Gaps = 0/308 (0%)
 Frame = +2

Query  107   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  286
             L+ V  E +DLE IPIEEVFE L+CTK+GLT+   ++RL IFG NKLEEKKESK LKFLG
Sbjct  6     LEDVKNENIDLERIPIEEVFEQLKCTKEGLTTAEGEKRLQIFGPNKLEEKKESKLLKFLG  65

Query  287   fMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaa  466
             FMWNPLSWVME+AAIMAI LANGGGKPPDWQDFVGII LL+INSTISFIEENNAGNAAAA
Sbjct  66    FMWNPLSWVMESAAIMAIVLANGGGKPPDWQDFVGIIVLLIINSTISFIEENNAGNAAAA  125

Query  467   lmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTG  646
             LMA LAPK KVLRDG+W EE+A+ILVPGD+ISVKLGDIIPADARLL+GDPLKIDQSALTG
Sbjct  126   LMAGLAPKTKVLRDGKWKEEEAAILVPGDVISVKLGDIIPADARLLEGDPLKIDQSALTG  185

Query  647   ESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAI  826
             ESLPVTK PGD ++SGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAI
Sbjct  186   ESLPVTKHPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAI  245

Query  827   ANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR  1006
              NFCICSIAVGMVIEI+VMYPIQHR YR GIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR
Sbjct  246   GNFCICSIAVGMVIEILVMYPIQHRAYREGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR  305

Query  1007  LAQQGAIT  1030
             L+QQGAIT
Sbjct  306   LSQQGAIT  313



>ref|XP_003610081.1| Plasma membrane H+-ATPase [Medicago truncatula]
 gb|AES92278.1| plasma membrane H+-ATPase [Medicago truncatula]
Length=947

 Score =   462 bits (1190),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 266/316 (84%), Positives = 290/316 (92%), Gaps = 1/316 (0%)
 Frame = +2

Query  86    MAEKPEV-LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekke  262
             MAE   + L+ +  ETVDLE IP+EEVFE L+CTK+GL+S+    RL IFG NKLEEKK+
Sbjct  1     MAESKSISLEQIKNETVDLERIPVEEVFEQLKCTKEGLSSEEGANRLQIFGPNKLEEKKD  60

Query  263   skflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEn  442
             SK LKFLGFMWNPLSWVMEAAA+MAI LANG GKPPDWQDFVGII LLVINSTISFIEEN
Sbjct  61    SKILKFLGFMWNPLSWVMEAAALMAIGLANGNGKPPDWQDFVGIICLLVINSTISFIEEN  120

Query  443   nagnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLK  622
             NAGNAAAALMA LAPK KVLRDG+WSE++A+ILVPGDIIS+KLGDI+PADARLL+GDPLK
Sbjct  121   NAGNAAAALMAGLAPKTKVLRDGKWSEQEAAILVPGDIISIKLGDIVPADARLLEGDPLK  180

Query  623   IDQSALTGESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGH  802
             IDQSALTGESLPVT+ PGD +YSGSTCKQGE+EAVVIATGVHTFFGKAAHLVDSTNQVGH
Sbjct  181   IDQSALTGESLPVTRNPGDEVYSGSTCKQGELEAVVIATGVHTFFGKAAHLVDSTNQVGH  240

Query  803   FQKVLTAIANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSV  982
             FQKVLTAI NFCICSIAVGM+ EI+VMYPIQHR+YR GIDNLLVLLIGGIPIAMPTVLSV
Sbjct  241   FQKVLTAIGNFCICSIAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSV  300

Query  983   TMAIGSHRLAQQGAIT  1030
             TMAIGSHRL+QQGAIT
Sbjct  301   TMAIGSHRLSQQGAIT  316



>ref|XP_009347012.1| PREDICTED: plasma membrane ATPase 4-like [Pyrus x bretschneideri]
Length=955

 Score =   462 bits (1190),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 267/308 (87%), Positives = 291/308 (94%), Gaps = 0/308 (0%)
 Frame = +2

Query  107   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  286
             L+ +  ETVDLE IP+EEVFE L+C+K+GL+S+   +RL+IFG NKLEEKKESKFLKFLG
Sbjct  10    LEEIKNETVDLERIPVEEVFEQLKCSKEGLSSEEGAQRLEIFGPNKLEEKKESKFLKFLG  69

Query  287   fMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaa  466
             FMWNPLSWVMEAAA+MAIALANG G+PPDWQDFVGI+ LLVINSTISFIEENNAGNAAAA
Sbjct  70    FMWNPLSWVMEAAAVMAIALANGEGQPPDWQDFVGILCLLVINSTISFIEENNAGNAAAA  129

Query  467   lmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTG  646
             LMA LAPK KVLRDG+WSEEDA+ILVPGDIIS+KLGDI+PADARLL+GDPLKIDQSALTG
Sbjct  130   LMAGLAPKTKVLRDGKWSEEDAAILVPGDIISIKLGDIVPADARLLEGDPLKIDQSALTG  189

Query  647   ESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAI  826
             ESLPVTK PGD ++SGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAI
Sbjct  190   ESLPVTKHPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAI  249

Query  827   ANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR  1006
              NFCICSIA+GMVIEI+VMYPIQHR+YR GIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR
Sbjct  250   GNFCICSIAIGMVIEIIVMYPIQHRKYRSGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR  309

Query  1007  LAQQGAIT  1030
             L+QQGAIT
Sbjct  310   LSQQGAIT  317



>ref|XP_010942146.1| PREDICTED: plasma membrane ATPase 4-like [Elaeis guineensis]
Length=950

 Score =   462 bits (1189),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 263/308 (85%), Positives = 287/308 (93%), Gaps = 0/308 (0%)
 Frame = +2

Query  107   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  286
             L+ +  ETVDLENIP+EEVFE L+C+++GLTS   ++RL IFG NKLEEKKESK LKFLG
Sbjct  6     LEQIKNETVDLENIPVEEVFEQLKCSREGLTSAEGEQRLQIFGPNKLEEKKESKLLKFLG  65

Query  287   fMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaa  466
             FMWNPLSWVME AAIMAI LANGGGKPPDWQDFVGI+ LL+INSTISFIEENNAGNAAAA
Sbjct  66    FMWNPLSWVMEIAAIMAIVLANGGGKPPDWQDFVGIVVLLIINSTISFIEENNAGNAAAA  125

Query  467   lmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTG  646
             LMA LAPK KVLRDG+WSE++A+ILVPGDIIS+KLGDIIPADARLL+GDPLKIDQSALTG
Sbjct  126   LMAGLAPKTKVLRDGKWSEQEAAILVPGDIISIKLGDIIPADARLLEGDPLKIDQSALTG  185

Query  647   ESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAI  826
             ESLPVTK PGD ++SGSTCKQGEIEA+VIATGVHTFFGKAAHLVDSTN VGHFQKVLTAI
Sbjct  186   ESLPVTKNPGDEVFSGSTCKQGEIEAIVIATGVHTFFGKAAHLVDSTNNVGHFQKVLTAI  245

Query  827   ANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR  1006
              NFCICSIAVGM+IEI+VMYPIQHR YR GIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR
Sbjct  246   GNFCICSIAVGMLIEIIVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR  305

Query  1007  LAQQGAIT  1030
             L++QGAIT
Sbjct  306   LSEQGAIT  313



>ref|XP_012083655.1| PREDICTED: plasma membrane ATPase 1 isoform X2 [Jatropha curcas]
Length=942

 Score =   462 bits (1188),  Expect = 3e-151, Method: Compositional matrix adjust.
 Identities = 269/315 (85%), Positives = 297/315 (94%), Gaps = 0/315 (0%)
 Frame = +2

Query  86    MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
             M ++   LDAV+KE VDLENIP+EEVF++L+CTK+GL+S A QERLD+FGHNKLEEKKES
Sbjct  1     MVDESVALDAVIKEAVDLENIPLEEVFDHLKCTKNGLSSDAVQERLDLFGHNKLEEKKES  60

Query  266   kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
             K LKFLGFMWNPLSWVMEAAAIMAIALA+GGGK PD+ DFVGI+ LLVINSTISFIEENN
Sbjct  61    KILKFLGFMWNPLSWVMEAAAIMAIALAHGGGKSPDYHDFVGIVILLVINSTISFIEENN  120

Query  446   agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  625
             AGNAAAALMARLAPKAKVLRDG+WSEEDAS+LVPGDIIS+KLGDIIPADARLL+GDPLKI
Sbjct  121   AGNAAAALMARLAPKAKVLRDGKWSEEDASVLVPGDIISIKLGDIIPADARLLEGDPLKI  180

Query  626   DQSALTGESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF  805
             DQSALTGESLPVTK PGDG+YSGSTCKQGEIEAVVIATGVHTFFGKAAHLV++T+ VGHF
Sbjct  181   DQSALTGESLPVTKNPGDGVYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVENTSHVGHF  240

Query  806   QKVLTAIANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVT  985
             QKVLT+I NFCICSIA+GM++EI+V+Y IQ R YR GIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  241   QKVLTSIGNFCICSIALGMLVEIIVIYGIQERGYRVGIDNLLVLLIGGIPIAMPTVLSVT  300

Query  986   MAIGSHRLAQQGAIT  1030
             MAIGSHRL+QQGAIT
Sbjct  301   MAIGSHRLSQQGAIT  315



>ref|XP_012083654.1| PREDICTED: plasma membrane ATPase 1 isoform X1 [Jatropha curcas]
 gb|KDP28822.1| hypothetical protein JCGZ_14593 [Jatropha curcas]
Length=966

 Score =   462 bits (1189),  Expect = 4e-151, Method: Compositional matrix adjust.
 Identities = 269/315 (85%), Positives = 297/315 (94%), Gaps = 0/315 (0%)
 Frame = +2

Query  86    MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
             M ++   LDAV+KE VDLENIP+EEVF++L+CTK+GL+S A QERLD+FGHNKLEEKKES
Sbjct  1     MVDESVALDAVIKEAVDLENIPLEEVFDHLKCTKNGLSSDAVQERLDLFGHNKLEEKKES  60

Query  266   kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
             K LKFLGFMWNPLSWVMEAAAIMAIALA+GGGK PD+ DFVGI+ LLVINSTISFIEENN
Sbjct  61    KILKFLGFMWNPLSWVMEAAAIMAIALAHGGGKSPDYHDFVGIVILLVINSTISFIEENN  120

Query  446   agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  625
             AGNAAAALMARLAPKAKVLRDG+WSEEDAS+LVPGDIIS+KLGDIIPADARLL+GDPLKI
Sbjct  121   AGNAAAALMARLAPKAKVLRDGKWSEEDASVLVPGDIISIKLGDIIPADARLLEGDPLKI  180

Query  626   DQSALTGESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF  805
             DQSALTGESLPVTK PGDG+YSGSTCKQGEIEAVVIATGVHTFFGKAAHLV++T+ VGHF
Sbjct  181   DQSALTGESLPVTKNPGDGVYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVENTSHVGHF  240

Query  806   QKVLTAIANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVT  985
             QKVLT+I NFCICSIA+GM++EI+V+Y IQ R YR GIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  241   QKVLTSIGNFCICSIALGMLVEIIVIYGIQERGYRVGIDNLLVLLIGGIPIAMPTVLSVT  300

Query  986   MAIGSHRLAQQGAIT  1030
             MAIGSHRL+QQGAIT
Sbjct  301   MAIGSHRLSQQGAIT  315



>ref|XP_008223752.1| PREDICTED: plasma membrane ATPase 4 [Prunus mume]
Length=955

 Score =   462 bits (1188),  Expect = 4e-151, Method: Compositional matrix adjust.
 Identities = 268/308 (87%), Positives = 290/308 (94%), Gaps = 0/308 (0%)
 Frame = +2

Query  107   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  286
             L+ +  ETVDLE IPIEEVFE L+C+++GL+ +   +RL+IFG NKLEEKKESKFLKFLG
Sbjct  10    LEEIKNETVDLERIPIEEVFEQLKCSREGLSGEEGAQRLEIFGPNKLEEKKESKFLKFLG  69

Query  287   fMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaa  466
             FMWNPLSWVMEAAAIMAIALANG GKPPDWQDFVGI+ LLVINSTISFIEENNAGNAAAA
Sbjct  70    FMWNPLSWVMEAAAIMAIALANGDGKPPDWQDFVGIVCLLVINSTISFIEENNAGNAAAA  129

Query  467   lmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTG  646
             LMA LAPK KVLRDG+WSEEDA+ILVPGDIIS+KLGDI+PADARLL+GDPLKIDQSALTG
Sbjct  130   LMAGLAPKTKVLRDGKWSEEDAAILVPGDIISIKLGDIVPADARLLEGDPLKIDQSALTG  189

Query  647   ESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAI  826
             ESLPVTK PGD ++SGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAI
Sbjct  190   ESLPVTKNPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAI  249

Query  827   ANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR  1006
              NFCICSIAVGM++EIVVMYPIQHR+YR GIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR
Sbjct  250   GNFCICSIAVGMLVEIVVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR  309

Query  1007  LAQQGAIT  1030
             L+QQGAIT
Sbjct  310   LSQQGAIT  317



>ref|XP_003610080.1| Plasma membrane H+-ATPase [Medicago truncatula]
 gb|AES92277.1| plasma membrane H+-ATPase [Medicago truncatula]
Length=952

 Score =   461 bits (1187),  Expect = 4e-151, Method: Compositional matrix adjust.
 Identities = 266/316 (84%), Positives = 290/316 (92%), Gaps = 1/316 (0%)
 Frame = +2

Query  86    MAEKPEV-LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekke  262
             MAE   + L+ +  ETVDLE IP+EEVFE L+CTK+GL+S+    RL IFG NKLEEKK+
Sbjct  1     MAESKSISLEQIKNETVDLERIPVEEVFEQLKCTKEGLSSEEGANRLQIFGPNKLEEKKD  60

Query  263   skflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEn  442
             SK LKFLGFMWNPLSWVMEAAA+MAI LANG GKPPDWQDFVGII LLVINSTISFIEEN
Sbjct  61    SKILKFLGFMWNPLSWVMEAAALMAIGLANGNGKPPDWQDFVGIICLLVINSTISFIEEN  120

Query  443   nagnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLK  622
             NAGNAAAALMA LAPK KVLRDG+WSE++A+ILVPGDIIS+KLGDI+PADARLL+GDPLK
Sbjct  121   NAGNAAAALMAGLAPKTKVLRDGKWSEQEAAILVPGDIISIKLGDIVPADARLLEGDPLK  180

Query  623   IDQSALTGESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGH  802
             IDQSALTGESLPVT+ PGD +YSGSTCKQGE+EAVVIATGVHTFFGKAAHLVDSTNQVGH
Sbjct  181   IDQSALTGESLPVTRNPGDEVYSGSTCKQGELEAVVIATGVHTFFGKAAHLVDSTNQVGH  240

Query  803   FQKVLTAIANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSV  982
             FQKVLTAI NFCICSIAVGM+ EI+VMYPIQHR+YR GIDNLLVLLIGGIPIAMPTVLSV
Sbjct  241   FQKVLTAIGNFCICSIAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSV  300

Query  983   TMAIGSHRLAQQGAIT  1030
             TMAIGSHRL+QQGAIT
Sbjct  301   TMAIGSHRLSQQGAIT  316



>ref|XP_008789658.1| PREDICTED: plasma membrane ATPase 4-like [Phoenix dactylifera]
Length=954

 Score =   461 bits (1187),  Expect = 4e-151, Method: Compositional matrix adjust.
 Identities = 267/308 (87%), Positives = 287/308 (93%), Gaps = 0/308 (0%)
 Frame = +2

Query  107   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  286
             L+ +  ETVDLE IPIEEVF+ L+CT++GLTS     RL IFG NKLEEKKESK LKFLG
Sbjct  9     LEEIKNETVDLEKIPIEEVFQQLKCTREGLTSDEGAHRLQIFGPNKLEEKKESKVLKFLG  68

Query  287   fMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaa  466
             FMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGI+ LLVINSTISFIEENNAGNAAAA
Sbjct  69    FMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIVVLLVINSTISFIEENNAGNAAAA  128

Query  467   lmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTG  646
             LMA LAPK KVLRDGRWSEE+A+ILVPGDIIS+KLGDI+PADARLL+GDPLKIDQSALTG
Sbjct  129   LMAGLAPKTKVLRDGRWSEEEAAILVPGDIISIKLGDIVPADARLLEGDPLKIDQSALTG  188

Query  647   ESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAI  826
             ESLPVT+ PGD ++SGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAI
Sbjct  189   ESLPVTRNPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAI  248

Query  827   ANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR  1006
              NFCICSIAVGM++EI+VMYPIQHR YR GIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR
Sbjct  249   GNFCICSIAVGMIVEIIVMYPIQHRIYRSGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR  308

Query  1007  LAQQGAIT  1030
             L++QGAIT
Sbjct  309   LSEQGAIT  316



>ref|XP_010929278.1| PREDICTED: plasma membrane ATPase-like [Elaeis guineensis]
Length=953

 Score =   461 bits (1187),  Expect = 4e-151, Method: Compositional matrix adjust.
 Identities = 268/315 (85%), Positives = 291/315 (92%), Gaps = 0/315 (0%)
 Frame = +2

Query  86    MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
             M +K   L+ +  ETVDLE +PIEEVFE L+CT++GL+S+    RL IFG NKLEEKKES
Sbjct  1     MGDKGISLEEIKNETVDLERVPIEEVFEQLKCTREGLSSEEGANRLQIFGPNKLEEKKES  60

Query  266   kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
             KFLKFLGFMWNPLSWVME AAIMAIALANGGGKPPDW+DFVGI+ LL INSTISFIEENN
Sbjct  61    KFLKFLGFMWNPLSWVMEMAAIMAIALANGGGKPPDWEDFVGIVALLFINSTISFIEENN  120

Query  446   agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  625
             AGNAAAALMA LAPK KVLRDGRWSEE+A+ILVPGDIIS+KLGDIIPADARLL+GDPLKI
Sbjct  121   AGNAAAALMASLAPKTKVLRDGRWSEEEAAILVPGDIISIKLGDIIPADARLLEGDPLKI  180

Query  626   DQSALTGESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF  805
             DQSALTGESLPVTK PGD I+SGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF
Sbjct  181   DQSALTGESLPVTKNPGDEIFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF  240

Query  806   QKVLTAIANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVT  985
             QKVLTAI NFCICSIAVG+++EI+VM+PIQHR+YR GIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  241   QKVLTAIGNFCICSIAVGIIVEIIVMFPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVT  300

Query  986   MAIGSHRLAQQGAIT  1030
             MAIGSHRL+QQGAIT
Sbjct  301   MAIGSHRLSQQGAIT  315



>ref|XP_002307856.1| ATPase 6 family protein [Populus trichocarpa]
 gb|EEE91379.1| ATPase 6 family protein [Populus trichocarpa]
Length=944

 Score =   461 bits (1186),  Expect = 5e-151, Method: Compositional matrix adjust.
 Identities = 264/308 (86%), Positives = 285/308 (93%), Gaps = 0/308 (0%)
 Frame = +2

Query  107   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  286
             ++ +  E++DLE IPIEEVFE L+CTK+GL +   +ERL IFG NKLEEKKESK LKFLG
Sbjct  1     MEDIKNESIDLEKIPIEEVFEKLKCTKEGLRTTEGEERLRIFGPNKLEEKKESKILKFLG  60

Query  287   fMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaa  466
             FMWNPLSWVMEAAAIMAI LANGGGKPPDWQDFVGII LL+INSTISFIEENNAGNAAA+
Sbjct  61    FMWNPLSWVMEAAAIMAIVLANGGGKPPDWQDFVGIIVLLIINSTISFIEENNAGNAAAS  120

Query  467   lmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTG  646
             LMA LAPK KVLRDG+WSE+DA+ILVPGDIIS+KLGDIIPADARL+ GDPLKIDQSALTG
Sbjct  121   LMAGLAPKTKVLRDGKWSEQDAAILVPGDIISIKLGDIIPADARLMVGDPLKIDQSALTG  180

Query  647   ESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAI  826
             ESLPVTK PG G+YSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTN VGHFQKVLTAI
Sbjct  181   ESLPVTKYPGSGVYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNNVGHFQKVLTAI  240

Query  827   ANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR  1006
              NFCICSIA+GM+IEI+VMYPIQHR YR GIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR
Sbjct  241   GNFCICSIAIGMLIEIIVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR  300

Query  1007  LAQQGAIT  1030
             L+QQGAIT
Sbjct  301   LSQQGAIT  308



>ref|XP_007225493.1| hypothetical protein PRUPE_ppa000937mg [Prunus persica]
 gb|EMJ26692.1| hypothetical protein PRUPE_ppa000937mg [Prunus persica]
Length=955

 Score =   461 bits (1186),  Expect = 7e-151, Method: Compositional matrix adjust.
 Identities = 269/308 (87%), Positives = 289/308 (94%), Gaps = 0/308 (0%)
 Frame = +2

Query  107   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  286
             L+ +  ETVDLE IPIEEVFE L+C+++GL  +   +RL+IFG NKLEEKKESKFLKFLG
Sbjct  10    LEEIKNETVDLERIPIEEVFEQLKCSREGLNGEEGAQRLEIFGPNKLEEKKESKFLKFLG  69

Query  287   fMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaa  466
             FMWNPLSWVMEAAAIMAIALANG GKPPDWQDFVGI+ LLVINSTISFIEENNAGNAAAA
Sbjct  70    FMWNPLSWVMEAAAIMAIALANGDGKPPDWQDFVGIVCLLVINSTISFIEENNAGNAAAA  129

Query  467   lmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTG  646
             LMA LAPK KVLRDG+WSEEDA+ILVPGDIIS+KLGDI+PADARLL+GDPLKIDQSALTG
Sbjct  130   LMAGLAPKTKVLRDGKWSEEDAAILVPGDIISIKLGDIVPADARLLEGDPLKIDQSALTG  189

Query  647   ESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAI  826
             ESLPVTK PGD ++SGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAI
Sbjct  190   ESLPVTKNPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAI  249

Query  827   ANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR  1006
              NFCICSIAVGM+IEIVVMYPIQHR+YR GIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR
Sbjct  250   GNFCICSIAVGMLIEIVVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR  309

Query  1007  LAQQGAIT  1030
             L+QQGAIT
Sbjct  310   LSQQGAIT  317



>gb|KDO67286.1| hypothetical protein CISIN_1g002203mg [Citrus sinensis]
Length=675

 Score =   452 bits (1164),  Expect = 7e-151, Method: Compositional matrix adjust.
 Identities = 263/308 (85%), Positives = 285/308 (93%), Gaps = 0/308 (0%)
 Frame = +2

Query  107   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  286
             L+ +  E+VDLE IPIEEVFE L+C+++GLTS     RL +FG NKLEEKKESK LKFLG
Sbjct  9     LEEIKNESVDLERIPIEEVFEQLKCSREGLTSDEGAHRLHVFGPNKLEEKKESKVLKFLG  68

Query  287   fMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaa  466
             FMWNPLSWVMEAAAIMAIALANGGG+ PDWQDFVGII LLVINSTISFIEENNAGNAAAA
Sbjct  69    FMWNPLSWVMEAAAIMAIALANGGGRDPDWQDFVGIIVLLVINSTISFIEENNAGNAAAA  128

Query  467   lmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTG  646
             LMA LAPK KVLRDGRWSE+DASILVPGD+IS+KLGDI+PADARLL+GDPLKIDQSALTG
Sbjct  129   LMANLAPKTKVLRDGRWSEQDASILVPGDVISIKLGDIVPADARLLEGDPLKIDQSALTG  188

Query  647   ESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAI  826
             ESLPVTK P D ++SGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAI
Sbjct  189   ESLPVTKNPYDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAI  248

Query  827   ANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR  1006
              NFCICSIAVG+V EI++MYP+QHR+YR GIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR
Sbjct  249   GNFCICSIAVGIVAEIIIMYPVQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR  308

Query  1007  LAQQGAIT  1030
             L+QQGAIT
Sbjct  309   LSQQGAIT  316



>gb|EYU31795.1| hypothetical protein MIMGU_mgv1a000883mg [Erythranthe guttata]
Length=951

 Score =   461 bits (1185),  Expect = 8e-151, Method: Compositional matrix adjust.
 Identities = 265/308 (86%), Positives = 289/308 (94%), Gaps = 0/308 (0%)
 Frame = +2

Query  107   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  286
             L+A+  ET+DLE++PIEEVF  L+CT++GLTS+   +RLDIFG NKLEEK+ESKFLKFLG
Sbjct  7     LEAIKNETIDLEHMPIEEVFAELKCTREGLTSEEGAKRLDIFGPNKLEEKQESKFLKFLG  66

Query  287   fMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaa  466
             FMWNPLSWVME+AAIMAI LANGGGKPPDWQDFVGI+ LL+INSTISFIEENNAGNAAAA
Sbjct  67    FMWNPLSWVMESAAIMAIVLANGGGKPPDWQDFVGILVLLIINSTISFIEENNAGNAAAA  126

Query  467   lmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTG  646
             LMA LAPK KVLRDG+WSE+DASILVPGD+ISVKLGDIIPADARLL+GDPLKIDQSALTG
Sbjct  127   LMAGLAPKTKVLRDGKWSEQDASILVPGDLISVKLGDIIPADARLLEGDPLKIDQSALTG  186

Query  647   ESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAI  826
             ESLPVTK PG  ++SGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTN VGHFQKVLTAI
Sbjct  187   ESLPVTKHPGAEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNNVGHFQKVLTAI  246

Query  827   ANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR  1006
              NFCICSIA+GM+IEIVVMYPIQ R+YR GIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR
Sbjct  247   GNFCICSIALGMIIEIVVMYPIQRRKYREGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR  306

Query  1007  LAQQGAIT  1030
             L+QQGAIT
Sbjct  307   LSQQGAIT  314



>gb|KJB82762.1| hypothetical protein B456_013G212200 [Gossypium raimondii]
Length=758

 Score =   455 bits (1170),  Expect = 9e-151, Method: Compositional matrix adjust.
 Identities = 264/308 (86%), Positives = 288/308 (94%), Gaps = 0/308 (0%)
 Frame = +2

Query  107   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  286
             LD +  E+VDLE IPIEEVFE L+CT++GL++Q    RL +FG NKLEEKKESKFLKFLG
Sbjct  9     LDEIKNESVDLERIPIEEVFEQLKCTREGLSTQEGNNRLQVFGPNKLEEKKESKFLKFLG  68

Query  287   fMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaa  466
             FMWNPLSWVMEAAAIMAIALANGGG+PPDWQDFVGII LLVINSTISFIEENNAGNAAAA
Sbjct  69    FMWNPLSWVMEAAAIMAIALANGGGRPPDWQDFVGIIVLLVINSTISFIEENNAGNAAAA  128

Query  467   lmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTG  646
             LMA LAPK KVLRDGRWSE++A+ILVPGDII++KLGDI+PADARLL+GDPLKIDQSALTG
Sbjct  129   LMANLAPKTKVLRDGRWSEQEAAILVPGDIITIKLGDIVPADARLLEGDPLKIDQSALTG  188

Query  647   ESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAI  826
             ESLPVTK P D ++SGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQ+VLTAI
Sbjct  189   ESLPVTKNPSDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQQVLTAI  248

Query  827   ANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR  1006
              NFCICSIAVG+VIE++VMYPIQ R+YR GIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR
Sbjct  249   GNFCICSIAVGIVIELIVMYPIQRRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR  308

Query  1007  LAQQGAIT  1030
             L+QQGAIT
Sbjct  309   LSQQGAIT  316



>ref|XP_004146701.1| PREDICTED: ATPase 8, plasma membrane-type [Cucumis sativus]
Length=948

 Score =   460 bits (1184),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 266/308 (86%), Positives = 285/308 (93%), Gaps = 0/308 (0%)
 Frame = +2

Query  107   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  286
             L+ V  E +DLE IP+EEVFE L+CTK+GL++   ++RL IFG NKLEEKKESK LKFLG
Sbjct  6     LEDVKNENIDLERIPVEEVFEQLKCTKEGLSTAEGEKRLQIFGPNKLEEKKESKLLKFLG  65

Query  287   fMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaa  466
             FMWNPLSWVME AAIMAI LANGGGKPPDWQDFVGII LL+INSTISFIEENNAGNAAAA
Sbjct  66    FMWNPLSWVMECAAIMAIVLANGGGKPPDWQDFVGIIVLLIINSTISFIEENNAGNAAAA  125

Query  467   lmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTG  646
             LMA LAPK KVLRDG+W EE+A+ILVPGD+ISVKLGDIIPADARLL+GDPLKIDQSALTG
Sbjct  126   LMAGLAPKTKVLRDGKWKEEEAAILVPGDVISVKLGDIIPADARLLEGDPLKIDQSALTG  185

Query  647   ESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAI  826
             ESLPVTK PGD ++SGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAI
Sbjct  186   ESLPVTKHPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAI  245

Query  827   ANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR  1006
              NFCICSIAVGMVIEI+VMYPIQHR YR GIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR
Sbjct  246   GNFCICSIAVGMVIEILVMYPIQHRAYREGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR  305

Query  1007  LAQQGAIT  1030
             L+QQGAIT
Sbjct  306   LSQQGAIT  313



>gb|KDO61837.1| hypothetical protein CISIN_1g002208mg [Citrus sinensis]
Length=953

 Score =   460 bits (1184),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 267/315 (85%), Positives = 290/315 (92%), Gaps = 0/315 (0%)
 Frame = +2

Query  86    MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
             M +K   L+ +  ETVDLE IPIEEVFE L+CT++GL+S     RL IFG NKLEEKKES
Sbjct  1     MGDKAISLEEIKNETVDLERIPIEEVFEQLKCTREGLSSTEGANRLQIFGPNKLEEKKES  60

Query  266   kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
             K LKFLGFMWNPLSWVMEAAA+MAIALANG GKPPDWQDFVGI+ LLVINSTISFIEENN
Sbjct  61    KILKFLGFMWNPLSWVMEAAAVMAIALANGEGKPPDWQDFVGIVCLLVINSTISFIEENN  120

Query  446   agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  625
             AGNAAAALMA LAPK K+LRDG+WSEE+A+ILVPGDIIS+KLGDIIPADARLL+GDPLK+
Sbjct  121   AGNAAAALMAGLAPKTKLLRDGKWSEEEAAILVPGDIISIKLGDIIPADARLLEGDPLKV  180

Query  626   DQSALTGESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF  805
             DQSALTGESLPVTK PGD ++SGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF
Sbjct  181   DQSALTGESLPVTKNPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF  240

Query  806   QKVLTAIANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVT  985
             QKVLTAI NFCICSIAVGM++EI+VMYPIQHR+YR GIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  241   QKVLTAIGNFCICSIAVGMLVEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVT  300

Query  986   MAIGSHRLAQQGAIT  1030
             MAIGSHRL+QQGAIT
Sbjct  301   MAIGSHRLSQQGAIT  315



>ref|NP_001292777.1| proton-exporting ATPase4 [Zea mays]
 gb|AFW59712.1| plasma membrane H+-transporting ATPase-like protein [Zea mays]
Length=951

 Score =   460 bits (1184),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 260/308 (84%), Positives = 289/308 (94%), Gaps = 0/308 (0%)
 Frame = +2

Query  107   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  286
             L+ +  E VDLENIPIEEVFE L+CT++GL+S   Q+RL+IFG N+LEEKKESK LKFLG
Sbjct  4     LEEIKNEAVDLENIPIEEVFEQLKCTREGLSSSEGQQRLEIFGPNRLEEKKESKILKFLG  63

Query  287   fMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaa  466
             FMWNPLSWVME AA+MAIALANGGGKPPDW+DFVGII LLVINSTISFIEENNAGNAAAA
Sbjct  64    FMWNPLSWVMEMAAVMAIALANGGGKPPDWEDFVGIIVLLVINSTISFIEENNAGNAAAA  123

Query  467   lmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTG  646
             LMA LAPK KVLRDGRW E++A+ILVPGDI+S+KLGDI+PADARLL+GDPLK+DQSALTG
Sbjct  124   LMANLAPKTKVLRDGRWGEQEAAILVPGDIVSIKLGDIVPADARLLEGDPLKVDQSALTG  183

Query  647   ESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAI  826
             ESLPVTKGPGD ++SGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQ+VLTAI
Sbjct  184   ESLPVTKGPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQQVLTAI  243

Query  827   ANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR  1006
              NFCICSIAVG+V+EI+VM+PIQHR YR GI+NLLVLLIGGIPIAMPTVLSVTMAIGSH+
Sbjct  244   GNFCICSIAVGIVVEIIVMFPIQHRRYRSGIENLLVLLIGGIPIAMPTVLSVTMAIGSHK  303

Query  1007  LAQQGAIT  1030
             L+QQGAIT
Sbjct  304   LSQQGAIT  311



>gb|KCW80694.1| hypothetical protein EUGRSUZ_C02092 [Eucalyptus grandis]
Length=815

 Score =   456 bits (1173),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 260/308 (84%), Positives = 286/308 (93%), Gaps = 0/308 (0%)
 Frame = +2

Query  107   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  286
             L+ +  ETVDLE IP+EEVFE L+CT++GL+S     RL +FG NKLEEKKESK LKFLG
Sbjct  9     LEEIKNETVDLEKIPVEEVFEQLKCTREGLSSDEGAHRLQVFGPNKLEEKKESKILKFLG  68

Query  287   fMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaa  466
             FMWNPLSWVMEAAA+MAIALANGGG+PPDWQDFVGII LL+INSTISFIEENNAGNAAAA
Sbjct  69    FMWNPLSWVMEAAALMAIALANGGGRPPDWQDFVGIIVLLLINSTISFIEENNAGNAAAA  128

Query  467   lmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTG  646
             LMA LAPK KVLRDGRWSE+DA++LVPGDIIS+KLGDI+PADARLL+GDPLKIDQSALTG
Sbjct  129   LMAGLAPKTKVLRDGRWSEQDAAMLVPGDIISIKLGDIVPADARLLEGDPLKIDQSALTG  188

Query  647   ESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAI  826
             ESLPVTK P D ++SGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAI
Sbjct  189   ESLPVTKNPSDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAI  248

Query  827   ANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR  1006
              NFCICSIA+G+ +E++VMYPIQHR+YR GIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR
Sbjct  249   GNFCICSIAIGIAVELIVMYPIQHRKYREGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR  308

Query  1007  LAQQGAIT  1030
             L+QQGAIT
Sbjct  309   LSQQGAIT  316



>ref|XP_006845683.1| PREDICTED: plasma membrane ATPase 4 [Amborella trichopoda]
 gb|ERN07358.1| hypothetical protein AMTR_s00019p00234460 [Amborella trichopoda]
Length=950

 Score =   460 bits (1183),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 263/308 (85%), Positives = 283/308 (92%), Gaps = 0/308 (0%)
 Frame = +2

Query  107   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  286
             L+ +  E VDLE+IPIEEVFE L+C+K+GLTS     RL IFG NKLEEKKESK LKFLG
Sbjct  5     LEQIKNEAVDLEHIPIEEVFEQLKCSKEGLTSDEGANRLQIFGPNKLEEKKESKILKFLG  64

Query  287   fMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaa  466
             FMWNPLSWVME AA+MAI LANG GKPPDWQDFVGI+ LLVINSTISFIEENNAGNAAAA
Sbjct  65    FMWNPLSWVMEMAALMAIVLANGQGKPPDWQDFVGIVALLVINSTISFIEENNAGNAAAA  124

Query  467   lmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTG  646
             LMA LAPK KVLRDGRWSE+DA+ILVPGDIIS+KLGDI+PADARLL+GDPLKIDQSALTG
Sbjct  125   LMAGLAPKTKVLRDGRWSEQDAAILVPGDIISIKLGDIVPADARLLEGDPLKIDQSALTG  184

Query  647   ESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAI  826
             ESLPVTK PGD ++SGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAI
Sbjct  185   ESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAI  244

Query  827   ANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR  1006
              NFCICSIA+GM++EI+VMYPIQ R YR GIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR
Sbjct  245   GNFCICSIAIGMIVEIIVMYPIQRRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR  304

Query  1007  LAQQGAIT  1030
             L+QQGAIT
Sbjct  305   LSQQGAIT  312



>ref|XP_008784794.1| PREDICTED: plasma membrane ATPase 4-like isoform X2 [Phoenix 
dactylifera]
Length=950

 Score =   460 bits (1183),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 261/308 (85%), Positives = 285/308 (93%), Gaps = 0/308 (0%)
 Frame = +2

Query  107   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  286
             L+ +  ETVDLENIP+EEVFE L+C+++GLTS   ++RL IFG NKLEEKKE K LKFLG
Sbjct  6     LEQIKNETVDLENIPVEEVFEQLKCSREGLTSAEGEQRLQIFGPNKLEEKKECKLLKFLG  65

Query  287   fMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaa  466
             FMWNPLSWVME AAIMAI LANGGGKPPDWQDFVGI+ LL+INSTISFIEENNAGNAAAA
Sbjct  66    FMWNPLSWVMEIAAIMAIVLANGGGKPPDWQDFVGIVVLLIINSTISFIEENNAGNAAAA  125

Query  467   lmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTG  646
             LMA LAPK KVLRDG+WSE++A+ILVPGDIIS+KLGDIIPADARLL+GDPLKIDQSALTG
Sbjct  126   LMAGLAPKTKVLRDGKWSEQEAAILVPGDIISIKLGDIIPADARLLEGDPLKIDQSALTG  185

Query  647   ESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAI  826
             ESLP TK PGD ++SGSTCKQGEIEA+VIATGVHTFFGKAAHLVDSTN VGHFQKVLTAI
Sbjct  186   ESLPATKNPGDEVFSGSTCKQGEIEAIVIATGVHTFFGKAAHLVDSTNNVGHFQKVLTAI  245

Query  827   ANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR  1006
              NFCICSIAVGM+IEI+VMYPIQHR YR GIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR
Sbjct  246   GNFCICSIAVGMLIEIIVMYPIQHRNYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR  305

Query  1007  LAQQGAIT  1030
             L++QGAIT
Sbjct  306   LSEQGAIT  313



>ref|XP_008451563.1| PREDICTED: plasma membrane ATPase 4 [Cucumis melo]
Length=954

 Score =   459 bits (1182),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 267/308 (87%), Positives = 288/308 (94%), Gaps = 0/308 (0%)
 Frame = +2

Query  107   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  286
             L+ +  ETVDLE IPIEEVFE L+CT++GL+SQ  + RL IFG NKLEEKKESK LKFLG
Sbjct  9     LEEIKNETVDLEKIPIEEVFEQLKCTREGLSSQEGENRLQIFGPNKLEEKKESKILKFLG  68

Query  287   fMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaa  466
             FMWNPLSWVMEAAAIMAIALANGGG+ PDWQDFVGI+ LLVINSTISFIEENNAGNAAAA
Sbjct  69    FMWNPLSWVMEAAAIMAIALANGGGRGPDWQDFVGIVCLLVINSTISFIEENNAGNAAAA  128

Query  467   lmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTG  646
             LMA LAPK KVLRDG+W E+DASILVPGD+ISVKLGDIIPADARLL+GDPLK+DQSALTG
Sbjct  129   LMAGLAPKTKVLRDGKWCEQDASILVPGDVISVKLGDIIPADARLLEGDPLKVDQSALTG  188

Query  647   ESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAI  826
             ESLPVTK PGD ++SGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAI
Sbjct  189   ESLPVTKNPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAI  248

Query  827   ANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR  1006
              NFCICSIA+GM+IEI+VMYPIQHREYR GIDNLLVLLIGGIPIAMPTVLSVTMAIGSH+
Sbjct  249   GNFCICSIAIGMLIEILVMYPIQHREYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHK  308

Query  1007  LAQQGAIT  1030
             L+QQGAIT
Sbjct  309   LSQQGAIT  316



>gb|AFW59711.1| plasma membrane H+-transporting ATPase-like protein [Zea mays]
Length=961

 Score =   459 bits (1182),  Expect = 3e-150, Method: Compositional matrix adjust.
 Identities = 260/308 (84%), Positives = 289/308 (94%), Gaps = 0/308 (0%)
 Frame = +2

Query  107   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  286
             L+ +  E VDLENIPIEEVFE L+CT++GL+S   Q+RL+IFG N+LEEKKESK LKFLG
Sbjct  14    LEEIKNEAVDLENIPIEEVFEQLKCTREGLSSSEGQQRLEIFGPNRLEEKKESKILKFLG  73

Query  287   fMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaa  466
             FMWNPLSWVME AA+MAIALANGGGKPPDW+DFVGII LLVINSTISFIEENNAGNAAAA
Sbjct  74    FMWNPLSWVMEMAAVMAIALANGGGKPPDWEDFVGIIVLLVINSTISFIEENNAGNAAAA  133

Query  467   lmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTG  646
             LMA LAPK KVLRDGRW E++A+ILVPGDI+S+KLGDI+PADARLL+GDPLK+DQSALTG
Sbjct  134   LMANLAPKTKVLRDGRWGEQEAAILVPGDIVSIKLGDIVPADARLLEGDPLKVDQSALTG  193

Query  647   ESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAI  826
             ESLPVTKGPGD ++SGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQ+VLTAI
Sbjct  194   ESLPVTKGPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQQVLTAI  253

Query  827   ANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR  1006
              NFCICSIAVG+V+EI+VM+PIQHR YR GI+NLLVLLIGGIPIAMPTVLSVTMAIGSH+
Sbjct  254   GNFCICSIAVGIVVEIIVMFPIQHRRYRSGIENLLVLLIGGIPIAMPTVLSVTMAIGSHK  313

Query  1007  LAQQGAIT  1030
             L+QQGAIT
Sbjct  314   LSQQGAIT  321



>ref|XP_011043940.1| PREDICTED: LOW QUALITY PROTEIN: plasma membrane ATPase 4 [Populus 
euphratica]
Length=952

 Score =   459 bits (1182),  Expect = 3e-150, Method: Compositional matrix adjust.
 Identities = 270/313 (86%), Positives = 288/313 (92%), Gaps = 0/313 (0%)
 Frame = +2

Query  92    EKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskf  271
             EK   L+ +  ETVDLE IP+EEVFE L+CTK+GL+S+    R+ IFG NKLEEKKESK 
Sbjct  2     EKATSLEEIKNETVDLERIPVEEVFEQLKCTKEGLSSEEGASRIQIFGPNKLEEKKESKI  61

Query  272   lkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnag  451
             LKFLGFMWNPLSWVMEAAAIMAIALANG GKPPDWQDFVGII LLVINSTISFIEENNAG
Sbjct  62    LKFLGFMWNPLSWVMEAAAIMAIALANGSGKPPDWQDFVGIICLLVINSTISFIEENNAG  121

Query  452   naaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQ  631
             NAAAALMA LAPK KVLRDG+W+EEDA+ILVPGDIISVKLGDIIPADARLL+GDPLKIDQ
Sbjct  122   NAAAALMAGLAPKTKVLRDGKWTEEDAAILVPGDIISVKLGDIIPADARLLEGDPLKIDQ  181

Query  632   SALTGESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQK  811
             SALTGESLPVT+ PGD ++SGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQ 
Sbjct  182   SALTGESLPVTRHPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQM  241

Query  812   VLTAIANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVTMA  991
             VLTAI NFCICSIAVGMVIE+VVMYPIQHR YR GIDNLLVLLIGGIPIAMPTVLSVTMA
Sbjct  242   VLTAIGNFCICSIAVGMVIELVVMYPIQHRGYRDGIDNLLVLLIGGIPIAMPTVLSVTMA  301

Query  992   IGSHRLAQQGAIT  1030
             IGSH+L+QQGAIT
Sbjct  302   IGSHKLSQQGAIT  314



>ref|XP_004507873.1| PREDICTED: plasma membrane ATPase 4-like [Cicer arietinum]
Length=952

 Score =   459 bits (1182),  Expect = 3e-150, Method: Compositional matrix adjust.
 Identities = 265/314 (84%), Positives = 289/314 (92%), Gaps = 0/314 (0%)
 Frame = +2

Query  89    AEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkesk  268
             A K   L+ +  ETVDLE IP+EEVFE L+CTK+GL+S+    RL IFG NKLEEKKESK
Sbjct  3     ANKSISLEEIKNETVDLERIPVEEVFEQLKCTKEGLSSEEGANRLQIFGPNKLEEKKESK  62

Query  269   flkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnna  448
             FLKFLGFMWNPLSWVMEAAA+MAI LANG GKPPDWQDFVGI+ LLVINSTISFIEENNA
Sbjct  63    FLKFLGFMWNPLSWVMEAAALMAIGLANGDGKPPDWQDFVGIVCLLVINSTISFIEENNA  122

Query  449   gnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKID  628
             GNAAAALMA LAPK KVLRDG+W+E++A+ILVPGDIIS+KLGDI+PADARLL+GDPLKID
Sbjct  123   GNAAAALMAGLAPKTKVLRDGKWTEQEAAILVPGDIISIKLGDIVPADARLLEGDPLKID  182

Query  629   QSALTGESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQ  808
             QSALTGESLPVT+ PGD ++SGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQ
Sbjct  183   QSALTGESLPVTRNPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQ  242

Query  809   KVLTAIANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVTM  988
             KVLTAI NFCICSIAVGM+ EI+VMYPIQHR+YR GIDNLLVLLIGGIPIAMPTVLSVTM
Sbjct  243   KVLTAIGNFCICSIAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTM  302

Query  989   AIGSHRLAQQGAIT  1030
             AIGSHRL+QQGAIT
Sbjct  303   AIGSHRLSQQGAIT  316



>gb|AAB84202.2| plasma membrane proton ATPase [Kosteletzkya virginica]
Length=954

 Score =   459 bits (1181),  Expect = 3e-150, Method: Compositional matrix adjust.
 Identities = 267/308 (87%), Positives = 287/308 (93%), Gaps = 0/308 (0%)
 Frame = +2

Query  107   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  286
             L+ +  ETVDLE IPIEEVFE L+CTK+GL+S+    RL IFG NKLEEKKESK LKFLG
Sbjct  9     LEEIRNETVDLEKIPIEEVFEQLKCTKEGLSSEEGANRLQIFGPNKLEEKKESKILKFLG  68

Query  287   fMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaa  466
             FMWNPLSWVMEAAAIMAIALANG GKPPDWQDFVGI+ LLVINSTISFIEENNAGNAAAA
Sbjct  69    FMWNPLSWVMEAAAIMAIALANGEGKPPDWQDFVGIVCLLVINSTISFIEENNAGNAAAA  128

Query  467   lmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTG  646
             LMA LAPK KVLRDG+WSE++A+ILVPGDIISVKLGDIIPADARLL+GDPLK+DQSALTG
Sbjct  129   LMAGLAPKTKVLRDGKWSEQEAAILVPGDIISVKLGDIIPADARLLEGDPLKVDQSALTG  188

Query  647   ESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAI  826
             ESLPVTK PG  ++SGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAI
Sbjct  189   ESLPVTKHPGQEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAI  248

Query  827   ANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR  1006
              NFCICSIAVGM++EI+VMYPIQHR+YR GIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR
Sbjct  249   GNFCICSIAVGMLVEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR  308

Query  1007  LAQQGAIT  1030
             L+QQGAIT
Sbjct  309   LSQQGAIT  316



>ref|XP_011017965.1| PREDICTED: ATPase 8, plasma membrane-type-like [Populus euphratica]
Length=949

 Score =   459 bits (1181),  Expect = 3e-150, Method: Compositional matrix adjust.
 Identities = 265/308 (86%), Positives = 289/308 (94%), Gaps = 0/308 (0%)
 Frame = +2

Query  107   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  286
             L+ +  E +DLE IP+EEVF+ LRCT++GLTS   +ERL IFG NKLEEKKESKFLKFLG
Sbjct  6     LEQIKNENIDLERIPVEEVFDQLRCTREGLTSAQGEERLKIFGPNKLEEKKESKFLKFLG  65

Query  287   fMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaa  466
             FMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGI+ LL+INSTISFIEENNAGNAAAA
Sbjct  66    FMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIVVLLIINSTISFIEENNAGNAAAA  125

Query  467   lmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTG  646
             LMA LAPK KVLRDG+WSE+DA+ILVPGD+IS+KLGDIIPADARL++GDPLKIDQSALTG
Sbjct  126   LMAGLAPKTKVLRDGKWSEQDAAILVPGDLISIKLGDIIPADARLMEGDPLKIDQSALTG  185

Query  647   ESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAI  826
             ESLPVTK PGDGI+SGSTCKQGEIEAVVIATGVHTFFGKAAHLVD+TN VGHFQKVLTAI
Sbjct  186   ESLPVTKNPGDGIFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDNTNNVGHFQKVLTAI  245

Query  827   ANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR  1006
              NFCICSIA+GM+IEI+VMYPIQ+R YR GIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR
Sbjct  246   GNFCICSIAIGMLIEIIVMYPIQNRRYREGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR  305

Query  1007  LAQQGAIT  1030
             L+QQGAIT
Sbjct  306   LSQQGAIT  313



>gb|AEQ27822.1| PM H+-ATPase R [Eichhornia crassipes]
Length=950

 Score =   459 bits (1181),  Expect = 3e-150, Method: Compositional matrix adjust.
 Identities = 265/308 (86%), Positives = 283/308 (92%), Gaps = 0/308 (0%)
 Frame = +2

Query  107   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  286
             L+ +  ETVDLE IPIEEVFE L+CTK+GLTS+    RL IFG NKLEEKKESK LKFL 
Sbjct  5     LEEIKNETVDLERIPIEEVFEQLKCTKEGLTSEEGANRLQIFGPNKLEEKKESKILKFLL  64

Query  287   fMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaa  466
             FMWNPLSWVME AAIMAIALANG GKPPDWQDFVGII LL+INSTISFIEENNAGNAAAA
Sbjct  65    FMWNPLSWVMEMAAIMAIALANGQGKPPDWQDFVGIIVLLLINSTISFIEENNAGNAAAA  124

Query  467   lmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTG  646
             LMA LAPK KVLRDG WSE+DA+ILVPGDIIS+KLGDI+PADARLLDGDPLKIDQSALTG
Sbjct  125   LMAGLAPKTKVLRDGSWSEQDAAILVPGDIISIKLGDIVPADARLLDGDPLKIDQSALTG  184

Query  647   ESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAI  826
             ESLPVTK PGD +++GSTCKQGEIEAVVIATGVHTFFGKAAHLVDS NQVGHFQKVLTAI
Sbjct  185   ESLPVTKNPGDEVFTGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSANQVGHFQKVLTAI  244

Query  827   ANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR  1006
              NFCICSIA+G+V+EI+VMYPIQHR YR GIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR
Sbjct  245   GNFCICSIALGIVVEIIVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR  304

Query  1007  LAQQGAIT  1030
             L+QQGAIT
Sbjct  305   LSQQGAIT  312



>ref|NP_001274848.1| plasma membrane ATPase 4-like [Solanum tuberosum]
 emb|CAA54045.1| H(+)-transporting ATPase [Solanum tuberosum]
Length=952

 Score =   459 bits (1181),  Expect = 4e-150, Method: Compositional matrix adjust.
 Identities = 267/308 (87%), Positives = 286/308 (93%), Gaps = 0/308 (0%)
 Frame = +2

Query  107   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  286
             L+ +  ETVDLE IPIEEVFE L+C+++GLTS     RL IFG NKLEEKKESK LKFLG
Sbjct  7     LEEIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNKLEEKKESKILKFLG  66

Query  287   fMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaa  466
             FMWNPLSWVMEAAAIMAIALANG GKPPDWQDFVGI+ LLVINSTISFIEENNAGNAAAA
Sbjct  67    FMWNPLSWVMEAAAIMAIALANGNGKPPDWQDFVGIVCLLVINSTISFIEENNAGNAAAA  126

Query  467   lmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTG  646
             LMA LAPK KVLRDGRWSE++A+ILVPGDIISVKLGDI+PADARLL+GDPLKIDQSALTG
Sbjct  127   LMAGLAPKTKVLRDGRWSEQEAAILVPGDIISVKLGDIVPADARLLEGDPLKIDQSALTG  186

Query  647   ESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAI  826
             ESLPVTK PGD ++SGSTCKQGE+EAVVIATGVHTFFGKAAHLVDSTN VGHFQKVLTAI
Sbjct  187   ESLPVTKNPGDEVFSGSTCKQGELEAVVIATGVHTFFGKAAHLVDSTNNVGHFQKVLTAI  246

Query  827   ANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR  1006
              NFCICSIAVGM+IEI+VMYPIQHR+YR GIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR
Sbjct  247   GNFCICSIAVGMLIEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR  306

Query  1007  LAQQGAIT  1030
             L+QQGAIT
Sbjct  307   LSQQGAIT  314



>ref|XP_002282619.1| PREDICTED: plasma membrane ATPase 4 [Vitis vinifera]
Length=954

 Score =   459 bits (1180),  Expect = 4e-150, Method: Compositional matrix adjust.
 Identities = 267/314 (85%), Positives = 290/314 (92%), Gaps = 0/314 (0%)
 Frame = +2

Query  89    AEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkesk  268
             A+K   L+ +  E+VDLE IPIEEVFE L+C+++GLTS     RL IFG NKLEEKKESK
Sbjct  3     ADKSIGLEEIKNESVDLERIPIEEVFEQLKCSREGLTSDEGASRLQIFGPNKLEEKKESK  62

Query  269   flkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnna  448
              LKFLGFMWNPLSWVMEAAAIMAIALANGGG+PPDWQDFVGII LL+INSTISFIEENNA
Sbjct  63    VLKFLGFMWNPLSWVMEAAAIMAIALANGGGQPPDWQDFVGIIVLLLINSTISFIEENNA  122

Query  449   gnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKID  628
             GNAAAALMA LAPK KVLRDGRW+E+DA+ILVPGDIIS+KLGDI+PADARLL+GDPLKID
Sbjct  123   GNAAAALMAGLAPKTKVLRDGRWTEQDAAILVPGDIISIKLGDIVPADARLLEGDPLKID  182

Query  629   QSALTGESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQ  808
             QSALTGESLPVTK P D ++SGSTCKQGEI+AVVIATGVHTFFGKAAHLVDSTNQVGHFQ
Sbjct  183   QSALTGESLPVTKNPSDEVFSGSTCKQGEIDAVVIATGVHTFFGKAAHLVDSTNQVGHFQ  242

Query  809   KVLTAIANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVTM  988
             KVLTAI NFCICSIAVGM+IEI+VMYPIQHR+YR GIDNLLVLLIGGIPIAMPTVLSVTM
Sbjct  243   KVLTAIGNFCICSIAVGMIIEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTM  302

Query  989   AIGSHRLAQQGAIT  1030
             AIGSHRL+QQGAIT
Sbjct  303   AIGSHRLSQQGAIT  316



>ref|XP_012075128.1| PREDICTED: plasma membrane ATPase 4 [Jatropha curcas]
 gb|KDP35383.1| hypothetical protein JCGZ_10367 [Jatropha curcas]
Length=952

 Score =   459 bits (1180),  Expect = 4e-150, Method: Compositional matrix adjust.
 Identities = 268/312 (86%), Positives = 289/312 (93%), Gaps = 0/312 (0%)
 Frame = +2

Query  95    KPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskfl  274
             K   L+ +  ETVDLE IPI+EVFE L+CT++GL+S+    RL IFG NKLEEKKESK L
Sbjct  3     KSITLEEIKNETVDLERIPIDEVFEQLKCTREGLSSEEGANRLQIFGPNKLEEKKESKIL  62

Query  275   kflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnagn  454
             KFLGFMWNPLSWVMEAAAIMAIALANG GKPPDWQDFVGI+ LLVINSTISFIEENNAGN
Sbjct  63    KFLGFMWNPLSWVMEAAAIMAIALANGDGKPPDWQDFVGIMCLLVINSTISFIEENNAGN  122

Query  455   aaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQS  634
             AAAALMA LAPK KVLRDG+WSEE+A+ILVPGDIISVKLGDIIPADARLL+GDPLKIDQS
Sbjct  123   AAAALMAGLAPKTKVLRDGKWSEEEAAILVPGDIISVKLGDIIPADARLLEGDPLKIDQS  182

Query  635   ALTGESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKV  814
             ALTGESLPVTK PGD ++SGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKV
Sbjct  183   ALTGESLPVTKNPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKV  242

Query  815   LTAIANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVTMAI  994
             LTAI NFCICSIAVGM++EI+VMYPIQHR+YR GIDNLLVLLIGGIPIAMPTVLSVTMAI
Sbjct  243   LTAIGNFCICSIAVGMLVEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAI  302

Query  995   GSHRLAQQGAIT  1030
             GSH+L+QQGAIT
Sbjct  303   GSHKLSQQGAIT  314



>ref|XP_008784793.1| PREDICTED: plasma membrane ATPase 4-like isoform X1 [Phoenix 
dactylifera]
Length=979

 Score =   459 bits (1182),  Expect = 5e-150, Method: Compositional matrix adjust.
 Identities = 261/308 (85%), Positives = 285/308 (93%), Gaps = 0/308 (0%)
 Frame = +2

Query  107   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  286
             L+ +  ETVDLENIP+EEVFE L+C+++GLTS   ++RL IFG NKLEEKKE K LKFLG
Sbjct  6     LEQIKNETVDLENIPVEEVFEQLKCSREGLTSAEGEQRLQIFGPNKLEEKKECKLLKFLG  65

Query  287   fMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaa  466
             FMWNPLSWVME AAIMAI LANGGGKPPDWQDFVGI+ LL+INSTISFIEENNAGNAAAA
Sbjct  66    FMWNPLSWVMEIAAIMAIVLANGGGKPPDWQDFVGIVVLLIINSTISFIEENNAGNAAAA  125

Query  467   lmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTG  646
             LMA LAPK KVLRDG+WSE++A+ILVPGDIIS+KLGDIIPADARLL+GDPLKIDQSALTG
Sbjct  126   LMAGLAPKTKVLRDGKWSEQEAAILVPGDIISIKLGDIIPADARLLEGDPLKIDQSALTG  185

Query  647   ESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAI  826
             ESLP TK PGD ++SGSTCKQGEIEA+VIATGVHTFFGKAAHLVDSTN VGHFQKVLTAI
Sbjct  186   ESLPATKNPGDEVFSGSTCKQGEIEAIVIATGVHTFFGKAAHLVDSTNNVGHFQKVLTAI  245

Query  827   ANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR  1006
              NFCICSIAVGM+IEI+VMYPIQHR YR GIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR
Sbjct  246   GNFCICSIAVGMLIEIIVMYPIQHRNYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR  305

Query  1007  LAQQGAIT  1030
             L++QGAIT
Sbjct  306   LSEQGAIT  313



>ref|XP_011031934.1| PREDICTED: plasma membrane ATPase 1 [Populus euphratica]
Length=965

 Score =   459 bits (1181),  Expect = 5e-150, Method: Compositional matrix adjust.
 Identities = 267/315 (85%), Positives = 290/315 (92%), Gaps = 0/315 (0%)
 Frame = +2

Query  86    MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
             M E    LDA+ KE VDLENIP+EEVFENLRCT++GLT+   +ERLD+FG+NKLEE+KE+
Sbjct  1     MVENSTALDAINKEAVDLENIPLEEVFENLRCTREGLTANEVRERLDLFGYNKLEEQKEN  60

Query  266   kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
             K LKFLGFMWNPLSWVMEAAAIMAI LA+GG K  D+ DFVGIITLL+INSTISFIEENN
Sbjct  61    KLLKFLGFMWNPLSWVMEAAAIMAIGLAHGGNKSADYHDFVGIITLLIINSTISFIEENN  120

Query  446   agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  625
             AGNAAAALMARLAPKAKVLRDGRWSEE+AS+LVPGDIIS+KLGDIIPADARLL+GDPLKI
Sbjct  121   AGNAAAALMARLAPKAKVLRDGRWSEEEASVLVPGDIISIKLGDIIPADARLLEGDPLKI  180

Query  626   DQSALTGESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF  805
             DQSALTGESLPVTK PGDG+YSGSTCKQGEIEAVVIATGVHTFFGKAAHLV++T  VGHF
Sbjct  181   DQSALTGESLPVTKSPGDGVYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVENTTHVGHF  240

Query  806   QKVLTAIANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVT  985
             QKVLTAI NFCICSIA GMVIEI+V+Y IQ R YR GIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  241   QKVLTAIGNFCICSIAAGMVIEIIVIYGIQGRGYRVGIDNLLVLLIGGIPIAMPTVLSVT  300

Query  986   MAIGSHRLAQQGAIT  1030
             MAIGSHRL+QQGAIT
Sbjct  301   MAIGSHRLSQQGAIT  315



>ref|XP_008663679.1| PREDICTED: plasma membrane ATPase isoform X1 [Zea mays]
Length=982

 Score =   459 bits (1182),  Expect = 6e-150, Method: Compositional matrix adjust.
 Identities = 260/308 (84%), Positives = 289/308 (94%), Gaps = 0/308 (0%)
 Frame = +2

Query  107   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  286
             L+ +  E VDLENIPIEEVFE L+CT++GL+S   Q+RL+IFG N+LEEKKESK LKFLG
Sbjct  4     LEEIKNEAVDLENIPIEEVFEQLKCTREGLSSSEGQQRLEIFGPNRLEEKKESKILKFLG  63

Query  287   fMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaa  466
             FMWNPLSWVME AA+MAIALANGGGKPPDW+DFVGII LLVINSTISFIEENNAGNAAAA
Sbjct  64    FMWNPLSWVMEMAAVMAIALANGGGKPPDWEDFVGIIVLLVINSTISFIEENNAGNAAAA  123

Query  467   lmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTG  646
             LMA LAPK KVLRDGRW E++A+ILVPGDI+S+KLGDI+PADARLL+GDPLK+DQSALTG
Sbjct  124   LMANLAPKTKVLRDGRWGEQEAAILVPGDIVSIKLGDIVPADARLLEGDPLKVDQSALTG  183

Query  647   ESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAI  826
             ESLPVTKGPGD ++SGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQ+VLTAI
Sbjct  184   ESLPVTKGPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQQVLTAI  243

Query  827   ANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR  1006
              NFCICSIAVG+V+EI+VM+PIQHR YR GI+NLLVLLIGGIPIAMPTVLSVTMAIGSH+
Sbjct  244   GNFCICSIAVGIVVEIIVMFPIQHRRYRSGIENLLVLLIGGIPIAMPTVLSVTMAIGSHK  303

Query  1007  LAQQGAIT  1030
             L+QQGAIT
Sbjct  304   LSQQGAIT  311



>ref|XP_002324564.1| ATPase 6 family protein [Populus trichocarpa]
 gb|EEF03129.1| ATPase 6 family protein [Populus trichocarpa]
Length=949

 Score =   458 bits (1179),  Expect = 7e-150, Method: Compositional matrix adjust.
 Identities = 264/308 (86%), Positives = 288/308 (94%), Gaps = 0/308 (0%)
 Frame = +2

Query  107   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  286
             L+ +  E +DLE IP+EEVF+ LRCT++GLTS   +ERL IFG NKLEEKKE KFLKFLG
Sbjct  6     LEQIKNENIDLERIPVEEVFDQLRCTREGLTSAQGEERLKIFGPNKLEEKKECKFLKFLG  65

Query  287   fMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaa  466
             FMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGI+ LL+INSTISFIEENNAGNAAAA
Sbjct  66    FMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIVVLLIINSTISFIEENNAGNAAAA  125

Query  467   lmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTG  646
             LMA LAPK KVLRDG+WSE+DA+ILVPGD+IS+KLGDIIPADARL++GDPLKIDQSALTG
Sbjct  126   LMAGLAPKTKVLRDGKWSEQDAAILVPGDLISIKLGDIIPADARLMEGDPLKIDQSALTG  185

Query  647   ESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAI  826
             ESLPVTK PGDGI+SGSTCKQGEIEAVVIATGVHTFFGKAAHLVD+TN VGHFQKVLTAI
Sbjct  186   ESLPVTKNPGDGIFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDNTNNVGHFQKVLTAI  245

Query  827   ANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR  1006
              NFCICSIA+GM+IEI+VMYPIQ+R YR GIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR
Sbjct  246   GNFCICSIAIGMLIEIIVMYPIQNRRYREGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR  305

Query  1007  LAQQGAIT  1030
             L+QQGAIT
Sbjct  306   LSQQGAIT  313



>ref|XP_006453324.1| hypothetical protein CICLE_v10007368mg [Citrus clementina]
 ref|XP_006474210.1| PREDICTED: plasma membrane ATPase 4-like isoform X1 [Citrus sinensis]
 gb|ESR66564.1| hypothetical protein CICLE_v10007368mg [Citrus clementina]
Length=954

 Score =   458 bits (1179),  Expect = 7e-150, Method: Compositional matrix adjust.
 Identities = 265/308 (86%), Positives = 287/308 (93%), Gaps = 0/308 (0%)
 Frame = +2

Query  107   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  286
             L+ +  ETVDLE IPIEEVFE L+CT++GL+S     RL IFG NKLEEKKESK LKFLG
Sbjct  9     LEEIKNETVDLERIPIEEVFEQLKCTREGLSSTEGANRLQIFGPNKLEEKKESKILKFLG  68

Query  287   fMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaa  466
             FMWNPLSWVMEAAA+MAIALANG GKPPDWQDFVGI+ LLVINSTISFIEENNAGNAAAA
Sbjct  69    FMWNPLSWVMEAAAVMAIALANGEGKPPDWQDFVGIVCLLVINSTISFIEENNAGNAAAA  128

Query  467   lmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTG  646
             LMA LAPK K+LRDG+WSEE+A+ILVPGDIIS+KLGDIIPADARLL+GDPLK+DQSALTG
Sbjct  129   LMAGLAPKTKLLRDGKWSEEEAAILVPGDIISIKLGDIIPADARLLEGDPLKVDQSALTG  188

Query  647   ESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAI  826
             ESLPVTK PGD ++SGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAI
Sbjct  189   ESLPVTKNPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAI  248

Query  827   ANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR  1006
              NFCICSIAVGM++EI+VMYPIQHR+YR GIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR
Sbjct  249   GNFCICSIAVGMLVEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR  308

Query  1007  LAQQGAIT  1030
             L+QQGAIT
Sbjct  309   LSQQGAIT  316



>ref|XP_011084025.1| PREDICTED: ATPase 8, plasma membrane-type [Sesamum indicum]
Length=949

 Score =   458 bits (1178),  Expect = 8e-150, Method: Compositional matrix adjust.
 Identities = 265/308 (86%), Positives = 286/308 (93%), Gaps = 0/308 (0%)
 Frame = +2

Query  107   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  286
             L+ +  ETVDLENIPIEEVF+ L+C++DGLTS    +RL IFG NKLEEKKESKFLKFLG
Sbjct  7     LEDIKNETVDLENIPIEEVFQELKCSRDGLTSDEGAKRLQIFGANKLEEKKESKFLKFLG  66

Query  287   fMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaa  466
             FMWNPLSWVME AAIMAI LANGGGKPPD+ DF+GI+ LLVINSTISFIEENNAGNAAAA
Sbjct  67    FMWNPLSWVMELAAIMAIVLANGGGKPPDYPDFIGIVVLLVINSTISFIEENNAGNAAAA  126

Query  467   lmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTG  646
             LMA LAPK KVLRDG+WSE+DASILVPGD+ISVKLGDIIPADARLL+GDPLKIDQSALTG
Sbjct  127   LMAGLAPKTKVLRDGKWSEQDASILVPGDLISVKLGDIIPADARLLEGDPLKIDQSALTG  186

Query  647   ESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAI  826
             ESL VTK PGD ++SGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTN VGHFQKVLTAI
Sbjct  187   ESLAVTKHPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNNVGHFQKVLTAI  246

Query  827   ANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR  1006
              NFCICSIA+GM+IEI+VMYPIQHR+YR GIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR
Sbjct  247   GNFCICSIALGMIIEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR  306

Query  1007  LAQQGAIT  1030
             L+QQGAIT
Sbjct  307   LSQQGAIT  314



>gb|AEO22063.1| plasma membrane H+-ATPase [Aeluropus littoralis]
Length=951

 Score =   458 bits (1178),  Expect = 9e-150, Method: Compositional matrix adjust.
 Identities = 262/308 (85%), Positives = 289/308 (94%), Gaps = 0/308 (0%)
 Frame = +2

Query  107   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  286
             L+ +  E VDLENIP+EEVFE L+CT++GL+S+   +RL +FG NKLEEKKESK LKFLG
Sbjct  4     LEEIKNEAVDLENIPMEEVFEQLKCTREGLSSEEGTQRLQVFGPNKLEEKKESKVLKFLG  63

Query  287   fMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaa  466
             FMWNPLSWVME AAIMAIALANGGGKPPDWQDFVGII LLVINSTISFIEENNAGNAAAA
Sbjct  64    FMWNPLSWVMEMAAIMAIALANGGGKPPDWQDFVGIIVLLVINSTISFIEENNAGNAAAA  123

Query  467   lmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTG  646
             LMA LAPK KVLRDGRW E++A+ILVPGDIIS+KLGDI+PADARLL+GDPLK+DQSALTG
Sbjct  124   LMANLAPKTKVLRDGRWGEQEAAILVPGDIISIKLGDIVPADARLLEGDPLKVDQSALTG  183

Query  647   ESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAI  826
             ESLPVTKGPGD ++SGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQ+VLTAI
Sbjct  184   ESLPVTKGPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQQVLTAI  243

Query  827   ANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR  1006
              NFCICSIAVG+VIEI+VM+PIQHR+YR GI+NLLVLLIGGIPIAMPTVLSVTMAIGSH+
Sbjct  244   GNFCICSIAVGIVIEIIVMFPIQHRKYRSGIENLLVLLIGGIPIAMPTVLSVTMAIGSHK  303

Query  1007  LAQQGAIT  1030
             L+QQGAIT
Sbjct  304   LSQQGAIT  311



>ref|XP_004960134.1| PREDICTED: plasma membrane ATPase-like [Setaria italica]
Length=951

 Score =   458 bits (1178),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 264/308 (86%), Positives = 288/308 (94%), Gaps = 0/308 (0%)
 Frame = +2

Query  107   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  286
             L+ +  E VDLENIPIEEVFE L+CT++GL+S    +RL+IFG NKLEEKKESK LKFLG
Sbjct  4     LEEIKNEAVDLENIPIEEVFEQLKCTREGLSSNEGAQRLEIFGPNKLEEKKESKILKFLG  63

Query  287   fMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaa  466
             FMWNPLSWVME AAIMAIALANGGGKPPDW+DFVGII LLVINSTISFIEENNAGNAAAA
Sbjct  64    FMWNPLSWVMEMAAIMAIALANGGGKPPDWEDFVGIIVLLVINSTISFIEENNAGNAAAA  123

Query  467   lmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTG  646
             LMA LAPK KVLRDGRW E++A+ILVPGDIIS+KLGDI+PADARLL+GDPLK+DQSALTG
Sbjct  124   LMANLAPKTKVLRDGRWGEQEAAILVPGDIISIKLGDIVPADARLLEGDPLKVDQSALTG  183

Query  647   ESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAI  826
             ESLPVTKGPGD ++SGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAI
Sbjct  184   ESLPVTKGPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAI  243

Query  827   ANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR  1006
              NFCICSIAVG+VIEI+VM+PIQHR YR GI+NLLVLLIGGIPIAMPTVLSVTMAIGSH+
Sbjct  244   GNFCICSIAVGIVIEIIVMFPIQHRAYRSGIENLLVLLIGGIPIAMPTVLSVTMAIGSHK  303

Query  1007  LAQQGAIT  1030
             L+QQGAIT
Sbjct  304   LSQQGAIT  311



>ref|XP_008804905.1| PREDICTED: plasma membrane ATPase-like [Phoenix dactylifera]
Length=954

 Score =   458 bits (1178),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 266/308 (86%), Positives = 286/308 (93%), Gaps = 0/308 (0%)
 Frame = +2

Query  107   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  286
             LD +  E VDLE IP+EEVFE L+CT++GL++   + RL IFG NKLEEKKESKFLKFLG
Sbjct  9     LDEIKNEAVDLERIPVEEVFEQLKCTREGLSASEGENRLQIFGPNKLEEKKESKFLKFLG  68

Query  287   fMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaa  466
             FMWNPLSWVME AAIMAIALANGGGKPPDWQDFVGII LLVINSTISFIEENNAGNAAAA
Sbjct  69    FMWNPLSWVMEMAAIMAIALANGGGKPPDWQDFVGIIALLVINSTISFIEENNAGNAAAA  128

Query  467   lmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTG  646
             LMA LAPK KVLRDG WSE+DASILVPGDIIS+KLGDIIPADARLL+GDPLKIDQSALTG
Sbjct  129   LMAGLAPKTKVLRDGVWSEQDASILVPGDIISIKLGDIIPADARLLEGDPLKIDQSALTG  188

Query  647   ESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAI  826
             ESLPV+K PGD ++SGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAI
Sbjct  189   ESLPVSKNPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAI  248

Query  827   ANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR  1006
              NFCICSIAVG+ +EI+VM+PIQHR+YR GIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR
Sbjct  249   GNFCICSIAVGIFVEIIVMFPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR  308

Query  1007  LAQQGAIT  1030
             L+QQGAIT
Sbjct  309   LSQQGAIT  316



>ref|XP_009394581.1| PREDICTED: plasma membrane ATPase-like [Musa acuminata subsp. 
malaccensis]
Length=954

 Score =   457 bits (1177),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 265/312 (85%), Positives = 284/312 (91%), Gaps = 0/312 (0%)
 Frame = +2

Query  95    KPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskfl  274
             K   L+ +  ETVDLE IPIEEVFE L+CTK GL+S+    RL IFG NKLEEKKESK L
Sbjct  5     KAITLEDIKNETVDLERIPIEEVFEELKCTKQGLSSEEGASRLQIFGPNKLEEKKESKIL  64

Query  275   kflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnagn  454
             KFLGFMWNPLSWVME AA+MAIALANG  K PDWQDFVGII LLVINSTISFIEENNAGN
Sbjct  65    KFLGFMWNPLSWVMEMAAVMAIALANGDNKDPDWQDFVGIIVLLVINSTISFIEENNAGN  124

Query  455   aaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQS  634
             AAAALMA LAPK KVLRDGRWSE+DA+ILVPGDIIS+KLGDI+PADARLL+GDPLKIDQS
Sbjct  125   AAAALMAGLAPKTKVLRDGRWSEQDAAILVPGDIISIKLGDIVPADARLLEGDPLKIDQS  184

Query  635   ALTGESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKV  814
             ALTGESLPVTK PGD ++SGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKV
Sbjct  185   ALTGESLPVTKNPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKV  244

Query  815   LTAIANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVTMAI  994
             LTAI NFCICSIA+GM++EI+VMYPIQHR YR GIDNLLVLLIGGIPIAMPTVLSVTMAI
Sbjct  245   LTAIGNFCICSIAIGMIVEIIVMYPIQHRRYRNGIDNLLVLLIGGIPIAMPTVLSVTMAI  304

Query  995   GSHRLAQQGAIT  1030
             GSHRL++QGAIT
Sbjct  305   GSHRLSEQGAIT  316



>ref|XP_007014221.1| Plasma membrane ATPase 4 isoform 1 [Theobroma cacao]
 gb|EOY31840.1| Plasma membrane ATPase 4 isoform 1 [Theobroma cacao]
Length=954

 Score =   457 bits (1177),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 263/308 (85%), Positives = 287/308 (93%), Gaps = 0/308 (0%)
 Frame = +2

Query  107   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  286
             L+ +  ETVDLE IPIEEVFE L+CT++GL++     RL IFG NKLEEKKESK LKFLG
Sbjct  9     LEEIKNETVDLEKIPIEEVFEQLKCTREGLSADEGANRLQIFGPNKLEEKKESKILKFLG  68

Query  287   fMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaa  466
             FMWNPLSWVME+AAIMAIALANG GKPPDWQDFVGI+ LLVINSTISFIEENNAGNAAAA
Sbjct  69    FMWNPLSWVMESAAIMAIALANGDGKPPDWQDFVGIVCLLVINSTISFIEENNAGNAAAA  128

Query  467   lmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTG  646
             LMA LAPK KVLRDG+W+E++A+ILVPGDIIS+KLGDIIPADARLL+GDPLK+DQSALTG
Sbjct  129   LMAGLAPKTKVLRDGKWTEQEAAILVPGDIISIKLGDIIPADARLLEGDPLKVDQSALTG  188

Query  647   ESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAI  826
             ESLPVTK PGD I+SGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAI
Sbjct  189   ESLPVTKNPGDEIFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAI  248

Query  827   ANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR  1006
              NFCICSIA+GM++EI+VMYPIQHR+YR GIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR
Sbjct  249   GNFCICSIAIGMLVEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR  308

Query  1007  LAQQGAIT  1030
             L+QQGAIT
Sbjct  309   LSQQGAIT  316



>ref|XP_007014222.1| Plasma membrane ATPase 4 isoform 2 [Theobroma cacao]
 gb|EOY31841.1| Plasma membrane ATPase 4 isoform 2 [Theobroma cacao]
Length=930

 Score =   457 bits (1175),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 263/308 (85%), Positives = 287/308 (93%), Gaps = 0/308 (0%)
 Frame = +2

Query  107   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  286
             L+ +  ETVDLE IPIEEVFE L+CT++GL++     RL IFG NKLEEKKESK LKFLG
Sbjct  9     LEEIKNETVDLEKIPIEEVFEQLKCTREGLSADEGANRLQIFGPNKLEEKKESKILKFLG  68

Query  287   fMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaa  466
             FMWNPLSWVME+AAIMAIALANG GKPPDWQDFVGI+ LLVINSTISFIEENNAGNAAAA
Sbjct  69    FMWNPLSWVMESAAIMAIALANGDGKPPDWQDFVGIVCLLVINSTISFIEENNAGNAAAA  128

Query  467   lmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTG  646
             LMA LAPK KVLRDG+W+E++A+ILVPGDIIS+KLGDIIPADARLL+GDPLK+DQSALTG
Sbjct  129   LMAGLAPKTKVLRDGKWTEQEAAILVPGDIISIKLGDIIPADARLLEGDPLKVDQSALTG  188

Query  647   ESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAI  826
             ESLPVTK PGD I+SGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAI
Sbjct  189   ESLPVTKNPGDEIFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAI  248

Query  827   ANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR  1006
              NFCICSIA+GM++EI+VMYPIQHR+YR GIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR
Sbjct  249   GNFCICSIAIGMLVEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR  308

Query  1007  LAQQGAIT  1030
             L+QQGAIT
Sbjct  309   LSQQGAIT  316



>gb|AAB17186.1| plasma membrane H+-ATPase [Solanum lycopersicum]
Length=952

 Score =   457 bits (1177),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 264/308 (86%), Positives = 285/308 (93%), Gaps = 0/308 (0%)
 Frame = +2

Query  107   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  286
             L+ +  ETVDLE IPIEEVFE L+C+++GLTS     RL IFG NKLEEKKESK LKFLG
Sbjct  7     LEEIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNKLEEKKESKILKFLG  66

Query  287   fMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaa  466
             FMWNPLSWVME AAIMAIALANG GKPPDWQDFVGI+ LLVINSTISFIEENNAGNAAAA
Sbjct  67    FMWNPLSWVMEMAAIMAIALANGDGKPPDWQDFVGIVCLLVINSTISFIEENNAGNAAAA  126

Query  467   lmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTG  646
             LMA LAPK KVLRDGRWSE++A+ILVPGDIISVKLGDI+PADARLL+GDPLKIDQSALTG
Sbjct  127   LMAGLAPKTKVLRDGRWSEQEAAILVPGDIISVKLGDIVPADARLLEGDPLKIDQSALTG  186

Query  647   ESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAI  826
             ESLPVTK PGD ++SGSTCKQGE+EAVVIATGVHTFFGKAAHLVDSTN VGHFQKVLTAI
Sbjct  187   ESLPVTKNPGDEVFSGSTCKQGELEAVVIATGVHTFFGKAAHLVDSTNNVGHFQKVLTAI  246

Query  827   ANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR  1006
              NFCICSIA+GM++EI+VMYPIQHR+YR GIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR
Sbjct  247   GNFCICSIAIGMLVEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR  306

Query  1007  LAQQGAIT  1030
             L+QQGAIT
Sbjct  307   LSQQGAIT  314



>ref|XP_004242908.1| PREDICTED: plasma membrane ATPase 4 [Solanum lycopersicum]
Length=952

 Score =   457 bits (1177),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 264/308 (86%), Positives = 285/308 (93%), Gaps = 0/308 (0%)
 Frame = +2

Query  107   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  286
             L+ +  ETVDLE IPIEEVFE L+C+++GLTS     RL IFG NKLEEKKESK LKFLG
Sbjct  7     LEEIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNKLEEKKESKILKFLG  66

Query  287   fMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaa  466
             FMWNPLSWVME AAIMAIALANG GKPPDWQDFVGI+ LLVINSTISFIEENNAGNAAAA
Sbjct  67    FMWNPLSWVMEMAAIMAIALANGDGKPPDWQDFVGIVCLLVINSTISFIEENNAGNAAAA  126

Query  467   lmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTG  646
             LMA LAPK KVLRDGRWSE++A+ILVPGDIISVKLGDI+PADARLL+GDPLKIDQSALTG
Sbjct  127   LMAGLAPKTKVLRDGRWSEQEAAILVPGDIISVKLGDIVPADARLLEGDPLKIDQSALTG  186

Query  647   ESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAI  826
             ESLPVTK PGD ++SGSTCKQGE+EAVVIATGVHTFFGKAAHLVDSTN VGHFQKVLTAI
Sbjct  187   ESLPVTKNPGDEVFSGSTCKQGELEAVVIATGVHTFFGKAAHLVDSTNNVGHFQKVLTAI  246

Query  827   ANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR  1006
              NFCICSIA+GM++EI+VMYPIQHR+YR GIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR
Sbjct  247   GNFCICSIAIGMLVEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR  306

Query  1007  LAQQGAIT  1030
             L+QQGAIT
Sbjct  307   LSQQGAIT  314



>ref|XP_002447249.1| hypothetical protein SORBIDRAFT_06g031240 [Sorghum bicolor]
 gb|EES11577.1| hypothetical protein SORBIDRAFT_06g031240 [Sorghum bicolor]
Length=951

 Score =   457 bits (1176),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 261/308 (85%), Positives = 290/308 (94%), Gaps = 0/308 (0%)
 Frame = +2

Query  107   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  286
             L+ +  E VDLENIPIEEVFE L+CT++GL+S   Q+RL+IFG NKLEEKKESK LKFLG
Sbjct  4     LEEIKNEAVDLENIPIEEVFEQLKCTREGLSSSEGQQRLEIFGPNKLEEKKESKILKFLG  63

Query  287   fMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaa  466
             FMWNPLSWVME AAIMAIALANGGGKPPDW+DFVGII LLVINSTISFIEENNAGNAAAA
Sbjct  64    FMWNPLSWVMEMAAIMAIALANGGGKPPDWEDFVGIIVLLVINSTISFIEENNAGNAAAA  123

Query  467   lmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTG  646
             LMA LAPK KVLRDGRW E++A+ILVPGDIIS+KLGDI+PADARLL+GDPLK+DQSALTG
Sbjct  124   LMANLAPKTKVLRDGRWGEQEAAILVPGDIISIKLGDIVPADARLLEGDPLKVDQSALTG  183

Query  647   ESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAI  826
             ESLPVT+GPGD ++SGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQ+VLTAI
Sbjct  184   ESLPVTRGPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQQVLTAI  243

Query  827   ANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR  1006
              NFCICSIAVG+++EI+VM+PIQHR+YR GI+NLLVLLIGGIPIAMPTVLSVTMAIGSH+
Sbjct  244   GNFCICSIAVGIIVEIIVMFPIQHRKYRSGIENLLVLLIGGIPIAMPTVLSVTMAIGSHK  303

Query  1007  LAQQGAIT  1030
             L+QQGAIT
Sbjct  304   LSQQGAIT  311



>gb|KHN17608.1| Plasma membrane ATPase 4 [Glycine soja]
Length=953

 Score =   457 bits (1176),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 265/308 (86%), Positives = 288/308 (94%), Gaps = 0/308 (0%)
 Frame = +2

Query  107   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  286
             L+ +  ETVDLE IPIEEVF+ L+CT++GL+S     RL IFG NKLEEKKESKFLKFLG
Sbjct  10    LEEIKNETVDLERIPIEEVFQQLKCTREGLSSDEGANRLQIFGPNKLEEKKESKFLKFLG  69

Query  287   fMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaa  466
             FMWNPLSWVMEAAAIMAIALANG GKPPDWQDFVGI+ LLVINSTISFIEENNAGNAAAA
Sbjct  70    FMWNPLSWVMEAAAIMAIALANGNGKPPDWQDFVGIVCLLVINSTISFIEENNAGNAAAA  129

Query  467   lmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTG  646
             LMA LAPK KVLRDG+W+EE+A+ILVPGDIIS+KLGDIIPADARLL+GDPLK+DQSALTG
Sbjct  130   LMAGLAPKTKVLRDGKWTEEEAAILVPGDIISIKLGDIIPADARLLEGDPLKVDQSALTG  189

Query  647   ESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAI  826
             ESLPVT+GPG+ ++SGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAI
Sbjct  190   ESLPVTRGPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAI  249

Query  827   ANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR  1006
              NFCICSIAVGM+ EI+VMYPIQHR+YR GIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR
Sbjct  250   GNFCICSIAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR  309

Query  1007  LAQQGAIT  1030
             L+QQGAIT
Sbjct  310   LSQQGAIT  317



>ref|XP_009401466.1| PREDICTED: plasma membrane ATPase-like [Musa acuminata subsp. 
malaccensis]
Length=954

 Score =   457 bits (1176),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 270/313 (86%), Positives = 289/313 (92%), Gaps = 0/313 (0%)
 Frame = +2

Query  92    EKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskf  271
             +K   L+ +  ETVDLE IPIEEVFE L+CTK+GLTSQ   +RL IFG NKLEEKKESKF
Sbjct  4     DKASSLEELKNETVDLEKIPIEEVFEQLKCTKEGLTSQEGADRLQIFGPNKLEEKKESKF  63

Query  272   lkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnag  451
             LKFLGFMWNPLSWVME AAIMAIALANGGG+ PDWQDF+GI  LLVINSTISFIEENNAG
Sbjct  64    LKFLGFMWNPLSWVMEMAAIMAIALANGGGRAPDWQDFLGIAILLVINSTISFIEENNAG  123

Query  452   naaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQ  631
             NAAAALMARLAPKAKVLRDG W+E+DA+ILVPGDIIS+KLGDIIPAD+RLL+GDPLKIDQ
Sbjct  124   NAAAALMARLAPKAKVLRDGTWAEQDAAILVPGDIISIKLGDIIPADSRLLEGDPLKIDQ  183

Query  632   SALTGESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQK  811
             SALTGESLPVTK PG G+YSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQK
Sbjct  184   SALTGESLPVTKNPGSGVYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQK  243

Query  812   VLTAIANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVTMA  991
             VLTAI NFCICSIA G+VIEI+VMYPIQHR YR GIDNLLVLLIGGIPIAMPTVLSVTMA
Sbjct  244   VLTAIGNFCICSIATGIVIEIIVMYPIQHRSYRDGIDNLLVLLIGGIPIAMPTVLSVTMA  303

Query  992   IGSHRLAQQGAIT  1030
             IGSH+L+QQGAIT
Sbjct  304   IGSHKLSQQGAIT  316



>ref|XP_010431653.1| PREDICTED: ATPase 9, plasma membrane-type-like [Camelina sativa]
Length=624

 Score =   447 bits (1150),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 262/314 (83%), Positives = 282/314 (90%), Gaps = 0/314 (0%)
 Frame = +2

Query  89    AEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkesk  268
             A K    D +  E ++LE IPIEEV   LRCT++GLTS+  Q RL+IFG NKLEEKKESK
Sbjct  3     AGKDSSWDDIKNEGINLEKIPIEEVLTQLRCTREGLTSEEGQTRLEIFGPNKLEEKKESK  62

Query  269   flkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnna  448
              LKFLGFMWNPLSWVME AAIMAIALANGGG+PPDWQDFVGI  LLVINSTISFIEENNA
Sbjct  63    VLKFLGFMWNPLSWVMELAAIMAIALANGGGRPPDWQDFVGITVLLVINSTISFIEENNA  122

Query  449   gnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKID  628
             GNAAAALMA LAPK K+LRDG+W+E++A+ILVPGDIIS+KLGDIIPAD RLLDGDPLK+D
Sbjct  123   GNAAAALMAGLAPKTKLLRDGKWNEQEAAILVPGDIISIKLGDIIPADGRLLDGDPLKVD  182

Query  629   QSALTGESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQ  808
             QSALTGESLPVTK PG  +YSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQ GHFQ
Sbjct  183   QSALTGESLPVTKNPGQEVYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQEGHFQ  242

Query  809   KVLTAIANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVTM  988
             KVLTAI NFCICSI +GM+IEIVVMYPIQHR YR GIDNLLVLLIGGIPIAMPTVLSVTM
Sbjct  243   KVLTAIGNFCICSIGIGMIIEIVVMYPIQHRAYRDGIDNLLVLLIGGIPIAMPTVLSVTM  302

Query  989   AIGSHRLAQQGAIT  1030
             AIGSHRL+QQGAIT
Sbjct  303   AIGSHRLSQQGAIT  316



>sp|Q03194.1|PMA4_NICPL RecName: Full=Plasma membrane ATPase 4; AltName: Full=Proton 
pump 4 [Nicotiana plumbaginifolia]
 emb|CAA47275.1| plasma membrane H+-ATPase [Nicotiana plumbaginifolia]
Length=952

 Score =   457 bits (1176),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 263/308 (85%), Positives = 285/308 (93%), Gaps = 0/308 (0%)
 Frame = +2

Query  107   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  286
             L+ +  ETVDLE IPIEEVFE L+CT++GL++     RL IFG NKLEEK ESK LKFLG
Sbjct  7     LEEIKNETVDLEKIPIEEVFEQLKCTREGLSADEGASRLQIFGPNKLEEKNESKILKFLG  66

Query  287   fMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaa  466
             FMWNPLSWVMEAAA+MAIALANG GKPPDWQDF+GII LLVINSTISFIEENNAGNAAAA
Sbjct  67    FMWNPLSWVMEAAAVMAIALANGDGKPPDWQDFIGIICLLVINSTISFIEENNAGNAAAA  126

Query  467   lmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTG  646
             LMA LAPK KVLRDGRWSE++A+ILVPGDIISVKLGDIIPADARLL+GDPLKIDQSALTG
Sbjct  127   LMAGLAPKTKVLRDGRWSEQEAAILVPGDIISVKLGDIIPADARLLEGDPLKIDQSALTG  186

Query  647   ESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAI  826
             ESLPVTK PGD ++SGSTCKQGE+EAVVIATGVHTFFGKAAHLVDSTN VGHFQKVLTAI
Sbjct  187   ESLPVTKNPGDEVFSGSTCKQGELEAVVIATGVHTFFGKAAHLVDSTNNVGHFQKVLTAI  246

Query  827   ANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR  1006
              NFCICSIA+GM++EI+VMYPIQHR+YR GIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR
Sbjct  247   GNFCICSIAIGMLVEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR  306

Query  1007  LAQQGAIT  1030
             L+QQGAIT
Sbjct  307   LSQQGAIT  314



>ref|XP_011002373.1| PREDICTED: ATPase 8, plasma membrane-type-like [Populus euphratica]
Length=944

 Score =   457 bits (1175),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 263/308 (85%), Positives = 285/308 (93%), Gaps = 0/308 (0%)
 Frame = +2

Query  107   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  286
             ++ +  E++DLE IPIEEV E L+CTK+GL++   +ERL IFG NKLEEKKESK LKFLG
Sbjct  1     MEDIKNESIDLEKIPIEEVLEKLKCTKEGLSTTEGEERLRIFGPNKLEEKKESKILKFLG  60

Query  287   fMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaa  466
             FMWNPLSWVMEAAAIMAI LANGGGKPPDWQDFVGII LL+INSTISFIEENNAGNAAAA
Sbjct  61    FMWNPLSWVMEAAAIMAIVLANGGGKPPDWQDFVGIIVLLIINSTISFIEENNAGNAAAA  120

Query  467   lmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTG  646
             LMA LAPK KVLRD +WSE+DA+ILVPGDIIS+KLGDIIPADARL++GDPLKIDQSALTG
Sbjct  121   LMAGLAPKTKVLRDRKWSEQDAAILVPGDIISIKLGDIIPADARLMEGDPLKIDQSALTG  180

Query  647   ESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAI  826
             ESLPVTK PG G+YSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTN VGHFQKVLTAI
Sbjct  181   ESLPVTKYPGSGVYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNNVGHFQKVLTAI  240

Query  827   ANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR  1006
              NFCICSIA+GM+IEI+VMYPIQHR YR GIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR
Sbjct  241   GNFCICSIAIGMLIEIIVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR  300

Query  1007  LAQQGAIT  1030
             L+QQGAIT
Sbjct  301   LSQQGAIT  308



>ref|XP_011084027.1| PREDICTED: ATPase 8, plasma membrane-type-like [Sesamum indicum]
Length=951

 Score =   457 bits (1175),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 264/308 (86%), Positives = 286/308 (93%), Gaps = 0/308 (0%)
 Frame = +2

Query  107   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  286
             L+ +  ETVDLENIPIEEVF+ L+C++DGLTS    +RL IFG NKLEEKKESKFLKFLG
Sbjct  7     LEDIRNETVDLENIPIEEVFQELKCSRDGLTSDEGAKRLQIFGANKLEEKKESKFLKFLG  66

Query  287   fMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaa  466
             FMWNPLSWVME AAIMAI LANGGGKPPD+ DF+GI+ LLVINSTISFIEENNAGNAAAA
Sbjct  67    FMWNPLSWVMELAAIMAIVLANGGGKPPDYPDFIGIVVLLVINSTISFIEENNAGNAAAA  126

Query  467   lmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTG  646
             LMA LAPK KVLRDG+WSE+DASILVPGD+ISVKLGDIIPADARLL+GDPLKIDQSALTG
Sbjct  127   LMAGLAPKTKVLRDGKWSEQDASILVPGDLISVKLGDIIPADARLLEGDPLKIDQSALTG  186

Query  647   ESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAI  826
             ESL VTK PGD ++SGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTN VGHFQ+VLTAI
Sbjct  187   ESLAVTKHPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNNVGHFQQVLTAI  246

Query  827   ANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR  1006
              NFCICSIA+GM+IEI+VMYPIQHR+YR GIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR
Sbjct  247   GNFCICSIALGMIIEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR  306

Query  1007  LAQQGAIT  1030
             L+QQGAIT
Sbjct  307   LSQQGAIT  314



>ref|XP_008810004.1| PREDICTED: plasma membrane ATPase [Phoenix dactylifera]
Length=954

 Score =   457 bits (1175),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 264/313 (84%), Positives = 288/313 (92%), Gaps = 0/313 (0%)
 Frame = +2

Query  92    EKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskf  271
             +KP  LD +  ETVDLE +PIEEVFE L+CT++GL+S+    RL IFG NKLEEKKESK 
Sbjct  4     DKPISLDEIKNETVDLERVPIEEVFEQLKCTREGLSSEEGANRLQIFGPNKLEEKKESKL  63

Query  272   lkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnag  451
             LKFLGFMWNPLSWVME AAIMAIALANG G+PPDW+DFVGI+ LL INSTISFIEENNAG
Sbjct  64    LKFLGFMWNPLSWVMEMAAIMAIALANGDGRPPDWEDFVGIVALLFINSTISFIEENNAG  123

Query  452   naaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQ  631
             NAAAALMA LAPK KVLRDGRW+EE+A+ILVPGDIIS+KLGDIIPADARLLDGDPLK+DQ
Sbjct  124   NAAAALMASLAPKTKVLRDGRWTEEEAAILVPGDIISIKLGDIIPADARLLDGDPLKVDQ  183

Query  632   SALTGESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQK  811
             SALTGESLPVTK PGD I+SGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQK
Sbjct  184   SALTGESLPVTKNPGDEIFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQK  243

Query  812   VLTAIANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVTMA  991
             VLTAI NFCICSIAVG+++EI+VM+PIQ R+YR GIDNLLVLLIGGIPIAMPTVLSVTMA
Sbjct  244   VLTAIGNFCICSIAVGIIVEIIVMFPIQDRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMA  303

Query  992   IGSHRLAQQGAIT  1030
             IGSHRL+QQGAIT
Sbjct  304   IGSHRLSQQGAIT  316



>ref|XP_008378243.1| PREDICTED: plasma membrane ATPase 4-like [Malus domestica]
Length=954

 Score =   457 bits (1175),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 264/308 (86%), Positives = 286/308 (93%), Gaps = 0/308 (0%)
 Frame = +2

Query  107   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  286
             L+ +  E+VDLE IP+EEVFE L+CTK+GLT +    RL +FG NKLEEKKESK LKFLG
Sbjct  9     LEEIKNESVDLERIPVEEVFEQLKCTKEGLTGEEGASRLQVFGPNKLEEKKESKLLKFLG  68

Query  287   fMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaa  466
             FMWNPLSWVMEAAA+MAIALANGGGKPPDWQDFVGI+ LLVINSTISFIEENNAGNAAAA
Sbjct  69    FMWNPLSWVMEAAALMAIALANGGGKPPDWQDFVGIVVLLVINSTISFIEENNAGNAAAA  128

Query  467   lmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTG  646
             LMA LAPK KVLRDGRWSE+DASILVPGDIIS+KLGDI+PADARLL+GDPLKIDQSALTG
Sbjct  129   LMAGLAPKTKVLRDGRWSEQDASILVPGDIISIKLGDIVPADARLLEGDPLKIDQSALTG  188

Query  647   ESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAI  826
             ESLPVTK P D ++SGSTCKQGEIEAVVIATGVHTFFGKAAHLVD+TNQVGHFQKVLTAI
Sbjct  189   ESLPVTKNPSDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDNTNQVGHFQKVLTAI  248

Query  827   ANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR  1006
              NFCICSIAVG++IEI+VMYPIQ R+YR GIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR
Sbjct  249   GNFCICSIAVGILIEIIVMYPIQKRKYRQGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR  308

Query  1007  LAQQGAIT  1030
             L+QQGAIT
Sbjct  309   LSQQGAIT  316



>ref|XP_003549363.1| PREDICTED: plasma membrane ATPase 4-like isoform 1 [Glycine max]
Length=953

 Score =   457 bits (1175),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 265/308 (86%), Positives = 288/308 (94%), Gaps = 0/308 (0%)
 Frame = +2

Query  107   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  286
             L+ +  ETVDLE IPIEEVF+ L+CT++GL+S     RL IFG NKLEEKKESKFLKFLG
Sbjct  10    LEEIKNETVDLERIPIEEVFQQLKCTREGLSSDEGANRLQIFGPNKLEEKKESKFLKFLG  69

Query  287   fMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaa  466
             FMWNPLSWVMEAAAIMAIALANG GKPPDWQDFVGI+ LLVINSTISFIEENNAGNAAAA
Sbjct  70    FMWNPLSWVMEAAAIMAIALANGNGKPPDWQDFVGIVCLLVINSTISFIEENNAGNAAAA  129

Query  467   lmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTG  646
             LMA LAPK KVLRDG+W+EE+A+ILVPGDIIS+KLGDIIPADARLL+GDPLK+DQSALTG
Sbjct  130   LMAGLAPKTKVLRDGKWTEEEAAILVPGDIISIKLGDIIPADARLLEGDPLKVDQSALTG  189

Query  647   ESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAI  826
             ESLPVT+GPG+ ++SGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAI
Sbjct  190   ESLPVTRGPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAI  249

Query  827   ANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR  1006
              NFCICSIAVGM+ EI+VMYPIQHR+YR GIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR
Sbjct  250   GNFCICSIAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR  309

Query  1007  LAQQGAIT  1030
             L+QQGAIT
Sbjct  310   LSQQGAIT  317



>ref|XP_011033475.1| PREDICTED: ATPase 8, plasma membrane-type [Populus euphratica]
Length=949

 Score =   457 bits (1175),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 262/308 (85%), Positives = 287/308 (93%), Gaps = 0/308 (0%)
 Frame = +2

Query  107   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  286
             L+ +  E +DLE IP+EEVF+ LRCTK+GL++   +ERL IFG NKLEEK+ESKFLKFLG
Sbjct  6     LEQIKNENIDLERIPVEEVFQQLRCTKEGLSTVQGEERLKIFGPNKLEEKRESKFLKFLG  65

Query  287   fMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaa  466
             FMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGI+ LL+INSTISFIEENNAGNAAAA
Sbjct  66    FMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIVVLLIINSTISFIEENNAGNAAAA  125

Query  467   lmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTG  646
             LMA LAPK KVLRDG+W EEDASILVPGD+IS+KLGDI+PADARL+ GDPLKIDQSALTG
Sbjct  126   LMAGLAPKTKVLRDGKWMEEDASILVPGDMISIKLGDIVPADARLMKGDPLKIDQSALTG  185

Query  647   ESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAI  826
             ESLPVTK PG+G++SGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTN VGHFQKVLTAI
Sbjct  186   ESLPVTKHPGEGVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNNVGHFQKVLTAI  245

Query  827   ANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR  1006
              NFCICSIA+GM++EI+VMYPIQHR YR GIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR
Sbjct  246   GNFCICSIAIGMLVEIIVMYPIQHRRYREGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR  305

Query  1007  LAQQGAIT  1030
             L+QQGAIT
Sbjct  306   LSQQGAIT  313



>ref|XP_011084028.1| PREDICTED: ATPase 8, plasma membrane-type-like [Sesamum indicum]
Length=951

 Score =   457 bits (1175),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 265/308 (86%), Positives = 284/308 (92%), Gaps = 0/308 (0%)
 Frame = +2

Query  107   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  286
             L+ V  ETVDLENIPIEEVF+ L+CT+DGLTS    +RL IFG NKLEEKKESKFLKFLG
Sbjct  7     LEDVRNETVDLENIPIEEVFQELKCTRDGLTSDEGAKRLQIFGANKLEEKKESKFLKFLG  66

Query  287   fMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaa  466
             FMWNPLSWVME AAIMAI LANGGGKPPD+ DF+GI+ LL INSTISFIEENNAGNAAAA
Sbjct  67    FMWNPLSWVMELAAIMAIVLANGGGKPPDYPDFIGIVVLLFINSTISFIEENNAGNAAAA  126

Query  467   lmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTG  646
             LMA LAPK KVLRDG+WSE++ASILVPGD+ISVKLGDIIPADARLL+GDPLKIDQSALTG
Sbjct  127   LMAGLAPKTKVLRDGKWSEQEASILVPGDLISVKLGDIIPADARLLEGDPLKIDQSALTG  186

Query  647   ESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAI  826
             ESL VTK PGD ++SGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTN VGHFQKVLTAI
Sbjct  187   ESLAVTKYPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNNVGHFQKVLTAI  246

Query  827   ANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR  1006
              NFCICSIA+GM+IEI+VMYPIQHR YR GIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR
Sbjct  247   GNFCICSIALGMIIEIIVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR  306

Query  1007  LAQQGAIT  1030
             L+QQGAIT
Sbjct  307   LSQQGAIT  314



>dbj|BAD16684.1| plasma membrane H+-ATPase [Daucus carota]
Length=950

 Score =   457 bits (1175),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 266/308 (86%), Positives = 286/308 (93%), Gaps = 0/308 (0%)
 Frame = +2

Query  107   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  286
             L+ +  ETVDLE IPIEEVFE L+CT++GL++     RL IFG NKLEEKKESK LKFLG
Sbjct  5     LEEIKNETVDLEKIPIEEVFEQLKCTREGLSADEGANRLQIFGPNKLEEKKESKLLKFLG  64

Query  287   fMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaa  466
             FMWNPLSWVMEAAAIMAIALANG GKPPDWQDFVGII LLVINSTISFIEENNAGNAAAA
Sbjct  65    FMWNPLSWVMEAAAIMAIALANGNGKPPDWQDFVGIICLLVINSTISFIEENNAGNAAAA  124

Query  467   lmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTG  646
             LMA LAPK KVLRDGRWSE+DA+ILVPGDIIS+KLGDI+PADARLL+GDPLKIDQSALTG
Sbjct  125   LMAGLAPKTKVLRDGRWSEQDAAILVPGDIISIKLGDIVPADARLLEGDPLKIDQSALTG  184

Query  647   ESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAI  826
             ESLPVT+ P D ++SGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAI
Sbjct  185   ESLPVTRNPYDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAI  244

Query  827   ANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR  1006
              NFCICSIAVGM++E+VVMYPIQHR+YR GIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR
Sbjct  245   GNFCICSIAVGMLVELVVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR  304

Query  1007  LAQQGAIT  1030
             L+QQGAIT
Sbjct  305   LSQQGAIT  312



>ref|XP_010929115.1| PREDICTED: plasma membrane ATPase 4-like [Elaeis guineensis]
Length=950

 Score =   457 bits (1175),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 259/308 (84%), Positives = 286/308 (93%), Gaps = 0/308 (0%)
 Frame = +2

Query  107   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  286
             L+ +  ETVDLENIP++EVFE L+C+++GLTS   ++RL IFG NKLEEKKESK LKFLG
Sbjct  6     LEQIKNETVDLENIPVDEVFEQLKCSREGLTSADGEQRLQIFGPNKLEEKKESKLLKFLG  65

Query  287   fMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaa  466
             FMWNPLSWVME AAIMAI LANGGGKPPDWQDFVGI+ LL+INSTISFIEENNAGNAAAA
Sbjct  66    FMWNPLSWVMEIAAIMAIVLANGGGKPPDWQDFVGIVVLLIINSTISFIEENNAGNAAAA  125

Query  467   lmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTG  646
             LMA LAPK KVLRDG+WSE++A+ILVPGDIIS+KLGDI+PADARLL+GDPLKIDQSALTG
Sbjct  126   LMAGLAPKTKVLRDGKWSEQEAAILVPGDIISIKLGDIVPADARLLEGDPLKIDQSALTG  185

Query  647   ESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAI  826
             ESLPVTK PGD ++SGSTCKQGEIEA+VIATGVHTFFGKAAHLVDSTN VGHFQKVLTAI
Sbjct  186   ESLPVTKNPGDEVFSGSTCKQGEIEAIVIATGVHTFFGKAAHLVDSTNNVGHFQKVLTAI  245

Query  827   ANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR  1006
              NFCICSI VGM+IEI++MYPIQHR YR GIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR
Sbjct  246   GNFCICSIGVGMLIEILIMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR  305

Query  1007  LAQQGAIT  1030
             L++QGAIT
Sbjct  306   LSEQGAIT  313



>ref|XP_009588974.1| PREDICTED: plasma membrane ATPase 4 [Nicotiana tomentosiformis]
Length=952

 Score =   457 bits (1175),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 263/308 (85%), Positives = 285/308 (93%), Gaps = 0/308 (0%)
 Frame = +2

Query  107   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  286
             L+ +  ETVDLE IPIEEVFE L+CT++GL++     RL IFG NKLEEK ESK LKFLG
Sbjct  7     LEEIKNETVDLEKIPIEEVFEQLKCTREGLSADEGANRLQIFGPNKLEEKNESKLLKFLG  66

Query  287   fMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaa  466
             FMWNPLSWVMEAAAIMAIALANG GKPPDWQDF+GII LLVINSTISFIEENNAGNAAAA
Sbjct  67    FMWNPLSWVMEAAAIMAIALANGNGKPPDWQDFIGIICLLVINSTISFIEENNAGNAAAA  126

Query  467   lmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTG  646
             LMA LAPK KVLRDGRWSE++A+ILVPGDIISVKLGDIIPADARLL+GDPLK+DQSALTG
Sbjct  127   LMAGLAPKTKVLRDGRWSEQEAAILVPGDIISVKLGDIIPADARLLEGDPLKVDQSALTG  186

Query  647   ESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAI  826
             ESLPVTK PGD ++SGSTCKQGE+EAVVIATGVHTFFGKAAHLVDSTN VGHFQKVLT+I
Sbjct  187   ESLPVTKNPGDEVFSGSTCKQGELEAVVIATGVHTFFGKAAHLVDSTNNVGHFQKVLTSI  246

Query  827   ANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR  1006
              NFCICSIAVGM++EI+VMYPIQHR+YR GIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR
Sbjct  247   GNFCICSIAVGMLVEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR  306

Query  1007  LAQQGAIT  1030
             L+QQGAIT
Sbjct  307   LSQQGAIT  314



>dbj|BAD16688.1| plasma membrane H+-ATPase [Daucus carota]
Length=950

 Score =   456 bits (1174),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 265/308 (86%), Positives = 287/308 (93%), Gaps = 0/308 (0%)
 Frame = +2

Query  107   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  286
             L+ +  ETVDLE IPIEEVFE L+CT++GL++     RL+IFG NKLEEKKESK LKFLG
Sbjct  5     LEEIKNETVDLEKIPIEEVFEQLKCTREGLSADEGTNRLEIFGPNKLEEKKESKLLKFLG  64

Query  287   fMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaa  466
             FMWNPLSWVMEAAAIMAIALANG GKPPDWQDFVGI+ LLVINSTISFIEENNAGNAAAA
Sbjct  65    FMWNPLSWVMEAAAIMAIALANGNGKPPDWQDFVGIMCLLVINSTISFIEENNAGNAAAA  124

Query  467   lmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTG  646
             LMA LAPK KVLRDGRWSE+DA+ILVPGDIIS+KLGDI+PADARLL+GDPLKIDQSALTG
Sbjct  125   LMAGLAPKTKVLRDGRWSEQDAAILVPGDIISIKLGDIVPADARLLEGDPLKIDQSALTG  184

Query  647   ESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAI  826
             ESLPVT+ P D ++SGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAI
Sbjct  185   ESLPVTRNPYDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAI  244

Query  827   ANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR  1006
              NFCICSIA+GM++EIVVMYPIQHR+YR GIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR
Sbjct  245   GNFCICSIAIGMLVEIVVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR  304

Query  1007  LAQQGAIT  1030
             L+QQGAIT
Sbjct  305   LSQQGAIT  312



>emb|CDX72218.1| BnaC07g42400D [Brassica napus]
Length=911

 Score =   455 bits (1171),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 264/308 (86%), Positives = 288/308 (94%), Gaps = 0/308 (0%)
 Frame = +2

Query  107   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  286
             L+ +  ETVDLE +PIEEVF+ L+CTK+GLT+Q  + R+ IFG NKLEEKKESK LKFLG
Sbjct  4     LENIKNETVDLEKVPIEEVFQQLKCTKEGLTTQEGEARVQIFGLNKLEEKKESKILKFLG  63

Query  287   fMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaa  466
             FMWNPLSWVMEAAAIMAIALANG G+PPDWQDFVGII LLVINSTISFIEENNAGNAAAA
Sbjct  64    FMWNPLSWVMEAAAIMAIALANGDGRPPDWQDFVGIICLLVINSTISFIEENNAGNAAAA  123

Query  467   lmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTG  646
             LMA LAPK KVLRDG+WSE++A+ILVPGDI+S+KLGDIIPADARLL+GDPLK+DQSALTG
Sbjct  124   LMAGLAPKTKVLRDGKWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSALTG  183

Query  647   ESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAI  826
             ESLPVTK PG G++SGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAI
Sbjct  184   ESLPVTKHPGQGVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAI  243

Query  827   ANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR  1006
              NFCICSIA+GMVIEI+VMYPIQ R+YR GIDNLLVLLIGGIPIAMPTVLSVTMAIGSH+
Sbjct  244   GNFCICSIAIGMVIEILVMYPIQRRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHK  303

Query  1007  LAQQGAIT  1030
             LAQQGAIT
Sbjct  304   LAQQGAIT  311



>gb|KJB82763.1| hypothetical protein B456_013G212200 [Gossypium raimondii]
Length=954

 Score =   456 bits (1174),  Expect = 4e-149, Method: Compositional matrix adjust.
 Identities = 264/308 (86%), Positives = 288/308 (94%), Gaps = 0/308 (0%)
 Frame = +2

Query  107   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  286
             LD +  E+VDLE IPIEEVFE L+CT++GL++Q    RL +FG NKLEEKKESKFLKFLG
Sbjct  9     LDEIKNESVDLERIPIEEVFEQLKCTREGLSTQEGNNRLQVFGPNKLEEKKESKFLKFLG  68

Query  287   fMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaa  466
             FMWNPLSWVMEAAAIMAIALANGGG+PPDWQDFVGII LLVINSTISFIEENNAGNAAAA
Sbjct  69    FMWNPLSWVMEAAAIMAIALANGGGRPPDWQDFVGIIVLLVINSTISFIEENNAGNAAAA  128

Query  467   lmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTG  646
             LMA LAPK KVLRDGRWSE++A+ILVPGDII++KLGDI+PADARLL+GDPLKIDQSALTG
Sbjct  129   LMANLAPKTKVLRDGRWSEQEAAILVPGDIITIKLGDIVPADARLLEGDPLKIDQSALTG  188

Query  647   ESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAI  826
             ESLPVTK P D ++SGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQ+VLTAI
Sbjct  189   ESLPVTKNPSDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQQVLTAI  248

Query  827   ANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR  1006
              NFCICSIAVG+VIE++VMYPIQ R+YR GIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR
Sbjct  249   GNFCICSIAVGIVIELIVMYPIQRRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR  308

Query  1007  LAQQGAIT  1030
             L+QQGAIT
Sbjct  309   LSQQGAIT  316



>emb|CDX72217.1| BnaC07g42390D [Brassica napus]
Length=910

 Score =   455 bits (1171),  Expect = 4e-149, Method: Compositional matrix adjust.
 Identities = 264/308 (86%), Positives = 288/308 (94%), Gaps = 0/308 (0%)
 Frame = +2

Query  107   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  286
             L+ +  ETVDLE IPIEEVF+ L+CTK+GLT+Q  + R+ IFG NKLEEKKESK LKFLG
Sbjct  3     LEDIKNETVDLEKIPIEEVFQQLKCTKEGLTTQEGEARVQIFGLNKLEEKKESKILKFLG  62

Query  287   fMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaa  466
             FMWNPLSWVMEAAAIMAIALANG G+PPDWQDFVGII LLVINSTISFIEENNAGNAAAA
Sbjct  63    FMWNPLSWVMEAAAIMAIALANGDGRPPDWQDFVGIICLLVINSTISFIEENNAGNAAAA  122

Query  467   lmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTG  646
             LMA LAPK KVLRDG+WSE++A+ILVPGDI+S+KLGDIIPADARLL+GDPLK+DQSALTG
Sbjct  123   LMAGLAPKTKVLRDGKWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSALTG  182

Query  647   ESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAI  826
             ESLPVTK PG G++SGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAI
Sbjct  183   ESLPVTKHPGQGVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAI  242

Query  827   ANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR  1006
              NFCICSIA+GMVIEI+VMYPIQ R+YR GIDNLLVLLIGGIPIAMPTVLSVTMAIGSH+
Sbjct  243   GNFCICSIAIGMVIEIIVMYPIQRRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHK  302

Query  1007  LAQQGAIT  1030
             L+QQGAIT
Sbjct  303   LSQQGAIT  310



>ref|XP_010049873.1| PREDICTED: ATPase 8, plasma membrane-type isoform X1 [Eucalyptus 
grandis]
 gb|KCW82682.1| hypothetical protein EUGRSUZ_C04061 [Eucalyptus grandis]
Length=951

 Score =   456 bits (1174),  Expect = 4e-149, Method: Compositional matrix adjust.
 Identities = 261/315 (83%), Positives = 291/315 (92%), Gaps = 0/315 (0%)
 Frame = +2

Query  86    MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
             MA     L+ +  E++DLE IP+EEVFE L+CT++GL++     RL IFG NKLEEKKES
Sbjct  1     MASGDISLEQIKNESIDLERIPVEEVFEQLKCTREGLSTTEGGRRLQIFGLNKLEEKKES  60

Query  266   kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
             KFLKFLGFMWNPLSWVMEAAA+MAIALANGGGKPPDWQDFVGI+TLL+INSTISFIEENN
Sbjct  61    KFLKFLGFMWNPLSWVMEAAAVMAIALANGGGKPPDWQDFVGIVTLLIINSTISFIEENN  120

Query  446   agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  625
             AGNAAAALMA LAPK KVLRDG+W+E++A+ILVPGD++S+KLGDI+PADARLL+GDPLKI
Sbjct  121   AGNAAAALMAGLAPKTKVLRDGKWNEQEAAILVPGDVVSIKLGDIVPADARLLEGDPLKI  180

Query  626   DQSALTGESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF  805
             DQSALTGESLPVTK PGD ++SGSTCKQGEIEA+VIATGVHTFFGKAAHLVDSTNQVGHF
Sbjct  181   DQSALTGESLPVTKNPGDEVFSGSTCKQGEIEAIVIATGVHTFFGKAAHLVDSTNQVGHF  240

Query  806   QKVLTAIANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVT  985
             QKVLTAI NFCICSIA+GM++EIVVMYPIQHR YR GIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  241   QKVLTAIGNFCICSIALGMLVEIVVMYPIQHRSYRAGIDNLLVLLIGGIPIAMPTVLSVT  300

Query  986   MAIGSHRLAQQGAIT  1030
             MAIGSHRL+QQGAIT
Sbjct  301   MAIGSHRLSQQGAIT  315



>ref|XP_010526353.1| PREDICTED: ATPase 2, plasma membrane-type-like [Tarenaya hassleriana]
Length=948

 Score =   456 bits (1174),  Expect = 4e-149, Method: Compositional matrix adjust.
 Identities = 266/308 (86%), Positives = 288/308 (94%), Gaps = 0/308 (0%)
 Frame = +2

Query  107   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  286
             L+ +  ETVDLE IPIEEVF+ L+C+++GLTSQ  ++R+ IFG NKLEEKKESK LKFLG
Sbjct  4     LEDIKNETVDLEKIPIEEVFQQLKCSREGLTSQEGEDRIQIFGPNKLEEKKESKILKFLG  63

Query  287   fMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaa  466
             FMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGI+ LLVINSTISFIEENNAGNAAAA
Sbjct  64    FMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIVCLLVINSTISFIEENNAGNAAAA  123

Query  467   lmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTG  646
             LMA LAPK KVLRDG+WSE++A+ILVPGDIISVKLGDIIPADARLL+GDPLK+DQSALTG
Sbjct  124   LMAGLAPKTKVLRDGKWSEQEAAILVPGDIISVKLGDIIPADARLLEGDPLKVDQSALTG  183

Query  647   ESLPVTKGPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAI  826
             ESLPVTK PGD ++SGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTN VGHFQ VLTAI
Sbjct  184   ESLPVTKHPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNNVGHFQMVLTAI  243

Query  827   ANFCICSIAVGMVIEIVVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR  1006
              NFCICSIAVGM+IEIVVMYPIQ R+YR GIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR
Sbjct  244   GNFCICSIAVGMLIEIVVMYPIQRRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR  303

Query  1007  LAQQGAIT  1030
             L+QQGAIT
Sbjct  304   LSQQGAIT  311



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2624981012963