BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig132

Length=1121
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009783836.1|  PREDICTED: proteasome subunit beta type-5-like     529   0.0      Nicotiana sylvestris
ref|XP_009596640.1|  PREDICTED: proteasome subunit beta type-5-like     523   0.0      Nicotiana tomentosiformis
ref|XP_004239661.1|  PREDICTED: proteasome subunit beta type-5          521   0.0      Solanum lycopersicum
ref|XP_006345787.1|  PREDICTED: proteasome subunit beta type-5-like     520   0.0      Solanum tuberosum [potatoes]
ref|XP_009780639.1|  PREDICTED: proteasome subunit beta type-5-like     518   0.0      Nicotiana sylvestris
ref|XP_009619742.1|  PREDICTED: proteasome subunit beta type-5-like     516   0.0      Nicotiana tomentosiformis
ref|XP_006363770.1|  PREDICTED: proteasome subunit beta type-5-li...    516   0.0      Solanum tuberosum [potatoes]
ref|XP_011071212.1|  PREDICTED: proteasome subunit beta type-5-like     501   6e-175   Sesamum indicum [beniseed]
ref|XP_002264828.1|  PREDICTED: proteasome subunit beta type-5          493   6e-172   Vitis vinifera
ref|XP_008222076.1|  PREDICTED: proteasome subunit beta type-5          490   5e-171   Prunus mume [ume]
ref|XP_004144192.1|  PREDICTED: proteasome subunit beta type-5          490   6e-171   Cucumis sativus [cucumbers]
gb|EYU42103.1|  hypothetical protein MIMGU_mgv1a011714mg                490   7e-171   Erythranthe guttata [common monkey flower]
gb|EPS61043.1|  hypothetical protein M569_13757                         489   1e-170   Genlisea aurea
gb|KHG05622.1|  Proteasome subunit beta type-5                          488   5e-170   Gossypium arboreum [tree cotton]
ref|XP_008445492.1|  PREDICTED: proteasome subunit beta type-5          488   7e-170   Cucumis melo [Oriental melon]
ref|XP_007222598.1|  hypothetical protein PRUPE_ppa009896mg             487   8e-170   Prunus persica
gb|KJB15718.1|  hypothetical protein B456_002G192400                    487   1e-169   Gossypium raimondii
emb|CDP13326.1|  unnamed protein product                                489   2e-169   Coffea canephora [robusta coffee]
ref|XP_012085655.1|  PREDICTED: proteasome subunit beta type-5          486   2e-169   Jatropha curcas
ref|XP_008340194.1|  PREDICTED: proteasome subunit beta type-5          486   3e-169   
gb|KHG25400.1|  Proteasome subunit beta type-5                          485   5e-169   Gossypium arboreum [tree cotton]
gb|KJB78067.1|  hypothetical protein B456_012G175200                    485   7e-169   Gossypium raimondii
ref|XP_009372313.1|  PREDICTED: proteasome subunit beta type-5          485   7e-169   Pyrus x bretschneideri [bai li]
ref|XP_009376552.1|  PREDICTED: proteasome subunit beta type-5-like     484   2e-168   Pyrus x bretschneideri [bai li]
ref|XP_007045043.1|  N-terminal nucleophile aminohydrolases (Ntn ...    483   2e-168   
ref|XP_008381840.1|  PREDICTED: proteasome subunit beta type-5-like     482   1e-167   
ref|XP_006395566.1|  hypothetical protein EUTSA_v10004762mg             481   1e-167   Eutrema salsugineum [saltwater cress]
ref|XP_006291670.1|  hypothetical protein CARUB_v10017828mg             480   6e-167   Capsella rubella
ref|XP_010025332.1|  PREDICTED: proteasome subunit beta type-5-B        480   7e-167   Eucalyptus grandis [rose gum]
ref|XP_010682823.1|  PREDICTED: proteasome subunit beta type-5          478   5e-166   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010250770.1|  PREDICTED: proteasome subunit beta type-5          475   4e-165   Nelumbo nucifera [Indian lotus]
ref|XP_009416647.1|  PREDICTED: proteasome subunit beta type-5-like     474   8e-165   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY34594.1|  BnaC03g56940D                                          474   9e-165   Brassica napus [oilseed rape]
ref|XP_010425347.1|  PREDICTED: proteasome subunit beta type-5-B        474   9e-165   Camelina sativa [gold-of-pleasure]
ref|XP_007137929.1|  hypothetical protein PHAVU_009G167300g             474   1e-164   Phaseolus vulgaris [French bean]
ref|XP_010105786.1|  Proteasome subunit beta type-5                     474   1e-164   Morus notabilis
emb|CDX98014.1|  BnaA06g07650D                                          474   2e-164   
emb|CDY21081.1|  BnaA08g24440D                                          473   2e-164   Brassica napus [oilseed rape]
ref|XP_009110603.1|  PREDICTED: proteasome subunit beta type-5-B        473   3e-164   Brassica rapa
sp|O24361.1|PSB5_SPIOL  RecName: Full=Proteasome subunit beta typ...    473   3e-164   Spinacia oleracea
ref|XP_010251768.1|  PREDICTED: proteasome subunit beta type-5-like     473   3e-164   Nelumbo nucifera [Indian lotus]
ref|XP_010514289.1|  PREDICTED: proteasome subunit beta type-5-B-...    473   3e-164   Camelina sativa [gold-of-pleasure]
ref|XP_003526966.1|  PREDICTED: proteasome subunit beta type-5-like     473   3e-164   Glycine max [soybeans]
ref|NP_189265.1|  proteasome subunit beta type-5-B                      472   6e-164   Arabidopsis thaliana [mouse-ear cress]
emb|CDY19402.1|  BnaC05g09110D                                          472   7e-164   Brassica napus [oilseed rape]
gb|KHN31904.1|  Proteasome subunit beta type-5                          472   8e-164   Glycine soja [wild soybean]
emb|CDY16054.1|  BnaC08g40690D                                          471   1e-163   Brassica napus [oilseed rape]
ref|XP_006417162.1|  hypothetical protein EUTSA_v10008454mg             471   2e-163   Eutrema salsugineum [saltwater cress]
gb|ACU23791.1|  unknown                                                 471   2e-163   Glycine max [soybeans]
ref|XP_010538272.1|  PREDICTED: proteasome subunit beta type-5-B-...    471   2e-163   Tarenaya hassleriana [spider flower]
ref|XP_009148547.1|  PREDICTED: proteasome subunit beta type-5-B-...    471   3e-163   Brassica rapa
ref|XP_010502548.1|  PREDICTED: proteasome subunit beta type-5-B-...    470   4e-163   Camelina sativa [gold-of-pleasure]
ref|XP_002876966.1|  hypothetical protein ARALYDRAFT_484397             470   4e-163   
ref|XP_003523139.1|  PREDICTED: proteasome subunit beta type-5-li...    469   9e-163   Glycine max [soybeans]
emb|CDY26610.1|  BnaA09g46670D                                          469   1e-162   Brassica napus [oilseed rape]
gb|ACP43315.1|  20S proteasome beta subunit 5                           469   1e-162   Citrus maxima [buntan]
gb|ERN03775.1|  hypothetical protein AMTR_s00078p00083100               469   2e-162   Amborella trichopoda
ref|XP_008810773.1|  PREDICTED: proteasome subunit beta type-5-like     469   2e-162   Phoenix dactylifera
ref|XP_006484070.1|  PREDICTED: proteasome subunit beta type-5-B-...    468   2e-162   Citrus sinensis [apfelsine]
ref|XP_011622487.1|  PREDICTED: proteasome subunit beta type-5          468   2e-162   Amborella trichopoda
ref|XP_010905449.1|  PREDICTED: proteasome subunit beta type-5-like     468   3e-162   Elaeis guineensis
ref|XP_006438069.1|  hypothetical protein CICLE_v10032238mg             468   4e-162   Citrus clementina [clementine]
ref|XP_008806245.1|  PREDICTED: proteasome subunit beta type-5-like     468   5e-162   Phoenix dactylifera
ref|XP_011457464.1|  PREDICTED: proteasome subunit beta type-5-like     467   1e-161   Fragaria vesca subsp. vesca
ref|XP_004135309.1|  PREDICTED: proteasome subunit beta type-5-like     466   2e-161   Cucumis sativus [cucumbers]
gb|AFK46055.1|  unknown                                                 466   2e-161   Lotus japonicus
gb|KGN51684.1|  hypothetical protein Csa_5G590010                       466   2e-161   Cucumis sativus [cucumbers]
ref|XP_010540655.1|  PREDICTED: proteasome subunit beta type-5-B        465   3e-161   Tarenaya hassleriana [spider flower]
ref|XP_009118034.1|  PREDICTED: proteasome subunit beta type-5-B-...    464   7e-161   Brassica rapa
gb|ABK25888.1|  unknown                                                 462   8e-160   Picea sitchensis
ref|XP_010912107.1|  PREDICTED: proteasome subunit beta type-5-like     461   1e-159   Elaeis guineensis
ref|XP_003602092.1|  Proteasome subunit beta type                       461   1e-159   Medicago truncatula
gb|ABK25785.1|  unknown                                                 461   2e-159   Picea sitchensis
ref|XP_011029673.1|  PREDICTED: proteasome subunit beta type-5-B-...    460   3e-159   Populus euphratica
ref|XP_002312631.2|  20S proteasome beta subunit family protein         460   5e-159   
gb|AFK34329.1|  unknown                                                 458   2e-158   Medicago truncatula
ref|XP_006305519.1|  hypothetical protein CARUB_v10009991mg             458   2e-158   Capsella rubella
ref|NP_172765.1|  20S proteasome beta subunit E1                        458   3e-158   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002889982.1|  hypothetical protein ARALYDRAFT_471459             457   4e-158   
gb|AAK92808.1|  putative proteasome epsilon chain precursor             457   5e-158   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010458748.1|  PREDICTED: proteasome subunit beta type-5-A-...    457   7e-158   Camelina sativa [gold-of-pleasure]
ref|XP_010494920.1|  PREDICTED: proteasome subunit beta type-5-A        457   9e-158   Camelina sativa [gold-of-pleasure]
ref|XP_010476293.1|  PREDICTED: proteasome subunit beta type-5-A-...    456   1e-157   Camelina sativa [gold-of-pleasure]
gb|AFK38197.1|  unknown                                                 454   1e-156   Medicago truncatula
ref|XP_002315619.1|  20S proteasome beta subunit family protein         448   2e-154   Populus trichocarpa [western balsam poplar]
ref|XP_011041516.1|  PREDICTED: proteasome subunit beta type-5-B-...    447   4e-154   Populus euphratica
gb|ACJ85344.1|  unknown                                                 447   5e-154   Medicago truncatula
ref|NP_001184978.1|  20S proteasome beta subunit E1                     445   1e-152   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001132821.1|  uncharacterized protein LOC100194311               431   2e-147   Zea mays [maize]
ref|XP_002437853.1|  hypothetical protein SORBIDRAFT_10g003770          431   2e-147   Sorghum bicolor [broomcorn]
ref|XP_004964820.1|  PREDICTED: proteasome subunit beta type-5-A-...    430   3e-147   Setaria italica
ref|XP_006655798.1|  PREDICTED: proteasome subunit beta type-5-A-...    430   4e-147   Oryza brachyantha
ref|XP_003564317.1|  PREDICTED: proteasome subunit beta type-5-A-...    426   1e-145   Brachypodium distachyon [annual false brome]
gb|EEE65108.1|  hypothetical protein OsJ_20167                          424   1e-144   Oryza sativa Japonica Group [Japonica rice]
dbj|BAA96838.1|  beta 5 subunit of 20S proteasome                       424   1e-144   Oryza sativa Japonica Group [Japonica rice]
gb|ACU51028.1|  20S proteasome beta5 subunit                            423   2e-144   Conocephalum conicum
gb|AAU82107.1|  20S proteasome beta 5 subunit                           422   3e-144   Triticum aestivum [Canadian hard winter wheat]
ref|NP_001056842.1|  Os06g0153800                                       422   4e-144   
gb|EEC80034.1|  hypothetical protein OsI_21721                          421   8e-144   Oryza sativa Indica Group [Indian rice]
ref|XP_010912828.1|  PREDICTED: proteasome subunit beta type-5-like     421   9e-144   Elaeis guineensis
ref|XP_008791726.1|  PREDICTED: proteasome subunit beta type-5-like     420   2e-143   Phoenix dactylifera
dbj|BAJ97061.1|  predicted protein                                      420   3e-143   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_001759925.1|  predicted protein                                  419   6e-143   
gb|EMS57921.1|  Proteasome subunit beta type-5                          401   9e-137   Triticum urartu
ref|XP_002972642.1|  hypothetical protein SELMODRAFT_270977             402   5e-136   Selaginella moellendorffii
dbj|BAG92607.1|  unnamed protein product                                398   1e-135   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002994143.1|  hypothetical protein SELMODRAFT_272351             400   2e-135   Selaginella moellendorffii
gb|AFW85803.1|  hypothetical protein ZEAMMB73_646691                    390   1e-131   
ref|XP_002514943.1|  proteasome subunit beta type 5,8, putative         388   4e-131   
gb|AAL26914.1|AF323592_1  putative 20S proteasome beta subunit 5        382   1e-129   Prunus persica
gb|EMT01588.1|  Proteasome subunit beta type-5-A                        416   3e-129   
ref|NP_001265983.1|  proteasome subunit beta type-5-like                379   1e-127   Cicer arietinum [garbanzo]
ref|XP_001751936.1|  predicted protein                                  372   6e-125   
gb|ACP43316.1|  20S proteasome beta subunit 5                           367   7e-124   Citrus maxima [buntan]
ref|XP_003061052.1|  predicted protein                                  366   4e-122   Micromonas pusilla CCMP1545
ref|XP_003083185.1|  20S proteasome, regulatory subunit beta type...    366   5e-122   Ostreococcus tauri
ref|XP_007514496.1|  predicted protein                                  365   3e-121   Bathycoccus prasinos
gb|ABE68720.1|  20S proteasome beta subunit                             361   6e-121   Arachis hypogaea [goober]
ref|XP_001421201.1|  predicted protein                                  363   1e-120   Ostreococcus lucimarinus CCE9901
ref|XP_002506817.1|  predicted protein                                  360   2e-119   Micromonas commoda
gb|KCW61971.1|  hypothetical protein EUGRSUZ_H04655                     353   4e-118   Eucalyptus grandis [rose gum]
emb|CAC43326.1|  putative beta5 proteasome subunit                      351   9e-118   Nicotiana tabacum [American tobacco]
ref|XP_007045045.1|  N-terminal nucleophile aminohydrolases (Ntn ...    352   1e-117   
ref|XP_005643539.1|  20S proteasome beta subunit E, type beta 5         351   2e-116   Coccomyxa subellipsoidea C-169
ref|XP_005851025.1|  hypothetical protein CHLNCDRAFT_56983              348   3e-115   Chlorella variabilis
ref|XP_002950006.1|  hypothetical protein VOLCADRAFT_74437              347   2e-114   Volvox carteri f. nagariensis
ref|XP_001698605.1|  20S proteasome beta subunit E, type beta 5         343   3e-113   Chlamydomonas reinhardtii
gb|KDO81953.1|  hypothetical protein CISIN_1g022125mg                   339   1e-112   Citrus sinensis [apfelsine]
ref|XP_006438071.1|  hypothetical protein CICLE_v10032238mg             338   3e-111   
ref|XP_011396916.1|  Proteasome subunit beta type-5-B                   337   1e-110   Auxenochlorella protothecoides
gb|KDD75121.1|  proteasome subunit protein                              319   3e-104   Helicosporidium sp. ATCC 50920
gb|AFW85805.1|  hypothetical protein ZEAMMB73_646691                    308   3e-100   
gb|EIE77859.1|  proteasome component PRE2                               309   8e-100   Rhizopus delemar RA 99-880
emb|CEG76257.1|  Putative Proteasome subunit beta type                  306   1e-98    Rhizopus microsporus
ref|XP_002678668.1|  predicted protein                                  306   2e-98    Naegleria gruberi strain NEG-M
gb|KFH71396.1|  20S proteasome subunit beta 5                           301   1e-96    Mortierella verticillata NRRL 6337
gb|KDO81951.1|  hypothetical protein CISIN_1g022125mg                   273   1e-96    Citrus sinensis [apfelsine]
emb|CEP17612.1|  hypothetical protein                                   301   1e-96    Parasitella parasitica
ref|XP_006484069.1|  PREDICTED: proteasome subunit beta type-5-B-...    272   1e-96    Citrus sinensis [apfelsine]
ref|XP_004333043.1|  proteasome endopeptidase subunit, putative         300   2e-96    Acanthamoeba castellanii str. Neff
ref|XP_006438070.1|  hypothetical protein CICLE_v10032238mg             271   2e-96    
ref|XP_009061521.1|  hypothetical protein LOTGIDRAFT_166223             300   3e-96    Lottia gigantea
ref|XP_002730946.1|  PREDICTED: proteasome subunit beta type-5-like     299   5e-96    Saccoglossus kowalevskii
gb|AAM18885.1|AF391293_2  unknown                                       299   6e-96    Branchiostoma floridae
ref|XP_009021669.1|  hypothetical protein HELRODRAFT_83371              298   6e-96    Helobdella robusta
ref|XP_002162379.2|  PREDICTED: proteasome subunit beta type-5-like     299   8e-96    Hydra vulgaris
dbj|GAN10935.1|  20S proteasome subunit                                 299   1e-95    Mucor ambiguus
ref|XP_006682354.1|  hypothetical protein BATDEDRAFT_14510              298   1e-95    Batrachochytrium dendrobatidis JAM81
gb|EPB87271.1|  proteasome component PRE2                               298   1e-95    Mucor circinelloides f. circinelloides 1006PhL
emb|CDH56820.1|  20s proteasome subunit                                 298   1e-95    Lichtheimia corymbifera JMRC:FSU:9682
ref|XP_005825075.1|  20S proteasome subunit beta type 5                 299   1e-95    Guillardia theta CCMP2712
gb|ESA00717.1|  hypothetical protein GLOINDRAFT_338395                  298   3e-95    
emb|CAA66313.1|  LMP7-like protein                                      296   4e-95    Botryllus schlosseri
ref|XP_002179855.1|  predicted protein                                  297   5e-95    Phaeodactylum tricornutum CCAP 1055/1
ref|XP_004994692.1|  LMP X protein                                      297   6e-95    Salpingoeca rosetta
gb|AAI55951.1|  LOC100127332 protein                                    296   7e-95    Xenopus laevis [clawed frog]
emb|CBY21147.1|  unnamed protein product                                296   9e-95    Oikopleura dioica
ref|XP_004347536.2|  hypothetical protein CAOG_04785                    297   1e-94    Capsaspora owczarzaki ATCC 30864
ref|XP_002111558.1|  hypothetical protein TRIADDRAFT_55706              296   1e-94    Trichoplax adhaerens
gb|AAY98499.1|  LMP X                                                   295   1e-94    Swiftia exserta
ref|XP_005994469.1|  PREDICTED: proteasome subunit beta type-5-like     295   1e-94    Latimeria chalumnae
gb|ELT88834.1|  hypothetical protein CAPTEDRAFT_150903                  296   1e-94    Capitella teleta
ref|XP_001730616.1|  hypothetical protein MGL_2412                      296   2e-94    Malassezia globosa CBS 7966
ref|XP_004474611.1|  PREDICTED: proteasome subunit beta type-5          295   2e-94    Dasypus novemcinctus
ref|XP_002941560.1|  PREDICTED: proteasome subunit beta type-5          295   2e-94    Xenopus tropicalis [western clawed frog]
gb|AAS01050.1|  putative proteasome 20S beta5 subunit                   290   3e-94    Brassica napus [oilseed rape]
ref|XP_011441202.1|  PREDICTED: proteasome subunit beta type-5-like     293   9e-94    Crassostrea gigas
ref|XP_005707411.1|  20S proteasome subunit beta 5                      293   1e-93    Galdieria sulphuraria
ref|XP_005110562.1|  PREDICTED: proteasome subunit beta type-5-like     293   1e-93    Aplysia californica
ref|XP_004694702.1|  PREDICTED: proteasome subunit beta type-5 is...    290   2e-93    
gb|AAP36588.1|  Homo sapiens proteasome (prosome, macropain) subu...    290   2e-93    synthetic construct
dbj|BAA06097.1|  proteasome subunit X                                   290   2e-93    Homo sapiens [man]
ref|XP_007258118.1|  PREDICTED: proteasome subunit beta type-5-li...    292   2e-93    
gb|KFH65162.1|  20S proteasome subunit beta 5                           292   3e-93    Mortierella verticillata NRRL 6337
ref|XP_005933706.1|  PREDICTED: proteasome subunit beta type-5-like     292   3e-93    Haplochromis burtoni
ref|XP_005740284.1|  PREDICTED: proteasome subunit beta type-5-like     292   4e-93    Pundamilia nyererei
emb|CAA66312.1|  LMP7-like protein                                      292   4e-93    Geodia cydonium
pdb|3UNB|K  Chain K, Mouse Constitutive 20s Proteasome In Complex...    289   4e-93    Mus musculus [mouse]
ref|XP_008332973.1|  PREDICTED: proteasome subunit beta type-5          292   4e-93    Cynoglossus semilaevis [half-smooth tongue sole]
ref|XP_005537552.1|  20S core proteasome subunit beta 5                 293   4e-93    Cyanidioschyzon merolae strain 10D
ref|XP_004565403.1|  PREDICTED: proteasome subunit beta type-5-like     291   4e-93    
pdb|4R3O|L  Chain L, Human Constitutive 20s Proteasome                  289   4e-93    Homo sapiens [man]
ref|XP_006988553.1|  PREDICTED: proteasome subunit beta type-5          291   5e-93    Peromyscus maniculatus bairdii
ref|XP_005875924.1|  PREDICTED: proteasome subunit beta type-5-like     291   5e-93    Myotis brandtii
ref|XP_003457456.2|  PREDICTED: proteasome subunit beta type-5-like     292   5e-93    Oreochromis niloticus
ref|XP_008292170.1|  PREDICTED: proteasome subunit beta type-5          291   5e-93    Stegastes partitus
dbj|BAA08204.1|  proteasome subunit RCX                                 289   5e-93    Rattus rattus [house rat]
pdb|1IRU|L  Chain L, Crystal Structure Of The Mammalian 20s Prote...    289   5e-93    Bos taurus [bovine]
ref|XP_007100517.1|  PREDICTED: proteasome subunit beta type-5 is...    291   6e-93    Physeter catodon
ref|XP_004010385.1|  PREDICTED: proteasome subunit beta type-5          291   6e-93    Ovis aries [domestic sheep]
ref|XP_005978061.1|  PREDICTED: proteasome subunit beta type-5 is...    291   7e-93    Pantholops hodgsonii [Tibetan antelope]
ref|XP_007439509.1|  PREDICTED: proteasome subunit beta type-5          291   7e-93    Python bivittatus
ref|XP_004421295.1|  PREDICTED: proteasome subunit beta type-5          291   8e-93    Ceratotherium simum simum [southern square-lipped rhinoceros]
ref|XP_004313402.1|  PREDICTED: proteasome subunit beta type-5 is...    288   9e-93    
ref|XP_006776843.1|  PREDICTED: proteasome subunit beta type-5          291   9e-93    Myotis davidii
ref|XP_008564788.1|  PREDICTED: proteasome subunit beta type-5          290   1e-92    Galeopterus variegatus [Malayan flying lemur]
ref|XP_003924370.1|  PREDICTED: proteasome subunit beta type-5          290   1e-92    Saimiri boliviensis boliviensis
ref|XP_006100131.1|  PREDICTED: proteasome subunit beta type-5          290   1e-92    Myotis lucifugus
ref|XP_002753673.3|  PREDICTED: proteasome subunit beta type-5          290   1e-92    Callithrix jacchus [common marmoset]
ref|XP_005338834.1|  PREDICTED: proteasome subunit beta type-5          288   1e-92    
gb|EWM22648.1|  proteasome subunit beta type 5                          291   1e-92    Nannochloropsis gaditana
ref|XP_006144566.1|  PREDICTED: proteasome subunit beta type-5          290   1e-92    Tupaia chinensis
ref|XP_007449602.1|  PREDICTED: proteasome subunit beta type-5 is...    290   1e-92    Lipotes vexillifer [baiji]
ref|XP_008156742.1|  PREDICTED: proteasome subunit beta type-5 is...    290   1e-92    Eptesicus fuscus
ref|XP_001626004.1|  predicted protein                                  291   1e-92    Nematostella vectensis
ref|XP_004283228.1|  PREDICTED: proteasome subunit beta type-5 is...    290   1e-92    Orcinus orca [Orca]
gb|ELR56586.1|  Proteasome subunit beta type-5                          290   2e-92    Bos mutus
ref|XP_006066544.1|  PREDICTED: proteasome subunit beta type-5          290   2e-92    Bubalus bubalis [domestic water buffalo]
gb|EFA82937.1|  proteasome subunit beta type 5                          290   2e-92    Heterostelium album PN500
ref|XP_004694701.1|  PREDICTED: proteasome subunit beta type-5 is...    290   2e-92    Condylura cristata
ref|XP_002290272.1|  proteasome subunit beta type 5 precursor           290   2e-92    Thalassiosira pseudonana CCMP1335
ref|XP_003801967.1|  PREDICTED: proteasome subunit beta type-5          290   2e-92    Otolemur garnettii
ref|XP_006835507.1|  PREDICTED: proteasome subunit beta type-5          290   2e-92    Chrysochloris asiatica
ref|NP_001032701.1|  proteasome subunit beta type-5                     290   2e-92    Bos taurus [bovine]
ref|XP_003987515.1|  PREDICTED: proteasome subunit beta type-5          290   2e-92    Felis catus [cat]
ref|XP_008065987.1|  PREDICTED: proteasome subunit beta type-5          290   2e-92    Carlito syrichta
ref|XP_002926051.1|  PREDICTED: proteasome subunit beta type-5          290   2e-92    Ailuropoda melanoleuca
ref|XP_006802789.1|  PREDICTED: proteasome subunit beta type-5-like     290   2e-92    Neolamprologus brichardi [lyretail cichlid]
ref|XP_005882305.1|  PREDICTED: proteasome subunit beta type-5          289   3e-92    Myotis brandtii
ref|XP_010744420.1|  PREDICTED: proteasome subunit beta type-5          290   3e-92    
ref|XP_003755883.1|  PREDICTED: proteasome subunit beta type-5          289   3e-92    Sarcophilus harrisii
ref|XP_007180616.1|  PREDICTED: proteasome subunit beta type-5          289   3e-92    Balaenoptera acutorostrata scammoni
ref|XP_008708757.1|  PREDICTED: proteasome subunit beta type-5          289   3e-92    Ursus maritimus [white bear]
ref|NP_001099197.2|  proteasome subunit beta type-5                     289   3e-92    Rattus norvegicus [brown rat]
ref|XP_002718121.1|  PREDICTED: proteasome subunit beta type-5 is...    289   3e-92    Oryctolagus cuniculus [domestic rabbit]
ref|XP_003421032.1|  PREDICTED: proteasome subunit beta type-5          289   4e-92    Loxodonta africana [African bush elephant]
ref|XP_004698955.1|  PREDICTED: proteasome subunit beta type-5          289   5e-92    Echinops telfairi [lesser hedgehog tenrec]
ref|XP_003506173.1|  PREDICTED: proteasome subunit beta type-5          289   5e-92    Cricetulus griseus [Chinese hamsters]
ref|XP_004389982.1|  PREDICTED: proteasome subunit beta type-5          289   5e-92    Trichechus manatus latirostris
ref|XP_001494538.2|  PREDICTED: proteasome subunit beta type-5 is...    289   5e-92    
ref|XP_004402154.1|  PREDICTED: proteasome subunit beta type-5          288   5e-92    Odobenus rosmarus divergens
ref|XP_008527207.1|  PREDICTED: proteasome subunit beta type-5          288   5e-92    Equus przewalskii [Przewalski horse]
dbj|BAE93066.1|  low molecular mass polypeptide                         286   5e-92    Lethenteron camtschaticum [Japanese lamprey]
ref|XP_003639276.1|  PREDICTED: proteasome subunit beta type-5          288   6e-92    Canis lupus familiaris [dogs]
ref|XP_010376681.1|  PREDICTED: proteasome subunit beta type-5          289   6e-92    Rhinopithecus roxellana
ref|NP_035316.1|  proteasome subunit beta type-5                        288   6e-92    Mus musculus [mouse]
gb|AAH12246.1|  Proteasome (prosome, macropain) subunit, beta type 5    288   6e-92    Mus musculus [mouse]
ref|XP_004313401.1|  PREDICTED: proteasome subunit beta type-5 is...    288   6e-92    Tursiops truncatus [Atlantic bottle-nosed dolphin]
emb|CAD97956.1|  hypothetical protein                                   288   6e-92    Homo sapiens [man]
ref|XP_004584741.1|  PREDICTED: proteasome subunit beta type-5          288   7e-92    Ochotona princeps [southern American pika]
ref|XP_003474544.1|  PREDICTED: proteasome subunit beta type-5          288   7e-92    Cavia porcellus [guinea pig]
ref|XP_006217298.1|  PREDICTED: proteasome subunit beta type-5          288   7e-92    Vicugna pacos
ref|XP_004054982.1|  PREDICTED: proteasome subunit beta type-5 is...    288   7e-92    
sp|P28075.3|PSB5_RAT  RecName: Full=Proteasome subunit beta type-...    288   7e-92    Rattus norvegicus [brown rat]
ref|XP_007989004.1|  PREDICTED: proteasome subunit beta type-5 is...    288   7e-92    Chlorocebus sabaeus
ref|XP_003260670.1|  PREDICTED: proteasome subunit beta type-5 is...    288   8e-92    Nomascus leucogenys [White-cheeked Gibbon]
ref|XP_004054980.1|  PREDICTED: proteasome subunit beta type-5 is...    288   8e-92    Gorilla gorilla gorilla [lowland gorilla]
ref|NP_001247774.1|  proteasome subunit beta type-5                     288   8e-92    Macaca mulatta [rhesus macaque]
gb|ADO27969.1|  proteasome subunit beta type-5                          288   8e-92    Ictalurus furcatus
ref|NP_002788.1|  proteasome subunit beta type-5 isoform 1              288   8e-92    Homo sapiens [man]
ref|XP_011786261.1|  PREDICTED: proteasome subunit beta type-5 is...    288   9e-92    Colobus angolensis palliatus
ref|XP_007949373.1|  PREDICTED: proteasome subunit beta type-5 is...    288   1e-91    Orycteropus afer afer
ref|XP_005978060.1|  PREDICTED: proteasome subunit beta type-5 is...    288   1e-91    Pantholops hodgsonii [Tibetan antelope]
gb|AAB33092.1|  proteasome subunit MB1                                  286   1e-91    Homo sapiens [man]
gb|AAL74417.1|  proteosome PSMB5/8 protein                              285   1e-91    Branchiostoma lanceolatum [common lancelet]
ref|XP_006913661.1|  PREDICTED: proteasome subunit beta type-5          288   1e-91    Pteropus alecto
ref|XP_005370537.1|  PREDICTED: proteasome subunit beta type-5          288   1e-91    Microtus ochrogaster [prairie voles]
ref|XP_001568804.1|  putative proteasome beta 5 subunit                 289   1e-91    Leishmania braziliensis MHOM/BR/75/M2904
ref|XP_004879937.1|  PREDICTED: proteasome subunit beta type-5          288   1e-91    
emb|CAF97719.1|  unnamed protein product                                288   1e-91    Tetraodon nigroviridis
ref|XP_010781265.1|  PREDICTED: proteasome subunit beta type-5          288   1e-91    Notothenia coriiceps [yellowbelly rockcod]
ref|XP_010703107.1|  proteasome beta 5 subunit, putative                289   2e-91    Leishmania panamensis
ref|XP_628966.1|  proteasome subunit beta type 5                        288   2e-91    Dictyostelium discoideum AX4
ref|XP_010636092.1|  PREDICTED: proteasome subunit beta type-5          287   2e-91    Fukomys damarensis [Damara mole rat]
ref|XP_008121563.1|  PREDICTED: proteasome subunit beta type-5          288   2e-91    Anolis carolinensis [Carolina anole]
ref|XP_004646709.1|  PREDICTED: proteasome subunit beta type-5          287   2e-91    Octodon degus
dbj|BAB26942.1|  unnamed protein product                                287   2e-91    Mus musculus [mouse]
ref|XP_006883201.1|  PREDICTED: proteasome subunit beta type-5          287   3e-91    Elephantulus edwardii [Cape long-eared elephant shrew]
ref|XP_001924480.2|  PREDICTED: proteasome subunit beta type-5          287   3e-91    Sus scrofa [pigs]
dbj|GAM19629.1|  hypothetical protein SAMD00019534_028040               287   3e-91    Acytostelium subglobosum LB1
ref|XP_004661842.1|  PREDICTED: proteasome subunit beta type-5          286   3e-91    Jaculus jaculus
ref|XP_001379940.1|  PREDICTED: proteasome subunit beta type-5          286   3e-91    Monodelphis domestica
ref|XP_008036606.1|  proteasome component pts1                          288   3e-91    Trametes versicolor FP-101664 SS1
ref|XP_001745267.1|  hypothetical protein                               286   3e-91    Monosiga brevicollis MX1
ref|XP_008838115.1|  PREDICTED: proteasome subunit beta type-5          286   4e-91    Nannospalax galili
ref|XP_003977752.1|  PREDICTED: proteasome subunit beta type-5          286   4e-91    
gb|ADL27419.1|  proteasome subunit beta type                            287   4e-91    Pheronema raphanus
ref|XP_004755394.1|  PREDICTED: proteasome subunit beta type-5 is...    286   4e-91    Mustela putorius furo [black ferret]
ref|XP_007536740.1|  PREDICTED: proteasome subunit beta type-5          286   5e-91    Erinaceus europaeus [common hedgehog]
ref|XP_001686739.1|  putative proteasome beta 5 subunit                 287   6e-91    
ref|XP_004609529.1|  PREDICTED: proteasome subunit beta type-5          286   7e-91    
gb|EJK48257.1|  hypothetical protein THAOC_32963                        285   9e-91    
ref|XP_005713380.1|  20S core proteasome subunit beta 5                 286   9e-91    
gb|ACO09253.1|  Proteasome subunit beta type 5 precursor                284   1e-90    
ref|XP_001469755.1|  putative proteasome beta 5 subunit                 286   1e-90    
ref|XP_003287743.1|  proteasome subunit beta type 5                     285   1e-90    
dbj|BAA10932.1|  LMPX of lamprey                                        285   1e-90    
emb|CCF49354.1|  probable PRE2-20S core proteasome subunit (beta5)      287   1e-90    
ref|XP_007395513.1|  hypothetical protein PHACADRAFT_255622             286   2e-90    
gb|KDN39743.1|  putative PRE2-20S core proteasome subunit               286   2e-90    
ref|XP_007552653.1|  PREDICTED: proteasome subunit beta type-5          286   2e-90    
ref|XP_005809292.1|  PREDICTED: proteasome subunit beta type-5-like     285   2e-90    
ref|XP_003388964.1|  PREDICTED: proteasome subunit beta type-5-like     285   2e-90    
ref|XP_005290231.1|  PREDICTED: proteasome subunit beta type-5          285   2e-90    
ref|XP_008431210.1|  PREDICTED: proteasome subunit beta type-5          285   3e-90    
ref|XP_007385467.1|  N-terminal nucleophile aminohydrolase              286   3e-90    
gb|EJU05281.1|  proteasome-domain-containing protein                    286   3e-90    
ref|XP_003874511.1|  putative proteasome beta 5 subunit                 285   3e-90    
ref|XP_007863011.1|  20S proteasome subunit                             285   4e-90    
ref|XP_005139397.1|  PREDICTED: LOW QUALITY PROTEIN: proteasome (...    283   4e-90    
ref|XP_006175925.1|  PREDICTED: proteasome subunit beta type-5          284   4e-90    
emb|CBN74512.1|  conserved unknown protein                              285   4e-90    
gb|AGG11598.1|  hypothetical protein                                    285   5e-90    
ref|XP_001509497.1|  PREDICTED: proteasome subunit beta type-5          283   6e-90    
ref|XP_007418509.1|  20S proteasome subunit                             284   7e-90    
dbj|BAA10935.1|  nurse shark LMPX                                       283   7e-90    
emb|CAQ14651.1|  proteasome (prosome, macropain) subunit, beta ty...    283   7e-90    
gb|AAI53590.1|  Psmb5 protein                                           283   8e-90    
ref|XP_009311762.1|  proteasome beta 5 subunit                          285   8e-90    
gb|AAD53518.1|AF155578_1  proteasome subunit beta 5                     283   8e-90    
ref|NP_001270574.1|  uncharacterized protein LOC101865806               283   9e-90    
emb|CCC93748.1|  proteasome beta 5 subunit                              284   9e-90    
ref|XP_002132107.1|  PREDICTED: proteasome subunit beta type-5          283   9e-90    
gb|KIK59625.1|  hypothetical protein GYMLUDRAFT_201809                  284   1e-89    
ref|XP_004358358.1|  proteasome subunit beta type 5                     284   1e-89    
ref|NP_571226.1|  proteasome subunit beta type-5                        282   2e-89    
ref|XP_011391773.1|  putative proteasome core particle subunit be...    283   2e-89    
gb|KDR73611.1|  hypothetical protein GALMADRAFT_124865                  284   2e-89    
ref|XP_003332961.2|  20S proteasome subunit beta 5                      283   2e-89    
ref|XP_006036581.1|  PREDICTED: proteasome subunit beta type-5          281   2e-89    
ref|XP_009242876.1|  PREDICTED: proteasome subunit beta type-5-like     282   2e-89    
gb|KDE05583.1|  proteasome component PRE2                               283   3e-89    
emb|CCO27714.1|  20S proteasome subunit beta 5                          283   3e-89    
gb|KJA27011.1|  hypothetical protein HYPSUDRAFT_35526                   283   4e-89    
emb|CDI55907.1|  probable PRE2-20S core proteasome subunit (beta5...    283   4e-89    
gb|KDQ33416.1|  hypothetical protein PLEOSDRAFT_1110569                 283   4e-89    
ref|XP_007006996.1|  hypothetical protein TREMEDRAFT_34309              282   4e-89    
gb|KDQ60928.1|  hypothetical protein JAAARDRAFT_125152                  283   5e-89    
gb|EPY26658.1|  20S proteasome subunit beta 5                           279   5e-89    
ref|XP_007850837.1|  proteasome component pre2 precursor                282   5e-89    
ref|XP_006261242.1|  PREDICTED: proteasome subunit beta type-5          281   5e-89    
gb|KDQ18004.1|  hypothetical protein BOTBODRAFT_104582                  282   6e-89    
gb|EPY20654.1|  20S proteasome subunit beta 5                           282   7e-89    
dbj|BAM21000.1|  proteasome subunit beta type-8                         279   7e-89    
ref|XP_007321997.1|  hypothetical protein SERLADRAFT_475676             282   8e-89    
gb|KIJ17479.1|  hypothetical protein PAXINDRAFT_168130                  282   8e-89    
gb|EST08741.1|  20S proteasome, regulatory subunit beta type PSMB...    283   9e-89    
dbj|BAA10933.1|  LMP7 of nurse shark                                    281   9e-89    
emb|CCM00020.1|  predicted protein                                      281   9e-89    
gb|KIJ69319.1|  hypothetical protein HYDPIDRAFT_79749                   282   1e-88    
gb|KII89158.1|  hypothetical protein PLICRDRAFT_109139                  282   1e-88    
gb|AGG11403.1|  hypothetical protein                                    281   1e-88    
emb|CDO73558.1|  hypothetical protein BN946_scf185014.g28               281   1e-88    
gb|KIL00906.1|  hypothetical protein PAXRUDRAFT_821100                  281   2e-88    
ref|XP_007764597.1|  20S proteasome subunit                             281   2e-88    
gb|AAF37285.1|AF226674_1  20S proteasome beta 5 subunit                 279   2e-88    
gb|KIY65291.1|  proteasome-domain-containing protein                    281   2e-88    
ref|XP_007361365.1|  N-terminal nucleophile aminohydrolase              281   2e-88    
dbj|BAA10934.1|  LMP7                                                   280   2e-88    
gb|KIM65350.1|  hypothetical protein SCLCIDRAFT_542814                  280   3e-88    
gb|EPY31554.1|  20S proteasome subunit beta 5                           279   3e-88    
dbj|BAO50694.1|  proteasome subunit beta type 8,F-type                  277   3e-88    
gb|AAC97957.2|  proteasome beta 5 subunit                               279   3e-88    
gb|EPY87607.1|  proteasome subunit beta type-5-like isoform 1           276   3e-88    
emb|CEG76258.1|  Putative Proteasome subunit beta type                  278   3e-88    
ref|XP_009541838.1|  subunit beta type peptidase T1A, 20S proteasome    280   4e-88    
ref|XP_007880004.1|  hypothetical protein PFL1_04286                    281   4e-88    
gb|AAW24786.1|  SJCHGC05978 protein                                     278   5e-88    
gb|EPY36607.1|  20S proteasome subunit beta 5                           280   6e-88    
emb|CAX70714.1|  proteasome (prosome, macropain) subunit, beta ty...    278   6e-88    
gb|KIK46362.1|  hypothetical protein CY34DRAFT_420304                   280   7e-88    
ref|XP_006957104.1|  20S proteasome subunit                             279   7e-88    
gb|KIK08153.1|  hypothetical protein K443DRAFT_672633                   279   9e-88    
gb|KIP12266.1|  hypothetical protein PHLGIDRAFT_17679                   279   9e-88    
emb|CBQ69839.1|  probable PRE2-20S core proteasome subunit (beta5)      280   1e-87    
gb|KEP54479.1|  proteasome subunit beta type-5 protein                  279   1e-87    
gb|EUC61688.1|  proteasome subunit beta type-5 protein                  279   1e-87    
ref|XP_822850.1|  proteasome subunit beta 5                             279   1e-87    
ref|XP_002911819.1|  proteasome component pts1                          279   1e-87    
emb|CEJ04297.1|  Putative Proteasome subunit beta type                  275   2e-87    
gb|EFX81688.1|  hypothetical protein DAPPUDRAFT_303318                  277   2e-87    
ref|XP_810086.1|  proteasome beta 5 subunit                             278   2e-87    
gb|KIO13433.1|  hypothetical protein M404DRAFT_122218                   278   2e-87    
gb|KIM79653.1|  hypothetical protein PILCRDRAFT_823192                  279   2e-87    
dbj|BAA10931.1|  LMPX of hagfish                                        277   2e-87    
ref|XP_002033298.1|  GM21240                                            277   2e-87    
gb|ESL07999.1|  proteasome beta 5 subunit                               278   2e-87    
ref|XP_001875479.1|  20S proteasome subunit                             278   2e-87    
ref|XP_002080955.1|  GD10758                                            277   2e-87    
ref|XP_007326468.1|  hypothetical protein AGABI1DRAFT_111072            278   3e-87    
ref|XP_002050049.1|  GJ21921                                            277   3e-87    
ref|XP_006457891.1|  20S proteasome subunit                             278   3e-87    
gb|KFM59336.1|  Proteasome subunit beta type-5                          277   3e-87    
gb|EKF32460.1|  proteasome beta 5 subunit, putative                     278   3e-87    
ref|XP_810804.1|  proteasome beta 5 subunit                             278   3e-87    
gb|EKG04000.1|  proteasome beta 5 subunit, putative                     278   4e-87    
gb|ESS68038.1|  proteasome beta 5 subunit                               278   4e-87    
gb|EPS96804.1|  hypothetical protein FOMPIDRAFT_1025230                 277   5e-87    
ref|XP_007300583.1|  N-terminal nucleophile aminohydrolase              277   5e-87    
gb|KGB40340.1|  Proteasome subunit beta type-5                          274   6e-87    
gb|AAL59862.1|AF363583_1  proteasome beta-subunit LMP7                  276   7e-87    
ref|XP_009038619.1|  hypothetical protein AURANDRAFT_28593              276   7e-87    
emb|CDQ73245.1|  unnamed protein product                                276   8e-87    
gb|EMS25821.1|  20S proteasome subunit beta 5                           276   8e-87    
dbj|BAO50692.1|  proteasome subunit beta type 8,A-type                  273   8e-87    
ref|XP_003036093.1|  hypothetical protein SCHCODRAFT_81440              277   9e-87    
gb|ACH85299.1|  proteasome (prosome, macropain) subunit beta type 5     275   9e-87    
gb|ACM08263.1|  Proteasome subunit beta type-5 precursor                275   1e-86    
gb|AAF26416.1|AF217726_1  20S proteasome beta5 subunit                  276   1e-86    
gb|ACI66984.1|  Proteasome subunit beta type-8 precursor                275   1e-86    
gb|ACM08758.1|  Proteasome subunit beta type-5 precursor                275   1e-86    
dbj|BAO50685.1|  proteasome subunit beta type 8,F-type                  273   1e-86    
ref|NP_652014.1|  proteasome beta5 subunit, isoform A                   275   2e-86    
ref|XP_004054985.1|  PREDICTED: proteasome subunit beta type-5 is...    275   2e-86    
emb|CAA40494.1|  proteasome C1 subunit                                  272   2e-86    
dbj|BAO50697.1|  proteasome subunit beta type 8,F-type                  272   2e-86    
gb|KIY43500.1|  N-terminal nucleophile aminohydrolase                   276   2e-86    
gb|EFX80663.1|  hypothetical protein DAPPUDRAFT_303852                  275   2e-86    
ref|XP_010870425.1|  PREDICTED: proteasome subunit beta type-5-like     274   3e-86    
gb|ACI67172.1|  Proteasome subunit beta type-5 precursor                274   3e-86    
gb|ACN10160.1|  Proteasome subunit beta type-8 precursor                275   3e-86    
emb|CCC51553.1|  putative proteasome beta 5 subunit, fragment           275   3e-86    
gb|ERE89366.1|  proteasome subunit beta type-5-like protein             275   3e-86    
ref|XP_001976166.1|  GG20151                                            274   3e-86    
ref|NP_001264655.1|  proteasome subunit beta type-5                     273   4e-86    
gb|EIE87710.1|  proteasome component PRE2                               271   4e-86    
sp|P34065.2|PSB5_CHICK  RecName: Full=Proteasome subunit beta typ...    273   5e-86    
ref|NP_001158688.1|  Proteasome subunit beta type 8                     274   5e-86    
ref|NP_001017791.1|  proteasome subunit beta type 8                     274   5e-86    
gb|KIL61310.1|  hypothetical protein M378DRAFT_861259                   275   7e-86    
ref|XP_002090364.1|  Prosbeta5                                          273   8e-86    
gb|AAL59861.1|AF363582_1  proteasome beta-subunit LMP7-like protein     273   8e-86    
emb|CCW60032.1|  unnamed protein product                                274   8e-86    
gb|EMD38457.1|  20S proteasome subunit                                  274   1e-85    
ref|XP_004833459.1|  proteasome beta 5 subunit, putative                273   1e-85    
ref|XP_009265754.1|  Proteasome component PRE2                          273   1e-85    
gb|AJK90586.1|  20S proteasome beta5 subunit                            273   1e-85    
gb|ABI31729.1|  low molecular mass protein 7                            272   1e-85    
gb|ETS60462.1|  hypothetical protein PaG_05302                          280   1e-85    
ref|XP_010866810.1|  PREDICTED: proteasome subunit beta type-8-like     272   1e-85    
ref|XP_005778345.1|  hypothetical protein EMIHUDRAFT_443537             272   1e-85    
gb|ACQ58835.1|  Proteasome subunit beta type-8 precursor                272   2e-85    
ref|XP_002063746.1|  GK15836                                            273   2e-85    
ref|XP_006001021.1|  PREDICTED: proteasome subunit beta type-8-like     272   2e-85    
dbj|BAO50684.1|  proteasome subunit beta type 8,A-type                  270   2e-85    
emb|CAN13318.1|  proteasome (prosome, macropain) subunit, beta ty...    270   2e-85    
dbj|BAO50689.1|  proteasome subunit beta type 8,A-type                  270   2e-85    
gb|KJE01830.1|  proteasome subunit beta type-5                          273   2e-85    
dbj|BAO50687.1|  proteasome subunit beta type 8,F-type                  270   2e-85    
ref|XP_970194.1|  PREDICTED: proteasome subunit beta type-5             272   2e-85    
gb|ABQ01989.1|  proteasome subunit beta type 8                          271   2e-85    
ref|XP_001924154.2|  PREDICTED: proteasome subunit beta type-8          272   2e-85    
gb|AHF22837.1|  PSMB8 proteasome subunit beta type 8                    272   2e-85    
ref|XP_008301219.1|  PREDICTED: proteasome subunit beta type-8          272   3e-85    
ref|NP_001117007.1|  proteasome subunit beta type 7b                    271   3e-85    
dbj|BAD89554.1|  proteasome subunit                                     271   3e-85    
ref|NP_999100.1|  proteasome subunit beta type-8                        271   3e-85    
dbj|BAO50693.1|  proteasome subunit beta type 8,F-type                  269   3e-85    
dbj|BAO50691.1|  proteasome subunit beta type 8,A-type                  269   3e-85    
ref|XP_011184652.1|  PREDICTED: proteasome subunit beta type-5-like     271   3e-85    
ref|XP_008543771.1|  PREDICTED: proteasome subunit beta type-5          271   4e-85    
dbj|BAO50690.1|  proteasome subunit beta type 8,A-type                  269   4e-85    
ref|XP_571562.1|  proteasome component pts1                             272   4e-85    
gb|KDR22252.1|  Proteasome subunit beta type-5                          271   5e-85    
gb|KIJ26450.1|  hypothetical protein M422DRAFT_236567                   272   5e-85    
gb|ACM09015.1|  Proteasome subunit beta type-5 precursor                271   5e-85    
gb|KIR99960.1|  proteasome subunit beta type-5                          272   6e-85    
ref|XP_003194765.1|  proteasome component                               272   6e-85    
ref|XP_008329167.1|  PREDICTED: proteasome subunit beta type-8 is...    271   6e-85    
ref|XP_012050515.1|  proteasome component PRE2                          273   7e-85    
emb|CCA68455.1|  probable PRE2-20S core proteasome subunit (beta5...    271   9e-85    
ref|XP_001986559.1|  GH20460                                            271   9e-85    
ref|XP_001961263.1|  GF13778                                            271   9e-85    
dbj|BAM20998.1|  proteasome subunit beta type-8                         268   1e-84    
gb|AGM32352.1|  proteasome subunit beta type-5-like protein             270   1e-84    
gb|ETE64662.1|  Proteasome subunit beta type-5                          270   1e-84    
gb|ACO10097.1|  Proteasome subunit beta type 8 precursor                270   2e-84    
dbj|BAO50686.1|  proteasome subunit beta type 8,A-type                  267   2e-84    
gb|AAG43439.1|AF184937_1  low molecular mass protein 7                  270   2e-84    
ref|XP_007319616.1|  hypothetical protein SERLADRAFT_470232             271   2e-84    
emb|CDQ57423.1|  unnamed protein product                                269   2e-84    
ref|XP_010747117.1|  PREDICTED: proteasome subunit beta type-8          270   2e-84    
ref|XP_007882652.1|  PREDICTED: proteasome subunit beta type-8-like     269   2e-84    
gb|KGB75936.1|  proteasome component pts1                               271   2e-84    
gb|ACO15462.1|  Proteasome subunit beta type-5 precursor                269   2e-84    
ref|XP_002005785.1|  GI18886                                            270   2e-84    
dbj|BAM20999.1|  proteasome subunit beta type-8                         268   2e-84    
ref|XP_007347836.1|  proteasome-domain-containing protein               271   3e-84    
ref|XP_002139075.1|  proteasome subunit beta type 5 precursor           269   3e-84    
ref|XP_007460868.1|  PREDICTED: proteasome subunit beta type-8          269   3e-84    
ref|XP_010866033.1|  PREDICTED: proteasome subunit beta type-8-like     269   3e-84    
ref|XP_002435468.1|  20S proteasome, regulatory subunit beta, put...    269   3e-84    
emb|CCW66993.1|  unnamed protein product                                270   3e-84    
ref|XP_007957196.1|  PREDICTED: proteasome subunit beta type-8          269   3e-84    
dbj|BAO50688.1|  proteasome subunit beta type 8,F-type                  266   3e-84    
dbj|BAO00926.1|  proteasome subunit beta type 8,A-type                  266   5e-84    
ref|XP_001361733.1|  GA11556                                            269   5e-84    
ref|XP_006164605.1|  PREDICTED: proteasome subunit beta type-8          268   6e-84    
ref|XP_011182734.1|  PREDICTED: proteasome subunit beta type-5-like     268   6e-84    
ref|XP_007264066.1|  N-terminal nucleophile aminohydrolase              270   6e-84    
dbj|GAK66792.1|  proteasome-domain-containing protein                   280   6e-84    
dbj|BAJ51757.1|  proteasome subunit, beta type 8                        268   7e-84    
gb|ACI67854.1|  Proteasome subunit beta type-8 precursor                268   9e-84    
ref|XP_005188727.1|  PREDICTED: proteasome subunit beta type-5          268   9e-84    
dbj|GAA98585.1|  hypothetical protein E5Q_05272                         269   9e-84    
dbj|BAJ51776.1|  proteasome subunit, beta type 8                        266   9e-84    
gb|ACO07495.1|  Proteasome subunit beta type 8 precursor                268   9e-84    
dbj|BAA19767.1|  LMP7                                                   266   9e-84    
ref|XP_004590508.1|  PREDICTED: proteasome subunit beta type-8          268   1e-83    
ref|XP_011214452.1|  PREDICTED: proteasome subunit beta type-5-like     268   1e-83    



>ref|XP_009783836.1| PREDICTED: proteasome subunit beta type-5-like [Nicotiana sylvestris]
 ref|XP_009783895.1| PREDICTED: proteasome subunit beta type-5-like [Nicotiana sylvestris]
Length=273

 Score =   529 bits (1363),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 252/273 (92%), Positives = 264/273 (97%), Gaps = 0/273 (0%)
 Frame = +3

Query  72   MVRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTL  251
            M++IDFSGLE TAP+RGESSELFD+IP  PSFQIPN T+FDGFQK+AIQMVKPAKGTTTL
Sbjct  1    MMKIDFSGLEPTAPLRGESSELFDDIPSSPSFQIPNTTNFDGFQKEAIQMVKPAKGTTTL  60

Query  252  AFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCR  431
            AFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCR
Sbjct  61   AFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCR  120

Query  432  LHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGN  611
            LHELANKRRISV GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKG 
Sbjct  121  LHELANKRRISVTGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGT  180

Query  612  RFSVGSGSPYAYGVLDNGYRFDLSVEEAAELARRSIYHATFRDGASGGVASVYHVGPNGW  791
            RFSVGSGSPYAYGVLDNGYR+DLSV+EAAELARR+IYHATFRDGASGGVASVYHVGPNGW
Sbjct  181  RFSVGSGSPYAYGVLDNGYRYDLSVKEAAELARRAIYHATFRDGASGGVASVYHVGPNGW  240

Query  792  KKLSGDDVGELHYHYYPVEAAAVEHEMTEVPIA  890
            KKLSGDDVGELHY+YYPVE AAVE EM EVP+A
Sbjct  241  KKLSGDDVGELHYNYYPVEVAAVEQEMAEVPVA  273



>ref|XP_009596640.1| PREDICTED: proteasome subunit beta type-5-like [Nicotiana tomentosiformis]
Length=273

 Score =   523 bits (1347),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 250/273 (92%), Positives = 262/273 (96%), Gaps = 0/273 (0%)
 Frame = +3

Query  72   MVRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTL  251
            M++IDFSGLE +AP+RGESSELFD IP  PSFQIP+  +FDGFQK+AIQMVKPAKGTTTL
Sbjct  1    MMKIDFSGLEPSAPLRGESSELFDGIPSSPSFQIPDTANFDGFQKEAIQMVKPAKGTTTL  60

Query  252  AFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCR  431
            AFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCR
Sbjct  61   AFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCR  120

Query  432  LHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGN  611
            LHELANKRRISV GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKG 
Sbjct  121  LHELANKRRISVTGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGT  180

Query  612  RFSVGSGSPYAYGVLDNGYRFDLSVEEAAELARRSIYHATFRDGASGGVASVYHVGPNGW  791
            RFSVGSGSPYAYGVLDNGYR+DLSVEEAAELARR+IYHATFRDGASGGVASVYHVGPNGW
Sbjct  181  RFSVGSGSPYAYGVLDNGYRYDLSVEEAAELARRAIYHATFRDGASGGVASVYHVGPNGW  240

Query  792  KKLSGDDVGELHYHYYPVEAAAVEHEMTEVPIA  890
            KKLSGDDVGELHY+YYPVE AAVE EM EVP+A
Sbjct  241  KKLSGDDVGELHYNYYPVEVAAVEQEMAEVPVA  273



>ref|XP_004239661.1| PREDICTED: proteasome subunit beta type-5 [Solanum lycopersicum]
 ref|XP_010321315.1| PREDICTED: proteasome subunit beta type-5 [Solanum lycopersicum]
Length=273

 Score =   521 bits (1341),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 249/273 (91%), Positives = 260/273 (95%), Gaps = 0/273 (0%)
 Frame = +3

Query  72   MVRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTL  251
            M++IDFSGLE +AP+RGESSELFD I   PSF +PN  +FDGFQK+AIQMVKPAKGTTTL
Sbjct  1    MMKIDFSGLEPSAPLRGESSELFDGISNSPSFHLPNTANFDGFQKEAIQMVKPAKGTTTL  60

Query  252  AFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCR  431
            AFIFK GVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCR
Sbjct  61   AFIFKGGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCR  120

Query  432  LHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGN  611
            LHELANKRRISV GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGN
Sbjct  121  LHELANKRRISVTGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGN  180

Query  612  RFSVGSGSPYAYGVLDNGYRFDLSVEEAAELARRSIYHATFRDGASGGVASVYHVGPNGW  791
            RFSVGSGSPYAYGVLDNGYR+DLSVEEAAELARR+IYHATFRDGASGGVASVYHVGPNGW
Sbjct  181  RFSVGSGSPYAYGVLDNGYRYDLSVEEAAELARRAIYHATFRDGASGGVASVYHVGPNGW  240

Query  792  KKLSGDDVGELHYHYYPVEAAAVEHEMTEVPIA  890
            KKLSGDDVGELHYHYYPVE AAVE EM EVP+A
Sbjct  241  KKLSGDDVGELHYHYYPVEVAAVEQEMAEVPVA  273



>ref|XP_006345787.1| PREDICTED: proteasome subunit beta type-5-like [Solanum tuberosum]
Length=273

 Score =   520 bits (1338),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 249/273 (91%), Positives = 259/273 (95%), Gaps = 0/273 (0%)
 Frame = +3

Query  72   MVRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTL  251
            M++IDFSGLE  AP+RGESSELFD I   PSF +PN  +FDGFQK+AIQMVKPAKGTTTL
Sbjct  1    MMKIDFSGLEPRAPLRGESSELFDGISNSPSFHLPNTANFDGFQKEAIQMVKPAKGTTTL  60

Query  252  AFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCR  431
            AFIFK GVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCR
Sbjct  61   AFIFKGGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCR  120

Query  432  LHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGN  611
            LHELANKRRISV GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGN
Sbjct  121  LHELANKRRISVTGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGN  180

Query  612  RFSVGSGSPYAYGVLDNGYRFDLSVEEAAELARRSIYHATFRDGASGGVASVYHVGPNGW  791
            RFSVGSGSPYAYGVLDNGYR+DLSVEEAAELARR+IYHATFRDGASGGVASVYHVGPNGW
Sbjct  181  RFSVGSGSPYAYGVLDNGYRYDLSVEEAAELARRAIYHATFRDGASGGVASVYHVGPNGW  240

Query  792  KKLSGDDVGELHYHYYPVEAAAVEHEMTEVPIA  890
            KKLSGDDVGELHYHYYPVE AAVE EM EVP+A
Sbjct  241  KKLSGDDVGELHYHYYPVEVAAVEQEMAEVPVA  273



>ref|XP_009780639.1| PREDICTED: proteasome subunit beta type-5-like [Nicotiana sylvestris]
Length=273

 Score =   518 bits (1333),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 250/273 (92%), Positives = 261/273 (96%), Gaps = 0/273 (0%)
 Frame = +3

Query  72   MVRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTL  251
            M++IDFSGLE TAPI+GESSEL D I   PSFQIPN T+FDGFQK+AIQMVKPAKGTTTL
Sbjct  1    MMKIDFSGLEPTAPIKGESSELCDGILSSPSFQIPNATNFDGFQKEAIQMVKPAKGTTTL  60

Query  252  AFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCR  431
            AFIFK GVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCR
Sbjct  61   AFIFKGGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCR  120

Query  432  LHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGN  611
            LHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGN
Sbjct  121  LHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGN  180

Query  612  RFSVGSGSPYAYGVLDNGYRFDLSVEEAAELARRSIYHATFRDGASGGVASVYHVGPNGW  791
            RFSVGSGSPYAYGVLD+GYRFDLSVEEAAELARR+IYHATFRDGASGGVASVYHVGPNGW
Sbjct  181  RFSVGSGSPYAYGVLDSGYRFDLSVEEAAELARRAIYHATFRDGASGGVASVYHVGPNGW  240

Query  792  KKLSGDDVGELHYHYYPVEAAAVEHEMTEVPIA  890
            KKLSGDDVGELHY+YYPVE  +VE EM EVP+A
Sbjct  241  KKLSGDDVGELHYNYYPVELESVEQEMAEVPVA  273



>ref|XP_009619742.1| PREDICTED: proteasome subunit beta type-5-like [Nicotiana tomentosiformis]
Length=273

 Score =   516 bits (1330),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 249/273 (91%), Positives = 261/273 (96%), Gaps = 0/273 (0%)
 Frame = +3

Query  72   MVRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTL  251
            M++IDFSGLE TAP++GESSEL D I   PSFQIPN T+FDGFQK+AIQMVKPAKGTTTL
Sbjct  1    MMKIDFSGLEPTAPLKGESSELCDGILSSPSFQIPNATNFDGFQKEAIQMVKPAKGTTTL  60

Query  252  AFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCR  431
            AFIFK GVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCR
Sbjct  61   AFIFKGGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCR  120

Query  432  LHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGN  611
            LHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGN
Sbjct  121  LHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGN  180

Query  612  RFSVGSGSPYAYGVLDNGYRFDLSVEEAAELARRSIYHATFRDGASGGVASVYHVGPNGW  791
            RFSVGSGSPYAYGVLD+GYRFDLSVEEAAELARR+IYHATFRDGASGGVASVYHVGPNGW
Sbjct  181  RFSVGSGSPYAYGVLDSGYRFDLSVEEAAELARRAIYHATFRDGASGGVASVYHVGPNGW  240

Query  792  KKLSGDDVGELHYHYYPVEAAAVEHEMTEVPIA  890
            KKLSGDDVGELHY+YYPVE  +VE EM EVP+A
Sbjct  241  KKLSGDDVGELHYNYYPVELESVEQEMAEVPVA  273



>ref|XP_006363770.1| PREDICTED: proteasome subunit beta type-5-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006363771.1| PREDICTED: proteasome subunit beta type-5-like isoform X2 [Solanum 
tuberosum]
Length=273

 Score =   516 bits (1328),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 247/273 (90%), Positives = 258/273 (95%), Gaps = 0/273 (0%)
 Frame = +3

Query  72   MVRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTL  251
            M++IDFSGLE +AP+RGESSELFD I   PSF +PN  +FDGFQK+AIQMVKPAKGTTTL
Sbjct  1    MMKIDFSGLEPSAPLRGESSELFDGISNSPSFHLPNTANFDGFQKEAIQMVKPAKGTTTL  60

Query  252  AFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCR  431
            AFIFK GVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCR
Sbjct  61   AFIFKGGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCR  120

Query  432  LHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGN  611
            LHELANKRRISV GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGN
Sbjct  121  LHELANKRRISVTGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGN  180

Query  612  RFSVGSGSPYAYGVLDNGYRFDLSVEEAAELARRSIYHATFRDGASGGVASVYHVGPNGW  791
            RFSVGSGSPYAYGVLDNGYR DLSVEEAAELARR+IYHATFRDGASGGVASVYHVGPNGW
Sbjct  181  RFSVGSGSPYAYGVLDNGYRNDLSVEEAAELARRAIYHATFRDGASGGVASVYHVGPNGW  240

Query  792  KKLSGDDVGELHYHYYPVEAAAVEHEMTEVPIA  890
            KKLSGDDVGELHYHYYP+E AAVE EM EV +A
Sbjct  241  KKLSGDDVGELHYHYYPIEVAAVEQEMAEVSVA  273



>ref|XP_011071212.1| PREDICTED: proteasome subunit beta type-5-like [Sesamum indicum]
Length=287

 Score =   501 bits (1289),  Expect = 6e-175, Method: Compositional matrix adjust.
 Identities = 240/273 (88%), Positives = 255/273 (93%), Gaps = 0/273 (0%)
 Frame = +3

Query  72   MVRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTL  251
            M++IDF GL+ +AP++G + +L +EI   PSF++P   DFDGFQK A+QMVKPAKGTTTL
Sbjct  1    MMKIDFGGLDPSAPLKGNTDDLHNEILAAPSFKLPITADFDGFQKAAVQMVKPAKGTTTL  60

Query  252  AFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCR  431
            AFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCR
Sbjct  61   AFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCR  120

Query  432  LHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGN  611
            LHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDE+GPGLYYVDSEGGRLKG 
Sbjct  121  LHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEQGPGLYYVDSEGGRLKGT  180

Query  612  RFSVGSGSPYAYGVLDNGYRFDLSVEEAAELARRSIYHATFRDGASGGVASVYHVGPNGW  791
            RFSVGSGSPYAYGVLDNGYRFDLSVEEAAELARR+IYHATFRDGASGGVASVYHVGPNGW
Sbjct  181  RFSVGSGSPYAYGVLDNGYRFDLSVEEAAELARRAIYHATFRDGASGGVASVYHVGPNGW  240

Query  792  KKLSGDDVGELHYHYYPVEAAAVEHEMTEVPIA  890
            KKLSGDDVGELHY YYPVE  AVE EMTEV IA
Sbjct  241  KKLSGDDVGELHYKYYPVEPTAVEQEMTEVSIA  273



>ref|XP_002264828.1| PREDICTED: proteasome subunit beta type-5 [Vitis vinifera]
 ref|XP_010655500.1| PREDICTED: proteasome subunit beta type-5 [Vitis vinifera]
 emb|CBI27591.3| unnamed protein product [Vitis vinifera]
Length=272

 Score =   493 bits (1268),  Expect = 6e-172, Method: Compositional matrix adjust.
 Identities = 236/269 (88%), Positives = 248/269 (92%), Gaps = 0/269 (0%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLA  254
            +++D SGLEST P+ G +SEL       PSF++PN TDFDGFQKDAIQMVKPAKGTTTLA
Sbjct  1    MKLDTSGLESTVPLFGANSELLGGFSAAPSFELPNTTDFDGFQKDAIQMVKPAKGTTTLA  60

Query  255  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  434
            FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRL
Sbjct  61   FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRL  120

Query  435  HELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNR  614
            HELANKRRISV GASKLLANILYSYRGMGLSVGTMIAGWDE GPGLYYVDSEGGRLKG R
Sbjct  121  HELANKRRISVTGASKLLANILYSYRGMGLSVGTMIAGWDETGPGLYYVDSEGGRLKGTR  180

Query  615  FSVGSGSPYAYGVLDNGYRFDLSVEEAAELARRSIYHATFRDGASGGVASVYHVGPNGWK  794
            FSVGSGSPYAYGVLDNGYR+D+SVEEAAELARRSIYHATFRDGASGGVASVY+VGPNGWK
Sbjct  181  FSVGSGSPYAYGVLDNGYRYDMSVEEAAELARRSIYHATFRDGASGGVASVYYVGPNGWK  240

Query  795  KLSGDDVGELHYHYYPVEAAAVEHEMTEV  881
            KLSGDDVGELHY YYPV  + VE EM EV
Sbjct  241  KLSGDDVGELHYKYYPVMPSTVEQEMVEV  269



>ref|XP_008222076.1| PREDICTED: proteasome subunit beta type-5 [Prunus mume]
Length=272

 Score =   490 bits (1262),  Expect = 5e-171, Method: Compositional matrix adjust.
 Identities = 235/269 (87%), Positives = 246/269 (91%), Gaps = 0/269 (0%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLA  254
            +++D SGLES AP+ G SS   D     PSF++P   DFDGFQK+AIQMVKPAKGTTTLA
Sbjct  1    MKLDTSGLESAAPLVGASSGFLDGFADAPSFEVPTTNDFDGFQKEAIQMVKPAKGTTTLA  60

Query  255  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  434
            FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRL
Sbjct  61   FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRL  120

Query  435  HELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNR  614
            HELANKRRISV GASKLLANILYSYRGMGLSVGTMIAGWDE GPGLYYVDSEGGRLKG R
Sbjct  121  HELANKRRISVTGASKLLANILYSYRGMGLSVGTMIAGWDETGPGLYYVDSEGGRLKGMR  180

Query  615  FSVGSGSPYAYGVLDNGYRFDLSVEEAAELARRSIYHATFRDGASGGVASVYHVGPNGWK  794
            FSVGSGSPYAYGVLDNGYR+D+SVEEAAELARR+IYHATFRDGASGGVASVYHVGPNGWK
Sbjct  181  FSVGSGSPYAYGVLDNGYRYDMSVEEAAELARRAIYHATFRDGASGGVASVYHVGPNGWK  240

Query  795  KLSGDDVGELHYHYYPVEAAAVEHEMTEV  881
            KLSGDDVGELHYHYYPV   AVE EM EV
Sbjct  241  KLSGDDVGELHYHYYPVVQGAVEQEMVEV  269



>ref|XP_004144192.1| PREDICTED: proteasome subunit beta type-5 [Cucumis sativus]
 gb|KGN47623.1| hypothetical protein Csa_6G365720 [Cucumis sativus]
Length=272

 Score =   490 bits (1261),  Expect = 6e-171, Method: Compositional matrix adjust.
 Identities = 235/272 (86%), Positives = 251/272 (92%), Gaps = 0/272 (0%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLA  254
            +++D SGL++TAP+ G + E  +     PSF+IPN +DFDGFQKDAIQMVKPAKGTTTLA
Sbjct  1    MKLDTSGLQTTAPLFGPTMEAMEGFAAAPSFEIPNSSDFDGFQKDAIQMVKPAKGTTTLA  60

Query  255  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  434
            FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL
Sbjct  61   FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  120

Query  435  HELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNR  614
            H+LANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDE GPGLYYVDSEGGRLKG R
Sbjct  121  HKLANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDETGPGLYYVDSEGGRLKGTR  180

Query  615  FSVGSGSPYAYGVLDNGYRFDLSVEEAAELARRSIYHATFRDGASGGVASVYHVGPNGWK  794
            FSVGSGSPYAYGVLDNGYR+DLSVEEAAELARR+IYHATFRDGASGGVASVY+VGPNGWK
Sbjct  181  FSVGSGSPYAYGVLDNGYRYDLSVEEAAELARRAIYHATFRDGASGGVASVYYVGPNGWK  240

Query  795  KLSGDDVGELHYHYYPVEAAAVEHEMTEVPIA  890
            KLSGDDVGELHY+YYPV    V+ EMTEV  A
Sbjct  241  KLSGDDVGELHYNYYPVTPTTVDQEMTEVTAA  272



>gb|EYU42103.1| hypothetical protein MIMGU_mgv1a011714mg [Erythranthe guttata]
Length=273

 Score =   490 bits (1261),  Expect = 7e-171, Method: Compositional matrix adjust.
 Identities = 233/273 (85%), Positives = 252/273 (92%), Gaps = 0/273 (0%)
 Frame = +3

Query  72   MVRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTL  251
            M++ID SGL+ +AP++  + +L +EI   PSF +P   DFDGFQK +IQMVKPA+GTTTL
Sbjct  1    MMKIDLSGLDPSAPMKRNTDDLDNEILATPSFALPTTVDFDGFQKASIQMVKPARGTTTL  60

Query  252  AFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCR  431
            AFIFK GVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCR
Sbjct  61   AFIFKGGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCR  120

Query  432  LHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGN  611
            LHELANKRRIS+AGASK+LANILYSYRGMGLSVGTMIAGWDE+GPGLYYVDSEGGRLKG 
Sbjct  121  LHELANKRRISIAGASKMLANILYSYRGMGLSVGTMIAGWDEQGPGLYYVDSEGGRLKGT  180

Query  612  RFSVGSGSPYAYGVLDNGYRFDLSVEEAAELARRSIYHATFRDGASGGVASVYHVGPNGW  791
            RFSVGSGSPYAYGVLD+GYRFDLSVEEAAELARR+IYHATFRDGASGGVASVYHVGPNGW
Sbjct  181  RFSVGSGSPYAYGVLDSGYRFDLSVEEAAELARRAIYHATFRDGASGGVASVYHVGPNGW  240

Query  792  KKLSGDDVGELHYHYYPVEAAAVEHEMTEVPIA  890
            +KLSGDDVGELHY YYPVE A VE EMTEV IA
Sbjct  241  EKLSGDDVGELHYKYYPVETAVVEQEMTEVAIA  273



>gb|EPS61043.1| hypothetical protein M569_13757, partial [Genlisea aurea]
Length=274

 Score =   489 bits (1259),  Expect = 1e-170, Method: Compositional matrix adjust.
 Identities = 232/273 (85%), Positives = 252/273 (92%), Gaps = 0/273 (0%)
 Frame = +3

Query  72   MVRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTL  251
            M++ID SGL+  AP++G S +L DEI   PSF++P   DFDGFQK A+QMVKPAKGTTTL
Sbjct  2    MMKIDLSGLDPLAPVKGNSDDLDDEIMAAPSFKLPTTVDFDGFQKAAVQMVKPAKGTTTL  61

Query  252  AFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCR  431
            AFIF +GVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCR
Sbjct  62   AFIFDKGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCR  121

Query  432  LHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGN  611
            LHELANKRRISVAGASKLL NILYSYRGMGLSVGTMIAGWDE+GPGLYYVDSEGGRLKG 
Sbjct  122  LHELANKRRISVAGASKLLGNILYSYRGMGLSVGTMIAGWDEQGPGLYYVDSEGGRLKGT  181

Query  612  RFSVGSGSPYAYGVLDNGYRFDLSVEEAAELARRSIYHATFRDGASGGVASVYHVGPNGW  791
            +FSVGSGSPYAYG+LD+G+RFDLSVEEAAELARR+IYHATFRDGASGGVASVYH+GPNGW
Sbjct  182  KFSVGSGSPYAYGILDSGHRFDLSVEEAAELARRAIYHATFRDGASGGVASVYHIGPNGW  241

Query  792  KKLSGDDVGELHYHYYPVEAAAVEHEMTEVPIA  890
            KKLSGDDVGELHY YYPVE A VE EM+EV I+
Sbjct  242  KKLSGDDVGELHYLYYPVEPATVEREMSEVAIS  274



>gb|KHG05622.1| Proteasome subunit beta type-5 [Gossypium arboreum]
Length=272

 Score =   488 bits (1255),  Expect = 5e-170, Method: Compositional matrix adjust.
 Identities = 234/269 (87%), Positives = 246/269 (91%), Gaps = 0/269 (0%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLA  254
            +++D SGLE  AP+ G  SEL D     PSF +PN TDFDGFQK+AIQMVKPAKGTTTLA
Sbjct  1    MKLDTSGLEPAAPVSGAPSELVDGFSAAPSFDLPNTTDFDGFQKEAIQMVKPAKGTTTLA  60

Query  255  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  434
            FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRL
Sbjct  61   FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRL  120

Query  435  HELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNR  614
            HELANKRRISV GASKLLANILYSYRGMGLSVGTMIAGWDE GPGLYYVDSEGGRLKG R
Sbjct  121  HELANKRRISVTGASKLLANILYSYRGMGLSVGTMIAGWDETGPGLYYVDSEGGRLKGMR  180

Query  615  FSVGSGSPYAYGVLDNGYRFDLSVEEAAELARRSIYHATFRDGASGGVASVYHVGPNGWK  794
            FSVGSGSPYAYGVLDNGYR+D+SVEEAAELARR+IYHATFRDGASGGVASVY+VGPNGWK
Sbjct  181  FSVGSGSPYAYGVLDNGYRYDMSVEEAAELARRAIYHATFRDGASGGVASVYYVGPNGWK  240

Query  795  KLSGDDVGELHYHYYPVEAAAVEHEMTEV  881
            KLSGDDVGELHY YYPV  + VE EM EV
Sbjct  241  KLSGDDVGELHYKYYPVMPSTVEQEMVEV  269



>ref|XP_008445492.1| PREDICTED: proteasome subunit beta type-5 [Cucumis melo]
Length=272

 Score =   488 bits (1255),  Expect = 7e-170, Method: Compositional matrix adjust.
 Identities = 235/272 (86%), Positives = 249/272 (92%), Gaps = 0/272 (0%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLA  254
            +++D SGL++TAP+ G   E  +     PSF+IPN +DFDGFQKDAIQMVKPAKGTTTLA
Sbjct  1    MKLDTSGLQTTAPMFGPRMEALEGFAAAPSFEIPNSSDFDGFQKDAIQMVKPAKGTTTLA  60

Query  255  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  434
            FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCR 
Sbjct  61   FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRR  120

Query  435  HELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNR  614
            HELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDE GPGLYYVDSEGGRLKG R
Sbjct  121  HELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDETGPGLYYVDSEGGRLKGTR  180

Query  615  FSVGSGSPYAYGVLDNGYRFDLSVEEAAELARRSIYHATFRDGASGGVASVYHVGPNGWK  794
            FSVGSGSPYAYGVLDNGYR+DLSVEEAAELARR+IYHATFRDGASGGVASVY+VGPNGWK
Sbjct  181  FSVGSGSPYAYGVLDNGYRYDLSVEEAAELARRAIYHATFRDGASGGVASVYYVGPNGWK  240

Query  795  KLSGDDVGELHYHYYPVEAAAVEHEMTEVPIA  890
            KLSGDDVGELHY+YYPV    V+ EMTEV  A
Sbjct  241  KLSGDDVGELHYNYYPVTPTTVDQEMTEVTAA  272



>ref|XP_007222598.1| hypothetical protein PRUPE_ppa009896mg [Prunus persica]
 gb|EMJ23797.1| hypothetical protein PRUPE_ppa009896mg [Prunus persica]
Length=272

 Score =   487 bits (1254),  Expect = 8e-170, Method: Compositional matrix adjust.
 Identities = 234/272 (86%), Positives = 247/272 (91%), Gaps = 0/272 (0%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLA  254
            +++D SGLES AP+ G SS   D     PSF++P   DFDGFQK+AIQMVKPAKGTTTLA
Sbjct  1    MKLDTSGLESAAPLVGASSGFLDGFADAPSFEVPTTNDFDGFQKEAIQMVKPAKGTTTLA  60

Query  255  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  434
            FIFK+GVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRL
Sbjct  61   FIFKDGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRL  120

Query  435  HELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNR  614
            HELANKRRISV GASKLLANILYSYRGMGLSVGTMIAGWDE GPGLYYVDSEGGRLKG R
Sbjct  121  HELANKRRISVTGASKLLANILYSYRGMGLSVGTMIAGWDETGPGLYYVDSEGGRLKGMR  180

Query  615  FSVGSGSPYAYGVLDNGYRFDLSVEEAAELARRSIYHATFRDGASGGVASVYHVGPNGWK  794
            FSVGSGSPYAYGVLD+GYR+D+SVEEAAELARR+IYHATFRDGASGGVASVYHVGPNGWK
Sbjct  181  FSVGSGSPYAYGVLDDGYRYDMSVEEAAELARRAIYHATFRDGASGGVASVYHVGPNGWK  240

Query  795  KLSGDDVGELHYHYYPVEAAAVEHEMTEVPIA  890
            KLSGDDVGELHYHYYPV   AVE EM EV  A
Sbjct  241  KLSGDDVGELHYHYYPVVEGAVEQEMVEVAAA  272



>gb|KJB15718.1| hypothetical protein B456_002G192400 [Gossypium raimondii]
 gb|KJB15719.1| hypothetical protein B456_002G192400 [Gossypium raimondii]
 gb|KJB15720.1| hypothetical protein B456_002G192400 [Gossypium raimondii]
Length=272

 Score =   487 bits (1253),  Expect = 1e-169, Method: Compositional matrix adjust.
 Identities = 235/269 (87%), Positives = 247/269 (92%), Gaps = 0/269 (0%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLA  254
            +++D SGLES AP+ G  SEL D     PSF +PN TDFDGFQK+AIQMVKPAKGTTTLA
Sbjct  1    MKLDTSGLESAAPVWGAPSELVDGFSAGPSFDLPNTTDFDGFQKEAIQMVKPAKGTTTLA  60

Query  255  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  434
            FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRL
Sbjct  61   FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRL  120

Query  435  HELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNR  614
            HELANKRRISV GASKLLANILYSYRGMGLSVGTMIAGWDE GPGLYYVDSEGGRLKG R
Sbjct  121  HELANKRRISVTGASKLLANILYSYRGMGLSVGTMIAGWDETGPGLYYVDSEGGRLKGMR  180

Query  615  FSVGSGSPYAYGVLDNGYRFDLSVEEAAELARRSIYHATFRDGASGGVASVYHVGPNGWK  794
            FSVGSGSPYAYGVLDNGYR+D+SVEEAAELARR+IYHATFRDGASGGVASVY+VGPNGWK
Sbjct  181  FSVGSGSPYAYGVLDNGYRYDMSVEEAAELARRAIYHATFRDGASGGVASVYYVGPNGWK  240

Query  795  KLSGDDVGELHYHYYPVEAAAVEHEMTEV  881
            KLSGDDVGELHY YYPV  + VE EM EV
Sbjct  241  KLSGDDVGELHYKYYPVMPSTVEQEMVEV  269



>emb|CDP13326.1| unnamed protein product [Coffea canephora]
Length=339

 Score =   489 bits (1259),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 234/271 (86%), Positives = 249/271 (92%), Gaps = 1/271 (0%)
 Frame = +3

Query  66   VTMVRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTT  245
            VTM++IDFSGLE  + +RG  +EL   +   P FQIPN  DFDGFQK+++QMVKPAKGTT
Sbjct  66   VTMMKIDFSGLEPNSLLRGNPNELLSGLSTAPEFQIPNTNDFDGFQKESVQMVKPAKGTT  125

Query  246  TLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVK  425
            TLAFIFKEGV+VAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+K
Sbjct  126  TLAFIFKEGVIVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIK  185

Query  426  CRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLK  605
            CRLHELANKRRISV GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRL 
Sbjct  186  CRLHELANKRRISVTGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLN  245

Query  606  GNRFSVGSGSPYAYGVLDNGYRFDLSVEEAAELARRSIYHATFRDGASGGVASVYHVGPN  785
            GNRFSVGSGSPYAYGVLD+GYRFD+SVEEAAELARR+IYHATFRDGASGGV SVYHVGP+
Sbjct  246  GNRFSVGSGSPYAYGVLDSGYRFDMSVEEAAELARRAIYHATFRDGASGGVVSVYHVGPD  305

Query  786  GWKKLSGDDVGELHYHYYPVEAAAVEHEMTE  878
            GWKKLSGDDVGELHY YYPVE   VEHEM E
Sbjct  306  GWKKLSGDDVGELHYAYYPVE-PTVEHEMAE  335



>ref|XP_012085655.1| PREDICTED: proteasome subunit beta type-5 [Jatropha curcas]
 gb|KDP26783.1| hypothetical protein JCGZ_17941 [Jatropha curcas]
Length=270

 Score =   486 bits (1252),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 232/269 (86%), Positives = 248/269 (92%), Gaps = 0/269 (0%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLA  254
            +++D SGLES AP+ G + ELF+     PSF++P  TDFDGFQK+AIQMVKPAKGTTTLA
Sbjct  1    MKLDTSGLESAAPLFGATGELFNGFSTAPSFELPVTTDFDGFQKEAIQMVKPAKGTTTLA  60

Query  255  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  434
            FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRL
Sbjct  61   FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRL  120

Query  435  HELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNR  614
            HELANKRRISV GASKLLANILYSYRGMGLSVGTMIAGWDE GPGLYYVDSEGGRLKG R
Sbjct  121  HELANKRRISVTGASKLLANILYSYRGMGLSVGTMIAGWDETGPGLYYVDSEGGRLKGTR  180

Query  615  FSVGSGSPYAYGVLDNGYRFDLSVEEAAELARRSIYHATFRDGASGGVASVYHVGPNGWK  794
            FSVGSGSPYAYGVLD+GYR+DLS+EEAAELARR+IYHATFRDGASGGVASVY+VGPNGWK
Sbjct  181  FSVGSGSPYAYGVLDSGYRYDLSIEEAAELARRAIYHATFRDGASGGVASVYYVGPNGWK  240

Query  795  KLSGDDVGELHYHYYPVEAAAVEHEMTEV  881
            KLSGDDVGELHY YYPV  + VE EM EV
Sbjct  241  KLSGDDVGELHYKYYPVMPSTVEQEMVEV  269



>ref|XP_008340194.1| PREDICTED: proteasome subunit beta type-5 [Malus domestica]
Length=272

 Score =   486 bits (1250),  Expect = 3e-169, Method: Compositional matrix adjust.
 Identities = 234/269 (87%), Positives = 247/269 (92%), Gaps = 0/269 (0%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLA  254
            +R+D SGLES AP+ GESS   D +   PSF++P   DFDGFQK+AIQMVKPAKGTTTLA
Sbjct  1    MRLDTSGLESXAPLFGESSGFLDGVSAPPSFEVPTTNDFDGFQKEAIQMVKPAKGTTTLA  60

Query  255  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  434
            FIFK+GVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRL
Sbjct  61   FIFKDGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRL  120

Query  435  HELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNR  614
            HELANKRRISV GASKLLANILYSYRGMGLSVGTMIAGWDE GPGLYYVDSEGGRLKG R
Sbjct  121  HELANKRRISVTGASKLLANILYSYRGMGLSVGTMIAGWDETGPGLYYVDSEGGRLKGMR  180

Query  615  FSVGSGSPYAYGVLDNGYRFDLSVEEAAELARRSIYHATFRDGASGGVASVYHVGPNGWK  794
            FSVGSGSPYAYGVLD+GYR+D+SVEEAAELARR+IYHATFRDGASGGVASVYHVG NGWK
Sbjct  181  FSVGSGSPYAYGVLDDGYRYDMSVEEAAELARRAIYHATFRDGASGGVASVYHVGANGWK  240

Query  795  KLSGDDVGELHYHYYPVEAAAVEHEMTEV  881
            KLSGDDVGELHY YYPV A AVE EM EV
Sbjct  241  KLSGDDVGELHYSYYPVVAGAVEQEMVEV  269



>gb|KHG25400.1| Proteasome subunit beta type-5 [Gossypium arboreum]
Length=272

 Score =   485 bits (1249),  Expect = 5e-169, Method: Compositional matrix adjust.
 Identities = 230/269 (86%), Positives = 248/269 (92%), Gaps = 0/269 (0%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLA  254
            +++D +G+ES AP+ G  +EL D     PSF++PN TDFDGFQK+AIQMVKPAKGTTTLA
Sbjct  1    MKLDTTGMESAAPVWGSHNELVDGFSAAPSFELPNTTDFDGFQKEAIQMVKPAKGTTTLA  60

Query  255  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  434
            FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRL
Sbjct  61   FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRL  120

Query  435  HELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNR  614
            HELANKRRISV GASKLLANILYSYRGMGLSVGTMIAGWDE GPGLYYVD+EGGRLKG R
Sbjct  121  HELANKRRISVTGASKLLANILYSYRGMGLSVGTMIAGWDETGPGLYYVDNEGGRLKGMR  180

Query  615  FSVGSGSPYAYGVLDNGYRFDLSVEEAAELARRSIYHATFRDGASGGVASVYHVGPNGWK  794
            FSVGSGSPYAYGVLDNGYR+D+SVEEAAELARR+IYHATFRDGASGGVASVY+VGPNGWK
Sbjct  181  FSVGSGSPYAYGVLDNGYRYDMSVEEAAELARRAIYHATFRDGASGGVASVYYVGPNGWK  240

Query  795  KLSGDDVGELHYHYYPVEAAAVEHEMTEV  881
            KLSGDDVGELHY YYPV  + +E EM EV
Sbjct  241  KLSGDDVGELHYRYYPVMPSTIEQEMAEV  269



>gb|KJB78067.1| hypothetical protein B456_012G175200 [Gossypium raimondii]
Length=272

 Score =   485 bits (1248),  Expect = 7e-169, Method: Compositional matrix adjust.
 Identities = 231/269 (86%), Positives = 247/269 (92%), Gaps = 0/269 (0%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLA  254
            +++D +G+ES AP+ G  +EL D     PSF++PN TDFDGFQK+AIQMVKPAKGTTTLA
Sbjct  1    MKLDTTGMESAAPVWGSHNELVDGFSAAPSFELPNTTDFDGFQKEAIQMVKPAKGTTTLA  60

Query  255  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  434
            FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG KCRL
Sbjct  61   FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGTKCRL  120

Query  435  HELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNR  614
            HELANKRRISV GASKLLANILYSYRGMGLSVGTMIAGWDE GPGLYYVD+EGGRLKG R
Sbjct  121  HELANKRRISVTGASKLLANILYSYRGMGLSVGTMIAGWDETGPGLYYVDNEGGRLKGMR  180

Query  615  FSVGSGSPYAYGVLDNGYRFDLSVEEAAELARRSIYHATFRDGASGGVASVYHVGPNGWK  794
            FSVGSGSPYAYGVLDNGYR+D+SVEEAAELARR+IYHATFRDGASGGVASVY+VGPNGWK
Sbjct  181  FSVGSGSPYAYGVLDNGYRYDMSVEEAAELARRAIYHATFRDGASGGVASVYYVGPNGWK  240

Query  795  KLSGDDVGELHYHYYPVEAAAVEHEMTEV  881
            KLSGDDVGELHY YYPV  + VE EM EV
Sbjct  241  KLSGDDVGELHYRYYPVMPSTVEQEMVEV  269



>ref|XP_009372313.1| PREDICTED: proteasome subunit beta type-5 [Pyrus x bretschneideri]
Length=272

 Score =   485 bits (1248),  Expect = 7e-169, Method: Compositional matrix adjust.
 Identities = 234/269 (87%), Positives = 246/269 (91%), Gaps = 0/269 (0%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLA  254
            +R+D SGLES AP+ GESS   D +   PSF++P   DFDGFQK+AIQMVKPAKGTTTLA
Sbjct  1    MRLDTSGLESHAPLFGESSGFLDGVSAPPSFEVPTTNDFDGFQKEAIQMVKPAKGTTTLA  60

Query  255  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  434
            FIFK+GVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRL
Sbjct  61   FIFKDGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRL  120

Query  435  HELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNR  614
            HELANKRRISV GASKLLANILYSYRGMGLSVGTMIAGWDE GPGLYYVDSEGGRLKG R
Sbjct  121  HELANKRRISVTGASKLLANILYSYRGMGLSVGTMIAGWDETGPGLYYVDSEGGRLKGMR  180

Query  615  FSVGSGSPYAYGVLDNGYRFDLSVEEAAELARRSIYHATFRDGASGGVASVYHVGPNGWK  794
            FSVGSGSPYAYGVLDNGYR+D+SVEEAAELARR+IYHATFRDGASGGVASVYHVG NGWK
Sbjct  181  FSVGSGSPYAYGVLDNGYRYDMSVEEAAELARRAIYHATFRDGASGGVASVYHVGANGWK  240

Query  795  KLSGDDVGELHYHYYPVEAAAVEHEMTEV  881
            KLSGDDVGELHY YYPV   AVE EM EV
Sbjct  241  KLSGDDVGELHYSYYPVVPGAVEQEMVEV  269



>ref|XP_009376552.1| PREDICTED: proteasome subunit beta type-5-like [Pyrus x bretschneideri]
Length=270

 Score =   484 bits (1245),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 234/270 (87%), Positives = 249/270 (92%), Gaps = 1/270 (0%)
 Frame = +3

Query  75   VRIDFSGLESTAP-IRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTL  251
            +++D SGLES AP + GESS   D +   P+F++P   DFDGFQK+AIQMVKPAKGTTTL
Sbjct  1    MKLDTSGLESHAPHLFGESSGFLDGVSGPPAFEVPTTNDFDGFQKEAIQMVKPAKGTTTL  60

Query  252  AFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCR  431
            AFIFK+GVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCR
Sbjct  61   AFIFKDGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCR  120

Query  432  LHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGN  611
            LHELANKRRISV GASKLLANILYSYRGMGLSVGTMIAGWDE GPGLYYVDSEGGRLKG 
Sbjct  121  LHELANKRRISVTGASKLLANILYSYRGMGLSVGTMIAGWDETGPGLYYVDSEGGRLKGM  180

Query  612  RFSVGSGSPYAYGVLDNGYRFDLSVEEAAELARRSIYHATFRDGASGGVASVYHVGPNGW  791
            RFSVGSGSPYAYGVLDNGYR+D+SVEEAAELARR+IYHATFRDGASGGVASVYHVGPNGW
Sbjct  181  RFSVGSGSPYAYGVLDNGYRYDMSVEEAAELARRAIYHATFRDGASGGVASVYHVGPNGW  240

Query  792  KKLSGDDVGELHYHYYPVEAAAVEHEMTEV  881
            KKLSGDDVGELHYHYYPV A +VE EM EV
Sbjct  241  KKLSGDDVGELHYHYYPVVAGSVEQEMVEV  270



>ref|XP_007045043.1| N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily 
protein isoform 1 [Theobroma cacao]
 ref|XP_007045044.1| N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily 
protein isoform 1 [Theobroma cacao]
 gb|EOY00875.1| N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily 
protein isoform 1 [Theobroma cacao]
 gb|EOY00876.1| N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily 
protein isoform 1 [Theobroma cacao]
Length=272

 Score =   483 bits (1244),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 232/269 (86%), Positives = 246/269 (91%), Gaps = 0/269 (0%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLA  254
            +++D SGLES  P+    +EL D     PSF++PN TDFDGFQK+AIQMVKPAKGTTTLA
Sbjct  1    MKLDTSGLESAEPVWATFNELADGFSAAPSFELPNTTDFDGFQKEAIQMVKPAKGTTTLA  60

Query  255  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  434
            FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRL
Sbjct  61   FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRL  120

Query  435  HELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNR  614
            HELANKRRISV GASKLLANILYSYRGMGLSVGTMIAGWDE GPGLYYVDSEGGRLKG R
Sbjct  121  HELANKRRISVTGASKLLANILYSYRGMGLSVGTMIAGWDETGPGLYYVDSEGGRLKGMR  180

Query  615  FSVGSGSPYAYGVLDNGYRFDLSVEEAAELARRSIYHATFRDGASGGVASVYHVGPNGWK  794
            FSVGSGSPYAYGVLD+GYR+D+SVEEAAELARR+IYHATFRDGASGGVASVYHVGPNGWK
Sbjct  181  FSVGSGSPYAYGVLDSGYRYDMSVEEAAELARRAIYHATFRDGASGGVASVYHVGPNGWK  240

Query  795  KLSGDDVGELHYHYYPVEAAAVEHEMTEV  881
            KLSGDDVGELHY YYPV  + VE EM EV
Sbjct  241  KLSGDDVGELHYKYYPVMPSTVEQEMVEV  269



>ref|XP_008381840.1| PREDICTED: proteasome subunit beta type-5-like [Malus domestica]
Length=270

 Score =   482 bits (1240),  Expect = 1e-167, Method: Compositional matrix adjust.
 Identities = 234/270 (87%), Positives = 248/270 (92%), Gaps = 1/270 (0%)
 Frame = +3

Query  75   VRIDFSGLESTAP-IRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTL  251
            +++D SGLES AP + GESS   D +   PSF++P   DFDGFQK+AIQMVKPAKGTTTL
Sbjct  1    MKLDTSGLESHAPHLFGESSGFLDGVSGPPSFEVPTTNDFDGFQKEAIQMVKPAKGTTTL  60

Query  252  AFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCR  431
            AFIFK+GVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCR
Sbjct  61   AFIFKDGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCR  120

Query  432  LHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGN  611
            LHELANKRRISV GASKLLANILYSYRGMGLSVGTMIAGWDE GPGLYYVDSEGGRLKG 
Sbjct  121  LHELANKRRISVTGASKLLANILYSYRGMGLSVGTMIAGWDETGPGLYYVDSEGGRLKGM  180

Query  612  RFSVGSGSPYAYGVLDNGYRFDLSVEEAAELARRSIYHATFRDGASGGVASVYHVGPNGW  791
            RFSVGSGSPYAYGVLDNGYR+D+SVEEAAELARR+IYHATFRDGASGGVASVY VGPNGW
Sbjct  181  RFSVGSGSPYAYGVLDNGYRYDMSVEEAAELARRAIYHATFRDGASGGVASVYXVGPNGW  240

Query  792  KKLSGDDVGELHYHYYPVEAAAVEHEMTEV  881
            KKLSGDDVGELHYHYYPV A +VE EM EV
Sbjct  241  KKLSGDDVGELHYHYYPVVAGSVEQEMVEV  270



>ref|XP_006395566.1| hypothetical protein EUTSA_v10004762mg [Eutrema salsugineum]
 gb|ESQ32852.1| hypothetical protein EUTSA_v10004762mg [Eutrema salsugineum]
Length=273

 Score =   481 bits (1239),  Expect = 1e-167, Method: Compositional matrix adjust.
 Identities = 230/270 (85%), Positives = 248/270 (92%), Gaps = 2/270 (1%)
 Frame = +3

Query  75   VRIDFSGLESTAPI--RGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTT  248
            +++D SG E+T P+   G SSE+ D    VPSF +P  TDFDGFQK+A+QMVKPAKGTTT
Sbjct  1    MKLDTSGFETTMPMIGFGSSSEMLDGFSSVPSFDLPRTTDFDGFQKEAVQMVKPAKGTTT  60

Query  249  LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKC  428
            LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KC
Sbjct  61   LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKC  120

Query  429  RLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKG  608
            RLHELANKRRISV+GASKLLAN+LYSYRGMGLSVGTMIAGWDE GPGLYYVD+EGGRLKG
Sbjct  121  RLHELANKRRISVSGASKLLANMLYSYRGMGLSVGTMIAGWDETGPGLYYVDNEGGRLKG  180

Query  609  NRFSVGSGSPYAYGVLDNGYRFDLSVEEAAELARRSIYHATFRDGASGGVASVYHVGPNG  788
            +RFSVGSGSPYAYGVLD+GY+FD+SVEEA+ELARRSIYHATFRDGASGGVASVYHVGPNG
Sbjct  181  DRFSVGSGSPYAYGVLDSGYKFDMSVEEASELARRSIYHATFRDGASGGVASVYHVGPNG  240

Query  789  WKKLSGDDVGELHYHYYPVEAAAVEHEMTE  878
            WKKLSGDDVGELHYHYYPV  A  E EM E
Sbjct  241  WKKLSGDDVGELHYHYYPVVPATAEQEMEE  270



>ref|XP_006291670.1| hypothetical protein CARUB_v10017828mg [Capsella rubella]
 gb|EOA24568.1| hypothetical protein CARUB_v10017828mg [Capsella rubella]
Length=272

 Score =   480 bits (1235),  Expect = 6e-167, Method: Compositional matrix adjust.
 Identities = 228/270 (84%), Positives = 246/270 (91%), Gaps = 2/270 (1%)
 Frame = +3

Query  75   VRIDFSGLESTAPI--RGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTT  248
            +++D SG E+T P+   G SSE+ D    VPSF +P  TDFDGFQK +++MVKPAKGTTT
Sbjct  1    MKLDTSGFETTMPVIGFGSSSEMLDGFSSVPSFDLPRTTDFDGFQKKSVEMVKPAKGTTT  60

Query  249  LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKC  428
            LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KC
Sbjct  61   LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKC  120

Query  429  RLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKG  608
            RLHELANKRRISV+GASKLLAN+LYSYRGMGLSVGTMIAGWDE GPGLYYVD+EGGRLKG
Sbjct  121  RLHELANKRRISVSGASKLLANMLYSYRGMGLSVGTMIAGWDETGPGLYYVDNEGGRLKG  180

Query  609  NRFSVGSGSPYAYGVLDNGYRFDLSVEEAAELARRSIYHATFRDGASGGVASVYHVGPNG  788
            +RFSVGSGSPYAYGVLD+GYRFD+SVEEA+ELARRSIYHATFRDGASGGVASVYHVGP G
Sbjct  181  DRFSVGSGSPYAYGVLDSGYRFDMSVEEASELARRSIYHATFRDGASGGVASVYHVGPQG  240

Query  789  WKKLSGDDVGELHYHYYPVEAAAVEHEMTE  878
            WKKLSGDDVGELHYHYYPV     EHEM E
Sbjct  241  WKKLSGDDVGELHYHYYPVAPTTAEHEMAE  270



>ref|XP_010025332.1| PREDICTED: proteasome subunit beta type-5-B [Eucalyptus grandis]
 ref|XP_010025333.1| PREDICTED: proteasome subunit beta type-5-B [Eucalyptus grandis]
 gb|KCW61970.1| hypothetical protein EUGRSUZ_H04655 [Eucalyptus grandis]
Length=273

 Score =   480 bits (1235),  Expect = 7e-167, Method: Compositional matrix adjust.
 Identities = 229/272 (84%), Positives = 247/272 (91%), Gaps = 0/272 (0%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLA  254
            +++D SGLEST P+ G + ELF+     P+F+IP   DFD FQK+A+QMVKPAKGTTTLA
Sbjct  1    MKLDTSGLESTMPVFGVNKELFEGFSAAPAFEIPGACDFDNFQKEAVQMVKPAKGTTTLA  60

Query  255  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  434
            FIFKEGVMVAADSRASMGGYISSQSVKKIIEINP+MLGTMAGGAADCQFWHRNLG+KCRL
Sbjct  61   FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPHMLGTMAGGAADCQFWHRNLGIKCRL  120

Query  435  HELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNR  614
            HELANKRRISV GASKLLANILYSYRGMGLSVGTMIAGWDE GPGLYYVDSEGGRLKG R
Sbjct  121  HELANKRRISVTGASKLLANILYSYRGMGLSVGTMIAGWDETGPGLYYVDSEGGRLKGTR  180

Query  615  FSVGSGSPYAYGVLDNGYRFDLSVEEAAELARRSIYHATFRDGASGGVASVYHVGPNGWK  794
            FSVGSGSPYAYGVLD+GYR+D+SVEEAAELARR+IYHATFRDGASGGVASVYHVGP GWK
Sbjct  181  FSVGSGSPYAYGVLDSGYRYDMSVEEAAELARRAIYHATFRDGASGGVASVYHVGPTGWK  240

Query  795  KLSGDDVGELHYHYYPVEAAAVEHEMTEVPIA  890
            KLSGDDVGELHYHY+PV  + VE EM EV  A
Sbjct  241  KLSGDDVGELHYHYHPVTPSTVEQEMAEVVAA  272



>ref|XP_010682823.1| PREDICTED: proteasome subunit beta type-5 [Beta vulgaris subsp. 
vulgaris]
Length=272

 Score =   478 bits (1229),  Expect = 5e-166, Method: Compositional matrix adjust.
 Identities = 226/269 (84%), Positives = 247/269 (92%), Gaps = 0/269 (0%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLA  254
            +++D SGLESTAP+   S+ +FD +   PSF++PN  DFDGFQKDAIQMVKPAKGTTTLA
Sbjct  1    MKLDTSGLESTAPLFRSSNVIFDGLQMTPSFELPNALDFDGFQKDAIQMVKPAKGTTTLA  60

Query  255  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  434
            FIFK GV+VAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRL
Sbjct  61   FIFKHGVIVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRL  120

Query  435  HELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNR  614
            HELANKRRISV GASKLLANILY+YRGMGLSVGTMIAGWDE GPGLYYVDSEGGRLKG R
Sbjct  121  HELANKRRISVTGASKLLANILYNYRGMGLSVGTMIAGWDETGPGLYYVDSEGGRLKGMR  180

Query  615  FSVGSGSPYAYGVLDNGYRFDLSVEEAAELARRSIYHATFRDGASGGVASVYHVGPNGWK  794
            FSVGSGSPYAYGVLDNGY++D++VEEA+ELARR+IYHAT+RDGASGGV SVYHVGP+GWK
Sbjct  181  FSVGSGSPYAYGVLDNGYQYDMTVEEASELARRAIYHATYRDGASGGVVSVYHVGPDGWK  240

Query  795  KLSGDDVGELHYHYYPVEAAAVEHEMTEV  881
            KL+GDDVGELHY YYPV  A VE EM EV
Sbjct  241  KLTGDDVGELHYQYYPVVPATVEQEMAEV  269



>ref|XP_010250770.1| PREDICTED: proteasome subunit beta type-5 [Nelumbo nucifera]
Length=272

 Score =   475 bits (1223),  Expect = 4e-165, Method: Compositional matrix adjust.
 Identities = 228/269 (85%), Positives = 243/269 (90%), Gaps = 0/269 (0%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLA  254
            ++ID SGLES  P+ G  +EL D     PSF++P  TDFDGFQK+A Q +KPAKGTTTLA
Sbjct  1    MKIDLSGLESAFPLFGGGNELSDGFSAAPSFELPCSTDFDGFQKEAKQTLKPAKGTTTLA  60

Query  255  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  434
            FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRL
Sbjct  61   FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRL  120

Query  435  HELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNR  614
            HELANKRRISV GASKLLANILYSYRGMGLSVGTMIAGWDE GPGLYYVDSEGGRLKG R
Sbjct  121  HELANKRRISVTGASKLLANILYSYRGMGLSVGTMIAGWDETGPGLYYVDSEGGRLKGTR  180

Query  615  FSVGSGSPYAYGVLDNGYRFDLSVEEAAELARRSIYHATFRDGASGGVASVYHVGPNGWK  794
            FSVGSGSPYAYGVLDNGYR+D+S+EEAAELARR+IYHATFRDGASGGVASVY+VGPNGWK
Sbjct  181  FSVGSGSPYAYGVLDNGYRYDMSIEEAAELARRAIYHATFRDGASGGVASVYYVGPNGWK  240

Query  795  KLSGDDVGELHYHYYPVEAAAVEHEMTEV  881
            KLSGDDVGELH+ YYPV    VE EM EV
Sbjct  241  KLSGDDVGELHFKYYPVSPGTVEQEMVEV  269



>ref|XP_009416647.1| PREDICTED: proteasome subunit beta type-5-like [Musa acuminata 
subsp. malaccensis]
Length=273

 Score =   474 bits (1221),  Expect = 8e-165, Method: Compositional matrix adjust.
 Identities = 230/273 (84%), Positives = 248/273 (91%), Gaps = 1/273 (0%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSE-LFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTL  251
            +++D SGL+S   I G + + L +++   PSFQ+P  +DFDGFQKDAIQMVKPAKGTTTL
Sbjct  1    MKLDLSGLQSFTSIPGGAVDGLGEDLFAAPSFQLPACSDFDGFQKDAIQMVKPAKGTTTL  60

Query  252  AFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCR  431
            AFIFKEGV+VAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCR
Sbjct  61   AFIFKEGVIVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCR  120

Query  432  LHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGN  611
            LHELANKRRISV GASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKG 
Sbjct  121  LHELANKRRISVTGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGT  180

Query  612  RFSVGSGSPYAYGVLDNGYRFDLSVEEAAELARRSIYHATFRDGASGGVASVYHVGPNGW  791
            RFSVGSGSPYAYGVLD+GYRFD+ VEEAAELARR+IYHATFRDGASGGVASVYHVGP+GW
Sbjct  181  RFSVGSGSPYAYGVLDSGYRFDMPVEEAAELARRAIYHATFRDGASGGVASVYHVGPDGW  240

Query  792  KKLSGDDVGELHYHYYPVEAAAVEHEMTEVPIA  890
            KKLSGDDVGELHY YYPV    VE EMT+ P A
Sbjct  241  KKLSGDDVGELHYKYYPVAPTPVEQEMTDAPAA  273



>emb|CDY34594.1| BnaC03g56940D [Brassica napus]
Length=274

 Score =   474 bits (1221),  Expect = 9e-165, Method: Compositional matrix adjust.
 Identities = 226/270 (84%), Positives = 246/270 (91%), Gaps = 2/270 (1%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRG--ESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTT  248
            +++D SG E++ P  G   S+++ D    VPSF +P  TDFDGFQK+A+QMVKPAKGTTT
Sbjct  1    MKLDTSGFETSMPTIGFESSNDMLDGFSTVPSFDLPRTTDFDGFQKEAVQMVKPAKGTTT  60

Query  249  LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKC  428
            LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KC
Sbjct  61   LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKC  120

Query  429  RLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKG  608
            RLHELANKRRISV+GASKLLAN+LYSYRGMGLSVGTMIAGWDE GPGLYYVD+EGGRLKG
Sbjct  121  RLHELANKRRISVSGASKLLANMLYSYRGMGLSVGTMIAGWDETGPGLYYVDNEGGRLKG  180

Query  609  NRFSVGSGSPYAYGVLDNGYRFDLSVEEAAELARRSIYHATFRDGASGGVASVYHVGPNG  788
            +RFSVGSGSPYAYGVLD+GY+FD+SVEEA+ELARRSIYHATFRDGASGGVASVYHVGPNG
Sbjct  181  DRFSVGSGSPYAYGVLDSGYKFDMSVEEASELARRSIYHATFRDGASGGVASVYHVGPNG  240

Query  789  WKKLSGDDVGELHYHYYPVEAAAVEHEMTE  878
            WKKLSGDDVGELHYHYYPV  A  E  M E
Sbjct  241  WKKLSGDDVGELHYHYYPVPPATAEQVMEE  270



>ref|XP_010425347.1| PREDICTED: proteasome subunit beta type-5-B [Camelina sativa]
Length=272

 Score =   474 bits (1221),  Expect = 9e-165, Method: Compositional matrix adjust.
 Identities = 224/270 (83%), Positives = 246/270 (91%), Gaps = 2/270 (1%)
 Frame = +3

Query  75   VRIDFSGLESTAPI--RGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTT  248
            +++D SG E+T P+   G +SE+ D +  VPSF +P  TDFDGFQK +++MVKPAKGTTT
Sbjct  1    MKLDTSGFETTMPVIGFGSNSEMLDGVSSVPSFDLPRTTDFDGFQKKSVEMVKPAKGTTT  60

Query  249  LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKC  428
            LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KC
Sbjct  61   LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKC  120

Query  429  RLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKG  608
            RLHELANKRRISV+GASKLLAN+LYSYRGMGLSVGTMIAGWDE GPGLYYVD+EGGRLKG
Sbjct  121  RLHELANKRRISVSGASKLLANMLYSYRGMGLSVGTMIAGWDETGPGLYYVDNEGGRLKG  180

Query  609  NRFSVGSGSPYAYGVLDNGYRFDLSVEEAAELARRSIYHATFRDGASGGVASVYHVGPNG  788
            +RFSVGSGSPYAYGVLD+GY+FD+S+EEA+ELARRSIYHATFRDGASGGVASVYHVGP G
Sbjct  181  DRFSVGSGSPYAYGVLDSGYKFDMSIEEASELARRSIYHATFRDGASGGVASVYHVGPQG  240

Query  789  WKKLSGDDVGELHYHYYPVEAAAVEHEMTE  878
            W KLSGDDVGELHYHYYPV  A  EH M E
Sbjct  241  WTKLSGDDVGELHYHYYPVAPATAEHVMEE  270



>ref|XP_007137929.1| hypothetical protein PHAVU_009G167300g [Phaseolus vulgaris]
 gb|ESW09923.1| hypothetical protein PHAVU_009G167300g [Phaseolus vulgaris]
Length=272

 Score =   474 bits (1220),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 227/270 (84%), Positives = 243/270 (90%), Gaps = 0/270 (0%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLA  254
            +++D +GLES   +    S++   +   PSF +PN  DFDGF K+AIQMVKPAKGTTTLA
Sbjct  1    MKLDTTGLESFPSLLAPQSDVVGALSAAPSFDLPNSNDFDGFLKEAIQMVKPAKGTTTLA  60

Query  255  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  434
            FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRL
Sbjct  61   FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRL  120

Query  435  HELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNR  614
            HELANKRRISV GASKLLANILYSYRGMGLSVGTMIAGWDE GPGLYYVDSEGGRLKG R
Sbjct  121  HELANKRRISVTGASKLLANILYSYRGMGLSVGTMIAGWDETGPGLYYVDSEGGRLKGTR  180

Query  615  FSVGSGSPYAYGVLDNGYRFDLSVEEAAELARRSIYHATFRDGASGGVASVYHVGPNGWK  794
            FSVGSGSPYAYGVLD+GYR+DLSVEEAAELARR+IYHATFRDGASGGVASVY+VGPNGWK
Sbjct  181  FSVGSGSPYAYGVLDSGYRYDLSVEEAAELARRAIYHATFRDGASGGVASVYYVGPNGWK  240

Query  795  KLSGDDVGELHYHYYPVEAAAVEHEMTEVP  884
            KLSGDDVGELHYHYYPV  + VE EM E P
Sbjct  241  KLSGDDVGELHYHYYPVTPSTVEQEMVEAP  270



>ref|XP_010105786.1| Proteasome subunit beta type-5 [Morus notabilis]
 gb|EXC06139.1| Proteasome subunit beta type-5 [Morus notabilis]
Length=272

 Score =   474 bits (1219),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 227/269 (84%), Positives = 244/269 (91%), Gaps = 0/269 (0%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLA  254
            +++D SGLESTA + G S+E  D +   PSF +P+  D DGF K+A+QMVKPAKGTTTLA
Sbjct  1    MKLDTSGLESTASLFGASNEFHDGLSTAPSFDLPSNVDLDGFLKEAVQMVKPAKGTTTLA  60

Query  255  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  434
            FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRL
Sbjct  61   FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRL  120

Query  435  HELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNR  614
            HELANKRRISV GASKLLANILYSYRGMGLSVGTMIAGWDE GPGLYYVDSEGGRLKG R
Sbjct  121  HELANKRRISVTGASKLLANILYSYRGMGLSVGTMIAGWDETGPGLYYVDSEGGRLKGTR  180

Query  615  FSVGSGSPYAYGVLDNGYRFDLSVEEAAELARRSIYHATFRDGASGGVASVYHVGPNGWK  794
            FSVGSGSPYAYGVLD+GYR+D+SV EAAELARR+IYHATFRDGASGGVASVY+VGP+GWK
Sbjct  181  FSVGSGSPYAYGVLDDGYRYDMSVHEAAELARRAIYHATFRDGASGGVASVYYVGPDGWK  240

Query  795  KLSGDDVGELHYHYYPVEAAAVEHEMTEV  881
            KLSGDDVGELHY YYPV A  VE EM EV
Sbjct  241  KLSGDDVGELHYKYYPVTAGTVEQEMAEV  269



>emb|CDX98014.1| BnaA06g07650D [Brassica napus]
Length=274

 Score =   474 bits (1219),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 226/270 (84%), Positives = 246/270 (91%), Gaps = 2/270 (1%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRG--ESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTT  248
            +++D SG E++ P  G   S+++ D    VPSF +P  TDFDGFQK+A+QMVKPAKGTTT
Sbjct  1    MKLDTSGFETSMPTVGFGSSNDMLDGFSTVPSFDLPRTTDFDGFQKEAVQMVKPAKGTTT  60

Query  249  LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKC  428
            LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KC
Sbjct  61   LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKC  120

Query  429  RLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKG  608
            RLHELANKRRISV+GASKLLAN+LYSYRGMGLSVGTMIAGWDE GPGLYYVD+EGGRLKG
Sbjct  121  RLHELANKRRISVSGASKLLANMLYSYRGMGLSVGTMIAGWDETGPGLYYVDNEGGRLKG  180

Query  609  NRFSVGSGSPYAYGVLDNGYRFDLSVEEAAELARRSIYHATFRDGASGGVASVYHVGPNG  788
            +RFSVGSGSPYAYGVLD+GY+FD+SVEEA+ELARRSIYHATFRDGASGGVASVYHVGPNG
Sbjct  181  DRFSVGSGSPYAYGVLDSGYKFDMSVEEASELARRSIYHATFRDGASGGVASVYHVGPNG  240

Query  789  WKKLSGDDVGELHYHYYPVEAAAVEHEMTE  878
            WKKLSGDDVGELHYHYYPV  A  E  M E
Sbjct  241  WKKLSGDDVGELHYHYYPVPPAIAEQVMEE  270



>emb|CDY21081.1| BnaA08g24440D [Brassica napus]
Length=274

 Score =   473 bits (1218),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 225/270 (83%), Positives = 246/270 (91%), Gaps = 2/270 (1%)
 Frame = +3

Query  75   VRIDFSGLESTAPI--RGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTT  248
            +++D SG E++ P    G S+++ D    VPSF +P  TDFDGFQK+A+QMVKPAKGTTT
Sbjct  1    MKLDTSGFETSMPTIGFGSSNDMLDGFSTVPSFDLPRTTDFDGFQKEAVQMVKPAKGTTT  60

Query  249  LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKC  428
            LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KC
Sbjct  61   LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKC  120

Query  429  RLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKG  608
            RLHELANKRRISV+GASKLLAN+LYSYRGMGLSVGTMIAGWDE GPGLYYVD+EGGRLKG
Sbjct  121  RLHELANKRRISVSGASKLLANMLYSYRGMGLSVGTMIAGWDETGPGLYYVDNEGGRLKG  180

Query  609  NRFSVGSGSPYAYGVLDNGYRFDLSVEEAAELARRSIYHATFRDGASGGVASVYHVGPNG  788
            +RFSVGSGSPYAYGVLD+GY+FD+SVEEA+ELARRSIYHATFRDGASGGVASVYHVGPNG
Sbjct  181  DRFSVGSGSPYAYGVLDSGYKFDMSVEEASELARRSIYHATFRDGASGGVASVYHVGPNG  240

Query  789  WKKLSGDDVGELHYHYYPVEAAAVEHEMTE  878
            WKKLSGDDVGELHYHYYPV  +  E  M E
Sbjct  241  WKKLSGDDVGELHYHYYPVPPSTAEQVMEE  270



>ref|XP_009110603.1| PREDICTED: proteasome subunit beta type-5-B [Brassica rapa]
Length=274

 Score =   473 bits (1218),  Expect = 3e-164, Method: Compositional matrix adjust.
 Identities = 225/270 (83%), Positives = 246/270 (91%), Gaps = 2/270 (1%)
 Frame = +3

Query  75   VRIDFSGLESTAPI--RGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTT  248
            +++D SG E++ P    G S+++ D    VPSF +P  TDFDGFQK+A+QMVKPAKGTTT
Sbjct  1    MKLDTSGFETSMPTIGFGSSNDMLDGFTTVPSFDLPRTTDFDGFQKEAVQMVKPAKGTTT  60

Query  249  LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKC  428
            LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KC
Sbjct  61   LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKC  120

Query  429  RLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKG  608
            RLHELANKRRISV+GASKLLAN+LYSYRGMGLSVGTMIAGWDE GPGLYYVD+EGGRLKG
Sbjct  121  RLHELANKRRISVSGASKLLANMLYSYRGMGLSVGTMIAGWDETGPGLYYVDNEGGRLKG  180

Query  609  NRFSVGSGSPYAYGVLDNGYRFDLSVEEAAELARRSIYHATFRDGASGGVASVYHVGPNG  788
            +RFSVGSGSPYAYGVLD+GY+FD+SVEEA+ELARRSIYHATFRDGASGGVASVYHVGPNG
Sbjct  181  DRFSVGSGSPYAYGVLDSGYKFDMSVEEASELARRSIYHATFRDGASGGVASVYHVGPNG  240

Query  789  WKKLSGDDVGELHYHYYPVEAAAVEHEMTE  878
            WKKLSGDDVGELHYHYYPV  +  E  M E
Sbjct  241  WKKLSGDDVGELHYHYYPVPPSTAEQVMEE  270



>sp|O24361.1|PSB5_SPIOL RecName: Full=Proteasome subunit beta type-5; AltName: Full=20S 
proteasome subunit E; AltName: Full=Proteasome epsilon chain; 
Flags: Precursor [Spinacia oleracea]
 dbj|BAA21650.1| 26S proteasome beta subunit [Spinacia oleracea]
Length=272

 Score =   473 bits (1217),  Expect = 3e-164, Method: Compositional matrix adjust.
 Identities = 224/269 (83%), Positives = 246/269 (91%), Gaps = 0/269 (0%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLA  254
            +++D SGLESTAPI   S  +FD +   PSF +PN TDFDGFQK+A+QMVKPAKGTTTLA
Sbjct  1    MKLDTSGLESTAPIFRRSDFVFDGLQMTPSFDLPNPTDFDGFQKEAVQMVKPAKGTTTLA  60

Query  255  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  434
            FIFK GVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRL
Sbjct  61   FIFKHGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRL  120

Query  435  HELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNR  614
            HELANKRRISV GASKLLANILY+YRGMGLSVGTMIAGWDE GPGLYYVDSEGGRLKG R
Sbjct  121  HELANKRRISVTGASKLLANILYNYRGMGLSVGTMIAGWDETGPGLYYVDSEGGRLKGMR  180

Query  615  FSVGSGSPYAYGVLDNGYRFDLSVEEAAELARRSIYHATFRDGASGGVASVYHVGPNGWK  794
            FSVGSGSPYAYGVLDNGY++D++VEEA+ELARR+IYHAT+RDGASGGV SVYHVGP+GWK
Sbjct  181  FSVGSGSPYAYGVLDNGYKYDMTVEEASELARRAIYHATYRDGASGGVVSVYHVGPDGWK  240

Query  795  KLSGDDVGELHYHYYPVEAAAVEHEMTEV  881
            K++GDDVG+LH+ YYPV  A VE EM EV
Sbjct  241  KVTGDDVGDLHFQYYPVVPATVEQEMVEV  269



>ref|XP_010251768.1| PREDICTED: proteasome subunit beta type-5-like [Nelumbo nucifera]
Length=272

 Score =   473 bits (1217),  Expect = 3e-164, Method: Compositional matrix adjust.
 Identities = 225/269 (84%), Positives = 242/269 (90%), Gaps = 0/269 (0%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLA  254
            +++D SGLES +P+    +E  +     PSF++P  TDFDGFQKDA Q +KPAKGTTTLA
Sbjct  1    MKLDLSGLESASPLFAVGNEFSNGFSAAPSFELPCTTDFDGFQKDAKQTLKPAKGTTTLA  60

Query  255  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  434
            FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRL
Sbjct  61   FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRL  120

Query  435  HELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNR  614
            HELANKRRISV GASKLL NILYSYRGMGLSVGTMIAGWDE GPGLYYVDSEGGRLKG R
Sbjct  121  HELANKRRISVTGASKLLTNILYSYRGMGLSVGTMIAGWDETGPGLYYVDSEGGRLKGTR  180

Query  615  FSVGSGSPYAYGVLDNGYRFDLSVEEAAELARRSIYHATFRDGASGGVASVYHVGPNGWK  794
            FSVGSGSPYAYGVLDNGYR+D+SVEEAAELARR+IYHATFRDGASGGVASVY+VGPNGWK
Sbjct  181  FSVGSGSPYAYGVLDNGYRYDMSVEEAAELARRAIYHATFRDGASGGVASVYYVGPNGWK  240

Query  795  KLSGDDVGELHYHYYPVEAAAVEHEMTEV  881
            KLSGDDVGELH+ YYPV    VE EM+EV
Sbjct  241  KLSGDDVGELHFKYYPVTPGTVEQEMSEV  269



>ref|XP_010514289.1| PREDICTED: proteasome subunit beta type-5-B-like [Camelina sativa]
Length=272

 Score =   473 bits (1217),  Expect = 3e-164, Method: Compositional matrix adjust.
 Identities = 223/270 (83%), Positives = 246/270 (91%), Gaps = 2/270 (1%)
 Frame = +3

Query  75   VRIDFSGLESTAPI--RGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTT  248
            +++D SG E++ P+   G +SE+ D +  VPSF +P  TDFDGFQK +++MVKPAKGTTT
Sbjct  1    MKLDTSGFETSMPVIGFGSNSEMLDGVSSVPSFDLPRTTDFDGFQKKSVEMVKPAKGTTT  60

Query  249  LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKC  428
            LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KC
Sbjct  61   LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKC  120

Query  429  RLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKG  608
            RLHELANKRRISV+GASKLLAN+LYSYRGMGLSVGTMIAGWDE GPGLYYVD+EGGRLKG
Sbjct  121  RLHELANKRRISVSGASKLLANMLYSYRGMGLSVGTMIAGWDETGPGLYYVDNEGGRLKG  180

Query  609  NRFSVGSGSPYAYGVLDNGYRFDLSVEEAAELARRSIYHATFRDGASGGVASVYHVGPNG  788
            +RFSVGSGSPYAYGVLD+GY+FD+S+EEA+ELARRSIYHATFRDGASGGVASVYHVGP G
Sbjct  181  DRFSVGSGSPYAYGVLDSGYKFDMSIEEASELARRSIYHATFRDGASGGVASVYHVGPQG  240

Query  789  WKKLSGDDVGELHYHYYPVEAAAVEHEMTE  878
            W KLSGDDVGELHYHYYPV  A  EH M E
Sbjct  241  WTKLSGDDVGELHYHYYPVAPATAEHVMEE  270



>ref|XP_003526966.1| PREDICTED: proteasome subunit beta type-5-like [Glycine max]
 gb|KHN23280.1| Proteasome subunit beta type-5 [Glycine soja]
Length=272

 Score =   473 bits (1217),  Expect = 3e-164, Method: Compositional matrix adjust.
 Identities = 226/268 (84%), Positives = 243/268 (91%), Gaps = 0/268 (0%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLA  254
            +++D +GLES   +    +++  E+   PSF +PN  DFDGF K+AIQMVKPAKGTTTLA
Sbjct  1    MKLDTTGLESFPTLLAPQNDVVGELSAAPSFDLPNSNDFDGFVKEAIQMVKPAKGTTTLA  60

Query  255  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  434
            FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRL
Sbjct  61   FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRL  120

Query  435  HELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNR  614
            HELANKRRISV GASKLLANILYSYRGMGLSVGTMIAGWDE GPGLYYVDSEGGRLKG R
Sbjct  121  HELANKRRISVTGASKLLANILYSYRGMGLSVGTMIAGWDETGPGLYYVDSEGGRLKGTR  180

Query  615  FSVGSGSPYAYGVLDNGYRFDLSVEEAAELARRSIYHATFRDGASGGVASVYHVGPNGWK  794
            FSVGSGSPYAYGVLD+GYR+DLSVEEAAELARR+IYHATFRDGASGGVASVY+VGPNGWK
Sbjct  181  FSVGSGSPYAYGVLDSGYRYDLSVEEAAELARRAIYHATFRDGASGGVASVYYVGPNGWK  240

Query  795  KLSGDDVGELHYHYYPVEAAAVEHEMTE  878
            KLSGDDVGELHYHYYPV  + VE EM E
Sbjct  241  KLSGDDVGELHYHYYPVTPSTVEQEMVE  268



>ref|NP_189265.1| proteasome subunit beta type-5-B [Arabidopsis thaliana]
 sp|Q9LIP2.1|PSB5B_ARATH RecName: Full=Proteasome subunit beta type-5-B; AltName: Full=20S 
proteasome beta subunit E-2; AltName: Full=Proteasome epsilon-2 
chain; Flags: Precursor [Arabidopsis thaliana]
 gb|AAL27514.1|AF439846_1 AT3g26340/F20C19_6 [Arabidopsis thaliana]
 dbj|BAB02194.1| proteasome epsilon chain precursor [Arabidopsis thaliana]
 gb|AAM62897.1| 26S proteasome beta subunit, putative [Arabidopsis thaliana]
 gb|AAM78079.1| AT3g26340/F20C19_6 [Arabidopsis thaliana]
 gb|AEE77147.1| proteasome subunit beta type-5-B [Arabidopsis thaliana]
Length=273

 Score =   472 bits (1215),  Expect = 6e-164, Method: Compositional matrix adjust.
 Identities = 225/270 (83%), Positives = 244/270 (90%), Gaps = 2/270 (1%)
 Frame = +3

Query  75   VRIDFSGLESTAPI--RGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTT  248
            +++D SGLE+T P+   G +SE+ D     PSF +P  TDFDGFQK A++MVKPAKGTTT
Sbjct  1    MKLDTSGLETTMPVIGFGSNSEMLDGFSSAPSFDLPRTTDFDGFQKKAVEMVKPAKGTTT  60

Query  249  LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKC  428
            LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KC
Sbjct  61   LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKC  120

Query  429  RLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKG  608
            RLHELANKRRISV+GASKLLAN+LYSYRGMGLSVGTMIAGWDE GPGLYYVD+EGGRLKG
Sbjct  121  RLHELANKRRISVSGASKLLANMLYSYRGMGLSVGTMIAGWDETGPGLYYVDNEGGRLKG  180

Query  609  NRFSVGSGSPYAYGVLDNGYRFDLSVEEAAELARRSIYHATFRDGASGGVASVYHVGPNG  788
            +RFSVGSGSPYAYGVLD+GY+FD+SVEEA+ELARRSIYHATFRDGASGGVASVYHVGP G
Sbjct  181  DRFSVGSGSPYAYGVLDSGYKFDMSVEEASELARRSIYHATFRDGASGGVASVYHVGPQG  240

Query  789  WKKLSGDDVGELHYHYYPVEAAAVEHEMTE  878
            W KLSGDDVGELHYHYYPV     EH M E
Sbjct  241  WTKLSGDDVGELHYHYYPVAPITAEHVMEE  270



>emb|CDY19402.1| BnaC05g09110D [Brassica napus]
Length=274

 Score =   472 bits (1215),  Expect = 7e-164, Method: Compositional matrix adjust.
 Identities = 225/270 (83%), Positives = 246/270 (91%), Gaps = 2/270 (1%)
 Frame = +3

Query  75   VRIDFSGLESTAPI--RGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTT  248
            +++D SG E++ P    G S+++ D    VPSF +P  TDFDGFQK+A+QMVKPA+GTTT
Sbjct  1    MKLDTSGFETSMPTIGFGSSNDMLDGFSTVPSFDLPRTTDFDGFQKEAVQMVKPARGTTT  60

Query  249  LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKC  428
            LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KC
Sbjct  61   LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKC  120

Query  429  RLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKG  608
            RLHELANKRRISV+GASKLLAN+LYSYRGMGLSVGTMIAGWDE GPGLYYVD+EGGRLKG
Sbjct  121  RLHELANKRRISVSGASKLLANMLYSYRGMGLSVGTMIAGWDETGPGLYYVDNEGGRLKG  180

Query  609  NRFSVGSGSPYAYGVLDNGYRFDLSVEEAAELARRSIYHATFRDGASGGVASVYHVGPNG  788
            +RFSVGSGSPYAYGVLD+GY+FD+SVEEA+ELARRSIYHATFRDGASGGVASVYHVGPNG
Sbjct  181  DRFSVGSGSPYAYGVLDSGYKFDMSVEEASELARRSIYHATFRDGASGGVASVYHVGPNG  240

Query  789  WKKLSGDDVGELHYHYYPVEAAAVEHEMTE  878
            WKKLSGDDVGELHYHYYPV  A  E  M E
Sbjct  241  WKKLSGDDVGELHYHYYPVPPAIAEQVMEE  270



>gb|KHN31904.1| Proteasome subunit beta type-5 [Glycine soja]
Length=272

 Score =   472 bits (1214),  Expect = 8e-164, Method: Compositional matrix adjust.
 Identities = 226/268 (84%), Positives = 242/268 (90%), Gaps = 0/268 (0%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLA  254
            +++D + LES   +    +++  E+   PSF +PN  DFDGF KDAIQMVKPAKGTTTLA
Sbjct  1    MKLDTTSLESFPTLIAPQNDVAGELSAAPSFDLPNSNDFDGFLKDAIQMVKPAKGTTTLA  60

Query  255  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  434
            FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRL
Sbjct  61   FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRL  120

Query  435  HELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNR  614
            HELANKRRISV GASKLLANILYSYRGMGLSVGTMIAGWDE GPGLYYVDSEGGRLKG R
Sbjct  121  HELANKRRISVTGASKLLANILYSYRGMGLSVGTMIAGWDETGPGLYYVDSEGGRLKGTR  180

Query  615  FSVGSGSPYAYGVLDNGYRFDLSVEEAAELARRSIYHATFRDGASGGVASVYHVGPNGWK  794
            FSVGSGSPYAYGVLD+GYR+DLSVEEAAELARR+IYHATFRDGASGGVASVY+VGPNGWK
Sbjct  181  FSVGSGSPYAYGVLDSGYRYDLSVEEAAELARRAIYHATFRDGASGGVASVYYVGPNGWK  240

Query  795  KLSGDDVGELHYHYYPVEAAAVEHEMTE  878
            KLSGDDVGELHYHYYPV  + VE EM E
Sbjct  241  KLSGDDVGELHYHYYPVTPSTVEQEMVE  268



>emb|CDY16054.1| BnaC08g40690D [Brassica napus]
Length=274

 Score =   471 bits (1213),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 225/270 (83%), Positives = 245/270 (91%), Gaps = 2/270 (1%)
 Frame = +3

Query  75   VRIDFSGLESTAPI--RGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTT  248
            +++D SG E++ P    G S+++ D    VPSF +P  TDFDGFQK+A+QMVKPAKGTTT
Sbjct  1    MKLDTSGFETSMPTIGFGSSNDMLDGFSTVPSFDLPRTTDFDGFQKEAVQMVKPAKGTTT  60

Query  249  LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKC  428
            LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KC
Sbjct  61   LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKC  120

Query  429  RLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKG  608
            RLHELANKRRISV+GASKLLAN+LYSYRGMGLSVGTMIAGWDE GPGLYYVD+EGGRLKG
Sbjct  121  RLHELANKRRISVSGASKLLANMLYSYRGMGLSVGTMIAGWDETGPGLYYVDNEGGRLKG  180

Query  609  NRFSVGSGSPYAYGVLDNGYRFDLSVEEAAELARRSIYHATFRDGASGGVASVYHVGPNG  788
            +RFSVGSGSPYAYGVLD+GY+FD+SVEEA+ELARRSIYHATFRDGASGGVASVYHVGPNG
Sbjct  181  DRFSVGSGSPYAYGVLDSGYKFDMSVEEASELARRSIYHATFRDGASGGVASVYHVGPNG  240

Query  789  WKKLSGDDVGELHYHYYPVEAAAVEHEMTE  878
            W KLSGDDVGELHYHYYPV  A  E  M E
Sbjct  241  WTKLSGDDVGELHYHYYPVPPAIAEQVMEE  270



>ref|XP_006417162.1| hypothetical protein EUTSA_v10008454mg [Eutrema salsugineum]
 gb|ESQ35515.1| hypothetical protein EUTSA_v10008454mg [Eutrema salsugineum]
Length=274

 Score =   471 bits (1213),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 224/270 (83%), Positives = 246/270 (91%), Gaps = 2/270 (1%)
 Frame = +3

Query  75   VRIDFSGLESTAPI--RGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTT  248
            +++D SG E++ P+   G S+++ D    VPSF +P  TDFDGFQK+A+QMVKPAKGTTT
Sbjct  1    MKLDTSGFETSMPLIGFGSSNDMLDGFSSVPSFDLPRTTDFDGFQKEAVQMVKPAKGTTT  60

Query  249  LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKC  428
            LAFIFK GVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KC
Sbjct  61   LAFIFKGGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKC  120

Query  429  RLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKG  608
            RLHELANKRRISV+GASKLLAN+LYSYRGMGLSVGTMIAGWDE GPGLYYVD+EGGRLKG
Sbjct  121  RLHELANKRRISVSGASKLLANMLYSYRGMGLSVGTMIAGWDETGPGLYYVDNEGGRLKG  180

Query  609  NRFSVGSGSPYAYGVLDNGYRFDLSVEEAAELARRSIYHATFRDGASGGVASVYHVGPNG  788
            +RFSVGSGSPYAYGVLD+GY++D+SVEEA+ELARRSIYHATFRDGASGGVASVYHVGPNG
Sbjct  181  DRFSVGSGSPYAYGVLDSGYKYDMSVEEASELARRSIYHATFRDGASGGVASVYHVGPNG  240

Query  789  WKKLSGDDVGELHYHYYPVEAAAVEHEMTE  878
            WKKLSGDDVGELHYHYYPV  A  E  M E
Sbjct  241  WKKLSGDDVGELHYHYYPVAPATAEQVMEE  270



>gb|ACU23791.1| unknown [Glycine max]
Length=272

 Score =   471 bits (1212),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 225/268 (84%), Positives = 243/268 (91%), Gaps = 0/268 (0%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLA  254
            +++D +GLES   +    +++  E+   PSF +PN  DFDGF K+AIQMVKPAKGTTTLA
Sbjct  1    MKLDTTGLESFPTLLAPQNDVVGELSAAPSFDLPNSNDFDGFVKEAIQMVKPAKGTTTLA  60

Query  255  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  434
            FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGT+AGGAADCQFWHRNLG+KCRL
Sbjct  61   FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTVAGGAADCQFWHRNLGIKCRL  120

Query  435  HELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNR  614
            HELANKRRISV GASKLLANILYSYRGMGLSVGTMIAGWDE GPGLYYVDSEGGRLKG R
Sbjct  121  HELANKRRISVTGASKLLANILYSYRGMGLSVGTMIAGWDETGPGLYYVDSEGGRLKGTR  180

Query  615  FSVGSGSPYAYGVLDNGYRFDLSVEEAAELARRSIYHATFRDGASGGVASVYHVGPNGWK  794
            FSVGSGSPYAYGVLD+GYR+DLSVEEAAELARR+IYHATFRDGASGGVASVY+VGPNGWK
Sbjct  181  FSVGSGSPYAYGVLDSGYRYDLSVEEAAELARRAIYHATFRDGASGGVASVYYVGPNGWK  240

Query  795  KLSGDDVGELHYHYYPVEAAAVEHEMTE  878
            KLSGDDVGELHYHYYPV  + VE EM E
Sbjct  241  KLSGDDVGELHYHYYPVTPSTVEQEMVE  268



>ref|XP_010538272.1| PREDICTED: proteasome subunit beta type-5-B-like [Tarenaya hassleriana]
Length=271

 Score =   471 bits (1212),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 224/270 (83%), Positives = 248/270 (92%), Gaps = 2/270 (1%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGES--SELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTT  248
            +++D SGLES  P+ G +  SE+ D +  VPSF +P   DFDGFQK+A+QMVKPAKGTTT
Sbjct  1    MKLDTSGLESNVPMFGRNCESEMLDGLSDVPSFDLPLANDFDGFQKEAVQMVKPAKGTTT  60

Query  249  LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKC  428
            LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KC
Sbjct  61   LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKC  120

Query  429  RLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKG  608
            RLHELANKRRISV+GASKLLAN+LYSYRGMGLSVGTMIAGWDE GPGLYYVD+EGGR+KG
Sbjct  121  RLHELANKRRISVSGASKLLANMLYSYRGMGLSVGTMIAGWDETGPGLYYVDNEGGRIKG  180

Query  609  NRFSVGSGSPYAYGVLDNGYRFDLSVEEAAELARRSIYHATFRDGASGGVASVYHVGPNG  788
            +RFSVGSGSPYAYGVLD+GY++D++VEEAAELARRSIYHATFRDGASGGVASVYHVGPNG
Sbjct  181  DRFSVGSGSPYAYGVLDSGYKYDMTVEEAAELARRSIYHATFRDGASGGVASVYHVGPNG  240

Query  789  WKKLSGDDVGELHYHYYPVEAAAVEHEMTE  878
            WKKLSGDDVGELHY YYPV  ++ E  M+E
Sbjct  241  WKKLSGDDVGELHYKYYPVTPSSAEQVMSE  270



>ref|XP_009148547.1| PREDICTED: proteasome subunit beta type-5-B-like [Brassica rapa]
Length=274

 Score =   471 bits (1211),  Expect = 3e-163, Method: Compositional matrix adjust.
 Identities = 224/270 (83%), Positives = 245/270 (91%), Gaps = 2/270 (1%)
 Frame = +3

Query  75   VRIDFSGLESTAPI--RGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTT  248
            +++D SG E++ P    G S+++ D    VPSF +P  TDFDGFQK+A+QMVKPAKGTTT
Sbjct  1    MKLDTSGFETSMPTIGFGSSNDMLDGFSTVPSFDLPRTTDFDGFQKEAVQMVKPAKGTTT  60

Query  249  LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKC  428
            LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KC
Sbjct  61   LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKC  120

Query  429  RLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKG  608
            RLHELANKRRISV+GASKLLAN+LYSYRGMGLSVGTMIAGWDE GPGLYYVD+EGGRLKG
Sbjct  121  RLHELANKRRISVSGASKLLANMLYSYRGMGLSVGTMIAGWDETGPGLYYVDNEGGRLKG  180

Query  609  NRFSVGSGSPYAYGVLDNGYRFDLSVEEAAELARRSIYHATFRDGASGGVASVYHVGPNG  788
            +R SVGSGSPYAYGVLD+GY+FD++VEEA+ELARRSIYHATFRDGASGGVASVYHVGPNG
Sbjct  181  DRLSVGSGSPYAYGVLDSGYKFDMTVEEASELARRSIYHATFRDGASGGVASVYHVGPNG  240

Query  789  WKKLSGDDVGELHYHYYPVEAAAVEHEMTE  878
            WKKLSGDDVGELHYHYYPV  A  E  M E
Sbjct  241  WKKLSGDDVGELHYHYYPVPPAIAEQVMEE  270



>ref|XP_010502548.1| PREDICTED: proteasome subunit beta type-5-B-like [Camelina sativa]
Length=272

 Score =   470 bits (1210),  Expect = 4e-163, Method: Compositional matrix adjust.
 Identities = 221/270 (82%), Positives = 246/270 (91%), Gaps = 2/270 (1%)
 Frame = +3

Query  75   VRIDFSGLESTAPI--RGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTT  248
            +++D SG E++ P+   G +SE+ D +  VPSF +P  TDFDGFQK +++MVKPAKGTTT
Sbjct  1    MKLDTSGFETSMPVIGFGSNSEMLDGVSSVPSFDLPRTTDFDGFQKKSVEMVKPAKGTTT  60

Query  249  LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKC  428
            LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLG+MAGG+ADCQFWHRNLG+KC
Sbjct  61   LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGSMAGGSADCQFWHRNLGIKC  120

Query  429  RLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKG  608
            RLHELANKRRISV+GASKLLAN+LYSYRGMGLSVGTMIAGWDE GPGLYYVD+EGGRLKG
Sbjct  121  RLHELANKRRISVSGASKLLANMLYSYRGMGLSVGTMIAGWDETGPGLYYVDNEGGRLKG  180

Query  609  NRFSVGSGSPYAYGVLDNGYRFDLSVEEAAELARRSIYHATFRDGASGGVASVYHVGPNG  788
            +RFSVGSGSPYAYGVLD+GY+FD+S+EEA+ELARRSIYHATFRDGASGGVASVYHVGP G
Sbjct  181  DRFSVGSGSPYAYGVLDSGYKFDMSIEEASELARRSIYHATFRDGASGGVASVYHVGPQG  240

Query  789  WKKLSGDDVGELHYHYYPVEAAAVEHEMTE  878
            W KLSGDDVGELHYHYYPV  A  EH M E
Sbjct  241  WTKLSGDDVGELHYHYYPVAPATAEHVMEE  270



>ref|XP_002876966.1| hypothetical protein ARALYDRAFT_484397 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH53225.1| hypothetical protein ARALYDRAFT_484397 [Arabidopsis lyrata subsp. 
lyrata]
Length=274

 Score =   470 bits (1210),  Expect = 4e-163, Method: Compositional matrix adjust.
 Identities = 226/271 (83%), Positives = 245/271 (90%), Gaps = 3/271 (1%)
 Frame = +3

Query  75   VRIDFSGLESTAPI--RGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTT  248
            +++D SGLE+T P+   G +SE+ D    VPSF +P  TDFDGFQK A++MVKPAKGTTT
Sbjct  1    MKLDTSGLETTMPVIGFGSNSEMLDGFSSVPSFDLPRTTDFDGFQKKAVEMVKPAKGTTT  60

Query  249  LAFIFKEGVMVAADSRASMGGYIS-SQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVK  425
            LAFIFKEGVMVAADSRASMGGYI  SQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+K
Sbjct  61   LAFIFKEGVMVAADSRASMGGYICMSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIK  120

Query  426  CRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLK  605
            CRLHELANKRRISV+GASKLLAN+LYSYRGMGLSVGTMIAGWDE GPGLYYVD+EGGRLK
Sbjct  121  CRLHELANKRRISVSGASKLLANMLYSYRGMGLSVGTMIAGWDETGPGLYYVDNEGGRLK  180

Query  606  GNRFSVGSGSPYAYGVLDNGYRFDLSVEEAAELARRSIYHATFRDGASGGVASVYHVGPN  785
            G+RFSVGSGSPYAYGVLD+GY+FD+SVEEA+ELARRSIYHATFRDGASGGVASVYHVGP 
Sbjct  181  GDRFSVGSGSPYAYGVLDSGYKFDMSVEEASELARRSIYHATFRDGASGGVASVYHVGPQ  240

Query  786  GWKKLSGDDVGELHYHYYPVEAAAVEHEMTE  878
            GWKKLSGDDVGELHYHYYPV     EH M E
Sbjct  241  GWKKLSGDDVGELHYHYYPVTPVTAEHVMEE  271



>ref|XP_003523139.1| PREDICTED: proteasome subunit beta type-5-like isoform X1 [Glycine 
max]
 ref|XP_006578699.1| PREDICTED: proteasome subunit beta type-5-like isoform X2 [Glycine 
max]
 ref|XP_006578700.1| PREDICTED: proteasome subunit beta type-5-like isoform X3 [Glycine 
max]
Length=272

 Score =   469 bits (1207),  Expect = 9e-163, Method: Compositional matrix adjust.
 Identities = 225/268 (84%), Positives = 241/268 (90%), Gaps = 0/268 (0%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLA  254
            +++D + LES   +    +++  E+   P F +PN  DFDGF KDAIQMVKPAKGTTTLA
Sbjct  1    MKLDTTSLESFPTLIAPQNDVAGELSAAPFFDLPNSNDFDGFLKDAIQMVKPAKGTTTLA  60

Query  255  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  434
            FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRL
Sbjct  61   FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRL  120

Query  435  HELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNR  614
            HELANKRRISV GASKLLANILYSYRGMGLSVGTMIAGWDE GPGLYYVDSEGGRLKG R
Sbjct  121  HELANKRRISVTGASKLLANILYSYRGMGLSVGTMIAGWDETGPGLYYVDSEGGRLKGTR  180

Query  615  FSVGSGSPYAYGVLDNGYRFDLSVEEAAELARRSIYHATFRDGASGGVASVYHVGPNGWK  794
            FSVGSGSPYAYGVLD+GYR+DLSVEEAAELARR+IYHATFRDGASGGVASVY+VGPNGWK
Sbjct  181  FSVGSGSPYAYGVLDSGYRYDLSVEEAAELARRAIYHATFRDGASGGVASVYYVGPNGWK  240

Query  795  KLSGDDVGELHYHYYPVEAAAVEHEMTE  878
            KLSGDDVGELHYHYYPV  + VE EM E
Sbjct  241  KLSGDDVGELHYHYYPVTPSTVEQEMVE  268



>emb|CDY26610.1| BnaA09g46670D [Brassica napus]
Length=274

 Score =   469 bits (1207),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 224/270 (83%), Positives = 244/270 (90%), Gaps = 2/270 (1%)
 Frame = +3

Query  75   VRIDFSGLESTAPI--RGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTT  248
            +++D SG E++ P    G S+++ D    VPSF +P  TDFDGFQK+A+QMVKPAKGTTT
Sbjct  1    MKLDTSGFETSMPTIGFGSSNDMLDGFSTVPSFDLPRTTDFDGFQKEAVQMVKPAKGTTT  60

Query  249  LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKC  428
            LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KC
Sbjct  61   LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKC  120

Query  429  RLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKG  608
            RLHELANKRRISV+GASKLLAN+LYSYRGMGLSVGTMIAGWDE GPGLYYVD+EGGRLKG
Sbjct  121  RLHELANKRRISVSGASKLLANMLYSYRGMGLSVGTMIAGWDETGPGLYYVDNEGGRLKG  180

Query  609  NRFSVGSGSPYAYGVLDNGYRFDLSVEEAAELARRSIYHATFRDGASGGVASVYHVGPNG  788
            +RFSVGSGSPYAYGVLD+GY+FD+SVEEA+ELARRSIYHATFRDGASGGVASVYHVG NG
Sbjct  181  DRFSVGSGSPYAYGVLDSGYKFDMSVEEASELARRSIYHATFRDGASGGVASVYHVGSNG  240

Query  789  WKKLSGDDVGELHYHYYPVEAAAVEHEMTE  878
            W KLSGDDVGELHYHYYPV  A  E  M E
Sbjct  241  WTKLSGDDVGELHYHYYPVPPAIAEQVMEE  270



>gb|ACP43315.1| 20S proteasome beta subunit 5 [Citrus maxima]
 gb|KDO81952.1| hypothetical protein CISIN_1g022125mg [Citrus sinensis]
Length=272

 Score =   469 bits (1206),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 225/269 (84%), Positives = 240/269 (89%), Gaps = 0/269 (0%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLA  254
            +++D SGLEST+P  G   EL  E+   PSF +P  TDFD FQKD    +K AKGTTTLA
Sbjct  1    MKLDTSGLESTSPFFGSGDELCPELSAAPSFSLPLSTDFDEFQKDTKATLKHAKGTTTLA  60

Query  255  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  434
            FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRL
Sbjct  61   FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRL  120

Query  435  HELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNR  614
            HELANKRRISV GASKLLANILYSYRGMGLSVGTMIAGWDE GPGLYYVDSEGGRLKG R
Sbjct  121  HELANKRRISVTGASKLLANILYSYRGMGLSVGTMIAGWDETGPGLYYVDSEGGRLKGTR  180

Query  615  FSVGSGSPYAYGVLDNGYRFDLSVEEAAELARRSIYHATFRDGASGGVASVYHVGPNGWK  794
            FSVGSGSPYAYGVLD+GY+FD+S+EEAAELARR+IYHATFRD ASGGVASVY+VGPNGWK
Sbjct  181  FSVGSGSPYAYGVLDSGYKFDMSIEEAAELARRAIYHATFRDAASGGVASVYYVGPNGWK  240

Query  795  KLSGDDVGELHYHYYPVEAAAVEHEMTEV  881
            KLSGDDVGELHYHYYPV  + VE EM EV
Sbjct  241  KLSGDDVGELHYHYYPVTPSTVEQEMAEV  269



>gb|ERN03775.1| hypothetical protein AMTR_s00078p00083100 [Amborella trichopoda]
Length=276

 Score =   469 bits (1206),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 225/268 (84%), Positives = 240/268 (90%), Gaps = 0/268 (0%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLA  254
            +R+D SGL S AP    + EL +    +PSFQ+PN  DFD FQK A+QMVKPAKGTTTLA
Sbjct  6    MRLDTSGLNSLAPAHVVNDELCEGFMSLPSFQLPNSADFDTFQKKAVQMVKPAKGTTTLA  65

Query  255  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  434
            FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPY++GT+AGGAADCQFWHRNLG+KCRL
Sbjct  66   FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYLIGTLAGGAADCQFWHRNLGIKCRL  125

Query  435  HELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNR  614
            HELANKRRISV GASKLLANILYSYRGMGLSVGTMIAGWDE GPGLYYVDSEGGRLKG R
Sbjct  126  HELANKRRISVTGASKLLANILYSYRGMGLSVGTMIAGWDETGPGLYYVDSEGGRLKGTR  185

Query  615  FSVGSGSPYAYGVLDNGYRFDLSVEEAAELARRSIYHATFRDGASGGVASVYHVGPNGWK  794
            FSVGSGSPYAYGVLD+GYR+D+S EEAAELARRSIYHATFRDGASGGVASVY+VGPNGWK
Sbjct  186  FSVGSGSPYAYGVLDSGYRYDMSCEEAAELARRSIYHATFRDGASGGVASVYYVGPNGWK  245

Query  795  KLSGDDVGELHYHYYPVEAAAVEHEMTE  878
            KLSGDDVGELHY YYPV    VE EM E
Sbjct  246  KLSGDDVGELHYKYYPVPKGNVEQEMVE  273



>ref|XP_008810773.1| PREDICTED: proteasome subunit beta type-5-like [Phoenix dactylifera]
Length=272

 Score =   469 bits (1206),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 223/269 (83%), Positives = 242/269 (90%), Gaps = 0/269 (0%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLA  254
            +++D SGLES  P+     +L  ++   P+F +P   DFDGFQKDAIQMVKPAKGTTTLA
Sbjct  1    MKLDTSGLESFVPLSAPIDDLCPDLSAPPTFDLPRSADFDGFQKDAIQMVKPAKGTTTLA  60

Query  255  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  434
            FIFKEGVMVAADSRASMGGYISSQ+VKKIIEINPYM+GTMAGGAADCQFWHRNLG+KCRL
Sbjct  61   FIFKEGVMVAADSRASMGGYISSQTVKKIIEINPYMIGTMAGGAADCQFWHRNLGIKCRL  120

Query  435  HELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNR  614
            HELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDE GPGLYYVDSEGGRLKG R
Sbjct  121  HELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDETGPGLYYVDSEGGRLKGTR  180

Query  615  FSVGSGSPYAYGVLDNGYRFDLSVEEAAELARRSIYHATFRDGASGGVASVYHVGPNGWK  794
            FSVGSGSPYAYGVLDNGYR+D+SVEEAAELARR+IYHATFRD ASGGVASVY+VGP+GWK
Sbjct  181  FSVGSGSPYAYGVLDNGYRYDMSVEEAAELARRAIYHATFRDAASGGVASVYYVGPSGWK  240

Query  795  KLSGDDVGELHYHYYPVEAAAVEHEMTEV  881
            KLSGDDVGELH+ YYPV  +  E EM EV
Sbjct  241  KLSGDDVGELHFRYYPVAPSPTEQEMAEV  269



>ref|XP_006484070.1| PREDICTED: proteasome subunit beta type-5-B-like isoform X2 [Citrus 
sinensis]
Length=272

 Score =   468 bits (1205),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 225/269 (84%), Positives = 240/269 (89%), Gaps = 0/269 (0%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLA  254
            +++D SGLEST+P  G   EL  E+   PSF +P  TDFD FQKD    +K AKGTTTLA
Sbjct  1    MKLDTSGLESTSPFFGSGDELCPELSAAPSFALPLSTDFDEFQKDTKATLKHAKGTTTLA  60

Query  255  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  434
            FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRL
Sbjct  61   FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRL  120

Query  435  HELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNR  614
            HELANKRRISV GASKLLANILYSYRGMGLSVGTMIAGWDE GPGLYYVDSEGGRLKG R
Sbjct  121  HELANKRRISVTGASKLLANILYSYRGMGLSVGTMIAGWDETGPGLYYVDSEGGRLKGTR  180

Query  615  FSVGSGSPYAYGVLDNGYRFDLSVEEAAELARRSIYHATFRDGASGGVASVYHVGPNGWK  794
            FSVGSGSPYAYGVLD+GY+FD+S+EEAAELARR+IYHATFRD ASGGVASVY+VGPNGWK
Sbjct  181  FSVGSGSPYAYGVLDSGYKFDMSIEEAAELARRAIYHATFRDAASGGVASVYYVGPNGWK  240

Query  795  KLSGDDVGELHYHYYPVEAAAVEHEMTEV  881
            KLSGDDVGELHYHYYPV  + VE EM EV
Sbjct  241  KLSGDDVGELHYHYYPVTPSTVEQEMAEV  269



>ref|XP_011622487.1| PREDICTED: proteasome subunit beta type-5 [Amborella trichopoda]
Length=271

 Score =   468 bits (1205),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 225/268 (84%), Positives = 240/268 (90%), Gaps = 0/268 (0%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLA  254
            +R+D SGL S AP    + EL +    +PSFQ+PN  DFD FQK A+QMVKPAKGTTTLA
Sbjct  1    MRLDTSGLNSLAPAHVVNDELCEGFMSLPSFQLPNSADFDTFQKKAVQMVKPAKGTTTLA  60

Query  255  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  434
            FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPY++GT+AGGAADCQFWHRNLG+KCRL
Sbjct  61   FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYLIGTLAGGAADCQFWHRNLGIKCRL  120

Query  435  HELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNR  614
            HELANKRRISV GASKLLANILYSYRGMGLSVGTMIAGWDE GPGLYYVDSEGGRLKG R
Sbjct  121  HELANKRRISVTGASKLLANILYSYRGMGLSVGTMIAGWDETGPGLYYVDSEGGRLKGTR  180

Query  615  FSVGSGSPYAYGVLDNGYRFDLSVEEAAELARRSIYHATFRDGASGGVASVYHVGPNGWK  794
            FSVGSGSPYAYGVLD+GYR+D+S EEAAELARRSIYHATFRDGASGGVASVY+VGPNGWK
Sbjct  181  FSVGSGSPYAYGVLDSGYRYDMSCEEAAELARRSIYHATFRDGASGGVASVYYVGPNGWK  240

Query  795  KLSGDDVGELHYHYYPVEAAAVEHEMTE  878
            KLSGDDVGELHY YYPV    VE EM E
Sbjct  241  KLSGDDVGELHYKYYPVPKGNVEQEMVE  268



>ref|XP_010905449.1| PREDICTED: proteasome subunit beta type-5-like [Elaeis guineensis]
Length=272

 Score =   468 bits (1204),  Expect = 3e-162, Method: Compositional matrix adjust.
 Identities = 223/272 (82%), Positives = 246/272 (90%), Gaps = 0/272 (0%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLA  254
            +++D SG ES AP+ G   ++  ++     F +PN +DFDGFQK+AIQMVKPAKGTTTLA
Sbjct  1    MKLDTSGFESFAPLSGSIDDVCSDLSAHQFFDLPNCSDFDGFQKNAIQMVKPAKGTTTLA  60

Query  255  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  434
            F+FKEGV+VAADSRASMGGYISSQ+VKKIIEINPYM+GTMAGGAADCQFWHRNLG+KCRL
Sbjct  61   FVFKEGVIVAADSRASMGGYISSQTVKKIIEINPYMIGTMAGGAADCQFWHRNLGIKCRL  120

Query  435  HELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNR  614
            HELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDE GPGLYYVDSEGGRLKG R
Sbjct  121  HELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDETGPGLYYVDSEGGRLKGTR  180

Query  615  FSVGSGSPYAYGVLDNGYRFDLSVEEAAELARRSIYHATFRDGASGGVASVYHVGPNGWK  794
            FSVGSGSPYAYGVLDNGYR+D+S+EEAAELARR+IYHATFRDGASGGV SVY+VG +GWK
Sbjct  181  FSVGSGSPYAYGVLDNGYRYDMSIEEAAELARRAIYHATFRDGASGGVVSVYYVGRDGWK  240

Query  795  KLSGDDVGELHYHYYPVEAAAVEHEMTEVPIA  890
            KLSGDDVGELHY YYPV  + VEHEM EVP A
Sbjct  241  KLSGDDVGELHYTYYPVAPSPVEHEMAEVPPA  272



>ref|XP_006438069.1| hypothetical protein CICLE_v10032238mg [Citrus clementina]
 gb|ESR51309.1| hypothetical protein CICLE_v10032238mg [Citrus clementina]
Length=272

 Score =   468 bits (1203),  Expect = 4e-162, Method: Compositional matrix adjust.
 Identities = 225/269 (84%), Positives = 240/269 (89%), Gaps = 0/269 (0%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLA  254
            +++D SGLEST+P  G   EL  E+   PSF +P  TDFD FQKD    +K AKGTTTLA
Sbjct  1    MKLDTSGLESTSPFFGSGDELCPELLAAPSFALPLSTDFDEFQKDTKATLKHAKGTTTLA  60

Query  255  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  434
            FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRL
Sbjct  61   FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRL  120

Query  435  HELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNR  614
            HELANKRRISV GASKLLANILYSYRGMGLSVGTMIAGWDE GPGLYYVDSEGGRLKG R
Sbjct  121  HELANKRRISVTGASKLLANILYSYRGMGLSVGTMIAGWDETGPGLYYVDSEGGRLKGTR  180

Query  615  FSVGSGSPYAYGVLDNGYRFDLSVEEAAELARRSIYHATFRDGASGGVASVYHVGPNGWK  794
            FSVGSGSPYAYGVLD+GY+FD+S+EEAAELARR+IYHATFRD ASGGVASVY+VGPNGWK
Sbjct  181  FSVGSGSPYAYGVLDSGYKFDMSIEEAAELARRAIYHATFRDAASGGVASVYYVGPNGWK  240

Query  795  KLSGDDVGELHYHYYPVEAAAVEHEMTEV  881
            KLSGDDVGELHYHYYPV  + VE EM EV
Sbjct  241  KLSGDDVGELHYHYYPVTPSTVEQEMAEV  269



>ref|XP_008806245.1| PREDICTED: proteasome subunit beta type-5-like [Phoenix dactylifera]
Length=272

 Score =   468 bits (1203),  Expect = 5e-162, Method: Compositional matrix adjust.
 Identities = 224/270 (83%), Positives = 245/270 (91%), Gaps = 0/270 (0%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLA  254
            +++D SG ES AP  G   ++  ++     F +PN +DFDGFQK+AIQMVKPAKGTTTLA
Sbjct  1    MKLDTSGFESFAPRSGLIDDVCSDLSAQQFFDLPNCSDFDGFQKNAIQMVKPAKGTTTLA  60

Query  255  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  434
            FIFKEGV+VAADSRASMGGYISSQ+VKKIIEINPYM+GTMAGGAADCQFWHRNLG+KCRL
Sbjct  61   FIFKEGVIVAADSRASMGGYISSQTVKKIIEINPYMIGTMAGGAADCQFWHRNLGIKCRL  120

Query  435  HELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNR  614
            HELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDE GPGLYYVDSEGGRLKG R
Sbjct  121  HELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDETGPGLYYVDSEGGRLKGTR  180

Query  615  FSVGSGSPYAYGVLDNGYRFDLSVEEAAELARRSIYHATFRDGASGGVASVYHVGPNGWK  794
            FSVGSGSPYAYGVLDNGYR+D+S+EEAAELARR+IYHATFRDGASGGVASVY+VG +GWK
Sbjct  181  FSVGSGSPYAYGVLDNGYRYDMSIEEAAELARRAIYHATFRDGASGGVASVYYVGRDGWK  240

Query  795  KLSGDDVGELHYHYYPVEAAAVEHEMTEVP  884
            KLSGDDVGELHY YYPV  + VEHEM EVP
Sbjct  241  KLSGDDVGELHYTYYPVAPSPVEHEMAEVP  270



>ref|XP_011457464.1| PREDICTED: proteasome subunit beta type-5-like [Fragaria vesca 
subsp. vesca]
Length=277

 Score =   467 bits (1201),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 228/277 (82%), Positives = 243/277 (88%), Gaps = 4/277 (1%)
 Frame = +3

Query  72   MVRIDFSGLESTAPIRGESSELFDEIP----RVPSFQIPNITDFDGFQKDAIQMVKPAKG  239
            M ++DFS L++TAP+ G+SS      P      PSF++P   DFDGFQK+A  MVK  KG
Sbjct  1    MRQLDFSSLQTTAPLLGDSSGFSGGFPGDFSAAPSFEVPVTDDFDGFQKEARDMVKSKKG  60

Query  240  TTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG  419
            TTTLAFIFK+GVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG
Sbjct  61   TTTLAFIFKDGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG  120

Query  420  VKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGR  599
            +KCRLHELANKRRISV GASKLLANILYSYRGMGLSVGTMIAGWDE GPGLYYVDSEGGR
Sbjct  121  IKCRLHELANKRRISVTGASKLLANILYSYRGMGLSVGTMIAGWDETGPGLYYVDSEGGR  180

Query  600  LKGNRFSVGSGSPYAYGVLDNGYRFDLSVEEAAELARRSIYHATFRDGASGGVASVYHVG  779
            LKG RFSVGSGSPYAYGVLDNGYR+D+SVEEA+ELARR+IYHATFRDGASGGVASVYHVG
Sbjct  181  LKGMRFSVGSGSPYAYGVLDNGYRYDMSVEEASELARRAIYHATFRDGASGGVASVYHVG  240

Query  780  PNGWKKLSGDDVGELHYHYYPVEAAAVEHEMTEVPIA  890
            PNGWKKLSGDDVGELHY YYPV    VE EM EV  A
Sbjct  241  PNGWKKLSGDDVGELHYEYYPVTPETVEQEMVEVGAA  277



>ref|XP_004135309.1| PREDICTED: proteasome subunit beta type-5-like [Cucumis sativus]
Length=272

 Score =   466 bits (1199),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 227/272 (83%), Positives = 240/272 (88%), Gaps = 1/272 (0%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGE-SSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTL  251
            +++D SGLES   + G  S+EL D +   PSF IPN  +FDGFQK+AIQMVKPAKGTTTL
Sbjct  1    MKLDTSGLESATFLSGAGSTELLDGLSSAPSFGIPNARNFDGFQKEAIQMVKPAKGTTTL  60

Query  252  AFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCR  431
            AF FKEGVMVAADSRASMGGYISSQS KKIIEIN YMLGTMAGGAADCQFWHRNLG+KCR
Sbjct  61   AFTFKEGVMVAADSRASMGGYISSQSAKKIIEINSYMLGTMAGGAADCQFWHRNLGIKCR  120

Query  432  LHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGN  611
             HEL NKRRISV GASKLLANILYSYRGMGLSVGTMIAGWDE GPGLYYVDSEGGRLKG 
Sbjct  121  RHELENKRRISVTGASKLLANILYSYRGMGLSVGTMIAGWDETGPGLYYVDSEGGRLKGT  180

Query  612  RFSVGSGSPYAYGVLDNGYRFDLSVEEAAELARRSIYHATFRDGASGGVASVYHVGPNGW  791
            RFSVGSGSPYAY VLDNGY++DLSVEEAAELARR+IYHATFRDGASGGVASVYHVGPNGW
Sbjct  181  RFSVGSGSPYAYCVLDNGYQYDLSVEEAAELARRAIYHATFRDGASGGVASVYHVGPNGW  240

Query  792  KKLSGDDVGELHYHYYPVEAAAVEHEMTEVPI  887
            KKLSGDDVGELHY YYPV    VE EM EV +
Sbjct  241  KKLSGDDVGELHYKYYPVVHDTVEQEMIEVTV  272



>gb|AFK46055.1| unknown [Lotus japonicus]
Length=270

 Score =   466 bits (1198),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 222/268 (83%), Positives = 242/268 (90%), Gaps = 0/268 (0%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLA  254
            +++D +GLES   +    +++  E    PSF++PN  DFDGF K+AIQMVKPAKGTTTLA
Sbjct  1    MKLDTTGLESFPKLVAPGNDVVGEFTAPPSFELPNSNDFDGFVKEAIQMVKPAKGTTTLA  60

Query  255  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  434
            FIFK+GVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRL
Sbjct  61   FIFKDGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRL  120

Query  435  HELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNR  614
            HELANKRRISV GASK+LANILYSYRGMGLSVGTMIAGWDE GPGLYYVDSEGGRLKG R
Sbjct  121  HELANKRRISVTGASKMLANILYSYRGMGLSVGTMIAGWDETGPGLYYVDSEGGRLKGTR  180

Query  615  FSVGSGSPYAYGVLDNGYRFDLSVEEAAELARRSIYHATFRDGASGGVASVYHVGPNGWK  794
            FSVGSGSPYAYGVLD+GY++D+SVEEAAELARR+IYHATFRDGASGGVASVYHVGPNGWK
Sbjct  181  FSVGSGSPYAYGVLDSGYKYDMSVEEAAELARRAIYHATFRDGASGGVASVYHVGPNGWK  240

Query  795  KLSGDDVGELHYHYYPVEAAAVEHEMTE  878
            KLSGDDVGELHYHY PV  + VE EM E
Sbjct  241  KLSGDDVGELHYHYNPVVPSTVEQEMVE  268



>gb|KGN51684.1| hypothetical protein Csa_5G590010 [Cucumis sativus]
Length=288

 Score =   466 bits (1200),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 227/275 (83%), Positives = 241/275 (88%), Gaps = 1/275 (0%)
 Frame = +3

Query  66   VTMVRIDFSGLESTAPIRGE-SSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGT  242
            +  +++D SGLES   + G  S+EL D +   PSF IPN  +FDGFQK+AIQMVKPAKGT
Sbjct  14   ILSMKLDTSGLESATFLSGAGSTELLDGLSSAPSFGIPNARNFDGFQKEAIQMVKPAKGT  73

Query  243  TTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGV  422
            TTLAF FKEGVMVAADSRASMGGYISSQS KKIIEIN YMLGTMAGGAADCQFWHRNLG+
Sbjct  74   TTLAFTFKEGVMVAADSRASMGGYISSQSAKKIIEINSYMLGTMAGGAADCQFWHRNLGI  133

Query  423  KCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRL  602
            KCR HEL NKRRISV GASKLLANILYSYRGMGLSVGTMIAGWDE GPGLYYVDSEGGRL
Sbjct  134  KCRRHELENKRRISVTGASKLLANILYSYRGMGLSVGTMIAGWDETGPGLYYVDSEGGRL  193

Query  603  KGNRFSVGSGSPYAYGVLDNGYRFDLSVEEAAELARRSIYHATFRDGASGGVASVYHVGP  782
            KG RFSVGSGSPYAY VLDNGY++DLSVEEAAELARR+IYHATFRDGASGGVASVYHVGP
Sbjct  194  KGTRFSVGSGSPYAYCVLDNGYQYDLSVEEAAELARRAIYHATFRDGASGGVASVYHVGP  253

Query  783  NGWKKLSGDDVGELHYHYYPVEAAAVEHEMTEVPI  887
            NGWKKLSGDDVGELHY YYPV    VE EM EV +
Sbjct  254  NGWKKLSGDDVGELHYKYYPVVHDTVEQEMIEVTV  288



>ref|XP_010540655.1| PREDICTED: proteasome subunit beta type-5-B [Tarenaya hassleriana]
Length=271

 Score =   465 bits (1197),  Expect = 3e-161, Method: Compositional matrix adjust.
 Identities = 222/270 (82%), Positives = 244/270 (90%), Gaps = 2/270 (1%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRG--ESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTT  248
            +++D SG EST P+ G    +E+ D +  VPSF +P   DFDGFQK+A+QMVKPAKGTTT
Sbjct  1    MKLDTSGFESTLPMFGGNTETEMLDGLSSVPSFDLPFTKDFDGFQKEAVQMVKPAKGTTT  60

Query  249  LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKC  428
            LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KC
Sbjct  61   LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKC  120

Query  429  RLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKG  608
            RLHELANKRRISV GASKLLAN+LYSYRGMGLSVGTMIAGWDE GPGLYYVD+EGGR+KG
Sbjct  121  RLHELANKRRISVPGASKLLANMLYSYRGMGLSVGTMIAGWDETGPGLYYVDNEGGRIKG  180

Query  609  NRFSVGSGSPYAYGVLDNGYRFDLSVEEAAELARRSIYHATFRDGASGGVASVYHVGPNG  788
            +RFSVGSGSPYAYGVLD+GY++D++VEEAAELARRSIYHATFRDGASGGVASVY+VGPNG
Sbjct  181  DRFSVGSGSPYAYGVLDSGYKYDMTVEEAAELARRSIYHATFRDGASGGVASVYYVGPNG  240

Query  789  WKKLSGDDVGELHYHYYPVEAAAVEHEMTE  878
            WKKLSGDDVGELHY YYPV  +  E  M E
Sbjct  241  WKKLSGDDVGELHYKYYPVAPSTAEQVMAE  270



>ref|XP_009118034.1| PREDICTED: proteasome subunit beta type-5-B-like [Brassica rapa]
Length=274

 Score =   464 bits (1195),  Expect = 7e-161, Method: Compositional matrix adjust.
 Identities = 222/270 (82%), Positives = 242/270 (90%), Gaps = 2/270 (1%)
 Frame = +3

Query  75   VRIDFSGLESTAPI--RGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTT  248
            +++D SG E++ P    G S+++ D    VPSF +P  TDFDGFQK+A+QMVKPAKGTTT
Sbjct  1    MKLDTSGFETSMPTIGFGSSNDMLDGFSTVPSFDLPRTTDFDGFQKEAVQMVKPAKGTTT  60

Query  249  LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKC  428
            LAFIF EG MVAA SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KC
Sbjct  61   LAFIFIEGAMVAAASRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKC  120

Query  429  RLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKG  608
            RLHELANKRRISV+GASKLLAN+LYSYRGMGLSVGTMIAGWDE GPGLYYVD+EGGRLKG
Sbjct  121  RLHELANKRRISVSGASKLLANMLYSYRGMGLSVGTMIAGWDETGPGLYYVDNEGGRLKG  180

Query  609  NRFSVGSGSPYAYGVLDNGYRFDLSVEEAAELARRSIYHATFRDGASGGVASVYHVGPNG  788
            +RFSVGSGSPYAYGVLD+GY+FD+SVEEA+ELARRSIYHATFRDGASGGVASVYHVGPNG
Sbjct  181  DRFSVGSGSPYAYGVLDSGYKFDMSVEEASELARRSIYHATFRDGASGGVASVYHVGPNG  240

Query  789  WKKLSGDDVGELHYHYYPVEAAAVEHEMTE  878
            W KLSGDDVGELHYHYYPV  A  E  M E
Sbjct  241  WTKLSGDDVGELHYHYYPVPPAIAEQVMEE  270



>gb|ABK25888.1| unknown [Picea sitchensis]
Length=271

 Score =   462 bits (1188),  Expect = 8e-160, Method: Compositional matrix adjust.
 Identities = 222/269 (83%), Positives = 238/269 (88%), Gaps = 0/269 (0%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLA  254
            +++D SGLE     +  +  L D     PSF+IPN  DFDGFQK A+QMVKPAKGTTTLA
Sbjct  1    MKLDLSGLEPATLHQLSNDNLCDVFSPTPSFEIPNDADFDGFQKAAVQMVKPAKGTTTLA  60

Query  255  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  434
            FIFKEG+MVAADSRASMGGYISSQSVKKIIEINPY+LGTMAGGAADCQFWHRNLG+KCRL
Sbjct  61   FIFKEGIMVAADSRASMGGYISSQSVKKIIEINPYLLGTMAGGAADCQFWHRNLGIKCRL  120

Query  435  HELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNR  614
            HELANKRRISV GASKLLANILYSYRGMGLSVGTMIAGWDE GPGLYYVDSEGGRLKG R
Sbjct  121  HELANKRRISVTGASKLLANILYSYRGMGLSVGTMIAGWDETGPGLYYVDSEGGRLKGTR  180

Query  615  FSVGSGSPYAYGVLDNGYRFDLSVEEAAELARRSIYHATFRDGASGGVASVYHVGPNGWK  794
            FSVGSGSPYAYGVLD+GYR+D+ VEEAAELARRSIYHATFRDGASGGVASVY+VGP GWK
Sbjct  181  FSVGSGSPYAYGVLDSGYRWDMPVEEAAELARRSIYHATFRDGASGGVASVYYVGPQGWK  240

Query  795  KLSGDDVGELHYHYYPVEAAAVEHEMTEV  881
            KLSGDDV ELH++YYPV    VE EM EV
Sbjct  241  KLSGDDVAELHFNYYPVTENVVEQEMVEV  269



>ref|XP_010912107.1| PREDICTED: proteasome subunit beta type-5-like [Elaeis guineensis]
Length=272

 Score =   461 bits (1186),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 219/269 (81%), Positives = 240/269 (89%), Gaps = 0/269 (0%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLA  254
            +++D SGL+S  P+     +L  ++   P+F +P   DFDGFQKDAIQMVKPAKGTTTLA
Sbjct  1    MKLDTSGLQSFVPLSAPIDDLCPDLSAPPTFDLPRSADFDGFQKDAIQMVKPAKGTTTLA  60

Query  255  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  434
            FIFKEGV+VAADSRASMGGYISSQ+VKKIIEINPYM+GTMAGGAADCQFWHRNLG+KCRL
Sbjct  61   FIFKEGVIVAADSRASMGGYISSQTVKKIIEINPYMIGTMAGGAADCQFWHRNLGIKCRL  120

Query  435  HELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNR  614
            HELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDE G GLYYVDSEGGRLKG R
Sbjct  121  HELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDETGAGLYYVDSEGGRLKGTR  180

Query  615  FSVGSGSPYAYGVLDNGYRFDLSVEEAAELARRSIYHATFRDGASGGVASVYHVGPNGWK  794
            FSVGSGSPYAYGVLDNGYR+D+S+EEAAELARR+IYHATFRD ASGGVASVY+VGP+GWK
Sbjct  181  FSVGSGSPYAYGVLDNGYRYDMSIEEAAELARRAIYHATFRDAASGGVASVYYVGPSGWK  240

Query  795  KLSGDDVGELHYHYYPVEAAAVEHEMTEV  881
            KLSGDDVGELH+ YYPV     E EM EV
Sbjct  241  KLSGDDVGELHFRYYPVAPNPTEQEMAEV  269



>ref|XP_003602092.1| Proteasome subunit beta type [Medicago truncatula]
 gb|AES72343.1| proteasome-alpha-type-5 protein [Medicago truncatula]
Length=271

 Score =   461 bits (1186),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 222/266 (83%), Positives = 237/266 (89%), Gaps = 0/266 (0%)
 Frame = +3

Query  81   IDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLAFI  260
            +D + LES   +      +  EI   PSFQ+PN  DFDGF K+ IQMVKPAKGTTTLAFI
Sbjct  2    LDTTALESFPSLISHGINVAGEISAPPSFQLPNSNDFDGFVKETIQMVKPAKGTTTLAFI  61

Query  261  FKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHE  440
            FKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRLHE
Sbjct  62   FKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHE  121

Query  441  LANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFS  620
            LANKRRISV GASKLLANILYSYRGMGLSVGTMIAGWDE GPGLYYVDSEGGRLKGNRFS
Sbjct  122  LANKRRISVTGASKLLANILYSYRGMGLSVGTMIAGWDETGPGLYYVDSEGGRLKGNRFS  181

Query  621  VGSGSPYAYGVLDNGYRFDLSVEEAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKL  800
            VGSGSPYAYGVLD+GY++D+SVEEA+ELARR+IYHATFRDGASGGVASVY+VGP GWKKL
Sbjct  182  VGSGSPYAYGVLDSGYKYDMSVEEASELARRAIYHATFRDGASGGVASVYYVGPTGWKKL  241

Query  801  SGDDVGELHYHYYPVEAAAVEHEMTE  878
            SGDDVGELHYHY PV  + VE EM E
Sbjct  242  SGDDVGELHYHYNPVTPSTVEQEMVE  267



>gb|ABK25785.1| unknown [Picea sitchensis]
Length=271

 Score =   461 bits (1185),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 222/269 (83%), Positives = 238/269 (88%), Gaps = 0/269 (0%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLA  254
            +++D SGLE     +     L D     PSF+IPN TDFDGFQK A+QMVKPAKGTTTLA
Sbjct  1    MKLDLSGLEPATLHQRSDDNLCDVFSPSPSFKIPNDTDFDGFQKAALQMVKPAKGTTTLA  60

Query  255  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  434
            FIFKEG+MVAADSRASMGGYISSQSVKKIIEINP++LGTMAGGAADCQFWHRNLG+KCRL
Sbjct  61   FIFKEGIMVAADSRASMGGYISSQSVKKIIEINPHLLGTMAGGAADCQFWHRNLGIKCRL  120

Query  435  HELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNR  614
            HELANKRRISV GASKLLANILYSYRGMGLS+GTMIAGWDE GPGLYYVDSEGGRLKG R
Sbjct  121  HELANKRRISVTGASKLLANILYSYRGMGLSIGTMIAGWDETGPGLYYVDSEGGRLKGTR  180

Query  615  FSVGSGSPYAYGVLDNGYRFDLSVEEAAELARRSIYHATFRDGASGGVASVYHVGPNGWK  794
            FSVGSGSPYAYGVLD+GYR+D+ VEEAAELARRSIYHATFRDGASGGVASVY+VGP GWK
Sbjct  181  FSVGSGSPYAYGVLDSGYRWDMPVEEAAELARRSIYHATFRDGASGGVASVYYVGPQGWK  240

Query  795  KLSGDDVGELHYHYYPVEAAAVEHEMTEV  881
            KLSGDDVGELH+ YYPV    VE EM EV
Sbjct  241  KLSGDDVGELHFKYYPVTENVVEQEMVEV  269



>ref|XP_011029673.1| PREDICTED: proteasome subunit beta type-5-B-like [Populus euphratica]
Length=272

 Score =   460 bits (1184),  Expect = 3e-159, Method: Compositional matrix adjust.
 Identities = 220/258 (85%), Positives = 239/258 (93%), Gaps = 1/258 (0%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGES-SELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTL  251
            ++ D SGLESTA + G + SEL D     P+F++P  TDFDGFQK+A+QMVKPAKGTTTL
Sbjct  1    MKFDTSGLESTASVFGTAGSELVDGFSAAPAFELPTTTDFDGFQKEAVQMVKPAKGTTTL  60

Query  252  AFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCR  431
            AFIFK+GV+VAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCR
Sbjct  61   AFIFKDGVIVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCR  120

Query  432  LHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGN  611
            LHELANKRRISV GASKLLANILYSYRGMGLSVGTMIAGWDE GPGLYYVDSEGGRLKG 
Sbjct  121  LHELANKRRISVTGASKLLANILYSYRGMGLSVGTMIAGWDETGPGLYYVDSEGGRLKGT  180

Query  612  RFSVGSGSPYAYGVLDNGYRFDLSVEEAAELARRSIYHATFRDGASGGVASVYHVGPNGW  791
            RFSVGSGSPYAYGVLD+GYRFD+S+EEAAEL RR+IYHATFRDGASGGVASVY+VGP+GW
Sbjct  181  RFSVGSGSPYAYGVLDSGYRFDMSIEEAAELGRRAIYHATFRDGASGGVASVYYVGPDGW  240

Query  792  KKLSGDDVGELHYHYYPV  845
            KKLSGDDV ELHY+YYPV
Sbjct  241  KKLSGDDVSELHYNYYPV  258



>ref|XP_002312631.2| 20S proteasome beta subunit family protein [Populus trichocarpa]
 gb|EEE89998.2| 20S proteasome beta subunit family protein [Populus trichocarpa]
Length=272

 Score =   460 bits (1183),  Expect = 5e-159, Method: Compositional matrix adjust.
 Identities = 219/258 (85%), Positives = 239/258 (93%), Gaps = 1/258 (0%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGES-SELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTL  251
            ++ D SGLESTA + G + SEL D     P+F++P  TDFDGFQK+A+QMVKPAKGTTTL
Sbjct  1    MKFDTSGLESTASVFGTAGSELVDGFSAAPAFELPTTTDFDGFQKEAVQMVKPAKGTTTL  60

Query  252  AFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCR  431
            AFIFK+GV+VAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCR
Sbjct  61   AFIFKDGVIVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCR  120

Query  432  LHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGN  611
            LHELANKRRISV GASKLLANILYSYRGMGLSVGTMIAGWDE GPGLYYVDSEGGRLKG 
Sbjct  121  LHELANKRRISVTGASKLLANILYSYRGMGLSVGTMIAGWDETGPGLYYVDSEGGRLKGT  180

Query  612  RFSVGSGSPYAYGVLDNGYRFDLSVEEAAELARRSIYHATFRDGASGGVASVYHVGPNGW  791
            RFSVGSGSPYAYG+LD+GYRFD+S+EEAAEL RR+IYHATFRDGASGGVASVY+VGP+GW
Sbjct  181  RFSVGSGSPYAYGILDSGYRFDMSIEEAAELGRRAIYHATFRDGASGGVASVYYVGPDGW  240

Query  792  KKLSGDDVGELHYHYYPV  845
            KKLSGDDV ELHY+YYPV
Sbjct  241  KKLSGDDVSELHYNYYPV  258



>gb|AFK34329.1| unknown [Medicago truncatula]
Length=271

 Score =   458 bits (1179),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 221/266 (83%), Positives = 236/266 (89%), Gaps = 0/266 (0%)
 Frame = +3

Query  81   IDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLAFI  260
            +D + LES   +      +  EI   PSFQ+PN  DFDGF K+ IQMVKPAKGTTTLAFI
Sbjct  2    LDTTALESFPSLISHGINVAGEISAPPSFQLPNSNDFDGFVKETIQMVKPAKGTTTLAFI  61

Query  261  FKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHE  440
            FKEGVMVAADSRASMGGYISS SVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRLHE
Sbjct  62   FKEGVMVAADSRASMGGYISSHSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHE  121

Query  441  LANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFS  620
            LANKRRISV GASKLLANILYSYRGMGLSVGTMIAGWDE GPGLYYVDSEGGRLKGNRFS
Sbjct  122  LANKRRISVTGASKLLANILYSYRGMGLSVGTMIAGWDETGPGLYYVDSEGGRLKGNRFS  181

Query  621  VGSGSPYAYGVLDNGYRFDLSVEEAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKL  800
            VGSGSPYAYGVLD+GY++D+SVEEA+ELARR+IYHATFRDGASGGVASVY+VGP GWKKL
Sbjct  182  VGSGSPYAYGVLDSGYKYDMSVEEASELARRAIYHATFRDGASGGVASVYYVGPTGWKKL  241

Query  801  SGDDVGELHYHYYPVEAAAVEHEMTE  878
            SGDDVGELHYHY PV  + VE EM E
Sbjct  242  SGDDVGELHYHYNPVTPSTVEQEMVE  267



>ref|XP_006305519.1| hypothetical protein CARUB_v10009991mg [Capsella rubella]
 gb|EOA38417.1| hypothetical protein CARUB_v10009991mg [Capsella rubella]
Length=274

 Score =   458 bits (1179),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 219/270 (81%), Positives = 243/270 (90%), Gaps = 2/270 (1%)
 Frame = +3

Query  75   VRIDFSGLESTAPI--RGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTT  248
            +++D SG E++ P    G SS++ DE+  VPSF +P+  +FDGFQK+A  M+K AKGTTT
Sbjct  1    MKLDTSGFETSMPTIGFGSSSDMLDELSSVPSFDLPHTKEFDGFQKEASNMLKHAKGTTT  60

Query  249  LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKC  428
            LAFIFK GVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KC
Sbjct  61   LAFIFKGGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKC  120

Query  429  RLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKG  608
            RLHELANKRRISV+GASKLLAN+LYSYRGMGLSVGTMIAGWDE GPGLYYVD+EGGRLKG
Sbjct  121  RLHELANKRRISVSGASKLLANMLYSYRGMGLSVGTMIAGWDETGPGLYYVDNEGGRLKG  180

Query  609  NRFSVGSGSPYAYGVLDNGYRFDLSVEEAAELARRSIYHATFRDGASGGVASVYHVGPNG  788
            +RFSVGSGSPYAYGVLD+GY++D+SVEEA+ELARRSIYHATFRDGASGGVASVYHVGP+G
Sbjct  181  DRFSVGSGSPYAYGVLDSGYKYDMSVEEASELARRSIYHATFRDGASGGVASVYHVGPDG  240

Query  789  WKKLSGDDVGELHYHYYPVEAAAVEHEMTE  878
            W KLSGDDVGELHYHYYPV  A  E  M E
Sbjct  241  WTKLSGDDVGELHYHYYPVAPAIAEQVMEE  270



>ref|NP_172765.1| 20S proteasome beta subunit E1 [Arabidopsis thaliana]
 sp|O23717.1|PSB5A_ARATH RecName: Full=Proteasome subunit beta type-5-A; AltName: Full=20S 
proteasome beta subunit E-1; AltName: Full=Proteasome component 
E; AltName: Full=Proteasome epsilon-1 chain; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AAD31059.1|AC007357_8 Identical to gb|Y13695 multicatalytic endopeptidase complex, 
proteasome precursor, beta subunit (prce) from Arabidopsis thaliana. 
ESTs gb|Y09360, gb|F13852, gb|T20555, gb|T44620, gb|AI099779 
and gb|AA586183 come from this gene [Arabidopsis thaliana]
 gb|AAK15550.1|AF348579_1 putative proteasome epsilon chain precursor [Arabidopsis thaliana]
 emb|CAA74029.1| multicatalytic endopeptidase complex, proteasome precursor, beta 
subunit [Arabidopsis thaliana]
 gb|AAC32072.1| 20S proteasome beta subunit PBE1 [Arabidopsis thaliana]
 gb|AAN12998.1| proteasome epsilon chain precursor [Arabidopsis thaliana]
 gb|AEE28965.1| 20S proteasome beta subunit E1 [Arabidopsis thaliana]
Length=274

 Score =   458 bits (1178),  Expect = 3e-158, Method: Compositional matrix adjust.
 Identities = 219/270 (81%), Positives = 241/270 (89%), Gaps = 2/270 (1%)
 Frame = +3

Query  75   VRIDFSGLESTAPI--RGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTT  248
            +++D SG E++ P+   G SS++ DE+  VPSF +P   +FDGFQK A  M+K AKGTTT
Sbjct  1    MKLDTSGFETSMPMIGFGSSSDMLDELSSVPSFDLPRTKEFDGFQKKAKDMLKHAKGTTT  60

Query  249  LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKC  428
            LAFIFK GVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KC
Sbjct  61   LAFIFKGGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKC  120

Query  429  RLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKG  608
            RLHELANKRRISV+GASKLLAN+LYSYRGMGLSVGTMIAGWDE GPGLYYVD+EGGRLKG
Sbjct  121  RLHELANKRRISVSGASKLLANMLYSYRGMGLSVGTMIAGWDETGPGLYYVDNEGGRLKG  180

Query  609  NRFSVGSGSPYAYGVLDNGYRFDLSVEEAAELARRSIYHATFRDGASGGVASVYHVGPNG  788
            +RFSVGSGSPYAYGVLD+GY++D+SVEEA+ELARRSIYHATFRDGASGGVASVYHVGP G
Sbjct  181  DRFSVGSGSPYAYGVLDSGYKYDMSVEEASELARRSIYHATFRDGASGGVASVYHVGPEG  240

Query  789  WKKLSGDDVGELHYHYYPVEAAAVEHEMTE  878
            W KLSGDDVGELHYHYYPV  A  E  M E
Sbjct  241  WTKLSGDDVGELHYHYYPVAPATAEQVMEE  270



>ref|XP_002889982.1| hypothetical protein ARALYDRAFT_471459 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66241.1| hypothetical protein ARALYDRAFT_471459 [Arabidopsis lyrata subsp. 
lyrata]
Length=274

 Score =   457 bits (1177),  Expect = 4e-158, Method: Compositional matrix adjust.
 Identities = 219/270 (81%), Positives = 242/270 (90%), Gaps = 2/270 (1%)
 Frame = +3

Query  75   VRIDFSGLESTAPI--RGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTT  248
            +++D SG E++ P+   G SS++ DE+  VPSF +P   +FDGFQK+A  M+K AKGTTT
Sbjct  1    MKLDTSGFETSMPMIGFGSSSDMLDELSSVPSFDLPRTKEFDGFQKEAKDMLKHAKGTTT  60

Query  249  LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKC  428
            LAFIFK GVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KC
Sbjct  61   LAFIFKGGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKC  120

Query  429  RLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKG  608
            RLHELANKRRISV+GASKLLAN+LYSYRGMGLSVGTMIAGWDE GPGLYYVD+EGGRLKG
Sbjct  121  RLHELANKRRISVSGASKLLANMLYSYRGMGLSVGTMIAGWDETGPGLYYVDNEGGRLKG  180

Query  609  NRFSVGSGSPYAYGVLDNGYRFDLSVEEAAELARRSIYHATFRDGASGGVASVYHVGPNG  788
            +RFSVGSGSPYAYGVLD+GY++D+SVEEA+ELARRSIYHATFRDGASGGVASVYHVGP G
Sbjct  181  DRFSVGSGSPYAYGVLDSGYKYDMSVEEASELARRSIYHATFRDGASGGVASVYHVGPEG  240

Query  789  WKKLSGDDVGELHYHYYPVEAAAVEHEMTE  878
            W KLSGDDVGELHYHYYPV  A  E  M E
Sbjct  241  WTKLSGDDVGELHYHYYPVAPAIAEQVMEE  270



>gb|AAK92808.1| putative proteasome epsilon chain precursor [Arabidopsis thaliana]
Length=274

 Score =   457 bits (1176),  Expect = 5e-158, Method: Compositional matrix adjust.
 Identities = 219/270 (81%), Positives = 241/270 (89%), Gaps = 2/270 (1%)
 Frame = +3

Query  75   VRIDFSGLESTAPI--RGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTT  248
            +++D SG E++ P+   G SS++ DE+  VPSF +P   +FDGFQK A  M+K AKGTTT
Sbjct  1    MKLDTSGFETSMPMIGFGSSSDVLDELSSVPSFDLPRTKEFDGFQKKAKDMLKHAKGTTT  60

Query  249  LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKC  428
            LAFIFK GVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KC
Sbjct  61   LAFIFKGGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKC  120

Query  429  RLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKG  608
            RLHELANKRRISV+GASKLLAN+LYSYRGMGLSVGTMIAGWDE GPGLYYVD+EGGRLKG
Sbjct  121  RLHELANKRRISVSGASKLLANMLYSYRGMGLSVGTMIAGWDETGPGLYYVDNEGGRLKG  180

Query  609  NRFSVGSGSPYAYGVLDNGYRFDLSVEEAAELARRSIYHATFRDGASGGVASVYHVGPNG  788
            +RFSVGSGSPYAYGVLD+GY++D+SVEEA+ELARRSIYHATFRDGASGGVASVYHVGP G
Sbjct  181  DRFSVGSGSPYAYGVLDSGYKYDMSVEEASELARRSIYHATFRDGASGGVASVYHVGPEG  240

Query  789  WKKLSGDDVGELHYHYYPVEAAAVEHEMTE  878
            W KLSGDDVGELHYHYYPV  A  E  M E
Sbjct  241  WTKLSGDDVGELHYHYYPVAPATAEQVMEE  270



>ref|XP_010458748.1| PREDICTED: proteasome subunit beta type-5-A-like [Camelina sativa]
Length=274

 Score =   457 bits (1175),  Expect = 7e-158, Method: Compositional matrix adjust.
 Identities = 218/270 (81%), Positives = 242/270 (90%), Gaps = 2/270 (1%)
 Frame = +3

Query  75   VRIDFSGLESTAPI--RGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTT  248
            +++D SG E++ P    G SS++ DE+  VPSF +P+  +FDGFQK A+ M+K AKGTTT
Sbjct  1    MKLDTSGFETSVPTIGFGSSSDMLDELSSVPSFDLPHTKEFDGFQKKAVDMLKHAKGTTT  60

Query  249  LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKC  428
            LAFIFK GVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KC
Sbjct  61   LAFIFKGGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKC  120

Query  429  RLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKG  608
            RLHELANKRRISV+GASKLLAN+LYSYRGMGLSVGTMIAGWDE GPGLYYVD+EGGRLKG
Sbjct  121  RLHELANKRRISVSGASKLLANMLYSYRGMGLSVGTMIAGWDETGPGLYYVDNEGGRLKG  180

Query  609  NRFSVGSGSPYAYGVLDNGYRFDLSVEEAAELARRSIYHATFRDGASGGVASVYHVGPNG  788
            +RFSVGSGSPYAYGVLD+GY++++SVEEA+ELARRSIYHATFRDGASGGVASVYHVGP G
Sbjct  181  DRFSVGSGSPYAYGVLDSGYKYEMSVEEASELARRSIYHATFRDGASGGVASVYHVGPEG  240

Query  789  WKKLSGDDVGELHYHYYPVEAAAVEHEMTE  878
            W KLSGDDVGELHYHYYPV  A  E  M E
Sbjct  241  WTKLSGDDVGELHYHYYPVPPAIAEQVMEE  270



>ref|XP_010494920.1| PREDICTED: proteasome subunit beta type-5-A [Camelina sativa]
Length=274

 Score =   457 bits (1175),  Expect = 9e-158, Method: Compositional matrix adjust.
 Identities = 218/270 (81%), Positives = 242/270 (90%), Gaps = 2/270 (1%)
 Frame = +3

Query  75   VRIDFSGLESTAPI--RGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTT  248
            +++D SG E++ P    G SS++ DE+  VPSF +P+  +FDGFQK A+ M+K AKGTTT
Sbjct  1    MKLDTSGFETSMPTIGFGSSSDMLDELSSVPSFDLPHTKEFDGFQKKAVDMLKHAKGTTT  60

Query  249  LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKC  428
            LAFIFK GVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KC
Sbjct  61   LAFIFKGGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKC  120

Query  429  RLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKG  608
            RLHELANKRRISV+GASKLLAN+LYSYRGMGLSVGTMIAGWDE GPGLYYVD+EGGRLKG
Sbjct  121  RLHELANKRRISVSGASKLLANMLYSYRGMGLSVGTMIAGWDETGPGLYYVDNEGGRLKG  180

Query  609  NRFSVGSGSPYAYGVLDNGYRFDLSVEEAAELARRSIYHATFRDGASGGVASVYHVGPNG  788
            +RFSVGSGSPYAYGVLD+GY++++SVEEA+ELARRSIYHATFRDGASGGVASVYHVGP G
Sbjct  181  DRFSVGSGSPYAYGVLDSGYKYEMSVEEASELARRSIYHATFRDGASGGVASVYHVGPEG  240

Query  789  WKKLSGDDVGELHYHYYPVEAAAVEHEMTE  878
            W KLSGDDVGELHYHYYPV  A  E  M E
Sbjct  241  WTKLSGDDVGELHYHYYPVPPAIAEQVMEE  270



>ref|XP_010476293.1| PREDICTED: proteasome subunit beta type-5-A-like [Camelina sativa]
Length=274

 Score =   456 bits (1174),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 218/270 (81%), Positives = 242/270 (90%), Gaps = 2/270 (1%)
 Frame = +3

Query  75   VRIDFSGLESTAPI--RGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTT  248
            +++D SG E++ P    G SS++ DE+  VPSF +P+  +FDGFQK A+ M+K AKGTTT
Sbjct  1    MKLDTSGFETSVPTIGFGSSSDMLDELSSVPSFDLPHTKEFDGFQKKAVDMLKHAKGTTT  60

Query  249  LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKC  428
            LAFIFK GVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KC
Sbjct  61   LAFIFKGGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKC  120

Query  429  RLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKG  608
            RLHELANKRRISV+GASKLLAN+LYSYRGMGLSVGTMIAGWDE GPGLYYVD+EGGRLKG
Sbjct  121  RLHELANKRRISVSGASKLLANMLYSYRGMGLSVGTMIAGWDETGPGLYYVDNEGGRLKG  180

Query  609  NRFSVGSGSPYAYGVLDNGYRFDLSVEEAAELARRSIYHATFRDGASGGVASVYHVGPNG  788
            +RFSVGSGSPYAYGVLD+GY++++SVEEA+ELARRSIYHATFRDGASGGVASVYHVGP G
Sbjct  181  DRFSVGSGSPYAYGVLDSGYKYEMSVEEASELARRSIYHATFRDGASGGVASVYHVGPEG  240

Query  789  WKKLSGDDVGELHYHYYPVEAAAVEHEMTE  878
            W KLSGDDVGELHYHYYPV  A  E  M E
Sbjct  241  WTKLSGDDVGELHYHYYPVPPAIAEQVMEE  270



>gb|AFK38197.1| unknown [Medicago truncatula]
Length=271

 Score =   454 bits (1167),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 220/266 (83%), Positives = 235/266 (88%), Gaps = 0/266 (0%)
 Frame = +3

Query  81   IDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLAFI  260
            +D + LES   +      +  EI   PSFQ+PN  DFDGF K+ IQMVKPAKGTTTLAFI
Sbjct  2    LDTTALESFPSLISHGINVAGEISAPPSFQLPNSNDFDGFVKETIQMVKPAKGTTTLAFI  61

Query  261  FKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHE  440
            FKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRLHE
Sbjct  62   FKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHE  121

Query  441  LANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFS  620
            LANKRRISV GASKLLANILYSYRGMG SVGTMIAGWDE GPGLYYVDSEGGRLKGNRFS
Sbjct  122  LANKRRISVTGASKLLANILYSYRGMGSSVGTMIAGWDETGPGLYYVDSEGGRLKGNRFS  181

Query  621  VGSGSPYAYGVLDNGYRFDLSVEEAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKL  800
            VGSGSPYAYGVLD+GY++D+SVEEA+ELARR+IYHATFRDGASGGVASVY+VGP G KKL
Sbjct  182  VGSGSPYAYGVLDSGYKYDMSVEEASELARRAIYHATFRDGASGGVASVYYVGPTGRKKL  241

Query  801  SGDDVGELHYHYYPVEAAAVEHEMTE  878
            SGDDVGELHYHY PV  + VE EM E
Sbjct  242  SGDDVGELHYHYNPVTPSTVEQEMVE  267



>ref|XP_002315619.1| 20S proteasome beta subunit family protein [Populus trichocarpa]
 gb|EEF01790.1| 20S proteasome beta subunit family protein [Populus trichocarpa]
Length=274

 Score =   448 bits (1153),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 216/263 (82%), Positives = 236/263 (90%), Gaps = 3/263 (1%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESS-ELFD--EIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTT  245
            ++ D SGLEST+ + G +  EL D       P+F++P   DFDGFQK+A+QMVKPAKGTT
Sbjct  1    MKFDTSGLESTSSVFGTAGRELVDGFSAAAAPAFELPTTKDFDGFQKEAVQMVKPAKGTT  60

Query  246  TLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVK  425
            TLAFIFKEGV+VAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+K
Sbjct  61   TLAFIFKEGVIVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIK  120

Query  426  CRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLK  605
            CRLHELANKRRISV GASKLLANIL+SYRGMGLSVGTMIAGWDE GPGLYYVDSEGGRLK
Sbjct  121  CRLHELANKRRISVTGASKLLANILFSYRGMGLSVGTMIAGWDETGPGLYYVDSEGGRLK  180

Query  606  GNRFSVGSGSPYAYGVLDNGYRFDLSVEEAAELARRSIYHATFRDGASGGVASVYHVGPN  785
            G RFSVGSGSPYAYG+LD+GYRFD+S+EEAAEL RR+IYHATFRDGASGGVASVY+VG N
Sbjct  181  GTRFSVGSGSPYAYGILDSGYRFDMSIEEAAELGRRAIYHATFRDGASGGVASVYYVGAN  240

Query  786  GWKKLSGDDVGELHYHYYPVEAA  854
            GW KLSGDDV ELHY YYPV +A
Sbjct  241  GWTKLSGDDVSELHYKYYPVVSA  263



>ref|XP_011041516.1| PREDICTED: proteasome subunit beta type-5-B-like [Populus euphratica]
 ref|XP_011041517.1| PREDICTED: proteasome subunit beta type-5-B-like [Populus euphratica]
 ref|XP_011041518.1| PREDICTED: proteasome subunit beta type-5-B-like [Populus euphratica]
 ref|XP_011041519.1| PREDICTED: proteasome subunit beta type-5-B-like [Populus euphratica]
Length=274

 Score =   447 bits (1150),  Expect = 4e-154, Method: Compositional matrix adjust.
 Identities = 215/263 (82%), Positives = 234/263 (89%), Gaps = 3/263 (1%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSELFDE---IPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTT  245
            ++ D SGLESTA + G +   F +       P+F++P   DFDGFQK+A+QMVKPAKGTT
Sbjct  1    MKFDTSGLESTASVFGTAGREFVDGFSAAAAPAFELPTTKDFDGFQKEAVQMVKPAKGTT  60

Query  246  TLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVK  425
            TLAFIFKEGV+VAADSRASMGGYISSQSVKKIIEINPYMLGTMAGG ADCQFWHRNLG+K
Sbjct  61   TLAFIFKEGVIVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGGADCQFWHRNLGIK  120

Query  426  CRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLK  605
            CRLHELANKRRISV GASKLLANIL+SYRGMGLSVGTMIAGWDE GPGLYYVDSEGGRLK
Sbjct  121  CRLHELANKRRISVTGASKLLANILFSYRGMGLSVGTMIAGWDETGPGLYYVDSEGGRLK  180

Query  606  GNRFSVGSGSPYAYGVLDNGYRFDLSVEEAAELARRSIYHATFRDGASGGVASVYHVGPN  785
            G RFSVGSGSPYAYGVLD+GYRFD+S+EEAAEL RR+IYHATFRDGASGGVASVY+VG N
Sbjct  181  GTRFSVGSGSPYAYGVLDSGYRFDMSIEEAAELGRRAIYHATFRDGASGGVASVYYVGAN  240

Query  786  GWKKLSGDDVGELHYHYYPVEAA  854
            GW KLSGDDV ELHY YYPV +A
Sbjct  241  GWTKLSGDDVSELHYKYYPVVSA  263



>gb|ACJ85344.1| unknown [Medicago truncatula]
Length=262

 Score =   447 bits (1149),  Expect = 5e-154, Method: Compositional matrix adjust.
 Identities = 217/261 (83%), Positives = 232/261 (89%), Gaps = 0/261 (0%)
 Frame = +3

Query  81   IDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLAFI  260
            +D + LES   +      +  EI   PSFQ+PN  DFDGF K+ IQMVKPAKGTTTLAFI
Sbjct  2    LDTTALESFPSLISHGINVAGEISAPPSFQLPNSNDFDGFVKETIQMVKPAKGTTTLAFI  61

Query  261  FKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHE  440
            FKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRLHE
Sbjct  62   FKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHE  121

Query  441  LANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFS  620
            LANKRRISV GASKLLANILYSYRGMG SVGTMIAGWDE GPGLYYVDSEGGRLKGNRFS
Sbjct  122  LANKRRISVTGASKLLANILYSYRGMGSSVGTMIAGWDETGPGLYYVDSEGGRLKGNRFS  181

Query  621  VGSGSPYAYGVLDNGYRFDLSVEEAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKL  800
            VGSGSPYAYGVLD+GY++D+SVEEA+ELARR+IYHATFRDGASGGVASVY+VGP G KKL
Sbjct  182  VGSGSPYAYGVLDSGYKYDMSVEEASELARRAIYHATFRDGASGGVASVYYVGPTGRKKL  241

Query  801  SGDDVGELHYHYYPVEAAAVE  863
            SGDDVGELHYHY PV  + VE
Sbjct  242  SGDDVGELHYHYNPVTPSTVE  262



>ref|NP_001184978.1| 20S proteasome beta subunit E1 [Arabidopsis thaliana]
 gb|AEE28966.1| 20S proteasome beta subunit E1 [Arabidopsis thaliana]
Length=298

 Score =   445 bits (1144),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 219/294 (74%), Positives = 241/294 (82%), Gaps = 26/294 (9%)
 Frame = +3

Query  75   VRIDFSGLESTAPI--RGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTT  248
            +++D SG E++ P+   G SS++ DE+  VPSF +P   +FDGFQK A  M+K AKGTTT
Sbjct  1    MKLDTSGFETSMPMIGFGSSSDMLDELSSVPSFDLPRTKEFDGFQKKAKDMLKHAKGTTT  60

Query  249  LAFIFKEGVMVAADSRASMGGYIS------------------------SQSVKKIIEINP  356
            LAFIFK GVMVAADSRASMGGYIS                        SQSVKKIIEINP
Sbjct  61   LAFIFKGGVMVAADSRASMGGYISVSSLKNSSKNMHPFDIVDFGRNTTSQSVKKIIEINP  120

Query  357  YMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGT  536
            YMLGTMAGGAADCQFWHRNLG+KCRLHELANKRRISV+GASKLLAN+LYSYRGMGLSVGT
Sbjct  121  YMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVSGASKLLANMLYSYRGMGLSVGT  180

Query  537  MIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEEAAELARRS  716
            MIAGWDE GPGLYYVD+EGGRLKG+RFSVGSGSPYAYGVLD+GY++D+SVEEA+ELARRS
Sbjct  181  MIAGWDETGPGLYYVDNEGGRLKGDRFSVGSGSPYAYGVLDSGYKYDMSVEEASELARRS  240

Query  717  IYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEHEMTE  878
            IYHATFRDGASGGVASVYHVGP GW KLSGDDVGELHYHYYPV  A  E  M E
Sbjct  241  IYHATFRDGASGGVASVYHVGPEGWTKLSGDDVGELHYHYYPVAPATAEQVMEE  294



>ref|NP_001132821.1| uncharacterized protein LOC100194311 [Zea mays]
 gb|ACF81829.1| unknown [Zea mays]
 gb|ACF86108.1| unknown [Zea mays]
 gb|ACG33811.1| proteasome subunit beta type 5 precursor [Zea mays]
 gb|AFW85804.1| proteasome subunit beta type [Zea mays]
Length=280

 Score =   431 bits (1107),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 207/277 (75%), Positives = 231/277 (83%), Gaps = 3/277 (1%)
 Frame = +3

Query  60   LVVTMVRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKG  239
            L ++ +  +F+ L ++A   G+ +    E P VPS  +P   DFDGFQ     MVK  KG
Sbjct  5    LDMSALETNFANLTASA---GDDTYFSAEAPDVPSMVLPICDDFDGFQAATKDMVKNKKG  61

Query  240  TTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG  419
            TTTLAFIF +GV+VAADSRASMGGYISSQ+V+KIIEINPYMLGTMAGGAADCQFWHRNLG
Sbjct  62   TTTLAFIFDKGVIVAADSRASMGGYISSQTVRKIIEINPYMLGTMAGGAADCQFWHRNLG  121

Query  420  VKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGR  599
             KCRLHEL+NKRRIS+AGASKLLANILYSYRGMGLS+GTMIAGWDEKGPGLYYVDSEG R
Sbjct  122  TKCRLHELSNKRRISIAGASKLLANILYSYRGMGLSIGTMIAGWDEKGPGLYYVDSEGAR  181

Query  600  LKGNRFSVGSGSPYAYGVLDNGYRFDLSVEEAAELARRSIYHATFRDGASGGVASVYHVG  779
            L GNRFSVGSGS YAYG+LD+GYRF +SVEEAAELARR+IY ATFRD ASGG  SVYHVG
Sbjct  182  LVGNRFSVGSGSLYAYGILDDGYRFSMSVEEAAELARRAIYGATFRDAASGGCVSVYHVG  241

Query  780  PNGWKKLSGDDVGELHYHYYPVEAAAVEHEMTEVPIA  890
            P+GW KLSGDDVGELHYHYYPV+   VE EM + P A
Sbjct  242  PDGWTKLSGDDVGELHYHYYPVQKTPVEQEMADAPTA  278



>ref|XP_002437853.1| hypothetical protein SORBIDRAFT_10g003770 [Sorghum bicolor]
 gb|EER89220.1| hypothetical protein SORBIDRAFT_10g003770 [Sorghum bicolor]
Length=280

 Score =   431 bits (1107),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 209/277 (75%), Positives = 231/277 (83%), Gaps = 6/277 (2%)
 Frame = +3

Query  75   VRIDFSGLES-----TAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKG  239
            +++D S LE+     T P   + +      P VPS  +P   DFDGFQ D   MVK  KG
Sbjct  3    MKVDMSALETNFANMTFPAS-DDTYFSAGAPDVPSMVLPTCDDFDGFQADTKAMVKNKKG  61

Query  240  TTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG  419
            TTTLAFIF +GV+VAADSRASMGGYISSQ+V+KIIEINPYMLGTMAGGAADCQFWHRNLG
Sbjct  62   TTTLAFIFDKGVIVAADSRASMGGYISSQTVRKIIEINPYMLGTMAGGAADCQFWHRNLG  121

Query  420  VKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGR  599
             KCRLHEL+NKRRIS+AGASKLLANILYSYRGMGLS+GTMIAGWDEKGPGLYYVDSEG R
Sbjct  122  NKCRLHELSNKRRISIAGASKLLANILYSYRGMGLSIGTMIAGWDEKGPGLYYVDSEGAR  181

Query  600  LKGNRFSVGSGSPYAYGVLDNGYRFDLSVEEAAELARRSIYHATFRDGASGGVASVYHVG  779
            L GN+FSVGSGS YAYGVLD+GYRF++SVEEAAELARR+IY ATFRD ASGG  SVYHVG
Sbjct  182  LVGNKFSVGSGSLYAYGVLDDGYRFNMSVEEAAELARRAIYGATFRDAASGGCVSVYHVG  241

Query  780  PNGWKKLSGDDVGELHYHYYPVEAAAVEHEMTEVPIA  890
            P+GW KLSGDDVGELHYHYYPV+   VE EMT+ P A
Sbjct  242  PDGWTKLSGDDVGELHYHYYPVQKTPVEQEMTDAPTA  278



>ref|XP_004964820.1| PREDICTED: proteasome subunit beta type-5-A-like [Setaria italica]
Length=280

 Score =   430 bits (1106),  Expect = 3e-147, Method: Compositional matrix adjust.
 Identities = 208/276 (75%), Positives = 229/276 (83%), Gaps = 4/276 (1%)
 Frame = +3

Query  75   VRIDFSGLESTAPI----RGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGT  242
            +++D S LE+   +     G+      E P VPS  +P   DFDGFQ     MVK  KGT
Sbjct  3    MKLDMSALETNFAVPCGDDGDGMYFSAEAPDVPSMVLPTCADFDGFQAATKDMVKNKKGT  62

Query  243  TTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGV  422
            TTLAFIF +GV+VAADSRASMGGYISSQ+V+KIIEINPYMLGTMAGGAADCQFWHRNLG 
Sbjct  63   TTLAFIFDKGVIVAADSRASMGGYISSQTVRKIIEINPYMLGTMAGGAADCQFWHRNLGN  122

Query  423  KCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRL  602
            KCRLHEL+NKRRIS+AGASKLLANILYSYRGMGLS+GTMIAGWDEKGPGLYYVDSEG RL
Sbjct  123  KCRLHELSNKRRISIAGASKLLANILYSYRGMGLSIGTMIAGWDEKGPGLYYVDSEGARL  182

Query  603  KGNRFSVGSGSPYAYGVLDNGYRFDLSVEEAAELARRSIYHATFRDGASGGVASVYHVGP  782
             GNRFSVGSGS YAYG+LD GYRF++SVEEA ELARR+IY ATFRD ASGG  SVYHVGP
Sbjct  183  VGNRFSVGSGSLYAYGILDEGYRFNMSVEEAGELARRAIYGATFRDAASGGCVSVYHVGP  242

Query  783  NGWKKLSGDDVGELHYHYYPVEAAAVEHEMTEVPIA  890
            +GWKKLSGDDVGELHYHYYPV+   VE EMT+ P A
Sbjct  243  DGWKKLSGDDVGELHYHYYPVQKTPVEQEMTDAPSA  278



>ref|XP_006655798.1| PREDICTED: proteasome subunit beta type-5-A-like [Oryza brachyantha]
Length=276

 Score =   430 bits (1105),  Expect = 4e-147, Method: Compositional matrix adjust.
 Identities = 206/276 (75%), Positives = 235/276 (85%), Gaps = 4/276 (1%)
 Frame = +3

Query  75   VRIDFSGLESTAPIR--GESSE--LFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGT  242
            +++D S +E+   +R  GE  +  +F     +P+ ++P   DFDGFQK+A +++K  KGT
Sbjct  1    MKLDVSAMENNFAVRCGGEDDDGGIFGAGADLPAMELPTCADFDGFQKEAKELMKNKKGT  60

Query  243  TTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGV  422
            TTLAFIF +GV+VAADSRASMGGYISSQ+V+KIIEINPYMLGTMAGGAADCQFWHRNLG+
Sbjct  61   TTLAFIFDKGVIVAADSRASMGGYISSQTVRKIIEINPYMLGTMAGGAADCQFWHRNLGI  120

Query  423  KCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRL  602
            KCRLHELANKRRISVAGASKLLANILYSYRGMGLS+GTMIAGWDEKGPGLYYVDSEG RL
Sbjct  121  KCRLHELANKRRISVAGASKLLANILYSYRGMGLSIGTMIAGWDEKGPGLYYVDSEGARL  180

Query  603  KGNRFSVGSGSPYAYGVLDNGYRFDLSVEEAAELARRSIYHATFRDGASGGVASVYHVGP  782
             G RFSVGSGS YAYG+LD GYR+ +SVEEA ELARR+IYHATFRDGASGG  SVYHVG 
Sbjct  181  VGTRFSVGSGSLYAYGILDEGYRYVMSVEEAGELARRAIYHATFRDGASGGCVSVYHVGA  240

Query  783  NGWKKLSGDDVGELHYHYYPVEAAAVEHEMTEVPIA  890
            +GWKKLSGDDVGELHY YYPV+A  VE EM + P A
Sbjct  241  DGWKKLSGDDVGELHYKYYPVQATPVEQEMADAPAA  276



>ref|XP_003564317.1| PREDICTED: proteasome subunit beta type-5-A-like [Brachypodium 
distachyon]
Length=277

 Score =   426 bits (1095),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 207/277 (75%), Positives = 230/277 (83%), Gaps = 3/277 (1%)
 Frame = +3

Query  75   VRIDFSGLES---TAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTT  245
            +R+D S LE+    AP       +F       + + P   DFDGFQK    MV   KGTT
Sbjct  1    MRLDVSALENHHFAAPGNEFGGGVFAADTEELAMEFPTCNDFDGFQKATKDMVNNKKGTT  60

Query  246  TLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVK  425
            TL+FIF +GV+VAADSRASMGGYISSQ+V+KIIEINPYMLGTMAGGAADCQFWHRNLG K
Sbjct  61   TLSFIFDKGVIVAADSRASMGGYISSQTVRKIIEINPYMLGTMAGGAADCQFWHRNLGTK  120

Query  426  CRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLK  605
            CRLHELANKRRIS+AG+SK+LANILYSYRGMGLS+GTMIAG+DE GPGLYYVDSEG RLK
Sbjct  121  CRLHELANKRRISIAGSSKMLANILYSYRGMGLSIGTMIAGFDETGPGLYYVDSEGARLK  180

Query  606  GNRFSVGSGSPYAYGVLDNGYRFDLSVEEAAELARRSIYHATFRDGASGGVASVYHVGPN  785
            GNRFSVGSGS YAYG+LD GY+F++SVEEA ELARR+IYHATFRDGASGG  SVYHVGPN
Sbjct  181  GNRFSVGSGSLYAYGILDEGYKFNMSVEEAGELARRAIYHATFRDGASGGCVSVYHVGPN  240

Query  786  GWKKLSGDDVGELHYHYYPVEAAAVEHEMTEVPIA*T  896
            GWKKLSGDDVGELHYHYYPV+AA VE EM + P A T
Sbjct  241  GWKKLSGDDVGELHYHYYPVQAAPVEQEMADAPSAST  277



>gb|EEE65108.1| hypothetical protein OsJ_20167 [Oryza sativa Japonica Group]
Length=277

 Score =   424 bits (1089),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 205/277 (74%), Positives = 231/277 (83%), Gaps = 5/277 (2%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSE----LFDEIPRVPSFQIPNI-TDFDGFQKDAIQMVKPAKG  239
            +++D S +E+    +    E    LF     +P+ ++P    DFDGFQK+  +M+K  KG
Sbjct  1    MKLDVSAMENNFAAQAAGGEDDGGLFGAGADLPAMELPTCPADFDGFQKETKEMLKHKKG  60

Query  240  TTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG  419
            TTTLAFIF +GV+VAADSRASMGGYISSQ+V+KIIEINPYMLGTMAGGAADCQFWHRNLG
Sbjct  61   TTTLAFIFDKGVIVAADSRASMGGYISSQTVRKIIEINPYMLGTMAGGAADCQFWHRNLG  120

Query  420  VKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGR  599
            +KCRLHELANKRRIS+AGASKLLANILYSYRGMGLS+GTMIAGWDEKGPGLYYVDSEG R
Sbjct  121  IKCRLHELANKRRISIAGASKLLANILYSYRGMGLSIGTMIAGWDEKGPGLYYVDSEGAR  180

Query  600  LKGNRFSVGSGSPYAYGVLDNGYRFDLSVEEAAELARRSIYHATFRDGASGGVASVYHVG  779
            L G+RFSVGSGS YAYG+LD GYR+ + VEEAAELARR+IY ATFRDGASGG  SVYHVG
Sbjct  181  LMGSRFSVGSGSLYAYGILDEGYRYVMPVEEAAELARRAIYQATFRDGASGGCVSVYHVG  240

Query  780  PNGWKKLSGDDVGELHYHYYPVEAAAVEHEMTEVPIA  890
            PNGW KLSGDDVGELHY YYPVEA  VE EM + P A
Sbjct  241  PNGWTKLSGDDVGELHYKYYPVEATPVEQEMADAPAA  277



>dbj|BAA96838.1| beta 5 subunit of 20S proteasome [Oryza sativa Japonica Group]
Length=277

 Score =   424 bits (1089),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 206/277 (74%), Positives = 232/277 (84%), Gaps = 5/277 (2%)
 Frame = +3

Query  75   VRIDFSGLEST----APIRGESSELFDEIPRVPSFQIPNI-TDFDGFQKDAIQMVKPAKG  239
            +++D S +E+     A  R +   LF     +P+ ++P    DFDGFQK+  +M+K  KG
Sbjct  1    MKLDVSAMENNFAAHAAGREDDGGLFGAGADLPAMELPTCPADFDGFQKETKEMLKHKKG  60

Query  240  TTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG  419
            TTTLAFIF +GV+VAADSRASMGGYISSQ+V+KIIEINPYMLGTMAGGAADCQFWHRNLG
Sbjct  61   TTTLAFIFDKGVIVAADSRASMGGYISSQTVRKIIEINPYMLGTMAGGAADCQFWHRNLG  120

Query  420  VKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGR  599
            +KCRLHELANKRRIS+AGASKLLANILYSYRGMGLS+GTMIAGWDEKGPGLYYVDSEG R
Sbjct  121  IKCRLHELANKRRISIAGASKLLANILYSYRGMGLSIGTMIAGWDEKGPGLYYVDSEGAR  180

Query  600  LKGNRFSVGSGSPYAYGVLDNGYRFDLSVEEAAELARRSIYHATFRDGASGGVASVYHVG  779
            L G+RFSVGSGS YAYG+LD GYR+ + VEEAAELARR+IY ATFRDGASGG  SVYHVG
Sbjct  181  LMGSRFSVGSGSLYAYGILDEGYRYVMPVEEAAELARRAIYQATFRDGASGGCVSVYHVG  240

Query  780  PNGWKKLSGDDVGELHYHYYPVEAAAVEHEMTEVPIA  890
            PNGW KLSGDDVGELHY YYPVEA  VE EM + P A
Sbjct  241  PNGWTKLSGDDVGELHYKYYPVEATPVEQEMADAPAA  277



>gb|ACU51028.1| 20S proteasome beta5 subunit [Conocephalum conicum]
Length=280

 Score =   423 bits (1087),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 202/271 (75%), Positives = 227/271 (84%), Gaps = 5/271 (2%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSE-----LFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKG  239
            +R+DF+GL+     R  S +      +D I   PSF +P + D DGF+K A+ MVKP  G
Sbjct  1    MRLDFAGLDPVTLRRPSSGDGGFDVAYDSIGSAPSFNLPAVADLDGFEKAAVDMVKPLHG  60

Query  240  TTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG  419
            TTTLAF+FKEGV+VAADSRASMG YISSQ VKKI+EINPY+LGTMAGGAADCQFW RNLG
Sbjct  61   TTTLAFVFKEGVIVAADSRASMGNYISSQDVKKILEINPYLLGTMAGGAADCQFWQRNLG  120

Query  420  VKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGR  599
             +CRLHEL NKRRISV GASKLLAN LYSYRGMGLS+GTMIAGWDE GPGLYYVDSEGGR
Sbjct  121  TRCRLHELGNKRRISVTGASKLLANTLYSYRGMGLSMGTMIAGWDETGPGLYYVDSEGGR  180

Query  600  LKGNRFSVGSGSPYAYGVLDNGYRFDLSVEEAAELARRSIYHATFRDGASGGVASVYHVG  779
            +KG RFSVGSGS YAYGVLD G+R+D++VEEA ELARRSIYHATFRDGASGGVASVY+VG
Sbjct  181  VKGRRFSVGSGSTYAYGVLDTGFRWDMTVEEAVELARRSIYHATFRDGASGGVASVYYVG  240

Query  780  PNGWKKLSGDDVGELHYHYYPVEAAAVEHEM  872
            P+GWKK+SGDDVGELHY YYPV  A  E E+
Sbjct  241  PDGWKKMSGDDVGELHYKYYPVSDAPAEQEV  271



>gb|AAU82107.1| 20S proteasome beta 5 subunit [Triticum aestivum]
Length=279

 Score =   422 bits (1086),  Expect = 3e-144, Method: Compositional matrix adjust.
 Identities = 199/245 (81%), Positives = 220/245 (90%), Gaps = 0/245 (0%)
 Frame = +3

Query  162  SFQIPNITDFDGFQKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKI  341
            + + P   DFDGFQK   +MV   KGTTTL+FIF +GV+VAADSRASMGGYISSQ+V+KI
Sbjct  35   ALEFPTCNDFDGFQKATKEMVNNKKGTTTLSFIFDKGVIVAADSRASMGGYISSQTVRKI  94

Query  342  IEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMG  521
            IEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRIS+AG+SK LANILYSYRGMG
Sbjct  95   IEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISIAGSSKTLANILYSYRGMG  154

Query  522  LSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEEAAE  701
            LS+GTMIAG+DE GPGLYYVDSEG RLKG+RFSVGSGS YAYG+LD GY+F++SVEEAAE
Sbjct  155  LSIGTMIAGFDETGPGLYYVDSEGARLKGSRFSVGSGSLYAYGILDEGYKFNMSVEEAAE  214

Query  702  LARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEHEMTEV  881
            LARR+IYHATFRDGASGG  SVY+VGP+GWKKLSGDDVGELHYHYYPV+AA VE EM E 
Sbjct  215  LARRAIYHATFRDGASGGCVSVYYVGPDGWKKLSGDDVGELHYHYYPVQAAPVEQEMAEA  274

Query  882  PIA*T  896
            P A T
Sbjct  275  PSAST  279



>ref|NP_001056842.1| Os06g0153800 [Oryza sativa Japonica Group]
 dbj|BAD69286.1| beta 5 subunit of 20S proteasome [Oryza sativa Japonica Group]
 dbj|BAF18756.1| Os06g0153800 [Oryza sativa Japonica Group]
 dbj|BAG96622.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96749.1| unnamed protein product [Oryza sativa Japonica Group]
Length=277

 Score =   422 bits (1085),  Expect = 4e-144, Method: Compositional matrix adjust.
 Identities = 205/277 (74%), Positives = 230/277 (83%), Gaps = 5/277 (2%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSE----LFDEIPRVPSFQIPNI-TDFDGFQKDAIQMVKPAKG  239
            +++D S +E+         E    LF     +P+ ++P    DFDGFQK+  +M+K  KG
Sbjct  1    MKLDVSAMENNFAAHAAGGEDDGGLFGAGADLPAMELPTCPADFDGFQKETKEMLKHKKG  60

Query  240  TTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG  419
            TTTLAFIF +GV+VAADSRASMGGYISSQ+V+KIIEINPYMLGTMAGGAADCQFWHRNLG
Sbjct  61   TTTLAFIFDKGVIVAADSRASMGGYISSQTVRKIIEINPYMLGTMAGGAADCQFWHRNLG  120

Query  420  VKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGR  599
            +KCRLHELANKRRIS+AGASKLLANILYSYRGMGLS+GTMIAGWDEKGPGLYYVDSEG R
Sbjct  121  IKCRLHELANKRRISIAGASKLLANILYSYRGMGLSIGTMIAGWDEKGPGLYYVDSEGAR  180

Query  600  LKGNRFSVGSGSPYAYGVLDNGYRFDLSVEEAAELARRSIYHATFRDGASGGVASVYHVG  779
            L G+RFSVGSGS YAYG+LD GYR+ + VEEAAELARR+IY ATFRDGASGG  SVYHVG
Sbjct  181  LMGSRFSVGSGSLYAYGILDEGYRYVMPVEEAAELARRAIYQATFRDGASGGCVSVYHVG  240

Query  780  PNGWKKLSGDDVGELHYHYYPVEAAAVEHEMTEVPIA  890
            PNGW KLSGDDVGELHY YYPVEA  VE EM + P A
Sbjct  241  PNGWTKLSGDDVGELHYKYYPVEATPVEQEMADAPAA  277



>gb|EEC80034.1| hypothetical protein OsI_21721 [Oryza sativa Indica Group]
Length=277

 Score =   421 bits (1083),  Expect = 8e-144, Method: Compositional matrix adjust.
 Identities = 205/277 (74%), Positives = 230/277 (83%), Gaps = 5/277 (2%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSE----LFDEIPRVPSFQIPNI-TDFDGFQKDAIQMVKPAKG  239
            +++D S +E+         E    LF     +P+ ++P    DFDGFQK+  +M+K  KG
Sbjct  1    MKLDVSAMENNFAAHAAGGEDDGGLFGAGADLPAMELPTCPADFDGFQKETKEMLKHKKG  60

Query  240  TTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG  419
            TTTLAFIF +GV+VAADSRASMGGYISSQ+V+KIIEINPYMLGTMAGGAADCQFWHRNLG
Sbjct  61   TTTLAFIFDKGVIVAADSRASMGGYISSQTVRKIIEINPYMLGTMAGGAADCQFWHRNLG  120

Query  420  VKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGR  599
            +KCRLHELANKRRIS+AGASKLLANILYSYRGMGLS+GTMIAGWDEKGPGLYYVDSEG R
Sbjct  121  IKCRLHELANKRRISIAGASKLLANILYSYRGMGLSIGTMIAGWDEKGPGLYYVDSEGAR  180

Query  600  LKGNRFSVGSGSPYAYGVLDNGYRFDLSVEEAAELARRSIYHATFRDGASGGVASVYHVG  779
            L G+RFSVGSGS YAYG+LD GYR+ + VEEAAELARR+IY ATFRDGASGG  SVYHVG
Sbjct  181  LMGSRFSVGSGSLYAYGILDEGYRYVMPVEEAAELARRAIYQATFRDGASGGCVSVYHVG  240

Query  780  PNGWKKLSGDDVGELHYHYYPVEAAAVEHEMTEVPIA  890
            PNGW KLSGDDVGELHY YYPVEA  VE EM + P A
Sbjct  241  PNGWTKLSGDDVGELHYKYYPVEAIPVEQEMADAPAA  277



>ref|XP_010912828.1| PREDICTED: proteasome subunit beta type-5-like [Elaeis guineensis]
Length=272

 Score =   421 bits (1082),  Expect = 9e-144, Method: Compositional matrix adjust.
 Identities = 200/269 (74%), Positives = 230/269 (86%), Gaps = 0/269 (0%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLA  254
            +++D +GLES AP+ G   +L  E+   PSF +P   DFDGFQK+AIQMVKPAKGTTTLA
Sbjct  1    MKLDTTGLESFAPLHGGMDDLHGELWAPPSFDLPVCADFDGFQKNAIQMVKPAKGTTTLA  60

Query  255  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  434
            F+FKEG++VAA+SR SMGGY++SQ+VKKI+EINP+M+ T+AGGAADC FWHRNLGVKCRL
Sbjct  61   FVFKEGIIVAAESRTSMGGYVASQNVKKIVEINPHMIATVAGGAADCIFWHRNLGVKCRL  120

Query  435  HELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNR  614
            +EL NKRRISVAGASKLL N+LYSYRGM LSVGTMIAGWDE GP LYYVDSEGGRLKG+R
Sbjct  121  YELENKRRISVAGASKLLTNMLYSYRGMELSVGTMIAGWDEMGPSLYYVDSEGGRLKGSR  180

Query  615  FSVGSGSPYAYGVLDNGYRFDLSVEEAAELARRSIYHATFRDGASGGVASVYHVGPNGWK  794
            FSVGSGSPYAY VLDNGYR+D+ + EAAELARR+IYHATFRDGASGGVA V HVGP+GWK
Sbjct  181  FSVGSGSPYAYAVLDNGYRYDMPLGEAAELARRAIYHATFRDGASGGVAIVCHVGPDGWK  240

Query  795  KLSGDDVGELHYHYYPVEAAAVEHEMTEV  881
            KLSGDDV ELH  YYP      E EM ++
Sbjct  241  KLSGDDVKELHDKYYPAVQVPAEQEMMQI  269



>ref|XP_008791726.1| PREDICTED: proteasome subunit beta type-5-like [Phoenix dactylifera]
Length=272

 Score =   420 bits (1080),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 200/270 (74%), Positives = 229/270 (85%), Gaps = 0/270 (0%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLA  254
            +++D +GLES A   GE  +L  E    PSF +P   DFDGFQK+AIQMVKPAKGTTTLA
Sbjct  1    MKLDTTGLESFASFHGEMDDLHGEFWAPPSFDLPVCADFDGFQKNAIQMVKPAKGTTTLA  60

Query  255  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  434
            F+FKEG++VAA+SR SMGGY++SQ+VKKI+EINPYM+ T+AGGAADC FWHRNLG+KCRL
Sbjct  61   FVFKEGIIVAAESRTSMGGYVASQNVKKIVEINPYMIATVAGGAADCIFWHRNLGMKCRL  120

Query  435  HELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNR  614
            +EL NKRRISVAGASKLL N+LYSYRGMGLS+GTM+AG DE GP LYYVDSEGGRLKG+R
Sbjct  121  YELENKRRISVAGASKLLTNMLYSYRGMGLSIGTMVAGCDEMGPSLYYVDSEGGRLKGSR  180

Query  615  FSVGSGSPYAYGVLDNGYRFDLSVEEAAELARRSIYHATFRDGASGGVASVYHVGPNGWK  794
            FSVGSGSPYAY VLDNGYR+D+   EAAELARR+IYHATFRDGASGGVA VYHVGP+GWK
Sbjct  181  FSVGSGSPYAYAVLDNGYRYDMPTGEAAELARRAIYHATFRDGASGGVAVVYHVGPDGWK  240

Query  795  KLSGDDVGELHYHYYPVEAAAVEHEMTEVP  884
            K+SGDDV ELH  YYP      E EM +VP
Sbjct  241  KISGDDVRELHDKYYPAVQVPPEQEMMQVP  270



>dbj|BAJ97061.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=279

 Score =   420 bits (1080),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 199/245 (81%), Positives = 219/245 (89%), Gaps = 0/245 (0%)
 Frame = +3

Query  162  SFQIPNITDFDGFQKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKI  341
            + + P   DFDGFQK    MV   KGTTTL+FIF +GV+VAADSRASMGGYISSQ+V+KI
Sbjct  35   ALEFPTCDDFDGFQKATKAMVNNKKGTTTLSFIFDKGVIVAADSRASMGGYISSQTVRKI  94

Query  342  IEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMG  521
            IEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRIS+AG+SK LANILYSYRGMG
Sbjct  95   IEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISIAGSSKTLANILYSYRGMG  154

Query  522  LSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEEAAE  701
            LS+GTMIAG+DE GPGLYYVDSEG RLKG+RFSVGSGS YAYG+LD GY+F++SVEEAAE
Sbjct  155  LSIGTMIAGFDETGPGLYYVDSEGARLKGSRFSVGSGSLYAYGILDEGYKFNMSVEEAAE  214

Query  702  LARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEHEMTEV  881
            LARR+IYHATFRDGASGG  SVY+VGP+GWKKLSGDDVGELHYHYYPV+AA VE EM E 
Sbjct  215  LARRAIYHATFRDGASGGCVSVYYVGPDGWKKLSGDDVGELHYHYYPVQAAPVEQEMAEA  274

Query  882  PIA*T  896
            P A T
Sbjct  275  PSAST  279



>ref|XP_001759925.1| predicted protein [Physcomitrella patens]
 gb|EDQ75429.1| predicted protein [Physcomitrella patens]
Length=269

 Score =   419 bits (1076),  Expect = 6e-143, Method: Compositional matrix adjust.
 Identities = 196/240 (82%), Positives = 215/240 (90%), Gaps = 0/240 (0%)
 Frame = +3

Query  159  PSFQIPNITDFDGFQKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKK  338
            PSF++P + D DGFQK A+QMVKPAKGTTTLAF+FK GV+VAADSRASMG YISSQSVKK
Sbjct  27   PSFELPAVADLDGFQKAAVQMVKPAKGTTTLAFVFKHGVIVAADSRASMGNYISSQSVKK  86

Query  339  IIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGM  518
            I+EINPY+LGTMAGGAADCQFW RNLG +CRLHELANKRRISV GASKLLAN LYSYRGM
Sbjct  87   ILEINPYLLGTMAGGAADCQFWQRNLGTRCRLHELANKRRISVTGASKLLANTLYSYRGM  146

Query  519  GLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEEAA  698
            GLS+GTMIAGWDE GPGLYYVDSEGGR+KG RFSVGSGS YAYGVLD G+ +D+S++EA 
Sbjct  147  GLSMGTMIAGWDETGPGLYYVDSEGGRVKGTRFSVGSGSTYAYGVLDTGFNWDMSIDEAV  206

Query  699  ELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEHEMTE  878
            ELARRSIYHATFRDGASGGV SVY+VGP GWKK+SGDDVGELHY YYPV+    E EM E
Sbjct  207  ELARRSIYHATFRDGASGGVVSVYYVGPGGWKKMSGDDVGELHYSYYPVQEVPAEAEMGE  266



>gb|EMS57921.1| Proteasome subunit beta type-5 [Triticum urartu]
Length=226

 Score =   401 bits (1031),  Expect = 9e-137, Method: Compositional matrix adjust.
 Identities = 191/226 (85%), Positives = 209/226 (92%), Gaps = 0/226 (0%)
 Frame = +3

Query  219  MVKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQ  398
            MV   KGTTTL+FIF +GV+VAADSRASMGGYISSQ+V+KIIEINPYMLGTMAGGAADCQ
Sbjct  1    MVNNKKGTTTLSFIFDKGVIVAADSRASMGGYISSQTVRKIIEINPYMLGTMAGGAADCQ  60

Query  399  FWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYY  578
            FWHRNLGVKCRLHELANKRRIS+AG+SK LANILYSYRGMGLS+GTMIAG+DE GPGLYY
Sbjct  61   FWHRNLGVKCRLHELANKRRISIAGSSKTLANILYSYRGMGLSIGTMIAGFDETGPGLYY  120

Query  579  VDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEEAAELARRSIYHATFRDGASGGV  758
            VDSEG RLKG+RFSVGSGS YAYG+LD GY+F++SVEEAAELARR+IYHATFRDGASGG 
Sbjct  121  VDSEGARLKGSRFSVGSGSLYAYGILDEGYKFNMSVEEAAELARRAIYHATFRDGASGGC  180

Query  759  ASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEHEMTEVPIA*T  896
             SVY+VGP+GWKKLSGDDVGELHYHYYPV+AA VE EM E P A T
Sbjct  181  VSVYYVGPDGWKKLSGDDVGELHYHYYPVQAAPVEQEMAEAPSAST  226



>ref|XP_002972642.1| hypothetical protein SELMODRAFT_270977 [Selaginella moellendorffii]
 gb|EFJ25863.1| hypothetical protein SELMODRAFT_270977 [Selaginella moellendorffii]
Length=277

 Score =   402 bits (1032),  Expect = 5e-136, Method: Compositional matrix adjust.
 Identities = 192/266 (72%), Positives = 220/266 (83%), Gaps = 0/266 (0%)
 Frame = +3

Query  81   IDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLAFI  260
            +DFSGLE  +  +   S+         SF +P + D DGFQK A+ ++KPA GTTTLAF 
Sbjct  5    LDFSGLEPASLRQHSYSDPAAHWEPQCSFPLPKVADLDGFQKAAVDLLKPAHGTTTLAFE  64

Query  261  FKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHE  440
            F+ G++VAADSRASMG YISSQSVKKI+EINPY+LGTMAGGAADCQFW RNLG +CRLHE
Sbjct  65   FQGGIIVAADSRASMGQYISSQSVKKILEINPYLLGTMAGGAADCQFWQRNLGTRCRLHE  124

Query  441  LANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFS  620
            LANKRRISVAGASKLLAN LYSYRGMGLS+GTMIAGWDE GP L+YVDSEGGR KG  FS
Sbjct  125  LANKRRISVAGASKLLANTLYSYRGMGLSMGTMIAGWDETGPALFYVDSEGGRTKGTLFS  184

Query  621  VGSGSPYAYGVLDNGYRFDLSVEEAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKL  800
            VGSGS YAYG+LD+GY+F++SVEEA EL RR+IYHATFRDGASGGVASVYH+GP GWKK+
Sbjct  185  VGSGSTYAYGILDSGYKFEMSVEEAVELGRRAIYHATFRDGASGGVASVYHIGPQGWKKI  244

Query  801  SGDDVGELHYHYYPVEAAAVEHEMTE  878
            SGDDV ELHY YYP E+ A   ++ E
Sbjct  245  SGDDVSELHYQYYPPESQASAPDVVE  270



>dbj|BAG92607.1| unnamed protein product [Oryza sativa Japonica Group]
Length=224

 Score =   398 bits (1023),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 190/224 (85%), Positives = 204/224 (91%), Gaps = 0/224 (0%)
 Frame = +3

Query  219  MVKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQ  398
            M+K  KGTTTLAFIF +GV+VAADSRASMGGYISSQ+V+KIIEINPYMLGTMAGGAADCQ
Sbjct  1    MLKHKKGTTTLAFIFDKGVIVAADSRASMGGYISSQTVRKIIEINPYMLGTMAGGAADCQ  60

Query  399  FWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYY  578
            FWHRNLG+KCRLHELANKRRIS+AGASKLLANILYSYRGMGLS+GTMIAGWDEKGPGLYY
Sbjct  61   FWHRNLGIKCRLHELANKRRISIAGASKLLANILYSYRGMGLSIGTMIAGWDEKGPGLYY  120

Query  579  VDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEEAAELARRSIYHATFRDGASGGV  758
            VDSEG RL G+RFSVGSGS YAYG+LD GYR+ + VEEAAELARR+IY ATFRDGASGG 
Sbjct  121  VDSEGARLMGSRFSVGSGSLYAYGILDEGYRYVMPVEEAAELARRAIYQATFRDGASGGC  180

Query  759  ASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEHEMTEVPIA  890
             SVYHVGPNGW KLSGDDVGELHY YYPVEA  VE EM + P A
Sbjct  181  VSVYHVGPNGWTKLSGDDVGELHYKYYPVEATPVEQEMADAPAA  224



>ref|XP_002994143.1| hypothetical protein SELMODRAFT_272351 [Selaginella moellendorffii]
 gb|EFJ04804.1| hypothetical protein SELMODRAFT_272351 [Selaginella moellendorffii]
Length=275

 Score =   400 bits (1027),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 191/266 (72%), Positives = 220/266 (83%), Gaps = 0/266 (0%)
 Frame = +3

Query  81   IDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLAFI  260
            +DFSGLE  +  +   S+         SF +P + D DGFQK A+ ++KPA GTTTLAF 
Sbjct  3    LDFSGLEPASLRQHSYSDPAAHWEPQCSFPLPKVADLDGFQKAAVDLLKPAHGTTTLAFE  62

Query  261  FKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHE  440
            F+ G++VAADSRASMG YISSQSVKKI+EINPY+LGTMAGGAADCQFW RNLG +CRLHE
Sbjct  63   FQGGIIVAADSRASMGQYISSQSVKKILEINPYLLGTMAGGAADCQFWQRNLGTRCRLHE  122

Query  441  LANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFS  620
            LANKRRISVAGASKLLAN LYSYRGMGLS+GTMIAGWDE GP L+YVDSEGGR KG  FS
Sbjct  123  LANKRRISVAGASKLLANTLYSYRGMGLSMGTMIAGWDETGPALFYVDSEGGRTKGTLFS  182

Query  621  VGSGSPYAYGVLDNGYRFDLSVEEAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKL  800
            VGSGS YAYG+LD+GY++++SVEEA EL RR+IYHATFRDGASGGVASVYH+GP GWKK+
Sbjct  183  VGSGSTYAYGILDSGYKYEMSVEEAVELGRRAIYHATFRDGASGGVASVYHIGPQGWKKI  242

Query  801  SGDDVGELHYHYYPVEAAAVEHEMTE  878
            SGDDV ELHY YYP E+ A   ++ E
Sbjct  243  SGDDVSELHYQYYPPESQASAPDVVE  268



>gb|AFW85803.1| hypothetical protein ZEAMMB73_646691 [Zea mays]
Length=263

 Score =   390 bits (1001),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 192/277 (69%), Positives = 214/277 (77%), Gaps = 20/277 (7%)
 Frame = +3

Query  60   LVVTMVRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKG  239
            L ++ +  +F+ L ++A   G+ +    E P VPS  +P   DFDGFQ     MVK  KG
Sbjct  5    LDMSALETNFANLTASA---GDDTYFSAEAPDVPSMVLPICDDFDGFQAATKDMVKNKKG  61

Query  240  TTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG  419
            TTTLAFIF +GV+VAADSRASMGGYISSQ+V+KIIEINPYMLGTMAGGAADCQFWHRNLG
Sbjct  62   TTTLAFIFDKGVIVAADSRASMGGYISSQTVRKIIEINPYMLGTMAGGAADCQFWHRNLG  121

Query  420  VKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGR  599
             KCRLHEL+NKRRIS+AGASKLLANILYSYRGMGLS+GTMIAGWDEKGPGLYYVDSEG R
Sbjct  122  TKCRLHELSNKRRISIAGASKLLANILYSYRGMGLSIGTMIAGWDEKGPGLYYVDSEGAR  181

Query  600  LKGNRFSVGSGSPYAYGVLDNGYRFDLSVEEAAELARRSIYHATFRDGASGGVASVYHVG  779
            L G                 N YRF +SVEEAAELARR+IY ATFRD ASGG  SVYHVG
Sbjct  182  LVG-----------------NSYRFSMSVEEAAELARRAIYGATFRDAASGGCVSVYHVG  224

Query  780  PNGWKKLSGDDVGELHYHYYPVEAAAVEHEMTEVPIA  890
            P+GW KLSGDDVGELHYHYYPV+   VE EM + P A
Sbjct  225  PDGWTKLSGDDVGELHYHYYPVQKTPVEQEMADAPTA  261



>ref|XP_002514943.1| proteasome subunit beta type 5,8, putative [Ricinus communis]
 gb|EEF47497.1| proteasome subunit beta type 5,8, putative [Ricinus communis]
Length=249

 Score =   388 bits (996),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 195/271 (72%), Positives = 213/271 (79%), Gaps = 27/271 (10%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRG--ESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTT  248
            +++D SG ESTAP+ G   SSE+ +      SF++P  +DFDGFQ +A Q +K AKGTTT
Sbjct  1    MKLDTSGFESTAPLFGASSSSEMVNGFSAPASFELPVTSDFDGFQSEAKQTLKHAKGTTT  60

Query  249  LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKC  428
            LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KC
Sbjct  61   LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKC  120

Query  429  RLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKG  608
            RLHELANKRRISV GASKLLANILY+YRGMGLSVGTM+AGWDE GPGLYYVDSEGGRLKG
Sbjct  121  RLHELANKRRISVTGASKLLANILYNYRGMGLSVGTMVAGWDETGPGLYYVDSEGGRLKG  180

Query  609  NRFSVGSGSPYAYGVLDNGYRFDLSVEEAAELARRSIYHATFRDGASGGVASVYHVGPNG  788
             RFSVGSGSPYAYGVLD+G                         G +     VY+VGPNG
Sbjct  181  TRFSVGSGSPYAYGVLDSG-------------------------GLTKFYVLVYYVGPNG  215

Query  789  WKKLSGDDVGELHYHYYPVEAAAVEHEMTEV  881
            WKKLSGDDVGELHYHYYPV  + VE EM EV
Sbjct  216  WKKLSGDDVGELHYHYYPVMPSTVEQEMVEV  246



>gb|AAL26914.1|AF323592_1 putative 20S proteasome beta subunit 5, partial [Prunus persica]
Length=201

 Score =   382 bits (981),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 184/201 (92%), Positives = 191/201 (95%), Gaps = 0/201 (0%)
 Frame = +3

Query  288  DSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISV  467
            +SRASMGGYISSQSV+KIIEINPYMLGTMAGGAADCQFWHRNLG+KCRLHELANKRRISV
Sbjct  1    NSRASMGGYISSQSVEKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISV  60

Query  468  AGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAY  647
             GASKLLANILYSYRGMGLSVGTMIAGWDE GPGLYYVDSEGGRLKG RFSVGSGSPYAY
Sbjct  61   TGASKLLANILYSYRGMGLSVGTMIAGWDETGPGLYYVDSEGGRLKGMRFSVGSGSPYAY  120

Query  648  GVLDNGYRFDLSVEEAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELH  827
            GVLD+GYR+D+SVEEAAELARR+IYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELH
Sbjct  121  GVLDDGYRYDMSVEEAAELARRAIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELH  180

Query  828  YHYYPVEAAAVEHEMTEVPIA  890
            YHYYPV   AVE EM EV  A
Sbjct  181  YHYYPVVEGAVEQEMVEVAAA  201



>gb|EMT01588.1| Proteasome subunit beta type-5-A [Aegilops tauschii]
Length=1520

 Score =   416 bits (1070),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 197/236 (83%), Positives = 216/236 (92%), Gaps = 0/236 (0%)
 Frame = +3

Query  189   FDGFQKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLG  368
             FDGFQK   +MV   KGTTTL+FIF +GV+VAADSRASMGGYISSQ+V+KIIEINPYMLG
Sbjct  1285  FDGFQKATKEMVNNKKGTTTLSFIFDKGVIVAADSRASMGGYISSQTVRKIIEINPYMLG  1344

Query  369   TMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAG  548
             TMAGGAADCQFWHRNLGVKCRLHELANKRRIS+AG+SK LANILYSYRGMGLS+GTMIAG
Sbjct  1345  TMAGGAADCQFWHRNLGVKCRLHELANKRRISIAGSSKTLANILYSYRGMGLSIGTMIAG  1404

Query  549   WDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEEAAELARRSIYHA  728
             +DE GPGLYYVDSEG RLKG+RFSVGSGS YAYG+LD GY+F++SVEEAAELARR+IYHA
Sbjct  1405  FDETGPGLYYVDSEGARLKGSRFSVGSGSLYAYGILDEGYKFNMSVEEAAELARRAIYHA  1464

Query  729   TFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEHEMTEVPIA*T  896
             TFRDGASGG  SVY+VGP+GWKKLSGDDVGELHYHYYPV+AA VE EM E P A T
Sbjct  1465  TFRDGASGGCVSVYYVGPDGWKKLSGDDVGELHYHYYPVQAAPVEQEMAEAPSAST  1520



>ref|NP_001265983.1| proteasome subunit beta type-5-like [Cicer arietinum]
 emb|CAA09603.1| 20S proteasome beta subunit [Cicer arietinum]
Length=238

 Score =   379 bits (972),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 187/268 (70%), Positives = 207/268 (77%), Gaps = 34/268 (13%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLA  254
            +++D SGLES   +    +++  E    PSF++PN  DFDGF K+AIQMVKPAKGTTTLA
Sbjct  1    MKLDTSGLESFPSLISHGNDVVGEFEAPPSFELPNSNDFDGFLKEAIQMVKPAKGTTTLA  60

Query  255  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  434
            FIFKEGVMVAAD                                  CQFWHRNLG+KCRL
Sbjct  61   FIFKEGVMVAAD----------------------------------CQFWHRNLGIKCRL  86

Query  435  HELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNR  614
            HELANKRRISV GASKLLANILYSYRGMGLSVGTMIAGWDE GPGLYYVDSEGGRLKG R
Sbjct  87   HELANKRRISVTGASKLLANILYSYRGMGLSVGTMIAGWDETGPGLYYVDSEGGRLKGTR  146

Query  615  FSVGSGSPYAYGVLDNGYRFDLSVEEAAELARRSIYHATFRDGASGGVASVYHVGPNGWK  794
            FSVGSGSPYAYGVLD+GY++D+S+EEA+ELARR+IYHATFRDGASGGVASVY+VGP GWK
Sbjct  147  FSVGSGSPYAYGVLDSGYKYDMSIEEASELARRAIYHATFRDGASGGVASVYYVGPTGWK  206

Query  795  KLSGDDVGELHYHYYPVEAAAVEHEMTE  878
            KLSGDDVGELHYHY PV  + VE EM E
Sbjct  207  KLSGDDVGELHYHYNPVTPSTVEQEMVE  234



>ref|XP_001751936.1| predicted protein [Physcomitrella patens]
 gb|EDQ83371.1| predicted protein, partial [Physcomitrella patens]
Length=236

 Score =   372 bits (954),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 178/236 (75%), Positives = 199/236 (84%), Gaps = 3/236 (1%)
 Frame = +3

Query  189  FDGFQKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLG  368
             DGFQK A+Q+VKPAKGTTTLAF+FK GV+VAADS ASMG  ISSQSVKKI+EINPY+LG
Sbjct  1    LDGFQKAAVQLVKPAKGTTTLAFVFKHGVIVAADSSASMGNSISSQSVKKILEINPYLLG  60

Query  369  TMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAG  548
            TMAGGAADCQFW RNLG +CRLHELANKR ISV GASKLLAN LYSYRGMGL +GTMIAG
Sbjct  61   TMAGGAADCQFWQRNLGTRCRLHELANKRHISVTGASKLLANTLYSYRGMGLFMGTMIAG  120

Query  549  WDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEEAAELARRSIYHA  728
            WDE GPGLYYVDSEGGR+KG RFSVGSGS YAYGVLD  ++ D+S++EA ELARRSIYHA
Sbjct  121  WDETGPGLYYVDSEGGRVKGTRFSVGSGSTYAYGVLDTVFKQDMSIDEAVELARRSIYHA  180

Query  729  TFRDGASGGVASV---YHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEHEMTEVPI  887
            T RDGASGGV  +      GP+GWKK+SGDD GELH+ YYPV+    E EM+E  +
Sbjct  181  TLRDGASGGVTLLKCSLLCGPSGWKKMSGDDGGELHHSYYPVQETPAEAEMSEASV  236



>gb|ACP43316.1| 20S proteasome beta subunit 5 [Citrus maxima]
Length=194

 Score =   367 bits (943),  Expect = 7e-124, Method: Compositional matrix adjust.
 Identities = 174/191 (91%), Positives = 182/191 (95%), Gaps = 0/191 (0%)
 Frame = +3

Query  309  GYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLL  488
            GYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRLHELANKRRISV GASKLL
Sbjct  1    GYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVTGASKLL  60

Query  489  ANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGY  668
            ANILYSYRGMGLSVGTMIAGWDE GPGLYYVDSEGGRLKG RFSVGSGSPYAYGVLD+GY
Sbjct  61   ANILYSYRGMGLSVGTMIAGWDETGPGLYYVDSEGGRLKGTRFSVGSGSPYAYGVLDSGY  120

Query  669  RFDLSVEEAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVE  848
            +FD+S+EEAAELARR+IYHATFRD ASGGVASVY+VGPNGWKKLSGDDVGELHYHYYPV 
Sbjct  121  KFDMSIEEAAELARRAIYHATFRDAASGGVASVYYVGPNGWKKLSGDDVGELHYHYYPVT  180

Query  849  AAAVEHEMTEV  881
             + VE EM EV
Sbjct  181  PSTVEQEMAEV  191



>ref|XP_003061052.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH54702.1| predicted protein [Micromonas pusilla CCMP1545]
Length=286

 Score =   366 bits (940),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 174/262 (66%), Positives = 210/262 (80%), Gaps = 4/262 (2%)
 Frame = +3

Query  75   VRIDFSGLES-TAPIRGESSELFDEIP---RVPSFQIPNITDFDGFQKDAIQMVKPAKGT  242
            +++DFS L++ T  I  E +E   EI       +F++P + ++D FQ++ +  VKP  GT
Sbjct  1    MKLDFSVLDAPTRKIDAEIAECAAEINSDVHAQNFKLPMVENYDSFQREVVDYVKPNHGT  60

Query  243  TTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGV  422
            TTL FIF+ GV++A DSRAS G YISSQ+VKK+IEINPY+LGTMAGGAADCQFW RNLG+
Sbjct  61   TTLGFIFEHGVVIAVDSRASQGPYISSQTVKKVIEINPYLLGTMAGGAADCQFWQRNLGI  120

Query  423  KCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRL  602
            +CRLHEL N +RISV+GASKLL+N LY YRG GLS+GTM+AGWD  GPGLYYVDS+G RL
Sbjct  121  QCRLHELENGKRISVSGASKLLSNTLYGYRGQGLSMGTMVAGWDLNGPGLYYVDSDGTRL  180

Query  603  KGNRFSVGSGSPYAYGVLDNGYRFDLSVEEAAELARRSIYHATFRDGASGGVASVYHVGP  782
            KG RFSVGSGS +AYGVLD GYR+DLSVE+A EL RR+IYHATFRD  SGG  SVYHVGP
Sbjct  181  KGKRFSVGSGSLFAYGVLDQGYRWDLSVEDACELGRRAIYHATFRDAFSGGTVSVYHVGP  240

Query  783  NGWKKLSGDDVGELHYHYYPVE  848
            +GW K+SG DVGELHY YYP +
Sbjct  241  DGWTKMSGTDVGELHYEYYPAD  262



>ref|XP_003083185.1| 20S proteasome, regulatory subunit beta type PSMB3/PUP3 (ISS) 
[Ostreococcus tauri]
 emb|CAL57460.1| Proteasome B-type subunit [Ostreococcus tauri]
Length=294

 Score =   366 bits (940),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 175/264 (66%), Positives = 203/264 (77%), Gaps = 6/264 (2%)
 Frame = +3

Query  75   VRIDFSGLEST------APIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAK  236
            V +D S L  T         R E+ +         +F  P + DFD FQ++ I  VKPA 
Sbjct  3    VNLDLSFLHDTERGAASTKYRDEALQGVSNSVHASNFTAPAVEDFDAFQREVINYVKPAH  62

Query  237  GTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNL  416
            GTTTL FIF+ G+++A DSRAS G YISSQ+VKK+IEINP++LGTMAGGAADCQFW RNL
Sbjct  63   GTTTLGFIFEHGIVIAVDSRASQGPYISSQTVKKVIEINPFLLGTMAGGAADCQFWQRNL  122

Query  417  GVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGG  596
            G++CRLHEL N +RI+V  ASKLLAN LYSY+G GLS+GTMIAGWD  GPGLYYVDSEG 
Sbjct  123  GIQCRLHELENGKRITVRAASKLLANTLYSYKGRGLSMGTMIAGWDLNGPGLYYVDSEGT  182

Query  597  RLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEEAAELARRSIYHATFRDGASGGVASVYHV  776
            RLKG RFSVGSGS +AYGVLD GYR+DLSV+EA EL RR+IYHATFRD  SGG  SVYHV
Sbjct  183  RLKGQRFSVGSGSLFAYGVLDQGYRWDLSVKEACELGRRAIYHATFRDAFSGGTVSVYHV  242

Query  777  GPNGWKKLSGDDVGELHYHYYPVE  848
            G NGW K++GDDVGELH+HYYP E
Sbjct  243  GKNGWTKVTGDDVGELHFHYYPSE  266



>ref|XP_007514496.1| predicted protein [Bathycoccus prasinos]
 emb|CCO14736.1| predicted protein [Bathycoccus prasinos]
Length=311

 Score =   365 bits (937),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 174/271 (64%), Positives = 208/271 (77%), Gaps = 11/271 (4%)
 Frame = +3

Query  66   VTMVRIDFSGLESTAPIRGESSELFDEIP---------RVPSFQIPNITDFDGFQKDAIQ  218
            +T + +DFS L+   P+R E+ EL   +              F IP + DF  FQKD ++
Sbjct  1    MTSLNLDFSVLDR--PVRKEADELTSTLENDVLCGINTHDQYFTIPRVEDFSRFQKDVVE  58

Query  219  MVKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQ  398
             VKP  GTTTL FIF+ G+++A DSRAS G YISSQ+VKK+IEINP++LGTMAGGAADCQ
Sbjct  59   HVKPQHGTTTLGFIFEHGIIIAVDSRASQGPYISSQTVKKVIEINPFLLGTMAGGAADCQ  118

Query  399  FWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYY  578
            FW RNLG++CRLHEL   +RI+V GASKLLAN LY YRG GLS+GTM+AGWD  GPGL+Y
Sbjct  119  FWQRNLGIQCRLHELETGKRITVTGASKLLANTLYGYRGRGLSMGTMVAGWDTTGPGLFY  178

Query  579  VDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEEAAELARRSIYHATFRDGASGGV  758
            VDS+G RLKG RFSVGSGS +AYGVLD G+R DLS++EAAEL RR+IYHATFRD  SGG 
Sbjct  179  VDSDGTRLKGKRFSVGSGSLFAYGVLDQGFRHDLSIKEAAELGRRAIYHATFRDAFSGGT  238

Query  759  ASVYHVGPNGWKKLSGDDVGELHYHYYPVEA  851
             SVYHVGP+GW K+SG DVGELHY YYP +A
Sbjct  239  VSVYHVGPDGWTKMSGTDVGELHYEYYPADA  269



>gb|ABE68720.1| 20S proteasome beta subunit [Arachis hypogaea]
Length=223

 Score =   361 bits (926),  Expect = 6e-121, Method: Compositional matrix adjust.
 Identities = 171/194 (88%), Positives = 180/194 (93%), Gaps = 0/194 (0%)
 Frame = +3

Query  297  ASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGA  476
            ASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRLHELANKRRISV GA
Sbjct  26   ASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVTGA  85

Query  477  SKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVL  656
            SKLLANILYSYRGMGLSVGTMIAGWDE GPGLYYVDSEGGRLKG RFSVGSGSPYAYG+L
Sbjct  86   SKLLANILYSYRGMGLSVGTMIAGWDETGPGLYYVDSEGGRLKGTRFSVGSGSPYAYGIL  145

Query  657  DNGYRFDLSVEEAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  836
            D+GYR+DLSV+EA EL RR+IYHATFRDGASGGV SVYHVGP GWKK +GDDVG+LHY Y
Sbjct  146  DSGYRYDLSVDEAVELGRRAIYHATFRDGASGGVVSVYHVGPEGWKKWTGDDVGDLHYQY  205

Query  837  YPVEAAAVEHEMTE  878
            YPV  + VE EM E
Sbjct  206  YPVVPSTVEQEMAE  219



>ref|XP_001421201.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO99494.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=297

 Score =   363 bits (932),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 176/262 (67%), Positives = 208/262 (79%), Gaps = 10/262 (4%)
 Frame = +3

Query  81   IDFSGLESTAPIRG--------ESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAK  236
            +DFS L++TA  RG        ES +  D      +F+ P + DF+GFQ++ I  VKP  
Sbjct  6    LDFSFLDATA--RGSMASKHVDESLDAIDGNMHECNFKAPAVEDFEGFQREVINYVKPNH  63

Query  237  GTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNL  416
            GTTTLAFIF+ G++VA DSRAS G YISSQ+VKK+IEINP++LGTMAGGAADCQFW RNL
Sbjct  64   GTTTLAFIFEHGIVVAVDSRASQGPYISSQTVKKVIEINPFLLGTMAGGAADCQFWQRNL  123

Query  417  GVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGG  596
            G++CRLHEL N +RI+V  ASKLLAN LYSY+G GLS+GTM+AGWD  GPGLYYVDSEG 
Sbjct  124  GIQCRLHELENGKRITVRAASKLLANTLYSYKGKGLSMGTMVAGWDLNGPGLYYVDSEGT  183

Query  597  RLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEEAAELARRSIYHATFRDGASGGVASVYHV  776
            RLKG RFSVGSGS +AYGVLD GY++DL+VEEA EL RR+IYHATFRD  SGG  SVYHV
Sbjct  184  RLKGQRFSVGSGSLFAYGVLDQGYKWDLTVEEACELGRRAIYHATFRDAFSGGTVSVYHV  243

Query  777  GPNGWKKLSGDDVGELHYHYYP  842
            G NGW K++GDDVGELH+ YYP
Sbjct  244  GANGWTKVTGDDVGELHFSYYP  265



>ref|XP_002506817.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO68075.1| predicted protein [Micromonas sp. RCC299]
Length=291

 Score =   360 bits (923),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 171/262 (65%), Positives = 206/262 (79%), Gaps = 4/262 (2%)
 Frame = +3

Query  75   VRIDFSGLES----TAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGT  242
            +++D+S L++    T  I  + +          +F++P + ++D FQ++ +  VKP  GT
Sbjct  4    LKLDYSVLDAPQRATDRIEADCAREIHGDVHAQNFKLPMVENYDEFQREVVDYVKPNHGT  63

Query  243  TTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGV  422
            TTL FIF+ GV++A DSRAS G YISSQ+VKK+IEINPY+LGTMAGGAADCQFW RNLG+
Sbjct  64   TTLGFIFEHGVVIAVDSRASQGPYISSQTVKKVIEINPYLLGTMAGGAADCQFWQRNLGI  123

Query  423  KCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRL  602
            +CRLHEL N +RISVAGASKLLAN LY YRG GLS+GTM+AGWD KGPGLYYVDS+G RL
Sbjct  124  QCRLHELENGKRISVAGASKLLANTLYGYRGQGLSMGTMVAGWDLKGPGLYYVDSDGTRL  183

Query  603  KGNRFSVGSGSPYAYGVLDNGYRFDLSVEEAAELARRSIYHATFRDGASGGVASVYHVGP  782
            KG RFSVGSGS +AYGVLD GYR+DLSVEEA EL RR+IYHATFRD  SGG  SVYHV  
Sbjct  184  KGQRFSVGSGSLFAYGVLDQGYRWDLSVEEACELGRRAIYHATFRDAFSGGTISVYHVNE  243

Query  783  NGWKKLSGDDVGELHYHYYPVE  848
            NGW K+SG DVGELH+ YYP +
Sbjct  244  NGWTKVSGTDVGELHFEYYPAD  265



>gb|KCW61971.1| hypothetical protein EUGRSUZ_H04655 [Eucalyptus grandis]
Length=201

 Score =   353 bits (906),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 168/198 (85%), Positives = 181/198 (91%), Gaps = 0/198 (0%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLA  254
            +++D SGLEST P+ G + ELF+     P+F+IP   DFD FQK+A+QMVKPAKGTTTLA
Sbjct  1    MKLDTSGLESTMPVFGVNKELFEGFSAAPAFEIPGACDFDNFQKEAVQMVKPAKGTTTLA  60

Query  255  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  434
            FIFKEGVMVAADSRASMGGYISSQSVKKIIEINP+MLGTMAGGAADCQFWHRNLG+KCRL
Sbjct  61   FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPHMLGTMAGGAADCQFWHRNLGIKCRL  120

Query  435  HELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNR  614
            HELANKRRISV GASKLLANILYSYRGMGLSVGTMIAGWDE GPGLYYVDSEGGRLKG R
Sbjct  121  HELANKRRISVTGASKLLANILYSYRGMGLSVGTMIAGWDETGPGLYYVDSEGGRLKGTR  180

Query  615  FSVGSGSPYAYGVLDNGY  668
            FSVGSGSPYAYGVLD+GY
Sbjct  181  FSVGSGSPYAYGVLDSGY  198



>emb|CAC43326.1| putative beta5 proteasome subunit [Nicotiana tabacum]
Length=174

 Score =   351 bits (900),  Expect = 9e-118, Method: Compositional matrix adjust.
 Identities = 170/174 (98%), Positives = 173/174 (99%), Gaps = 0/174 (0%)
 Frame = +3

Query  297  ASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGA  476
            ASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRLHELANKRR SVAGA
Sbjct  1    ASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRTSVAGA  60

Query  477  SKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVL  656
            SKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVL
Sbjct  61   SKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVL  120

Query  657  DNGYRFDLSVEEAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVG  818
            D+GYRFDLSVEEAAELARR+IYHATFRDGASGGVASVYHVGPNGWKKLSGDDVG
Sbjct  121  DSGYRFDLSVEEAAELARRAIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVG  174



>ref|XP_007045045.1| N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily 
protein isoform 3, partial [Theobroma cacao]
 gb|EOY00877.1| N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily 
protein isoform 3, partial [Theobroma cacao]
Length=213

 Score =   352 bits (903),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 169/196 (86%), Positives = 179/196 (91%), Gaps = 0/196 (0%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLA  254
            +++D SGLES  P+    +EL D     PSF++PN TDFDGFQK+AIQMVKPAKGTTTLA
Sbjct  1    MKLDTSGLESAEPVWATFNELADGFSAAPSFELPNTTDFDGFQKEAIQMVKPAKGTTTLA  60

Query  255  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  434
            FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRL
Sbjct  61   FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRL  120

Query  435  HELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNR  614
            HELANKRRISV GASKLLANILYSYRGMGLSVGTMIAGWDE GPGLYYVDSEGGRLKG R
Sbjct  121  HELANKRRISVTGASKLLANILYSYRGMGLSVGTMIAGWDETGPGLYYVDSEGGRLKGMR  180

Query  615  FSVGSGSPYAYGVLDN  662
            FSVGSGSPYAYGVLD+
Sbjct  181  FSVGSGSPYAYGVLDS  196



>ref|XP_005643539.1| 20S proteasome beta subunit E, type beta 5 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE18995.1| 20S proteasome beta subunit E, type beta 5 [Coccomyxa subellipsoidea 
C-169]
Length=276

 Score =   351 bits (901),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 171/277 (62%), Positives = 207/277 (75%), Gaps = 5/277 (2%)
 Frame = +3

Query  72   MVRIDFSGLESTAPIRGESSELFDEIPRVPS----FQIPNITDFDGFQKDAIQMVKPAKG  239
            M ++DFS L S  P+  +S    +++  + S    F +P + D D F+ + +  VKP  G
Sbjct  1    MDKLDFSALCSR-PLSEKSGACVEDVASITSAVQDFPLPQVQDVDRFENEVMSYVKPNHG  59

Query  240  TTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG  419
            TTTL FIFK GV++A DSRASMG YISSQ+VKK+IEINPY+LGTMAGGAADCQFW RNLG
Sbjct  60   TTTLGFIFKYGVIIAVDSRASMGSYISSQTVKKVIEINPYLLGTMAGGAADCQFWQRNLG  119

Query  420  VKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGR  599
             +CRL+EL N +RISV  ASKLLAN+++SY+G GLS+GTM+AG+D  GPGLYYVDS+G R
Sbjct  120  QQCRLYELNNGKRISVRAASKLLANVMFSYKGYGLSMGTMVAGYDPTGPGLYYVDSDGQR  179

Query  600  LKGNRFSVGSGSPYAYGVLDNGYRFDLSVEEAAELARRSIYHATFRDGASGGVASVYHVG  779
             KG  FSVGSGS YAYGVLDNGY++D+ VE+A EL RRSIYHATFRD  SGG  SVYHV 
Sbjct  180  TKGQIFSVGSGSLYAYGVLDNGYKWDMDVEDAIELGRRSIYHATFRDAVSGGTVSVYHVT  239

Query  780  PNGWKKLSGDDVGELHYHYYPVEAAAVEHEMTEVPIA  890
             +GWKK+ GDDVGELHY YYP   A   H    +  A
Sbjct  240  ADGWKKVRGDDVGELHYEYYPTPEAHPCHRADPLETA  276



>ref|XP_005851025.1| hypothetical protein CHLNCDRAFT_56983 [Chlorella variabilis]
 gb|EFN58923.1| hypothetical protein CHLNCDRAFT_56983 [Chlorella variabilis]
Length=275

 Score =   348 bits (893),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 175/283 (62%), Positives = 211/283 (75%), Gaps = 15/283 (5%)
 Frame = +3

Query  72   MVRIDFSGLESTA-----PIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAK  236
            M+++D S LE  A     P   E++ +      V SF +P + D D F+++ ++ VKP  
Sbjct  1    MMKLDLSCLEPAAGAGREPCGLEAAGVSGVA--VDSFPLPAVADIDSFEREVVEYVKPNH  58

Query  237  GTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNL  416
            GTTTL FIF+ GV++A DSRAS G YISSQ+VKK+IEINP++LGTMAGGAADCQFW RNL
Sbjct  59   GTTTLGFIFQGGVIIAVDSRASQGSYISSQTVKKVIEINPHLLGTMAGGAADCQFWERNL  118

Query  417  GVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGG  596
            G +CRL+ELAN +RI+V GASKLLAN ++SYRGMGLS+GTM+AGWDE GPGLYYVDS+G 
Sbjct  119  GRQCRLYELANGKRITVRGASKLLANTMFSYRGMGLSMGTMVAGWDEAGPGLYYVDSDGQ  178

Query  597  RLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEEAAELARRSIYHATFRDGASGGVASVYHV  776
            R KG  FSVGSGS YAYGVLD GYR+DLSVEEA EL +RSIYHATFRD ASGG  S YHV
Sbjct  179  RTKGKLFSVGSGSLYAYGVLDEGYRWDLSVEEAVELGQRSIYHATFRDAASGGTVSAYHV  238

Query  777  GPNGWKKLSGDDVGELHYHYYPVEAAAVEHEMTEVPIA*TDPF  905
               GW K+ G+DVG+LH++YYP   A  EH     P    DP 
Sbjct  239  TQEGWTKVRGEDVGQLHFNYYP---APEEH-----PCNSKDPL  273



>ref|XP_002950006.1| hypothetical protein VOLCADRAFT_74437 [Volvox carteri f. nagariensis]
 gb|EFJ49109.1| hypothetical protein VOLCADRAFT_74437 [Volvox carteri f. nagariensis]
Length=272

 Score =   347 bits (889),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 168/272 (62%), Positives = 207/272 (76%), Gaps = 6/272 (2%)
 Frame = +3

Query  78   RIDFSGLESTAPIRGES--SELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTL  251
            ++D   LE  A  +G     +L  ++P   SF +P + D D F+++ ++MVKP  GTTTL
Sbjct  4    KLDLGILEPNAGRKGPGLGPDLQLDVP-TASFPLPAVQDLDKFEREVVEMVKPCHGTTTL  62

Query  252  AFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCR  431
             FIF+ GV++A DSRA+MG +ISSQ+VKK+IEIN +++GTMAGGAADCQFW RNLG++CR
Sbjct  63   GFIFQHGVIIAVDSRATMGSFISSQTVKKVIEINKHLIGTMAGGAADCQFWQRNLGMRCR  122

Query  432  LHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGN  611
            L+EL N +RI+V  ASKLLAN ++SYRGMGLS+GTM+AGWD  GPGLYYVDS+G R KG 
Sbjct  123  LYELNNGKRITVCAASKLLANTMFSYRGMGLSMGTMVAGWDSTGPGLYYVDSDGQRTKGQ  182

Query  612  RFSVGSGSPYAYGVLDNGYRFDLSVEEAAELARRSIYHATFRDGASGGVASVYHVGPNGW  791
             FSVGSGS YAYGVLD+GYR+DLSVEEA EL RRSIYHA FRD ASGG  SVYHV  +GW
Sbjct  183  IFSVGSGSLYAYGVLDSGYRWDLSVEEAIELGRRSIYHAGFRDCASGGTVSVYHVTQDGW  242

Query  792  KKLSGDDVGELHYHYYPVEAAAVEHEMTEVPI  887
             K+ GDDV ELHY YYP  A   +H  T   +
Sbjct  243  TKVRGDDVTELHYQYYPDPA---QHPATATSV  271



>ref|XP_001698605.1| 20S proteasome beta subunit E, type beta 5 [Chlamydomonas reinhardtii]
 gb|EDP08098.1| 20S proteasome beta subunit E, type beta 5 [Chlamydomonas reinhardtii]
Length=273

 Score =   343 bits (880),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 156/227 (69%), Positives = 188/227 (83%), Gaps = 0/227 (0%)
 Frame = +3

Query  162  SFQIPNITDFDGFQKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKI  341
            SF +P + D D F+++ ++MVKP  GTTTL FIF+ GV++A DSRA+MG YISSQ+VKK+
Sbjct  34   SFPLPAVQDVDKFEREVVEMVKPCHGTTTLGFIFQHGVIIAVDSRATMGAYISSQTVKKV  93

Query  342  IEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMG  521
            IEIN ++LGTMAGGAADCQFW RNLG++CRL+EL N +RI+V  ASKLL+N+++SYRGMG
Sbjct  94   IEINKFLLGTMAGGAADCQFWQRNLGMQCRLYELNNGKRITVRAASKLLSNVMFSYRGMG  153

Query  522  LSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEEAAE  701
            LS+GTM+AGWD  GPGLYYVDS+G R KG  FSVGSGS YAYGVLD GYR+D+ VEEA E
Sbjct  154  LSMGTMVAGWDPTGPGLYYVDSDGQRTKGQIFSVGSGSLYAYGVLDAGYRWDMPVEEAVE  213

Query  702  LARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYP  842
            L RRSIYHA FRD ASGG  SVYHV  +GW K+ GDD+ ELHY YYP
Sbjct  214  LGRRSIYHAGFRDCASGGTVSVYHVTQDGWTKVRGDDISELHYQYYP  260



>gb|KDO81953.1| hypothetical protein CISIN_1g022125mg [Citrus sinensis]
Length=212

 Score =   339 bits (870),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 165/197 (84%), Positives = 174/197 (88%), Gaps = 0/197 (0%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLA  254
            +++D SGLEST+P  G   EL  E+   PSF +P  TDFD FQKD    +K AKGTTTLA
Sbjct  1    MKLDTSGLESTSPFFGSGDELCPELSAAPSFSLPLSTDFDEFQKDTKATLKHAKGTTTLA  60

Query  255  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  434
            FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRL
Sbjct  61   FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRL  120

Query  435  HELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNR  614
            HELANKRRISV GASKLLANILYSYRGMGLSVGTMIAGWDE GPGLYYVDSEGGRLKG R
Sbjct  121  HELANKRRISVTGASKLLANILYSYRGMGLSVGTMIAGWDETGPGLYYVDSEGGRLKGTR  180

Query  615  FSVGSGSPYAYGVLDNG  665
            FSVGSGSPYAYGVLD+G
Sbjct  181  FSVGSGSPYAYGVLDSG  197



>ref|XP_006438071.1| hypothetical protein CICLE_v10032238mg [Citrus clementina]
 gb|ESR51311.1| hypothetical protein CICLE_v10032238mg [Citrus clementina]
Length=271

 Score =   338 bits (867),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 165/197 (84%), Positives = 174/197 (88%), Gaps = 0/197 (0%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLA  254
            +++D SGLEST+P  G   EL  E+   PSF +P  TDFD FQKD    +K AKGTTTLA
Sbjct  1    MKLDTSGLESTSPFFGSGDELCPELLAAPSFALPLSTDFDEFQKDTKATLKHAKGTTTLA  60

Query  255  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  434
            FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRL
Sbjct  61   FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRL  120

Query  435  HELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNR  614
            HELANKRRISV GASKLLANILYSYRGMGLSVGTMIAGWDE GPGLYYVDSEGGRLKG R
Sbjct  121  HELANKRRISVTGASKLLANILYSYRGMGLSVGTMIAGWDETGPGLYYVDSEGGRLKGTR  180

Query  615  FSVGSGSPYAYGVLDNG  665
            FSVGSGSPYAYGVLD+G
Sbjct  181  FSVGSGSPYAYGVLDSG  197


 Score = 83.2 bits (204),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 43/73 (59%), Positives = 52/73 (71%), Gaps = 0/73 (0%)
 Frame = +1

Query  652  FLIMGTGLICLLKKLQSWLGGLFIMQRSVMELVEVLPVFTMLGQMDGRNCRVMMLESFTT  831
            + ++ +GL CLLKKL+SWL  LFIMQ S M+ V VL  F M  QMDGR+C VMMLESFTT
Sbjct  191  YGVLDSGLTCLLKKLRSWLEELFIMQHSEMQPVVVLQAFIMWDQMDGRSCLVMMLESFTT  250

Query  832  ITTQLKQQQWSMK  870
            I  Q +  +WS K
Sbjct  251  IIIQSRPVRWSKK  263



>ref|XP_011396916.1| Proteasome subunit beta type-5-B [Auxenochlorella protothecoides]
 gb|KFM24035.1| Proteasome subunit beta type-5-B [Auxenochlorella protothecoides]
Length=277

 Score =   337 bits (863),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 159/232 (69%), Positives = 189/232 (81%), Gaps = 3/232 (1%)
 Frame = +3

Query  156  VPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVK  335
            + +F +P + D D F+K+ ++ VKP+ GTTTL FIF+ GV+VA DSRAS G YISSQ+VK
Sbjct  31   IDAFPLPAVADLDSFEKEVVEYVKPSHGTTTLGFIFQGGVIVAVDSRASQGSYISSQTVK  90

Query  336  KIIEINPYMLGTMAGGAADCQFWHRNLG---VKCRLHELANKRRISVAGASKLLANILYS  506
            K+IEINP++LGTMAGGAADCQFW RNLG   V CRL+EL N +RI+V GASKLLAN ++S
Sbjct  91   KVIEINPFLLGTMAGGAADCQFWERNLGRQVVWCRLYELNNGKRITVRGASKLLANTMFS  150

Query  507  YRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSV  686
            YRGMGLS+GTM+AGWD  GPGLYYVDS+G R KG RFSVGSGS YAYGVLD GY +D+SV
Sbjct  151  YRGMGLSMGTMVAGWDVAGPGLYYVDSDGQRTKGQRFSVGSGSLYAYGVLDAGYSWDMSV  210

Query  687  EEAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYP  842
            E+A EL +R+IYHAT RD ASGG ASVYHV   GW K+ G+ VGELHY YYP
Sbjct  211  EDAVELGQRAIYHATARDAASGGTASVYHVTEAGWTKVRGESVGELHYKYYP  262



>gb|KDD75121.1| proteasome subunit protein [Helicosporidium sp. ATCC 50920]
Length=241

 Score =   319 bits (817),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 150/218 (69%), Positives = 179/218 (82%), Gaps = 0/218 (0%)
 Frame = +3

Query  189  FDGFQKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLG  368
             DGF++  ++ VKP+ GTTTL FIF+ GV++A DSRAS G Y+SSQ+VKK+IEINPY+LG
Sbjct  9    LDGFERSVVEYVKPSHGTTTLGFIFQGGVIIAVDSRASQGSYLSSQTVKKVIEINPYLLG  68

Query  369  TMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAG  548
            TMAGGAADCQFW RNLG +CRL+EL   RRI+V  ASKLLAN ++SYRGMGLS+GTMIAG
Sbjct  69   TMAGGAADCQFWERNLGRQCRLYELKEGRRITVKAASKLLANTMFSYRGMGLSMGTMIAG  128

Query  549  WDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEEAAELARRSIYHA  728
            WD  GPGLYYVDS+G R  G RFSVGSGS YAYGVLD GY +D+SVE+A EL +R+I+HA
Sbjct  129  WDIGGPGLYYVDSDGQRTGGQRFSVGSGSLYAYGVLDTGYSWDMSVEDAVELGQRAIFHA  188

Query  729  TFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYP  842
            T RD ASGG ASVYHV  +GW K+ GD VG+L+Y Y P
Sbjct  189  TSRDAASGGTASVYHVTESGWTKVRGDAVGDLYYKYNP  226



>gb|AFW85805.1| hypothetical protein ZEAMMB73_646691 [Zea mays]
Length=203

 Score =   308 bits (788),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 150/201 (75%), Positives = 166/201 (83%), Gaps = 4/201 (2%)
 Frame = +3

Query  75   VRIDFSGLEST----APIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGT  242
            +++D S LE+         G+ +    E P VPS  +P   DFDGFQ     MVK  KGT
Sbjct  3    MKLDMSALETNFANLTASAGDDTYFSAEAPDVPSMVLPICDDFDGFQAATKDMVKNKKGT  62

Query  243  TTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGV  422
            TTLAFIF +GV+VAADSRASMGGYISSQ+V+KIIEINPYMLGTMAGGAADCQFWHRNLG 
Sbjct  63   TTLAFIFDKGVIVAADSRASMGGYISSQTVRKIIEINPYMLGTMAGGAADCQFWHRNLGT  122

Query  423  KCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRL  602
            KCRLHEL+NKRRIS+AGASKLLANILYSYRGMGLS+GTMIAGWDEKGPGLYYVDSEG RL
Sbjct  123  KCRLHELSNKRRISIAGASKLLANILYSYRGMGLSIGTMIAGWDEKGPGLYYVDSEGARL  182

Query  603  KGNRFSVGSGSPYAYGVLDNG  665
             GNRFSVGSGS YAYG+LD+G
Sbjct  183  VGNRFSVGSGSLYAYGILDDG  203



>gb|EIE77859.1| proteasome component PRE2 [Rhizopus delemar RA 99-880]
Length=277

 Score =   309 bits (792),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 150/241 (62%), Positives = 182/241 (76%), Gaps = 6/241 (2%)
 Frame = +3

Query  159  PSFQIPNITDFDGFQKDAIQ------MVKPAKGTTTLAFIFKEGVMVAADSRASMGGYIS  320
            PSF +P I +   F ++          +K   GTTTLAF F+ GV+VA DSRA+MG YIS
Sbjct  37   PSFDVPAIHNPVDFLRNVTDEESPEYKIKIQHGTTTLAFQFQGGVVVAVDSRATMGNYIS  96

Query  321  SQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANIL  500
            SQ+VKK+IEINPY+LGTMAGGAADCQ+W R LG +CRLHEL NK RISVA ASKLLAN++
Sbjct  97   SQTVKKVIEINPYLLGTMAGGAADCQYWERELGRRCRLHELRNKERISVAAASKLLANMV  156

Query  501  YSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDL  680
            YSY+GMGLS+GTM+ GWD+ GP L+YVDS+G RLKG+ FSVGSGS +AYGVLD+GY +DL
Sbjct  157  YSYKGMGLSMGTMVTGWDKTGPNLFYVDSDGSRLKGDIFSVGSGSTFAYGVLDSGYNYDL  216

Query  681  SVEEAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAV  860
            SV++A EL RRSIYHAT RD  SGG  ++YHV  NGW      DVGELH+ Y    A  +
Sbjct  217  SVKDALELGRRSIYHATHRDAMSGGSVNLYHVTENGWDYHGNHDVGELHWEYQDENAKGM  276

Query  861  E  863
            +
Sbjct  277  Q  277



>emb|CEG76257.1| Putative Proteasome subunit beta type [Rhizopus microsporus]
Length=277

 Score =   306 bits (784),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 146/241 (61%), Positives = 184/241 (76%), Gaps = 6/241 (2%)
 Frame = +3

Query  159  PSFQIPNITDFDGFQKDAIQ------MVKPAKGTTTLAFIFKEGVMVAADSRASMGGYIS  320
            P+F +P + +   F ++          +K   GTTTLAF F+ GV+VA DSRA+MG YI+
Sbjct  37   PTFDVPAVHNPVDFLRNVTDEESPEYKIKIQHGTTTLAFQFQGGVVVAVDSRATMGNYIA  96

Query  321  SQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANIL  500
            SQ+VKK+IEINPY+LGT+AGGAADCQ+W R LG +CRLHEL NK RISVA ASKLLAN++
Sbjct  97   SQTVKKVIEINPYLLGTLAGGAADCQYWERELGRRCRLHELRNKERISVAAASKLLANMV  156

Query  501  YSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDL  680
            YSY+GMGLS+GTM+ GWD+ GP L+YVDS+G RLKG+ FSVGSGS +AYGVLD+GY FDL
Sbjct  157  YSYKGMGLSMGTMVTGWDKTGPNLFYVDSDGSRLKGDIFSVGSGSTFAYGVLDSGYDFDL  216

Query  681  SVEEAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAV  860
            SV++A EL RRSIYHAT RD  SGG  ++YHV  NGW+     DVG+LH+ Y    A ++
Sbjct  217  SVKDALELGRRSIYHATHRDAMSGGSVNLYHVTENGWEYHGNHDVGQLHWDYQDENAKSM  276

Query  861  E  863
            +
Sbjct  277  Q  277



>ref|XP_002678668.1| predicted protein [Naegleria gruberi]
 gb|EFC45924.1| predicted protein [Naegleria gruberi]
Length=300

 Score =   306 bits (785),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 159/291 (55%), Positives = 203/291 (70%), Gaps = 11/291 (4%)
 Frame = +3

Query  21   P*VESTPSFYSRYLVVTMVRIDFSGLESTAPIRGESSELFDEIPRV-------PSFQIPN  179
            P  ++T SF     + +++  DF+ L S  P   ++  L D    +         F +P 
Sbjct  5    PSTKTTKSFKQGANLSSVLSSDFTSL-SIGPQDEDNVILQDPCLDISYGLDGQQGFALPP  63

Query  180  ITDFDGF--QKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEIN  353
              +  GF  QK+ ++    AKGTTTL F+F +G+++A DSRASMG YISSQ+VKK+IEIN
Sbjct  64   SLNNSGFIHQKEKLEKTY-AKGTTTLGFVFNKGIVIAVDSRASMGNYISSQNVKKVIEIN  122

Query  354  PYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVG  533
            PY+LGTMAGGAADCQFW R LG++CRL+EL NKRRISVA ASKLL+NI+Y Y+  GLS+G
Sbjct  123  PYLLGTMAGGAADCQFWERYLGMQCRLYELRNKRRISVAAASKLLSNIVYQYKDHGLSMG  182

Query  534  TMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEEAAELARR  713
            TMIAGWD  GP L+ VD++G RLKG RFSVGSGS YAYGVLD GYR DL+ EEA EL RR
Sbjct  183  TMIAGWDHTGPNLFMVDNDGTRLKGTRFSVGSGSLYAYGVLDQGYRADLTEEEACELGRR  242

Query  714  SIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEH  866
            +IYHAT RD  SGG+ +VY +  +GW K+S  D+ ELHY  Y  E   +++
Sbjct  243  AIYHATHRDAYSGGIINVYLIRSDGWTKISSTDMNELHYGKYAPEKGILDN  293



>gb|KFH71396.1| 20S proteasome subunit beta 5 [Mortierella verticillata NRRL 
6337]
Length=278

 Score =   301 bits (771),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 146/240 (61%), Positives = 182/240 (76%), Gaps = 5/240 (2%)
 Frame = +3

Query  156  VPSFQIP---NITDFDGFQKDAI--QMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYIS  320
            +P+F IP   N TDF     DA     ++   GTTTLAF F+ G++VA DSRAS G YI+
Sbjct  38   LPAFDIPMVANPTDFLRAHTDASAENRIRIQHGTTTLAFKFQGGIIVAVDSRASGGSYIA  97

Query  321  SQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANIL  500
            SQ+VKK+IEINPY+LGTMAGGAADCQ+W R LG +CRL+EL NK RISVA ASK+L+N++
Sbjct  98   SQTVKKVIEINPYLLGTMAGGAADCQYWERELGRRCRLYELRNKERISVAAASKILSNMV  157

Query  501  YSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDL  680
            Y Y+GMGLS+GTMI GWD+ GP L+YVDS+G R++G RFSVGSGS +AYGVLD GY F+L
Sbjct  158  YDYKGMGLSMGTMITGWDKTGPALFYVDSDGTRMRGERFSVGSGSTFAYGVLDTGYDFNL  217

Query  681  SVEEAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAV  860
            SV +A EL RR+IYHAT RD  SGG  +V+HV   GW+ +   DVGELH+HY+     A+
Sbjct  218  SVPDAIELGRRAIYHATHRDAYSGGSVNVFHVKETGWEFIGNYDVGELHWHYHAQPKGAI  277



>gb|KDO81951.1| hypothetical protein CISIN_1g022125mg [Citrus sinensis]
Length=302

 Score =   273 bits (697),  Expect(2) = 1e-96, Method: Compositional matrix adjust.
 Identities = 132/161 (82%), Positives = 140/161 (87%), Gaps = 0/161 (0%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLA  254
            +++D SGLEST+P  G   EL  E+   PSF +P  TDFD FQKD    +K AKGTTTLA
Sbjct  1    MKLDTSGLESTSPFFGSGDELCPELSAAPSFSLPLSTDFDEFQKDTKATLKHAKGTTTLA  60

Query  255  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  434
            FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRL
Sbjct  61   FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRL  120

Query  435  HELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDE  557
            HELANKRRISV GASKLLANILYSYRGMGLSVGTMIAGWDE
Sbjct  121  HELANKRRISVTGASKLLANILYSYRGMGLSVGTMIAGWDE  161


 Score =   109 bits (273),  Expect(2) = 1e-96, Method: Compositional matrix adjust.
 Identities = 62/104 (60%), Positives = 68/104 (65%), Gaps = 0/104 (0%)
 Frame = +1

Query  559  RVQDSIMWIVKVDG*RETDSLWDLVLHMLMEFLIMGTGLICLLKKLQSWLGGLFIMQRSV  738
            RV   IMW VK  G +E  SLWD V HMLM +   GT L CLLKKL+SWL  LFIM+ S 
Sbjct  191  RVLGCIMWTVKEGGSKEHGSLWDQVHHMLMVYWTAGTSLTCLLKKLRSWLEELFIMRHSE  250

Query  739  MELVEVLPVFTMLGQMDGRNCRVMMLESFTTITTQLKQQQWSMK  870
            M+ V VL  F M  QMDGR+C VMMLESFTTI  Q    QWS K
Sbjct  251  MQPVVVLQAFIMWDQMDGRSCLVMMLESFTTIIIQSHPVQWSKK  294



>emb|CEP17612.1| hypothetical protein [Parasitella parasitica]
Length=277

 Score =   301 bits (771),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 147/236 (62%), Positives = 177/236 (75%), Gaps = 14/236 (6%)
 Frame = +3

Query  159  PSFQIP----------NITDFDGFQKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMG  308
            P+F IP          N+TD    +K A   +K   GTTTLAF F+ GV+VA DSRA+MG
Sbjct  37   PAFDIPAIHNPVDFLRNVTD----EKSADYKIKIQHGTTTLAFQFQHGVIVAVDSRATMG  92

Query  309  GYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLL  488
             YI SQ+VKK+IEINPY+LGTMAGGAADC +W R LG +CRLHEL NK RISVA ASKLL
Sbjct  93   NYIGSQTVKKVIEINPYLLGTMAGGAADCSYWERELGRRCRLHELRNKERISVAAASKLL  152

Query  489  ANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGY  668
            AN++Y+Y+GMGLS+GTM+ GWD+ GP L+YVDS+G RLKG+ FSVGSGS +AYGVLD+GY
Sbjct  153  ANMVYAYKGMGLSMGTMVTGWDKSGPNLFYVDSDGSRLKGDIFSVGSGSTFAYGVLDSGY  212

Query  669  RFDLSVEEAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  836
             +DLS++EA EL RRSIYHAT RD  SGG  ++YHV   GW      DVG LH+ Y
Sbjct  213  DYDLSIKEALELGRRSIYHATHRDAMSGGSVNLYHVTEKGWTYHGNHDVGSLHWEY  268



>ref|XP_006484069.1| PREDICTED: proteasome subunit beta type-5-B-like isoform X1 [Citrus 
sinensis]
Length=302

 Score =   272 bits (695),  Expect(2) = 1e-96, Method: Compositional matrix adjust.
 Identities = 132/161 (82%), Positives = 140/161 (87%), Gaps = 0/161 (0%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLA  254
            +++D SGLEST+P  G   EL  E+   PSF +P  TDFD FQKD    +K AKGTTTLA
Sbjct  1    MKLDTSGLESTSPFFGSGDELCPELSAAPSFALPLSTDFDEFQKDTKATLKHAKGTTTLA  60

Query  255  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  434
            FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRL
Sbjct  61   FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRL  120

Query  435  HELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDE  557
            HELANKRRISV GASKLLANILYSYRGMGLSVGTMIAGWDE
Sbjct  121  HELANKRRISVTGASKLLANILYSYRGMGLSVGTMIAGWDE  161


 Score =   110 bits (275),  Expect(2) = 1e-96, Method: Compositional matrix adjust.
 Identities = 62/104 (60%), Positives = 69/104 (66%), Gaps = 0/104 (0%)
 Frame = +1

Query  559  RVQDSIMWIVKVDG*RETDSLWDLVLHMLMEFLIMGTGLICLLKKLQSWLGGLFIMQRSV  738
            RV   IMW VK  G +E  SLWD V HMLM +   GT L CLLKKL+SWL  LFIMQ S 
Sbjct  191  RVLGCIMWTVKEGGSKEHGSLWDQVHHMLMVYWTAGTSLTCLLKKLRSWLEELFIMQHSE  250

Query  739  MELVEVLPVFTMLGQMDGRNCRVMMLESFTTITTQLKQQQWSMK  870
            M+ V VL  F M  QMDGR+C VMMLESFTTI  Q +  +WS K
Sbjct  251  MQPVVVLQAFIMWDQMDGRSCLVMMLESFTTIIIQSRPVRWSKK  294



>ref|XP_004333043.1| proteasome endopeptidase subunit, putative [Acanthamoeba castellanii 
str. Neff]
 gb|ELR11030.1| proteasome endopeptidase subunit, putative [Acanthamoeba castellanii 
str. Neff]
Length=275

 Score =   300 bits (769),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 144/279 (52%), Positives = 195/279 (70%), Gaps = 10/279 (4%)
 Frame = +3

Query  60   LVVTMVRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITD-----FDGFQKDAIQMV  224
            +    + +DF  L    P   E ++L +E+  V  F +P +++      D FQ+   + +
Sbjct  1    MATAALNLDFLDL----PSEREDNQLQNEVLDVDRFTLPAVSNPASFLTDTFQETQAEPI  56

Query  225  KPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFW  404
            K   GTTTL+F+F+ G++VA DSRA+ G YI+SQSV+K+I INP++LGTMAGGAADC +W
Sbjct  57   KMLHGTTTLSFVFQGGIVVAVDSRATQGTYIASQSVQKVIRINPFLLGTMAGGAADCSYW  116

Query  405  HRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVD  584
             R LG + RL++L NK R++VA ASK+L+NILY YR  GLSVG+MI GWD++GP ++YVD
Sbjct  117  ERELGRRTRLYQLRNKERMTVAAASKVLSNILYYYRNQGLSVGSMICGWDKRGPNIFYVD  176

Query  585  SEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEEAAELARRSIYHATFRDGASGGVAS  764
            S+G RLKG++FSVGSG  YAYGV+D GYRFDL+VEEA EL RR+I+HA  RD  SGG  +
Sbjct  177  SDGTRLKGDKFSVGSGGTYAYGVMDAGYRFDLTVEEACELGRRAIFHAAHRDAYSGGTIN  236

Query  765  VYHVGPNGWKKLSGDDVGELHYHYYPVEA-AAVEHEMTE  878
            VYH+   GWK +S  D  +L+Y  Y + A    E EM E
Sbjct  237  VYHISEQGWKHISAQDSNDLYYEQYGLAAREKAEKEMNE  275



>ref|XP_006438070.1| hypothetical protein CICLE_v10032238mg [Citrus clementina]
 gb|ESR51310.1| hypothetical protein CICLE_v10032238mg [Citrus clementina]
Length=302

 Score =   271 bits (693),  Expect(2) = 2e-96, Method: Compositional matrix adjust.
 Identities = 132/161 (82%), Positives = 140/161 (87%), Gaps = 0/161 (0%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLA  254
            +++D SGLEST+P  G   EL  E+   PSF +P  TDFD FQKD    +K AKGTTTLA
Sbjct  1    MKLDTSGLESTSPFFGSGDELCPELLAAPSFALPLSTDFDEFQKDTKATLKHAKGTTTLA  60

Query  255  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  434
            FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRL
Sbjct  61   FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRL  120

Query  435  HELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDE  557
            HELANKRRISV GASKLLANILYSYRGMGLSVGTMIAGWDE
Sbjct  121  HELANKRRISVTGASKLLANILYSYRGMGLSVGTMIAGWDE  161


 Score =   110 bits (274),  Expect(2) = 2e-96, Method: Compositional matrix adjust.
 Identities = 62/104 (60%), Positives = 69/104 (66%), Gaps = 0/104 (0%)
 Frame = +1

Query  559  RVQDSIMWIVKVDG*RETDSLWDLVLHMLMEFLIMGTGLICLLKKLQSWLGGLFIMQRSV  738
            RV   IMW VK  G +E  SLWD V HMLM +   GT L CLLKKL+SWL  LFIMQ S 
Sbjct  191  RVLGCIMWTVKEGGSKEHGSLWDQVHHMLMVYWTAGTSLTCLLKKLRSWLEELFIMQHSE  250

Query  739  MELVEVLPVFTMLGQMDGRNCRVMMLESFTTITTQLKQQQWSMK  870
            M+ V VL  F M  QMDGR+C VMMLESFTTI  Q +  +WS K
Sbjct  251  MQPVVVLQAFIMWDQMDGRSCLVMMLESFTTIIIQSRPVRWSKK  294



>ref|XP_009061521.1| hypothetical protein LOTGIDRAFT_166223 [Lottia gigantea]
 gb|ESO87922.1| hypothetical protein LOTGIDRAFT_166223 [Lottia gigantea]
Length=263

 Score =   300 bits (767),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 149/245 (61%), Positives = 180/245 (73%), Gaps = 2/245 (1%)
 Frame = +3

Query  117  RGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLAFIFKEGVMVAADSR  296
            +GE ++LF+         +     F   + D    +    GTTTLAF FK G +VA DSR
Sbjct  18   QGERNQLFNNCGGNYGRPLETRNSFTNEKSDV--KIHFDHGTTTLAFKFKHGCIVAVDSR  75

Query  297  ASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGA  476
            A+ G YI+SQ+VKK+IEINPY+LGTMAGGAADC FW R+L  +CRL+EL NK RISVA A
Sbjct  76   ATAGSYIASQTVKKVIEINPYLLGTMAGGAADCSFWERHLAKECRLYELRNKERISVAAA  135

Query  477  SKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVL  656
            SKLLAN +Y+Y+GMGLS+GTMI GWD+KGPGLYYVDS+G RL  N FSVGSGS YAYGVL
Sbjct  136  SKLLANTVYNYKGMGLSMGTMIVGWDKKGPGLYYVDSDGERLTNNMFSVGSGSTYAYGVL  195

Query  657  DNGYRFDLSVEEAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  836
            D+GY +DLSVE+A EL +RSIYHAT RD  SGGV ++YH+   GW K+S  DV ELHY Y
Sbjct  196  DSGYSWDLSVEDAYELGKRSIYHATHRDAYSGGVVNLYHMKQTGWIKVSQTDVKELHYKY  255

Query  837  YPVEA  851
               +A
Sbjct  256  QEEKA  260



>ref|XP_002730946.1| PREDICTED: proteasome subunit beta type-5-like [Saccoglossus 
kowalevskii]
Length=277

 Score =   299 bits (766),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 147/255 (58%), Positives = 189/255 (74%), Gaps = 15/255 (6%)
 Frame = +3

Query  87   FSGLESTAPIRGESSELFDEIPRVPSFQIPNITD----FDGFQK-DAIQMVKPAKGTTTL  251
            F  L++  P      E ++E    P F +P + D       F+K D+   ++   GTTTL
Sbjct  26   FEALDNVEP------EFYNE----PKFTLPQVADPAEYLKQFEKEDSDVKIRFHHGTTTL  75

Query  252  AFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCR  431
            AF F+ GV+VA DSRA+ G +I+SQ+VKK+IEINPY+LGTMAGGAADC FW R L  +CR
Sbjct  76   AFKFQHGVIVAVDSRATAGPFIASQTVKKVIEINPYLLGTMAGGAADCSFWERVLSQQCR  135

Query  432  LHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGN  611
            ++EL NK RISVA ASKLLAN++Y+Y+GMGLS+GTMI GWD++GPGLYYVDS+G R+   
Sbjct  136  IYELRNKERISVAAASKLLANMVYNYKGMGLSMGTMICGWDKRGPGLYYVDSDGTRITNY  195

Query  612  RFSVGSGSPYAYGVLDNGYRFDLSVEEAAELARRSIYHATFRDGASGGVASVYHVGPNGW  791
             FSVGSGS YAYGVLD+GYR++LSV+EA +L +R+IYHAT RD  SGGV ++YH+   GW
Sbjct  196  MFSVGSGSTYAYGVLDSGYRYELSVQEAYDLGQRAIYHATHRDAYSGGVVNLYHMKETGW  255

Query  792  KKLSGDDVGELHYHY  836
             K+S +DV ELHY Y
Sbjct  256  IKVSQNDVKELHYKY  270



>gb|AAM18885.1|AF391293_2 unknown [Branchiostoma floridae]
Length=275

 Score =   299 bits (766),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 146/243 (60%), Positives = 183/243 (75%), Gaps = 5/243 (2%)
 Frame = +3

Query  123  ESSELFDEIPRVPSFQIPNITDFDGFQK-----DAIQMVKPAKGTTTLAFIFKEGVMVAA  287
            + S++ + +  +  F IP +TD   F K     +    ++   GTTTLAF F+ GV+VA 
Sbjct  28   DESDVLNNLWSLDKFSIPAVTDPAEFLKPFTTGEGNVKIEFDHGTTTLAFKFQHGVIVAV  87

Query  288  DSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISV  467
            DSRA+ G YI+SQ+VKK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISV
Sbjct  88   DSRATAGSYIASQTVKKVIEINPYLLGTMAGGAADCSFWERVLAEQCRIYELRNKERISV  147

Query  468  AGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAY  647
            A ASKLLANI+Y+Y+GMGLS+GTMI GWD++GPGLYYVDS+G RL  N FSVGSGS YAY
Sbjct  148  AAASKLLANIVYNYKGMGLSMGTMIVGWDKRGPGLYYVDSDGTRLSNNMFSVGSGSTYAY  207

Query  648  GVLDNGYRFDLSVEEAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELH  827
            GVLD+GY +D+ VEEA EL +R+IYHAT RD  SGGV ++YH+   GW K+S  DV +LH
Sbjct  208  GVLDSGYSWDMGVEEAYELGKRAIYHATHRDAYSGGVVNLYHMKETGWIKVSQTDVMDLH  267

Query  828  YHY  836
            Y Y
Sbjct  268  YKY  270



>ref|XP_009021669.1| hypothetical protein HELRODRAFT_83371 [Helobdella robusta]
 gb|ESO00235.1| hypothetical protein HELRODRAFT_83371 [Helobdella robusta]
Length=245

 Score =   298 bits (763),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 149/234 (64%), Positives = 184/234 (79%), Gaps = 5/234 (2%)
 Frame = +3

Query  138  FDEIPRVPSFQIPNITDFDGFQKDAIQM-VKPAKGTTTLAFIFKEGVMVAADSRASMGGY  314
            F+ +P+  SFQ P++  F+    D  ++ +    GTTTL+F +K GV+VA DSRA+ G +
Sbjct  11   FNLVPK--SFQ-PSL-HFNKESNDESKIKIHFDHGTTTLSFKYKNGVIVAVDSRATAGPW  66

Query  315  ISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLAN  494
            I+SQ+VKK+IEINPY+LGTMAGGAADC FW R L  KCRL+EL NK RISVA ASKLLAN
Sbjct  67   IASQNVKKVIEINPYLLGTMAGGAADCSFWQRFLAEKCRLYELRNKERISVAAASKLLAN  126

Query  495  ILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRF  674
            ILY Y+GMGLSVGTMI GWD++GPGLYYVDS+G RL    FSVGSGS YAYGVLD+GYR+
Sbjct  127  ILYGYKGMGLSVGTMIVGWDKRGPGLYYVDSDGTRLSSVMFSVGSGSTYAYGVLDSGYRY  186

Query  675  DLSVEEAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  836
            DLS +EA +L RR+IYHAT+RD  SGG+ S+YH+  +GW K+S DDV +LHY Y
Sbjct  187  DLSDDEAYDLGRRAIYHATYRDAYSGGIVSLYHMKESGWVKISQDDVSDLHYTY  240



>ref|XP_002162379.2| PREDICTED: proteasome subunit beta type-5-like [Hydra vulgaris]
Length=277

 Score =   299 bits (765),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 142/228 (62%), Positives = 177/228 (78%), Gaps = 3/228 (1%)
 Frame = +3

Query  162  SFQIPNITDFDGFQKDAIQ---MVKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSV  332
            +F +PN++D   F  +       ++   GTTTLAF FK GV+VA DSRAS G YI+SQ+V
Sbjct  44   NFPLPNVSDVSQFLNEYTNGDTKIQFHHGTTTLAFKFKHGVIVAVDSRASAGSYIASQTV  103

Query  333  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  512
            KK+IEINPY+LGTMAGGAADC FW R L  +CRL++L NK RISVA ASKLLAN++Y Y+
Sbjct  104  KKVIEINPYLLGTMAGGAADCAFWQRVLAKECRLYQLRNKERISVAAASKLLANMVYQYK  163

Query  513  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  692
            GMGLS+GTMI GWD++GPGLYYVDS+G RLKG+ FSVGSGS YAYGVLD  +++DL++EE
Sbjct  164  GMGLSMGTMICGWDKRGPGLYYVDSDGSRLKGDLFSVGSGSTYAYGVLDADHKWDLTLEE  223

Query  693  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  836
            A +L  R+IYHAT RD  SGGV ++YH+   GW K+S  DV +LHY Y
Sbjct  224  AYDLGNRAIYHATHRDAGSGGVCNLYHMQETGWIKVSQTDVTDLHYKY  271



>dbj|GAN10935.1| 20S proteasome subunit [Mucor ambiguus]
Length=277

 Score =   299 bits (765),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 148/236 (63%), Positives = 176/236 (75%), Gaps = 14/236 (6%)
 Frame = +3

Query  159  PSFQIP----------NITDFDGFQKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMG  308
            PSF IP          N+TD    +K A   +K   GTTTLAF F+ GV+VA DSRA+MG
Sbjct  37   PSFDIPAIHNPVDFLRNVTD----EKSADYKIKIQHGTTTLAFQFQGGVIVAVDSRATMG  92

Query  309  GYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLL  488
             YI SQ+VKK+IEINPY+LGTMAGGAADC +W R LG +CRLHEL NK RISVA ASKLL
Sbjct  93   NYIGSQTVKKVIEINPYLLGTMAGGAADCSYWERELGRRCRLHELRNKERISVAAASKLL  152

Query  489  ANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGY  668
            AN++Y+Y+GMGLS+GTM+ GWD+ GP L+YVDS+G RLKG+ FSVGSGS +AYGVLD+GY
Sbjct  153  ANMVYAYKGMGLSMGTMVTGWDKSGPNLFYVDSDGSRLKGDIFSVGSGSTFAYGVLDSGY  212

Query  669  RFDLSVEEAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  836
              DLSV++A EL RRSIYHAT RD  SGG  ++YHV   GW      DVG LH+ Y
Sbjct  213  DHDLSVKDALELGRRSIYHATHRDAMSGGSVNLYHVTEEGWTYHGNHDVGNLHWDY  268



>ref|XP_006682354.1| hypothetical protein BATDEDRAFT_14510, partial [Batrachochytrium 
dendrobatidis JAM81]
 gb|EGF76856.1| hypothetical protein BATDEDRAFT_14510, partial [Batrachochytrium 
dendrobatidis JAM81]
Length=267

 Score =   298 bits (764),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 142/203 (70%), Positives = 168/203 (83%), Gaps = 0/203 (0%)
 Frame = +3

Query  222  VKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQF  401
            +K  KGTTTLAF F +GV+VA DSRA+MG YI SQ+VKK+IEINPY+LGTMAGGAADC F
Sbjct  1    IKLEKGTTTLAFKFAKGVVVAVDSRATMGSYIGSQTVKKVIEINPYLLGTMAGGAADCSF  60

Query  402  WHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYV  581
            W R LG + RL+EL NK RISVA ASKLL+N++Y Y+GMGLS+GTMI GWD++GPGL+YV
Sbjct  61   WERELGRRARLYELRNKERISVAAASKLLSNMVYGYKGMGLSMGTMITGWDKQGPGLFYV  120

Query  582  DSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEEAAELARRSIYHATFRDGASGGVA  761
            DS+G RLK + FSVGSGS YAYGVLD GY +DLSV +A +LARRSIYHATFRD  SGG  
Sbjct  121  DSDGQRLKNHMFSVGSGSTYAYGVLDAGYDYDLSVNDAIDLARRSIYHATFRDAYSGGSV  180

Query  762  SVYHVGPNGWKKLSGDDVGELHY  830
            +VYHV  +GWK +S  DV +LHY
Sbjct  181  NVYHVQQDGWKFISNTDVMDLHY  203



>gb|EPB87271.1| proteasome component PRE2 [Mucor circinelloides f. circinelloides 
1006PhL]
Length=277

 Score =   298 bits (764),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 148/236 (63%), Positives = 176/236 (75%), Gaps = 14/236 (6%)
 Frame = +3

Query  159  PSFQIP----------NITDFDGFQKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMG  308
            PSF IP          N+TD    +K A   +K   GTTTLAF F+ GV+VA DSRA+MG
Sbjct  37   PSFDIPAIHNPVDFLRNVTD----EKSADYKIKIQHGTTTLAFQFQGGVIVAVDSRATMG  92

Query  309  GYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLL  488
             YI SQ+VKK+IEINPY+LGTMAGGAADC +W R LG +CRLHEL NK RISVA ASKLL
Sbjct  93   NYIGSQTVKKVIEINPYLLGTMAGGAADCSYWERELGRRCRLHELRNKERISVAAASKLL  152

Query  489  ANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGY  668
            AN++Y+Y+GMGLS+GTM+ GWD+ GP L+YVDS+G RLKG+ FSVGSGS +AYGVLD+GY
Sbjct  153  ANMVYAYKGMGLSMGTMVTGWDKSGPNLFYVDSDGSRLKGDIFSVGSGSTFAYGVLDSGY  212

Query  669  RFDLSVEEAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  836
              DLSV++A EL RRSIYHAT RD  SGG  ++YHV   GW      DVG LH+ Y
Sbjct  213  DHDLSVKDALELGRRSIYHATHRDAMSGGSVNLYHVTEEGWTYHGNHDVGSLHWDY  268



>emb|CDH56820.1| 20s proteasome subunit [Lichtheimia corymbifera JMRC:FSU:9682]
 emb|CDS14360.1| Putative Proteasome subunit beta type [Absidia idahoensis var. 
thermophila]
Length=277

 Score =   298 bits (764),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 145/232 (63%), Positives = 176/232 (76%), Gaps = 6/232 (3%)
 Frame = +3

Query  159  PSFQIPNITDFDGFQKDAIQ------MVKPAKGTTTLAFIFKEGVMVAADSRASMGGYIS  320
            P+F IP++ +   F +           +K   GTTTLAF F+ GV+VA DSRA+MG YI 
Sbjct  37   PTFDIPDVHNPVDFLRSVTDEDSPDYKIKIQHGTTTLAFQFQGGVIVAVDSRATMGNYIG  96

Query  321  SQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANIL  500
            SQ+VKK+IEINPY+LGTMAGGAADCQ+W R LG +CRL+EL NK RISVA ASKLL N++
Sbjct  97   SQTVKKVIEINPYLLGTMAGGAADCQYWERELGRRCRLYELRNKERISVAAASKLLGNMV  156

Query  501  YSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDL  680
            YSY+GMGLS+GTMI GWD+ GP L+YVDS+G RLKG+ FSVGSGS +AYGVLD+GY FDL
Sbjct  157  YSYKGMGLSMGTMITGWDKTGPNLFYVDSDGQRLKGDLFSVGSGSTFAYGVLDSGYDFDL  216

Query  681  SVEEAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  836
            SV +A EL +RSIYHAT RD  SGG  ++YHV  +GW+     DVG LHY Y
Sbjct  217  SVSDALELGKRSIYHATHRDAMSGGSVNLYHVTESGWEYHGNHDVGPLHYEY  268



>ref|XP_005825075.1| 20S proteasome subunit beta type 5 [Guillardia theta CCMP2712]
 gb|EKX38095.1| 20S proteasome subunit beta type 5 [Guillardia theta CCMP2712]
Length=290

 Score =   299 bits (765),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 148/243 (61%), Positives = 176/243 (72%), Gaps = 10/243 (4%)
 Frame = +3

Query  138  FDEIPRVPSFQIPNITDFDGF---------QKDAIQMVKPAKGTTTLAFIFKEGVMVAAD  290
            +DE   +  F +P     D F           D+   +K   GTTTL F+F +G+++A D
Sbjct  34   YDEEEMLMKFAMPGPNAPDDFLSGAFAPKNANDSDPALKFLHGTTTLGFVFSQGIIIAVD  93

Query  291  SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVA  470
            SRASMG YI SQ+VKK IEI PY+LGTMAGGAADC FW R+LG  CRL+EL NK RI+ A
Sbjct  94   SRASMGSYIGSQTVKKCIEITPYLLGTMAGGAADCMFWERHLGRLCRLYELRNKERITTA  153

Query  471  GASKLLANILYSYRGMGLSVGTMIAGWDEK-GPGLYYVDSEGGRLKGNRFSVGSGSPYAY  647
             ASKLL NI+YSY+G GLS+GTMIAGWD+  GP LYY DSEG R+KG +FSVGSGSPYAY
Sbjct  154  AASKLLHNIMYSYKGYGLSMGTMIAGWDKDIGPNLYYCDSEGTRVKGQKFSVGSGSPYAY  213

Query  648  GVLDNGYRFDLSVEEAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELH  827
            GVLD GY+FD+S+++A EL RR+IYHATFRD  SGG  SVYHV  NGW K+S DDV  LH
Sbjct  214  GVLDEGYKFDMSIDDACELGRRAIYHATFRDAMSGGRVSVYHVHENGWTKISMDDVQLLH  273

Query  828  YHY  836
              Y
Sbjct  274  EKY  276



>gb|ESA00717.1| hypothetical protein GLOINDRAFT_338395 [Rhizophagus irregularis 
DAOM 181602]
 gb|EXX64892.1| proteasome core particle subunit beta 5 [Rhizophagus irregularis 
DAOM 197198w]
Length=288

 Score =   298 bits (762),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 150/255 (59%), Positives = 191/255 (75%), Gaps = 13/255 (5%)
 Frame = +3

Query  84   DFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKD----AIQMVKPAKGTTTL  251
            DF G ++    +G S   FD    VPS   PN T+F     D    A   +K   GTTTL
Sbjct  23   DFVGFDAA---KGFSLPTFD----VPS--CPNPTEFLKAHTDENSTAEYQIKLEHGTTTL  73

Query  252  AFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCR  431
            +F F+ G++VA DSRAS G +I++Q+VKK+IEINPY+LGTMAGGAADC FW R LG +CR
Sbjct  74   SFKFQGGIIVAVDSRASAGSFIATQTVKKVIEINPYLLGTMAGGAADCIFWQRELGRRCR  133

Query  432  LHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGN  611
            L+EL NK RISVA ASKLLAN++Y+Y+GMGLS+GTM+AGWD+ GP ++Y+DS+G RLKG+
Sbjct  134  LYELRNKERISVAAASKLLANMVYAYKGMGLSMGTMVAGWDKTGPSIFYIDSDGTRLKGD  193

Query  612  RFSVGSGSPYAYGVLDNGYRFDLSVEEAAELARRSIYHATFRDGASGGVASVYHVGPNGW  791
             FSVGSGSP+AYGV+D+G+ +DLSV+EA EL RRSIYHA  RD ASGG  +VYHV  +GW
Sbjct  194  LFSVGSGSPFAYGVVDSGFDYDLSVQEAIELGRRSIYHAAHRDSASGGSINVYHVKQDGW  253

Query  792  KKLSGDDVGELHYHY  836
            + +   DVG+LH+ Y
Sbjct  254  EFIGNYDVGDLHWEY  268



>emb|CAA66313.1| LMP7-like protein [Botryllus schlosseri]
Length=257

 Score =   296 bits (758),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 150/260 (58%), Positives = 192/260 (74%), Gaps = 14/260 (5%)
 Frame = +3

Query  72   MVRIDFSGLESTAPI-----RGESSELFDEIPRV--PSFQIPNITDFDGFQKDAIQMVKP  230
            M  I+   L++ AP+     R +  E   +IP V  P+  +  +TD   + K     +K 
Sbjct  1    MAMIEECSLDAFAPLSLKAPRDDGVEF--QIPEVINPALHLRELTD-SKYGKG----IKF  53

Query  231  AKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHR  410
              GTTTLAF F+ GV+VA DSRA+ G YI+SQ+VKK+IEINPY+LGTMAGGAADC FW R
Sbjct  54   NHGTTTLAFKFQHGVVVAVDSRATAGSYIASQTVKKVIEINPYLLGTMAGGAADCMFWER  113

Query  411  NLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSE  590
             L  +CR++EL NK RISVA ASK+LAN++Y+Y+GMGLS+GTMI GWD+ GPGL+YVDS+
Sbjct  114  VLAKQCRIYELRNKERISVAAASKILANMVYNYKGMGLSMGTMICGWDKHGPGLFYVDSD  173

Query  591  GGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEEAAELARRSIYHATFRDGASGGVASVY  770
            G RLKGN FSVGSGS YAYGV+D+GYR+DLSV EA +L +RSIYHAT RD  SGGV ++Y
Sbjct  174  GQRLKGNMFSVGSGSTYAYGVMDSGYRYDLSVAEALDLGKRSIYHATHRDAYSGGVVNLY  233

Query  771  HVGPNGWKKLSGDDVGELHY  830
            H+   GW+ +S  DV ++HY
Sbjct  234  HMKETGWEFISQTDVLDIHY  253



>ref|XP_002179855.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
 gb|EEC48841.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
Length=283

 Score =   297 bits (760),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 145/233 (62%), Positives = 182/233 (78%), Gaps = 2/233 (1%)
 Frame = +3

Query  144  EIPRVPSFQIPNITDFDGF--QKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYI  317
            ++P VP   +   ++F       DA Q VK AKGTTTLAF F  G++V+ DSR++MG YI
Sbjct  41   DVPNVPDPALYCRSNFASACGNADAGQEVKFAKGTTTLAFKFNGGIIVSVDSRSTMGYYI  100

Query  318  SSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANI  497
            +S +VKK+IEINP++LGTMAGGAADC FW RNLG++CRL+EL N RRI+VA ASKLLAN+
Sbjct  101  ASGTVKKVIEINPFLLGTMAGGAADCSFWERNLGMECRLYELRNGRRITVAAASKLLANV  160

Query  498  LYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFD  677
            + +YRG GLS+GTMI GWDE GP LYYVD++G RLKG  FSVGSGS YAYGVLDN +R D
Sbjct  161  MSAYRGYGLSMGTMITGWDETGPQLYYVDNDGTRLKGKYFSVGSGSMYAYGVLDNHWRED  220

Query  678  LSVEEAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  836
            LSVEEA +L +R+IYHAT RD ASGG+ ++YHV  +GWK + G DV ++HY +
Sbjct  221  LSVEEAIDLGKRAIYHATHRDAASGGINNLYHVTADGWKYIHGIDVNDMHYEF  273



>ref|XP_004994692.1| LMP X protein [Salpingoeca rosetta]
 gb|EGD72869.1| LMP X protein [Salpingoeca rosetta]
Length=292

 Score =   297 bits (761),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 148/235 (63%), Positives = 176/235 (75%), Gaps = 8/235 (3%)
 Frame = +3

Query  156  VPSFQIPNITDFDGF-------QKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGY  314
            VP F +P   +   F         D+   ++ A GTTTL F F+ GV++A DSRAS G Y
Sbjct  45   VPMFSLPRTDNPSEFLHQYSDANPDSKVKIQFAHGTTTLGFKFQHGVIIAVDSRASAGSY  104

Query  315  ISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLAN  494
            I+SQ+VKK+IEINPY+LGTMAGGAADC +W R L  +CRL EL N  RISVA ASK+LAN
Sbjct  105  IASQTVKKVIEINPYLLGTMAGGAADCSYWERVLAKECRLFELRNGERISVAAASKILAN  164

Query  495  ILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRF  674
            I+Y YRGMGLS+GTMI GWD+KGPGL+YVDS+G RL  N FSVGSGS YAYGVLD GYR+
Sbjct  165  IVYHYRGMGLSMGTMICGWDKKGPGLFYVDSDGTRLTNNLFSVGSGSTYAYGVLDAGYRW  224

Query  675  DLSVEEAAELARRSIYHATFRDGASGGVASVYHVGPNGWKK-LSGDDVGELHYHY  836
            DLSVEEA ELARR+IYHATFRD  SGG  ++YH+   GW++ L+  DVG LHY Y
Sbjct  225  DLSVEEAHELARRAIYHATFRDAYSGGHINLYHMKETGWERILNMQDVGPLHYEY  279



>gb|AAI55951.1| LOC100127332 protein [Xenopus laevis]
Length=253

 Score =   296 bits (757),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 140/200 (70%), Positives = 167/200 (84%), Gaps = 0/200 (0%)
 Frame = +3

Query  237  GTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNL  416
            GTTTLAF F+ GV+VA DSRA+ G YI+SQ+VKK+IEINPY+LGTMAGGAADC FW R L
Sbjct  49   GTTTLAFKFRHGVIVAVDSRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLL  108

Query  417  GVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGG  596
              +CR++EL NK RISVA ASKLLAN++Y Y+GMGLS+GTMI GWD++GPGLYYVDSEG 
Sbjct  109  ARQCRIYELRNKERISVAAASKLLANMVYQYKGMGLSMGTMICGWDKRGPGLYYVDSEGN  168

Query  597  RLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEEAAELARRSIYHATFRDGASGGVASVYHV  776
            R+ G+ FSVGSGS YAYGVLD+GY ++L VEEA ELARRSIY AT+RD  SGGV ++YHV
Sbjct  169  RVSGSVFSVGSGSMYAYGVLDSGYNYELEVEEAQELARRSIYQATYRDAYSGGVVNLYHV  228

Query  777  GPNGWKKLSGDDVGELHYHY  836
              +GW ++S DDV ELH  Y
Sbjct  229  REDGWVRVSQDDVLELHQKY  248



>emb|CBY21147.1| unnamed protein product [Oikopleura dioica]
 emb|CBY40350.1| unnamed protein product [Oikopleura dioica]
Length=287

 Score =   296 bits (759),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 144/236 (61%), Positives = 174/236 (74%), Gaps = 0/236 (0%)
 Frame = +3

Query  159  PSFQIPNITDFDGFQKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKK  338
            P F  P +     F  D    +K   GTT LAF FK GVMVA DSRA+ GGYI+SQ VKK
Sbjct  52   PPFSNPQLHLDQNFGDDKPVKIKFNHGTTCLAFKFKHGVMVATDSRATAGGYIASQEVKK  111

Query  339  IIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGM  518
            +IEINPY+LGTMAGGAADCQFW R L ++CRL+EL NK RISVA ASKLLAN++Y Y+GM
Sbjct  112  VIEINPYLLGTMAGGAADCQFWERVLAMECRLYELRNKERISVAAASKLLANMVYQYKGM  171

Query  519  GLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEEAA  698
            GLS+GTM+ GWD+KGPGLYYVD  G RL+G+ FSVGSGS +AYGVLD GY +D+ VE A 
Sbjct  172  GLSMGTMVCGWDKKGPGLYYVDDGGQRLEGSLFSVGSGSLFAYGVLDEGYSYDIEVEAAK  231

Query  699  ELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAVEH  866
            +LA RSIYHAT+RD ASGG  ++YH+   GW+     DV ELH+ Y+  + A  + 
Sbjct  232  DLAIRSIYHATYRDAASGGFVNLYHMKETGWEHCGWMDVKELHWKYHDEKIARAQQ  287



>ref|XP_004347536.2| hypothetical protein CAOG_04785 [Capsaspora owczarzaki ATCC 30864]
 gb|KJE94093.1| hypothetical protein CAOG_004785 [Capsaspora owczarzaki ATCC 
30864]
Length=305

 Score =   297 bits (760),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 156/288 (54%), Positives = 195/288 (68%), Gaps = 20/288 (7%)
 Frame = +3

Query  9    SPIVP*VESTPSFYS-RYLVVT-----MVRIDFSGLESTAPIRGESSELFDEIPRVPSFQ  170
            +PI     STP+  S RY  ++     M   + SGL        E ++    + ++P F 
Sbjct  20   APITA-ARSTPASVSGRYAALSAEDDAMAESELSGLT-------ELNQQLGAMSQLPVFD  71

Query  171  IPNITD----FDGFQKDAIQMVKP--AKGTTTLAFIFKEGVMVAADSRASMGGYISSQSV  332
            +P + D       + +D    VK     GTTTLAF FK G++VA DSRA+ G YI+S +V
Sbjct  72   VPAVQDPAAFLHAYTEDPHSKVKIHIQHGTTTLAFKFKHGIIVAVDSRATGGSYIASGTV  131

Query  333  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  512
            KK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA ASKLLAN++Y Y+
Sbjct  132  KKVIEINPYLLGTMAGGAADCSFWERELARRCRIYELRNKERISVAAASKLLANMVYGYK  191

Query  513  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  692
             MGLS+GTMI GWD++GP LYYVDS+G RL G+ FSVGSGS YAYGVLD G+R+D++ EE
Sbjct  192  NMGLSMGTMITGWDKRGPELYYVDSDGTRLHGDMFSVGSGSTYAYGVLDAGFRYDMTPEE  251

Query  693  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  836
            A EL RRSIYHAT RD  SGG  +VYHV   GW K+S  DV +LHY Y
Sbjct  252  ACELGRRSIYHATHRDAYSGGFVNVYHVREEGWVKISSTDVNQLHYGY  299



>ref|XP_002111558.1| hypothetical protein TRIADDRAFT_55706 [Trichoplax adhaerens]
 gb|EDV25525.1| hypothetical protein TRIADDRAFT_55706 [Trichoplax adhaerens]
Length=276

 Score =   296 bits (757),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 148/240 (62%), Positives = 179/240 (75%), Gaps = 6/240 (3%)
 Frame = +3

Query  132  ELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAK-----GTTTLAFIFKEGVMVAADSR  296
            EL   + +  SFQ+P + D   F K   +     K     GTTTLAF FK GV+VAADSR
Sbjct  34   ELRTHLSKELSFQVPPM-DPQVFLKSINERENGVKIQFLHGTTTLAFKFKNGVIVAADSR  92

Query  297  ASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGA  476
            ASMG YI SQ+VKK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA A
Sbjct  93   ASMGSYIGSQTVKKVIEINPYLLGTMAGGAADCSFWERVLAERCRVYELRNKERISVAAA  152

Query  477  SKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVL  656
            SKLLAN++Y Y+GMGLS+GTMI GWD++GPGLYYVDS+G R+    FSVGSGS YAYG+L
Sbjct  153  SKLLANMVYYYKGMGLSMGTMICGWDKRGPGLYYVDSDGTRMTNYMFSVGSGSTYAYGIL  212

Query  657  DNGYRFDLSVEEAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  836
            D+G++ DL  EEA +LARR+I+HAT RD  SGG  ++YHV   GW K+S DDVG L+Y Y
Sbjct  213  DSGFKHDLEDEEAYDLARRAIFHATHRDAYSGGSVNLYHVKETGWVKISRDDVGPLYYQY  272



>gb|AAY98499.1| LMP X [Swiftia exserta]
Length=268

 Score =   295 bits (756),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 139/205 (68%), Positives = 169/205 (82%), Gaps = 0/205 (0%)
 Frame = +3

Query  222  VKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQF  401
            ++ A GTTTLAF F+ GV+VA DSRA+ G YI+SQ+VKK+IEINPY+LGTMAGGAADC +
Sbjct  59   IQFAHGTTTLAFKFQHGVIVAVDSRATAGSYIASQTVKKVIEINPYLLGTMAGGAADCSY  118

Query  402  WHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYV  581
            W R L  +CR++EL NK RISVA ASKLLAN++Y YRGMGLS+GTMI GWD++GPGLYYV
Sbjct  119  WERVLAKQCRIYELRNKERISVAAASKLLANMVYYYRGMGLSMGTMICGWDKRGPGLYYV  178

Query  582  DSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEEAAELARRSIYHATFRDGASGGVA  761
            DS+G RL  N FSVGSGS +AYGVLD+GYR DLSV+EA +L  R+IYHAT RD  SGGV 
Sbjct  179  DSDGSRLSNNIFSVGSGSTFAYGVLDSGYRPDLSVQEAYDLGERAIYHATHRDAYSGGVV  238

Query  762  SVYHVGPNGWKKLSGDDVGELHYHY  836
            ++YH+   GW K+S +DVG+LHY Y
Sbjct  239  NMYHMQETGWVKVSQNDVGQLHYKY  263



>ref|XP_005994469.1| PREDICTED: proteasome subunit beta type-5-like [Latimeria chalumnae]
Length=260

 Score =   295 bits (756),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 142/229 (62%), Positives = 175/229 (76%), Gaps = 0/229 (0%)
 Frame = +3

Query  150  PRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQS  329
            P   S   P +      +++    ++   GTTTLAF F  GV+VA DSRA+ G YI+SQ+
Sbjct  28   PAGLSLAAPKLIGLGEEEENQAPKIEFLHGTTTLAFKFFHGVLVAVDSRATAGSYIASQT  87

Query  330  VKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  509
            VKK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA ASKLLAN++Y Y
Sbjct  88   VKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQY  147

Query  510  RGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVE  689
            +GMGLS+GTMI GWD++GPGLY+VDSEG R+ G+ FSVGSGS YAYGVLD GY FDLSVE
Sbjct  148  KGMGLSMGTMICGWDKRGPGLYFVDSEGNRITGDNFSVGSGSVYAYGVLDRGYHFDLSVE  207

Query  690  EAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  836
            EA +LARR+IYHAT+RD  SGGV ++YHV  +GW ++  DDV ELH  +
Sbjct  208  EAYDLARRAIYHATYRDAYSGGVVNIYHVREDGWFRVFQDDVLELHEEF  256



>gb|ELT88834.1| hypothetical protein CAPTEDRAFT_150903 [Capitella teleta]
Length=275

 Score =   296 bits (757),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 142/234 (61%), Positives = 180/234 (77%), Gaps = 8/234 (3%)
 Frame = +3

Query  156  VPSFQIP-------NITDFDGFQKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGY  314
              +F+IP       ++  F     D I+ ++ A GTTTLAF FK GV+VA DSRA+ G +
Sbjct  38   TETFEIPQNFNPGEDLKQFTEGNDDNIK-IRIAHGTTTLAFKFKHGVIVAVDSRATAGDW  96

Query  315  ISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLAN  494
            I+SQ+VKK+IEINPY+LGTMAGGAADCQ+W R +  +CR++EL NK RISVA ASKLLAN
Sbjct  97   IASQTVKKVIEINPYLLGTMAGGAADCQYWERVVARQCRIYELRNKERISVAAASKLLAN  156

Query  495  ILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRF  674
            I+Y+Y+GMGLS+GTMI GWD+KGPGLYYVDS+G R+    FSVGSGS YAYGVLD+ YR+
Sbjct  157  IVYNYKGMGLSMGTMICGWDKKGPGLYYVDSDGTRMTNAMFSVGSGSTYAYGVLDSSYRW  216

Query  675  DLSVEEAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  836
            DLSVEEA  L  R+IYHA  RD  +GGV ++YH+  +GW K+S +D+GELHY +
Sbjct  217  DLSVEEAYALGERAIYHAAHRDAFTGGVVNMYHMKESGWVKVSQNDIGELHYKF  270



>ref|XP_001730616.1| hypothetical protein MGL_2412 [Malassezia globosa CBS 7966]
 gb|EDP43402.1| hypothetical protein MGL_2412 [Malassezia globosa CBS 7966]
Length=295

 Score =   296 bits (758),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 144/224 (64%), Positives = 175/224 (78%), Gaps = 2/224 (1%)
 Frame = +3

Query  159  PSFQIPNITDFDGFQKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKK  338
            PS  +   TD D  + DA   +K   GTTTLAF +K GV+VA DSRAS G YI+S SVKK
Sbjct  37   PSRFLAQYTDVDSTRPDA--RIKLNHGTTTLAFRYKGGVVVAVDSRASAGSYIASGSVKK  94

Query  339  IIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGM  518
            +IEINPY+LGTMAGGAADCQ+W   LG++CRLHEL NK RISVA ASK+L+N++YSY+GM
Sbjct  95   VIEINPYLLGTMAGGAADCQYWETYLGIQCRLHELRNKERISVAAASKILSNLVYSYKGM  154

Query  519  GLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEEAA  698
            GLS+GTMI GWD+ GP +YYVDSEG R+KG+ FSVGSGS +AYGVLD GY +DLS EEA 
Sbjct  155  GLSMGTMICGWDKSGPAIYYVDSEGSRMKGDLFSVGSGSTFAYGVLDQGYHWDLSEEEAL  214

Query  699  ELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHY  830
            +L RRSIY AT RD  SG   ++YH+GPNGW+ ++  DV +LHY
Sbjct  215  DLGRRSIYAATHRDAYSGNTINLYHMGPNGWRFIANYDVMQLHY  258



>ref|XP_004474611.1| PREDICTED: proteasome subunit beta type-5 [Dasypus novemcinctus]
Length=262

 Score =   295 bits (755),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 147/243 (60%), Positives = 183/243 (75%), Gaps = 10/243 (4%)
 Frame = +3

Query  120  GESSELFDEIPRVPS----FQIPNITDFDGFQKDAIQMVKPAKGTTTLAFIFKEGVMVAA  287
            G  ++L D  P  PS       PN+   D  ++  I+M+    GTTTLAF F+ GV+VA 
Sbjct  22   GGRADLLDLGPGSPSDGMSLAAPNL---DVSEEPGIEMLH---GTTTLAFKFRHGVIVAV  75

Query  288  DSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISV  467
            DSRA+ G YI+SQ+VKK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISV
Sbjct  76   DSRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISV  135

Query  468  AGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAY  647
            A ASKLLAN++Y Y+GMGLS+GTMI GWD++GPGLYYVDSEG R+ G  FSVGSGS YAY
Sbjct  136  AAASKLLANMVYQYKGMGLSMGTMICGWDKRGPGLYYVDSEGNRISGTTFSVGSGSVYAY  195

Query  648  GVLDNGYRFDLSVEEAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELH  827
            GV+D GY +DL VEEA +LARR+IY AT+RD  SGGV ++YHV  +GW ++S D+V +LH
Sbjct  196  GVMDRGYTYDLEVEEAYDLARRAIYQATYRDAYSGGVVNLYHVREDGWIRVSSDNVADLH  255

Query  828  YHY  836
              Y
Sbjct  256  DKY  258



>ref|XP_002941560.1| PREDICTED: proteasome subunit beta type-5 [Xenopus (Silurana) 
tropicalis]
Length=257

 Score =   295 bits (754),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 138/200 (69%), Positives = 166/200 (83%), Gaps = 0/200 (0%)
 Frame = +3

Query  237  GTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNL  416
            GTTTLAF F+ GV+VA DSRA+ G YI+SQ+VKK+IEINPY+LGTMAGGAADC FW R L
Sbjct  53   GTTTLAFKFRHGVIVAVDSRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLL  112

Query  417  GVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGG  596
              +CR++EL NK RISVA ASKLLAN++Y Y+GMGLS+GTMI GWD++GPGLYYVDSEG 
Sbjct  113  ARQCRIYELRNKERISVAAASKLLANMVYQYKGMGLSMGTMICGWDKRGPGLYYVDSEGN  172

Query  597  RLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEEAAELARRSIYHATFRDGASGGVASVYHV  776
            R+ G+ FSVGSGS YAYGVLD GY +++ VEEA ELARRSIY AT+RD  SGGV ++YHV
Sbjct  173  RVSGSVFSVGSGSMYAYGVLDRGYNYEMEVEEAQELARRSIYQATYRDAYSGGVVNLYHV  232

Query  777  GPNGWKKLSGDDVGELHYHY  836
              +GW ++S DDV +LH  Y
Sbjct  233  REDGWVRVSQDDVADLHQKY  252



>gb|AAS01050.1| putative proteasome 20S beta5 subunit [Brassica napus]
Length=150

 Score =   290 bits (742),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 139/150 (93%), Positives = 148/150 (99%), Gaps = 0/150 (0%)
 Frame = +3

Query  297  ASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGA  476
            ASMGGYISSQSVKKIIEINPYMLGTMAGGAAD QFWHRNLG+KCRLHELANKRRISV+GA
Sbjct  1    ASMGGYISSQSVKKIIEINPYMLGTMAGGAADRQFWHRNLGIKCRLHELANKRRISVSGA  60

Query  477  SKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVL  656
            SKLLAN+LYSYRGMGLSVGTMIAGWDE GPGLYYVD+EGGRLKG+RFSVGSGSPYAYGVL
Sbjct  61   SKLLANMLYSYRGMGLSVGTMIAGWDETGPGLYYVDNEGGRLKGDRFSVGSGSPYAYGVL  120

Query  657  DNGYRFDLSVEEAAELARRSIYHATFRDGA  746
            D+GY+FD+SVEEA+ELARRSIYHATFRDGA
Sbjct  121  DSGYKFDMSVEEASELARRSIYHATFRDGA  150



>ref|XP_011441202.1| PREDICTED: proteasome subunit beta type-5-like [Crassostrea gigas]
Length=275

 Score =   293 bits (751),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 145/247 (59%), Positives = 184/247 (74%), Gaps = 10/247 (4%)
 Frame = +3

Query  120  GESSELFDE-IPRVPSFQIP-------NITDFDGFQKDAIQMVKPAKGTTTLAFIFKEGV  275
            G S+ L D+ +    +F +P       ++ +F   + D    +    GTTTLAF F+ GV
Sbjct  24   GSSTHLLDDALTSTTNFTVPYDIDPVESLKEFTNPKSDV--KIHFDHGTTTLAFKFQHGV  81

Query  276  MVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKR  455
            +VA DSRA+ G  I SQ+VKK+IEINPY+LGTMAGGAADC +W R L  +CR++EL NK 
Sbjct  82   IVAVDSRATAGPSIESQTVKKVIEINPYLLGTMAGGAADCAYWERVLARQCRIYELRNKE  141

Query  456  RISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGS  635
            RISVA ASKLLANI+Y+Y+GMGLS+GTMI GWD++GPGLYYVDS+G R+  N +SVGSGS
Sbjct  142  RISVAAASKLLANIVYNYKGMGLSMGTMICGWDKRGPGLYYVDSDGERMSNNIYSVGSGS  201

Query  636  PYAYGVLDNGYRFDLSVEEAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDV  815
             YAYGVLD+GYR+DLSVEEA +L RRSIYHAT RD  SGGV ++YH+  +GW+ +S  DV
Sbjct  202  VYAYGVLDSGYRYDLSVEEAIDLGRRSIYHATHRDAYSGGVVNLYHMKESGWEFISQTDV  261

Query  816  GELHYHY  836
             +LHY Y
Sbjct  262  FDLHYQY  268



>ref|XP_005707411.1| 20S proteasome subunit beta 5 [Galdieria sulphuraria]
 gb|EME30891.1| 20S proteasome subunit beta 5 [Galdieria sulphuraria]
Length=275

 Score =   293 bits (750),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 148/251 (59%), Positives = 185/251 (74%), Gaps = 8/251 (3%)
 Frame = +3

Query  132  ELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGG  311
            EL+  IP  P     N+ +     +    +VK   GTTTL+FIF EG++ A DSRASMG 
Sbjct  28   ELYSAIPLAPRLS-NNVLN----NRPPKDLVKFHHGTTTLSFIFSEGIVAAVDSRASMGQ  82

Query  312  YISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLA  491
            YI S SVKK+IEIN Y+LGTMAGGAADC FW R LG++CR+ EL NK RISVA ASK+L 
Sbjct  83   YIGSGSVKKVIEINKYLLGTMAGGAADCTFWERYLGMRCRIFELKNKERISVAAASKILC  142

Query  492  NILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYR  671
            N +Y Y+GMGLS+GTMI GWD+KGP +YYVDSEG RLKG++FSVGSGS +A GVLD GY+
Sbjct  143  NTVYQYKGMGLSMGTMIMGWDKKGPHIYYVDSEGTRLKGSKFSVGSGSTHALGVLDQGYK  202

Query  672  FDLSVEEAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVG-ELHYHYYPVE  848
            +++SVEEA EL RRSIYHAT RD  SGG  +VY++GP+GWK +S +D G + HY Y   +
Sbjct  203  WNMSVEEACELGRRSIYHATHRDAFSGGYINVYYIGPDGWKFISHEDSGFDKHYQYAADK  262

Query  849  A--AAVEHEMT  875
            A  A  + +M+
Sbjct  263  ATEAQTQQQMS  273



>ref|XP_005110562.1| PREDICTED: proteasome subunit beta type-5-like [Aplysia californica]
Length=281

 Score =   293 bits (750),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 139/200 (70%), Positives = 165/200 (83%), Gaps = 0/200 (0%)
 Frame = +3

Query  237  GTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNL  416
            GTTTLAF F+ GV+VA DSRA+ G  I SQ+VKK+IEINPY+LGTMAGGAADC FW R L
Sbjct  73   GTTTLAFKFQHGVIVAVDSRATAGPSIESQTVKKVIEINPYLLGTMAGGAADCMFWERAL  132

Query  417  GVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGG  596
              +CR++EL NK RISVA ASKLLANI+Y Y+GMGLS+GTMI GWD+KGPGLYYVD++G 
Sbjct  133  ARQCRIYELRNKERISVAAASKLLANIVYDYKGMGLSMGTMIIGWDKKGPGLYYVDNDGE  192

Query  597  RLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEEAAELARRSIYHATFRDGASGGVASVYHV  776
            RL+G  FSVGSGS YAYGVLD+GY++DLSVEEA +L RR+IYHAT RD  SGGV ++YH+
Sbjct  193  RLEGKLFSVGSGSVYAYGVLDSGYKWDLSVEEAQDLGRRAIYHATHRDAYSGGVVNLYHM  252

Query  777  GPNGWKKLSGDDVGELHYHY  836
               GW+K+S  D  ELHY Y
Sbjct  253  KQTGWEKISQTDTMELHYQY  272



>ref|XP_004694702.1| PREDICTED: proteasome subunit beta type-5 isoform X2 [Condylura 
cristata]
Length=208

 Score =   290 bits (743),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 136/200 (68%), Positives = 165/200 (83%), Gaps = 0/200 (0%)
 Frame = +3

Query  237  GTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNL  416
            GTTTLAF F+ GV+VAADSRA+ G YI+SQ+VKK+IEINPY+LGTMAGGAADC FW R L
Sbjct  4    GTTTLAFKFRHGVIVAADSRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLL  63

Query  417  GVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGG  596
              +CR++EL NK RISVA ASKLLAN++Y Y+GMGLS+GTMI GWD++GPGLYYVDSEG 
Sbjct  64   ARQCRIYELRNKERISVAAASKLLANMVYQYKGMGLSMGTMICGWDKRGPGLYYVDSEGN  123

Query  597  RLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEEAAELARRSIYHATFRDGASGGVASVYHV  776
            R+ G  FSVGSGS YAYGV+D GY +DL VEEA +LARR+IY AT+RD  SGG  ++YHV
Sbjct  124  RISGVTFSVGSGSVYAYGVMDRGYSYDLEVEEAYDLARRAIYQATYRDAYSGGSVNLYHV  183

Query  777  GPNGWKKLSGDDVGELHYHY  836
              +GW ++S D+V +LH  Y
Sbjct  184  REDGWIRVSSDNVADLHDKY  203



>gb|AAP36588.1| Homo sapiens proteasome (prosome, macropain) subunit, beta type, 
5 [synthetic construct]
Length=209

 Score =   290 bits (743),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 135/200 (68%), Positives = 165/200 (83%), Gaps = 0/200 (0%)
 Frame = +3

Query  237  GTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNL  416
            GTTTLAF F+ GV+VAADSRA+ G YI+SQ+VKK+IEINPY+LGTMAGGAADC FW R L
Sbjct  4    GTTTLAFKFRHGVIVAADSRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLL  63

Query  417  GVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGG  596
              +CR++EL NK RISVA ASKLLAN++Y Y+GMGLS+GTMI GWD++GPGLYYVDSEG 
Sbjct  64   ARQCRIYELRNKERISVAAASKLLANMVYQYKGMGLSMGTMICGWDKRGPGLYYVDSEGN  123

Query  597  RLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEEAAELARRSIYHATFRDGASGGVASVYHV  776
            R+ G  FSVGSGS YAYGV+D GY +DL VE+A +LARR+IY AT+RD  SGG  ++YHV
Sbjct  124  RISGATFSVGSGSVYAYGVMDRGYSYDLEVEQAYDLARRAIYQATYRDAYSGGAVNLYHV  183

Query  777  GPNGWKKLSGDDVGELHYHY  836
              +GW ++S D+V +LH  Y
Sbjct  184  REDGWIRVSSDNVADLHEKY  203



>dbj|BAA06097.1| proteasome subunit X [Homo sapiens]
 gb|AAP35423.1| proteasome (prosome, macropain) subunit, beta type, 5 [Homo sapiens]
 gb|AIC59195.1| hypothetical protein, partial [synthetic construct]
Length=208

 Score =   290 bits (743),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 135/200 (68%), Positives = 165/200 (83%), Gaps = 0/200 (0%)
 Frame = +3

Query  237  GTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNL  416
            GTTTLAF F+ GV+VAADSRA+ G YI+SQ+VKK+IEINPY+LGTMAGGAADC FW R L
Sbjct  4    GTTTLAFKFRHGVIVAADSRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLL  63

Query  417  GVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGG  596
              +CR++EL NK RISVA ASKLLAN++Y Y+GMGLS+GTMI GWD++GPGLYYVDSEG 
Sbjct  64   ARQCRIYELRNKERISVAAASKLLANMVYQYKGMGLSMGTMICGWDKRGPGLYYVDSEGN  123

Query  597  RLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEEAAELARRSIYHATFRDGASGGVASVYHV  776
            R+ G  FSVGSGS YAYGV+D GY +DL VE+A +LARR+IY AT+RD  SGG  ++YHV
Sbjct  124  RISGATFSVGSGSVYAYGVMDRGYSYDLEVEQAYDLARRAIYQATYRDAYSGGAVNLYHV  183

Query  777  GPNGWKKLSGDDVGELHYHY  836
              +GW ++S D+V +LH  Y
Sbjct  184  REDGWIRVSSDNVADLHEKY  203



>ref|XP_007258118.1| PREDICTED: proteasome subunit beta type-5-like isoform X1 [Astyanax 
mexicanus]
 ref|XP_007258119.1| PREDICTED: proteasome subunit beta type-5-like isoform X2 [Astyanax 
mexicanus]
Length=269

 Score =   292 bits (748),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 136/205 (66%), Positives = 169/205 (82%), Gaps = 0/205 (0%)
 Frame = +3

Query  237  GTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNL  416
            GTTTLAF F+ GV+VA DSRA+ G YI+SQ+VKK+IEINPY+LGTMAGGAADC FW R L
Sbjct  65   GTTTLAFKFQHGVIVAVDSRATAGSYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLL  124

Query  417  GVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGG  596
              +CR++EL NK RISVA ASKLLAN++Y Y+GMGLS+GTMI GWD++GPGLYYVDSEG 
Sbjct  125  ARQCRIYELRNKERISVAAASKLLANMVYQYKGMGLSMGTMICGWDKRGPGLYYVDSEGN  184

Query  597  RLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEEAAELARRSIYHATFRDGASGGVASVYHV  776
            R+ G++F+VGSGS YAYGVLD+G R DL+VEEA +L RR+IY AT+RD  SGG  ++YHV
Sbjct  185  RVCGDQFAVGSGSMYAYGVLDSGLRQDLTVEEACDLGRRAIYQATYRDAYSGGQVNLYHV  244

Query  777  GPNGWKKLSGDDVGELHYHYYPVEA  851
               GWK++S +DV +LH+ Y   +A
Sbjct  245  HSEGWKRVSQEDVLQLHHQYQSQKA  269



>gb|KFH65162.1| 20S proteasome subunit beta 5 [Mortierella verticillata NRRL 
6337]
Length=276

 Score =   292 bits (748),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 142/240 (59%), Positives = 180/240 (75%), Gaps = 7/240 (3%)
 Frame = +3

Query  159  PSFQIP---NITDFDGFQKDA--IQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYISS  323
            PSF IP   N TDF     DA     ++   GTTTLAF F+ G++VA DSRAS+G  I+S
Sbjct  37   PSFDIPMVSNPTDFLRAHTDASAQHRIRIQHGTTTLAFKFQGGIIVAVDSRASVGNQIAS  96

Query  324  QSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILY  503
            Q+VKK+IEINPY+LGT+AGGAADCQ+W R LG + RLHEL +  RISVA ASK+L+N++Y
Sbjct  97   QTVKKVIEINPYLLGTVAGGAADCQYWERELGRRARLHELRHHERISVAAASKMLSNMVY  156

Query  504  SYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLS  683
             Y+GM LS+GTMI GWD+ GP LYYVDS+G R++G+RF+VGSGS +AYG+LD G+RFD+S
Sbjct  157  DYKGMDLSMGTMITGWDKTGPALYYVDSDGTRMQGDRFAVGSGSTFAYGILDTGFRFDMS  216

Query  684  VEEAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY--YPVEAAA  857
            V EA EL +R++YHATFRD  SGG   +YHV  +GW+     DV +LH+HY   P EA A
Sbjct  217  VPEALELGKRAVYHATFRDAYSGGSVHLYHVKSDGWEICGEFDVNQLHWHYKSQPKEAIA  276



>ref|XP_005933706.1| PREDICTED: proteasome subunit beta type-5-like [Haplochromis 
burtoni]
Length=281

 Score =   292 bits (748),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 140/228 (61%), Positives = 176/228 (77%), Gaps = 7/228 (3%)
 Frame = +3

Query  162  SFQIPN---ITDFDGFQKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSV  332
            SF + N   + D DG ++     ++   GTTTLAF F+ GV+VA DSRA+ G YI+SQ+V
Sbjct  54   SFSVKNPLCVGDDDGVERK----IEFLHGTTTLAFKFQHGVIVAVDSRATAGSYIASQTV  109

Query  333  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  512
            KK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA ASKLLAN++Y Y+
Sbjct  110  KKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYK  169

Query  513  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  692
            GMGLS+GTM+ GWD++GPGLYYVDSEG R+ G+ F+VGSGS YAYGV+D+G R DL+VEE
Sbjct  170  GMGLSMGTMVCGWDKRGPGLYYVDSEGNRVCGDLFAVGSGSMYAYGVMDSGVRHDLTVEE  229

Query  693  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  836
            A EL RR+IY AT+RD  SGG  ++YHV   GW ++S DDV  LH+ Y
Sbjct  230  ACELGRRAIYQATYRDAYSGGQVNLYHVHSEGWTRISQDDVLMLHHQY  277



>ref|XP_005740284.1| PREDICTED: proteasome subunit beta type-5-like [Pundamilia nyererei]
Length=281

 Score =   292 bits (748),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 140/228 (61%), Positives = 176/228 (77%), Gaps = 7/228 (3%)
 Frame = +3

Query  162  SFQIPN---ITDFDGFQKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSV  332
            SF + N   + D DG ++     ++   GTTTLAF F+ GV+VA DSRA+ G YI+SQ+V
Sbjct  54   SFSVKNPLCVGDDDGVERK----IEFLHGTTTLAFKFQHGVIVAVDSRATAGSYIASQTV  109

Query  333  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  512
            KK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA ASKLLAN++Y Y+
Sbjct  110  KKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYK  169

Query  513  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  692
            GMGLS+GTM+ GWD++GPGLYYVDSEG R+ G+ F+VGSGS YAYGV+D+G R DL+VEE
Sbjct  170  GMGLSMGTMVCGWDKRGPGLYYVDSEGNRVCGDLFAVGSGSMYAYGVMDSGVRHDLTVEE  229

Query  693  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  836
            A EL RR+IY AT+RD  SGG  ++YHV   GW ++S DDV  LH+ Y
Sbjct  230  ACELGRRAIYQATYRDAYSGGQVNLYHVHSEGWTRISQDDVLVLHHQY  277



>emb|CAA66312.1| LMP7-like protein [Geodia cydonium]
Length=280

 Score =   292 bits (748),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 150/258 (58%), Positives = 185/258 (72%), Gaps = 9/258 (3%)
 Frame = +3

Query  90   SGLESTAPIRGESS----ELFDEIPRVPSFQIP-NITDFDGFQKDAIQ----MVKPAKGT  242
            S LE TA  R E       L  E     SF +P  I   +  Q+ +       ++ A GT
Sbjct  16   SLLERTAAWREEDPLTDRPLMAESATPRSFAVPPGIEPVEFLQRFSSDEGGVKIEFAHGT  75

Query  243  TTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGV  422
            TTLAF F+ GV+VA DSRA+ G +I+SQ+VKK+IEINPY+LGTMAGGAADC +W R L  
Sbjct  76   TTLAFKFQHGVIVAVDSRATAGSWIASQTVKKVIEINPYLLGTMAGGAADCAYWERQLAF  135

Query  423  KCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRL  602
             CR++EL NK RISVA ASK+L+N++Y Y+GMGLS+GTMI GWD+KGPGLYYVDS+G RL
Sbjct  136  SCRVYELRNKERISVAAASKILSNMVYRYKGMGLSMGTMICGWDKKGPGLYYVDSDGSRL  195

Query  603  KGNRFSVGSGSPYAYGVLDNGYRFDLSVEEAAELARRSIYHATFRDGASGGVASVYHVGP  782
              + FSVGSGS YAYGVLD+GY +DLSVEEA +L +R+IYHAT RD  SGGV ++YH+  
Sbjct  196  THHMFSVGSGSTYAYGVLDSGYSYDLSVEEARDLGKRAIYHATHRDAYSGGVVNLYHMME  255

Query  783  NGWKKLSGDDVGELHYHY  836
             GW K+S  DV ELHY Y
Sbjct  256  TGWVKVSQTDVKELHYQY  273



>pdb|3UNB|K Chain K, Mouse Constitutive 20s Proteasome In Complex With Pr-957
 pdb|3UNB|Y Chain Y, Mouse Constitutive 20s Proteasome In Complex With Pr-957
 pdb|3UNB|MM Chain m, Mouse Constitutive 20s Proteasome In Complex With Pr-957
 pdb|3UNB|1 Chain 1, Mouse Constitutive 20s Proteasome In Complex With Pr-957
 pdb|3UNE|K Chain K, Mouse Constitutive 20s Proteasome
 pdb|3UNE|Y Chain Y, Mouse Constitutive 20s Proteasome
 pdb|3UNE|MM Chain m, Mouse Constitutive 20s Proteasome
 pdb|3UNE|1 Chain 1, Mouse Constitutive 20s Proteasome
Length=205

 Score =   289 bits (740),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 136/202 (67%), Positives = 164/202 (81%), Gaps = 0/202 (0%)
 Frame = +3

Query  240  TTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG  419
            TTTLAF F  GV+VAADSRA+ G YI+SQ+VKK+IEINPY+LGTMAGGAADC FW R L 
Sbjct  1    TTTLAFKFLHGVIVAADSRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLA  60

Query  420  VKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGR  599
             +CR++EL NK RISVA ASKLLAN++Y Y+GMGLS+GTMI GWD++GPGLYYVDSEG R
Sbjct  61   RQCRIYELRNKERISVAAASKLLANMVYQYKGMGLSMGTMICGWDKRGPGLYYVDSEGNR  120

Query  600  LKGNRFSVGSGSPYAYGVLDNGYRFDLSVEEAAELARRSIYHATFRDGASGGVASVYHVG  779
            + G  FSVGSGS YAYGV+D GY +DL VEEA +LARR+IY AT+RD  SGG  ++YHV 
Sbjct  121  ISGTAFSVGSGSVYAYGVMDRGYSYDLKVEEAYDLARRAIYQATYRDAYSGGAVNLYHVR  180

Query  780  PNGWKKLSGDDVGELHYHYYPV  845
             +GW ++S D+V +LH  Y  V
Sbjct  181  EDGWIRVSSDNVADLHDKYSSV  202



>ref|XP_008332973.1| PREDICTED: proteasome subunit beta type-5 [Cynoglossus semilaevis]
Length=278

 Score =   292 bits (747),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 136/211 (64%), Positives = 167/211 (79%), Gaps = 0/211 (0%)
 Frame = +3

Query  237  GTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNL  416
            GTTTLAF F+ GV+VA DSRA+ G YI+SQ+VKK+IEINPY+LGTMAGGAADC FW R L
Sbjct  68   GTTTLAFKFQHGVIVAVDSRATAGSYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLL  127

Query  417  GVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGG  596
              +CR++EL NK RISVA ASKLLAN++Y Y+GMGLS+GTM+ GWD++GPGLYYVDSEG 
Sbjct  128  ARQCRIYELRNKERISVAAASKLLANMVYQYKGMGLSMGTMVCGWDKRGPGLYYVDSEGN  187

Query  597  RLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEEAAELARRSIYHATFRDGASGGVASVYHV  776
            R+ G+ F+VGSGS YAYGV+D+G R+DLSV+EA EL RR+IY AT+RD  SGG  ++YHV
Sbjct  188  RVSGDLFAVGSGSMYAYGVMDSGLRYDLSVDEACELGRRAIYQATYRDAYSGGQVNLYHV  247

Query  777  GPNGWKKLSGDDVGELHYHYYPVEAAAVEHE  869
               GW ++S DDV +LH  Y   E      E
Sbjct  248  QSEGWTRVSQDDVLKLHQKYNDQEKLETAQE  278



>ref|XP_005537552.1| 20S core proteasome subunit beta 5 [Cyanidioschyzon merolae strain 
10D]
 dbj|BAM81516.1| 20S core proteasome subunit beta 5 [Cyanidioschyzon merolae strain 
10D]
Length=299

 Score =   293 bits (749),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 145/232 (63%), Positives = 177/232 (76%), Gaps = 2/232 (1%)
 Frame = +3

Query  144  EIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYISS  323
             +PR  S   P + D    ++++  +VK   GTTTLAF+F++G++VA DSRASMG YI S
Sbjct  41   RVPRGASIA-PRLRDVLRDEQNS-SLVKFLHGTTTLAFVFRDGIIVAVDSRASMGQYIGS  98

Query  324  QSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILY  503
             +VKKIIEINPY+LGTMAGGAADC FW R LG++CRLHEL ++ RISVA ASKLLANI+Y
Sbjct  99   GTVKKIIEINPYLLGTMAGGAADCSFWERYLGMRCRLHELQHRERISVAAASKLLANIVY  158

Query  504  SYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLS  683
             Y+GMGLS+GTMIAGWD+ GP L+YVDS+G RL+G RFSVGSGS +AYGVLD  YR+D+ 
Sbjct  159  EYKGMGLSMGTMIAGWDKTGPQLFYVDSDGVRLRGTRFSVGSGSTFAYGVLDQFYRWDMD  218

Query  684  VEEAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYY  839
              EAAEL RR+I+HAT RD  SGG  +VYHV  +GW  LS DD G   Y  Y
Sbjct  219  AAEAAELGRRAIFHATHRDAYSGGYINVYHVKADGWVNLSHDDSGITKYAEY  270



>ref|XP_004565403.1| PREDICTED: proteasome subunit beta type-5-like [Maylandia zebra]
Length=271

 Score =   291 bits (746),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 140/228 (61%), Positives = 176/228 (77%), Gaps = 7/228 (3%)
 Frame = +3

Query  162  SFQIPN---ITDFDGFQKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSV  332
            SF + N   + D DG ++     ++   GTTTLAF F+ GV+VA DSRA+ G YI+SQ+V
Sbjct  44   SFSVKNPLCVGDDDGVERK----IEFLHGTTTLAFKFQHGVIVAVDSRATAGSYIASQTV  99

Query  333  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  512
            KK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA ASKLLAN++Y Y+
Sbjct  100  KKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYK  159

Query  513  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  692
            GMGLS+GTM+ GWD++GPGLYYVDSEG R+ G+ F+VGSGS YAYGV+D+G R DL+VEE
Sbjct  160  GMGLSMGTMVCGWDKRGPGLYYVDSEGNRVCGDLFAVGSGSMYAYGVMDSGVRHDLTVEE  219

Query  693  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  836
            A EL RR+IY AT+RD  SGG  ++YHV   GW ++S DDV  LH+ Y
Sbjct  220  ACELGRRAIYQATYRDAYSGGQVNLYHVHSEGWTRISQDDVLVLHHQY  267



>pdb|4R3O|L Chain L, Human Constitutive 20s Proteasome
 pdb|4R3O|Z Chain Z, Human Constitutive 20s Proteasome
 pdb|4R67|L Chain L, Human Constitutive 20s Proteasome In Complex With Carfilzomib
 pdb|4R67|Z Chain Z, Human Constitutive 20s Proteasome In Complex With Carfilzomib
 pdb|4R67|NN Chain n, Human Constitutive 20s Proteasome In Complex With Carfilzomib
 pdb|4R67|3 Chain 3, Human Constitutive 20s Proteasome In Complex With Carfilzomib
Length=201

 Score =   289 bits (740),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 134/199 (67%), Positives = 164/199 (82%), Gaps = 0/199 (0%)
 Frame = +3

Query  240  TTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG  419
            TTTLAF F+ GV+VAADSRA+ G YI+SQ+VKK+IEINPY+LGTMAGGAADC FW R L 
Sbjct  1    TTTLAFKFRHGVIVAADSRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLA  60

Query  420  VKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGR  599
             +CR++EL NK RISVA ASKLLAN++Y Y+GMGLS+GTMI GWD++GPGLYYVDSEG R
Sbjct  61   RQCRIYELRNKERISVAAASKLLANMVYQYKGMGLSMGTMICGWDKRGPGLYYVDSEGNR  120

Query  600  LKGNRFSVGSGSPYAYGVLDNGYRFDLSVEEAAELARRSIYHATFRDGASGGVASVYHVG  779
            + G  FSVGSGS YAYGV+D GY +DL VE+A +LARR+IY AT+RD  SGG  ++YHV 
Sbjct  121  ISGATFSVGSGSVYAYGVMDRGYSYDLEVEQAYDLARRAIYQATYRDAYSGGAVNLYHVR  180

Query  780  PNGWKKLSGDDVGELHYHY  836
             +GW ++S D+V +LH  Y
Sbjct  181  EDGWIRVSSDNVADLHEKY  199



>ref|XP_006988553.1| PREDICTED: proteasome subunit beta type-5 [Peromyscus maniculatus 
bairdii]
Length=263

 Score =   291 bits (745),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 141/226 (62%), Positives = 176/226 (78%), Gaps = 11/226 (5%)
 Frame = +3

Query  159  PSFQIPNITDFDGFQKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKK  338
            PS+ +P        ++  I+M+    GTTTLAF F+ GV+VAADSRA+ G YI+SQ+VKK
Sbjct  44   PSWGVP--------EEPKIEMLH---GTTTLAFKFRHGVIVAADSRATAGAYIASQTVKK  92

Query  339  IIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGM  518
            +IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA ASKLLAN++Y Y+GM
Sbjct  93   VIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYKGM  152

Query  519  GLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEEAA  698
            GLS+GTMI GWD++GPGLYYVDSEG R+ G  FSVGSGS YAYGV+D GY +DL VE+A 
Sbjct  153  GLSMGTMICGWDKRGPGLYYVDSEGNRISGTAFSVGSGSVYAYGVMDRGYSYDLEVEDAY  212

Query  699  ELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  836
            +LARR+IY AT+RD  SGG  ++YHV  NGW ++S D+V +LH  Y
Sbjct  213  DLARRAIYQATYRDAYSGGAVNLYHVRENGWIRVSSDNVADLHDKY  258



>ref|XP_005875924.1| PREDICTED: proteasome subunit beta type-5-like [Myotis brandtii]
 gb|EPQ13719.1| Proteasome subunit beta type-5 [Myotis brandtii]
Length=263

 Score =   291 bits (745),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 149/256 (58%), Positives = 185/256 (72%), Gaps = 9/256 (4%)
 Frame = +3

Query  90   SGLESTAPIR-------GESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTT  248
            S LES+ P+        G  ++L D  P  PS  +       G  ++    ++   GTTT
Sbjct  5    SVLESSVPVNRHGFFGLGGRADLLDLGPGSPSDGLSLAAPSWGVPEE--PRIEILHGTTT  62

Query  249  LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKC  428
            LAF F+ GV+VAADSRA+ G YI+SQ+VKK+IEINPY+LGTMAGGAADC FW R L  +C
Sbjct  63   LAFKFQHGVIVAADSRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQC  122

Query  429  RLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKG  608
            R++EL NK RISVA ASKLL N+LY Y+GMGLSVGTMI GWD++GPGLYYVDSEG R+ G
Sbjct  123  RIYELRNKERISVAAASKLLVNMLYQYKGMGLSVGTMICGWDKRGPGLYYVDSEGNRISG  182

Query  609  NRFSVGSGSPYAYGVLDNGYRFDLSVEEAAELARRSIYHATFRDGASGGVASVYHVGPNG  788
              FSVGSGS YAYGV+D GY +DL VEEA +LARR+IY AT+RD  SGG  ++YHV  +G
Sbjct  183  VTFSVGSGSVYAYGVMDRGYSYDLEVEEAYDLARRAIYQATYRDAYSGGSVNLYHVREDG  242

Query  789  WKKLSGDDVGELHYHY  836
            W ++S D+V +LH  Y
Sbjct  243  WIRVSSDNVADLHDKY  258



>ref|XP_003457456.2| PREDICTED: proteasome subunit beta type-5-like [Oreochromis niloticus]
Length=281

 Score =   292 bits (747),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 140/228 (61%), Positives = 176/228 (77%), Gaps = 7/228 (3%)
 Frame = +3

Query  162  SFQIPN---ITDFDGFQKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSV  332
            SF + N   + D DG ++     ++   GTTTLAF F+ GV+VA DSRA+ G YI+SQ+V
Sbjct  54   SFSVKNPLCVGDDDGVERK----IEFLHGTTTLAFKFQHGVIVAVDSRATAGSYIASQTV  109

Query  333  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  512
            KK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA ASKLLAN++Y Y+
Sbjct  110  KKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYK  169

Query  513  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  692
            GMGLS+GTM+ GWD++GPGLYYVDSEG R+ G+ F+VGSGS YAYGV+D+G R DL+VEE
Sbjct  170  GMGLSMGTMVCGWDKRGPGLYYVDSEGNRVCGDLFAVGSGSMYAYGVMDSGVRHDLTVEE  229

Query  693  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  836
            A EL RR+IY AT+RD  SGG  ++YHV   GW ++S DDV  LH+ Y
Sbjct  230  ACELGRRAIYQATYRDAYSGGQVNLYHVHSEGWTRISQDDVLVLHHQY  277



>ref|XP_008292170.1| PREDICTED: proteasome subunit beta type-5 [Stegastes partitus]
Length=271

 Score =   291 bits (746),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 140/225 (62%), Positives = 175/225 (78%), Gaps = 1/225 (0%)
 Frame = +3

Query  162  SFQIPNITDFDGFQKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKI  341
            SF + N   + G +    + ++   GTTTLAF F+ GV+VA DSRA+ G YI+SQ+VKK+
Sbjct  44   SFSVKNPL-YAGAEDGVERKIEFLHGTTTLAFKFQHGVIVAVDSRATAGSYIASQTVKKV  102

Query  342  IEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMG  521
            IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA ASKLLAN++Y Y+GMG
Sbjct  103  IEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYKGMG  162

Query  522  LSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEEAAE  701
            LS+GTM+ GWD++GPGLYYVDSEG R+ G+ F+VGSGS YAYGV+D+G RFDL+VEEA E
Sbjct  163  LSMGTMVCGWDKRGPGLYYVDSEGNRVCGDLFAVGSGSMYAYGVMDSGLRFDLTVEEACE  222

Query  702  LARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  836
            LARR+IY AT+RD  SGG  ++YHV   GW ++S DDV  LH  Y
Sbjct  223  LARRAIYQATYRDAYSGGQVNLYHVHGKGWTRVSQDDVLMLHQQY  267



>dbj|BAA08204.1| proteasome subunit RCX [Rattus rattus]
Length=208

 Score =   289 bits (740),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 135/200 (68%), Positives = 165/200 (83%), Gaps = 0/200 (0%)
 Frame = +3

Query  237  GTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNL  416
            GTTTLAF F+ GV+VAADSRA+ G YI+SQ+VKK+IEINPY+LGTMAGGAADC FW R L
Sbjct  4    GTTTLAFKFQHGVIVAADSRATAGPYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLL  63

Query  417  GVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGG  596
              +CR++EL NK RISVA ASKLLAN++Y Y+GMGLS+GTMI GWD++GPGLYYVDSEG 
Sbjct  64   ARQCRIYELRNKERISVAAASKLLANMVYQYKGMGLSMGTMICGWDKRGPGLYYVDSEGN  123

Query  597  RLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEEAAELARRSIYHATFRDGASGGVASVYHV  776
            R+ G  FSVGSGS YA+GV+D GY +DL VEEA +LARR+IY AT+RD  SGG  ++YHV
Sbjct  124  RISGTAFSVGSGSVYAFGVMDRGYSYDLQVEEAYDLARRAIYQATYRDAYSGGAVNLYHV  183

Query  777  GPNGWKKLSGDDVGELHYHY  836
              +GW ++S D+V +LH  Y
Sbjct  184  REDGWIRVSSDNVADLHDKY  203



>pdb|1IRU|L Chain L, Crystal Structure Of The Mammalian 20s Proteasome At 
2.75 A Resolution
 pdb|1IRU|Z Chain Z, Crystal Structure Of The Mammalian 20s Proteasome At 
2.75 A Resolution
Length=204

 Score =   289 bits (739),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 134/199 (67%), Positives = 164/199 (82%), Gaps = 0/199 (0%)
 Frame = +3

Query  240  TTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG  419
            TTTLAF F+ GV+VAADSRA+ G YI+SQ+VKK+IEINPY+LGTMAGGAADC FW R L 
Sbjct  1    TTTLAFKFRHGVIVAADSRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLA  60

Query  420  VKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGR  599
             +CR++EL NK RISVA ASKLLAN++Y Y+GMGLS+GTMI GWD++GPGLYYVDSEG R
Sbjct  61   RQCRIYELRNKERISVAAASKLLANMVYQYKGMGLSMGTMICGWDKRGPGLYYVDSEGNR  120

Query  600  LKGNRFSVGSGSPYAYGVLDNGYRFDLSVEEAAELARRSIYHATFRDGASGGVASVYHVG  779
            + G  FSVGSGS YAYGV+D GY +DL VE+A +LARR+IY AT+RD  SGG  ++YHV 
Sbjct  121  ISGATFSVGSGSVYAYGVMDRGYSYDLEVEQAYDLARRAIYQATYRDAYSGGAVNLYHVR  180

Query  780  PNGWKKLSGDDVGELHYHY  836
             +GW ++S D+V +LH  Y
Sbjct  181  EDGWIRVSSDNVADLHEKY  199



>ref|XP_007100517.1| PREDICTED: proteasome subunit beta type-5 isoform X1 [Physeter 
catodon]
Length=263

 Score =   291 bits (745),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 150/257 (58%), Positives = 187/257 (73%), Gaps = 11/257 (4%)
 Frame = +3

Query  90   SGLESTAPIR-------GESSELFDEIPRVPSFQIPNITDFDGFQKDA-IQMVKPAKGTT  245
            S LE   P+        G  ++L D  P  PS  +  I    G  ++  I+M+    GTT
Sbjct  5    SVLERALPVNRRGFFGLGGRADLLDLGPGSPSDGLSLIAPSWGVPEEPRIEMLH---GTT  61

Query  246  TLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVK  425
            TLAF F+ GV+VAADSRA+ G YI+SQ+VKK+IEINPY+LGTMAGGAADC FW R L  +
Sbjct  62   TLAFKFRHGVIVAADSRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQ  121

Query  426  CRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLK  605
            CR++EL NK RISVA ASKLLAN++Y Y+GMGLS+GTMI GWD++GPGLYYVDSEG R+ 
Sbjct  122  CRIYELRNKERISVAAASKLLANMVYQYKGMGLSMGTMICGWDKRGPGLYYVDSEGNRIS  181

Query  606  GNRFSVGSGSPYAYGVLDNGYRFDLSVEEAAELARRSIYHATFRDGASGGVASVYHVGPN  785
            G  FSVGSGS YAYGV+D GY +DL VEEA +LARR+IY AT+RD  SGG  ++YHV  +
Sbjct  182  GATFSVGSGSVYAYGVMDRGYSYDLEVEEAYDLARRAIYQATYRDAYSGGSVNLYHVRED  241

Query  786  GWKKLSGDDVGELHYHY  836
            GW ++S D+V +LH  Y
Sbjct  242  GWIRVSSDNVADLHDKY  258



>ref|XP_004010385.1| PREDICTED: proteasome subunit beta type-5 [Ovis aries]
 ref|XP_005685312.1| PREDICTED: proteasome subunit beta type-5 [Capra hircus]
 ref|XP_011984672.1| PREDICTED: proteasome subunit beta type-5 [Ovis aries musimon]
Length=263

 Score =   291 bits (744),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 142/226 (63%), Positives = 176/226 (78%), Gaps = 11/226 (5%)
 Frame = +3

Query  159  PSFQIPNITDFDGFQKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKK  338
            PS+ +P        ++  I+M+    GTTTLAF F+ GV+VAADSRA+ G YI+SQ+VKK
Sbjct  44   PSWGVP--------EEPRIEMLH---GTTTLAFKFRHGVIVAADSRATAGAYIASQTVKK  92

Query  339  IIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGM  518
            +IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA ASKLLAN++Y Y+GM
Sbjct  93   VIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYKGM  152

Query  519  GLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEEAA  698
            GLS+GTMI GWD++GPGLYYVDSEG R+ G  FSVGSGS YAYGV+D GY +DL VEEA 
Sbjct  153  GLSMGTMICGWDKRGPGLYYVDSEGNRISGATFSVGSGSVYAYGVMDRGYSYDLEVEEAY  212

Query  699  ELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  836
            +LARR+IY AT+RD  SGG  S+YHV  +GW ++S D+V +LH  Y
Sbjct  213  DLARRAIYQATYRDAYSGGSVSLYHVREDGWIRVSSDNVADLHDKY  258



>ref|XP_005978061.1| PREDICTED: proteasome subunit beta type-5 isoform X2 [Pantholops 
hodgsonii]
Length=263

 Score =   291 bits (744),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 142/226 (63%), Positives = 176/226 (78%), Gaps = 11/226 (5%)
 Frame = +3

Query  159  PSFQIPNITDFDGFQKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKK  338
            PS+ +P        ++  I+M+    GTTTLAF F+ GV+VAADSRA+ G YI+SQ+VKK
Sbjct  44   PSWGVP--------EEPRIEMLH---GTTTLAFKFRHGVIVAADSRATAGAYIASQTVKK  92

Query  339  IIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGM  518
            +IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA ASKLLAN++Y Y+GM
Sbjct  93   VIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYKGM  152

Query  519  GLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEEAA  698
            GLS+GTMI GWD++GPGLYYVDSEG R+ G  FSVGSGS YAYGV+D GY +DL VEEA 
Sbjct  153  GLSMGTMICGWDKRGPGLYYVDSEGNRISGATFSVGSGSVYAYGVMDRGYSYDLEVEEAY  212

Query  699  ELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  836
            +LARR+IY AT+RD  SGG  S+YHV  +GW ++S D+V +LH  Y
Sbjct  213  DLARRAIYQATYRDAYSGGSVSLYHVREDGWIRVSSDNVADLHDKY  258



>ref|XP_007439509.1| PREDICTED: proteasome subunit beta type-5 [Python bivittatus]
Length=265

 Score =   291 bits (744),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 140/213 (66%), Positives = 170/213 (80%), Gaps = 0/213 (0%)
 Frame = +3

Query  222  VKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQF  401
            ++   GTTTLAF F+ GV+VAADSR++ G Y++SQ+VKKIIEINPY+LGTMAGGAADC F
Sbjct  52   IELQHGTTTLAFKFQHGVIVAADSRSTAGVYVASQTVKKIIEINPYLLGTMAGGAADCSF  111

Query  402  WHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYV  581
            W R L  +CR++EL NK RISVA ASKLLAN++Y Y+GMGLS+GTMI GWD++GPGLYYV
Sbjct  112  WERLLARQCRIYELRNKERISVAAASKLLANMVYQYKGMGLSMGTMICGWDKRGPGLYYV  171

Query  582  DSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEEAAELARRSIYHATFRDGASGGVA  761
            DSEG R+ G  FSVGSGS YAYGV+D GY  DLSVEEA +LARR+IY AT+RD  SGG  
Sbjct  172  DSEGNRISGTVFSVGSGSVYAYGVMDRGYSHDLSVEEAYDLARRAIYQATYRDAYSGGSV  231

Query  762  SVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAV  860
            +VYHVGP+GW ++S DDV  L   +    + AV
Sbjct  232  NVYHVGPDGWIRVSSDDVSNLRELFRDTASEAV  264



>ref|XP_004421295.1| PREDICTED: proteasome subunit beta type-5 [Ceratotherium simum 
simum]
Length=263

 Score =   291 bits (744),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 141/226 (62%), Positives = 176/226 (78%), Gaps = 11/226 (5%)
 Frame = +3

Query  159  PSFQIPNITDFDGFQKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKK  338
            PS+ +P        ++  I+M+    GTTTLAF F+ GV+VAADSRA+ G YI+SQ+VKK
Sbjct  44   PSWGVP--------EEPRIEMLH---GTTTLAFKFQHGVIVAADSRATAGAYIASQTVKK  92

Query  339  IIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGM  518
            +IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA ASKLLAN++Y Y+GM
Sbjct  93   VIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYKGM  152

Query  519  GLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEEAA  698
            GLS+GTMI GWD++GPGLYYVDSEG R+ G  FSVGSGS YAYGV+D GY +DL VEEA 
Sbjct  153  GLSMGTMICGWDKRGPGLYYVDSEGNRISGTTFSVGSGSVYAYGVMDRGYSYDLEVEEAY  212

Query  699  ELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  836
            +LARR+IY AT+RD  SGG  ++YHV  +GW ++S D+V +LH  Y
Sbjct  213  DLARRAIYQATYRDAYSGGAVNLYHVREDGWIRVSSDNVADLHDKY  258



>ref|XP_004313402.1| PREDICTED: proteasome subunit beta type-5 isoform 2 [Tursiops 
truncatus]
Length=208

 Score =   288 bits (738),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 135/200 (68%), Positives = 165/200 (83%), Gaps = 0/200 (0%)
 Frame = +3

Query  237  GTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNL  416
            GTTTLAF F+ GV+VAADSRA+ G YI+SQ+VKK+IEINPY+LGTMAGGAADC FW R L
Sbjct  4    GTTTLAFKFRHGVIVAADSRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLL  63

Query  417  GVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGG  596
              +CR++EL NK RISVA ASKLLAN++Y Y+GMGLS+GTMI GWD++GPGLYYVDSEG 
Sbjct  64   ARQCRIYELRNKERISVAAASKLLANMVYQYKGMGLSMGTMICGWDKRGPGLYYVDSEGN  123

Query  597  RLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEEAAELARRSIYHATFRDGASGGVASVYHV  776
            R+ G  FSVGSGS YAYGV+D GY +DL VEEA +LARR+IY AT+RD  SGG  ++YHV
Sbjct  124  RISGATFSVGSGSVYAYGVMDRGYSYDLEVEEAYDLARRAIYQATYRDAYSGGSVNLYHV  183

Query  777  GPNGWKKLSGDDVGELHYHY  836
              +GW ++S ++V +LH  Y
Sbjct  184  REDGWIRVSSNNVADLHDKY  203



>ref|XP_006776843.1| PREDICTED: proteasome subunit beta type-5 [Myotis davidii]
Length=263

 Score =   291 bits (744),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 148/256 (58%), Positives = 186/256 (73%), Gaps = 9/256 (4%)
 Frame = +3

Query  90   SGLESTAPIR-------GESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTT  248
            S LE++ P+        G  ++L D  P  PS  +       G  ++    ++   GTTT
Sbjct  5    SVLETSVPVNRHGFFGLGGRADLLDLGPGSPSDGLSLAAPSWGVPEE--PRIEILHGTTT  62

Query  249  LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKC  428
            LAF FK GV+VAADSRA+ G YI+SQ+VKK+IEINPY+LGTMAGGAADC FW R L  +C
Sbjct  63   LAFKFKHGVIVAADSRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQC  122

Query  429  RLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKG  608
            R++EL NK RISVA ASKLLAN++Y Y+GMGLS+GTMI GWD++GPGLYYVDSEG R+ G
Sbjct  123  RIYELRNKERISVAAASKLLANMVYQYKGMGLSMGTMICGWDKRGPGLYYVDSEGNRISG  182

Query  609  NRFSVGSGSPYAYGVLDNGYRFDLSVEEAAELARRSIYHATFRDGASGGVASVYHVGPNG  788
              FSVGSGS YAYGV+D GY +DL VEEA +LARR+IY AT+RD  SGG  ++YHV  +G
Sbjct  183  VTFSVGSGSVYAYGVMDRGYSYDLDVEEAYDLARRAIYQATYRDAYSGGSVNLYHVREDG  242

Query  789  WKKLSGDDVGELHYHY  836
            W ++S D+V +LH  Y
Sbjct  243  WIRVSSDNVADLHDKY  258



>ref|XP_008564788.1| PREDICTED: proteasome subunit beta type-5 [Galeopterus variegatus]
Length=263

 Score =   290 bits (743),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 147/253 (58%), Positives = 184/253 (73%), Gaps = 18/253 (7%)
 Frame = +3

Query  78   RIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLAF  257
            R D   L   +PI G S          PS+ +P        ++  I+M+    GTTTLAF
Sbjct  24   RTDLLDLGPGSPIDGLSLA-------APSWGVP--------EEPGIEMLH---GTTTLAF  65

Query  258  IFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLH  437
             F+ GV+VAADSRA+ G YI+SQ+VKK+IEINPY+LGTMAGGAADC FW R L  +CR++
Sbjct  66   KFRHGVIVAADSRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIY  125

Query  438  ELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRF  617
            EL NK RISVA ASKLLAN++Y Y+GMGLS+GTMI GWD++GPGLYYVDSEG R+ G  F
Sbjct  126  ELRNKERISVAAASKLLANMVYQYKGMGLSMGTMICGWDKRGPGLYYVDSEGNRISGATF  185

Query  618  SVGSGSPYAYGVLDNGYRFDLSVEEAAELARRSIYHATFRDGASGGVASVYHVGPNGWKK  797
            SVGSGS YAYGV+D GY +DL VE+A +LARR+IY AT+RD  SGG  ++YHV  +GW +
Sbjct  186  SVGSGSVYAYGVMDRGYSYDLEVEQAYDLARRAIYQATYRDAYSGGAVNLYHVREDGWIR  245

Query  798  LSGDDVGELHYHY  836
            +S D+V +LH  Y
Sbjct  246  VSSDNVADLHDKY  258



>ref|XP_003924370.1| PREDICTED: proteasome subunit beta type-5 [Saimiri boliviensis 
boliviensis]
Length=263

 Score =   290 bits (743),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 141/227 (62%), Positives = 176/227 (78%), Gaps = 11/227 (5%)
 Frame = +3

Query  156  VPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVK  335
            VP + +P        ++  I+M+    GTTTLAF F+ GV+VAADSRA+ G YI+SQ+VK
Sbjct  43   VPGWGVP--------EEPGIEMLH---GTTTLAFKFRHGVIVAADSRATAGAYIASQTVK  91

Query  336  KIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRG  515
            K+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA ASKLLAN++Y Y+G
Sbjct  92   KVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYKG  151

Query  516  MGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEEA  695
            MGLS+GTMI GWD++GPGLYYVDSEG R+ G  FSVGSGS YAYGV+D GY +DL VEEA
Sbjct  152  MGLSMGTMICGWDKRGPGLYYVDSEGNRISGATFSVGSGSVYAYGVMDRGYSYDLEVEEA  211

Query  696  AELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  836
             +LARR+IY AT+RD  SGG  ++YHV  +GW ++S D+V +LH  Y
Sbjct  212  YDLARRAIYQATYRDAYSGGAVNLYHVREDGWIRVSSDNVADLHEKY  258



>ref|XP_006100131.1| PREDICTED: proteasome subunit beta type-5 [Myotis lucifugus]
Length=263

 Score =   290 bits (743),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 148/256 (58%), Positives = 186/256 (73%), Gaps = 9/256 (4%)
 Frame = +3

Query  90   SGLESTAPIR-------GESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTT  248
            S LES+ P+        G  ++L D  P  PS  +       G  ++    ++   GTTT
Sbjct  5    SVLESSVPVNRHGFFGLGGRADLLDLGPGSPSDGLSLAAPSWGVPEE--PRIEILHGTTT  62

Query  249  LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKC  428
            LAF F+ GV+VAADSRA+ G YI+SQ+VKK+IEINPY+LGTMAGGAADC FW R L  +C
Sbjct  63   LAFKFQHGVIVAADSRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQC  122

Query  429  RLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKG  608
            R++EL NK RISVA ASKLLAN++Y Y+GMGLS+GTMI GWD++GPGLYYVDSEG R+ G
Sbjct  123  RIYELRNKERISVAAASKLLANMVYQYKGMGLSMGTMICGWDKRGPGLYYVDSEGNRISG  182

Query  609  NRFSVGSGSPYAYGVLDNGYRFDLSVEEAAELARRSIYHATFRDGASGGVASVYHVGPNG  788
              FSVGSGS YAYGV+D GY +DL VEEA +LARR+IY AT+RD  SGG  ++YHV  +G
Sbjct  183  VTFSVGSGSVYAYGVMDRGYSYDLEVEEAYDLARRAIYQATYRDAYSGGSVNLYHVREDG  242

Query  789  WKKLSGDDVGELHYHY  836
            W ++S D+V +LH  Y
Sbjct  243  WIRVSSDNVADLHDKY  258



>ref|XP_002753673.3| PREDICTED: proteasome subunit beta type-5 [Callithrix jacchus]
Length=268

 Score =   290 bits (743),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 140/227 (62%), Positives = 176/227 (78%), Gaps = 11/227 (5%)
 Frame = +3

Query  156  VPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVK  335
            +P + +P        ++  I+M+    GTTTLAF F+ GV+VAADSRA+ G YI+SQ+VK
Sbjct  48   MPGWSVP--------EEPGIEMLH---GTTTLAFKFRHGVIVAADSRATAGAYIASQTVK  96

Query  336  KIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRG  515
            K+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA ASKLLAN++Y Y+G
Sbjct  97   KVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYKG  156

Query  516  MGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEEA  695
            MGLS+GTMI GWD++GPGLYYVDSEG R+ G  FSVGSGS YAYGV+D GY +DL VEEA
Sbjct  157  MGLSMGTMICGWDKRGPGLYYVDSEGNRISGATFSVGSGSVYAYGVMDRGYSYDLEVEEA  216

Query  696  AELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  836
             +LARR+IY AT+RD  SGG  ++YHV  +GW ++S D+V +LH  Y
Sbjct  217  YDLARRAIYQATYRDAYSGGAVNLYHVREDGWIRVSSDNVADLHEKY  263



>ref|XP_005338834.1| PREDICTED: proteasome subunit beta type-5 [Ictidomys tridecemlineatus]
Length=208

 Score =   288 bits (738),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 135/200 (68%), Positives = 164/200 (82%), Gaps = 0/200 (0%)
 Frame = +3

Query  237  GTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNL  416
            GTTTLAF F+ GV+VAADSRA+ G YI+SQ+VKK+IEINPY+LGTMAGGAADC FW R L
Sbjct  4    GTTTLAFKFQHGVIVAADSRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLL  63

Query  417  GVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGG  596
              +CR++EL NK RISVA ASKLLAN++Y Y+GMGLS+GTMI GWD++GPGLYYVDSEG 
Sbjct  64   ARQCRIYELRNKERISVAAASKLLANMVYQYKGMGLSMGTMICGWDKRGPGLYYVDSEGN  123

Query  597  RLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEEAAELARRSIYHATFRDGASGGVASVYHV  776
            R+ G  FSVGSGS YAYGV+D GY +DL VE+A +LARR+IY AT+RD  SGG  ++YHV
Sbjct  124  RISGATFSVGSGSVYAYGVMDRGYSYDLDVEQAYDLARRAIYQATYRDAYSGGSVNLYHV  183

Query  777  GPNGWKKLSGDDVGELHYHY  836
              +GW  +S D+V +LH  Y
Sbjct  184  REDGWIHVSSDNVADLHDKY  203



>gb|EWM22648.1| proteasome subunit beta type 5 [Nannochloropsis gaditana]
Length=278

 Score =   291 bits (744),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 141/222 (64%), Positives = 170/222 (77%), Gaps = 0/222 (0%)
 Frame = +3

Query  195  GFQKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTM  374
            G+  D  Q +K AKGTTTLAF F  G++VA DSR++ G Y++S +VKK+IEINPY+LGTM
Sbjct  55   GYGTDQHQELKFAKGTTTLAFKFDGGIVVAVDSRSTQGAYVASGTVKKVIEINPYLLGTM  114

Query  375  AGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWD  554
            AGGAADC FW RNLG++CRL+EL +K RISVA ASKLLAN +  YRG GLS+GTMI GWD
Sbjct  115  AGGAADCSFWERNLGIQCRLYELRHKERISVAAASKLLANTVMQYRGYGLSMGTMITGWD  174

Query  555  EKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEEAAELARRSIYHATF  734
            + GP L+YVD++G RLKGN FSVGSGS YAYGVLD  YR DLS +EA EL RR+IYHAT 
Sbjct  175  KTGPQLFYVDNDGMRLKGNLFSVGSGSTYAYGVLDAHYRKDLSADEAIELGRRAIYHATH  234

Query  735  RDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEAAAV  860
            RD  SGG+ +VYHV   GW K+   D  ELHY Y   + A++
Sbjct  235  RDAYSGGIINVYHVQEQGWVKVFSGDCNELHYKYQEEKTASM  276



>ref|XP_006144566.1| PREDICTED: proteasome subunit beta type-5 [Tupaia chinensis]
 gb|ELW69249.1| Proteasome subunit beta type-5 [Tupaia chinensis]
Length=263

 Score =   290 bits (743),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 140/226 (62%), Positives = 176/226 (78%), Gaps = 11/226 (5%)
 Frame = +3

Query  159  PSFQIPNITDFDGFQKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKK  338
            PS+ +P        ++  I+M+    GTTTLAF F+ GV+VAADSRA+ G YI+SQ+VKK
Sbjct  44   PSWDVP--------EEPRIEMLH---GTTTLAFKFRHGVIVAADSRATAGAYIASQTVKK  92

Query  339  IIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGM  518
            +IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA ASKLLAN++Y Y+GM
Sbjct  93   VIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYKGM  152

Query  519  GLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEEAA  698
            GLS+GTMI GWD++GPGLYYVDSEG R+ G  FSVGSGS YAYGV+D GY +DL VE+A 
Sbjct  153  GLSMGTMICGWDKRGPGLYYVDSEGNRISGATFSVGSGSVYAYGVMDRGYSYDLEVEQAY  212

Query  699  ELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  836
            +LARR+IY AT+RD  SGG  ++YHV  +GW ++S D+V +LH  Y
Sbjct  213  DLARRAIYQATYRDAYSGGAVNLYHVREDGWIRVSSDNVADLHDKY  258



>ref|XP_007449602.1| PREDICTED: proteasome subunit beta type-5 isoform X1 [Lipotes 
vexillifer]
Length=263

 Score =   290 bits (743),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 149/257 (58%), Positives = 187/257 (73%), Gaps = 11/257 (4%)
 Frame = +3

Query  90   SGLESTAPIR-------GESSELFDEIPRVPSFQIPNITDFDGFQKDA-IQMVKPAKGTT  245
            S LE   P+        G  ++L D  P  PS  +  +    G  ++  I+M+    GTT
Sbjct  5    SVLERALPVNRRGFFGLGGRADLLDLGPGSPSDGLSLVAPSWGVPEEPRIEMLH---GTT  61

Query  246  TLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVK  425
            TLAF F+ GV+VAADSRA+ G YI+SQ+VKK+IEINPY+LGTMAGGAADC FW R L  +
Sbjct  62   TLAFKFRHGVIVAADSRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQ  121

Query  426  CRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLK  605
            CR++EL NK RISVA ASKLLAN++Y Y+GMGLS+GTMI GWD++GPGLYYVDSEG R+ 
Sbjct  122  CRIYELRNKERISVAAASKLLANMVYQYKGMGLSMGTMICGWDKRGPGLYYVDSEGNRIS  181

Query  606  GNRFSVGSGSPYAYGVLDNGYRFDLSVEEAAELARRSIYHATFRDGASGGVASVYHVGPN  785
            G  FSVGSGS YAYGV+D GY +DL VEEA +LARR+IY AT+RD  SGG  ++YHV  +
Sbjct  182  GATFSVGSGSVYAYGVMDRGYSYDLEVEEAYDLARRAIYQATYRDAYSGGSVNLYHVRED  241

Query  786  GWKKLSGDDVGELHYHY  836
            GW ++S D+V +LH  Y
Sbjct  242  GWIRVSSDNVADLHDKY  258



>ref|XP_008156742.1| PREDICTED: proteasome subunit beta type-5 isoform X1 [Eptesicus 
fuscus]
Length=263

 Score =   290 bits (742),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 148/256 (58%), Positives = 186/256 (73%), Gaps = 9/256 (4%)
 Frame = +3

Query  90   SGLESTAPIR-------GESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTT  248
            S LES+ P+        G  ++L D  P  PS  +       G  ++    ++   GTTT
Sbjct  5    SVLESSVPVNRHGFFGLGGRADLLDLGPGSPSDGLSLAAPSWGVPEE--PKIEILHGTTT  62

Query  249  LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKC  428
            LAF F+ GV+VAADSRA+ G YI+SQ+VKK+IEINPY+LGTMAGGAADC FW R L  +C
Sbjct  63   LAFKFQHGVIVAADSRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQC  122

Query  429  RLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKG  608
            R++EL NK RISVA ASKLLAN++Y Y+GMGLS+GTMI GWD++GPGLYYVDSEG R+ G
Sbjct  123  RIYELRNKERISVAAASKLLANMVYQYKGMGLSMGTMICGWDKRGPGLYYVDSEGNRISG  182

Query  609  NRFSVGSGSPYAYGVLDNGYRFDLSVEEAAELARRSIYHATFRDGASGGVASVYHVGPNG  788
              FSVGSGS YAYGV+D GY +DL VEEA +LARR+IY AT+RD  SGG  ++YHV  +G
Sbjct  183  VTFSVGSGSVYAYGVMDRGYSYDLEVEEAYDLARRAIYQATYRDAYSGGSVNLYHVREDG  242

Query  789  WKKLSGDDVGELHYHY  836
            W ++S D+V +LH  Y
Sbjct  243  WIRVSSDNVADLHDKY  258



>ref|XP_001626004.1| predicted protein [Nematostella vectensis]
 gb|EDO33904.1| predicted protein [Nematostella vectensis]
Length=279

 Score =   291 bits (744),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 140/222 (63%), Positives = 169/222 (76%), Gaps = 12/222 (5%)
 Frame = +3

Query  207  DAIQMVKP------------AKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEI  350
            D I+ +KP              GTTTLAF FK GV+VA DSRA+ G YI+SQ+VKK+IEI
Sbjct  52   DPIEFLKPFTNGESDVKIHFDHGTTTLAFKFKHGVIVAVDSRATAGSYIASQTVKKVIEI  111

Query  351  NPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSV  530
            NPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA ASK+LAN++Y Y+GMGLS+
Sbjct  112  NPYLLGTMAGGAADCSFWERLLAKQCRIYELRNKERISVAAASKILANMVYYYKGMGLSM  171

Query  531  GTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEEAAELAR  710
            GTMI GWD+KGPGLYYVDS+G RL    FSVGSGS YAYGV+D+GY++D+S EEA +L  
Sbjct  172  GTMICGWDKKGPGLYYVDSDGTRLSNQMFSVGSGSTYAYGVMDSGYKYDMSPEEAYDLGV  231

Query  711  RSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  836
            RSIYHAT RD  SGGV ++YH+   GW K+S  DV +LHY Y
Sbjct  232  RSIYHATHRDAYSGGVVNLYHMKETGWIKVSQTDVAKLHYQY  273



>ref|XP_004283228.1| PREDICTED: proteasome subunit beta type-5 isoform 1 [Orcinus 
orca]
Length=263

 Score =   290 bits (742),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 145/240 (60%), Positives = 182/240 (76%), Gaps = 4/240 (2%)
 Frame = +3

Query  120  GESSELFDEIPRVPSFQIPNITDFDGFQKDA-IQMVKPAKGTTTLAFIFKEGVMVAADSR  296
            G  ++L D  P  PS  +  +    G  ++  I+M+    GTTTLAF F+ GV+VAADSR
Sbjct  22   GGRADLLDLGPGSPSDGLSLVAPSWGVPEEPRIEMLH---GTTTLAFKFRHGVIVAADSR  78

Query  297  ASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGA  476
            A+ G YI+SQ+VKK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA A
Sbjct  79   ATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAA  138

Query  477  SKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVL  656
            SKLLAN++Y Y+GMGLS+GTMI GWD++GPGLYYVDSEG R+ G  FSVGSGS YAYGV+
Sbjct  139  SKLLANMVYQYKGMGLSMGTMICGWDKRGPGLYYVDSEGNRISGATFSVGSGSVYAYGVM  198

Query  657  DNGYRFDLSVEEAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  836
            D GY +DL VEEA +LARR+IY AT+RD  SGG  ++YHV  +GW ++S D+V +LH  Y
Sbjct  199  DRGYSYDLEVEEAYDLARRAIYQATYRDAYSGGSVNLYHVREDGWIRVSSDNVADLHDKY  258



>gb|ELR56586.1| Proteasome subunit beta type-5, partial [Bos mutus]
Length=266

 Score =   290 bits (742),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 137/200 (69%), Positives = 165/200 (83%), Gaps = 0/200 (0%)
 Frame = +3

Query  237  GTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNL  416
            GTTTLAF F+ GV+VAADSRA+ G YI+SQ+VKK+IEINPY+LGTMAGGAADC FW R L
Sbjct  62   GTTTLAFKFRHGVIVAADSRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLL  121

Query  417  GVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGG  596
              +CR++EL NK RISVA ASKLLAN++Y Y+GMGLS+GTMI GWD++GPGLYYVDSEG 
Sbjct  122  ARQCRIYELRNKERISVAAASKLLANMVYQYKGMGLSMGTMICGWDKRGPGLYYVDSEGN  181

Query  597  RLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEEAAELARRSIYHATFRDGASGGVASVYHV  776
            R+ G  FSVGSGS YAYGV+D GY +DL VEEA +LARR+IY AT+RD  SGG  S+YHV
Sbjct  182  RISGATFSVGSGSVYAYGVMDRGYSYDLEVEEAYDLARRAIYQATYRDAYSGGSVSLYHV  241

Query  777  GPNGWKKLSGDDVGELHYHY  836
              +GW ++S D+V +LH  Y
Sbjct  242  REDGWIRVSSDNVADLHDKY  261



>ref|XP_006066544.1| PREDICTED: proteasome subunit beta type-5 [Bubalus bubalis]
Length=263

 Score =   290 bits (742),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 137/200 (69%), Positives = 165/200 (83%), Gaps = 0/200 (0%)
 Frame = +3

Query  237  GTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNL  416
            GTTTLAF F+ GV+VAADSRA+ G YI+SQ+VKK+IEINPY+LGTMAGGAADC FW R L
Sbjct  59   GTTTLAFKFRHGVIVAADSRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLL  118

Query  417  GVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGG  596
              +CR++EL NK RISVA ASKLLAN++Y Y+GMGLS+GTMI GWD++GPGLYYVDSEG 
Sbjct  119  ARQCRIYELRNKERISVAAASKLLANMVYQYKGMGLSMGTMICGWDKRGPGLYYVDSEGN  178

Query  597  RLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEEAAELARRSIYHATFRDGASGGVASVYHV  776
            R+ G  FSVGSGS YAYGV+D GY +DL VEEA +LARR+IY AT+RD  SGG  S+YHV
Sbjct  179  RISGATFSVGSGSVYAYGVMDRGYSYDLEVEEAYDLARRAIYQATYRDAYSGGSVSLYHV  238

Query  777  GPNGWKKLSGDDVGELHYHY  836
              +GW ++S D+V +LH  Y
Sbjct  239  REDGWVRVSSDNVADLHDKY  258



>gb|EFA82937.1| proteasome subunit beta type 5 [Polysphondylium pallidum PN500]
Length=277

 Score =   290 bits (743),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 146/271 (54%), Positives = 194/271 (72%), Gaps = 8/271 (3%)
 Frame = +3

Query  72   MVRIDFSGLESTAPIRGESSELFDEIPRVPS--FQIPNITDFDGFQK-----DAIQMVKP  230
            M  IDF  + ST   R   S++  E+  V +  F++P     D  ++     +A + ++ 
Sbjct  1    MSMIDFDKI-STGLNRTYESDILQELDMVDTQHFEMPACKPGDFLEQVWDHPNAPKPIEM  59

Query  231  AKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHR  410
            A GTTTLAF +  GV+VA DS+++ G Y++S++VKK+IEI PY+LGTMAGGAADC +W R
Sbjct  60   AHGTTTLAFQYAGGVIVAVDSKSTQGSYVASRTVKKVIEITPYLLGTMAGGAADCSYWER  119

Query  411  NLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSE  590
             LG +CRL EL NK  ISVA ASK+LANI+Y Y+G GLS+GTM+ GWD+ GP LYYVDSE
Sbjct  120  ELGRQCRLFELRNKEMISVAAASKILANIVYGYKGYGLSMGTMVTGWDKTGPCLYYVDSE  179

Query  591  GGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEEAAELARRSIYHATFRDGASGGVASVY  770
            G RLKG RF+VGSGS YAYGVLD+G+ ++++ E+A EL RRS+YHAT RD  SGG  +VY
Sbjct  180  GTRLKGLRFAVGSGSTYAYGVLDSGFDWNMTDEQACELGRRSVYHATHRDAMSGGFINVY  239

Query  771  HVGPNGWKKLSGDDVGELHYHYYPVEAAAVE  863
            HV  +GWKK+S DD  +L+  YY V+A  V+
Sbjct  240  HVQKDGWKKISSDDCFQLYQKYYNVKATGVD  270



>ref|XP_004694701.1| PREDICTED: proteasome subunit beta type-5 isoform X1 [Condylura 
cristata]
Length=263

 Score =   290 bits (742),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 141/226 (62%), Positives = 176/226 (78%), Gaps = 11/226 (5%)
 Frame = +3

Query  159  PSFQIPNITDFDGFQKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKK  338
            PS+ +P+        +  I+M+    GTTTLAF F+ GV+VAADSRA+ G YI+SQ+VKK
Sbjct  44   PSWGVPD--------EPRIEMLH---GTTTLAFKFRHGVIVAADSRATAGAYIASQTVKK  92

Query  339  IIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGM  518
            +IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA ASKLLAN++Y Y+GM
Sbjct  93   VIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYKGM  152

Query  519  GLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEEAA  698
            GLS+GTMI GWD++GPGLYYVDSEG R+ G  FSVGSGS YAYGV+D GY +DL VEEA 
Sbjct  153  GLSMGTMICGWDKRGPGLYYVDSEGNRISGVTFSVGSGSVYAYGVMDRGYSYDLEVEEAY  212

Query  699  ELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  836
            +LARR+IY AT+RD  SGG  ++YHV  +GW ++S D+V +LH  Y
Sbjct  213  DLARRAIYQATYRDAYSGGSVNLYHVREDGWIRVSSDNVADLHDKY  258



>ref|XP_002290272.1| proteasome subunit beta type 5 precursor [Thalassiosira pseudonana 
CCMP1335]
 gb|EED92024.1| proteasome subunit beta type 5 precursor [Thalassiosira pseudonana 
CCMP1335]
Length=276

 Score =   290 bits (743),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 138/224 (62%), Positives = 171/224 (76%), Gaps = 8/224 (4%)
 Frame = +3

Query  165  FQIPNITDFDGFQKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKII  344
            F++PN+ D  G        VK AKGTTTLAF F  G++V+ DSR++MG YI+S +VKK+I
Sbjct  50   FEVPNVADVSG--------VKFAKGTTTLAFKFNGGIIVSVDSRSTMGAYIASGTVKKVI  101

Query  345  EINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGL  524
            EINP++LGTMAGGAADC FW RNLG++CRL+EL NK+RI+VA ASKLLAN + SYRG GL
Sbjct  102  EINPFLLGTMAGGAADCSFWERNLGMQCRLYELRNKKRITVASASKLLANTMSSYRGYGL  161

Query  525  SVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEEAAEL  704
            S+GTMI GWDE GP LYYVD +G RL G  FSVGSGS YAYGVLD  YR DL+VEEA +L
Sbjct  162  SMGTMITGWDETGPQLYYVDDDGTRLHGRYFSVGSGSTYAYGVLDTYYRPDLTVEEAIDL  221

Query  705  ARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  836
             +R+IYHA  RD  SG + ++YHV  +GW K+   DV ++HY +
Sbjct  222  GKRAIYHACHRDAMSGSINNLYHVTKDGWVKIHAIDVNDMHYEF  265



>ref|XP_003801967.1| PREDICTED: proteasome subunit beta type-5 [Otolemur garnettii]
Length=263

 Score =   290 bits (741),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 144/240 (60%), Positives = 182/240 (76%), Gaps = 4/240 (2%)
 Frame = +3

Query  120  GESSELFDEIPRVPSFQIPNITDFDGF-QKDAIQMVKPAKGTTTLAFIFKEGVMVAADSR  296
            G  ++L D  P+ PS  +  +    G  ++  I+M+    GTTTLAF F+ GV+VAADSR
Sbjct  22   GGRADLLDLGPKSPSDGLSLVAPSWGVPEEPGIEMLH---GTTTLAFKFRHGVIVAADSR  78

Query  297  ASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGA  476
            A+ G YI+SQ+VKK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA A
Sbjct  79   ATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAA  138

Query  477  SKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVL  656
            SKLLAN++Y Y+GMGLS+GTMI GWD++GPGLYYVDSEG R+ G  FSVGSGS YAYGV+
Sbjct  139  SKLLANMVYQYKGMGLSMGTMICGWDKRGPGLYYVDSEGNRISGATFSVGSGSVYAYGVM  198

Query  657  DNGYRFDLSVEEAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  836
            D GY + L VE+A +LARR+IY AT+RD  SGG  ++YHV  +GW ++S D+V ELH  Y
Sbjct  199  DRGYSYHLEVEQAYDLARRAIYQATYRDAYSGGSVNLYHVREDGWIRVSSDNVAELHDKY  258



>ref|XP_006835507.1| PREDICTED: proteasome subunit beta type-5 [Chrysochloris asiatica]
Length=263

 Score =   290 bits (741),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 138/212 (65%), Positives = 171/212 (81%), Gaps = 3/212 (1%)
 Frame = +3

Query  201  QKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAG  380
            ++  I+M+    GTTTLAF F+ GV+VA DSRA+ G YI+SQ+VKK+IEINPY+LGTMAG
Sbjct  50   EEPGIEMLH---GTTTLAFKFRHGVIVAVDSRATAGAYIASQTVKKVIEINPYLLGTMAG  106

Query  381  GAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEK  560
            GAADC FW R L  +CR++EL NK RISVA ASKLLAN++Y Y+GMGLS+GTMI GWD++
Sbjct  107  GAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYKGMGLSMGTMICGWDKR  166

Query  561  GPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEEAAELARRSIYHATFRD  740
            GPGLYYVDSEG R+ G  FSVGSGS YAYGV+D GY +DL VE+A +LARR+IY AT+RD
Sbjct  167  GPGLYYVDSEGNRISGATFSVGSGSVYAYGVMDRGYSYDLEVEQAYDLARRAIYQATYRD  226

Query  741  GASGGVASVYHVGPNGWKKLSGDDVGELHYHY  836
              SGGV ++YHV  +GW ++S D+V ELH  Y
Sbjct  227  AYSGGVVNLYHVREDGWIRVSSDNVAELHDKY  258



>ref|NP_001032701.1| proteasome subunit beta type-5 [Bos taurus]
 ref|XP_005895501.1| PREDICTED: proteasome subunit beta type-5 [Bos mutus]
 ref|XP_010829574.1| PREDICTED: proteasome subunit beta type-5 [Bison bison bison]
 sp|Q32KL2.1|PSB5_BOVIN RecName: Full=Proteasome subunit beta type-5; Flags: Precursor 
[Bos taurus]
 gb|AAI10040.1| Proteasome (prosome, macropain) subunit, beta type, 5 [Bos taurus]
 tpg|DAA25764.1| TPA: proteasome subunit beta type-5 precursor [Bos taurus]
Length=263

 Score =   290 bits (741),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 137/200 (69%), Positives = 165/200 (83%), Gaps = 0/200 (0%)
 Frame = +3

Query  237  GTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNL  416
            GTTTLAF F+ GV+VAADSRA+ G YI+SQ+VKK+IEINPY+LGTMAGGAADC FW R L
Sbjct  59   GTTTLAFKFRHGVIVAADSRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLL  118

Query  417  GVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGG  596
              +CR++EL NK RISVA ASKLLAN++Y Y+GMGLS+GTMI GWD++GPGLYYVDSEG 
Sbjct  119  ARQCRIYELRNKERISVAAASKLLANMVYQYKGMGLSMGTMICGWDKRGPGLYYVDSEGN  178

Query  597  RLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEEAAELARRSIYHATFRDGASGGVASVYHV  776
            R+ G  FSVGSGS YAYGV+D GY +DL VEEA +LARR+IY AT+RD  SGG  S+YHV
Sbjct  179  RISGATFSVGSGSVYAYGVMDRGYSYDLEVEEAYDLARRAIYQATYRDAYSGGSVSLYHV  238

Query  777  GPNGWKKLSGDDVGELHYHY  836
              +GW ++S D+V +LH  Y
Sbjct  239  REDGWIRVSSDNVADLHDKY  258



>ref|XP_003987515.1| PREDICTED: proteasome subunit beta type-5 [Felis catus]
 ref|XP_007098030.1| PREDICTED: proteasome subunit beta type-5 [Panthera tigris altaica]
Length=263

 Score =   290 bits (741),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 143/237 (60%), Positives = 180/237 (76%), Gaps = 4/237 (2%)
 Frame = +3

Query  129  SELFDEIPRVPSFQIPNITDFDGFQKDA-IQMVKPAKGTTTLAFIFKEGVMVAADSRASM  305
            ++L D  P  PS  +       G  ++  I+M+    GTTTLAF F+ GV+VAADSRA+ 
Sbjct  25   ADLLDLGPGSPSDGLSLAAPHRGVPEEPRIEMLH---GTTTLAFKFQHGVIVAADSRATA  81

Query  306  GGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKL  485
            G YI+SQ+VKK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA ASKL
Sbjct  82   GAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASKL  141

Query  486  LANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNG  665
            LAN++Y Y+GMGLS+GTMI GWD++GPGLYYVDSEG R+ G  FSVGSGS YAYGV+D G
Sbjct  142  LANMVYQYKGMGLSMGTMICGWDKRGPGLYYVDSEGNRISGATFSVGSGSVYAYGVMDRG  201

Query  666  YRFDLSVEEAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  836
            Y +DL VE+A +LARR+IY AT+RD  SGG  ++YHV  +GW ++S D+V +LH  Y
Sbjct  202  YSYDLEVEQAYDLARRAIYQATYRDAYSGGAVNLYHVREDGWIRVSSDNVADLHDKY  258



>ref|XP_008065987.1| PREDICTED: proteasome subunit beta type-5 [Tarsius syrichta]
Length=263

 Score =   290 bits (741),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 145/240 (60%), Positives = 182/240 (76%), Gaps = 4/240 (2%)
 Frame = +3

Query  120  GESSELFDEIPRVPSFQIPNITDFDGF-QKDAIQMVKPAKGTTTLAFIFKEGVMVAADSR  296
            G  ++L D  P  PS  +   T   G  ++  I+M+    GTTTLAF F+ GV+VAADSR
Sbjct  22   GGRADLLDLGPGNPSDGLSLATPSWGVPEEPGIEMLH---GTTTLAFKFRHGVIVAADSR  78

Query  297  ASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGA  476
            A+ G YI+SQ+VKK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA A
Sbjct  79   ATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAA  138

Query  477  SKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVL  656
            SKLLAN++Y Y+GMGLS+GTMI GWD++GPGLYYVDSEG R+ G  FSVGSGS YAYGV+
Sbjct  139  SKLLANMVYQYKGMGLSMGTMICGWDKRGPGLYYVDSEGNRISGATFSVGSGSVYAYGVM  198

Query  657  DNGYRFDLSVEEAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  836
            D GY +DL VE+A +LARR+IY AT+RD  SGG  ++YHV  +GW ++S D+V +LH  Y
Sbjct  199  DRGYSYDLEVEQAYDLARRAIYQATYRDAYSGGAVNLYHVREDGWIRVSSDNVADLHDKY  258



>ref|XP_002926051.1| PREDICTED: proteasome subunit beta type-5 [Ailuropoda melanoleuca]
 gb|EFB18962.1| hypothetical protein PANDA_015661, partial [Ailuropoda melanoleuca]
Length=263

 Score =   290 bits (741),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 144/240 (60%), Positives = 181/240 (75%), Gaps = 10/240 (4%)
 Frame = +3

Query  129  SELFDEIPRVPS----FQIPNITDFDGFQKDAIQMVKPAKGTTTLAFIFKEGVMVAADSR  296
            ++L D  P  PS       PN   +   ++  I+M+    GTTTLAF F+ GV+VAADSR
Sbjct  25   ADLLDLGPGSPSDGLSLAAPN---WGVTEEPRIEMLH---GTTTLAFKFQHGVIVAADSR  78

Query  297  ASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGA  476
            A+ G YI+SQ+VKK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA A
Sbjct  79   ATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAA  138

Query  477  SKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVL  656
            SKLLAN++Y Y+GMGLS+GTMI GWD++GPGLYYVDSEG R+ G  FSVGSGS YAYGV+
Sbjct  139  SKLLANMVYQYKGMGLSMGTMICGWDKRGPGLYYVDSEGNRISGATFSVGSGSVYAYGVM  198

Query  657  DNGYRFDLSVEEAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  836
            D GY +DL VE+A +LARR+IY AT+RD  SGG  ++YHV  +GW ++S D+V +LH  Y
Sbjct  199  DRGYSYDLEVEQAYDLARRAIYQATYRDAYSGGAVNLYHVREDGWIRVSSDNVADLHDEY  258



>ref|XP_006802789.1| PREDICTED: proteasome subunit beta type-5-like [Neolamprologus 
brichardi]
Length=281

 Score =   290 bits (743),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 140/228 (61%), Positives = 176/228 (77%), Gaps = 7/228 (3%)
 Frame = +3

Query  162  SFQIPN---ITDFDGFQKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSV  332
            SF + N   + D DG ++     ++   GTTTLAF F+ GV+VA DSRA+ G YI+SQ+V
Sbjct  54   SFSVKNPLCVGDDDGVERK----IEFLHGTTTLAFKFQHGVIVAVDSRATAGSYIASQTV  109

Query  333  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  512
            KK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA ASKLLAN++Y Y+
Sbjct  110  KKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYK  169

Query  513  GMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEE  692
            GMGLS+GTM+ GWD++GPGLYYVDSEG R+ G+ F+VGSGS YAYGV+D+G R DL+VEE
Sbjct  170  GMGLSMGTMVCGWDKRGPGLYYVDSEGNRVCGDLFAVGSGSMYAYGVMDSGVRHDLTVEE  229

Query  693  AAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  836
            A EL RR+IY AT+RD  SGG  ++YHV   GW ++S DDV  LH+ Y
Sbjct  230  ACELGRRAIYQATYRDAYSGGQVNLYHVHSEGWTRISQDDVLVLHHQY  277



>ref|XP_005882305.1| PREDICTED: proteasome subunit beta type-5 [Myotis brandtii]
Length=263

 Score =   289 bits (740),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 147/256 (57%), Positives = 186/256 (73%), Gaps = 9/256 (4%)
 Frame = +3

Query  90   SGLESTAPIR-------GESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTT  248
            S LES+ P+        G  ++L D  P  PS  +       G  ++    ++   GTTT
Sbjct  5    SVLESSVPVNRHGFFGLGGRADLLDLGPGSPSDGLSLAAPSWGVPEE--PRIEILHGTTT  62

Query  249  LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKC  428
            LAF F+ GV+VAADSRA++G YI+SQ+VKK+IEINPY+LGTMAGGAADC FW R L  +C
Sbjct  63   LAFKFQHGVIVAADSRATVGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQC  122

Query  429  RLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKG  608
            R++EL NK RISVA ASKLL N++Y Y+GMGLS+GTMI GWD++GPGLYYVDSEG R+ G
Sbjct  123  RIYELRNKERISVAAASKLLVNMVYQYKGMGLSMGTMICGWDKRGPGLYYVDSEGNRISG  182

Query  609  NRFSVGSGSPYAYGVLDNGYRFDLSVEEAAELARRSIYHATFRDGASGGVASVYHVGPNG  788
              FSVGSGS YAYGV+D GY +DL VEEA +LARR+IY AT+RD  SGG  ++YHV  +G
Sbjct  183  VTFSVGSGSVYAYGVMDRGYSYDLEVEEAYDLARRAIYQATYRDAYSGGSVNLYHVREDG  242

Query  789  WKKLSGDDVGELHYHY  836
            W ++S D+V +LH  Y
Sbjct  243  WIRVSSDNVADLHDKY  258



>ref|XP_010744420.1| PREDICTED: proteasome subunit beta type-5 [Larimichthys crocea]
Length=273

 Score =   290 bits (741),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 143/237 (60%), Positives = 178/237 (75%), Gaps = 8/237 (3%)
 Frame = +3

Query  138  FDEIP-RVPSFQIPN---ITDFDGFQKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASM  305
            FD  P    SF + N     D DG ++     ++   GTTTLAF F+ GV+VA DSRA+ 
Sbjct  35   FDATPGDGLSFSVRNPLCAADDDGVERK----IEFLHGTTTLAFKFQHGVIVAVDSRATA  90

Query  306  GGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKL  485
            G YI+SQ+VKK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA ASKL
Sbjct  91   GSYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASKL  150

Query  486  LANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNG  665
            LAN++Y Y+GMGLS+GTM+ GWD++GPGLYYVDSEG R+ G+ F+VGSGS YAYGV+D+G
Sbjct  151  LANMVYQYKGMGLSMGTMVCGWDKRGPGLYYVDSEGNRVCGDLFAVGSGSMYAYGVMDSG  210

Query  666  YRFDLSVEEAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  836
             R DLSVEEA EL RR+IY AT+RD  SGG  ++YHV   GW ++S +DV  LH+ Y
Sbjct  211  LRHDLSVEEACELGRRAIYQATYRDAYSGGQVNLYHVHSEGWTRVSQEDVLMLHHQY  267



>ref|XP_003755883.1| PREDICTED: proteasome subunit beta type-5 [Sarcophilus harrisii]
Length=263

 Score =   289 bits (740),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 151/260 (58%), Positives = 188/260 (72%), Gaps = 17/260 (7%)
 Frame = +3

Query  90   SGLESTAPIRGES-------SELFDEIPRVP----SFQIPNITDFDGFQKDAIQMVKPAK  236
            S LES  P+ G         S+L D  P  P    S   P+    D   +  I+++    
Sbjct  5    SVLESPLPVNGVGFFGLGGRSDLLDLGPGAPGDGLSLAAPSWGAPD---EPGIELLH---  58

Query  237  GTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNL  416
            GTTTLAF F+ GV+VA DSRA+ G YI+SQ+VKK+IEINPY+LGTMAGGAADC FW R L
Sbjct  59   GTTTLAFKFRHGVIVAVDSRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLL  118

Query  417  GVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGG  596
              +CR++EL NK RISVA ASKLLAN++Y Y+GMGLS+GTMI GWD++GPGLYYVDSEG 
Sbjct  119  ARQCRIYELRNKERISVAAASKLLANMVYQYKGMGLSMGTMICGWDKRGPGLYYVDSEGN  178

Query  597  RLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEEAAELARRSIYHATFRDGASGGVASVYHV  776
            R+ G  FSVGSGS YAYGV+D GY FDL+VEEA +LARR+IY AT+RD  SGGV ++YHV
Sbjct  179  RISGVTFSVGSGSVYAYGVMDRGYSFDLTVEEAYDLARRAIYQATYRDAYSGGVVNLYHV  238

Query  777  GPNGWKKLSGDDVGELHYHY  836
              +GW ++S D+V +L+  Y
Sbjct  239  REDGWIRVSSDNVADLNDKY  258



>ref|XP_007180616.1| PREDICTED: proteasome subunit beta type-5 [Balaenoptera acutorostrata 
scammoni]
Length=263

 Score =   289 bits (740),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 143/239 (60%), Positives = 180/239 (75%), Gaps = 2/239 (1%)
 Frame = +3

Query  120  GESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRA  299
            G  ++L D  P  PS  +  +    G  ++    ++   GTTTLAF F+ GV+VAADSRA
Sbjct  22   GGRADLLDLGPGSPSDGLSLVAPSWGVPEE--PRIEILHGTTTLAFKFRHGVIVAADSRA  79

Query  300  SMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGAS  479
            + G YI+SQ+VKK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA AS
Sbjct  80   TAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAAS  139

Query  480  KLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLD  659
            KLLAN++Y Y+GMGLS+GTMI GWD++GPGLYYVDSEG R+ G  FSVGSGS YAYGV+D
Sbjct  140  KLLANMVYQYKGMGLSMGTMICGWDKRGPGLYYVDSEGNRISGATFSVGSGSVYAYGVMD  199

Query  660  NGYRFDLSVEEAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  836
             GY +DL VEEA +LARR+IY AT+RD  SGG  ++YHV  +GW ++S D+V +LH  Y
Sbjct  200  RGYSYDLEVEEAYDLARRAIYQATYRDAYSGGSVNLYHVREDGWIRVSSDNVADLHDKY  258



>ref|XP_008708757.1| PREDICTED: proteasome subunit beta type-5 [Ursus maritimus]
Length=263

 Score =   289 bits (740),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 144/240 (60%), Positives = 180/240 (75%), Gaps = 10/240 (4%)
 Frame = +3

Query  129  SELFDEIPRVPS----FQIPNITDFDGFQKDAIQMVKPAKGTTTLAFIFKEGVMVAADSR  296
            ++L D  P  PS       PN   +   ++  I+M+    GTTTLAF F+ GV+VAADSR
Sbjct  25   ADLLDLGPGSPSDGLSLAAPN---WGVAEEPRIEMLH---GTTTLAFKFQHGVIVAADSR  78

Query  297  ASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGA  476
            A+ G YI+SQ+VKK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA A
Sbjct  79   ATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAA  138

Query  477  SKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVL  656
            SKLLAN++Y Y+GMGLS+GTMI GWD++GPGLYYVDSEG R+ G  FSVGSGS YAYGV+
Sbjct  139  SKLLANMVYQYKGMGLSMGTMICGWDKRGPGLYYVDSEGNRISGATFSVGSGSVYAYGVM  198

Query  657  DNGYRFDLSVEEAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  836
            D GY +DL VEEA +LARR+IY AT+RD  SGG  ++YHV  +GW ++S D+V +L   Y
Sbjct  199  DRGYSYDLEVEEAYDLARRAIYQATYRDAYSGGAVNLYHVREDGWTRVSSDNVADLQDKY  258



>ref|NP_001099197.2| proteasome subunit beta type-5 [Rattus norvegicus]
 gb|EDM14180.1| proteasome (prosome, macropain) subunit, beta type 5, isoform 
CRA_a [Rattus norvegicus]
Length=263

 Score =   289 bits (740),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 140/226 (62%), Positives = 176/226 (78%), Gaps = 11/226 (5%)
 Frame = +3

Query  159  PSFQIPNITDFDGFQKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKK  338
            PS+ +P        ++  I+M+    GTTTLAF F+ GV+VAADSRA+ G YI+SQ+VKK
Sbjct  44   PSWGVP--------EEPRIEMLH---GTTTLAFKFQHGVIVAADSRATAGAYIASQTVKK  92

Query  339  IIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGM  518
            +IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA ASKLLAN++Y Y+GM
Sbjct  93   VIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYKGM  152

Query  519  GLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEEAA  698
            GLS+GTMI GWD++GPGLYYVDSEG R+ G  FSVGSGS YA+GV+D GY +DL VEEA 
Sbjct  153  GLSMGTMICGWDKRGPGLYYVDSEGNRISGTAFSVGSGSVYAFGVMDRGYSYDLQVEEAY  212

Query  699  ELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  836
            +LARR+IY AT+RD  SGG  ++YHV  +GW ++S D+V +LH  Y
Sbjct  213  DLARRAIYQATYRDAYSGGAVNLYHVREDGWIRVSSDNVADLHDKY  258



>ref|XP_002718121.1| PREDICTED: proteasome subunit beta type-5 isoform X1 [Oryctolagus 
cuniculus]
Length=263

 Score =   289 bits (740),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 148/257 (58%), Positives = 187/257 (73%), Gaps = 11/257 (4%)
 Frame = +3

Query  90   SGLESTAPIR-------GESSELFDEIPRVPSFQIPNITDFDGF-QKDAIQMVKPAKGTT  245
            S LE+  P+        G  ++L D  P  PS  +       G  ++  I+M+    GTT
Sbjct  5    SVLETPLPVNQRGFFGLGGRTDLLDLGPGSPSDGLSLTAPGWGVPEEPGIEMLH---GTT  61

Query  246  TLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVK  425
            TLAF F+ GV+VAADSRA+ G YI+SQ+VKK+IEINPY+LGTMAGGAADC FW R L  +
Sbjct  62   TLAFKFRHGVIVAADSRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQ  121

Query  426  CRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLK  605
            CR++EL NK RISVA ASKLLAN++Y Y+GMGLS+GTMI GWD++GPGLYYVDSEG R+ 
Sbjct  122  CRIYELRNKERISVAAASKLLANMVYQYKGMGLSMGTMICGWDKRGPGLYYVDSEGNRIS  181

Query  606  GNRFSVGSGSPYAYGVLDNGYRFDLSVEEAAELARRSIYHATFRDGASGGVASVYHVGPN  785
            G  FSVGSGS YAYGV+D GY +DL VE+A +LARR+IY AT+RD  SGG  ++YHV  +
Sbjct  182  GATFSVGSGSVYAYGVMDRGYSYDLEVEQAYDLARRAIYQATYRDAYSGGAVNLYHVRED  241

Query  786  GWKKLSGDDVGELHYHY  836
            GW ++S D+V +LH  Y
Sbjct  242  GWIRVSSDNVADLHDKY  258



>ref|XP_003421032.1| PREDICTED: proteasome subunit beta type-5 [Loxodonta africana]
Length=263

 Score =   289 bits (739),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 137/212 (65%), Positives = 171/212 (81%), Gaps = 3/212 (1%)
 Frame = +3

Query  201  QKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAG  380
            ++  I+M+    GTTTLAF F+ GV+VA DSRA+ G YI+SQ+VKK+IEINPY+LGTMAG
Sbjct  50   EEPGIEMLH---GTTTLAFKFRHGVIVAVDSRATAGAYIASQTVKKVIEINPYLLGTMAG  106

Query  381  GAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEK  560
            GAADC FW R L  +CR++EL NK RISVA ASKLLAN++Y Y+GMGLS+GTMI GWD++
Sbjct  107  GAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYKGMGLSMGTMICGWDKR  166

Query  561  GPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEEAAELARRSIYHATFRD  740
            GPGLYYVDSEG R+ G  FSVGSGS YAYGV+D GY +DL VE+A +LARR+IY AT+RD
Sbjct  167  GPGLYYVDSEGNRISGATFSVGSGSVYAYGVMDRGYSYDLEVEQAYDLARRAIYQATYRD  226

Query  741  GASGGVASVYHVGPNGWKKLSGDDVGELHYHY  836
              SGGV ++YHV  +GW ++S D+V +LH  Y
Sbjct  227  AYSGGVVNLYHVREDGWIRVSSDNVADLHDKY  258



>ref|XP_004698955.1| PREDICTED: proteasome subunit beta type-5 [Echinops telfairi]
Length=263

 Score =   289 bits (739),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 135/200 (68%), Positives = 165/200 (83%), Gaps = 0/200 (0%)
 Frame = +3

Query  237  GTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNL  416
            GTTTLAF F+ GV+VA DSRA+ G YI+SQ+VKK+IEINPY+LGTMAGGAADC FW R L
Sbjct  59   GTTTLAFKFRRGVIVAVDSRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLL  118

Query  417  GVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGG  596
              +CR++EL NK RISVA ASKLLAN++Y Y+GMGLS+GTMI GWD++GPGLYYVDSEG 
Sbjct  119  ARQCRIYELRNKERISVAAASKLLANMVYQYKGMGLSMGTMICGWDKRGPGLYYVDSEGN  178

Query  597  RLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEEAAELARRSIYHATFRDGASGGVASVYHV  776
            R+ G  FSVGSGS YAYGV+D GY +DL VE+A +LARR+IY AT+RD  SGGV ++YHV
Sbjct  179  RISGTTFSVGSGSVYAYGVMDRGYSYDLEVEQAYDLARRAIYQATYRDAYSGGVVNLYHV  238

Query  777  GPNGWKKLSGDDVGELHYHY  836
              +GW ++S D+V +LH  Y
Sbjct  239  REDGWIRVSSDNVADLHDKY  258



>ref|XP_003506173.1| PREDICTED: proteasome subunit beta type-5 [Cricetulus griseus]
 ref|XP_007609296.1| PREDICTED: proteasome subunit beta type-5 [Cricetulus griseus]
 gb|EGV98712.1| Proteasome subunit beta type-5 [Cricetulus griseus]
Length=263

 Score =   289 bits (739),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 140/226 (62%), Positives = 176/226 (78%), Gaps = 11/226 (5%)
 Frame = +3

Query  159  PSFQIPNITDFDGFQKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKK  338
            PS+ +P        ++  I+M+    GTTTLAF F+ GV+VAADSRA+ G YI+SQ+VKK
Sbjct  44   PSWGVP--------EEPRIEMLH---GTTTLAFKFRHGVIVAADSRATAGAYIASQTVKK  92

Query  339  IIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGM  518
            +IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA ASKLLAN++Y Y+GM
Sbjct  93   VIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYKGM  152

Query  519  GLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEEAA  698
            GLS+GTMI GWD++GPGLYYVDSEG R+ G  FSVGSGS YAYGV+D GY +DL V+EA 
Sbjct  153  GLSMGTMICGWDKRGPGLYYVDSEGNRISGTAFSVGSGSVYAYGVMDRGYSYDLEVQEAY  212

Query  699  ELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  836
            +LARR+IY AT+RD  SGG  ++YHV  +GW ++S D+V +LH  Y
Sbjct  213  DLARRAIYQATYRDAYSGGSVNLYHVREDGWIRVSSDNVADLHDKY  258



>ref|XP_004389982.1| PREDICTED: proteasome subunit beta type-5 [Trichechus manatus 
latirostris]
Length=263

 Score =   289 bits (739),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 137/212 (65%), Positives = 171/212 (81%), Gaps = 3/212 (1%)
 Frame = +3

Query  201  QKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAG  380
            ++  I+M+    GTTTLAF F+ GV+VA DSRA+ G YI+SQ+VKK+IEINPY+LGTMAG
Sbjct  50   EEPGIEMLH---GTTTLAFKFRHGVIVAVDSRATAGAYIASQTVKKVIEINPYLLGTMAG  106

Query  381  GAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEK  560
            GAADC FW R L  +CR++EL NK RISVA ASKLLAN++Y Y+GMGLS+GTMI GWD++
Sbjct  107  GAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYKGMGLSMGTMICGWDKR  166

Query  561  GPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEEAAELARRSIYHATFRD  740
            GPGLYYVDSEG R+ G  FSVGSGS YAYGV+D GY +DL VE+A +LARR+IY AT+RD
Sbjct  167  GPGLYYVDSEGNRISGATFSVGSGSVYAYGVMDRGYSYDLEVEQAYDLARRAIYQATYRD  226

Query  741  GASGGVASVYHVGPNGWKKLSGDDVGELHYHY  836
              SGGV ++YHV  +GW ++S D+V +LH  Y
Sbjct  227  AYSGGVVNLYHVREDGWIRVSSDNVADLHDKY  258



>ref|XP_001494538.2| PREDICTED: proteasome subunit beta type-5 isoform 1 [Equus caballus]
Length=263

 Score =   289 bits (739),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 140/226 (62%), Positives = 176/226 (78%), Gaps = 11/226 (5%)
 Frame = +3

Query  159  PSFQIPNITDFDGFQKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKK  338
            PS+ +P        ++  I+M+    GTTTLAF F+ GV+VAADSRA+ G YI+SQ+VKK
Sbjct  44   PSWGVP--------EEPRIEMLH---GTTTLAFKFQHGVIVAADSRATAGAYIASQTVKK  92

Query  339  IIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGM  518
            +IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA ASKLLAN++Y Y+GM
Sbjct  93   VIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYKGM  152

Query  519  GLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEEAA  698
            GLS+GTMI GWD++GPGLYYVDSEG R+ G  FSVGSGS YAYGV+D GY +DL VE+A 
Sbjct  153  GLSMGTMICGWDKRGPGLYYVDSEGNRISGATFSVGSGSVYAYGVMDRGYSYDLEVEQAY  212

Query  699  ELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  836
            +LARR+IY AT+RD  SGG  ++YHV  +GW ++S D+V +LH  Y
Sbjct  213  DLARRAIYQATYRDAYSGGAVNLYHVREDGWIRVSSDNVADLHDKY  258



>ref|XP_004402154.1| PREDICTED: proteasome subunit beta type-5 [Odobenus rosmarus 
divergens]
Length=263

 Score =   288 bits (738),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 135/200 (68%), Positives = 165/200 (83%), Gaps = 0/200 (0%)
 Frame = +3

Query  237  GTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNL  416
            GTTTLAF F+ GV+VAADSRA+ G YI+SQ+VKK+IEINPY+LGTMAGGAADC FW R L
Sbjct  59   GTTTLAFKFQHGVIVAADSRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLL  118

Query  417  GVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGG  596
              +CR++EL NK RISVA ASKLLAN++Y Y+GMGLS+GTMI GWD++GPGLYYVDSEG 
Sbjct  119  ARQCRIYELRNKERISVAAASKLLANMVYQYKGMGLSMGTMICGWDKRGPGLYYVDSEGN  178

Query  597  RLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEEAAELARRSIYHATFRDGASGGVASVYHV  776
            R+ G  FSVGSGS YAYGV+D GY +DL VE+A +LARR+IY AT+RD  SGG  ++YHV
Sbjct  179  RISGATFSVGSGSVYAYGVMDRGYSYDLEVEQAYDLARRAIYQATYRDAYSGGAVNLYHV  238

Query  777  GPNGWKKLSGDDVGELHYHY  836
              +GW ++S D+V +LH  Y
Sbjct  239  REDGWIRVSSDNVADLHDKY  258



>ref|XP_008527207.1| PREDICTED: proteasome subunit beta type-5 [Equus przewalskii]
Length=263

 Score =   288 bits (738),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 140/226 (62%), Positives = 176/226 (78%), Gaps = 11/226 (5%)
 Frame = +3

Query  159  PSFQIPNITDFDGFQKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKK  338
            PS+ +P        ++  I+M+    GTTTLAF F+ GV+VAADSRA+ G YI+SQ+VKK
Sbjct  44   PSWGVP--------EEPRIEMLH---GTTTLAFKFQHGVIVAADSRATAGAYIASQTVKK  92

Query  339  IIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGM  518
            +IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA ASKLLAN++Y Y+GM
Sbjct  93   VIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYKGM  152

Query  519  GLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEEAA  698
            GLS+GTMI GWD++GPGLYYVDSEG R+ G  FSVGSGS YAYGV+D GY +DL VE+A 
Sbjct  153  GLSMGTMICGWDKRGPGLYYVDSEGNRISGATFSVGSGSVYAYGVMDRGYSYDLEVEQAY  212

Query  699  ELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  836
            +LARR+IY AT+RD  SGG  ++YHV  +GW ++S D+V +LH  Y
Sbjct  213  DLARRAIYQATYRDAYSGGAVNLYHVREDGWIRVSSDNVADLHDKY  258



>dbj|BAE93066.1| low molecular mass polypeptide [Lethenteron camtschaticum]
Length=204

 Score =   286 bits (733),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 136/200 (68%), Positives = 163/200 (82%), Gaps = 0/200 (0%)
 Frame = +3

Query  237  GTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNL  416
            GTTTLAF F+ GV+VA DSRA+ G YI+SQ+VKK+IEINPY+LGTMAGGAADC +W R L
Sbjct  1    GTTTLAFKFQHGVIVAVDSRATAGSYIASQTVKKVIEINPYLLGTMAGGAADCMYWERVL  60

Query  417  GVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGG  596
              +CR++EL NK RISVA ASKLLAN++Y Y+GMGLS+GTMI GWD+KGPGLYYVD EG 
Sbjct  61   AKQCRIYELRNKERISVAAASKLLANMVYQYKGMGLSMGTMICGWDKKGPGLYYVDDEGM  120

Query  597  RLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEEAAELARRSIYHATFRDGASGGVASVYHV  776
            RL G+ F+VGSGSPYA+GVLD+GYR DLS EEA +L RR+I  AT RD  SGGV ++YH+
Sbjct  121  RLPGSMFAVGSGSPYAFGVLDSGYREDLSKEEAYDLGRRAIASATHRDAYSGGVVNLYHM  180

Query  777  GPNGWKKLSGDDVGELHYHY  836
               GW K+S DDV EL Y +
Sbjct  181  CQTGWIKVSQDDVSELQYKF  200



>ref|XP_003639276.1| PREDICTED: proteasome subunit beta type-5 [Canis lupus familiaris]
Length=263

 Score =   288 bits (738),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 143/236 (61%), Positives = 180/236 (76%), Gaps = 4/236 (2%)
 Frame = +3

Query  132  ELFDEIPRVPSFQIPNITDFDGFQKD-AIQMVKPAKGTTTLAFIFKEGVMVAADSRASMG  308
            +L D  P  PS  +  +    G  ++  I+M+    GTTTLAF F+ GV+VAADSRA+ G
Sbjct  26   DLLDLGPGSPSDGLSLVAPNWGVAEEPGIEMLH---GTTTLAFKFQHGVIVAADSRATAG  82

Query  309  GYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLL  488
             YI+SQ+VKK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA ASKLL
Sbjct  83   AYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASKLL  142

Query  489  ANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGY  668
            AN++Y Y+GMGLS+GTMI GWD++GPGLYYVDSEG R+ G  FSVGSGS YAYGV+D GY
Sbjct  143  ANMVYQYKGMGLSMGTMICGWDKRGPGLYYVDSEGNRISGATFSVGSGSVYAYGVMDRGY  202

Query  669  RFDLSVEEAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  836
             +DL VE+A +LARR+IY AT+RD  SGG  ++YHV  +GW ++S D+V +LH  Y
Sbjct  203  SYDLEVEQAYDLARRAIYQATYRDAYSGGAVNLYHVREDGWIRVSSDNVADLHDKY  258



>ref|XP_010376681.1| PREDICTED: proteasome subunit beta type-5 [Rhinopithecus roxellana]
Length=271

 Score =   289 bits (739),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 137/212 (65%), Positives = 171/212 (81%), Gaps = 3/212 (1%)
 Frame = +3

Query  201  QKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAG  380
            ++  I+M+    GTTTLAF F+ GV+VAADSRA+ G YI+SQ+VKK+IEINPY+LGTMAG
Sbjct  58   EEPGIEMLH---GTTTLAFKFRHGVVVAADSRATAGAYIASQTVKKVIEINPYLLGTMAG  114

Query  381  GAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEK  560
            GAADC FW R L  +CR++EL NK RISVA ASKLLAN++Y Y+GMGLS+GTMI GWD++
Sbjct  115  GAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYKGMGLSMGTMICGWDKR  174

Query  561  GPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEEAAELARRSIYHATFRD  740
            GPGLYYVDSEG R+ G  FSVGSGS YAYGV+D GY +DL VE+A +LARR+IY AT+RD
Sbjct  175  GPGLYYVDSEGNRISGATFSVGSGSVYAYGVMDRGYSYDLEVEQAYDLARRAIYQATYRD  234

Query  741  GASGGVASVYHVGPNGWKKLSGDDVGELHYHY  836
              SGG  ++YHV  +GW ++S D+V +LH  Y
Sbjct  235  AYSGGAVNLYHVREDGWIRVSSDNVADLHEKY  266



>ref|NP_035316.1| proteasome subunit beta type-5 [Mus musculus]
 sp|O55234.3|PSB5_MOUSE RecName: Full=Proteasome subunit beta type-5; AltName: Full=Macropain 
epsilon chain; AltName: Full=Multicatalytic endopeptidase 
complex epsilon chain; AltName: Full=Proteasome chain 
6; AltName: Full=Proteasome epsilon chain; AltName: Full=Proteasome 
subunit X; Flags: Precursor [Mus musculus]
 gb|AAD50536.1|AF060091_1 proteasome subunit X [Mus musculus]
 dbj|BAA24916.1| PSMB5 [Mus musculus]
 dbj|BAA24917.1| PSMB5 [Mus musculus]
 dbj|BAE21876.1| unnamed protein product [Mus musculus]
 gb|AAI06145.1| Proteasome (prosome, macropain) subunit, beta type 5 [Mus musculus]
 gb|EDL36339.1| mCG8712, isoform CRA_b [Mus musculus]
Length=264

 Score =   288 bits (738),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 142/229 (62%), Positives = 176/229 (77%), Gaps = 11/229 (5%)
 Frame = +3

Query  159  PSFQIPNITDFDGFQKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKK  338
            PS+ +P        ++  I+M+    GTTTLAF F  GV+VAADSRA+ G YI+SQ+VKK
Sbjct  44   PSWGVP--------EEPRIEMLH---GTTTLAFKFLHGVIVAADSRATAGAYIASQTVKK  92

Query  339  IIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGM  518
            +IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA ASKLLAN++Y Y+GM
Sbjct  93   VIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYKGM  152

Query  519  GLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEEAA  698
            GLS+GTMI GWD++GPGLYYVDSEG R+ G  FSVGSGS YAYGV+D GY +DL VEEA 
Sbjct  153  GLSMGTMICGWDKRGPGLYYVDSEGNRISGTAFSVGSGSVYAYGVMDRGYSYDLKVEEAY  212

Query  699  ELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPV  845
            +LARR+IY AT+RD  SGG  ++YHV  +GW ++S D+V +LH  Y  V
Sbjct  213  DLARRAIYQATYRDAYSGGAVNLYHVREDGWIRVSSDNVADLHDKYSSV  261



>gb|AAH12246.1| Proteasome (prosome, macropain) subunit, beta type 5 [Mus musculus]
Length=264

 Score =   288 bits (738),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 142/229 (62%), Positives = 176/229 (77%), Gaps = 11/229 (5%)
 Frame = +3

Query  159  PSFQIPNITDFDGFQKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKK  338
            PS+ +P        ++  I+M+    GTTTLAF F  GV+VAADSRA+ G YI+SQ+VKK
Sbjct  44   PSWGVP--------EEPRIEMLH---GTTTLAFKFLHGVIVAADSRATAGAYIASQTVKK  92

Query  339  IIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGM  518
            +IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA ASKLLAN++Y Y+GM
Sbjct  93   VIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYKGM  152

Query  519  GLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEEAA  698
            GLS+GTMI GWD++GPGLYYVDSEG R+ G  FSVGSGS YAYGV+D GY +DL VEEA 
Sbjct  153  GLSMGTMICGWDKRGPGLYYVDSEGNRISGTAFSVGSGSVYAYGVMDRGYSYDLKVEEAY  212

Query  699  ELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPV  845
            +LARR+IY AT+RD  SGG  ++YHV  +GW ++S D+V +LH  Y  V
Sbjct  213  DLARRAIYQATYRDAYSGGAVNLYHVREDGWIRVSNDNVADLHDKYSSV  261



>ref|XP_004313401.1| PREDICTED: proteasome subunit beta type-5 isoform 1 [Tursiops 
truncatus]
Length=263

 Score =   288 bits (738),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 144/240 (60%), Positives = 182/240 (76%), Gaps = 4/240 (2%)
 Frame = +3

Query  120  GESSELFDEIPRVPSFQIPNITDFDGFQKDA-IQMVKPAKGTTTLAFIFKEGVMVAADSR  296
            G  ++L D  P  PS  +  +    G  ++  I+M+    GTTTLAF F+ GV+VAADSR
Sbjct  22   GGRADLLDLGPGSPSDGLSLVAPSWGVPEEPRIEMLH---GTTTLAFKFRHGVIVAADSR  78

Query  297  ASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGA  476
            A+ G YI+SQ+VKK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA A
Sbjct  79   ATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAA  138

Query  477  SKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVL  656
            SKLLAN++Y Y+GMGLS+GTMI GWD++GPGLYYVDSEG R+ G  FSVGSGS YAYGV+
Sbjct  139  SKLLANMVYQYKGMGLSMGTMICGWDKRGPGLYYVDSEGNRISGATFSVGSGSVYAYGVM  198

Query  657  DNGYRFDLSVEEAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  836
            D GY +DL VEEA +LARR+IY AT+RD  SGG  ++YHV  +GW ++S ++V +LH  Y
Sbjct  199  DRGYSYDLEVEEAYDLARRAIYQATYRDAYSGGSVNLYHVREDGWIRVSSNNVADLHDKY  258



>emb|CAD97956.1| hypothetical protein [Homo sapiens]
Length=266

 Score =   288 bits (738),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 137/212 (65%), Positives = 171/212 (81%), Gaps = 3/212 (1%)
 Frame = +3

Query  201  QKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAG  380
            ++  I+M+    GTTTLAF F+ GV+VAADSRA+ G YI+SQ+VKK+IEINPY+LGTMAG
Sbjct  53   EEPGIEMLH---GTTTLAFKFRHGVIVAADSRATAGAYIASQTVKKVIEINPYLLGTMAG  109

Query  381  GAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEK  560
            GAADC FW R L  +CR++EL NK RISVA ASKLLAN++Y Y+GMGLS+GTMI GWD++
Sbjct  110  GAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYKGMGLSMGTMICGWDKR  169

Query  561  GPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEEAAELARRSIYHATFRD  740
            GPGLYYVDSEG R+ G  FSVGSGS YAYGV+D GY +DL VE+A +LARR+IY AT+RD
Sbjct  170  GPGLYYVDSEGNRISGATFSVGSGSVYAYGVMDRGYSYDLEVEQAYDLARRAIYQATYRD  229

Query  741  GASGGVASVYHVGPNGWKKLSGDDVGELHYHY  836
              SGG  ++YHV  +GW ++S D+V +LH  Y
Sbjct  230  AYSGGAVNLYHVREDGWIRVSSDNVADLHEKY  261



>ref|XP_004584741.1| PREDICTED: proteasome subunit beta type-5 [Ochotona princeps]
Length=263

 Score =   288 bits (738),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 138/212 (65%), Positives = 171/212 (81%), Gaps = 3/212 (1%)
 Frame = +3

Query  201  QKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAG  380
            ++  I+MV    GTTTLAF F+ GV+VAADSRA+ G YI+SQ+VKK+IEINPY+LGTMAG
Sbjct  50   EEPGIEMVH---GTTTLAFKFRHGVIVAADSRATAGAYIASQTVKKVIEINPYLLGTMAG  106

Query  381  GAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEK  560
            GAADC FW R L  +CR++EL NK RISVA ASKLLAN++Y Y+GMGLS+GTMI GWD++
Sbjct  107  GAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYKGMGLSMGTMICGWDKR  166

Query  561  GPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEEAAELARRSIYHATFRD  740
            GPGLYYVDSEG R+ G  FSVGSGS YAYGV+D GY ++L VEEA +LARR+IY AT+RD
Sbjct  167  GPGLYYVDSEGNRISGATFSVGSGSVYAYGVMDRGYSYNLEVEEAYDLARRAIYQATYRD  226

Query  741  GASGGVASVYHVGPNGWKKLSGDDVGELHYHY  836
              SGG  ++YHV  +GW ++S D+V +LH  Y
Sbjct  227  AYSGGAVNLYHVREDGWIRVSSDNVADLHDKY  258



>ref|XP_003474544.1| PREDICTED: proteasome subunit beta type-5 [Cavia porcellus]
Length=263

 Score =   288 bits (738),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 136/200 (68%), Positives = 165/200 (83%), Gaps = 0/200 (0%)
 Frame = +3

Query  237  GTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNL  416
            GTTTLAF F+ GV+VAADSRA+ G YI+SQ+VKK+IEINPY+LGTMAGGAADC FW R L
Sbjct  59   GTTTLAFKFRHGVIVAADSRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLL  118

Query  417  GVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPGLYYVDSEGG  596
              +CR++EL NK RISVA ASKLLAN++Y Y+GMGLS+GTMI GWD++GPGLYYVDSEG 
Sbjct  119  ARQCRIYELRNKERISVAAASKLLANMVYQYKGMGLSMGTMICGWDKRGPGLYYVDSEGN  178

Query  597  RLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEEAAELARRSIYHATFRDGASGGVASVYHV  776
            R+ G  FSVGSGS YAYGV+D GY +DL VEEA +LARR+IY AT+RD  SGG  ++YHV
Sbjct  179  RISGAAFSVGSGSVYAYGVMDRGYSYDLQVEEAYDLARRAIYQATYRDAYSGGSVNLYHV  238

Query  777  GPNGWKKLSGDDVGELHYHY  836
              +GW ++S D+V +LH  Y
Sbjct  239  REDGWIRVSSDNVADLHDKY  258



>ref|XP_006217298.1| PREDICTED: proteasome subunit beta type-5 [Vicugna pacos]
 ref|XP_010953019.1| PREDICTED: proteasome subunit beta type-5 [Camelus bactrianus]
 ref|XP_010987732.1| PREDICTED: proteasome subunit beta type-5 [Camelus dromedarius]
Length=263

 Score =   288 bits (738),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 141/226 (62%), Positives = 175/226 (77%), Gaps = 11/226 (5%)
 Frame = +3

Query  159  PSFQIPNITDFDGFQKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKK  338
            PS+ +P        ++  I+M+    GTTTLAF F  GV+VAADSRA+ G YI+SQ+VKK
Sbjct  44   PSWGVP--------EEPRIEMLH---GTTTLAFKFLHGVIVAADSRATAGAYIASQTVKK  92

Query  339  IIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGM  518
            +IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA ASKLLAN++Y Y+GM
Sbjct  93   VIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYKGM  152

Query  519  GLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEEAA  698
            GLS+GTMI GWD++GPGLYYVDSEG R+ G  FSVGSGS YAYGV+D GY +DL VEEA 
Sbjct  153  GLSMGTMICGWDKRGPGLYYVDSEGNRISGAAFSVGSGSVYAYGVMDRGYSYDLEVEEAY  212

Query  699  ELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  836
            +LARR+IY AT+RD  SGG  ++YHV  +GW ++S D+V +LH  Y
Sbjct  213  DLARRAIYQATYRDAYSGGAVNLYHVREDGWIRVSSDNVADLHDKY  258



>ref|XP_004054982.1| PREDICTED: proteasome subunit beta type-5 isoform 3 [Gorilla 
gorilla gorilla]
Length=268

 Score =   288 bits (738),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 137/212 (65%), Positives = 171/212 (81%), Gaps = 3/212 (1%)
 Frame = +3

Query  201  QKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAG  380
            ++  I+M+    GTTTLAF F+ GV+VAADSRA+ G YI+SQ+VKK+IEINPY+LGTMAG
Sbjct  55   EEPGIEMLH---GTTTLAFKFRHGVIVAADSRATAGAYIASQTVKKVIEINPYLLGTMAG  111

Query  381  GAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEK  560
            GAADC FW R L  +CR++EL NK RISVA ASKLLAN++Y Y+GMGLS+GTMI GWD++
Sbjct  112  GAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYKGMGLSMGTMICGWDKR  171

Query  561  GPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEEAAELARRSIYHATFRD  740
            GPGLYYVDSEG R+ G  FSVGSGS YAYGV+D GY +DL VE+A +LARR+IY AT+RD
Sbjct  172  GPGLYYVDSEGNRISGATFSVGSGSVYAYGVMDRGYSYDLEVEQAYDLARRAIYQATYRD  231

Query  741  GASGGVASVYHVGPNGWKKLSGDDVGELHYHY  836
              SGG  ++YHV  +GW ++S D+V +LH  Y
Sbjct  232  AYSGGAVNLYHVREDGWIRVSSDNVADLHEKY  263



>sp|P28075.3|PSB5_RAT RecName: Full=Proteasome subunit beta type-5; AltName: Full=Macropain 
epsilon chain; AltName: Full=Multicatalytic endopeptidase 
complex epsilon chain; AltName: Full=Proteasome chain 
6; AltName: Full=Proteasome epsilon chain; AltName: Full=Proteasome 
subunit X; Flags: Precursor [Rattus norvegicus]
Length=263

 Score =   288 bits (737),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 140/226 (62%), Positives = 176/226 (78%), Gaps = 11/226 (5%)
 Frame = +3

Query  159  PSFQIPNITDFDGFQKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKK  338
            PS+ +P        ++  I+M+    GTTTLAF F+ GV+VAADSRA+ G YI+SQ+VKK
Sbjct  44   PSWGVP--------EEPRIEMLH---GTTTLAFKFQHGVIVAADSRATAGPYIASQTVKK  92

Query  339  IIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGM  518
            +IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA ASKLLAN++Y Y+GM
Sbjct  93   VIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYKGM  152

Query  519  GLSVGTMIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEEAA  698
            GLS+GTMI GWD++GPGLYYVDSEG R+ G  FSVGSGS YA+GV+D GY +DL VEEA 
Sbjct  153  GLSMGTMICGWDKRGPGLYYVDSEGNRISGTAFSVGSGSVYAFGVMDRGYSYDLQVEEAY  212

Query  699  ELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  836
            +LARR+IY AT+RD  SGG  ++YHV  +GW ++S D+V +LH  Y
Sbjct  213  DLARRAIYQATYRDAYSGGAVNLYHVREDGWIRVSSDNVADLHDKY  258



>ref|XP_007989004.1| PREDICTED: proteasome subunit beta type-5 isoform X1 [Chlorocebus 
sabaeus]
Length=263

 Score =   288 bits (737),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 137/212 (65%), Positives = 171/212 (81%), Gaps = 3/212 (1%)
 Frame = +3

Query  201  QKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAG  380
            ++  I+M+    GTTTLAF F+ GV+VAADSRA+ G YI+SQ+VKK+IEINPY+LGTMAG
Sbjct  50   EEPGIEMLH---GTTTLAFKFRHGVIVAADSRATAGAYIASQTVKKVIEINPYLLGTMAG  106

Query  381  GAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEK  560
            GAADC FW R L  +CR++EL NK RISVA ASKLLAN++Y Y+GMGLS+GTMI GWD++
Sbjct  107  GAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYKGMGLSMGTMICGWDKR  166

Query  561  GPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEEAAELARRSIYHATFRD  740
            GPGLYYVDSEG R+ G  FSVGSGS YAYGV+D GY +DL VE+A +LARR+IY AT+RD
Sbjct  167  GPGLYYVDSEGNRISGATFSVGSGSVYAYGVMDRGYSYDLEVEQAYDLARRAIYQATYRD  226

Query  741  GASGGVASVYHVGPNGWKKLSGDDVGELHYHY  836
              SGG  ++YHV  +GW ++S D+V +LH  Y
Sbjct  227  AYSGGAVNLYHVREDGWIRVSSDNVADLHEKY  258



>ref|XP_003260670.1| PREDICTED: proteasome subunit beta type-5 isoform 1 [Nomascus 
leucogenys]
 ref|XP_004091952.1| PREDICTED: proteasome subunit beta type-5 [Nomascus leucogenys]
Length=263

 Score =   288 bits (737),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 137/212 (65%), Positives = 171/212 (81%), Gaps = 3/212 (1%)
 Frame = +3

Query  201  QKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAG  380
            ++  I+M+    GTTTLAF F+ GV+VAADSRA+ G YI+SQ+VKK+IEINPY+LGTMAG
Sbjct  50   EEPGIEMLH---GTTTLAFKFRHGVIVAADSRATAGAYIASQTVKKVIEINPYLLGTMAG  106

Query  381  GAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEK  560
            GAADC FW R L  +CR++EL NK RISVA ASKLLAN++Y Y+GMGLS+GTMI GWD++
Sbjct  107  GAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYKGMGLSMGTMICGWDKR  166

Query  561  GPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEEAAELARRSIYHATFRD  740
            GPGLYYVDSEG R+ G  FSVGSGS YAYGV+D GY +DL VE+A +LARR+IY AT+RD
Sbjct  167  GPGLYYVDSEGNRISGATFSVGSGSVYAYGVMDRGYSYDLEVEQAYDLARRAIYQATYRD  226

Query  741  GASGGVASVYHVGPNGWKKLSGDDVGELHYHY  836
              SGG  ++YHV  +GW ++S D+V +LH  Y
Sbjct  227  AYSGGAVNLYHVREDGWIRVSSDNVADLHEKY  258



>ref|XP_004054980.1| PREDICTED: proteasome subunit beta type-5 isoform 1 [Gorilla 
gorilla gorilla]
 ref|XP_004054981.1| PREDICTED: proteasome subunit beta type-5 isoform 2 [Gorilla 
gorilla gorilla]
 ref|XP_004054983.1| PREDICTED: proteasome subunit beta type-5 isoform 4 [Gorilla 
gorilla gorilla]
 ref|XP_004054984.1| PREDICTED: proteasome subunit beta type-5 isoform 5 [Gorilla 
gorilla gorilla]
Length=263

 Score =   288 bits (737),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 137/212 (65%), Positives = 171/212 (81%), Gaps = 3/212 (1%)
 Frame = +3

Query  201  QKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAG  380
            ++  I+M+    GTTTLAF F+ GV+VAADSRA+ G YI+SQ+VKK+IEINPY+LGTMAG
Sbjct  50   EEPGIEMLH---GTTTLAFKFRHGVIVAADSRATAGAYIASQTVKKVIEINPYLLGTMAG  106

Query  381  GAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEK  560
            GAADC FW R L  +CR++EL NK RISVA ASKLLAN++Y Y+GMGLS+GTMI GWD++
Sbjct  107  GAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYKGMGLSMGTMICGWDKR  166

Query  561  GPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEEAAELARRSIYHATFRD  740
            GPGLYYVDSEG R+ G  FSVGSGS YAYGV+D GY +DL VE+A +LARR+IY AT+RD
Sbjct  167  GPGLYYVDSEGNRISGATFSVGSGSVYAYGVMDRGYSYDLEVEQAYDLARRAIYQATYRD  226

Query  741  GASGGVASVYHVGPNGWKKLSGDDVGELHYHY  836
              SGG  ++YHV  +GW ++S D+V +LH  Y
Sbjct  227  AYSGGAVNLYHVREDGWIRVSSDNVADLHEKY  258



>ref|NP_001247774.1| proteasome subunit beta type-5 [Macaca mulatta]
 ref|XP_003901626.1| PREDICTED: proteasome subunit beta type-5 isoform X1 [Papio anubis]
 ref|XP_011846037.1| PREDICTED: proteasome subunit beta type-5 isoform X1 [Mandrillus 
leucophaeus]
 ref|XP_011943900.1| PREDICTED: proteasome subunit beta type-5 isoform X1 [Cercocebus 
atys]
 ref|XP_011770630.1| PREDICTED: proteasome subunit beta type-5 [Macaca nemestrina]
 gb|EHH27742.1| hypothetical protein EGK_18013 [Macaca mulatta]
 gb|EHH63472.1| hypothetical protein EGM_16445 [Macaca fascicularis]
Length=263

 Score =   288 bits (737),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 137/212 (65%), Positives = 171/212 (81%), Gaps = 3/212 (1%)
 Frame = +3

Query  201  QKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAG  380
            ++  I+M+    GTTTLAF F+ GV+VAADSRA+ G YI+SQ+VKK+IEINPY+LGTMAG
Sbjct  50   EEPGIEMLH---GTTTLAFKFRHGVIVAADSRATAGAYIASQTVKKVIEINPYLLGTMAG  106

Query  381  GAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEK  560
            GAADC FW R L  +CR++EL NK RISVA ASKLLAN++Y Y+GMGLS+GTMI GWD++
Sbjct  107  GAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYKGMGLSMGTMICGWDKR  166

Query  561  GPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEEAAELARRSIYHATFRD  740
            GPGLYYVDSEG R+ G  FSVGSGS YAYGV+D GY +DL VE+A +LARR+IY AT+RD
Sbjct  167  GPGLYYVDSEGNRISGATFSVGSGSVYAYGVMDRGYSYDLEVEQAYDLARRAIYQATYRD  226

Query  741  GASGGVASVYHVGPNGWKKLSGDDVGELHYHY  836
              SGG  ++YHV  +GW ++S D+V +LH  Y
Sbjct  227  AYSGGAVNLYHVREDGWIRVSSDNVADLHEKY  258



>gb|ADO27969.1| proteasome subunit beta type-5 [Ictalurus furcatus]
Length=266

 Score =   288 bits (737),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 135/225 (60%), Positives = 175/225 (78%), Gaps = 0/225 (0%)
 Frame = +3

Query  177  NITDFDGFQKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINP  356
             +  F+G +    + ++   GTTTLAF F+ GV+VA DSRA+ G YI+SQ+VKK+IEINP
Sbjct  42   TLKHFEGEEGGIERKIEFLHGTTTLAFKFQHGVIVAVDSRATAGSYIASQTVKKVIEINP  101

Query  357  YMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGT  536
            Y+LGTMAGGAADC FW R L  +CR++EL NK RISVA ASKLLAN++Y Y+GMGLS+GT
Sbjct  102  YLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYKGMGLSMGT  161

Query  537  MIAGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEEAAELARRS  716
            M+ GWD++GPGLYYVDSEG R+ G+ F+VGSGS YAYGVLD+G+R DL++EEA +L RR+
Sbjct  162  MVCGWDKRGPGLYYVDSEGNRVCGDMFAVGSGSMYAYGVLDSGHRTDLTIEEACDLGRRA  221

Query  717  IYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHYYPVEA  851
            IY ATFRD  SGG  ++Y V   GW+++S DDV  LH+ +   +A
Sbjct  222  IYQATFRDAYSGGQVNLYRVHSEGWERVSQDDVLALHHQFQSQKA  266



>ref|NP_002788.1| proteasome subunit beta type-5 isoform 1 [Homo sapiens]
 ref|NP_001126063.1| proteasome subunit beta type-5 precursor [Pongo abelii]
 ref|XP_003808166.1| PREDICTED: proteasome subunit beta type-5 [Pan paniscus]
 sp|P28074.3|PSB5_HUMAN RecName: Full=Proteasome subunit beta type-5; AltName: Full=Macropain 
epsilon chain; AltName: Full=Multicatalytic endopeptidase 
complex epsilon chain; AltName: Full=Proteasome chain 
6; AltName: Full=Proteasome epsilon chain; AltName: Full=Proteasome 
subunit MB1; AltName: Full=Proteasome subunit X; Flags: 
Precursor [Homo sapiens]
 sp|Q5R8S2.3|PSB5_PONAB RecName: Full=Proteasome subunit beta type-5; Flags: Precursor 
[Pongo abelii]
 emb|CAA64838.1| proteasome [Homo sapiens]
 gb|AAH57840.1| Proteasome (prosome, macropain) subunit, beta type, 5 [Homo sapiens]
 emb|CAH91838.1| hypothetical protein [Pongo abelii]
 gb|AAI07721.1| Proteasome (prosome, macropain) subunit, beta type, 5 [Homo sapiens]
 gb|EAW66193.1| proteasome (prosome, macropain) subunit, beta type, 5, isoform 
CRA_a [Homo sapiens]
 gb|EAW66195.1| proteasome (prosome, macropain) subunit, beta type, 5, isoform 
CRA_a [Homo sapiens]
 dbj|BAG34836.1| unnamed protein product [Homo sapiens]
 dbj|BAI47149.1| proteasome (prosome, macropain) subunit, beta type, 5 [synthetic 
construct]
 gb|ADQ33015.1| proteasome (prosome, macropain) subunit, beta type, 5 [synthetic 
construct]
Length=263

 Score =   288 bits (737),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 137/212 (65%), Positives = 171/212 (81%), Gaps = 3/212 (1%)
 Frame = +3

Query  201  QKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAG  380
            ++  I+M+    GTTTLAF F+ GV+VAADSRA+ G YI+SQ+VKK+IEINPY+LGTMAG
Sbjct  50   EEPGIEMLH---GTTTLAFKFRHGVIVAADSRATAGAYIASQTVKKVIEINPYLLGTMAG  106

Query  381  GAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEK  560
            GAADC FW R L  +CR++EL NK RISVA ASKLLAN++Y Y+GMGLS+GTMI GWD++
Sbjct  107  GAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYKGMGLSMGTMICGWDKR  166

Query  561  GPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDNGYRFDLSVEEAAELARRSIYHATFRD  740
            GPGLYYVDSEG R+ G  FSVGSGS YAYGV+D GY +DL VE+A +LARR+IY AT+RD
Sbjct  167  GPGLYYVDSEGNRISGATFSVGSGSVYAYGVMDRGYSYDLEVEQAYDLARRAIYQATYRD  226

Query  741  GASGGVASVYHVGPNGWKKLSGDDVGELHYHY  836
              SGG  ++YHV  +GW ++S D+V +LH  Y
Sbjct  227  AYSGGAVNLYHVREDGWIRVSSDNVADLHEKY  258



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3004911485040