BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig65

Length=549
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

dbj|BAE94394.1|  bHLH transcriptional factor                            274   1e-84   Ipomoea nil [qian niu]
gb|ABY26929.1|  putative anthocyanin transcriptional regulator          264   7e-81   Ipomoea hederacea [ivy-leaf morning-glory]
dbj|BAD18983.1|  bHLH transcription activator Ivory seed                262   5e-80   Ipomoea tricolor [campanilla]
gb|ABW69686.1|  anthocyanin synthesis regulatory protein                261   1e-79   Ipomoea purpurea
gb|ABW69687.1|  anthocyanin synthesis regulatory protein                261   1e-79   Ipomoea purpurea
gb|ABW69688.1|  anthocyanin synthesis regulatory protein                261   1e-79   Ipomoea purpurea
dbj|BAF46859.1|  bHLH transcription activator Ivory seed                259   6e-79   Ipomoea purpurea
gb|ABY26932.1|  putative anthocyanin transcriptional regulator          259   7e-79   Ipomoea coccinea [red morning-glory]
dbj|BAD18982.1|  bHLH transcription activator Ivory seed                259   8e-79   Ipomoea purpurea
gb|ABY26931.1|  putative anthocyanin transcriptional regulator          258   1e-78   Ipomoea quamoclit [bejuco de cipres]
gb|ABY26930.1|  putative anthocyanin transcriptional regulator          256   7e-78   Ipomoea alba [moonflower]
gb|ABY26935.1|  putative anthocyanin transcriptional regulator          243   1e-72   Ipomoea violacea [beach moonflower]
gb|ABY26937.1|  putative anthocyanin transcriptional regulator          243   1e-72   Ipomoea hochstetteri
gb|ABY26936.1|  putative anthocyanin transcriptional regulator          239   2e-71   Ipomoea horsfalliae [Kuhio-vine]
gb|AHH29256.1|  transcriptional regulator bHLH2                         239   2e-71   Ipomoea batatas [batate]
gb|AFV33952.1|  bHLH2 transcription factor                              239   2e-71   Ipomoea batatas [batate]
gb|AEA34965.1|  putative transcription factor BHLH2                     236   5e-70   Ipomoea batatas [batate]
gb|ABY26934.1|  putative anthocyanin transcriptional regulator          232   1e-68   Ipomoea lacunosa [white morning-glory]
gb|ABY26938.1|  putative anthocyanin transcriptional regulator          223   3e-65   Operculina pteripes
gb|ABY26933.1|  putative anthocyanin transcriptional regulator          213   2e-61   Ipomoea trifida
ref|XP_008368857.1|  PREDICTED: truncated basic helix-loop-helix ...    186   8e-57   
ref|XP_007200710.1|  hypothetical protein PRUPE_ppa002884m1g            187   2e-56   
gb|AFL02464.1|  transcription factor bHLH3-delta                        192   5e-56   Fragaria x ananassa
ref|NP_001289495.1|  basic helix-loop-helix protein A                   197   1e-55   Nicotiana sylvestris
ref|XP_009803796.1|  PREDICTED: basic helix-loop-helix protein A ...    197   1e-55   Nicotiana sylvestris
gb|AAG25927.1|AF260918_1  anthocyanin 1                                 196   3e-55   Petunia x hybrida [garden petunia]
gb|AEE99257.1|  anthocyanin 1a                                          196   4e-55   Nicotiana tabacum [American tobacco]
gb|KHN03790.1|  Transcription factor TT8                                182   4e-55   Glycine soja [wild soybean]
ref|XP_006479738.1|  PREDICTED: transcription factor TT8-like iso...    195   6e-55   Citrus sinensis [apfelsine]
ref|XP_006479737.1|  PREDICTED: transcription factor TT8-like iso...    195   6e-55   Citrus sinensis [apfelsine]
ref|XP_006444091.1|  hypothetical protein CICLE_v10019118mg             195   6e-55   
ref|XP_006444093.1|  hypothetical protein CICLE_v10019118mg             195   6e-55   Citrus clementina [clementine]
gb|KDO68766.1|  hypothetical protein CISIN_1g037798mg                   195   7e-55   Citrus sinensis [apfelsine]
ref|XP_006444092.1|  hypothetical protein CICLE_v10019118mg             195   7e-55   
ref|XP_009602367.1|  PREDICTED: basic helix-loop-helix protein A ...    194   8e-55   
ref|XP_009602346.1|  PREDICTED: basic helix-loop-helix protein A ...    195   9e-55   Nicotiana tomentosiformis
ref|XP_009602360.1|  PREDICTED: basic helix-loop-helix protein A ...    194   1e-54   Nicotiana tomentosiformis
gb|AEE99258.1|  anthocyanin 1b                                          194   1e-54   Nicotiana tabacum [American tobacco]
ref|NP_001289454.1|  basic helix-loop-helix protein A                   194   1e-54   Nicotiana tomentosiformis
gb|KHG29717.1|  Transcription factor TT8 -like protein                  193   2e-54   Gossypium arboreum [tree cotton]
ref|XP_012092262.1|  PREDICTED: basic helix-loop-helix protein A        194   2e-54   Jatropha curcas
ref|XP_007050639.1|  BHLH-like DNA binding protein                      194   2e-54   
dbj|BAM36702.1|  bHLH transcriptional factor AN1 homolog                193   3e-54   Rosa hybrid cultivar
gb|KJB25921.1|  hypothetical protein B456_004G215900                    193   3e-54   Gossypium raimondii
ref|XP_002520758.1|  conserved hypothetical protein                     193   3e-54   
gb|KJB25919.1|  hypothetical protein B456_004G215900                    193   3e-54   Gossypium raimondii
gb|KJB25920.1|  hypothetical protein B456_004G215900                    193   4e-54   Gossypium raimondii
emb|CBI32369.3|  unnamed protein product                                192   6e-54   Vitis vinifera
ref|XP_004290663.1|  PREDICTED: basic helix-loop-helix protein A ...    192   7e-54   Fragaria vesca subsp. vesca
emb|CAN62848.1|  hypothetical protein VITISV_010152                     192   9e-54   Vitis vinifera
gb|AJN91105.1|  anthocyanin-related transcription factor TT8            191   1e-53   Solanum melongena [aubergine]
ref|NP_001268182.1|  uncharacterized protein LOC100251098               192   1e-53   Vitis vinifera
gb|KHG10778.1|  Transcription factor TT8 -like protein                  185   2e-53   Gossypium arboreum [tree cotton]
gb|AGO58372.1|  basic helix-loop-helix protein                          191   2e-53   Morella rubra [Chinese arbutus]
ref|XP_007144626.1|  hypothetical protein PHAVU_007G171300g             184   3e-53   Phaseolus vulgaris [French bean]
gb|AIU98516.1|  bHLH transcription factor                               191   3e-53   Paeonia suffruticosa [moutan peony]
ref|XP_010090392.1|  hypothetical protein L484_025057                   191   3e-53   
ref|XP_011625677.1|  PREDICTED: basic helix-loop-helix protein A        190   4e-53   Amborella trichopoda
gb|ERN12312.1|  hypothetical protein AMTR_s00025p00048410               190   4e-53   Amborella trichopoda
ref|XP_008235271.1|  PREDICTED: basic helix-loop-helix protein A        190   5e-53   Prunus mume [ume]
gb|AIE57508.1|  bHLH3                                                   190   5e-53   Prunus persica
ref|XP_006575075.1|  PREDICTED: transcription factor TT8-like iso...    183   7e-53   
gb|AGL81357.1|  BHLH domain class transcription factor                  189   1e-52   Pyrus communis
ref|XP_009356769.1|  PREDICTED: LOW QUALITY PROTEIN: basic helix-...    189   2e-52   
gb|AGC31677.1|  basic helix loop helix                                  188   2e-52   Solanum tuberosum [potatoes]
sp|E3SXU5.1|BHLHM_PEA  RecName: Full=Truncated basic helix-loop-h...    182   2e-52   Pisum sativum [garden pea]
ref|XP_010326368.1|  PREDICTED: basic helix-loop-helix protein A        187   3e-52   
gb|ADL36597.1|  BHLH domain class transcription factor                  187   3e-52   Malus domestica [apple tree]
ref|XP_006588626.1|  PREDICTED: transcription factor TT8-like           187   4e-52   Glycine max [soybeans]
ref|NP_001280978.1|  basic helix-loop-helix protein A                   187   4e-52   Malus domestica [apple tree]
gb|AHM88207.1|  bHLH3 protein                                           187   4e-52   Malus hybrid cultivar
ref|XP_010255921.1|  PREDICTED: basic helix-loop-helix protein A-...    187   7e-52   Nelumbo nucifera [Indian lotus]
ref|XP_006383662.1|  hypothetical protein POPTR_0005s23010g             181   1e-51   
gb|KJB42088.1|  hypothetical protein B456_007G136400                    186   1e-51   Gossypium raimondii
gb|AIF70439.1|  basic helix-loop-helix transcription factor             184   2e-51   Populus tremula x Populus tremuloides
ref|XP_010070223.1|  PREDICTED: basic helix-loop-helix protein A        186   2e-51   Eucalyptus grandis [rose gum]
ref|XP_006575074.1|  PREDICTED: transcription factor TT8-like iso...    185   2e-51   Glycine max [soybeans]
gb|AJB28482.1|  bHLH3                                                   186   2e-51   Prunus avium [gean]
gb|AJB28481.1|  bHLH3                                                   186   2e-51   Prunus avium [gean]
gb|AIT76559.1|  bHLH protein                                            185   2e-51   Trifolium repens [creeping white clover]
ref|XP_011032729.1|  PREDICTED: basic helix-loop-helix protein A ...    185   2e-51   Populus euphratica
gb|KCW58860.1|  hypothetical protein EUGRSUZ_H01487                     185   3e-51   Eucalyptus grandis [rose gum]
ref|XP_011032731.1|  PREDICTED: basic helix-loop-helix protein A ...    185   3e-51   Populus euphratica
ref|XP_008790988.1|  PREDICTED: basic helix-loop-helix protein A ...    185   3e-51   Phoenix dactylifera
ref|XP_010906881.1|  PREDICTED: basic helix-loop-helix protein A ...    185   3e-51   Elaeis guineensis
ref|XP_008790987.1|  PREDICTED: basic helix-loop-helix protein A ...    185   3e-51   Phoenix dactylifera
ref|XP_010906882.1|  PREDICTED: basic helix-loop-helix protein A ...    185   3e-51   Elaeis guineensis
ref|XP_010906884.1|  PREDICTED: basic helix-loop-helix protein A ...    185   3e-51   Elaeis guineensis
ref|XP_004495293.1|  PREDICTED: transcription factor TT8-like           184   3e-51   
gb|AIF70440.1|  basic helix-loop-helix transcription factor             185   4e-51   Malus domestica [apple tree]
ref|XP_010906883.1|  PREDICTED: basic helix-loop-helix protein A ...    185   4e-51   
emb|CEL26634.1|  bHLH3                                                  184   4e-51   Ribes rubrum [northern red currant]
gb|AIS24255.1|  basic helix-loop-helix regulatory protein               184   5e-51   Punica granatum [granado]
sp|E3SXU4.1|BHLHW_PEA  RecName: Full=Basic helix-loop-helix prote...    183   9e-51   Pisum sativum [garden pea]
dbj|BAH28881.1|  bHLH transcription factor LjTT8                        183   9e-51   Lotus japonicus
gb|EYU46593.1|  hypothetical protein MIMGU_mgv1a002681mg                182   2e-50   Erythranthe guttata [common monkey flower]
ref|NP_001275098.1|  transcription factor TT8-like                      183   2e-50   Solanum tuberosum [potatoes]
dbj|BAC56998.1|  F3G1                                                   180   4e-50   Perilla frutescens [beefsteak-mint]
ref|XP_010684257.1|  PREDICTED: basic helix-loop-helix protein A        181   4e-50   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_003590656.1|  Transcription factor TT8                           181   5e-50   
ref|XP_010278097.1|  PREDICTED: basic helix-loop-helix protein A-...    180   1e-49   Nelumbo nucifera [Indian lotus]
ref|XP_010278105.1|  PREDICTED: basic helix-loop-helix protein A-...    180   1e-49   Nelumbo nucifera [Indian lotus]
ref|XP_009405589.1|  PREDICTED: basic helix-loop-helix protein A-...    179   1e-49   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009405588.1|  PREDICTED: truncated basic helix-loop-helix ...    179   2e-49   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009405587.1|  PREDICTED: basic helix-loop-helix protein A-...    179   3e-49   Musa acuminata subsp. malaccensis [pisang utan]
emb|CBY88797.1|  basic helix-loop-helix transcription factor            179   3e-49   Humulus lupulus [common hop]
gb|AFL02463.1|  transcription factor bHLH3                              179   4e-49   Fragaria x ananassa
ref|XP_011079838.1|  PREDICTED: truncated basic helix-loop-helix ...    179   4e-49   Sesamum indicum [beniseed]
ref|XP_002302118.1|  hypothetical protein POPTR_0002s05510g             179   4e-49   
emb|CDP03619.1|  unnamed protein product                                179   5e-49   Coffea canephora [robusta coffee]
ref|XP_009392688.1|  PREDICTED: basic helix-loop-helix protein A-...    178   7e-49   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011026186.1|  PREDICTED: basic helix-loop-helix protein A-...    178   1e-48   Populus euphratica
gb|AGP03675.1|  basic helix-loop-helix (bHLH) DNA-binding superfa...    175   3e-48   Glycine max [soybeans]
gb|AGP03687.1|  basic helix-loop-helix (bHLH) DNA-binding superfa...    175   3e-48   Glycine soja [wild soybean]
gb|AGP03686.1|  basic helix-loop-helix (bHLH) DNA-binding superfa...    175   3e-48   Glycine soja [wild soybean]
gb|AGP03673.1|  basic helix-loop-helix (bHLH) DNA-binding superfa...    175   3e-48   Glycine max [soybeans]
gb|AGP03684.1|  basic helix-loop-helix (bHLH) DNA-binding superfa...    175   3e-48   Glycine soja [wild soybean]
gb|AGP03676.1|  basic helix-loop-helix (bHLH) DNA-binding superfa...    175   3e-48   Glycine max [soybeans]
ref|XP_003520564.1|  PREDICTED: transcription factor TT8-like           176   3e-48   Glycine max [soybeans]
gb|KHN19887.1|  Transcription factor TT8                                175   4e-48   Glycine soja [wild soybean]
ref|XP_007162415.1|  hypothetical protein PHAVU_001G1503001g            169   5e-48   Phaseolus vulgaris [French bean]
gb|AII25878.1|  anthocyanin-activating bHLH3                            175   9e-48   Erythranthe lewisii
dbj|BAE20058.1|  bHLH transcription factor                              175   1e-47   Lilium hybrid division I
gb|AEC03343.1|  bHLH transcription factor MYC1                          175   1e-47   Diospyros kaki [Japanese persimmon]
dbj|BAH03388.1|  bHLH transcriptional factor                            172   7e-47   Gentiana triflora
gb|AEH76882.1|  bHLH transcription factor                               160   1e-46   Punica granatum [granado]
dbj|BAM84240.1|  bHLH transcription factor                              170   5e-46   Dahlia pinnata
gb|ABV71912.1|  AN1                                                     158   5e-46   Plectranthus scutellarioides
ref|XP_010255924.1|  PREDICTED: basic helix-loop-helix protein A-...    170   6e-46   
dbj|BAM84239.1|  bHLH transcription factor                              169   8e-46   Dahlia pinnata
ref|XP_003553458.1|  PREDICTED: transcription factor TT8-like           168   2e-45   Glycine max [soybeans]
gb|KHN45359.1|  Transcription factor TT8                                168   2e-45   Glycine soja [wild soybean]
dbj|BAM84241.1|  bHLH transcription factor                              168   2e-45   Dahlia pinnata
dbj|BAM84238.1|  bHLH transcription factor                              167   7e-45   Dahlia pinnata
dbj|BAJ33515.1|  bHLH transcriptional factor                            166   9e-45   Dahlia pinnata
pir||T04030  hypothetical protein F17A8.170 - Arabidopsis thaliana      161   4e-44
emb|CAC14865.1|  transparent testa 8                                    161   3e-43   Arabidopsis thaliana [mouse-ear cress]
ref|NP_192720.2|  transcription factor TT8                              161   3e-43   Arabidopsis thaliana [mouse-ear cress]
gb|ABK28624.1|  unknown                                                 161   4e-43   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006397140.1|  hypothetical protein EUTSA_v10028584mg             160   7e-43   
ref|XP_002872462.1|  hypothetical protein ARALYDRAFT_489834             159   2e-42   Arabidopsis lyrata subsp. lyrata
ref|XP_010455373.1|  PREDICTED: transcription factor TT8-like           156   3e-41   Camelina sativa [gold-of-pleasure]
ref|XP_006289065.1|  hypothetical protein CARUB_v10002462mg             155   4e-41   
ref|XP_010437974.1|  PREDICTED: LOW QUALITY PROTEIN: transcriptio...    154   1e-40   Camelina sativa [gold-of-pleasure]
ref|XP_010421888.1|  PREDICTED: transcription factor TT8                152   4e-40   Camelina sativa [gold-of-pleasure]
gb|KFK32044.1|  hypothetical protein AALP_AA6G192900                    152   7e-40   Arabis alpina [alpine rockcress]
gb|ABR17818.1|  unknown                                                 150   9e-39   Picea sitchensis
tpg|DAA60017.1|  TPA: intensifier1                                      146   2e-38   
ref|XP_008652187.1|  PREDICTED: LOW QUALITY PROTEIN: basic helix-...    147   1e-37   
ref|XP_010230009.1|  PREDICTED: basic helix-loop-helix protein A-...    146   2e-37   
ref|XP_010545177.1|  PREDICTED: truncated basic helix-loop-helix ...    143   1e-36   Tarenaya hassleriana [spider flower]
gb|AEO53065.1|  transcription factor TT8                                140   2e-36   Raphanus sativus var. niger [daikon]
ref|XP_011022678.1|  PREDICTED: transcription factor GLABRA 3 iso...    140   2e-35   Populus euphratica
ref|XP_011022679.1|  PREDICTED: transcription factor GLABRA 3 iso...    140   3e-35   Populus euphratica
gb|AAS86304.1|  myc-like anthocyanin regulatory protein                 139   6e-35   Cornus unalaschkensis
gb|AAS86282.1|  myc-like anthocyanin regulatory protein                 139   7e-35   Cornus cf. canadensis Xiang and Fan 9-1
gb|AAS86267.1|  myc-like anthocyanin regulatory protein                 139   7e-35   Cornus canadensis [bunchberry]
gb|AAR21665.1|  myc-like anthocyanin regulatory protein                 139   8e-35   Cornus canadensis [bunchberry]
gb|AAS86272.1|  myc-like anthocyanin regulatory protein                 139   8e-35   Cornus canadensis [bunchberry]
gb|AAS86281.1|  myc-like anthocyanin regulatory protein                 138   8e-35   Cornus unalaschkensis
ref|XP_002303592.1|  regulator of anthocyanin biosynthesis pathwa...    138   1e-34   
emb|CDY45357.1|  BnaA09g12420D                                          131   2e-34   Brassica napus [oilseed rape]
gb|AIN41653.1|  TT8                                                     137   2e-34   Brassica juncea [brown mustard]
gb|ABY59772.1|  bHLH DNA-binding domain transcription factor            137   2e-34   Brassica napus [oilseed rape]
ref|XP_009113574.1|  PREDICTED: transcription factor TT8                137   2e-34   Brassica rapa
ref|XP_002967013.1|  hypothetical protein SELMODRAFT_87033              135   2e-34   
ref|XP_002960995.1|  hypothetical protein SELMODRAFT_73360              135   2e-34   
ref|XP_010255365.1|  PREDICTED: transcription factor GLABRA 3-like      138   2e-34   Nelumbo nucifera [Indian lotus]
ref|XP_010278113.1|  PREDICTED: basic helix-loop-helix protein A-...    137   5e-34   Nelumbo nucifera [Indian lotus]
gb|ACA04013.1|  bHLH transcriptional regulator                          133   6e-34   Diplacus aurantiacus
gb|AAS86303.1|  myc-like anthocyanin regulatory protein                 136   6e-34   Cornus cf. canadensis Xiang and Fan 30-1
gb|AAS86269.1|  myc-like anthocyanin regulatory protein                 136   7e-34   Cornus cf. canadensis Xiang and Fan 14-1
gb|AAS86279.1|  myc-like anthocyanin regulatory protein                 135   8e-34   Cornus unalaschkensis
gb|AAS86289.1|  myc-like anthocyanin regulatory protein                 135   8e-34   Cornus unalaschkensis
gb|AAS86268.1|  myc-like anthocyanin regulatory protein                 135   8e-34   Cornus canadensis [bunchberry]
gb|AAS86273.1|  myc-like anthocyanin regulatory protein                 135   8e-34   Cornus canadensis [bunchberry]
gb|AAS86299.1|  myc-like anthocyanin regulatory protein                 135   8e-34   Cornus unalaschkensis
gb|AAS86295.1|  myc-like anthocyanin regulatory protein                 135   9e-34   Cornus unalaschkensis
gb|AAS86294.1|  myc-like anthocyanin regulatory protein                 135   9e-34   Cornus unalaschkensis
gb|AAS86274.1|  myc-like anthocyanin regulatory protein                 135   9e-34   Cornus canadensis [bunchberry]
gb|AAS86286.1|  myc-like anthocyanin regulatory protein                 135   9e-34   Cornus cf. canadensis Xiang and Fan 26-1
gb|AAS86270.1|  myc-like anthocyanin regulatory protein                 135   9e-34   Cornus canadensis [bunchberry]
gb|AAS86305.1|  myc-like anthocyanin regulatory protein                 135   9e-34   Cornus cf. canadensis Xiang and Fan 42-1
gb|AAS86300.1|  myc-like anthocyanin regulatory protein                 135   9e-34   Cornus unalaschkensis
gb|AAS86278.1|  myc-like anthocyanin regulatory protein                 135   9e-34   Cornus canadensis [bunchberry]
gb|AAS86297.1|  myc-like anthocyanin regulatory protein                 135   9e-34   Cornus unalaschkensis
gb|AAS86298.1|  myc-like anthocyanin regulatory protein                 135   9e-34   Cornus unalaschkensis
ref|XP_010918535.1|  PREDICTED: transcription factor GLABRA 3           136   1e-33   Elaeis guineensis
gb|AAS86292.1|  myc-like anthocyanin regulatory protein                 135   1e-33   Cornus unalaschkensis
gb|AAS86285.1|  myc-like anthocyanin regulatory protein                 135   1e-33   Cornus unalaschkensis
gb|AAS86290.1|  myc-like anthocyanin regulatory protein                 135   1e-33   Cornus unalaschkensis
gb|AAS86284.1|  myc-like anthocyanin regulatory protein                 135   1e-33   Cornus cf. canadensis Xiang and Fan 20-1
gb|AAS86280.1|  myc-like anthocyanin regulatory protein                 135   1e-33   Cornus unalaschkensis
gb|AAS86287.1|  myc-like anthocyanin regulatory protein                 135   1e-33   Cornus unalaschkensis
gb|AAS86302.1|  myc-like anthocyanin regulatory protein                 135   1e-33   Cornus cf. canadensis Xiang and Fan 29-2
gb|AAS86307.1|  myc-like anthocyanin regulatory protein                 135   1e-33   Cornus suecica [Lapland cornel]
gb|AAS86309.1|  myc-like anthocyanin regulatory protein                 135   1e-33   Cornus suecica [Lapland cornel]
gb|AAS86296.1|  myc-like anthocyanin regulatory protein                 135   2e-33   Cornus unalaschkensis
ref|XP_010241898.1|  PREDICTED: transcription factor GLABRA 3-lik...    135   2e-33   Nelumbo nucifera [Indian lotus]
gb|AAS86283.1|  myc-like anthocyanin regulatory protein                 134   2e-33   Cornus unalaschkensis
ref|XP_008806796.1|  PREDICTED: transcription factor GLABRA 3           135   2e-33   Phoenix dactylifera
gb|AAS86308.1|  myc-like anthocyanin regulatory protein                 134   2e-33   Cornus cf. canadensis Xiang and Fan SC29-1
dbj|BAC83694.1|  putative intensifier                                   134   2e-33   Oryza sativa Japonica Group [Japonica rice]
gb|ADP76654.1|  TT8                                                     134   2e-33   Brassica oleracea var. botrytis [cauliflower]
gb|AAS86293.1|  myc-like anthocyanin regulatory protein                 134   3e-33   Cornus cf. canadensis Xiang and Fan 41-1
gb|ADV03942.1|  bHLH DNA binding domain transcription factor BnaC...    133   3e-33   Brassica napus [oilseed rape]
gb|ADK36609.1|  Rc protein                                              134   3e-33   Oryza rufipogon [common wild rice]
ref|XP_004298802.1|  PREDICTED: transcription factor GLABRA 3           134   3e-33   Fragaria vesca subsp. vesca
gb|EAZ39105.1|  hypothetical protein OsJ_23537                          134   3e-33   Oryza sativa Japonica Group [Japonica rice]
gb|AAR21674.1|  myc-like anthocyanin regulatory protein                 134   3e-33   Cornus alternifolia [green osier]
gb|ADY17836.1|  bHLH transcription factor                               134   3e-33   Oryza sativa [red rice]
gb|ABB17166.1|  brown pericarp and seed coat                            134   4e-33   Oryza sativa Japonica Group [Japonica rice]
gb|ADY17842.1|  bHLH transcription factor                               134   4e-33   Oryza glaberrima
gb|ADV03944.1|  bHLH DNA binding domain transcription factor BolC...    133   4e-33   Brassica oleracea
gb|AAS86306.1|  myc-like anthocyanin regulatory protein                 134   4e-33   Cornus suecica [Lapland cornel]
ref|XP_010910264.1|  PREDICTED: anthocyanin regulatory Lc protein...    134   4e-33   Elaeis guineensis
ref|XP_010910261.1|  PREDICTED: anthocyanin regulatory Lc protein...    134   5e-33   
ref|XP_007040254.1|  Basic helix-loop-helix DNA-binding superfami...    132   5e-33   
ref|XP_002299530.1|  regulator of anthocyanin biosynthesis pathwa...    134   5e-33   
gb|AAR21667.1|  myc-like anthocyanin regulatory protein                 133   6e-33   Cornus suecica [Lapland cornel]
gb|AAR21672.1|  myc-like anthocyanin regulatory protein                 134   6e-33   Cornus oblonga
ref|XP_007040248.1|  Basic helix-loop-helix DNA-binding superfami...    134   6e-33   
gb|AAR21669.1|  myc-like anthocyanin regulatory protein                 133   7e-33   Cornus florida [flowering dogwood]
gb|KDP25431.1|  hypothetical protein JCGZ_20587                         133   7e-33   Jatropha curcas
ref|XP_011029287.1|  PREDICTED: transcription factor GLABRA 3           133   8e-33   Populus euphratica
gb|AAR21670.1|  myc-like anthocyanin regulatory protein                 133   9e-33   Cornus florida [flowering dogwood]
ref|XP_006827621.1|  PREDICTED: transcription factor EGL1 isoform X1    133   9e-33   Amborella trichopoda
ref|XP_012086893.1|  PREDICTED: transcription factor GLABRA 3-lik...    133   1e-32   Jatropha curcas
ref|XP_012086894.1|  PREDICTED: transcription factor GLABRA 3-lik...    133   1e-32   Jatropha curcas
gb|AAR21671.1|  myc-like anthocyanin regulatory protein                 133   1e-32   Cornus capitata
ref|XP_010230011.1|  PREDICTED: basic helix-loop-helix protein A-...    133   1e-32   Brachypodium distachyon [annual false brome]
gb|AIS35934.1|  bHLH transcription factor                               132   1e-32   Phalaenopsis equestris
gb|AAB03841.1|  IN1                                                     133   1e-32   Zea mays [maize]
gb|AAS86277.1|  myc-like anthocyanin regulatory protein                 132   1e-32   Cornus cf. canadensis Xiang and Fan 16-1
gb|AAR21675.1|  myc-like anthocyanin regulatory protein                 132   1e-32   Cornus eydeana
ref|XP_008238828.1|  PREDICTED: transcription factor EGL1               132   2e-32   Prunus mume [ume]
ref|XP_007209040.1|  hypothetical protein PRUPE_ppa002762mg             132   2e-32   
gb|ADK36601.1|  Rc protein                                              132   2e-32   Oryza rufipogon [common wild rice]
gb|AGO58373.1|  basic helix-loop-helix protein                          132   2e-32   Morella rubra [Chinese arbutus]
ref|XP_006391734.1|  hypothetical protein EUTSA_v10023356mg             132   2e-32   Eutrema salsugineum [saltwater cress]
ref|XP_009112753.1|  PREDICTED: transcription factor EGL1               132   2e-32   
gb|AJI76866.1|  GL3-like basic helix-loop-helix transcription factor    132   3e-32   Populus tremula x Populus tremuloides
ref|XP_009364930.1|  PREDICTED: transcription factor EGL1-like          132   3e-32   Pyrus x bretschneideri [bai li]
gb|AFD29598.1|  DEL65                                                   131   3e-32   Gossypium arboreum [tree cotton]
ref|XP_006476561.1|  PREDICTED: transcription factor GLABRA 3-lik...    131   3e-32   Citrus sinensis [apfelsine]
gb|KHG13854.1|  Transcription factor GLABRA 3 -like protein             131   3e-32   Gossypium arboreum [tree cotton]
ref|XP_008392582.1|  PREDICTED: transcription factor EGL1-like          131   3e-32   Malus domestica [apple tree]
ref|XP_006476560.1|  PREDICTED: transcription factor GLABRA 3-lik...    131   3e-32   Citrus sinensis [apfelsine]
gb|KDO76231.1|  hypothetical protein CISIN_1g007527mg                   131   4e-32   Citrus sinensis [apfelsine]
gb|AAR21666.1|  myc-like anthocyanin regulatory protein                 131   4e-32   Cornus unalaschkensis
emb|CDP12029.1|  unnamed protein product                                131   5e-32   Coffea canephora [robusta coffee]
emb|CDY08314.1|  BnaC09g12820D                                          130   5e-32   Brassica napus [oilseed rape]
ref|XP_010089100.1|  hypothetical protein L484_024273                   131   6e-32   
emb|CBI34665.3|  unnamed protein product                                129   8e-32   Vitis vinifera
gb|AAR21668.1|  myc-like anthocyanin regulatory protein                 130   1e-31   Cornus suecica [Lapland cornel]
ref|XP_002887946.1|  hypothetical protein ARALYDRAFT_474990             129   1e-31   
ref|XP_006439540.1|  hypothetical protein CICLE_v10019338mg             130   1e-31   
gb|ADY17835.1|  bHLH transcription factor                               130   1e-31   Oryza sativa [red rice]
ref|XP_010053253.1|  PREDICTED: transcription factor EGL1-like          129   2e-31   Eucalyptus grandis [rose gum]
gb|KJB25868.1|  hypothetical protein B456_004G212200                    129   2e-31   Gossypium raimondii
gb|AAK19613.1|AF336280_1  GHDEL65                                       129   2e-31   Gossypium hirsutum [American cotton]
gb|AAR21673.1|  myc-like anthocyanin regulatory protein                 129   2e-31   Cornus chinensis
gb|AIS92514.1|  putative GLABRA 3 transcription factor                  129   2e-31   Epimedium sagittatum
ref|XP_008361579.1|  PREDICTED: LOW QUALITY PROTEIN: transcriptio...    129   2e-31   
gb|AIU98518.1|  bHLH transcription factor                               129   3e-31   Paeonia suffruticosa [moutan peony]
emb|CDP90457.1|  bHLH transcription factor                              129   3e-31   Humulus lupulus [common hop]
gb|EPS60959.1|  hypothetical protein M569_13841                         122   3e-31   Genlisea aurea
ref|XP_009411527.1|  PREDICTED: transcription factor GLABRA 3-like      129   3e-31   
emb|CAN75308.1|  hypothetical protein VITISV_040405                     128   3e-31   Vitis vinifera
emb|CAA07615.1|  GMYC1 protein                                          127   3e-31   Gerbera hybrid cultivar
ref|XP_010545729.1|  PREDICTED: transcription factor EGL1               129   3e-31   Tarenaya hassleriana [spider flower]
ref|XP_011080947.1|  PREDICTED: transcription factor EGL1-like          129   4e-31   Sesamum indicum [beniseed]
ref|XP_009384094.1|  PREDICTED: transcription factor EGL1-like          129   4e-31   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009112931.1|  PREDICTED: transcription factor EGL1-like          128   5e-31   Brassica rapa
emb|CDY25513.1|  BnaC09g11380D                                          127   5e-31   Brassica napus [oilseed rape]
emb|CDY58950.1|  BnaCnng33960D                                          127   6e-31   Brassica napus [oilseed rape]
emb|CDY34367.1|  BnaA09g11090D                                          127   6e-31   Brassica napus [oilseed rape]
gb|KJB41333.1|  hypothetical protein B456_007G099300                    128   6e-31   Gossypium raimondii
ref|NP_001267954.1|  myc anthocyanin regulatory protein                 128   6e-31   Vitis vinifera
gb|KFK33021.1|  hypothetical protein AALP_AA6G320200                    128   7e-31   
gb|AGW45470.1|  BVEGL3-2                                                126   7e-31   
ref|XP_009346743.1|  PREDICTED: transcription factor EGL1               128   7e-31   
ref|XP_010661717.1|  PREDICTED: myc anthocyanin regulatory protei...    128   8e-31   
gb|ABR68793.1|  MYC2                                                    128   8e-31   
gb|ABR68792.1|  MYC2                                                    128   8e-31   
gb|AGW45469.1|  BVEGL3-1                                                127   8e-31   
ref|XP_006445042.1|  hypothetical protein CICLE_v10019219mg             128   8e-31   
emb|CBI40375.3|  unnamed protein product                                127   8e-31   
emb|CDY39747.1|  BnaA04g11060D                                          127   9e-31   
gb|KJB41334.1|  hypothetical protein B456_007G099300                    127   9e-31   
gb|ADK11703.1|  enhancer of glabra 3                                    127   9e-31   
ref|XP_002270239.2|  PREDICTED: transcription factor EGL1               127   1e-30   
ref|XP_004245600.1|  PREDICTED: transcription factor EGL1               127   1e-30   
ref|XP_009382358.1|  PREDICTED: transcription factor EGL1-like          127   1e-30   
gb|ABM63388.1|  truncated Rc protein                                    125   1e-30   
gb|KHG17443.1|  Transcription factor GLABRA 3 -like protein             127   2e-30   
gb|ADY17845.1|  bHLH transcription factor                               125   2e-30   
gb|ADY17831.1|  truncated bHLH transcription factor                     125   2e-30   
ref|XP_009140081.1|  PREDICTED: transcription factor GLABRA 3 iso...    127   2e-30   
gb|KGN47893.1|  hypothetical protein Csa_6G409990                       119   2e-30   
ref|XP_010053704.1|  PREDICTED: transcription factor EGL1               126   2e-30   
ref|XP_009600070.1|  PREDICTED: transcription factor EGL1 isoform X2    126   2e-30   
gb|AGX01001.1|  JAF13-like protein                                      126   3e-30   
ref|XP_009600065.1|  PREDICTED: transcription factor EGL1 isoform X1    126   3e-30   
ref|XP_009600071.1|  PREDICTED: transcription factor EGL1 isoform X3    125   3e-30   
emb|CAZ40332.1|  putative transcription factor                          126   3e-30   
gb|ADK36613.1|  Rc protein                                              126   3e-30   
gb|ADK36612.1|  Rc protein                                              126   3e-30   
gb|ADK36611.1|  Rc protein                                              126   4e-30   
gb|ADK36596.1|  Rc protein                                              126   4e-30   
gb|ADK36599.1|  Rc protein                                              126   4e-30   
gb|ABB17167.1|  brown pericarp and seed coat                            126   4e-30   
gb|ADK36602.1|  Rc protein                                              126   4e-30   
gb|ADK36608.1|  Rc protein                                              126   4e-30   
gb|ADK36603.1|  Rc protein                                              126   4e-30   
gb|ADK36557.1|  Rc protein                                              126   4e-30   
gb|ADK36614.1|  Rc protein                                              126   4e-30   
gb|ADY17834.1|  bHLH transcription factor                               126   4e-30   
gb|ADK36616.1|  Rc protein                                              126   4e-30   
gb|ADY17839.1|  bHLH transcription factor                               126   4e-30   
gb|ADY17832.1|  bHLH transcription factor                               126   4e-30   
gb|ADK36619.1|  Rc protein                                              126   4e-30   
dbj|BAF42667.1|  Myc-like proanthocyanidin regulatory protein           126   4e-30   
dbj|BAF42668.1|  bHLH protein                                           126   4e-30   
gb|ADY17841.1|  bHLH transcription factor                               126   4e-30   
gb|ADR01101.1|  Rc protein                                              126   4e-30   
gb|ADR01100.1|  Rc protein                                              126   4e-30   
gb|ADK36621.1|  Rc protein                                              126   4e-30   
gb|ADY17833.1|  bHLH transcription factor                               126   4e-30   
gb|ADK36600.1|  Rc protein                                              126   4e-30   
gb|ADR01102.1|  Rc protein                                              126   5e-30   
gb|AAA32663.1|  DEL                                                     125   5e-30   
gb|EAZ03204.1|  hypothetical protein OsI_25355                          125   5e-30   
gb|AEM63394.1|  delila2                                                 125   5e-30   
ref|XP_007051809.1|  Basic helix-loop-helix DNA-binding superfami...    127   6e-30   
ref|XP_009779731.1|  PREDICTED: transcription factor EGL1-like is...    125   7e-30   
gb|AGX01002.1|  JAF13-like protein                                      125   7e-30   
ref|XP_009779730.1|  PREDICTED: transcription factor EGL1-like is...    125   8e-30   
gb|AHY00341.1|  JAF13                                                   125   8e-30   
ref|XP_009779732.1|  PREDICTED: transcription factor GLABRA 3-lik...    124   9e-30   
gb|AIP93872.1|  anthocyanin bHLH transcription factor                   124   1e-29   
dbj|BAA75513.1|  MYC-RP                                                 124   2e-29   
dbj|BAA75514.1|  MYC-GP                                                 124   2e-29   
dbj|BAJ10680.1|  bHLH transcription factor                              124   2e-29   
ref|XP_006343977.1|  PREDICTED: transcription factor GLABRA 3-lik...    124   2e-29   
gb|ADK36626.1|  Rc protein                                              124   2e-29   
ref|NP_001275132.1|  transcription factor GLABRA 3-like                 124   2e-29   
ref|XP_009367859.1|  PREDICTED: transcription factor EGL1-like          124   2e-29   
gb|AGL98426.1|  bHLH1                                                   124   2e-29   
ref|XP_011072763.1|  PREDICTED: transcription factor EGL1-like is...    124   2e-29   
gb|KDP28629.1|  hypothetical protein JCGZ_14400                         124   2e-29   
ref|XP_011656339.1|  PREDICTED: transcription factor EGL1 isoform X2    124   2e-29   
ref|XP_008458230.1|  PREDICTED: LOW QUALITY PROTEIN: transcriptio...    124   2e-29   
ref|XP_012083393.1|  PREDICTED: transcription factor EGL1 isoform X1    124   3e-29   
gb|AHJ80986.1|  basic helix-loop-helix transcription factor             123   3e-29   
gb|AIT76563.1|  bHLH protein                                            123   3e-29   
dbj|BAN17386.1|  bHLH transcription factor                              123   3e-29   
ref|XP_011657519.1|  PREDICTED: basic helix-loop-helix protein A ...    123   3e-29   
ref|XP_004140222.2|  PREDICTED: basic helix-loop-helix protein A ...    123   3e-29   
ref|NP_001292635.1|  transcription factor EGL1                          123   4e-29   
gb|AAM28200.1|AF505625_1  putative basic helix-loop-helix protein       116   4e-29   
gb|EYU38344.1|  hypothetical protein MIMGU_mgv1a002904mg                123   4e-29   
ref|XP_002459545.1|  hypothetical protein SORBIDRAFT_02g006380          116   4e-29   
ref|XP_008449448.1|  PREDICTED: basic helix-loop-helix protein A ...    123   5e-29   
ref|XP_004503712.1|  PREDICTED: transcription factor GLABRA 3-lik...    123   5e-29   
ref|XP_008449449.1|  PREDICTED: basic helix-loop-helix protein A ...    123   5e-29   
ref|XP_001773815.1|  predicted protein                                  121   5e-29   
ref|XP_004503713.1|  PREDICTED: transcription factor GLABRA 3-lik...    122   6e-29   
ref|XP_011072770.1|  PREDICTED: transcription factor EGL1-like is...    122   7e-29   
gb|KHN23640.1|  Transcription factor GLABRA 3                           122   8e-29   
gb|ABY26918.1|  putative anthocyanin regulator                          122   9e-29   
ref|XP_003525395.1|  PREDICTED: transcription factor GLABRA 3-like      122   9e-29   
gb|AHJ80985.1|  basic helix-loop-helix transcription factor             122   1e-28   
gb|ABY26924.1|  putative anthocyanin regulator                          122   1e-28   
gb|ABY26927.1|  putative anthocyanin regulator                          121   1e-28   
gb|ABY26926.1|  putative anthocyanin regulator                          121   1e-28   
dbj|BAF46860.1|  bHLH transcriptional regulator                         121   1e-28   
gb|ADY17837.1|  bHLH transcription factor                               122   2e-28   
gb|AHH29255.1|  transcriptional regulator bHLH1                         121   2e-28   
dbj|BAE94393.1|  bHLH transcriptional regulator                         121   2e-28   
gb|ABY26928.1|  putative anthocyanin regulator                          121   2e-28   
gb|AFV33951.1|  bHLH1 transcription factor                              121   2e-28   
gb|ABY26925.1|  putative anthocyanin regulator                          121   2e-28   
gb|ABY26922.1|  putative anthocyanin regulator                          121   2e-28   
ref|XP_002511859.1|  transcription factor, putative                     121   2e-28   
ref|XP_009385233.1|  PREDICTED: transcription factor EGL1-like          120   3e-28   
ref|XP_004308377.1|  PREDICTED: transcription factor EGL1               120   4e-28   
gb|ABY26921.1|  putative anthocyanin regulator                          120   4e-28   
ref|XP_006300873.1|  hypothetical protein CARUB_v10019965mg             120   4e-28   
gb|ABY26919.1|  putative anthocyanin regulator                          120   5e-28   
ref|XP_011023340.1|  PREDICTED: transcription factor EGL1-like is...    120   6e-28   
gb|AIY34723.1|  anthocyanin regulatory protein                          120   6e-28   
gb|AHM88208.1|  bHLH33 protein                                          120   6e-28   
gb|ABY26923.1|  putative anthocyanin regulator                          119   6e-28   
ref|XP_002301357.1|  basic helix-loop-helix regulatory family pro...    120   6e-28   
gb|ABB84474.1|  bHLH33                                                  119   7e-28   
gb|ACC62038.1|  myc-like anthocyanin regulatory protein                 112   7e-28   
gb|ADE77258.1|  unknown                                                 114   9e-28   
gb|EEC77782.1|  hypothetical protein OsI_16951                          118   1e-27   
ref|XP_010553518.1|  PREDICTED: transcription factor EGL1-like is...    119   1e-27   
emb|CAH67406.1|  OSIGBa0137D06.7                                        118   1e-27   
ref|NP_001053530.2|  Os04g0557200                                       118   1e-27   
ref|XP_010553516.1|  PREDICTED: transcription factor EGL1-like is...    119   1e-27   
gb|KHG14409.1|  Transcription factor MYC1 -like protein                 117   2e-27   
ref|XP_011023339.1|  PREDICTED: transcription factor EGL1-like is...    119   2e-27   
gb|ABY26920.1|  putative anthocyanin regulator                          118   2e-27   
emb|CAE03479.2|  OSJNBa0065O17.4                                        118   2e-27   
gb|EMT08716.1|  Anthocyanin regulatory R-S protein                      117   2e-27   
gb|KEH21065.1|  bHLH transcription factor                               117   3e-27   
gb|AFD29599.1|  DEL61                                                   117   3e-27   
gb|ABE67978.1|  myc-like anthocyanin regulatory protein                 117   3e-27   
ref|XP_006652628.1|  PREDICTED: anthocyanin regulatory Lc protein...    117   3e-27   
ref|XP_010418395.1|  PREDICTED: transcription factor EGL1-like is...    117   5e-27   
ref|XP_010418394.1|  PREDICTED: transcription factor EGL1-like is...    117   5e-27   
ref|XP_010430470.1|  PREDICTED: transcription factor EGL1-like is...    117   5e-27   
ref|XP_010430469.1|  PREDICTED: transcription factor EGL1-like is...    117   5e-27   
gb|EMT01602.1|  hypothetical protein F775_14189                         112   5e-27   
gb|KHN16817.1|  Transcription factor GLABRA 3                           117   5e-27   
ref|XP_009340108.1|  PREDICTED: transcription factor EGL1-like          117   5e-27   
ref|XP_010241899.1|  PREDICTED: transcription factor GLABRA 3-lik...    117   6e-27   
gb|ADK36598.1|  Rc protein                                              117   6e-27   
ref|XP_008232900.1|  PREDICTED: transcription factor EGL1               117   6e-27   
gb|AAK19612.1|AF336279_1  GHDEL61                                       117   7e-27   
ref|XP_003532789.1|  PREDICTED: transcription factor GLABRA 3-like      117   7e-27   
ref|XP_010473611.1|  PREDICTED: transcription factor EGL1               116   7e-27   
ref|XP_007220209.1|  hypothetical protein PRUPE_ppa002645mg             117   7e-27   
gb|ADN52335.1|  bHLH protein                                            117   7e-27   
dbj|BAE20057.1|  bHLH transcription factor                              117   7e-27   
gb|KJB39649.1|  hypothetical protein B456_007G023500                    116   7e-27   
gb|AJB28483.1|  bHLH33                                                  117   8e-27   
ref|XP_009402059.1|  PREDICTED: anthocyanin regulatory Lc protein...    116   1e-26   
gb|AGZ15305.1|  bHLH protein                                            116   1e-26   
gb|AJG36537.1|  MYC-like regulatory protein                             115   1e-26   
gb|EEE54856.1|  hypothetical protein OsJ_02325                          109   2e-26   
gb|KJB39650.1|  hypothetical protein B456_007G023500                    115   2e-26   
dbj|BAJ92151.1|  predicted protein                                      112   2e-26   
ref|XP_007040250.1|  Basic helix-loop-helix DNA-binding superfami...    115   2e-26   
gb|ADK36620.1|  Rc protein                                              115   2e-26   
gb|EMT27008.1|  Anthocyanin regulatory Lc protein                       114   3e-26   
ref|XP_010436079.1|  PREDICTED: transcription factor GLABRA 3 iso...    114   4e-26   
ref|XP_010436078.1|  PREDICTED: transcription factor GLABRA 3 iso...    114   4e-26   
ref|XP_010447324.1|  PREDICTED: LOW QUALITY PROTEIN: transcriptio...    114   4e-26   
gb|ADR30718.1|  putative bHLH domain protein                            114   5e-26   
gb|EMS65005.1|  Anthocyanin regulatory R-S protein                      115   5e-26   
ref|XP_006653664.1|  PREDICTED: anthocyanin regulatory R-S protei...    114   6e-26   
gb|AAB72192.1|  bHLH protein                                            114   6e-26   
ref|XP_006405367.1|  hypothetical protein EUTSA_v10027709mg             113   6e-26   
gb|AGZ15306.1|  bHLH protein                                            114   7e-26   
ref|NP_176552.1|  transcription factor EGL1                             114   7e-26   
gb|AAC49219.1|  Ra                                                      114   7e-26   
ref|XP_010055649.1|  PREDICTED: transcription factor GLABRA 3-lik...    114   8e-26   
ref|XP_010055653.1|  PREDICTED: transcription factor GLABRA 3-lik...    114   8e-26   
gb|ADR30712.1|  putative bHLH domain protein                            113   8e-26   
dbj|BAB64301.1|  R-type basic helix-loop-helix protein                  113   8e-26   
dbj|BAJ92594.1|  predicted protein                                      113   8e-26   
gb|ADR30705.1|  putative bHLH domain protein                            113   8e-26   
gb|ADG56511.1|  basic helix-loop-helix protein                          113   9e-26   
gb|AAS86288.1|  myc-like anthocyanin regulatory protein                 113   1e-25   
gb|ADR30684.1|  truncated putative bHLH domain protein                  110   1e-25   
gb|ABW89744.1|  putative anthocyanin regulatory Lc protein              113   1e-25   
ref|XP_010445720.1|  PREDICTED: transcription factor GLABRA 3-like      111   2e-25   
ref|NP_001053532.1|  Os04g0557800                                       112   2e-25   
ref|XP_011036272.1|  PREDICTED: transcription factor EGL1-like          112   2e-25   
gb|EMT25332.1|  Anthocyanin regulatory Lc protein                       112   3e-25   
ref|XP_002320131.1|  basic helix-loop-helix regulatory family pro...    112   3e-25   
ref|XP_006283308.1|  hypothetical protein CARUB_v10004345mg             112   3e-25   
ref|XP_002870642.1|  hypothetical protein ARALYDRAFT_493847             112   3e-25   
ref|NP_680372.1|  transcription factor GLABRA 3                         112   3e-25   
ref|XP_004976473.1|  PREDICTED: anthocyanin regulatory R-S protei...    111   4e-25   
gb|ABM69182.1|  TAN1                                                    112   4e-25   
gb|EMS66405.1|  Anthocyanin regulatory R-S protein                      111   5e-25   
dbj|BAE94395.1|  bHLH transcriptional regulator                         111   6e-25   
dbj|BAJ10681.1|  bHLH transcription factor LjTAN1                       111   7e-25   
ref|XP_006653663.1|  PREDICTED: anthocyanin regulatory R-S protei...    111   7e-25   
dbj|BAJ33516.1|  bHLH transcriptional factor                            110   9e-25   
gb|AAS86275.1|  myc-like anthocyanin regulatory protein                 110   9e-25   
ref|XP_004970877.1|  PREDICTED: anthocyanin regulatory R-S protei...    110   9e-25   
ref|XP_007160070.1|  hypothetical protein PHAVU_002G290000g             110   9e-25   
ref|XP_006576324.1|  PREDICTED: transcription factor GLABRA 3-lik...    110   1e-24   
ref|XP_006576323.1|  PREDICTED: transcription factor GLABRA 3-lik...    110   2e-24   
ref|XP_011625032.1|  PREDICTED: transcription factor GLABRA 3 iso...    110   2e-24   
gb|ADK36622.1|  Rc protein                                              110   2e-24   
gb|ADK36627.1|  Rc protein                                              110   2e-24   
ref|XP_003520996.1|  PREDICTED: transcription factor GLABRA 3-lik...    110   2e-24   
dbj|BAB64302.1|  R-type basic helix-loop-helix protein                  108   2e-24   
ref|XP_002448310.1|  hypothetical protein SORBIDRAFT_06g025020          109   3e-24   
gb|AAM22476.1|AF503362_1  myc-like regulatory protein                   109   3e-24   
gb|AAC39455.1|  bHLH transcription factor JAF13                         109   3e-24   
gb|AGV54603.1|  myc-like regulatory protein                             108   3e-24   
gb|EEC77783.1|  hypothetical protein OsI_16952                          107   4e-24   
gb|ACF72869.1|  basic helix loop helix regulatory protein               102   4e-24   
ref|XP_006658393.1|  PREDICTED: transcription factor TT8-like           108   5e-24   
ref|XP_007135064.1|  hypothetical protein PHAVU_010G098500g             108   8e-24   
ref|XP_007135065.1|  hypothetical protein PHAVU_010G098500g             108   9e-24   
ref|XP_002447817.1|  hypothetical protein SORBIDRAFT_06g016380          106   3e-23   
gb|KHN26969.1|  Transcription factor EGL1                               106   3e-23   
ref|XP_002448313.1|  hypothetical protein SORBIDRAFT_06g025060          106   3e-23   
ref|XP_003529942.1|  PREDICTED: transcription factor EGL1-like          106   4e-23   
ref|XP_008669036.1|  PREDICTED: anthocyanin regulatory R-S protei...    105   7e-23   
gb|AHH01298.1|  colored plant1                                          102   8e-23   



>dbj|BAE94394.1| bHLH transcriptional factor [Ipomoea nil]
Length=669

 Score =   274 bits (701),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 130/130 (100%), Positives = 130/130 (100%), Gaps = 0/130 (0%)
 Frame = +3

Query  159  MAETPGGAAHLQTLLQTAVQSVHWTYSLFWNLCPHNGMLVWSDGYYNGAIKTRKTVQGTE  338
            MAETPGGAAHLQTLLQTAVQSVHWTYSLFWNLCPHNGMLVWSDGYYNGAIKTRKTVQGTE
Sbjct  1    MAETPGGAAHLQTLLQTAVQSVHWTYSLFWNLCPHNGMLVWSDGYYNGAIKTRKTVQGTE  60

Query  339  VSAEEASLHRSQQIKELYESLSATAEESNGGGGQQPARRPSAALSPEDLTESEWFYLMCI  518
            VSAEEASLHRSQQIKELYESLSATAEESNGGGGQQPARRPSAALSPEDLTESEWFYLMCI
Sbjct  61   VSAEEASLHRSQQIKELYESLSATAEESNGGGGQQPARRPSAALSPEDLTESEWFYLMCI  120

Query  519  SFSFPSAVGL  548
            SFSFPSAVGL
Sbjct  121  SFSFPSAVGL  130



>gb|ABY26929.1| putative anthocyanin transcriptional regulator [Ipomoea hederacea]
Length=664

 Score =   264 bits (675),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 127/130 (98%), Positives = 128/130 (98%), Gaps = 1/130 (1%)
 Frame = +3

Query  159  MAETPGGAAHLQTLLQTAVQSVHWTYSLFWNLCPHNGMLVWSDGYYNGAIKTRKTVQGTE  338
            MAE PGGAAHLQ+LLQTAVQSVHWTYSLFWNLCPHNGMLVWSDGYYNGAIKTRKTVQGTE
Sbjct  1    MAENPGGAAHLQSLLQTAVQSVHWTYSLFWNLCPHNGMLVWSDGYYNGAIKTRKTVQGTE  60

Query  339  VSAEEASLHRSQQIKELYESLSATAEESNGGGGQQPARRPSAALSPEDLTESEWFYLMCI  518
            VSAEEASLHRSQQIKELYESLSATAEESN GGGQQPARRPSAALSPEDLTESEWFYLMCI
Sbjct  61   VSAEEASLHRSQQIKELYESLSATAEESN-GGGQQPARRPSAALSPEDLTESEWFYLMCI  119

Query  519  SFSFPSAVGL  548
            SFSFPSAVGL
Sbjct  120  SFSFPSAVGL  129



>dbj|BAD18983.1| bHLH transcription activator Ivory seed [Ipomoea tricolor]
 dbj|BAD18984.1| bHLH transcription activator Ivory seed [Ipomoea tricolor]
Length=670

 Score =   262 bits (670),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 126/130 (97%), Positives = 127/130 (98%), Gaps = 1/130 (1%)
 Frame = +3

Query  159  MAETPGGAAHLQTLLQTAVQSVHWTYSLFWNLCPHNGMLVWSDGYYNGAIKTRKTVQGTE  338
            MAE PGGAAHLQ+LLQTAVQSVHWTYSLFW LCPHNGMLVWSDGYYNGAIKTRKTVQGTE
Sbjct  1    MAENPGGAAHLQSLLQTAVQSVHWTYSLFWKLCPHNGMLVWSDGYYNGAIKTRKTVQGTE  60

Query  339  VSAEEASLHRSQQIKELYESLSATAEESNGGGGQQPARRPSAALSPEDLTESEWFYLMCI  518
            VSAEEASLHRSQQIKELYESLSATAEESN GGGQQPARRPSAALSPEDLTESEWFYLMCI
Sbjct  61   VSAEEASLHRSQQIKELYESLSATAEESN-GGGQQPARRPSAALSPEDLTESEWFYLMCI  119

Query  519  SFSFPSAVGL  548
            SFSFPSAVGL
Sbjct  120  SFSFPSAVGL  129



>gb|ABW69686.1| anthocyanin synthesis regulatory protein [Ipomoea purpurea]
Length=662

 Score =   261 bits (667),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 126/130 (97%), Positives = 127/130 (98%), Gaps = 1/130 (1%)
 Frame = +3

Query  159  MAETPGGAAHLQTLLQTAVQSVHWTYSLFWNLCPHNGMLVWSDGYYNGAIKTRKTVQGTE  338
            MAETPGGAAHLQ+LLQTAVQSVHWTYSLFW LCPHNGMLVWSDGYYNGAIKTRKTVQGTE
Sbjct  1    MAETPGGAAHLQSLLQTAVQSVHWTYSLFWKLCPHNGMLVWSDGYYNGAIKTRKTVQGTE  60

Query  339  VSAEEASLHRSQQIKELYESLSATAEESNGGGGQQPARRPSAALSPEDLTESEWFYLMCI  518
            VSAEEASLHRS QIKELYESLSATAEESN GGGQQPARRPSAALSPEDLTESEWFYLMCI
Sbjct  61   VSAEEASLHRSLQIKELYESLSATAEESN-GGGQQPARRPSAALSPEDLTESEWFYLMCI  119

Query  519  SFSFPSAVGL  548
            SFSFPSAVGL
Sbjct  120  SFSFPSAVGL  129



>gb|ABW69687.1| anthocyanin synthesis regulatory protein [Ipomoea purpurea]
Length=664

 Score =   261 bits (666),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 126/130 (97%), Positives = 127/130 (98%), Gaps = 1/130 (1%)
 Frame = +3

Query  159  MAETPGGAAHLQTLLQTAVQSVHWTYSLFWNLCPHNGMLVWSDGYYNGAIKTRKTVQGTE  338
            MAETPGGAAHLQ+LLQTAVQSVHWTYSLFW LCPHNGMLVWSDGYYNGAIKTRKTVQGTE
Sbjct  1    MAETPGGAAHLQSLLQTAVQSVHWTYSLFWKLCPHNGMLVWSDGYYNGAIKTRKTVQGTE  60

Query  339  VSAEEASLHRSQQIKELYESLSATAEESNGGGGQQPARRPSAALSPEDLTESEWFYLMCI  518
            VSAEEASLHRS QIKELYESLSATAEESN GGGQQPARRPSAALSPEDLTESEWFYLMCI
Sbjct  61   VSAEEASLHRSLQIKELYESLSATAEESN-GGGQQPARRPSAALSPEDLTESEWFYLMCI  119

Query  519  SFSFPSAVGL  548
            SFSFPSAVGL
Sbjct  120  SFSFPSAVGL  129



>gb|ABW69688.1| anthocyanin synthesis regulatory protein [Ipomoea purpurea]
Length=664

 Score =   261 bits (666),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 126/130 (97%), Positives = 127/130 (98%), Gaps = 1/130 (1%)
 Frame = +3

Query  159  MAETPGGAAHLQTLLQTAVQSVHWTYSLFWNLCPHNGMLVWSDGYYNGAIKTRKTVQGTE  338
            MAETPGGAAHLQ+LLQTAVQSVHWTYSLFW LCPHNGMLVWSDGYYNGAIKTRKTVQGTE
Sbjct  1    MAETPGGAAHLQSLLQTAVQSVHWTYSLFWKLCPHNGMLVWSDGYYNGAIKTRKTVQGTE  60

Query  339  VSAEEASLHRSQQIKELYESLSATAEESNGGGGQQPARRPSAALSPEDLTESEWFYLMCI  518
            VSAEEASLHRS QIKELYESLSATAEESN GGGQQPARRPSAALSPEDLTESEWFYLMCI
Sbjct  61   VSAEEASLHRSLQIKELYESLSATAEESN-GGGQQPARRPSAALSPEDLTESEWFYLMCI  119

Query  519  SFSFPSAVGL  548
            SFSFPSAVGL
Sbjct  120  SFSFPSAVGL  129



>dbj|BAF46859.1| bHLH transcription activator Ivory seed [Ipomoea purpurea]
Length=664

 Score =   259 bits (662),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 125/130 (96%), Positives = 126/130 (97%), Gaps = 1/130 (1%)
 Frame = +3

Query  159  MAETPGGAAHLQTLLQTAVQSVHWTYSLFWNLCPHNGMLVWSDGYYNGAIKTRKTVQGTE  338
            MAE PGGAAHLQ+LLQTAVQSVHWTYSLFW LCPHNGMLVWSDGYYNGAIKTRKTVQGTE
Sbjct  1    MAENPGGAAHLQSLLQTAVQSVHWTYSLFWKLCPHNGMLVWSDGYYNGAIKTRKTVQGTE  60

Query  339  VSAEEASLHRSQQIKELYESLSATAEESNGGGGQQPARRPSAALSPEDLTESEWFYLMCI  518
            VSAEEASLHRS QIKELYESLSATAEESN GGGQQPARRPSAALSPEDLTESEWFYLMCI
Sbjct  61   VSAEEASLHRSLQIKELYESLSATAEESN-GGGQQPARRPSAALSPEDLTESEWFYLMCI  119

Query  519  SFSFPSAVGL  548
            SFSFPSAVGL
Sbjct  120  SFSFPSAVGL  129



>gb|ABY26932.1| putative anthocyanin transcriptional regulator [Ipomoea coccinea]
Length=661

 Score =   259 bits (661),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 124/130 (95%), Positives = 126/130 (97%), Gaps = 1/130 (1%)
 Frame = +3

Query  159  MAETPGGAAHLQTLLQTAVQSVHWTYSLFWNLCPHNGMLVWSDGYYNGAIKTRKTVQGTE  338
            MAE PGGAAHLQ+LLQTAVQSVHWTYSLFWNLCPHNGMLVWSDGYYNGAIKTRKTVQGTE
Sbjct  1    MAENPGGAAHLQSLLQTAVQSVHWTYSLFWNLCPHNGMLVWSDGYYNGAIKTRKTVQGTE  60

Query  339  VSAEEASLHRSQQIKELYESLSATAEESNGGGGQQPARRPSAALSPEDLTESEWFYLMCI  518
            VSAEEASLHRSQQ+KELYESLSATAEESN GG QQP RRPSAALSPEDLTESEWFYLMCI
Sbjct  61   VSAEEASLHRSQQLKELYESLSATAEESN-GGAQQPPRRPSAALSPEDLTESEWFYLMCI  119

Query  519  SFSFPSAVGL  548
            SFSFPSAVGL
Sbjct  120  SFSFPSAVGL  129



>dbj|BAD18982.1| bHLH transcription activator Ivory seed [Ipomoea purpurea]
 dbj|BAF46858.1| bHLH transcription activator Ivory seed [Ipomoea purpurea]
Length=665

 Score =   259 bits (661),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 125/130 (96%), Positives = 126/130 (97%), Gaps = 1/130 (1%)
 Frame = +3

Query  159  MAETPGGAAHLQTLLQTAVQSVHWTYSLFWNLCPHNGMLVWSDGYYNGAIKTRKTVQGTE  338
            MAE PGGAAHLQ+LLQTAVQSVHWTYSLFW LCPHNGMLVWSDGYYNGAIKTRKTVQGTE
Sbjct  1    MAENPGGAAHLQSLLQTAVQSVHWTYSLFWKLCPHNGMLVWSDGYYNGAIKTRKTVQGTE  60

Query  339  VSAEEASLHRSQQIKELYESLSATAEESNGGGGQQPARRPSAALSPEDLTESEWFYLMCI  518
            VSAEEASLHRS QIKELYESLSATAEESN GGGQQPARRPSAALSPEDLTESEWFYLMCI
Sbjct  61   VSAEEASLHRSLQIKELYESLSATAEESN-GGGQQPARRPSAALSPEDLTESEWFYLMCI  119

Query  519  SFSFPSAVGL  548
            SFSFPSAVGL
Sbjct  120  SFSFPSAVGL  129



>gb|ABY26931.1| putative anthocyanin transcriptional regulator [Ipomoea quamoclit]
Length=659

 Score =   258 bits (660),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 124/130 (95%), Positives = 125/130 (96%), Gaps = 1/130 (1%)
 Frame = +3

Query  159  MAETPGGAAHLQTLLQTAVQSVHWTYSLFWNLCPHNGMLVWSDGYYNGAIKTRKTVQGTE  338
            MAE PGGAAHLQ+LLQTAVQSVHWTYSLFW LCPHNGMLVWSDGYYNGAIKTRKTVQGTE
Sbjct  1    MAENPGGAAHLQSLLQTAVQSVHWTYSLFWKLCPHNGMLVWSDGYYNGAIKTRKTVQGTE  60

Query  339  VSAEEASLHRSQQIKELYESLSATAEESNGGGGQQPARRPSAALSPEDLTESEWFYLMCI  518
            VSAEEASLHRSQQIKELYESLSATAEESN GG QQP RRPSAALSPEDLTESEWFYLMCI
Sbjct  61   VSAEEASLHRSQQIKELYESLSATAEESN-GGAQQPPRRPSAALSPEDLTESEWFYLMCI  119

Query  519  SFSFPSAVGL  548
            SFSFPSAVGL
Sbjct  120  SFSFPSAVGL  129



>gb|ABY26930.1| putative anthocyanin transcriptional regulator [Ipomoea alba]
Length=671

 Score =   256 bits (655),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 121/130 (93%), Positives = 125/130 (96%), Gaps = 0/130 (0%)
 Frame = +3

Query  159  MAETPGGAAHLQTLLQTAVQSVHWTYSLFWNLCPHNGMLVWSDGYYNGAIKTRKTVQGTE  338
            MAE PGGAAHLQ+LLQT+VQSV WTYSLFW LC HNGMLVWSDGYYNGAIKTRKTVQGTE
Sbjct  1    MAENPGGAAHLQSLLQTSVQSVQWTYSLFWKLCSHNGMLVWSDGYYNGAIKTRKTVQGTE  60

Query  339  VSAEEASLHRSQQIKELYESLSATAEESNGGGGQQPARRPSAALSPEDLTESEWFYLMCI  518
            VSAEEASLHRSQQIKELYESLSATAEESNGGG QQPARRP+AALSPEDLTESEW+YLMCI
Sbjct  61   VSAEEASLHRSQQIKELYESLSATAEESNGGGSQQPARRPTAALSPEDLTESEWYYLMCI  120

Query  519  SFSFPSAVGL  548
            SFSFPSAVGL
Sbjct  121  SFSFPSAVGL  130



>gb|ABY26935.1| putative anthocyanin transcriptional regulator [Ipomoea violacea]
Length=684

 Score =   243 bits (620),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 117/134 (87%), Positives = 121/134 (90%), Gaps = 4/134 (3%)
 Frame = +3

Query  159  MAETPGGAAHLQTLLQTAVQSVHWTYSLFWNLCPHNGMLVWSDGYYNGAIKTRKTVQGTE  338
            MAE PGG   L++LLQTAVQSV WTYSLFW LCP NGMLVWSDGYYNGAIKTRKTVQGTE
Sbjct  1    MAENPGGGGRLESLLQTAVQSVQWTYSLFWKLCPQNGMLVWSDGYYNGAIKTRKTVQGTE  60

Query  339  VSAEEASLHRSQQIKELYESLSATAEESNGG----GGQQPARRPSAALSPEDLTESEWFY  506
            VSA+EASLHRSQQIKELYESLSATAE+SNGG    G QQ ARRPSAALSPEDLTESEWFY
Sbjct  61   VSADEASLHRSQQIKELYESLSATAEDSNGGGSAYGAQQTARRPSAALSPEDLTESEWFY  120

Query  507  LMCISFSFPSAVGL  548
            LMCISFSFPSAVGL
Sbjct  121  LMCISFSFPSAVGL  134



>gb|ABY26937.1| putative anthocyanin transcriptional regulator [Ipomoea hochstetteri]
Length=683

 Score =   243 bits (620),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 120/136 (88%), Positives = 123/136 (90%), Gaps = 6/136 (4%)
 Frame = +3

Query  159  MAETPGGAA-HLQTLLQTAVQSVHWTYSLFWNLCPHNGMLVWSDGYYNGAIKTRKTVQGT  335
            MAE PGG A  L++LLQTAVQSV WTYSLFW LCPHNGMLVWSDGYYNGAIKTRKTVQGT
Sbjct  1    MAENPGGGAGRLESLLQTAVQSVEWTYSLFWKLCPHNGMLVWSDGYYNGAIKTRKTVQGT  60

Query  336  EVSAEEASLHRSQQIKELYESLSATAEESN-----GGGGQQPARRPSAALSPEDLTESEW  500
            EVSAEEASLHRSQQIKELYESLSATAEESN     G GGQQP RRP+AALSPEDLTESEW
Sbjct  61   EVSAEEASLHRSQQIKELYESLSATAEESNGCAGSGYGGQQPPRRPTAALSPEDLTESEW  120

Query  501  FYLMCISFSFPSAVGL  548
            FYLMCISFSFPSAVGL
Sbjct  121  FYLMCISFSFPSAVGL  136



>gb|ABY26936.1| putative anthocyanin transcriptional regulator [Ipomoea horsfalliae]
Length=672

 Score =   239 bits (611),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 117/130 (90%), Positives = 120/130 (92%), Gaps = 2/130 (2%)
 Frame = +3

Query  159  MAETPGGAAHLQTLLQTAVQSVHWTYSLFWNLCPHNGMLVWSDGYYNGAIKTRKTVQGTE  338
            MAE PGG   L++LLQTAVQSV WTYSLFW LCP NGMLVWSDGYYNG IKTRKTVQGTE
Sbjct  1    MAENPGGR-RLESLLQTAVQSVQWTYSLFWKLCPQNGMLVWSDGYYNGTIKTRKTVQGTE  59

Query  339  VSAEEASLHRSQQIKELYESLSATAEESNGGGGQQPARRPSAALSPEDLTESEWFYLMCI  518
            VSAEEASLHRSQQIKELYESLSATAEESN GGGQQP RRPSAALSPEDLTESEWFYLMCI
Sbjct  60   VSAEEASLHRSQQIKELYESLSATAEESN-GGGQQPTRRPSAALSPEDLTESEWFYLMCI  118

Query  519  SFSFPSAVGL  548
            SFSFPSA+GL
Sbjct  119  SFSFPSALGL  128



>gb|AHH29256.1| transcriptional regulator bHLH2 [Ipomoea batatas]
Length=672

 Score =   239 bits (611),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 115/130 (88%), Positives = 119/130 (92%), Gaps = 1/130 (1%)
 Frame = +3

Query  162  AETPGGAAHLQTLLQTAVQSVHWTYSLFWNLCPHNGMLVWSDGYYNGAIKTRKTVQGTEV  341
            AE P G   L++LLQTAVQSV WTYSLFW LCPHNGMLVWSDGYYNGAIKTRKTVQGTEV
Sbjct  3    AENPVGGGRLESLLQTAVQSVRWTYSLFWKLCPHNGMLVWSDGYYNGAIKTRKTVQGTEV  62

Query  342  SAEEASLHRSQQIKELYESLSATAEESNGG-GGQQPARRPSAALSPEDLTESEWFYLMCI  518
            SAEEASLHRSQQIKELYESL +TAEESNGG  GQQP RRPSAALSPEDLTESEWFYLMCI
Sbjct  63   SAEEASLHRSQQIKELYESLPSTAEESNGGSAGQQPPRRPSAALSPEDLTESEWFYLMCI  122

Query  519  SFSFPSAVGL  548
            SFSFPSA+GL
Sbjct  123  SFSFPSALGL  132



>gb|AFV33952.1| bHLH2 transcription factor [Ipomoea batatas]
Length=674

 Score =   239 bits (610),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 117/130 (90%), Positives = 121/130 (93%), Gaps = 2/130 (2%)
 Frame = +3

Query  162  AETPGGAAHLQTLLQTAVQSVHWTYSLFWNLCPHNGMLVWSDGYYNGAIKTRKTVQGTEV  341
            AE P G   L++LLQTAVQSV WTYSLFW LCPHNGMLVWSDGYYNGAIKTRKTVQGTEV
Sbjct  3    AENPVGG-RLESLLQTAVQSVQWTYSLFWKLCPHNGMLVWSDGYYNGAIKTRKTVQGTEV  61

Query  342  SAEEASLHRSQQIKELYESLSATAEESNGGG-GQQPARRPSAALSPEDLTESEWFYLMCI  518
            SAEEASLHRSQQIKELYESLS+TAEESNGGG GQQP RRPSAALSPEDLTESEWFYLMCI
Sbjct  62   SAEEASLHRSQQIKELYESLSSTAEESNGGGAGQQPPRRPSAALSPEDLTESEWFYLMCI  121

Query  519  SFSFPSAVGL  548
            SFSFPSA+GL
Sbjct  122  SFSFPSALGL  131



>gb|AEA34965.1| putative transcription factor BHLH2 [Ipomoea batatas]
Length=667

 Score =   236 bits (601),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 116/130 (89%), Positives = 119/130 (92%), Gaps = 2/130 (2%)
 Frame = +3

Query  162  AETPGGAAHLQTLLQTAVQSVHWTYSLFWNLCPHNGMLVWSDGYYNGAIKTRKTVQGTEV  341
            AE P G   L+ LLQTAVQSV WTYSLFW LCPHNGMLVWSDGYYNGAIKTRKTVQGTEV
Sbjct  3    AENPVGG-RLEGLLQTAVQSVQWTYSLFWKLCPHNGMLVWSDGYYNGAIKTRKTVQGTEV  61

Query  342  SAEEASLHRSQQIKELYESLSATAEESNGG-GGQQPARRPSAALSPEDLTESEWFYLMCI  518
            SAEEASLHRSQQIKELYESLS+TAEESNGG  GQQP RRPSAALSPEDLTESEWFYLMCI
Sbjct  62   SAEEASLHRSQQIKELYESLSSTAEESNGGDAGQQPPRRPSAALSPEDLTESEWFYLMCI  121

Query  519  SFSFPSAVGL  548
            SFSFPSA+GL
Sbjct  122  SFSFPSALGL  131



>gb|ABY26934.1| putative anthocyanin transcriptional regulator [Ipomoea lacunosa]
Length=669

 Score =   232 bits (591),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 117/133 (88%), Positives = 121/133 (91%), Gaps = 3/133 (2%)
 Frame = +3

Query  159  MAETPGGAAHLQTLLQTAVQSVHWTYSLFWNLCPHNGMLVWSDGYYNGAIKTRKTVQGTE  338
            MAE PGG   L++LLQTAVQSV WTYSLFW LCPHNGMLVWSDGYYNGAIKTRKTVQ TE
Sbjct  1    MAENPGGGGRLESLLQTAVQSVQWTYSLFWKLCPHNGMLVWSDGYYNGAIKTRKTVQWTE  60

Query  339  VSAEEASLHRSQQIKELYESLSATAEESN---GGGGQQPARRPSAALSPEDLTESEWFYL  509
            VS EEASLHRSQQIKELYESLS+TAEESN   GGGGQQP RRPSAALSPEDLTESEWFYL
Sbjct  61   VSTEEASLHRSQQIKELYESLSSTAEESNGGGGGGGQQPPRRPSAALSPEDLTESEWFYL  120

Query  510  MCISFSFPSAVGL  548
            MCISFSFPSA+GL
Sbjct  121  MCISFSFPSALGL  133



>gb|ABY26938.1| putative anthocyanin transcriptional regulator [Operculina pteripes]
Length=661

 Score =   223 bits (568),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 111/130 (85%), Positives = 116/130 (89%), Gaps = 2/130 (2%)
 Frame = +3

Query  159  MAETPGGAAHLQTLLQTAVQSVHWTYSLFWNLCPHNGMLVWSDGYYNGAIKTRKTVQGTE  338
            MAE PGG+  LQ+LLQTAVQS  WTYSLFW  CP  GMLVWSDGYYNGAIKTRKTVQGTE
Sbjct  1    MAENPGGSP-LQSLLQTAVQSAQWTYSLFWKPCPQKGMLVWSDGYYNGAIKTRKTVQGTE  59

Query  339  VSAEEASLHRSQQIKELYESLSATAEESNGGGGQQPARRPSAALSPEDLTESEWFYLMCI  518
            VSAEEASLHRSQQIK+LYESLSATAEES+  G QQP RRP+AALSPEDLTESEWFYLMCI
Sbjct  60   VSAEEASLHRSQQIKDLYESLSATAEESS-CGVQQPTRRPTAALSPEDLTESEWFYLMCI  118

Query  519  SFSFPSAVGL  548
            SFSFP AVGL
Sbjct  119  SFSFPLAVGL  128



>gb|ABY26933.1| putative anthocyanin transcriptional regulator [Ipomoea trifida]
Length=676

 Score =   213 bits (541),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 118/132 (89%), Positives = 122/132 (92%), Gaps = 3/132 (2%)
 Frame = +3

Query  159  MAETPGGAAHLQTLLQTAVQSVHWTYSLFWNLCPHNGMLVWSDGYYNGAIKTRKTVQGTE  338
            MAE PGG   L++LLQTAVQSV WTYSLFW LCP NGMLVWSDGYYNGAIKTRKTVQGTE
Sbjct  1    MAENPGGG-RLESLLQTAVQSVQWTYSLFWKLCPPNGMLVWSDGYYNGAIKTRKTVQGTE  59

Query  339  VSAEEASLHRSQQIKELYESLSATAEESN--GGGGQQPARRPSAALSPEDLTESEWFYLM  512
            VSAEEASLHRSQQIKELYESLS+TAEESN  GGGGQQP RRPSAALSPEDLTESEWFYLM
Sbjct  60   VSAEEASLHRSQQIKELYESLSSTAEESNGGGGGGQQPPRRPSAALSPEDLTESEWFYLM  119

Query  513  CISFSFPSAVGL  548
            CISFSFPSA+GL
Sbjct  120  CISFSFPSALGL  131



>ref|XP_008368857.1| PREDICTED: truncated basic helix-loop-helix protein A-like [Malus 
domestica]
Length=123

 Score =   186 bits (473),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 90/129 (70%), Positives = 102/129 (79%), Gaps = 6/129 (5%)
 Frame = +3

Query  159  MAETPGGAAHLQTLLQTAVQSVHWTYSLFWNLCPHNGMLVWSDGYYNGAIKTRKTVQGTE  338
            MA  P  ++ L+ +LQ +VQSV WTYSLFW +CP  G+LVWSDGYYNGAIKTRKTVQ  E
Sbjct  1    MALPPPSSSRLRGMLQASVQSVQWTYSLFWQICPQQGILVWSDGYYNGAIKTRKTVQPME  60

Query  339  VSAEEASLHRSQQIKELYESLSATAEESNGGGGQQPARRPSAALSPEDLTESEWFYLMCI  518
            VSAEEASL RSQQ++ELY+SLSA      G   Q PARRP A+LSPEDLTESEWFYLMC+
Sbjct  61   VSAEEASLQRSQQLRELYDSLSA------GETNQPPARRPCASLSPEDLTESEWFYLMCV  114

Query  519  SFSFPSAVG  545
            SFSFP  VG
Sbjct  115  SFSFPPGVG  123



>ref|XP_007200710.1| hypothetical protein PRUPE_ppa002884m1g, partial [Prunus persica]
 gb|EMJ01909.1| hypothetical protein PRUPE_ppa002884m1g, partial [Prunus persica]
Length=178

 Score =   187 bits (475),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 89/126 (71%), Positives = 102/126 (81%), Gaps = 6/126 (5%)
 Frame = +3

Query  171  PGGAAHLQTLLQTAVQSVHWTYSLFWNLCPHNGMLVWSDGYYNGAIKTRKTVQGTEVSAE  350
            P  ++ L+++LQ +VQSV WTYSLFW +CP  G+LVWSDGYYNGAIKTRKTVQ  EVSAE
Sbjct  4    PPSSSRLRSMLQASVQSVQWTYSLFWQICPQQGILVWSDGYYNGAIKTRKTVQPMEVSAE  63

Query  351  EASLHRSQQIKELYESLSATAEESNGGGGQQPARRPSAALSPEDLTESEWFYLMCISFSF  530
            EASL RSQQ++ELY+SLSA      G   Q PARRP A+LSPEDLTESEWFYLMC+SFSF
Sbjct  64   EASLQRSQQLRELYDSLSA------GETNQPPARRPCASLSPEDLTESEWFYLMCVSFSF  117

Query  531  PSAVGL  548
            P  VGL
Sbjct  118  PPGVGL  123



>gb|AFL02464.1| transcription factor bHLH3-delta [Fragaria x ananassa]
Length=355

 Score =   192 bits (487),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 90/130 (69%), Positives = 104/130 (80%), Gaps = 7/130 (5%)
 Frame = +3

Query  159  MAETPGGAAHLQTLLQTAVQSVHWTYSLFWNLCPHNGMLVWSDGYYNGAIKTRKTVQGTE  338
            MA  P  ++ L+ +LQ+AVQSV WTYSLFW +CP  GML+W+DGYYNGAIKTRKTVQ  E
Sbjct  1    MATPPPSSSRLRGMLQSAVQSVQWTYSLFWQICPQQGMLIWADGYYNGAIKTRKTVQPME  60

Query  339  VSAEEASLHRSQQIKELYESLSATAEESNGGGGQQPARRPSAALSPEDLTESEWFYLMCI  518
            VS+EEASL RSQQ++ELY++LSA       G   QPARRP AALSPEDLTESEWFYLMC+
Sbjct  61   VSSEEASLQRSQQLRELYDTLSA-------GETNQPARRPCAALSPEDLTESEWFYLMCV  113

Query  519  SFSFPSAVGL  548
            SFSFP  VGL
Sbjct  114  SFSFPPGVGL  123



>ref|NP_001289495.1| basic helix-loop-helix protein A [Nicotiana sylvestris]
 gb|AEE99259.1| anthocyanin 1-like protein [Nicotiana sylvestris]
Length=671

 Score =   197 bits (501),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 95/130 (73%), Positives = 103/130 (79%), Gaps = 8/130 (6%)
 Frame = +3

Query  159  MAETPGGAAHLQTLLQTAVQSVHWTYSLFWNLCPHNGMLVWSDGYYNGAIKTRKTVQGTE  338
            M E P  +  +QT+LQ AVQSV WTY+LFW LCP  G LVW DGYYNGAIKTRKTVQ  E
Sbjct  1    MTEIPPNS-QMQTMLQKAVQSVQWTYTLFWQLCPQQGALVWRDGYYNGAIKTRKTVQPME  59

Query  339  VSAEEASLHRSQQIKELYESLSATAEESNGGGGQQPARRPSAALSPEDLTESEWFYLMCI  518
            VSAEEASLHRSQQ++ELYESLSA       G   QPARRPSAALSPEDLTESEWFYLMC+
Sbjct  60   VSAEEASLHRSQQLRELYESLSA-------GESNQPARRPSAALSPEDLTESEWFYLMCV  112

Query  519  SFSFPSAVGL  548
            SFSFP  +GL
Sbjct  113  SFSFPPGIGL  122



>ref|XP_009803796.1| PREDICTED: basic helix-loop-helix protein A isoform X2 [Nicotiana 
sylvestris]
Length=666

 Score =   197 bits (500),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 95/130 (73%), Positives = 103/130 (79%), Gaps = 8/130 (6%)
 Frame = +3

Query  159  MAETPGGAAHLQTLLQTAVQSVHWTYSLFWNLCPHNGMLVWSDGYYNGAIKTRKTVQGTE  338
            M E P  +  +QT+LQ AVQSV WTY+LFW LCP  G LVW DGYYNGAIKTRKTVQ  E
Sbjct  1    MTEIPPNS-QMQTMLQKAVQSVQWTYTLFWQLCPQQGALVWRDGYYNGAIKTRKTVQPME  59

Query  339  VSAEEASLHRSQQIKELYESLSATAEESNGGGGQQPARRPSAALSPEDLTESEWFYLMCI  518
            VSAEEASLHRSQQ++ELYESLSA       G   QPARRPSAALSPEDLTESEWFYLMC+
Sbjct  60   VSAEEASLHRSQQLRELYESLSA-------GESNQPARRPSAALSPEDLTESEWFYLMCV  112

Query  519  SFSFPSAVGL  548
            SFSFP  +GL
Sbjct  113  SFSFPPGIGL  122



>gb|AAG25927.1|AF260918_1 anthocyanin 1 [Petunia x hybrida]
 gb|AAG25928.1|AF260919_1 anthocyanin 1 [Petunia x hybrida]
Length=668

 Score =   196 bits (498),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 92/121 (76%), Positives = 100/121 (83%), Gaps = 7/121 (6%)
 Frame = +3

Query  186  HLQTLLQTAVQSVHWTYSLFWNLCPHNGMLVWSDGYYNGAIKTRKTVQGTEVSAEEASLH  365
             LQT+L+ AVQSV WTYSLFW LCP  G+LVW DGYYNGAIKTRKTVQ  EVSAEEASLH
Sbjct  2    QLQTMLRNAVQSVQWTYSLFWQLCPQQGVLVWRDGYYNGAIKTRKTVQPMEVSAEEASLH  61

Query  366  RSQQIKELYESLSATAEESNGGGGQQPARRPSAALSPEDLTESEWFYLMCISFSFPSAVG  545
            RSQQ++ELYESLSA       G   QP RRPSAALSPEDLTESEWFYLMC+SFSFP+ +G
Sbjct  62   RSQQLRELYESLSA-------GESNQPTRRPSAALSPEDLTESEWFYLMCVSFSFPAGIG  114

Query  546  L  548
            L
Sbjct  115  L  115



>gb|AEE99257.1| anthocyanin 1a [Nicotiana tabacum]
Length=671

 Score =   196 bits (497),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 94/130 (72%), Positives = 103/130 (79%), Gaps = 8/130 (6%)
 Frame = +3

Query  159  MAETPGGAAHLQTLLQTAVQSVHWTYSLFWNLCPHNGMLVWSDGYYNGAIKTRKTVQGTE  338
            M E P  +  ++T+LQ AVQSV WTY+LFW LCP  G LVW DGYYNGAIKTRKTVQ  E
Sbjct  1    MTEIPPNS-QMKTMLQKAVQSVQWTYTLFWQLCPQQGALVWRDGYYNGAIKTRKTVQPME  59

Query  339  VSAEEASLHRSQQIKELYESLSATAEESNGGGGQQPARRPSAALSPEDLTESEWFYLMCI  518
            VSAEEASLHRSQQ++ELYESLSA       G   QPARRPSAALSPEDLTESEWFYLMC+
Sbjct  60   VSAEEASLHRSQQLRELYESLSA-------GESNQPARRPSAALSPEDLTESEWFYLMCV  112

Query  519  SFSFPSAVGL  548
            SFSFP  +GL
Sbjct  113  SFSFPPGIGL  122



>gb|KHN03790.1| Transcription factor TT8 [Glycine soja]
Length=120

 Score =   182 bits (461),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 89/119 (75%), Positives = 95/119 (80%), Gaps = 7/119 (6%)
 Frame = +3

Query  189  LQTLLQTAVQSVHWTYSLFWNLCPHNGMLVWSDGYYNGAIKTRKTVQGTEVSAEEASLHR  368
            LQ++LQ AVQSV WTYSLFW LCP  G+LVW DGYYNGAIKTRKTVQ  EVSAEEASL R
Sbjct  9    LQSMLQAAVQSVQWTYSLFWQLCPQQGILVWGDGYYNGAIKTRKTVQPMEVSAEEASLQR  68

Query  369  SQQIKELYESLSATAEESNGGGGQQPARRPSAALSPEDLTESEWFYLMCISFSFPSAVG  545
            SQQ++ELYESLSA       G    P RRP AALSPEDLTESEWFYLMC+SFSFP  VG
Sbjct  69   SQQLRELYESLSA-------GETNPPCRRPCAALSPEDLTESEWFYLMCVSFSFPPGVG  120



>ref|XP_006479738.1| PREDICTED: transcription factor TT8-like isoform X3 [Citrus sinensis]
Length=683

 Score =   195 bits (496),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 92/128 (72%), Positives = 103/128 (80%), Gaps = 7/128 (5%)
 Frame = +3

Query  165  ETPGGAAHLQTLLQTAVQSVHWTYSLFWNLCPHNGMLVWSDGYYNGAIKTRKTVQGTEVS  344
            + P  ++ LQ++LQ AVQSV WTYSLFW +CP  G+L+W DGYYNGAIKTRKTVQ  EVS
Sbjct  2    DAPPPSSRLQSILQEAVQSVQWTYSLFWQICPQQGILIWGDGYYNGAIKTRKTVQPMEVS  61

Query  345  AEEASLHRSQQIKELYESLSATAEESNGGGGQQPARRPSAALSPEDLTESEWFYLMCISF  524
            AEEASL RSQQ++ELYESLSA       G   QP RRPSAALSPEDLTESEWFYLMC+SF
Sbjct  62   AEEASLQRSQQLRELYESLSA-------GETNQPTRRPSAALSPEDLTESEWFYLMCVSF  114

Query  525  SFPSAVGL  548
            SFPS VGL
Sbjct  115  SFPSGVGL  122



>ref|XP_006479737.1| PREDICTED: transcription factor TT8-like isoform X2 [Citrus sinensis]
Length=689

 Score =   195 bits (496),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 92/128 (72%), Positives = 103/128 (80%), Gaps = 7/128 (5%)
 Frame = +3

Query  165  ETPGGAAHLQTLLQTAVQSVHWTYSLFWNLCPHNGMLVWSDGYYNGAIKTRKTVQGTEVS  344
            + P  ++ LQ++LQ AVQSV WTYSLFW +CP  G+L+W DGYYNGAIKTRKTVQ  EVS
Sbjct  2    DAPPPSSRLQSILQEAVQSVQWTYSLFWQICPQQGILIWGDGYYNGAIKTRKTVQPMEVS  61

Query  345  AEEASLHRSQQIKELYESLSATAEESNGGGGQQPARRPSAALSPEDLTESEWFYLMCISF  524
            AEEASL RSQQ++ELYESLSA       G   QP RRPSAALSPEDLTESEWFYLMC+SF
Sbjct  62   AEEASLQRSQQLRELYESLSA-------GETNQPTRRPSAALSPEDLTESEWFYLMCVSF  114

Query  525  SFPSAVGL  548
            SFPS VGL
Sbjct  115  SFPSGVGL  122



>ref|XP_006444091.1| hypothetical protein CICLE_v10019118mg [Citrus clementina]
 ref|XP_006444094.1| hypothetical protein CICLE_v10019118mg [Citrus clementina]
 gb|ESR57331.1| hypothetical protein CICLE_v10019118mg [Citrus clementina]
 gb|ESR57334.1| hypothetical protein CICLE_v10019118mg [Citrus clementina]
Length=692

 Score =   195 bits (496),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 92/128 (72%), Positives = 103/128 (80%), Gaps = 7/128 (5%)
 Frame = +3

Query  165  ETPGGAAHLQTLLQTAVQSVHWTYSLFWNLCPHNGMLVWSDGYYNGAIKTRKTVQGTEVS  344
            + P  ++ LQ++LQ AVQSV WTYSLFW +CP  G+L+W DGYYNGAIKTRKTVQ  EVS
Sbjct  2    DAPPPSSRLQSILQEAVQSVQWTYSLFWQICPQQGILIWGDGYYNGAIKTRKTVQPMEVS  61

Query  345  AEEASLHRSQQIKELYESLSATAEESNGGGGQQPARRPSAALSPEDLTESEWFYLMCISF  524
            AEEASL RSQQ++ELYESLSA       G   QP RRPSAALSPEDLTESEWFYLMC+SF
Sbjct  62   AEEASLQRSQQLRELYESLSA-------GETNQPTRRPSAALSPEDLTESEWFYLMCVSF  114

Query  525  SFPSAVGL  548
            SFPS VGL
Sbjct  115  SFPSGVGL  122



>ref|XP_006444093.1| hypothetical protein CICLE_v10019118mg [Citrus clementina]
 ref|XP_006479736.1| PREDICTED: transcription factor TT8-like isoform X1 [Citrus sinensis]
 gb|ESR57333.1| hypothetical protein CICLE_v10019118mg [Citrus clementina]
Length=694

 Score =   195 bits (496),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 92/128 (72%), Positives = 103/128 (80%), Gaps = 7/128 (5%)
 Frame = +3

Query  165  ETPGGAAHLQTLLQTAVQSVHWTYSLFWNLCPHNGMLVWSDGYYNGAIKTRKTVQGTEVS  344
            + P  ++ LQ++LQ AVQSV WTYSLFW +CP  G+L+W DGYYNGAIKTRKTVQ  EVS
Sbjct  2    DAPPPSSRLQSILQEAVQSVQWTYSLFWQICPQQGILIWGDGYYNGAIKTRKTVQPMEVS  61

Query  345  AEEASLHRSQQIKELYESLSATAEESNGGGGQQPARRPSAALSPEDLTESEWFYLMCISF  524
            AEEASL RSQQ++ELYESLSA       G   QP RRPSAALSPEDLTESEWFYLMC+SF
Sbjct  62   AEEASLQRSQQLRELYESLSA-------GETNQPTRRPSAALSPEDLTESEWFYLMCVSF  114

Query  525  SFPSAVGL  548
            SFPS VGL
Sbjct  115  SFPSGVGL  122



>gb|KDO68766.1| hypothetical protein CISIN_1g037798mg [Citrus sinensis]
Length=687

 Score =   195 bits (496),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 92/128 (72%), Positives = 103/128 (80%), Gaps = 7/128 (5%)
 Frame = +3

Query  165  ETPGGAAHLQTLLQTAVQSVHWTYSLFWNLCPHNGMLVWSDGYYNGAIKTRKTVQGTEVS  344
            + P  ++ LQ++LQ AVQSV WTYSLFW +CP  G+L+W DGYYNGAIKTRKTVQ  EVS
Sbjct  2    DAPPPSSRLQSILQEAVQSVQWTYSLFWQICPQQGILIWGDGYYNGAIKTRKTVQPMEVS  61

Query  345  AEEASLHRSQQIKELYESLSATAEESNGGGGQQPARRPSAALSPEDLTESEWFYLMCISF  524
            AEEASL RSQQ++ELYESLSA       G   QP RRPSAALSPEDLTESEWFYLMC+SF
Sbjct  62   AEEASLQRSQQLRELYESLSA-------GETNQPTRRPSAALSPEDLTESEWFYLMCVSF  114

Query  525  SFPSAVGL  548
            SFPS VGL
Sbjct  115  SFPSGVGL  122



>ref|XP_006444092.1| hypothetical protein CICLE_v10019118mg [Citrus clementina]
 gb|ESR57332.1| hypothetical protein CICLE_v10019118mg [Citrus clementina]
Length=687

 Score =   195 bits (496),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 92/128 (72%), Positives = 103/128 (80%), Gaps = 7/128 (5%)
 Frame = +3

Query  165  ETPGGAAHLQTLLQTAVQSVHWTYSLFWNLCPHNGMLVWSDGYYNGAIKTRKTVQGTEVS  344
            + P  ++ LQ++LQ AVQSV WTYSLFW +CP  G+L+W DGYYNGAIKTRKTVQ  EVS
Sbjct  2    DAPPPSSRLQSILQEAVQSVQWTYSLFWQICPQQGILIWGDGYYNGAIKTRKTVQPMEVS  61

Query  345  AEEASLHRSQQIKELYESLSATAEESNGGGGQQPARRPSAALSPEDLTESEWFYLMCISF  524
            AEEASL RSQQ++ELYESLSA       G   QP RRPSAALSPEDLTESEWFYLMC+SF
Sbjct  62   AEEASLQRSQQLRELYESLSA-------GETNQPTRRPSAALSPEDLTESEWFYLMCVSF  114

Query  525  SFPSAVGL  548
            SFPS VGL
Sbjct  115  SFPSGVGL  122



>ref|XP_009602367.1| PREDICTED: basic helix-loop-helix protein A isoform X4 [Nicotiana 
tomentosiformis]
Length=667

 Score =   194 bits (494),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 94/130 (72%), Positives = 103/130 (79%), Gaps = 8/130 (6%)
 Frame = +3

Query  159  MAETPGGAAHLQTLLQTAVQSVHWTYSLFWNLCPHNGMLVWSDGYYNGAIKTRKTVQGTE  338
            M E P  +  +QT+LQ AVQSV WTY+LFW LC   G+LVW DGYYNGAIKTRKTVQ  E
Sbjct  1    MTEIPPNS-QMQTMLQKAVQSVQWTYTLFWQLCSQQGVLVWRDGYYNGAIKTRKTVQPME  59

Query  339  VSAEEASLHRSQQIKELYESLSATAEESNGGGGQQPARRPSAALSPEDLTESEWFYLMCI  518
            VSAEEASLHRSQQ++ELYESLSA       G   QPARRPSAALSPEDLTESEWFYLMC+
Sbjct  60   VSAEEASLHRSQQLRELYESLSA-------GESNQPARRPSAALSPEDLTESEWFYLMCV  112

Query  519  SFSFPSAVGL  548
            SFSFP  +GL
Sbjct  113  SFSFPPGIGL  122



>ref|XP_009602346.1| PREDICTED: basic helix-loop-helix protein A isoform X1 [Nicotiana 
tomentosiformis]
Length=686

 Score =   195 bits (495),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 94/130 (72%), Positives = 103/130 (79%), Gaps = 8/130 (6%)
 Frame = +3

Query  159  MAETPGGAAHLQTLLQTAVQSVHWTYSLFWNLCPHNGMLVWSDGYYNGAIKTRKTVQGTE  338
            M E P  +  +QT+LQ AVQSV WTY+LFW LC   G+LVW DGYYNGAIKTRKTVQ  E
Sbjct  1    MTEIPPNS-QMQTMLQKAVQSVQWTYTLFWQLCSQQGVLVWRDGYYNGAIKTRKTVQPME  59

Query  339  VSAEEASLHRSQQIKELYESLSATAEESNGGGGQQPARRPSAALSPEDLTESEWFYLMCI  518
            VSAEEASLHRSQQ++ELYESLSA       G   QPARRPSAALSPEDLTESEWFYLMC+
Sbjct  60   VSAEEASLHRSQQLRELYESLSA-------GESNQPARRPSAALSPEDLTESEWFYLMCV  112

Query  519  SFSFPSAVGL  548
            SFSFP  +GL
Sbjct  113  SFSFPPGIGL  122



>ref|XP_009602360.1| PREDICTED: basic helix-loop-helix protein A isoform X3 [Nicotiana 
tomentosiformis]
Length=681

 Score =   194 bits (494),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 94/130 (72%), Positives = 103/130 (79%), Gaps = 8/130 (6%)
 Frame = +3

Query  159  MAETPGGAAHLQTLLQTAVQSVHWTYSLFWNLCPHNGMLVWSDGYYNGAIKTRKTVQGTE  338
            M E P  +  +QT+LQ AVQSV WTY+LFW LC   G+LVW DGYYNGAIKTRKTVQ  E
Sbjct  1    MTEIPPNS-QMQTMLQKAVQSVQWTYTLFWQLCSQQGVLVWRDGYYNGAIKTRKTVQPME  59

Query  339  VSAEEASLHRSQQIKELYESLSATAEESNGGGGQQPARRPSAALSPEDLTESEWFYLMCI  518
            VSAEEASLHRSQQ++ELYESLSA       G   QPARRPSAALSPEDLTESEWFYLMC+
Sbjct  60   VSAEEASLHRSQQLRELYESLSA-------GESNQPARRPSAALSPEDLTESEWFYLMCV  112

Query  519  SFSFPSAVGL  548
            SFSFP  +GL
Sbjct  113  SFSFPPGIGL  122



>gb|AEE99258.1| anthocyanin 1b [Nicotiana tabacum]
Length=683

 Score =   194 bits (494),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 94/130 (72%), Positives = 103/130 (79%), Gaps = 8/130 (6%)
 Frame = +3

Query  159  MAETPGGAAHLQTLLQTAVQSVHWTYSLFWNLCPHNGMLVWSDGYYNGAIKTRKTVQGTE  338
            M E P  +  +QT+LQ AVQSV WTY+LFW LC   G+LVW DGYYNGAIKTRKTVQ  E
Sbjct  1    MTEIPPNS-QMQTMLQKAVQSVQWTYTLFWQLCSQQGVLVWRDGYYNGAIKTRKTVQPME  59

Query  339  VSAEEASLHRSQQIKELYESLSATAEESNGGGGQQPARRPSAALSPEDLTESEWFYLMCI  518
            VSAEEASLHRSQQ++ELYESLSA       G   QPARRPSAALSPEDLTESEWFYLMC+
Sbjct  60   VSAEEASLHRSQQLRELYESLSA-------GESNQPARRPSAALSPEDLTESEWFYLMCV  112

Query  519  SFSFPSAVGL  548
            SFSFP  +GL
Sbjct  113  SFSFPPGIGL  122



>ref|NP_001289454.1| basic helix-loop-helix protein A [Nicotiana tomentosiformis]
 gb|AEE99260.1| anthocyanin 1-like protein [Nicotiana tomentosiformis]
Length=683

 Score =   194 bits (494),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 94/130 (72%), Positives = 103/130 (79%), Gaps = 8/130 (6%)
 Frame = +3

Query  159  MAETPGGAAHLQTLLQTAVQSVHWTYSLFWNLCPHNGMLVWSDGYYNGAIKTRKTVQGTE  338
            M E P  +  +QT+LQ AVQSV WTY+LFW LC   G+LVW DGYYNGAIKTRKTVQ  E
Sbjct  1    MTEIPPNS-QMQTMLQKAVQSVQWTYTLFWQLCSQQGVLVWRDGYYNGAIKTRKTVQPME  59

Query  339  VSAEEASLHRSQQIKELYESLSATAEESNGGGGQQPARRPSAALSPEDLTESEWFYLMCI  518
            VSAEEASLHRSQQ++ELYESLSA       G   QPARRPSAALSPEDLTESEWFYLMC+
Sbjct  60   VSAEEASLHRSQQLRELYESLSA-------GESNQPARRPSAALSPEDLTESEWFYLMCV  112

Query  519  SFSFPSAVGL  548
            SFSFP  +GL
Sbjct  113  SFSFPPGIGL  122



>gb|KHG29717.1| Transcription factor TT8 -like protein [Gossypium arboreum]
Length=660

 Score =   193 bits (491),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 92/130 (71%), Positives = 103/130 (79%), Gaps = 9/130 (7%)
 Frame = +3

Query  159  MAETPGGAAHLQTLLQTAVQSVHWTYSLFWNLCPHNGMLVWSDGYYNGAIKTRKTVQGTE  338
            MA  P  ++ LQ +LQ AVQSV WTYSLFW +CP  G+L+WSDGYYNGAIKTRKTVQ  E
Sbjct  1    MAAPP--SSRLQKMLQAAVQSVQWTYSLFWQICPQQGILIWSDGYYNGAIKTRKTVQPME  58

Query  339  VSAEEASLHRSQQIKELYESLSATAEESNGGGGQQPARRPSAALSPEDLTESEWFYLMCI  518
            VS EEASL RSQQ++ELY+SLS+       G   QPARRPSAALSPEDLTESEWFYLMC+
Sbjct  59   VSTEEASLQRSQQLRELYDSLSS-------GDTNQPARRPSAALSPEDLTESEWFYLMCV  111

Query  519  SFSFPSAVGL  548
            SFSFP  VGL
Sbjct  112  SFSFPPGVGL  121



>ref|XP_012092262.1| PREDICTED: basic helix-loop-helix protein A [Jatropha curcas]
 gb|KDP21472.1| hypothetical protein JCGZ_21943 [Jatropha curcas]
Length=696

 Score =   194 bits (492),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 94/130 (72%), Positives = 103/130 (79%), Gaps = 8/130 (6%)
 Frame = +3

Query  159  MAETPGGAAHLQTLLQTAVQSVHWTYSLFWNLCPHNGMLVWSDGYYNGAIKTRKTVQGTE  338
            MA TP  ++ LQ++LQ AVQSV WTYSLFW +CP  G+LVW DGYYNGAIKTRKTVQ  E
Sbjct  1    MAATPP-SSRLQSMLQAAVQSVQWTYSLFWQICPQQGILVWGDGYYNGAIKTRKTVQPME  59

Query  339  VSAEEASLHRSQQIKELYESLSATAEESNGGGGQQPARRPSAALSPEDLTESEWFYLMCI  518
            VSAEE SL RSQQ++ELYESLSA       G   QPARRP AALSPEDLTESEWFYLMC+
Sbjct  60   VSAEEVSLQRSQQLRELYESLSA-------GETNQPARRPCAALSPEDLTESEWFYLMCV  112

Query  519  SFSFPSAVGL  548
            SFSFP  VGL
Sbjct  113  SFSFPPGVGL  122



>ref|XP_007050639.1| BHLH-like DNA binding protein [Theobroma cacao]
 gb|EOX94796.1| BHLH-like DNA binding protein [Theobroma cacao]
Length=686

 Score =   194 bits (492),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 94/130 (72%), Positives = 103/130 (79%), Gaps = 9/130 (7%)
 Frame = +3

Query  159  MAETPGGAAHLQTLLQTAVQSVHWTYSLFWNLCPHNGMLVWSDGYYNGAIKTRKTVQGTE  338
            MA  P  ++ LQ +LQ AVQSV WTYSLFW +CP  G+L+WSDGYYNGAIKTRKTVQ  E
Sbjct  1    MAAPP--SSRLQNMLQEAVQSVQWTYSLFWQICPQQGILIWSDGYYNGAIKTRKTVQPME  58

Query  339  VSAEEASLHRSQQIKELYESLSATAEESNGGGGQQPARRPSAALSPEDLTESEWFYLMCI  518
            VSAEEASL RSQQ++ELYESLSA       G   QPARRP AALSPEDLTESEWFYLMC+
Sbjct  59   VSAEEASLQRSQQLRELYESLSA-------GETNQPARRPCAALSPEDLTESEWFYLMCV  111

Query  519  SFSFPSAVGL  548
            SFSFP  VGL
Sbjct  112  SFSFPPGVGL  121



>dbj|BAM36702.1| bHLH transcriptional factor AN1 homolog [Rosa hybrid cultivar]
Length=702

 Score =   193 bits (491),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 91/130 (70%), Positives = 104/130 (80%), Gaps = 7/130 (5%)
 Frame = +3

Query  159  MAETPGGAAHLQTLLQTAVQSVHWTYSLFWNLCPHNGMLVWSDGYYNGAIKTRKTVQGTE  338
            MA  P  ++ L+ +LQ+AVQSV WTYSLFW +CP  GML+W+DGYYNGAIKTRKTVQ  E
Sbjct  1    MATPPPSSSRLRGMLQSAVQSVQWTYSLFWQICPQQGMLIWADGYYNGAIKTRKTVQPME  60

Query  339  VSAEEASLHRSQQIKELYESLSATAEESNGGGGQQPARRPSAALSPEDLTESEWFYLMCI  518
            VS+EEASL RSQQ++ELY+SLSA       G   QPARRP AALSPEDLTESEWFYLMC+
Sbjct  61   VSSEEASLQRSQQLRELYDSLSA-------GETNQPARRPCAALSPEDLTESEWFYLMCV  113

Query  519  SFSFPSAVGL  548
            SFSFP  VGL
Sbjct  114  SFSFPPGVGL  123



>gb|KJB25921.1| hypothetical protein B456_004G215900 [Gossypium raimondii]
Length=680

 Score =   193 bits (491),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 92/130 (71%), Positives = 103/130 (79%), Gaps = 9/130 (7%)
 Frame = +3

Query  159  MAETPGGAAHLQTLLQTAVQSVHWTYSLFWNLCPHNGMLVWSDGYYNGAIKTRKTVQGTE  338
            MA  P  ++ LQ +LQ AVQSV WTYSLFW +CP  G+L+WSDGYYNGAIKTRKTVQ  E
Sbjct  1    MAAPP--SSRLQKMLQAAVQSVQWTYSLFWQICPQQGILIWSDGYYNGAIKTRKTVQPME  58

Query  339  VSAEEASLHRSQQIKELYESLSATAEESNGGGGQQPARRPSAALSPEDLTESEWFYLMCI  518
            VS EEASL RSQQ++ELY+SLS+       G   QPARRPSAALSPEDLTESEWFYLMC+
Sbjct  59   VSTEEASLQRSQQLRELYDSLSS-------GDTNQPARRPSAALSPEDLTESEWFYLMCV  111

Query  519  SFSFPSAVGL  548
            SFSFP  VGL
Sbjct  112  SFSFPPGVGL  121



>ref|XP_002520758.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF41720.1| conserved hypothetical protein [Ricinus communis]
Length=668

 Score =   193 bits (490),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 95/130 (73%), Positives = 103/130 (79%), Gaps = 9/130 (7%)
 Frame = +3

Query  159  MAETPGGAAHLQTLLQTAVQSVHWTYSLFWNLCPHNGMLVWSDGYYNGAIKTRKTVQGTE  338
            MA  P  ++ LQ +LQ AVQSV+WTYSLFW LCP  G+LVW DGYYNGAIKTRKTVQ  E
Sbjct  1    MAAPP--SSRLQNMLQAAVQSVNWTYSLFWQLCPQQGILVWGDGYYNGAIKTRKTVQPME  58

Query  339  VSAEEASLHRSQQIKELYESLSATAEESNGGGGQQPARRPSAALSPEDLTESEWFYLMCI  518
            VSAEEASL RSQQ++ELYESLSA       G   QPARRP AALSPEDLTESEWFYLMC+
Sbjct  59   VSAEEASLQRSQQLRELYESLSA-------GETNQPARRPCAALSPEDLTESEWFYLMCV  111

Query  519  SFSFPSAVGL  548
            SFSFP  VGL
Sbjct  112  SFSFPPGVGL  121



>gb|KJB25919.1| hypothetical protein B456_004G215900 [Gossypium raimondii]
Length=685

 Score =   193 bits (491),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 92/130 (71%), Positives = 103/130 (79%), Gaps = 9/130 (7%)
 Frame = +3

Query  159  MAETPGGAAHLQTLLQTAVQSVHWTYSLFWNLCPHNGMLVWSDGYYNGAIKTRKTVQGTE  338
            MA  P  ++ LQ +LQ AVQSV WTYSLFW +CP  G+L+WSDGYYNGAIKTRKTVQ  E
Sbjct  1    MAAPP--SSRLQKMLQAAVQSVQWTYSLFWQICPQQGILIWSDGYYNGAIKTRKTVQPME  58

Query  339  VSAEEASLHRSQQIKELYESLSATAEESNGGGGQQPARRPSAALSPEDLTESEWFYLMCI  518
            VS EEASL RSQQ++ELY+SLS+       G   QPARRPSAALSPEDLTESEWFYLMC+
Sbjct  59   VSTEEASLQRSQQLRELYDSLSS-------GDTNQPARRPSAALSPEDLTESEWFYLMCV  111

Query  519  SFSFPSAVGL  548
            SFSFP  VGL
Sbjct  112  SFSFPPGVGL  121



>gb|KJB25920.1| hypothetical protein B456_004G215900 [Gossypium raimondii]
Length=664

 Score =   193 bits (490),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 92/130 (71%), Positives = 103/130 (79%), Gaps = 9/130 (7%)
 Frame = +3

Query  159  MAETPGGAAHLQTLLQTAVQSVHWTYSLFWNLCPHNGMLVWSDGYYNGAIKTRKTVQGTE  338
            MA  P  ++ LQ +LQ AVQSV WTYSLFW +CP  G+L+WSDGYYNGAIKTRKTVQ  E
Sbjct  1    MAAPP--SSRLQKMLQAAVQSVQWTYSLFWQICPQQGILIWSDGYYNGAIKTRKTVQPME  58

Query  339  VSAEEASLHRSQQIKELYESLSATAEESNGGGGQQPARRPSAALSPEDLTESEWFYLMCI  518
            VS EEASL RSQQ++ELY+SLS+       G   QPARRPSAALSPEDLTESEWFYLMC+
Sbjct  59   VSTEEASLQRSQQLRELYDSLSS-------GDTNQPARRPSAALSPEDLTESEWFYLMCV  111

Query  519  SFSFPSAVGL  548
            SFSFP  VGL
Sbjct  112  SFSFPPGVGL  121



>emb|CBI32369.3| unnamed protein product [Vitis vinifera]
Length=620

 Score =   192 bits (487),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 94/130 (72%), Positives = 103/130 (79%), Gaps = 9/130 (7%)
 Frame = +3

Query  159  MAETPGGAAHLQTLLQTAVQSVHWTYSLFWNLCPHNGMLVWSDGYYNGAIKTRKTVQGTE  338
            MA  P   + LQ++LQ+AVQSV WTYSLFW +CP  G+LVW DGYYNGAIKTRKTVQ  E
Sbjct  1    MAAPPN--SRLQSMLQSAVQSVRWTYSLFWQICPQQGILVWGDGYYNGAIKTRKTVQPME  58

Query  339  VSAEEASLHRSQQIKELYESLSATAEESNGGGGQQPARRPSAALSPEDLTESEWFYLMCI  518
            VSAEEASL RSQQ++ELYESLSA       G   QPARRP AALSPEDLTESEWFYLMC+
Sbjct  59   VSAEEASLQRSQQLRELYESLSA-------GETNQPARRPCAALSPEDLTESEWFYLMCV  111

Query  519  SFSFPSAVGL  548
            SFSFP  VGL
Sbjct  112  SFSFPPGVGL  121



>ref|XP_004290663.1| PREDICTED: basic helix-loop-helix protein A isoform X1 [Fragaria 
vesca subsp. vesca]
Length=702

 Score =   192 bits (489),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 90/130 (69%), Positives = 104/130 (80%), Gaps = 7/130 (5%)
 Frame = +3

Query  159  MAETPGGAAHLQTLLQTAVQSVHWTYSLFWNLCPHNGMLVWSDGYYNGAIKTRKTVQGTE  338
            MA  P  ++ L+ +LQ+AVQSV WTYSLFW +CP  GML+W+DGYYNGAIKTRKTVQ  E
Sbjct  1    MATPPPSSSRLRGMLQSAVQSVQWTYSLFWQICPQQGMLIWADGYYNGAIKTRKTVQPME  60

Query  339  VSAEEASLHRSQQIKELYESLSATAEESNGGGGQQPARRPSAALSPEDLTESEWFYLMCI  518
            VS+EEASL RSQQ++ELY++LSA       G   QPARRP AALSPEDLTESEWFYLMC+
Sbjct  61   VSSEEASLQRSQQLRELYDTLSA-------GETNQPARRPCAALSPEDLTESEWFYLMCV  113

Query  519  SFSFPSAVGL  548
            SFSFP  VGL
Sbjct  114  SFSFPPGVGL  123



>emb|CAN62848.1| hypothetical protein VITISV_010152 [Vitis vinifera]
Length=668

 Score =   192 bits (487),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 94/130 (72%), Positives = 103/130 (79%), Gaps = 9/130 (7%)
 Frame = +3

Query  159  MAETPGGAAHLQTLLQTAVQSVHWTYSLFWNLCPHNGMLVWSDGYYNGAIKTRKTVQGTE  338
            MA  P   + LQ++LQ+AVQSV WTYSLFW +CP  G+LVW DGYYNGAIKTRKTVQ  E
Sbjct  1    MAAPPN--SRLQSMLQSAVQSVRWTYSLFWQICPQQGILVWGDGYYNGAIKTRKTVQPME  58

Query  339  VSAEEASLHRSQQIKELYESLSATAEESNGGGGQQPARRPSAALSPEDLTESEWFYLMCI  518
            VSAEEASL RSQQ++ELYESLSA       G   QPARRP AALSPEDLTESEWFYLMC+
Sbjct  59   VSAEEASLQRSQQLRELYESLSA-------GETNQPARRPCAALSPEDLTESEWFYLMCV  111

Query  519  SFSFPSAVGL  548
            SFSFP  VGL
Sbjct  112  SFSFPPGVGL  121



>gb|AJN91105.1| anthocyanin-related transcription factor TT8 [Solanum melongena]
Length=631

 Score =   191 bits (486),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 89/121 (74%), Positives = 99/121 (82%), Gaps = 7/121 (6%)
 Frame = +3

Query  186  HLQTLLQTAVQSVHWTYSLFWNLCPHNGMLVWSDGYYNGAIKTRKTVQGTEVSAEEASLH  365
             LQT+L+ +VQS+ WTYSLFW  CP  G+LVW DGYYNGAIKTRKTVQ  EV+AEEASLH
Sbjct  10   QLQTMLRDSVQSIKWTYSLFWQFCPKQGVLVWRDGYYNGAIKTRKTVQPIEVTAEEASLH  69

Query  366  RSQQIKELYESLSATAEESNGGGGQQPARRPSAALSPEDLTESEWFYLMCISFSFPSAVG  545
            RSQQ+KELYESLSA       G   QP+RRPSAALSPEDLTESEWFYLMC+SFSFP  +G
Sbjct  70   RSQQLKELYESLSA-------GDSNQPSRRPSAALSPEDLTESEWFYLMCVSFSFPPPIG  122

Query  546  L  548
            L
Sbjct  123  L  123



>ref|NP_001268182.1| uncharacterized protein LOC100251098 [Vitis vinifera]
 gb|ACC68685.1| bHLH-like DNA binding protein [Vitis vinifera]
Length=701

 Score =   192 bits (487),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 94/130 (72%), Positives = 103/130 (79%), Gaps = 9/130 (7%)
 Frame = +3

Query  159  MAETPGGAAHLQTLLQTAVQSVHWTYSLFWNLCPHNGMLVWSDGYYNGAIKTRKTVQGTE  338
            MA  P   + LQ++LQ+AVQSV WTYSLFW +CP  G+LVW DGYYNGAIKTRKTVQ  E
Sbjct  1    MAAPPN--SRLQSMLQSAVQSVRWTYSLFWQICPQQGILVWGDGYYNGAIKTRKTVQPME  58

Query  339  VSAEEASLHRSQQIKELYESLSATAEESNGGGGQQPARRPSAALSPEDLTESEWFYLMCI  518
            VSAEEASL RSQQ++ELYESLSA       G   QPARRP AALSPEDLTESEWFYLMC+
Sbjct  59   VSAEEASLQRSQQLRELYESLSA-------GETNQPARRPCAALSPEDLTESEWFYLMCV  111

Query  519  SFSFPSAVGL  548
            SFSFP  VGL
Sbjct  112  SFSFPPGVGL  121



>gb|KHG10778.1| Transcription factor TT8 -like protein [Gossypium arboreum]
Length=339

 Score =   185 bits (469),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 88/121 (73%), Positives = 96/121 (79%), Gaps = 7/121 (6%)
 Frame = +3

Query  186  HLQTLLQTAVQSVHWTYSLFWNLCPHNGMLVWSDGYYNGAIKTRKTVQGTEVSAEEASLH  365
             L+ +LQ AVQSV WTYSL W +CP  G+LVWSDGYYNGAIKTRKTVQ  EVSAEEASL 
Sbjct  8    RLRNMLQAAVQSVQWTYSLLWQICPQQGILVWSDGYYNGAIKTRKTVQPMEVSAEEASLQ  67

Query  366  RSQQIKELYESLSATAEESNGGGGQQPARRPSAALSPEDLTESEWFYLMCISFSFPSAVG  545
            RSQQ++ELY+SLSA       G   Q  RRPSAALSPEDLTESEWFYLMC+SFSFP  VG
Sbjct  68   RSQQLRELYDSLSA-------GESNQTVRRPSAALSPEDLTESEWFYLMCVSFSFPPGVG  120

Query  546  L  548
            L
Sbjct  121  L  121



>gb|AGO58372.1| basic helix-loop-helix protein [Morella rubra]
Length=709

 Score =   191 bits (485),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 94/130 (72%), Positives = 106/130 (82%), Gaps = 9/130 (7%)
 Frame = +3

Query  159  MAETPGGAAHLQTLLQTAVQSVHWTYSLFWNLCPHNGMLVWSDGYYNGAIKTRKTVQGTE  338
            MA  P  ++ LQ++LQ AVQSV WTYSLFW LCP  G+LVW+DGYYNGAIKTRKTVQ  E
Sbjct  1    MAAPP--SSQLQSMLQAAVQSVQWTYSLFWQLCPQQGILVWADGYYNGAIKTRKTVQPME  58

Query  339  VSAEEASLHRSQQIKELYESLSATAEESNGGGGQQPARRPSAALSPEDLTESEWFYLMCI  518
            VSAEEASL RSQQ++ELY+SLSA   E+N     QPARRP AALSPEDLTESEWFYLMC+
Sbjct  59   VSAEEASLQRSQQLRELYDSLSAA--ETN-----QPARRPCAALSPEDLTESEWFYLMCV  111

Query  519  SFSFPSAVGL  548
            SFSFP  VG+
Sbjct  112  SFSFPPGVGI  121



>ref|XP_007144626.1| hypothetical protein PHAVU_007G171300g [Phaseolus vulgaris]
 gb|ESW16620.1| hypothetical protein PHAVU_007G171300g [Phaseolus vulgaris]
Length=352

 Score =   184 bits (468),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 90/121 (74%), Positives = 96/121 (79%), Gaps = 7/121 (6%)
 Frame = +3

Query  186  HLQTLLQTAVQSVHWTYSLFWNLCPHNGMLVWSDGYYNGAIKTRKTVQGTEVSAEEASLH  365
             LQ++LQ AVQSVHWTYSLFW LCP   +LVW DGYYNGAIKTRKTVQ  EVSAEEASL 
Sbjct  8    RLQSMLQAAVQSVHWTYSLFWQLCPQQVILVWGDGYYNGAIKTRKTVQPMEVSAEEASLQ  67

Query  366  RSQQIKELYESLSATAEESNGGGGQQPARRPSAALSPEDLTESEWFYLMCISFSFPSAVG  545
            RSQQ++ELYESLSA       G    P RRP AALSPEDLTESEWFYLMC+SFSFP  VG
Sbjct  68   RSQQLRELYESLSA-------GETNPPTRRPCAALSPEDLTESEWFYLMCVSFSFPPGVG  120

Query  546  L  548
            L
Sbjct  121  L  121



>gb|AIU98516.1| bHLH transcription factor [Paeonia suffruticosa]
Length=691

 Score =   191 bits (484),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 91/126 (72%), Positives = 99/126 (79%), Gaps = 7/126 (6%)
 Frame = +3

Query  171  PGGAAHLQTLLQTAVQSVHWTYSLFWNLCPHNGMLVWSDGYYNGAIKTRKTVQGTEVSAE  350
            P   + LQ +LQ+AVQSV WTYSLFW LCP  G+LVW DGYYNGAIKTRKTVQ  EVS E
Sbjct  4    PPVNSRLQNMLQSAVQSVQWTYSLFWQLCPQQGILVWGDGYYNGAIKTRKTVQPMEVSTE  63

Query  351  EASLHRSQQIKELYESLSATAEESNGGGGQQPARRPSAALSPEDLTESEWFYLMCISFSF  530
            EASL RSQQ++ELY+SLSA       G   QPARRP AALSPEDLTESEWFYLMC+SFSF
Sbjct  64   EASLQRSQQLRELYDSLSA-------GETNQPARRPCAALSPEDLTESEWFYLMCVSFSF  116

Query  531  PSAVGL  548
            P  VGL
Sbjct  117  PPGVGL  122



>ref|XP_010090392.1| hypothetical protein L484_025057 [Morus notabilis]
 gb|EXB39362.1| hypothetical protein L484_025057 [Morus notabilis]
Length=698

 Score =   191 bits (484),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 93/132 (70%), Positives = 102/132 (77%), Gaps = 9/132 (7%)
 Frame = +3

Query  153  IVMAETPGGAAHLQTLLQTAVQSVHWTYSLFWNLCPHNGMLVWSDGYYNGAIKTRKTVQG  332
            + MA  P G  H  ++LQTAVQSV WTYSLFW +CP  G+LVWSDGYYNGAIKTRKTVQ 
Sbjct  15   VRMAALPSGRLH--SMLQTAVQSVQWTYSLFWQICPQKGILVWSDGYYNGAIKTRKTVQP  72

Query  333  TEVSAEEASLHRSQQIKELYESLSATAEESNGGGGQQPARRPSAALSPEDLTESEWFYLM  512
             EVS EEASL RSQQ++ELY+SLS        G   QPARRP AALSPEDLTESEWFYLM
Sbjct  73   MEVSTEEASLQRSQQLRELYDSLSI-------GETNQPARRPCAALSPEDLTESEWFYLM  125

Query  513  CISFSFPSAVGL  548
            C+SFSFP  VGL
Sbjct  126  CVSFSFPPGVGL  137



>ref|XP_011625677.1| PREDICTED: basic helix-loop-helix protein A [Amborella trichopoda]
Length=701

 Score =   190 bits (483),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 91/142 (64%), Positives = 106/142 (75%), Gaps = 10/142 (7%)
 Frame = +3

Query  132  TSSSAWSIVMAETPG---GAAHLQTLLQTAVQSVHWTYSLFWNLCPHNGMLVWSDGYYNG  302
            +S   WS+  AETP     AA LQ LLQ AVQSV WTYS+FW +CP  G+L+W DGYYNG
Sbjct  8    SSKPNWSMATAETPALSSAAAQLQRLLQLAVQSVQWTYSVFWQICPQQGVLIWGDGYYNG  67

Query  303  AIKTRKTVQGTEVSAEEASLHRSQQIKELYESLSATAEESNGGGGQQPARRPSAALSPED  482
            AIKTRKTVQ  EV+AEE  L RSQQ++ELY+SLSA       G   QP++RP AALSPED
Sbjct  68   AIKTRKTVQPMEVNAEEVCLQRSQQLRELYDSLSA-------GETNQPSKRPCAALSPED  120

Query  483  LTESEWFYLMCISFSFPSAVGL  548
            LTESEWFYLMCISF+FP  +G+
Sbjct  121  LTESEWFYLMCISFTFPLGIGI  142



>gb|ERN12312.1| hypothetical protein AMTR_s00025p00048410 [Amborella trichopoda]
Length=701

 Score =   190 bits (483),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 91/142 (64%), Positives = 106/142 (75%), Gaps = 10/142 (7%)
 Frame = +3

Query  132  TSSSAWSIVMAETPG---GAAHLQTLLQTAVQSVHWTYSLFWNLCPHNGMLVWSDGYYNG  302
            +S   WS+  AETP     AA LQ LLQ AVQSV WTYS+FW +CP  G+L+W DGYYNG
Sbjct  8    SSKPNWSMATAETPALSSAAAQLQRLLQLAVQSVQWTYSVFWQICPQQGVLIWGDGYYNG  67

Query  303  AIKTRKTVQGTEVSAEEASLHRSQQIKELYESLSATAEESNGGGGQQPARRPSAALSPED  482
            AIKTRKTVQ  EV+AEE  L RSQQ++ELY+SLSA       G   QP++RP AALSPED
Sbjct  68   AIKTRKTVQPMEVNAEEVCLQRSQQLRELYDSLSA-------GETNQPSKRPCAALSPED  120

Query  483  LTESEWFYLMCISFSFPSAVGL  548
            LTESEWFYLMCISF+FP  +G+
Sbjct  121  LTESEWFYLMCISFTFPLGIGI  142



>ref|XP_008235271.1| PREDICTED: basic helix-loop-helix protein A [Prunus mume]
Length=706

 Score =   190 bits (482),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 89/126 (71%), Positives = 102/126 (81%), Gaps = 6/126 (5%)
 Frame = +3

Query  171  PGGAAHLQTLLQTAVQSVHWTYSLFWNLCPHNGMLVWSDGYYNGAIKTRKTVQGTEVSAE  350
            P  ++ L+++LQ +VQSV WTYSLFW +CP  G+LVWSDGYYNGAIKTRKTVQ  EVSAE
Sbjct  4    PPSSSRLRSMLQASVQSVQWTYSLFWQICPQQGILVWSDGYYNGAIKTRKTVQPMEVSAE  63

Query  351  EASLHRSQQIKELYESLSATAEESNGGGGQQPARRPSAALSPEDLTESEWFYLMCISFSF  530
            EASL RSQQ++ELY+SLSA      G   Q PARRP A+LSPEDLTESEWFYLMC+SFSF
Sbjct  64   EASLQRSQQLRELYDSLSA------GETNQPPARRPCASLSPEDLTESEWFYLMCVSFSF  117

Query  531  PSAVGL  548
            P  VGL
Sbjct  118  PPGVGL  123



>gb|AIE57508.1| bHLH3 [Prunus persica]
Length=704

 Score =   190 bits (482),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 89/126 (71%), Positives = 102/126 (81%), Gaps = 6/126 (5%)
 Frame = +3

Query  171  PGGAAHLQTLLQTAVQSVHWTYSLFWNLCPHNGMLVWSDGYYNGAIKTRKTVQGTEVSAE  350
            P  ++ L+++LQ +VQSV WTYSLFW +CP  G+LVWSDGYYNGAIKTRKTVQ  EVSAE
Sbjct  4    PPSSSRLRSMLQASVQSVQWTYSLFWQICPQQGILVWSDGYYNGAIKTRKTVQPMEVSAE  63

Query  351  EASLHRSQQIKELYESLSATAEESNGGGGQQPARRPSAALSPEDLTESEWFYLMCISFSF  530
            EASL RSQQ++ELY+SLSA      G   Q PARRP A+LSPEDLTESEWFYLMC+SFSF
Sbjct  64   EASLQRSQQLRELYDSLSA------GETNQPPARRPCASLSPEDLTESEWFYLMCVSFSF  117

Query  531  PSAVGL  548
            P  VGL
Sbjct  118  PPGVGL  123



>ref|XP_006575075.1| PREDICTED: transcription factor TT8-like isoform X2 [Glycine 
max]
Length=350

 Score =   183 bits (465),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 89/120 (74%), Positives = 95/120 (79%), Gaps = 7/120 (6%)
 Frame = +3

Query  189  LQTLLQTAVQSVHWTYSLFWNLCPHNGMLVWSDGYYNGAIKTRKTVQGTEVSAEEASLHR  368
            LQ++LQ AVQSVHWTYSLFW LCP   +LVW DGYYNGAIKTRKTVQ  EVSAEEASL R
Sbjct  9    LQSMLQAAVQSVHWTYSLFWQLCPQQVILVWGDGYYNGAIKTRKTVQPMEVSAEEASLQR  68

Query  369  SQQIKELYESLSATAEESNGGGGQQPARRPSAALSPEDLTESEWFYLMCISFSFPSAVGL  548
            SQQ++ELYESLS        G    P RRP AALSPEDLTESEWFYLMC+SFSFP  VGL
Sbjct  69   SQQLRELYESLSV-------GETNPPTRRPCAALSPEDLTESEWFYLMCVSFSFPPGVGL  121



>gb|AGL81357.1| BHLH domain class transcription factor [Pyrus communis]
Length=709

 Score =   189 bits (479),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 90/130 (69%), Positives = 102/130 (78%), Gaps = 6/130 (5%)
 Frame = +3

Query  159  MAETPGGAAHLQTLLQTAVQSVHWTYSLFWNLCPHNGMLVWSDGYYNGAIKTRKTVQGTE  338
            MA  P  ++ L+ +LQ +VQ V WTYSLFW +CP  G+LVWSDGYYNGAIKTRKTVQ  E
Sbjct  1    MAAPPPSSSRLRGMLQASVQYVQWTYSLFWQICPQQGILVWSDGYYNGAIKTRKTVQPME  60

Query  339  VSAEEASLHRSQQIKELYESLSATAEESNGGGGQQPARRPSAALSPEDLTESEWFYLMCI  518
            VSAEEASL RSQQ++ELY+SLSA      G   Q PARRP A+LSPEDLTESEWFYLMC+
Sbjct  61   VSAEEASLQRSQQLRELYDSLSA------GETNQPPARRPCASLSPEDLTESEWFYLMCV  114

Query  519  SFSFPSAVGL  548
            SFSFP  VGL
Sbjct  115  SFSFPPGVGL  124



>ref|XP_009356769.1| PREDICTED: LOW QUALITY PROTEIN: basic helix-loop-helix protein 
A [Pyrus x bretschneideri]
Length=709

 Score =   189 bits (479),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 90/130 (69%), Positives = 102/130 (78%), Gaps = 6/130 (5%)
 Frame = +3

Query  159  MAETPGGAAHLQTLLQTAVQSVHWTYSLFWNLCPHNGMLVWSDGYYNGAIKTRKTVQGTE  338
            MA  P  ++ L+ +LQ +VQ V WTYSLFW +CP  G+LVWSDGYYNGAIKTRKTVQ  E
Sbjct  1    MAAPPPSSSRLRGMLQASVQYVQWTYSLFWQICPQQGILVWSDGYYNGAIKTRKTVQPME  60

Query  339  VSAEEASLHRSQQIKELYESLSATAEESNGGGGQQPARRPSAALSPEDLTESEWFYLMCI  518
            VSAEEASL RSQQ++ELY+SLSA      G   Q PARRP A+LSPEDLTESEWFYLMC+
Sbjct  61   VSAEEASLQRSQQLRELYDSLSA------GETNQPPARRPCASLSPEDLTESEWFYLMCV  114

Query  519  SFSFPSAVGL  548
            SFSFP  VGL
Sbjct  115  SFSFPPGVGL  124



>gb|AGC31677.1| basic helix loop helix [Solanum tuberosum]
Length=689

 Score =   188 bits (478),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 88/121 (73%), Positives = 97/121 (80%), Gaps = 7/121 (6%)
 Frame = +3

Query  186  HLQTLLQTAVQSVHWTYSLFWNLCPHNGMLVWSDGYYNGAIKTRKTVQGTEVSAEEASLH  365
             LQ +LQ +VQSV WTYSLFW  CP  G+LVW DGYYNGAIKTRKTVQ  EV+AEEASLH
Sbjct  10   QLQNMLQNSVQSVKWTYSLFWQFCPKQGVLVWRDGYYNGAIKTRKTVQPMEVTAEEASLH  69

Query  366  RSQQIKELYESLSATAEESNGGGGQQPARRPSAALSPEDLTESEWFYLMCISFSFPSAVG  545
            RSQQ++ELY+SLSA       G    PARRPSAALSPEDLTESEWFYLMC+SFSFP  +G
Sbjct  70   RSQQLRELYDSLSA-------GDSNPPARRPSAALSPEDLTESEWFYLMCVSFSFPPPIG  122

Query  546  L  548
            L
Sbjct  123  L  123



>sp|E3SXU5.1|BHLHM_PEA RecName: Full=Truncated basic helix-loop-helix protein A [Pisum 
sativum]
 gb|ADO13283.1| truncated bHLH [Pisum sativum]
Length=358

 Score =   182 bits (462),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 91/132 (69%), Positives = 99/132 (75%), Gaps = 8/132 (6%)
 Frame = +3

Query  156  VMAETP-GGAAHLQTLLQTAVQSVHWTYSLFWNLCPHNGMLVWSDGYYNGAIKTRKTVQG  332
            + A TP  G   LQ +LQ AVQSV WTYSLFW +CP   +LVW DGYYNGAIKTRKTVQ 
Sbjct  1    MTAPTPENGCNKLQNMLQAAVQSVQWTYSLFWQICPQQLILVWGDGYYNGAIKTRKTVQP  60

Query  333  TEVSAEEASLHRSQQIKELYESLSATAEESNGGGGQQPARRPSAALSPEDLTESEWFYLM  512
             EVSAEEASL RSQQ++ELYESLSA       G    P RRP A+LSPEDLTESEWFYLM
Sbjct  61   MEVSAEEASLQRSQQLRELYESLSA-------GETNPPTRRPCASLSPEDLTESEWFYLM  113

Query  513  CISFSFPSAVGL  548
            C+SFSFP  VGL
Sbjct  114  CVSFSFPPGVGL  125



>ref|XP_010326368.1| PREDICTED: basic helix-loop-helix protein A [Solanum lycopersicum]
Length=660

 Score =   187 bits (476),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 87/121 (72%), Positives = 97/121 (80%), Gaps = 7/121 (6%)
 Frame = +3

Query  186  HLQTLLQTAVQSVHWTYSLFWNLCPHNGMLVWSDGYYNGAIKTRKTVQGTEVSAEEASLH  365
             LQ +LQ +VQSV WTYS+FW  CP  G+LVW DGYYNGAIKTRKTVQ  EV+AEEASLH
Sbjct  11   QLQNMLQNSVQSVKWTYSIFWQFCPKQGVLVWRDGYYNGAIKTRKTVQPMEVTAEEASLH  70

Query  366  RSQQIKELYESLSATAEESNGGGGQQPARRPSAALSPEDLTESEWFYLMCISFSFPSAVG  545
            RSQQ++ELY+SLSA       G    PARRPSAALSPEDLTESEWFYLMC+SFSFP  +G
Sbjct  71   RSQQLRELYDSLSA-------GDSNPPARRPSAALSPEDLTESEWFYLMCVSFSFPPPIG  123

Query  546  L  548
            L
Sbjct  124  L  124



>gb|ADL36597.1| BHLH domain class transcription factor [Malus domestica]
Length=709

 Score =   187 bits (476),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 89/130 (68%), Positives = 102/130 (78%), Gaps = 6/130 (5%)
 Frame = +3

Query  159  MAETPGGAAHLQTLLQTAVQSVHWTYSLFWNLCPHNGMLVWSDGYYNGAIKTRKTVQGTE  338
            MA  P  ++ L+ +LQ +VQ V WTYSLFW +CP  G+LVWSDGYYNGAIKTRKTVQ  E
Sbjct  1    MAAPPPSSSRLRGMLQASVQYVQWTYSLFWQICPQQGILVWSDGYYNGAIKTRKTVQPME  60

Query  339  VSAEEASLHRSQQIKELYESLSATAEESNGGGGQQPARRPSAALSPEDLTESEWFYLMCI  518
            VSA+EASL RSQQ++ELY+SLSA      G   Q PARRP A+LSPEDLTESEWFYLMC+
Sbjct  61   VSADEASLQRSQQLRELYDSLSA------GETNQPPARRPCASLSPEDLTESEWFYLMCV  114

Query  519  SFSFPSAVGL  548
            SFSFP  VGL
Sbjct  115  SFSFPPGVGL  124



>ref|XP_006588626.1| PREDICTED: transcription factor TT8-like [Glycine max]
Length=664

 Score =   187 bits (475),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 90/120 (75%), Positives = 96/120 (80%), Gaps = 7/120 (6%)
 Frame = +3

Query  189  LQTLLQTAVQSVHWTYSLFWNLCPHNGMLVWSDGYYNGAIKTRKTVQGTEVSAEEASLHR  368
            LQ++LQ AVQSV WTYSLFW LCP  G+LVW DGYYNGAIKTRKTVQ  EVSAEEASL R
Sbjct  9    LQSMLQAAVQSVQWTYSLFWQLCPQQGILVWGDGYYNGAIKTRKTVQPMEVSAEEASLQR  68

Query  369  SQQIKELYESLSATAEESNGGGGQQPARRPSAALSPEDLTESEWFYLMCISFSFPSAVGL  548
            SQQ++ELYESLSA       G    P RRP AALSPEDLTESEWFYLMC+SFSFP  VGL
Sbjct  69   SQQLRELYESLSA-------GETNPPCRRPCAALSPEDLTESEWFYLMCVSFSFPPGVGL  121



>ref|NP_001280978.1| basic helix-loop-helix protein A [Malus domestica]
 gb|AEI84807.1| bHLH transcription factor [Malus domestica]
Length=709

 Score =   187 bits (476),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 89/130 (68%), Positives = 102/130 (78%), Gaps = 6/130 (5%)
 Frame = +3

Query  159  MAETPGGAAHLQTLLQTAVQSVHWTYSLFWNLCPHNGMLVWSDGYYNGAIKTRKTVQGTE  338
            MA  P  ++ L+ +LQ +VQ V WTYSLFW +CP  G+LVWSDGYYNGAIKTRKTVQ  E
Sbjct  1    MAAPPPSSSRLRGMLQASVQYVQWTYSLFWQICPQQGILVWSDGYYNGAIKTRKTVQPME  60

Query  339  VSAEEASLHRSQQIKELYESLSATAEESNGGGGQQPARRPSAALSPEDLTESEWFYLMCI  518
            VSA+EASL RSQQ++ELY+SLSA      G   Q PARRP A+LSPEDLTESEWFYLMC+
Sbjct  61   VSADEASLQRSQQLRELYDSLSA------GETNQPPARRPCASLSPEDLTESEWFYLMCV  114

Query  519  SFSFPSAVGL  548
            SFSFP  VGL
Sbjct  115  SFSFPPGVGL  124



>gb|AHM88207.1| bHLH3 protein [Malus hybrid cultivar]
Length=709

 Score =   187 bits (476),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 89/130 (68%), Positives = 102/130 (78%), Gaps = 6/130 (5%)
 Frame = +3

Query  159  MAETPGGAAHLQTLLQTAVQSVHWTYSLFWNLCPHNGMLVWSDGYYNGAIKTRKTVQGTE  338
            MA  P  ++ L+ +LQ +VQ V WTYSLFW +CP  G+LVWSDGYYNGAIKTRKTVQ  E
Sbjct  1    MAAPPPSSSRLRGMLQASVQYVQWTYSLFWQICPQQGILVWSDGYYNGAIKTRKTVQPME  60

Query  339  VSAEEASLHRSQQIKELYESLSATAEESNGGGGQQPARRPSAALSPEDLTESEWFYLMCI  518
            VSA+EASL RSQQ++ELY+SLSA      G   Q PARRP A+LSPEDLTESEWFYLMC+
Sbjct  61   VSADEASLQRSQQLRELYDSLSA------GETNQPPARRPCASLSPEDLTESEWFYLMCV  114

Query  519  SFSFPSAVGL  548
            SFSFP  VGL
Sbjct  115  SFSFPPGVGL  124



>ref|XP_010255921.1| PREDICTED: basic helix-loop-helix protein A-like isoform X1 [Nelumbo 
nucifera]
 ref|XP_010255923.1| PREDICTED: basic helix-loop-helix protein A-like isoform X1 [Nelumbo 
nucifera]
Length=707

 Score =   187 bits (474),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 90/127 (71%), Positives = 99/127 (78%), Gaps = 7/127 (6%)
 Frame = +3

Query  168  TPGGAAHLQTLLQTAVQSVHWTYSLFWNLCPHNGMLVWSDGYYNGAIKTRKTVQGTEVSA  347
            T  G+  LQ +LQ+AVQSV WTYSLFW +CP  G+LVW DGYYNG IKTRKTVQ  EVSA
Sbjct  2    TTPGSNRLQQMLQSAVQSVQWTYSLFWKICPQQGILVWGDGYYNGPIKTRKTVQPMEVSA  61

Query  348  EEASLHRSQQIKELYESLSATAEESNGGGGQQPARRPSAALSPEDLTESEWFYLMCISFS  527
            EEASL RSQQ++ELYESLSA       G   QPARRP AALSPEDLTE+EWFYLMC+SFS
Sbjct  62   EEASLQRSQQLRELYESLSA-------GETNQPARRPCAALSPEDLTETEWFYLMCVSFS  114

Query  528  FPSAVGL  548
            F   VGL
Sbjct  115  FSPGVGL  121



>ref|XP_006383662.1| hypothetical protein POPTR_0005s23010g, partial [Populus trichocarpa]
 gb|ERP61459.1| hypothetical protein POPTR_0005s23010g, partial [Populus trichocarpa]
Length=359

 Score =   181 bits (458),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 88/130 (68%), Positives = 99/130 (76%), Gaps = 9/130 (7%)
 Frame = +3

Query  159  MAETPGGAAHLQTLLQTAVQSVHWTYSLFWNLCPHNGMLVWSDGYYNGAIKTRKTVQGTE  338
            MA  P  ++ LQT+LQ AVQSV WTYSLFW +CP  G+LVW DGYYNG IKTRKTVQ  E
Sbjct  1    MATPP--SSRLQTMLQAAVQSVQWTYSLFWQMCPQQGILVWGDGYYNGPIKTRKTVQPME  58

Query  339  VSAEEASLHRSQQIKELYESLSATAEESNGGGGQQPARRPSAALSPEDLTESEWFYLMCI  518
            V+ EEASL RSQQ++ELY+SLS        G   QPARRP AALSPEDLTE+EWFYLMC+
Sbjct  59   VTTEEASLQRSQQLRELYDSLSI-------GETNQPARRPCAALSPEDLTETEWFYLMCV  111

Query  519  SFSFPSAVGL  548
            SFSFP   GL
Sbjct  112  SFSFPPGGGL  121



>gb|KJB42088.1| hypothetical protein B456_007G136400 [Gossypium raimondii]
Length=661

 Score =   186 bits (472),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 87/121 (72%), Positives = 97/121 (80%), Gaps = 7/121 (6%)
 Frame = +3

Query  186  HLQTLLQTAVQSVHWTYSLFWNLCPHNGMLVWSDGYYNGAIKTRKTVQGTEVSAEEASLH  365
             L+ +LQ AVQSV WTYSLFW +CP  G+LVWSDGYYNGAIKTRKT+Q  EVSAEEA+L 
Sbjct  8    RLRNMLQAAVQSVQWTYSLFWQICPQQGILVWSDGYYNGAIKTRKTLQPMEVSAEEAALQ  67

Query  366  RSQQIKELYESLSATAEESNGGGGQQPARRPSAALSPEDLTESEWFYLMCISFSFPSAVG  545
            RSQQ++ELY+SLSA       G   Q  RRPSAALSPEDLTESEWFYLMC+SFSFP  VG
Sbjct  68   RSQQLRELYDSLSA-------GESNQTVRRPSAALSPEDLTESEWFYLMCVSFSFPPGVG  120

Query  546  L  548
            L
Sbjct  121  L  121



>gb|AIF70439.1| basic helix-loop-helix transcription factor [Populus tremula 
x Populus tremuloides]
Length=534

 Score =   184 bits (467),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 89/130 (68%), Positives = 100/130 (77%), Gaps = 9/130 (7%)
 Frame = +3

Query  159  MAETPGGAAHLQTLLQTAVQSVHWTYSLFWNLCPHNGMLVWSDGYYNGAIKTRKTVQGTE  338
            MA  P  ++ LQT+LQ AVQSV WTYSLFW +CP  G+LVW DGYYNG IKTRKTVQ  E
Sbjct  1    MATPP--SSRLQTMLQAAVQSVQWTYSLFWQMCPQQGILVWGDGYYNGPIKTRKTVQPME  58

Query  339  VSAEEASLHRSQQIKELYESLSATAEESNGGGGQQPARRPSAALSPEDLTESEWFYLMCI  518
            V+ EEASL RSQQ++ELY+SLS        G   QPARRP AALSPEDLTE+EWFYLMC+
Sbjct  59   VTTEEASLQRSQQLRELYDSLSI-------GETNQPARRPCAALSPEDLTETEWFYLMCV  111

Query  519  SFSFPSAVGL  548
            SFSFP  VGL
Sbjct  112  SFSFPPGVGL  121



>ref|XP_010070223.1| PREDICTED: basic helix-loop-helix protein A [Eucalyptus grandis]
 gb|KCW58859.1| hypothetical protein EUGRSUZ_H01487 [Eucalyptus grandis]
Length=682

 Score =   186 bits (471),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 88/130 (68%), Positives = 102/130 (78%), Gaps = 9/130 (7%)
 Frame = +3

Query  159  MAETPGGAAHLQTLLQTAVQSVHWTYSLFWNLCPHNGMLVWSDGYYNGAIKTRKTVQGTE  338
            MA  P  ++ LQ++LQ+AVQS+ W+YSLFW +CP  G+L+W DGYYNG IKTRKTVQ  E
Sbjct  1    MATPP--SSRLQSMLQSAVQSIKWSYSLFWQICPQQGILIWGDGYYNGPIKTRKTVQPME  58

Query  339  VSAEEASLHRSQQIKELYESLSATAEESNGGGGQQPARRPSAALSPEDLTESEWFYLMCI  518
            VSAEEASL RSQQ++ELYESLSA       G   QPARRP AALSPEDLTE+EWFYLMC+
Sbjct  59   VSAEEASLQRSQQLRELYESLSA-------GETNQPARRPCAALSPEDLTETEWFYLMCV  111

Query  519  SFSFPSAVGL  548
            SFSFP   GL
Sbjct  112  SFSFPPGAGL  121



>ref|XP_006575074.1| PREDICTED: transcription factor TT8-like isoform X1 [Glycine 
max]
Length=653

 Score =   185 bits (470),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 89/120 (74%), Positives = 95/120 (79%), Gaps = 7/120 (6%)
 Frame = +3

Query  189  LQTLLQTAVQSVHWTYSLFWNLCPHNGMLVWSDGYYNGAIKTRKTVQGTEVSAEEASLHR  368
            LQ++LQ AVQSVHWTYSLFW LCP   +LVW DGYYNGAIKTRKTVQ  EVSAEEASL R
Sbjct  9    LQSMLQAAVQSVHWTYSLFWQLCPQQVILVWGDGYYNGAIKTRKTVQPMEVSAEEASLQR  68

Query  369  SQQIKELYESLSATAEESNGGGGQQPARRPSAALSPEDLTESEWFYLMCISFSFPSAVGL  548
            SQQ++ELYESLS        G    P RRP AALSPEDLTESEWFYLMC+SFSFP  VGL
Sbjct  69   SQQLRELYESLSV-------GETNPPTRRPCAALSPEDLTESEWFYLMCVSFSFPPGVGL  121



>gb|AJB28482.1| bHLH3 [Prunus avium]
Length=703

 Score =   186 bits (471),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 88/126 (70%), Positives = 101/126 (80%), Gaps = 6/126 (5%)
 Frame = +3

Query  171  PGGAAHLQTLLQTAVQSVHWTYSLFWNLCPHNGMLVWSDGYYNGAIKTRKTVQGTEVSAE  350
            P  ++ L+++LQ +VQSV WTYSLFW +CP  G+LVWSDGYYNGAIKTRKTVQ  EVSAE
Sbjct  4    PPSSSRLRSMLQASVQSVQWTYSLFWQICPQQGILVWSDGYYNGAIKTRKTVQPMEVSAE  63

Query  351  EASLHRSQQIKELYESLSATAEESNGGGGQQPARRPSAALSPEDLTESEWFYLMCISFSF  530
            EASL RSQQ++ELY+SLSA      G   Q PARRP A+LSPEDLTESEWFYLMC+SFSF
Sbjct  64   EASLQRSQQLRELYDSLSA------GETNQPPARRPCASLSPEDLTESEWFYLMCVSFSF  117

Query  531  PSAVGL  548
               VGL
Sbjct  118  HPGVGL  123



>gb|AJB28481.1| bHLH3 [Prunus avium]
Length=705

 Score =   186 bits (471),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 88/126 (70%), Positives = 101/126 (80%), Gaps = 6/126 (5%)
 Frame = +3

Query  171  PGGAAHLQTLLQTAVQSVHWTYSLFWNLCPHNGMLVWSDGYYNGAIKTRKTVQGTEVSAE  350
            P  ++ L+++LQ +VQSV WTYSLFW +CP  G+LVWSDGYYNGAIKTRKTVQ  EVSAE
Sbjct  4    PPSSSRLRSMLQASVQSVQWTYSLFWQICPQQGILVWSDGYYNGAIKTRKTVQPMEVSAE  63

Query  351  EASLHRSQQIKELYESLSATAEESNGGGGQQPARRPSAALSPEDLTESEWFYLMCISFSF  530
            EASL RSQQ++ELY+SLSA      G   Q PARRP A+LSPEDLTESEWFYLMC+SFSF
Sbjct  64   EASLQRSQQLRELYDSLSA------GETNQPPARRPCASLSPEDLTESEWFYLMCVSFSF  117

Query  531  PSAVGL  548
               VGL
Sbjct  118  HPGVGL  123



>gb|AIT76559.1| bHLH protein [Trifolium repens]
Length=657

 Score =   185 bits (469),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 91/134 (68%), Positives = 101/134 (75%), Gaps = 10/134 (7%)
 Frame = +3

Query  156  VMAETP---GGAAHLQTLLQTAVQSVHWTYSLFWNLCPHNGMLVWSDGYYNGAIKTRKTV  326
            +MA  P   G ++ LQ +LQ AVQSV WTYSLFW LCP   +LVW+DGYYNGAIKTRKTV
Sbjct  4    IMASQPPIIGSSSKLQNMLQAAVQSVQWTYSLFWQLCPQQMILVWADGYYNGAIKTRKTV  63

Query  327  QGTEVSAEEASLHRSQQIKELYESLSATAEESNGGGGQQPARRPSAALSPEDLTESEWFY  506
            Q  EVSAEEASL RS Q++ELYESLSA       G    P RRP A+LSPEDLTESEWFY
Sbjct  64   QPMEVSAEEASLQRSHQLRELYESLSA-------GETNPPTRRPCASLSPEDLTESEWFY  116

Query  507  LMCISFSFPSAVGL  548
            LMC+SFSFP  VGL
Sbjct  117  LMCVSFSFPPGVGL  130



>ref|XP_011032729.1| PREDICTED: basic helix-loop-helix protein A isoform X1 [Populus 
euphratica]
 ref|XP_011032730.1| PREDICTED: basic helix-loop-helix protein A isoform X1 [Populus 
euphratica]
Length=692

 Score =   185 bits (470),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 88/130 (68%), Positives = 100/130 (77%), Gaps = 9/130 (7%)
 Frame = +3

Query  159  MAETPGGAAHLQTLLQTAVQSVHWTYSLFWNLCPHNGMLVWSDGYYNGAIKTRKTVQGTE  338
            MA  P  ++ LQT+LQ AVQS+ WTYSLFW +CP  G+LVW DGYYNG IKTRKTVQ  E
Sbjct  1    MATPP--SSRLQTMLQAAVQSIQWTYSLFWQMCPQQGILVWGDGYYNGPIKTRKTVQPME  58

Query  339  VSAEEASLHRSQQIKELYESLSATAEESNGGGGQQPARRPSAALSPEDLTESEWFYLMCI  518
            V+ EEASL RSQQ++ELY+SLS        G   QPARRP AALSPEDLTE+EWFYLMC+
Sbjct  59   VTTEEASLQRSQQLRELYDSLSI-------GETNQPARRPCAALSPEDLTETEWFYLMCV  111

Query  519  SFSFPSAVGL  548
            SFSFP  VGL
Sbjct  112  SFSFPPGVGL  121



>gb|KCW58860.1| hypothetical protein EUGRSUZ_H01487 [Eucalyptus grandis]
Length=672

 Score =   185 bits (469),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 88/130 (68%), Positives = 102/130 (78%), Gaps = 9/130 (7%)
 Frame = +3

Query  159  MAETPGGAAHLQTLLQTAVQSVHWTYSLFWNLCPHNGMLVWSDGYYNGAIKTRKTVQGTE  338
            MA  P  ++ LQ++LQ+AVQS+ W+YSLFW +CP  G+L+W DGYYNG IKTRKTVQ  E
Sbjct  1    MATPP--SSRLQSMLQSAVQSIKWSYSLFWQICPQQGILIWGDGYYNGPIKTRKTVQPME  58

Query  339  VSAEEASLHRSQQIKELYESLSATAEESNGGGGQQPARRPSAALSPEDLTESEWFYLMCI  518
            VSAEEASL RSQQ++ELYESLSA       G   QPARRP AALSPEDLTE+EWFYLMC+
Sbjct  59   VSAEEASLQRSQQLRELYESLSA-------GETNQPARRPCAALSPEDLTETEWFYLMCV  111

Query  519  SFSFPSAVGL  548
            SFSFP   GL
Sbjct  112  SFSFPPGAGL  121



>ref|XP_011032731.1| PREDICTED: basic helix-loop-helix protein A isoform X2 [Populus 
euphratica]
Length=688

 Score =   185 bits (469),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 88/130 (68%), Positives = 100/130 (77%), Gaps = 9/130 (7%)
 Frame = +3

Query  159  MAETPGGAAHLQTLLQTAVQSVHWTYSLFWNLCPHNGMLVWSDGYYNGAIKTRKTVQGTE  338
            MA  P  ++ LQT+LQ AVQS+ WTYSLFW +CP  G+LVW DGYYNG IKTRKTVQ  E
Sbjct  1    MATPP--SSRLQTMLQAAVQSIQWTYSLFWQMCPQQGILVWGDGYYNGPIKTRKTVQPME  58

Query  339  VSAEEASLHRSQQIKELYESLSATAEESNGGGGQQPARRPSAALSPEDLTESEWFYLMCI  518
            V+ EEASL RSQQ++ELY+SLS        G   QPARRP AALSPEDLTE+EWFYLMC+
Sbjct  59   VTTEEASLQRSQQLRELYDSLSI-------GETNQPARRPCAALSPEDLTETEWFYLMCV  111

Query  519  SFSFPSAVGL  548
            SFSFP  VGL
Sbjct  112  SFSFPPGVGL  121



>ref|XP_008790988.1| PREDICTED: basic helix-loop-helix protein A isoform X2 [Phoenix 
dactylifera]
Length=698

 Score =   185 bits (470),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 90/123 (73%), Positives = 96/123 (78%), Gaps = 7/123 (6%)
 Frame = +3

Query  180  AAHLQTLLQTAVQSVHWTYSLFWNLCPHNGMLVWSDGYYNGAIKTRKTVQGTEVSAEEAS  359
            ++ LQ  LQ  VQSV WTYSLFW LCP  G+LVW +GYYNGAIKTRKTVQ  EVS EEAS
Sbjct  6    SSKLQETLQLVVQSVGWTYSLFWQLCPQQGILVWGEGYYNGAIKTRKTVQPVEVSTEEAS  65

Query  360  LHRSQQIKELYESLSATAEESNGGGGQQPARRPSAALSPEDLTESEWFYLMCISFSFPSA  539
            L RSQQ++ELYESLSA       G   QPARRP AALSPEDLTESEWFYLMCISFSFP  
Sbjct  66   LQRSQQLRELYESLSA-------GEANQPARRPCAALSPEDLTESEWFYLMCISFSFPPG  118

Query  540  VGL  548
            VGL
Sbjct  119  VGL  121



>ref|XP_010906881.1| PREDICTED: basic helix-loop-helix protein A isoform X1 [Elaeis 
guineensis]
Length=695

 Score =   185 bits (469),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 89/123 (72%), Positives = 95/123 (77%), Gaps = 7/123 (6%)
 Frame = +3

Query  180  AAHLQTLLQTAVQSVHWTYSLFWNLCPHNGMLVWSDGYYNGAIKTRKTVQGTEVSAEEAS  359
            +  LQ  LQ  VQSV WTYSLFW LCP  G+LVW +GYYNGAIKTRKTVQ  EVS EEAS
Sbjct  6    STKLQQTLQEVVQSVQWTYSLFWQLCPQQGILVWGEGYYNGAIKTRKTVQPMEVSTEEAS  65

Query  360  LHRSQQIKELYESLSATAEESNGGGGQQPARRPSAALSPEDLTESEWFYLMCISFSFPSA  539
            L RSQQ++ELYESLSA       G   QPARRP AALSPEDLTESEWFYLMC+SFSFP  
Sbjct  66   LQRSQQLRELYESLSA-------GEANQPARRPCAALSPEDLTESEWFYLMCVSFSFPPG  118

Query  540  VGL  548
            VGL
Sbjct  119  VGL  121



>ref|XP_008790987.1| PREDICTED: basic helix-loop-helix protein A isoform X1 [Phoenix 
dactylifera]
Length=699

 Score =   185 bits (469),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 90/123 (73%), Positives = 96/123 (78%), Gaps = 7/123 (6%)
 Frame = +3

Query  180  AAHLQTLLQTAVQSVHWTYSLFWNLCPHNGMLVWSDGYYNGAIKTRKTVQGTEVSAEEAS  359
            ++ LQ  LQ  VQSV WTYSLFW LCP  G+LVW +GYYNGAIKTRKTVQ  EVS EEAS
Sbjct  6    SSKLQETLQLVVQSVGWTYSLFWQLCPQQGILVWGEGYYNGAIKTRKTVQPVEVSTEEAS  65

Query  360  LHRSQQIKELYESLSATAEESNGGGGQQPARRPSAALSPEDLTESEWFYLMCISFSFPSA  539
            L RSQQ++ELYESLSA       G   QPARRP AALSPEDLTESEWFYLMCISFSFP  
Sbjct  66   LQRSQQLRELYESLSA-------GEANQPARRPCAALSPEDLTESEWFYLMCISFSFPPG  118

Query  540  VGL  548
            VGL
Sbjct  119  VGL  121



>ref|XP_010906882.1| PREDICTED: basic helix-loop-helix protein A isoform X2 [Elaeis 
guineensis]
Length=694

 Score =   185 bits (469),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 89/123 (72%), Positives = 95/123 (77%), Gaps = 7/123 (6%)
 Frame = +3

Query  180  AAHLQTLLQTAVQSVHWTYSLFWNLCPHNGMLVWSDGYYNGAIKTRKTVQGTEVSAEEAS  359
            +  LQ  LQ  VQSV WTYSLFW LCP  G+LVW +GYYNGAIKTRKTVQ  EVS EEAS
Sbjct  6    STKLQQTLQEVVQSVQWTYSLFWQLCPQQGILVWGEGYYNGAIKTRKTVQPMEVSTEEAS  65

Query  360  LHRSQQIKELYESLSATAEESNGGGGQQPARRPSAALSPEDLTESEWFYLMCISFSFPSA  539
            L RSQQ++ELYESLSA       G   QPARRP AALSPEDLTESEWFYLMC+SFSFP  
Sbjct  66   LQRSQQLRELYESLSA-------GEANQPARRPCAALSPEDLTESEWFYLMCVSFSFPPG  118

Query  540  VGL  548
            VGL
Sbjct  119  VGL  121



>ref|XP_010906884.1| PREDICTED: basic helix-loop-helix protein A isoform X4 [Elaeis 
guineensis]
Length=689

 Score =   185 bits (469),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 89/123 (72%), Positives = 95/123 (77%), Gaps = 7/123 (6%)
 Frame = +3

Query  180  AAHLQTLLQTAVQSVHWTYSLFWNLCPHNGMLVWSDGYYNGAIKTRKTVQGTEVSAEEAS  359
            +  LQ  LQ  VQSV WTYSLFW LCP  G+LVW +GYYNGAIKTRKTVQ  EVS EEAS
Sbjct  6    STKLQQTLQEVVQSVQWTYSLFWQLCPQQGILVWGEGYYNGAIKTRKTVQPMEVSTEEAS  65

Query  360  LHRSQQIKELYESLSATAEESNGGGGQQPARRPSAALSPEDLTESEWFYLMCISFSFPSA  539
            L RSQQ++ELYESLSA       G   QPARRP AALSPEDLTESEWFYLMC+SFSFP  
Sbjct  66   LQRSQQLRELYESLSA-------GEANQPARRPCAALSPEDLTESEWFYLMCVSFSFPPG  118

Query  540  VGL  548
            VGL
Sbjct  119  VGL  121



>ref|XP_004495293.1| PREDICTED: transcription factor TT8-like [Cicer arietinum]
Length=609

 Score =   184 bits (467),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 91/130 (70%), Positives = 98/130 (75%), Gaps = 8/130 (6%)
 Frame = +3

Query  159  MAETPGGAAHLQTLLQTAVQSVHWTYSLFWNLCPHNGMLVWSDGYYNGAIKTRKTVQGTE  338
            MA  P G   LQ +LQ AVQSV WTYSLFW LCP   +L+W DGYYNGAIKTRKTVQ  E
Sbjct  3    MAAPPVGN-KLQNMLQAAVQSVQWTYSLFWQLCPQQLILIWGDGYYNGAIKTRKTVQPME  61

Query  339  VSAEEASLHRSQQIKELYESLSATAEESNGGGGQQPARRPSAALSPEDLTESEWFYLMCI  518
            VSAEEASL RSQQ++ELYESLSA       G    P RRP A+LSPEDLTESEWFYLMC+
Sbjct  62   VSAEEASLQRSQQLRELYESLSA-------GETNPPTRRPCASLSPEDLTESEWFYLMCV  114

Query  519  SFSFPSAVGL  548
            SFSFP  VGL
Sbjct  115  SFSFPPGVGL  124



>gb|AIF70440.1| basic helix-loop-helix transcription factor [Malus domestica]
Length=692

 Score =   185 bits (469),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 87/117 (74%), Positives = 96/117 (82%), Gaps = 6/117 (5%)
 Frame = +3

Query  198  LLQTAVQSVHWTYSLFWNLCPHNGMLVWSDGYYNGAIKTRKTVQGTEVSAEEASLHRSQQ  377
            +LQ +VQSV WTYSLFW +CP  G+LVWSDGYYNGAIKTRKTVQ  EVSAEEASL RSQQ
Sbjct  1    MLQASVQSVQWTYSLFWQICPQQGILVWSDGYYNGAIKTRKTVQPMEVSAEEASLQRSQQ  60

Query  378  IKELYESLSATAEESNGGGGQQPARRPSAALSPEDLTESEWFYLMCISFSFPSAVGL  548
            ++ELY+SLSA      G   Q PARRP A+LSPEDLTESEWFYLMC+SFSFP  VGL
Sbjct  61   LRELYDSLSA------GETNQPPARRPCASLSPEDLTESEWFYLMCVSFSFPPGVGL  111



>ref|XP_010906883.1| PREDICTED: basic helix-loop-helix protein A isoform X3 [Elaeis 
guineensis]
Length=692

 Score =   185 bits (469),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 89/123 (72%), Positives = 95/123 (77%), Gaps = 7/123 (6%)
 Frame = +3

Query  180  AAHLQTLLQTAVQSVHWTYSLFWNLCPHNGMLVWSDGYYNGAIKTRKTVQGTEVSAEEAS  359
            +  LQ  LQ  VQSV WTYSLFW LCP  G+LVW +GYYNGAIKTRKTVQ  EVS EEAS
Sbjct  6    STKLQQTLQEVVQSVQWTYSLFWQLCPQQGILVWGEGYYNGAIKTRKTVQPMEVSTEEAS  65

Query  360  LHRSQQIKELYESLSATAEESNGGGGQQPARRPSAALSPEDLTESEWFYLMCISFSFPSA  539
            L RSQQ++ELYESLSA       G   QPARRP AALSPEDLTESEWFYLMC+SFSFP  
Sbjct  66   LQRSQQLRELYESLSA-------GEANQPARRPCAALSPEDLTESEWFYLMCVSFSFPPG  118

Query  540  VGL  548
            VGL
Sbjct  119  VGL  121



>emb|CEL26634.1| bHLH3 [Ribes rubrum]
Length=723

 Score =   184 bits (468),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 89/130 (68%), Positives = 98/130 (75%), Gaps = 7/130 (5%)
 Frame = +3

Query  159  MAETPGGAAHLQTLLQTAVQSVHWTYSLFWNLCPHNGMLVWSDGYYNGAIKTRKTVQGTE  338
            MA  P     LQ +LQTAVQSV WTYSL+W  C   G+L+W DGYYNGAIKTRKTVQ  E
Sbjct  1    MAAQPQPNTRLQNMLQTAVQSVQWTYSLYWQFCQQQGILIWGDGYYNGAIKTRKTVQPME  60

Query  339  VSAEEASLHRSQQIKELYESLSATAEESNGGGGQQPARRPSAALSPEDLTESEWFYLMCI  518
            VS+EEASL RSQQ++ELY+SLSA       G   QPARRP AALSPEDLTESEWFYLMC+
Sbjct  61   VSSEEASLQRSQQLRELYDSLSA-------GETNQPARRPCAALSPEDLTESEWFYLMCV  113

Query  519  SFSFPSAVGL  548
            SFSF   VGL
Sbjct  114  SFSFAPGVGL  123



>gb|AIS24255.1| basic helix-loop-helix regulatory protein [Punica granatum]
Length=689

 Score =   184 bits (468),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 86/123 (70%), Positives = 99/123 (80%), Gaps = 7/123 (6%)
 Frame = +3

Query  180  AAHLQTLLQTAVQSVHWTYSLFWNLCPHNGMLVWSDGYYNGAIKTRKTVQGTEVSAEEAS  359
            ++ LQ++LQ AVQSV WTYSLFW++CP  G+L+W DGYYNG IKTRKTVQ  EVSAEEAS
Sbjct  6    SSRLQSMLQAAVQSVKWTYSLFWHICPQQGILIWGDGYYNGPIKTRKTVQPMEVSAEEAS  65

Query  360  LHRSQQIKELYESLSATAEESNGGGGQQPARRPSAALSPEDLTESEWFYLMCISFSFPSA  539
            L RSQ ++ELYESLSA       G   QPARRP A+LSPEDLTE+EWFYLMC+SFSFP  
Sbjct  66   LQRSQHLRELYESLSA-------GETNQPARRPCASLSPEDLTETEWFYLMCVSFSFPPG  118

Query  540  VGL  548
            VGL
Sbjct  119  VGL  121



>sp|E3SXU4.1|BHLHW_PEA RecName: Full=Basic helix-loop-helix protein A [Pisum sativum]
 gb|ADO13282.1| bHLH [Pisum sativum]
Length=652

 Score =   183 bits (465),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 91/132 (69%), Positives = 99/132 (75%), Gaps = 8/132 (6%)
 Frame = +3

Query  156  VMAETP-GGAAHLQTLLQTAVQSVHWTYSLFWNLCPHNGMLVWSDGYYNGAIKTRKTVQG  332
            + A TP  G   LQ +LQ AVQSV WTYSLFW +CP   +LVW DGYYNGAIKTRKTVQ 
Sbjct  1    MTAPTPENGCNKLQNMLQAAVQSVQWTYSLFWQICPQQLILVWGDGYYNGAIKTRKTVQP  60

Query  333  TEVSAEEASLHRSQQIKELYESLSATAEESNGGGGQQPARRPSAALSPEDLTESEWFYLM  512
             EVSAEEASL RSQQ++ELYESLSA       G    P RRP A+LSPEDLTESEWFYLM
Sbjct  61   MEVSAEEASLQRSQQLRELYESLSA-------GETNPPTRRPCASLSPEDLTESEWFYLM  113

Query  513  CISFSFPSAVGL  548
            C+SFSFP  VGL
Sbjct  114  CVSFSFPPGVGL  125



>dbj|BAH28881.1| bHLH transcription factor LjTT8 [Lotus japonicus]
Length=678

 Score =   183 bits (465),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 88/124 (71%), Positives = 97/124 (78%), Gaps = 7/124 (6%)
 Frame = +3

Query  177  GAAHLQTLLQTAVQSVHWTYSLFWNLCPHNGMLVWSDGYYNGAIKTRKTVQGTEVSAEEA  356
            G++ LQ++LQ AVQSV WTYSLFW LCP   +LVW DGYYNGAIKTRKTVQ  EVS EEA
Sbjct  20   GSSKLQSMLQGAVQSVQWTYSLFWQLCPQQVILVWGDGYYNGAIKTRKTVQPMEVSTEEA  79

Query  357  SLHRSQQIKELYESLSATAEESNGGGGQQPARRPSAALSPEDLTESEWFYLMCISFSFPS  536
            SL RSQQ++ELY+SLSA       G    P RRP AALSPEDLTESEWFYLMC+SFSFP 
Sbjct  80   SLQRSQQLRELYDSLSA-------GETNPPTRRPCAALSPEDLTESEWFYLMCVSFSFPP  132

Query  537  AVGL  548
             VGL
Sbjct  133  GVGL  136



>gb|EYU46593.1| hypothetical protein MIMGU_mgv1a002681mg [Erythranthe guttata]
Length=647

 Score =   182 bits (463),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 85/126 (67%), Positives = 100/126 (79%), Gaps = 5/126 (4%)
 Frame = +3

Query  171  PGGAAHLQTLLQTAVQSVHWTYSLFWNLCPHNGMLVWSDGYYNGAIKTRKTVQGTEVSAE  350
            P   + LQ++L+ AVQ+V WTYSLFW L P  G+LVW +GYYNGAIKTRKT+Q TEV+ E
Sbjct  8    PARKSRLQSVLRAAVQTVEWTYSLFWQLSPQQGILVWREGYYNGAIKTRKTIQPTEVTTE  67

Query  351  EASLHRSQQIKELYESLSATAEESNGGGGQQPARRPSAALSPEDLTESEWFYLMCISFSF  530
            EA++HRS Q++ELYESLSAT       G  Q +RRPSAALSPEDLTESEWFYLMC+SFSF
Sbjct  68   EATVHRSHQLRELYESLSAT-----DAGSSQQSRRPSAALSPEDLTESEWFYLMCVSFSF  122

Query  531  PSAVGL  548
            P  VGL
Sbjct  123  PPGVGL  128



>ref|NP_001275098.1| transcription factor TT8-like [Solanum tuberosum]
 emb|CDJ79759.1| bHLH transcription factor [Solanum tuberosum]
Length=687

 Score =   183 bits (464),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 87/121 (72%), Positives = 95/121 (79%), Gaps = 7/121 (6%)
 Frame = +3

Query  186  HLQTLLQTAVQSVHWTYSLFWNLCPHNGMLVWSDGYYNGAIKTRKTVQGTEVSAEEASLH  365
             LQ +LQ +VQSV WTYSLFW  CP  G+LVW DGYYNGAIKTRKTVQ  EV+AEEASLH
Sbjct  10   QLQNMLQNSVQSVKWTYSLFWQFCPKQGVLVWRDGYYNGAIKTRKTVQPMEVTAEEASLH  69

Query  366  RSQQIKELYESLSATAEESNGGGGQQPARRPSAALSPEDLTESEWFYLMCISFSFPSAVG  545
            RSQQ++EL +SLSA       G    PARRPSAALSPEDLTESEWFYLMC+SFSFP   G
Sbjct  70   RSQQLRELCDSLSA-------GDSNPPARRPSAALSPEDLTESEWFYLMCVSFSFPPPFG  122

Query  546  L  548
            L
Sbjct  123  L  123



>dbj|BAC56998.1| F3G1 [Perilla frutescens]
Length=519

 Score =   180 bits (456),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 89/130 (68%), Positives = 99/130 (76%), Gaps = 9/130 (7%)
 Frame = +3

Query  159  MAETPGGAAHLQTLLQTAVQSVHWTYSLFWNLCPHNGMLVWSDGYYNGAIKTRKTVQGTE  338
            M E P   + +++LLQ AVQ+  WTYSLFW LCP  G LVWSDGYYNGAIKTRKTVQ TE
Sbjct  1    MVEPP--KSRVESLLQAAVQTAQWTYSLFWQLCPQKGTLVWSDGYYNGAIKTRKTVQPTE  58

Query  339  VSAEEASLHRSQQIKELYESLSATAEESNGGGGQQPARRPSAALSPEDLTESEWFYLMCI  518
              AEE +L RSQQ++ELYESLSA      G    QP RRPSA+LSPEDLTESEWFYLMC+
Sbjct  59   DVAEELTLQRSQQLRELYESLSA------GETNHQP-RRPSASLSPEDLTESEWFYLMCV  111

Query  519  SFSFPSAVGL  548
            SFSFP  VGL
Sbjct  112  SFSFPPGVGL  121



>ref|XP_010684257.1| PREDICTED: basic helix-loop-helix protein A [Beta vulgaris subsp. 
vulgaris]
Length=673

 Score =   181 bits (460),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 87/121 (72%), Positives = 96/121 (79%), Gaps = 7/121 (6%)
 Frame = +3

Query  186  HLQTLLQTAVQSVHWTYSLFWNLCPHNGMLVWSDGYYNGAIKTRKTVQGTEVSAEEASLH  365
             LQ +LQ+AVQ+V WTYSLFW+ CP  G+LVW DGYYNGAIKTRKTVQ  + SAEEA L 
Sbjct  10   QLQQMLQSAVQAVQWTYSLFWHYCPQQGILVWLDGYYNGAIKTRKTVQPMDTSAEEACLQ  69

Query  366  RSQQIKELYESLSATAEESNGGGGQQPARRPSAALSPEDLTESEWFYLMCISFSFPSAVG  545
            RSQQ++ELYESLSA       G   QPARRP AALSPEDLTESEWFYLMC+SFSFP  VG
Sbjct  70   RSQQLRELYESLSA-------GELNQPARRPCAALSPEDLTESEWFYLMCVSFSFPPGVG  122

Query  546  L  548
            L
Sbjct  123  L  123



>ref|XP_003590656.1| Transcription factor TT8 [Medicago truncatula]
 gb|AES60907.1| bHLH transcription factor [Medicago truncatula]
Length=656

 Score =   181 bits (460),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 90/129 (70%), Positives = 99/129 (77%), Gaps = 8/129 (6%)
 Frame = +3

Query  162  AETPGGAAHLQTLLQTAVQSVHWTYSLFWNLCPHNGMLVWSDGYYNGAIKTRKTVQGTEV  341
            A +P G+  LQ +LQ AVQSV WTYSLFW LCP   +LVW DGYYNG+IKTRKTVQ  EV
Sbjct  3    APSPLGSK-LQNMLQAAVQSVQWTYSLFWQLCPQQLILVWGDGYYNGSIKTRKTVQPMEV  61

Query  342  SAEEASLHRSQQIKELYESLSATAEESNGGGGQQPARRPSAALSPEDLTESEWFYLMCIS  521
            SAEEASL RSQQ++ELYESLSA       G    P RRP A+LSPEDLTESEWFYLMC+S
Sbjct  62   SAEEASLQRSQQLRELYESLSA-------GETNPPTRRPCASLSPEDLTESEWFYLMCVS  114

Query  522  FSFPSAVGL  548
            FSFP  VGL
Sbjct  115  FSFPPGVGL  123



>ref|XP_010278097.1| PREDICTED: basic helix-loop-helix protein A-like isoform X1 [Nelumbo 
nucifera]
Length=688

 Score =   180 bits (457),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 87/121 (72%), Positives = 98/121 (81%), Gaps = 7/121 (6%)
 Frame = +3

Query  186  HLQTLLQTAVQSVHWTYSLFWNLCPHNGMLVWSDGYYNGAIKTRKTVQGTEVSAEEASLH  365
             LQ +L++AVQSV WTYSLFW +CP  G+LVW DGYYNG IKTRKTVQ  EVSAEEASL 
Sbjct  8    RLQQMLKSAVQSVQWTYSLFWRICPQQGILVWGDGYYNGQIKTRKTVQPMEVSAEEASLQ  67

Query  366  RSQQIKELYESLSATAEESNGGGGQQPARRPSAALSPEDLTESEWFYLMCISFSFPSAVG  545
            RSQQ++ELYESLS +  E+N     QPARRPSAALSPEDLTE+EWFYLMC+SFSF   V 
Sbjct  68   RSQQLRELYESLSGS--ETN-----QPARRPSAALSPEDLTETEWFYLMCVSFSFAPGVE  120

Query  546  L  548
            L
Sbjct  121  L  121



>ref|XP_010278105.1| PREDICTED: basic helix-loop-helix protein A-like isoform X2 [Nelumbo 
nucifera]
Length=683

 Score =   180 bits (457),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 87/121 (72%), Positives = 98/121 (81%), Gaps = 7/121 (6%)
 Frame = +3

Query  186  HLQTLLQTAVQSVHWTYSLFWNLCPHNGMLVWSDGYYNGAIKTRKTVQGTEVSAEEASLH  365
             LQ +L++AVQSV WTYSLFW +CP  G+LVW DGYYNG IKTRKTVQ  EVSAEEASL 
Sbjct  8    RLQQMLKSAVQSVQWTYSLFWRICPQQGILVWGDGYYNGQIKTRKTVQPMEVSAEEASLQ  67

Query  366  RSQQIKELYESLSATAEESNGGGGQQPARRPSAALSPEDLTESEWFYLMCISFSFPSAVG  545
            RSQQ++ELYESLS +  E+N     QPARRPSAALSPEDLTE+EWFYLMC+SFSF   V 
Sbjct  68   RSQQLRELYESLSGS--ETN-----QPARRPSAALSPEDLTETEWFYLMCVSFSFAPGVE  120

Query  546  L  548
            L
Sbjct  121  L  121



>ref|XP_009405589.1| PREDICTED: basic helix-loop-helix protein A-like isoform X3 [Musa 
acuminata subsp. malaccensis]
Length=587

 Score =   179 bits (455),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 86/120 (72%), Positives = 92/120 (77%), Gaps = 7/120 (6%)
 Frame = +3

Query  189  LQTLLQTAVQSVHWTYSLFWNLCPHNGMLVWSDGYYNGAIKTRKTVQGTEVSAEEASLHR  368
            LQ  LQ  VQSVHWTYSLFW +CP  G LVW DGYYNG IKTRKTVQ  EVS EEASL R
Sbjct  9    LQQALQAVVQSVHWTYSLFWQVCPQQGTLVWGDGYYNGGIKTRKTVQPVEVSTEEASLQR  68

Query  369  SQQIKELYESLSATAEESNGGGGQQPARRPSAALSPEDLTESEWFYLMCISFSFPSAVGL  548
            SQQ++EL+ESLS+       G    PARRP AALSPEDLTE+EWFYLMCISFSFP  VGL
Sbjct  69   SQQLRELFESLSS-------GEANLPARRPCAALSPEDLTEAEWFYLMCISFSFPPGVGL  121



>ref|XP_009405588.1| PREDICTED: truncated basic helix-loop-helix protein A-like isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=641

 Score =   179 bits (455),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 86/120 (72%), Positives = 92/120 (77%), Gaps = 7/120 (6%)
 Frame = +3

Query  189  LQTLLQTAVQSVHWTYSLFWNLCPHNGMLVWSDGYYNGAIKTRKTVQGTEVSAEEASLHR  368
            LQ  LQ  VQSVHWTYSLFW +CP  G LVW DGYYNG IKTRKTVQ  EVS EEASL R
Sbjct  9    LQQALQAVVQSVHWTYSLFWQVCPQQGTLVWGDGYYNGGIKTRKTVQPVEVSTEEASLQR  68

Query  369  SQQIKELYESLSATAEESNGGGGQQPARRPSAALSPEDLTESEWFYLMCISFSFPSAVGL  548
            SQQ++EL+ESLS+       G    PARRP AALSPEDLTE+EWFYLMCISFSFP  VGL
Sbjct  69   SQQLRELFESLSS-------GEANLPARRPCAALSPEDLTEAEWFYLMCISFSFPPGVGL  121



>ref|XP_009405587.1| PREDICTED: basic helix-loop-helix protein A-like isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=651

 Score =   179 bits (454),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 86/120 (72%), Positives = 92/120 (77%), Gaps = 7/120 (6%)
 Frame = +3

Query  189  LQTLLQTAVQSVHWTYSLFWNLCPHNGMLVWSDGYYNGAIKTRKTVQGTEVSAEEASLHR  368
            LQ  LQ  VQSVHWTYSLFW +CP  G LVW DGYYNG IKTRKTVQ  EVS EEASL R
Sbjct  9    LQQALQAVVQSVHWTYSLFWQVCPQQGTLVWGDGYYNGGIKTRKTVQPVEVSTEEASLQR  68

Query  369  SQQIKELYESLSATAEESNGGGGQQPARRPSAALSPEDLTESEWFYLMCISFSFPSAVGL  548
            SQQ++EL+ESLS+       G    PARRP AALSPEDLTE+EWFYLMCISFSFP  VGL
Sbjct  69   SQQLRELFESLSS-------GEANLPARRPCAALSPEDLTEAEWFYLMCISFSFPPGVGL  121



>emb|CBY88797.1| basic helix-loop-helix transcription factor [Humulus lupulus]
Length=695

 Score =   179 bits (455),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 86/117 (74%), Positives = 93/117 (79%), Gaps = 7/117 (6%)
 Frame = +3

Query  198  LLQTAVQSVHWTYSLFWNLCPHNGMLVWSDGYYNGAIKTRKTVQGTEVSAEEASLHRSQQ  377
            +LQTAVQSV WTYSLFW LCP  G+LVW+DGYYNGAIKTRKTVQ  EVSAEEASL RSQQ
Sbjct  1    MLQTAVQSVQWTYSLFWQLCPQQGILVWADGYYNGAIKTRKTVQPMEVSAEEASLQRSQQ  60

Query  378  IKELYESLSATAEESNGGGGQQPARRPSAALSPEDLTESEWFYLMCISFSFPSAVGL  548
            ++ELY+SLS        G   QP RRP AALSPEDLTESEWFYLMC+SFSF    GL
Sbjct  61   LRELYDSLSV-------GETNQPQRRPCAALSPEDLTESEWFYLMCVSFSFSPGSGL  110



>gb|AFL02463.1| transcription factor bHLH3 [Fragaria x ananassa]
Length=697

 Score =   179 bits (454),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 87/130 (67%), Positives = 99/130 (76%), Gaps = 7/130 (5%)
 Frame = +3

Query  159  MAETPGGAAHLQTLLQTAVQSVHWTYSLFWNLCPHNGMLVWSDGYYNGAIKTRKTVQGTE  338
            MA  P  ++ L+ +LQ+AVQSV WTYSLFW +CP  GML     YYNGAIKTRKTVQ  E
Sbjct  1    MATPPPSSSRLRGMLQSAVQSVQWTYSLFWQICPQQGMLXXXMXYYNGAIKTRKTVQPME  60

Query  339  VSAEEASLHRSQQIKELYESLSATAEESNGGGGQQPARRPSAALSPEDLTESEWFYLMCI  518
            VS+EEASL RSQQ++ELY++LSA       G   QPARRP AALSPEDLTESEWFYLMC+
Sbjct  61   VSSEEASLQRSQQLRELYDTLSA-------GETNQPARRPCAALSPEDLTESEWFYLMCV  113

Query  519  SFSFPSAVGL  548
            SFSFP  VGL
Sbjct  114  SFSFPPGVGL  123



>ref|XP_011079838.1| PREDICTED: truncated basic helix-loop-helix protein A [Sesamum 
indicum]
Length=672

 Score =   179 bits (454),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 84/124 (68%), Positives = 98/124 (79%), Gaps = 6/124 (5%)
 Frame = +3

Query  177  GAAHLQTLLQTAVQSVHWTYSLFWNLCPHNGMLVWSDGYYNGAIKTRKTVQGTEVSAEEA  356
            G + LQ++LQ AVQ+VHWTYSLFW LCP   +LVW DGYYNGAIKTRKTVQ TEV+ EEA
Sbjct  7    GKSRLQSMLQAAVQAVHWTYSLFWQLCPQQRILVWGDGYYNGAIKTRKTVQPTEVTTEEA  66

Query  357  SLHRSQQIKELYESLSATAEESNGGGGQQPARRPSAALSPEDLTESEWFYLMCISFSFPS  536
            +L RSQQ++E Y+SLSA    ++        RRPSAALSPEDLTESEWFYLMC+SFSFP 
Sbjct  67   TLQRSQQLREPYDSLSAPPPVADH------PRRPSAALSPEDLTESEWFYLMCLSFSFPP  120

Query  537  AVGL  548
             +GL
Sbjct  121  GLGL  124



>ref|XP_002302118.1| hypothetical protein POPTR_0002s05510g [Populus trichocarpa]
 gb|EEE81391.1| hypothetical protein POPTR_0002s05510g [Populus trichocarpa]
Length=680

 Score =   179 bits (454),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 84/123 (68%), Positives = 94/123 (76%), Gaps = 7/123 (6%)
 Frame = +3

Query  180  AAHLQTLLQTAVQSVHWTYSLFWNLCPHNGMLVWSDGYYNGAIKTRKTVQGTEVSAEEAS  359
            ++ LQT+LQ AVQSV WTYSLFW +CP  G+LVW DGYYNG IKTRKTVQ  EVS EEAS
Sbjct  6    SSRLQTMLQAAVQSVQWTYSLFWQMCPQQGILVWGDGYYNGPIKTRKTVQPMEVSTEEAS  65

Query  360  LHRSQQIKELYESLSATAEESNGGGGQQPARRPSAALSPEDLTESEWFYLMCISFSFPSA  539
            L RSQQ++ELY+SLS        G   QP RRP AALSPEDLTE+EWFYLMC+SFSF   
Sbjct  66   LQRSQQLRELYDSLSI-------GETNQPERRPCAALSPEDLTETEWFYLMCVSFSFSPG  118

Query  540  VGL  548
             GL
Sbjct  119  AGL  121



>emb|CDP03619.1| unnamed protein product [Coffea canephora]
Length=717

 Score =   179 bits (453),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 86/126 (68%), Positives = 98/126 (78%), Gaps = 4/126 (3%)
 Frame = +3

Query  171  PGGAAHLQTLLQTAVQSVHWTYSLFWNLCPHNGMLVWSDGYYNGAIKTRKTVQGTEVSAE  350
            P  +  LQ +LQ AVQ+V WTYSLFW LCP   +LVW DGYYNGAIKTRKTVQ  EVSAE
Sbjct  4    PPSSRELQHMLQRAVQTVEWTYSLFWQLCPQQRILVWGDGYYNGAIKTRKTVQPMEVSAE  63

Query  351  EASLHRSQQIKELYESLSATAEESNGGGGQQPARRPSAALSPEDLTESEWFYLMCISFSF  530
            EASL RSQQ++ELY++LS+     +    QQ ARRPSA+LSPEDLTESEWFYLMC+SFSF
Sbjct  64   EASLQRSQQLRELYDALSS----GDTNQQQQQARRPSASLSPEDLTESEWFYLMCVSFSF  119

Query  531  PSAVGL  548
               VGL
Sbjct  120  APGVGL  125



>ref|XP_009392688.1| PREDICTED: basic helix-loop-helix protein A-like [Musa acuminata 
subsp. malaccensis]
Length=641

 Score =   178 bits (451),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 86/120 (72%), Positives = 92/120 (77%), Gaps = 7/120 (6%)
 Frame = +3

Query  189  LQTLLQTAVQSVHWTYSLFWNLCPHNGMLVWSDGYYNGAIKTRKTVQGTEVSAEEASLHR  368
            LQ  LQ  VQSV WTYSLFW  CP  G+LVW DGYYNG+IKTRKTVQ  EVS EEASL R
Sbjct  9    LQQTLQAVVQSVRWTYSLFWQPCPQQGILVWGDGYYNGSIKTRKTVQPVEVSTEEASLQR  68

Query  369  SQQIKELYESLSATAEESNGGGGQQPARRPSAALSPEDLTESEWFYLMCISFSFPSAVGL  548
            SQQ++ELYESLS+       G    PARRP AALSPEDLTE+EWFYLMCISFSFP  VGL
Sbjct  69   SQQLRELYESLSS-------GEANLPARRPCAALSPEDLTEAEWFYLMCISFSFPPGVGL  121



>ref|XP_011026186.1| PREDICTED: basic helix-loop-helix protein A-like [Populus euphratica]
Length=702

 Score =   178 bits (451),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 83/123 (67%), Positives = 94/123 (76%), Gaps = 7/123 (6%)
 Frame = +3

Query  180  AAHLQTLLQTAVQSVHWTYSLFWNLCPHNGMLVWSDGYYNGAIKTRKTVQGTEVSAEEAS  359
            ++ LQT+LQ AVQSV WTYSLFW +CP  G+LVW DGYYNG IKTRKTVQ  EVS EEAS
Sbjct  6    SSRLQTILQAAVQSVQWTYSLFWQMCPQQGILVWGDGYYNGPIKTRKTVQPMEVSTEEAS  65

Query  360  LHRSQQIKELYESLSATAEESNGGGGQQPARRPSAALSPEDLTESEWFYLMCISFSFPSA  539
            L RSQQ+++LY+SLS        G   QP RRP AALSPEDLTE+EWFYLMC+SFSF   
Sbjct  66   LQRSQQLRDLYDSLSI-------GETNQPERRPCAALSPEDLTETEWFYLMCVSFSFSPG  118

Query  540  VGL  548
             GL
Sbjct  119  AGL  121



>gb|AGP03675.1| basic helix-loop-helix (bHLH) DNA-binding superfamily protein, 
partial [Glycine max]
Length=529

 Score =   175 bits (444),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 84/127 (66%), Positives = 95/127 (75%), Gaps = 7/127 (6%)
 Frame = +3

Query  168  TPGGAAHLQTLLQTAVQSVHWTYSLFWNLCPHNGMLVWSDGYYNGAIKTRKTVQGTEVSA  347
            TP     LQT+L+ AVQSV WTYSLFW LCPH G+L W DGYYNGAIKTRKTVQ  EVS 
Sbjct  3    TPPPNNSLQTMLRAAVQSVQWTYSLFWQLCPHKGILTWGDGYYNGAIKTRKTVQAMEVST  62

Query  348  EEASLHRSQQIKELYESLSATAEESNGGGGQQPARRPSAALSPEDLTESEWFYLMCISFS  527
            EEASL RS+Q++ELYESLS       GG      RRP A+LSPEDLTE+EWFYL+C+SFS
Sbjct  63   EEASLQRSEQLRELYESLS-------GGETNAKTRRPCASLSPEDLTETEWFYLLCVSFS  115

Query  528  FPSAVGL  548
            F   +GL
Sbjct  116  FHPGLGL  122



>gb|AGP03687.1| basic helix-loop-helix (bHLH) DNA-binding superfamily protein, 
partial [Glycine soja]
Length=529

 Score =   175 bits (444),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 84/127 (66%), Positives = 95/127 (75%), Gaps = 7/127 (6%)
 Frame = +3

Query  168  TPGGAAHLQTLLQTAVQSVHWTYSLFWNLCPHNGMLVWSDGYYNGAIKTRKTVQGTEVSA  347
            TP     LQT+L+ AVQSV WTYSLFW LCPH G+L W DGYYNGAIKTRKTVQ  EVS 
Sbjct  3    TPPPNNSLQTMLRAAVQSVQWTYSLFWQLCPHKGILTWGDGYYNGAIKTRKTVQAMEVST  62

Query  348  EEASLHRSQQIKELYESLSATAEESNGGGGQQPARRPSAALSPEDLTESEWFYLMCISFS  527
            EEASL RS+Q++ELYESLS       GG      RRP A+LSPEDLTE+EWFYL+C+SFS
Sbjct  63   EEASLQRSEQLRELYESLS-------GGETNAKTRRPCASLSPEDLTETEWFYLLCVSFS  115

Query  528  FPSAVGL  548
            F   +GL
Sbjct  116  FHPGLGL  122



>gb|AGP03686.1| basic helix-loop-helix (bHLH) DNA-binding superfamily protein, 
partial [Glycine soja]
Length=529

 Score =   175 bits (444),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 84/127 (66%), Positives = 95/127 (75%), Gaps = 7/127 (6%)
 Frame = +3

Query  168  TPGGAAHLQTLLQTAVQSVHWTYSLFWNLCPHNGMLVWSDGYYNGAIKTRKTVQGTEVSA  347
            TP     LQT+L+ AVQSV WTYSLFW LCPH G+L W DGYYNGAIKTRKTVQ  EVS 
Sbjct  3    TPPPNNSLQTMLRAAVQSVQWTYSLFWQLCPHKGILTWGDGYYNGAIKTRKTVQAMEVST  62

Query  348  EEASLHRSQQIKELYESLSATAEESNGGGGQQPARRPSAALSPEDLTESEWFYLMCISFS  527
            EEASL RS+Q++ELYESLS       GG      RRP A+LSPEDLTE+EWFYL+C+SFS
Sbjct  63   EEASLQRSEQLRELYESLS-------GGETNAKTRRPCASLSPEDLTETEWFYLLCVSFS  115

Query  528  FPSAVGL  548
            F   +GL
Sbjct  116  FHPGLGL  122



>gb|AGP03673.1| basic helix-loop-helix (bHLH) DNA-binding superfamily protein, 
partial [Glycine max]
 gb|AGP03674.1| basic helix-loop-helix (bHLH) DNA-binding superfamily protein, 
partial [Glycine max]
 gb|AGP03677.1| basic helix-loop-helix (bHLH) DNA-binding superfamily protein, 
partial [Glycine max]
 gb|AGP03678.1| basic helix-loop-helix (bHLH) DNA-binding superfamily protein, 
partial [Glycine max]
 gb|AGP03679.1| basic helix-loop-helix (bHLH) DNA-binding superfamily protein, 
partial [Glycine max]
 gb|AGP03682.1| basic helix-loop-helix (bHLH) DNA-binding superfamily protein, 
partial [Glycine max]
 gb|AGP03683.1| basic helix-loop-helix (bHLH) DNA-binding superfamily protein, 
partial [Glycine soja]
Length=529

 Score =   175 bits (444),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 84/127 (66%), Positives = 95/127 (75%), Gaps = 7/127 (6%)
 Frame = +3

Query  168  TPGGAAHLQTLLQTAVQSVHWTYSLFWNLCPHNGMLVWSDGYYNGAIKTRKTVQGTEVSA  347
            TP     LQT+L+ AVQSV WTYSLFW LCPH G+L W DGYYNGAIKTRKTVQ  EVS 
Sbjct  3    TPPPNNSLQTMLRAAVQSVQWTYSLFWQLCPHKGILTWGDGYYNGAIKTRKTVQAMEVST  62

Query  348  EEASLHRSQQIKELYESLSATAEESNGGGGQQPARRPSAALSPEDLTESEWFYLMCISFS  527
            EEASL RS+Q++ELYESLS       GG      RRP A+LSPEDLTE+EWFYL+C+SFS
Sbjct  63   EEASLQRSEQLRELYESLS-------GGETNAKTRRPCASLSPEDLTETEWFYLLCVSFS  115

Query  528  FPSAVGL  548
            F   +GL
Sbjct  116  FHPGLGL  122



>gb|AGP03684.1| basic helix-loop-helix (bHLH) DNA-binding superfamily protein, 
partial [Glycine soja]
Length=530

 Score =   175 bits (444),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 84/127 (66%), Positives = 95/127 (75%), Gaps = 7/127 (6%)
 Frame = +3

Query  168  TPGGAAHLQTLLQTAVQSVHWTYSLFWNLCPHNGMLVWSDGYYNGAIKTRKTVQGTEVSA  347
            TP     LQT+L+ AVQSV WTYSLFW LCPH G+L W DGYYNGAIKTRKTVQ  EVS 
Sbjct  3    TPPPNNSLQTMLRAAVQSVQWTYSLFWQLCPHKGILTWGDGYYNGAIKTRKTVQAMEVST  62

Query  348  EEASLHRSQQIKELYESLSATAEESNGGGGQQPARRPSAALSPEDLTESEWFYLMCISFS  527
            EEASL RS+Q++ELYESLS       GG      RRP A+LSPEDLTE+EWFYL+C+SFS
Sbjct  63   EEASLQRSEQLRELYESLS-------GGETNAKTRRPCASLSPEDLTETEWFYLLCVSFS  115

Query  528  FPSAVGL  548
            F   +GL
Sbjct  116  FHPGLGL  122



>gb|AGP03676.1| basic helix-loop-helix (bHLH) DNA-binding superfamily protein, 
partial [Glycine max]
 gb|AGP03680.1| basic helix-loop-helix (bHLH) DNA-binding superfamily protein, 
partial [Glycine max]
 gb|AGP03681.1| basic helix-loop-helix (bHLH) DNA-binding superfamily protein, 
partial [Glycine max]
 gb|AGP03685.1| basic helix-loop-helix (bHLH) DNA-binding superfamily protein, 
partial [Glycine soja]
 gb|AGP03688.1| basic helix-loop-helix (bHLH) DNA-binding superfamily protein, 
partial [Glycine soja]
Length=529

 Score =   175 bits (443),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 84/127 (66%), Positives = 95/127 (75%), Gaps = 7/127 (6%)
 Frame = +3

Query  168  TPGGAAHLQTLLQTAVQSVHWTYSLFWNLCPHNGMLVWSDGYYNGAIKTRKTVQGTEVSA  347
            TP     LQT+L+ AVQSV WTYSLFW LCPH G+L W DGYYNGAIKTRKTVQ  EVS 
Sbjct  3    TPPPNNSLQTMLRAAVQSVQWTYSLFWQLCPHKGILTWGDGYYNGAIKTRKTVQAMEVST  62

Query  348  EEASLHRSQQIKELYESLSATAEESNGGGGQQPARRPSAALSPEDLTESEWFYLMCISFS  527
            EEASL RS+Q++ELYESLS       GG      RRP A+LSPEDLTE+EWFYL+C+SFS
Sbjct  63   EEASLQRSEQLRELYESLS-------GGETNAKTRRPCASLSPEDLTETEWFYLLCVSFS  115

Query  528  FPSAVGL  548
            F   +GL
Sbjct  116  FHPGLGL  122



>ref|XP_003520564.1| PREDICTED: transcription factor TT8-like [Glycine max]
Length=577

 Score =   176 bits (445),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 84/127 (66%), Positives = 95/127 (75%), Gaps = 7/127 (6%)
 Frame = +3

Query  168  TPGGAAHLQTLLQTAVQSVHWTYSLFWNLCPHNGMLVWSDGYYNGAIKTRKTVQGTEVSA  347
            TP     LQT+L+ AVQSV WTYSLFW LCPH G+L W DGYYNGAIKTRKTVQ  EVS 
Sbjct  3    TPPPNNSLQTMLRAAVQSVQWTYSLFWQLCPHKGILTWGDGYYNGAIKTRKTVQAMEVST  62

Query  348  EEASLHRSQQIKELYESLSATAEESNGGGGQQPARRPSAALSPEDLTESEWFYLMCISFS  527
            EEASL RS+Q++ELYESLS       GG      RRP A+LSPEDLTE+EWFYL+C+SFS
Sbjct  63   EEASLQRSEQLRELYESLS-------GGETNAKTRRPCASLSPEDLTETEWFYLLCVSFS  115

Query  528  FPSAVGL  548
            F   +GL
Sbjct  116  FHPGLGL  122



>gb|KHN19887.1| Transcription factor TT8 [Glycine soja]
Length=572

 Score =   175 bits (444),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 84/127 (66%), Positives = 95/127 (75%), Gaps = 7/127 (6%)
 Frame = +3

Query  168  TPGGAAHLQTLLQTAVQSVHWTYSLFWNLCPHNGMLVWSDGYYNGAIKTRKTVQGTEVSA  347
            TP     LQT+L+ AVQSV WTYSLFW LCPH G+L W DGYYNGAIKTRKTVQ  EVS 
Sbjct  3    TPPPNNSLQTMLRAAVQSVQWTYSLFWQLCPHKGILTWGDGYYNGAIKTRKTVQAMEVST  62

Query  348  EEASLHRSQQIKELYESLSATAEESNGGGGQQPARRPSAALSPEDLTESEWFYLMCISFS  527
            EEASL RS+Q++ELYESLS       GG      RRP A+LSPEDLTE+EWFYL+C+SFS
Sbjct  63   EEASLQRSEQLRELYESLS-------GGETNAKTRRPCASLSPEDLTETEWFYLLCVSFS  115

Query  528  FPSAVGL  548
            F   +GL
Sbjct  116  FHPGLGL  122



>ref|XP_007162415.1| hypothetical protein PHAVU_001G1503001g, partial [Phaseolus vulgaris]
 gb|ESW34409.1| hypothetical protein PHAVU_001G1503001g, partial [Phaseolus vulgaris]
Length=310

 Score =   169 bits (429),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 85/130 (65%), Positives = 95/130 (73%), Gaps = 9/130 (7%)
 Frame = +3

Query  159  MAETPGGAAHLQTLLQTAVQSVHWTYSLFWNLCPHNGMLVWSDGYYNGAIKTRKTVQGTE  338
            MA  P   + LQ++L+ AVQSV WTYSLFW LCP  G+L W DGYYNGAIKTRKTVQ  E
Sbjct  1    MAAPPN--SRLQSMLRAAVQSVQWTYSLFWQLCPQQGILTWGDGYYNGAIKTRKTVQAME  58

Query  339  VSAEEASLHRSQQIKELYESLSATAEESNGGGGQQPARRPSAALSPEDLTESEWFYLMCI  518
            VS EEASL RS+Q++ELYESLSA       G      RRP AALSPEDLTESEWFYL+C+
Sbjct  59   VSTEEASLQRSEQLRELYESLSA-------GEANAQTRRPCAALSPEDLTESEWFYLLCV  111

Query  519  SFSFPSAVGL  548
            SFSF    GL
Sbjct  112  SFSFLPGDGL  121



>gb|AII25878.1| anthocyanin-activating bHLH3 [Erythranthe lewisii]
Length=654

 Score =   175 bits (443),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 87/126 (69%), Positives = 100/126 (79%), Gaps = 2/126 (2%)
 Frame = +3

Query  171  PGGAAHLQTLLQTAVQSVHWTYSLFWNLCPHNGMLVWSDGYYNGAIKTRKTVQGTEVSAE  350
            P  +  LQ++LQ AVQ+V WTY +FW L P  G LVW +GYYNGAIKTRKTVQ TEV+ E
Sbjct  4    PPKSRQLQSILQAAVQTVQWTYCVFWQLSPQQGTLVWREGYYNGAIKTRKTVQPTEVTTE  63

Query  351  EASLHRSQQIKELYESLSATAEESNGGGGQQPARRPSAALSPEDLTESEWFYLMCISFSF  530
            EA+L RSQQ++ELYESLSAT  E  GGGG Q ++RPS ALSPEDLTE EWFYLMC+SFSF
Sbjct  64   EATLQRSQQLRELYESLSAT--EGGGGGGGQQSQRPSVALSPEDLTEPEWFYLMCVSFSF  121

Query  531  PSAVGL  548
            P  VGL
Sbjct  122  PPGVGL  127



>dbj|BAE20058.1| bHLH transcription factor [Lilium hybrid division I]
Length=680

 Score =   175 bits (443),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 83/120 (69%), Positives = 92/120 (77%), Gaps = 6/120 (5%)
 Frame = +3

Query  189  LQTLLQTAVQSVHWTYSLFWNLCPHNGMLVWSDGYYNGAIKTRKTVQGTEVSAEEASLHR  368
            LQ LLQT VQSV WTYSLFW LCP   +LVW  GYYNGAIKTRKTVQ  +VS EE+SL R
Sbjct  9    LQQLLQTVVQSVDWTYSLFWQLCPREEILVWGGGYYNGAIKTRKTVQSVDVSIEESSLQR  68

Query  369  SQQIKELYESLSATAEESNGGGGQQPARRPSAALSPEDLTESEWFYLMCISFSFPSAVGL  548
            SQQ++ELY+SL+        G   QP  RPSAALSPEDLTESEWFYL+C+SFSFP  VGL
Sbjct  69   SQQLRELYDSLTT------AGKAGQPVLRPSAALSPEDLTESEWFYLICVSFSFPPGVGL  122



>gb|AEC03343.1| bHLH transcription factor MYC1 [Diospyros kaki]
Length=719

 Score =   175 bits (443),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 85/130 (65%), Positives = 98/130 (75%), Gaps = 9/130 (7%)
 Frame = +3

Query  159  MAETPGGAAHLQTLLQTAVQSVHWTYSLFWNLCPHNGMLVWSDGYYNGAIKTRKTVQGTE  338
            MA  P  ++ LQ +LQ AVQ+V WTYSLFW +C   G+LVW DGYYNGAIKTRKT+Q  E
Sbjct  1    MAAPP--SSRLQAMLQAAVQTVQWTYSLFWQMCSQQGILVWGDGYYNGAIKTRKTIQPME  58

Query  339  VSAEEASLHRSQQIKELYESLSATAEESNGGGGQQPARRPSAALSPEDLTESEWFYLMCI  518
            V+AEEASL RSQQ++ELY+SLSA       G   Q  RRP AALSPEDLTESE FYLMC+
Sbjct  59   VTAEEASLQRSQQLRELYDSLSA-------GESNQQTRRPCAALSPEDLTESERFYLMCV  111

Query  519  SFSFPSAVGL  548
            SF+FP  VGL
Sbjct  112  SFTFPPGVGL  121



>dbj|BAH03388.1| bHLH transcriptional factor [Gentiana triflora]
 dbj|BAH03387.1| bHLH transcriptional factor [Gentiana triflora]
Length=661

 Score =   172 bits (437),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 82/123 (67%), Positives = 97/123 (79%), Gaps = 5/123 (4%)
 Frame = +3

Query  180  AAHLQTLLQTAVQSVHWTYSLFWNLCPHNGMLVWSDGYYNGAIKTRKTVQGTEVSAEEAS  359
            + HLQ +LQ AVQ+V WTYS++W LCP   +LVW++GYYNG IKTRKTVQ  EVSAEEAS
Sbjct  13   SQHLQNMLQRAVQTVRWTYSIYWKLCPLQRILVWNEGYYNGEIKTRKTVQLKEVSAEEAS  72

Query  360  LHRSQQIKELYESLSATAEESNGGGGQQPARRPSAALSPEDLTESEWFYLMCISFSFPSA  539
            L RSQQ++ELYE+L A + E+N        RRPSAALSPEDLTESEWFYL+C S+ FP A
Sbjct  73   LQRSQQLRELYETLCAGSAETN-----HQTRRPSAALSPEDLTESEWFYLLCFSYFFPPA  127

Query  540  VGL  548
            VGL
Sbjct  128  VGL  130



>gb|AEH76882.1| bHLH transcription factor, partial [Punica granatum]
 gb|AHB18404.1| BHLH transcription factor, partial [Punica granatum]
Length=109

 Score =   160 bits (404),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 77/111 (69%), Positives = 89/111 (80%), Gaps = 7/111 (6%)
 Frame = +3

Query  180  AAHLQTLLQTAVQSVHWTYSLFWNLCPHNGMLVWSDGYYNGAIKTRKTVQGTEVSAEEAS  359
            ++ LQ++LQ AVQSV WTYSLFW++CP  G+L+W DGYYNG IKTRKTVQ  EVSAEEAS
Sbjct  6    SSRLQSMLQAAVQSVKWTYSLFWHICPQQGILIWGDGYYNGPIKTRKTVQPMEVSAEEAS  65

Query  360  LHRSQQIKELYESLSATAEESNGGGGQQPARRPSAALSPEDLTESEWFYLM  512
            L RSQ ++ELYESLSA       G   QPARRP A+LSPEDLTE+EWFYLM
Sbjct  66   LQRSQHLRELYESLSA-------GETNQPARRPCASLSPEDLTETEWFYLM  109



>dbj|BAM84240.1| bHLH transcription factor [Dahlia pinnata]
Length=649

 Score =   170 bits (431),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 79/134 (59%), Positives = 96/134 (72%), Gaps = 0/134 (0%)
 Frame = +3

Query  147  WSIVMAETPGGAAHLQTLLQTAVQSVHWTYSLFWNLCPHNGMLVWSDGYYNGAIKTRKTV  326
            + I   ET   A  L+ +LQ+AVQSV WTY + W  CP   +LVW DGYYNGAIKTRKTV
Sbjct  2    FDIDREETIMAADGLKEMLQSAVQSVQWTYIIIWQFCPERRVLVWGDGYYNGAIKTRKTV  61

Query  327  QGTEVSAEEASLHRSQQIKELYESLSATAEESNGGGGQQPARRPSAALSPEDLTESEWFY  506
            Q  EVS EEA+L RS+Q++ELY+SL++  ++          RRPS ALSPEDLTE+EWFY
Sbjct  62   QPVEVSTEEAALSRSEQLRELYDSLASGEQQVAESQQAATVRRPSVALSPEDLTEAEWFY  121

Query  507  LMCISFSFPSAVGL  548
            LMC+SFSFP  VGL
Sbjct  122  LMCVSFSFPPGVGL  135



>gb|ABV71912.1| AN1 [Solenostemon scutellarioides]
Length=100

 Score =   158 bits (399),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 77/110 (70%), Positives = 85/110 (77%), Gaps = 10/110 (9%)
 Frame = +3

Query  213  VQSVHWTYSLFWNLCPHNGMLVWSDGYYNGAIKTRKTVQGTEVSAEEASLHRSQQIKELY  392
            VQ+  WTYS+FW LC   G LVWSDGYYNGAIKTRKTVQ TE SAEEA+L RSQQ++ELY
Sbjct  1    VQTAQWTYSIFWQLCTQQGSLVWSDGYYNGAIKTRKTVQATEESAEEATLQRSQQLRELY  60

Query  393  ESLSATAEESNGGGGQQPARRPSAALSPEDLTESEWFYLMCISFSFPSAV  542
            E+ SA        G Q   RRPSA+LSPEDLTESEWFYLMC+SFSFP  V
Sbjct  61   ETXSA--------GDQ--TRRPSASLSPEDLTESEWFYLMCVSFSFPPGV  100



>ref|XP_010255924.1| PREDICTED: basic helix-loop-helix protein A-like isoform X2 [Nelumbo 
nucifera]
Length=696

 Score =   170 bits (431),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 83/121 (69%), Positives = 92/121 (76%), Gaps = 7/121 (6%)
 Frame = +3

Query  168  TPGGAAHLQTLLQTAVQSVHWTYSLFWNLCPHNGMLVWSDGYYNGAIKTRKTVQGTEVSA  347
            T  G+  LQ +LQ+AVQSV WTYSLFW +CP  G+LVW DGYYNG IKTRKTVQ  EVSA
Sbjct  2    TTPGSNRLQQMLQSAVQSVQWTYSLFWKICPQQGILVWGDGYYNGPIKTRKTVQPMEVSA  61

Query  348  EEASLHRSQQIKELYESLSATAEESNGGGGQQPARRPSAALSPEDLTESEWFYLMCISFS  527
            EEASL RSQQ++ELYESLSA       G   QPARRP AALSPEDLTE+EWFYLM    +
Sbjct  62   EEASLQRSQQLRELYESLSA-------GETNQPARRPCAALSPEDLTETEWFYLMLPGKA  114

Query  528  F  530
            F
Sbjct  115  F  115



>dbj|BAM84239.1| bHLH transcription factor [Dahlia pinnata]
Length=651

 Score =   169 bits (429),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 78/133 (59%), Positives = 96/133 (72%), Gaps = 0/133 (0%)
 Frame = +3

Query  150  SIVMAETPGGAAHLQTLLQTAVQSVHWTYSLFWNLCPHNGMLVWSDGYYNGAIKTRKTVQ  329
            +I+ A  P     L+ +LQ+AVQSV WTY + W  CP   +LVW DGYYNGAIKTRKTVQ
Sbjct  9    TIMAAAGPVNDDGLKEMLQSAVQSVQWTYIIIWQFCPERRVLVWGDGYYNGAIKTRKTVQ  68

Query  330  GTEVSAEEASLHRSQQIKELYESLSATAEESNGGGGQQPARRPSAALSPEDLTESEWFYL  509
              EVS EEA+L RS+Q++ELY+SL++  ++          RRPS ALSPEDLTE+EWFYL
Sbjct  69   PVEVSTEEAALSRSEQLRELYDSLASGEQQVTENQQAATVRRPSMALSPEDLTEAEWFYL  128

Query  510  MCISFSFPSAVGL  548
            MC+SFSFP  VGL
Sbjct  129  MCVSFSFPPGVGL  141



>ref|XP_003553458.1| PREDICTED: transcription factor TT8-like [Glycine max]
Length=588

 Score =   168 bits (426),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 85/130 (65%), Positives = 96/130 (74%), Gaps = 8/130 (6%)
 Frame = +3

Query  159  MAETPGGAAHLQTLLQTAVQSVHWTYSLFWNLCPHNGMLVWSDGYYNGAIKTRKTVQGTE  338
            MA  P    H  T+L+ +VQSV WTYSLFW LCP  G+L W DGYYNGAIKTRKTVQ  E
Sbjct  1    MATPPNSRLH--TMLRASVQSVQWTYSLFWQLCPQQGILTWGDGYYNGAIKTRKTVQAME  58

Query  339  VSAEEASLHRSQQIKELYESLSATAEESNGGGGQQPARRPSAALSPEDLTESEWFYLMCI  518
            VS EEASL RS+Q++ELYESLS  AEE+         RRP AALSPEDLTESEWFYL+C+
Sbjct  59   VSTEEASLQRSEQLRELYESLS--AEETINTQ----TRRPCAALSPEDLTESEWFYLLCV  112

Query  519  SFSFPSAVGL  548
            SFSF   +GL
Sbjct  113  SFSFHLGIGL  122



>gb|KHN45359.1| Transcription factor TT8 [Glycine soja]
Length=583

 Score =   168 bits (425),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 85/130 (65%), Positives = 96/130 (74%), Gaps = 8/130 (6%)
 Frame = +3

Query  159  MAETPGGAAHLQTLLQTAVQSVHWTYSLFWNLCPHNGMLVWSDGYYNGAIKTRKTVQGTE  338
            MA  P    H  T+L+ +VQSV WTYSLFW LCP  G+L W DGYYNGAIKTRKTVQ  E
Sbjct  1    MATPPNSRLH--TMLRASVQSVQWTYSLFWQLCPQQGILTWGDGYYNGAIKTRKTVQAME  58

Query  339  VSAEEASLHRSQQIKELYESLSATAEESNGGGGQQPARRPSAALSPEDLTESEWFYLMCI  518
            VS EEASL RS+Q++ELYESLS  AEE+         RRP AALSPEDLTESEWFYL+C+
Sbjct  59   VSTEEASLQRSEQLRELYESLS--AEETINTQ----TRRPCAALSPEDLTESEWFYLLCV  112

Query  519  SFSFPSAVGL  548
            SFSF   +GL
Sbjct  113  SFSFHLGIGL  122



>dbj|BAM84241.1| bHLH transcription factor [Dahlia pinnata]
Length=658

 Score =   168 bits (426),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 76/125 (61%), Positives = 92/125 (74%), Gaps = 0/125 (0%)
 Frame = +3

Query  174  GGAAHLQTLLQTAVQSVHWTYSLFWNLCPHNGMLVWSDGYYNGAIKTRKTVQGTEVSAEE  353
              A  L+ +LQ+AVQSV WTY + W  CP   +LVW DGYYNGAIKTRKTVQ  EVS EE
Sbjct  12   AAADGLKEMLQSAVQSVQWTYIIIWQFCPQRRVLVWGDGYYNGAIKTRKTVQPVEVSTEE  71

Query  354  ASLHRSQQIKELYESLSATAEESNGGGGQQPARRPSAALSPEDLTESEWFYLMCISFSFP  533
            A+L RS+Q++ELY+SL++  ++          RRPS ALSPEDLTE+EWFYLMC+SFSFP
Sbjct  72   AALSRSEQLRELYDSLASGEQQVTENQQAATVRRPSVALSPEDLTEAEWFYLMCVSFSFP  131

Query  534  SAVGL  548
              VGL
Sbjct  132  PGVGL  136



>dbj|BAM84238.1| bHLH transcription factor [Dahlia pinnata]
Length=652

 Score =   167 bits (422),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 75/120 (63%), Positives = 91/120 (76%), Gaps = 0/120 (0%)
 Frame = +3

Query  189  LQTLLQTAVQSVHWTYSLFWNLCPHNGMLVWSDGYYNGAIKTRKTVQGTEVSAEEASLHR  368
            L+ +LQ+AVQSV WTY + W  CP   +LVW DGYYNGAIKTRKTVQ  EVS EEA+L R
Sbjct  22   LKEMLQSAVQSVQWTYIIIWQFCPERRVLVWGDGYYNGAIKTRKTVQPVEVSTEEAALSR  81

Query  369  SQQIKELYESLSATAEESNGGGGQQPARRPSAALSPEDLTESEWFYLMCISFSFPSAVGL  548
            S+Q++ELY+SL++  ++          RRPS ALSPEDLTE+EWFYLMC+SFSFP  VGL
Sbjct  82   SEQLRELYDSLASGEQQVAENQQAATVRRPSVALSPEDLTEAEWFYLMCVSFSFPPGVGL  141



>dbj|BAJ33515.1| bHLH transcriptional factor [Dahlia pinnata]
 dbj|BAJ33520.1| bHLH transcriptional factor [Dahlia pinnata]
Length=649

 Score =   166 bits (421),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 74/120 (62%), Positives = 91/120 (76%), Gaps = 0/120 (0%)
 Frame = +3

Query  189  LQTLLQTAVQSVHWTYSLFWNLCPHNGMLVWSDGYYNGAIKTRKTVQGTEVSAEEASLHR  368
            L+ +LQ+A+QSV WTY + W  CP   +LVW DGYYNGAIKTRKTVQ  EVS EEA+L R
Sbjct  22   LKEMLQSAIQSVQWTYIIIWQFCPERRVLVWGDGYYNGAIKTRKTVQPVEVSTEEAALSR  81

Query  369  SQQIKELYESLSATAEESNGGGGQQPARRPSAALSPEDLTESEWFYLMCISFSFPSAVGL  548
            S+Q++ELY+SL++  ++          RRPS ALSPEDLTE+EWFYLMC+SFSFP  VGL
Sbjct  82   SEQLRELYDSLASGEQQVAENQQAATVRRPSVALSPEDLTEAEWFYLMCVSFSFPPGVGL  141



>pir||T04030 hypothetical protein F17A8.170 - Arabidopsis thaliana
 emb|CAB39649.1| putative protein [Arabidopsis thaliana]
 emb|CAB78105.1| putative protein [Arabidopsis thaliana]
Length=379

 Score =   161 bits (408),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 81/135 (60%), Positives = 94/135 (70%), Gaps = 10/135 (7%)
 Frame = +3

Query  150  SIVMAETPGGA--AHLQTLLQTAVQSVHWTYSLFWNLCPHNGMLVWSDGYYNGAIKTRKT  323
            SI+ AE   GA    LQ LL+TAVQSV WTYS+FW  CP   +LVW +GYYNGAIKTRKT
Sbjct  5    SIIPAEKVAGAEKKELQGLLKTAVQSVDWTYSVFWQFCPQQRVLVWGNGYYNGAIKTRKT  64

Query  324  VQGTEVSAEEASLHRSQQIKELYESLSATAEESNGGGGQQPARRPSAALSPEDLTESEWF  503
             Q  EV+AEEA+L RSQQ++ELYE+L A        G      R   ALSPEDLTE+EWF
Sbjct  65   TQPAEVTAEEAALERSQQLRELYETLLA--------GESTSEARACTALSPEDLTETEWF  116

Query  504  YLMCISFSFPSAVGL  548
            YLMC+SFSFP   G+
Sbjct  117  YLMCVSFSFPPPSGM  131



>emb|CAC14865.1| transparent testa 8 [Arabidopsis thaliana]
Length=518

 Score =   161 bits (407),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 81/135 (60%), Positives = 94/135 (70%), Gaps = 10/135 (7%)
 Frame = +3

Query  150  SIVMAETPGGA--AHLQTLLQTAVQSVHWTYSLFWNLCPHNGMLVWSDGYYNGAIKTRKT  323
            SI+ AE   GA    LQ LL+TAVQSV WTYS+FW  CP   +LVW +GYYNGAIKTRKT
Sbjct  5    SIIPAEKVAGAEKKELQGLLKTAVQSVDWTYSVFWQFCPQQRVLVWGNGYYNGAIKTRKT  64

Query  324  VQGTEVSAEEASLHRSQQIKELYESLSATAEESNGGGGQQPARRPSAALSPEDLTESEWF  503
             Q  EV+AEEA+L RSQQ++ELYE+L A        G      R   ALSPEDLTE+EWF
Sbjct  65   TQPAEVTAEEAALERSQQLRELYETLLA--------GESTSEARACTALSPEDLTETEWF  116

Query  504  YLMCISFSFPSAVGL  548
            YLMC+SFSFP   G+
Sbjct  117  YLMCVSFSFPPPSGM  131



>ref|NP_192720.2| transcription factor TT8 [Arabidopsis thaliana]
 sp|Q9FT81.2|TT8_ARATH RecName: Full=Transcription factor TT8; AltName: Full=Basic helix-loop-helix 
protein 42; Short=AtbHLH42; Short=bHLH 42; AltName: 
Full=Protein TRANSPARENT TESTA 8; AltName: Full=Transcription 
factor EN 32; AltName: Full=bHLH transcription factor 
042 [Arabidopsis thaliana]
 gb|ABE66051.1| basic helix-loop-helix family protein [Arabidopsis thaliana]
 gb|AEE82802.1| transcription factor TT8 [Arabidopsis thaliana]
Length=518

 Score =   161 bits (407),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 81/135 (60%), Positives = 94/135 (70%), Gaps = 10/135 (7%)
 Frame = +3

Query  150  SIVMAETPGGA--AHLQTLLQTAVQSVHWTYSLFWNLCPHNGMLVWSDGYYNGAIKTRKT  323
            SI+ AE   GA    LQ LL+TAVQSV WTYS+FW  CP   +LVW +GYYNGAIKTRKT
Sbjct  5    SIIPAEKVAGAEKKELQGLLKTAVQSVDWTYSVFWQFCPQQRVLVWGNGYYNGAIKTRKT  64

Query  324  VQGTEVSAEEASLHRSQQIKELYESLSATAEESNGGGGQQPARRPSAALSPEDLTESEWF  503
             Q  EV+AEEA+L RSQQ++ELYE+L A        G      R   ALSPEDLTE+EWF
Sbjct  65   TQPAEVTAEEAALERSQQLRELYETLLA--------GESTSEARACTALSPEDLTETEWF  116

Query  504  YLMCISFSFPSAVGL  548
            YLMC+SFSFP   G+
Sbjct  117  YLMCVSFSFPPPSGM  131



>gb|ABK28624.1| unknown [Arabidopsis thaliana]
Length=519

 Score =   161 bits (407),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 81/135 (60%), Positives = 94/135 (70%), Gaps = 10/135 (7%)
 Frame = +3

Query  150  SIVMAETPGGA--AHLQTLLQTAVQSVHWTYSLFWNLCPHNGMLVWSDGYYNGAIKTRKT  323
            SI+ AE   GA    LQ LL+TAVQSV WTYS+FW  CP   +LVW +GYYNGAIKTRKT
Sbjct  5    SIIPAEKVAGAEKKELQGLLKTAVQSVDWTYSVFWQFCPQQRVLVWGNGYYNGAIKTRKT  64

Query  324  VQGTEVSAEEASLHRSQQIKELYESLSATAEESNGGGGQQPARRPSAALSPEDLTESEWF  503
             Q  EV+AEEA+L RSQQ++ELYE+L A        G      R   ALSPEDLTE+EWF
Sbjct  65   TQPAEVTAEEAALERSQQLRELYETLLA--------GESTSEARACTALSPEDLTETEWF  116

Query  504  YLMCISFSFPSAVGL  548
            YLMC+SFSFP   G+
Sbjct  117  YLMCVSFSFPPPSGM  131



>ref|XP_006397140.1| hypothetical protein EUTSA_v10028584mg [Eutrema salsugineum]
 gb|ESQ38593.1| hypothetical protein EUTSA_v10028584mg [Eutrema salsugineum]
Length=514

 Score =   160 bits (405),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 81/135 (60%), Positives = 94/135 (70%), Gaps = 10/135 (7%)
 Frame = +3

Query  150  SIVMAETPGGAAH--LQTLLQTAVQSVHWTYSLFWNLCPHNGMLVWSDGYYNGAIKTRKT  323
            SI+ AE   GA    LQ LL+ AVQSV WTYS+FW LCP   +LVW +GYYNGAIKTRKT
Sbjct  5    SIIPAEKVIGAERRELQGLLKAAVQSVEWTYSIFWQLCPQQRVLVWENGYYNGAIKTRKT  64

Query  324  VQGTEVSAEEASLHRSQQIKELYESLSATAEESNGGGGQQPARRPSAALSPEDLTESEWF  503
             Q  EV+AEEA+L RSQQ++ELYE+L A        G      R   ALSPEDLTE+EWF
Sbjct  65   TQPAEVTAEEAALERSQQLRELYETLLA--------GESSSETRACTALSPEDLTETEWF  116

Query  504  YLMCISFSFPSAVGL  548
            YLMC+SFSFP   G+
Sbjct  117  YLMCVSFSFPPPSGM  131



>ref|XP_002872462.1| hypothetical protein ARALYDRAFT_489834 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH48721.1| hypothetical protein ARALYDRAFT_489834 [Arabidopsis lyrata subsp. 
lyrata]
Length=518

 Score =   159 bits (401),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 80/135 (59%), Positives = 93/135 (69%), Gaps = 10/135 (7%)
 Frame = +3

Query  150  SIVMAETPGGAA--HLQTLLQTAVQSVHWTYSLFWNLCPHNGMLVWSDGYYNGAIKTRKT  323
            SI+ AE   GA    LQ LL+TAVQ V WTYS+FW  CP   +LVW+ GYYNGAIKTRKT
Sbjct  5    SIIPAEKVAGAEKRELQGLLKTAVQFVEWTYSVFWQFCPQQRVLVWASGYYNGAIKTRKT  64

Query  324  VQGTEVSAEEASLHRSQQIKELYESLSATAEESNGGGGQQPARRPSAALSPEDLTESEWF  503
             Q  EV+AEEA+L RSQQ++ELYE+L A        G      R   ALSPEDLTE+EWF
Sbjct  65   TQPAEVTAEEAALERSQQLRELYETLLA--------GESTSEARACTALSPEDLTETEWF  116

Query  504  YLMCISFSFPSAVGL  548
            YLMC+SFSFP   G+
Sbjct  117  YLMCVSFSFPPPSGM  131



>ref|XP_010455373.1| PREDICTED: transcription factor TT8-like [Camelina sativa]
Length=521

 Score =   156 bits (394),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 79/135 (59%), Positives = 91/135 (67%), Gaps = 10/135 (7%)
 Frame = +3

Query  150  SIVMAETPGGAA--HLQTLLQTAVQSVHWTYSLFWNLCPHNGMLVWSDGYYNGAIKTRKT  323
            SI+  E   GA    LQ LL+ AVQSV WTYSLFW  CP   +LVW +GYYNGAIKTRKT
Sbjct  5    SIIPTEKSAGAEKRELQGLLKEAVQSVEWTYSLFWQFCPQQRVLVWGNGYYNGAIKTRKT  64

Query  324  VQGTEVSAEEASLHRSQQIKELYESLSATAEESNGGGGQQPARRPSAALSPEDLTESEWF  503
             Q  EV+AEEA+L RSQQ++ELYE+L A        G      R   ALSPEDLTE+EWF
Sbjct  65   TQPAEVTAEEATLERSQQLRELYETLLA--------GESTSEARACTALSPEDLTETEWF  116

Query  504  YLMCISFSFPSAVGL  548
            YLMC+SFSF    G+
Sbjct  117  YLMCVSFSFSPPSGM  131



>ref|XP_006289065.1| hypothetical protein CARUB_v10002462mg [Capsella rubella]
 gb|EOA21963.1| hypothetical protein CARUB_v10002462mg [Capsella rubella]
Length=520

 Score =   155 bits (393),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 78/135 (58%), Positives = 91/135 (67%), Gaps = 10/135 (7%)
 Frame = +3

Query  150  SIVMAETPGG--AAHLQTLLQTAVQSVHWTYSLFWNLCPHNGMLVWSDGYYNGAIKTRKT  323
            SI+  E   G     LQ LL+ AVQSV WTYS+FW  CP   +LVW +GYYNGAIKTRKT
Sbjct  6    SIIPVEKVAGDEKRELQGLLKAAVQSVEWTYSVFWQYCPQQRVLVWGNGYYNGAIKTRKT  65

Query  324  VQGTEVSAEEASLHRSQQIKELYESLSATAEESNGGGGQQPARRPSAALSPEDLTESEWF  503
             Q  EV+AEEA+L RSQQ++ELYE+L A        G      R   ALSPEDLTE+EWF
Sbjct  66   TQPAEVTAEEAALERSQQLRELYETLLA--------GESTSEARACTALSPEDLTETEWF  117

Query  504  YLMCISFSFPSAVGL  548
            YLMC+SFSFP   G+
Sbjct  118  YLMCVSFSFPPPSGM  132



>ref|XP_010437974.1| PREDICTED: LOW QUALITY PROTEIN: transcription factor TT8-like 
[Camelina sativa]
Length=513

 Score =   154 bits (389),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 78/135 (58%), Positives = 91/135 (67%), Gaps = 10/135 (7%)
 Frame = +3

Query  150  SIVMAETPGGAA--HLQTLLQTAVQSVHWTYSLFWNLCPHNGMLVWSDGYYNGAIKTRKT  323
            SI+  E   GA    LQ LL+ AVQSV WTYSLFW  CP   +LVW +GYYNGAIKTRKT
Sbjct  5    SIIPTEKSAGAEKRELQGLLKEAVQSVEWTYSLFWQFCPQQRVLVWGNGYYNGAIKTRKT  64

Query  324  VQGTEVSAEEASLHRSQQIKELYESLSATAEESNGGGGQQPARRPSAALSPEDLTESEWF  503
             Q  EV+AEEA+L RSQQ++ELY++L A        G      R   ALSPEDLTE+EWF
Sbjct  65   TQPAEVTAEEAALERSQQLRELYQTLLA--------GESTSEARACTALSPEDLTETEWF  116

Query  504  YLMCISFSFPSAVGL  548
            YLMC+SFSF    G+
Sbjct  117  YLMCVSFSFSPPSGI  131



>ref|XP_010421888.1| PREDICTED: transcription factor TT8 [Camelina sativa]
Length=515

 Score =   152 bits (385),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 77/130 (59%), Positives = 88/130 (68%), Gaps = 10/130 (8%)
 Frame = +3

Query  165  ETPGGA--AHLQTLLQTAVQSVHWTYSLFWNLCPHNGMLVWSDGYYNGAIKTRKTVQGTE  338
            E   GA    LQ LL+ AVQSV WTYSLFW  CP   +LVW +GYYNGAIKTRKT Q  E
Sbjct  10   EKSAGADKRELQGLLKEAVQSVEWTYSLFWQFCPQQRVLVWGNGYYNGAIKTRKTTQPAE  69

Query  339  VSAEEASLHRSQQIKELYESLSATAEESNGGGGQQPARRPSAALSPEDLTESEWFYLMCI  518
            V+AEEA+L RSQQ++ELYE+L A        G      R   ALSPEDLTE+EWFYLMC+
Sbjct  70   VTAEEAALERSQQLRELYETLLA--------GESTSEARACTALSPEDLTETEWFYLMCV  121

Query  519  SFSFPSAVGL  548
            SFSF    G+
Sbjct  122  SFSFSPPSGM  131



>gb|KFK32044.1| hypothetical protein AALP_AA6G192900 [Arabis alpina]
Length=529

 Score =   152 bits (384),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 74/121 (61%), Positives = 84/121 (69%), Gaps = 8/121 (7%)
 Frame = +3

Query  186  HLQTLLQTAVQSVHWTYSLFWNLCPHNGMLVWSDGYYNGAIKTRKTVQGTEVSAEEASLH  365
             LQ LL+ AVQSV WTYSLFW LCP   +LVW +GYYNGAIKTRKT Q  EV+ EEA+L 
Sbjct  20   ELQELLKAAVQSVEWTYSLFWQLCPQQRVLVWGNGYYNGAIKTRKTTQPKEVTTEEAALE  79

Query  366  RSQQIKELYESLSATAEESNGGGGQQPARRPSAALSPEDLTESEWFYLMCISFSFPSAVG  545
            RSQQI+ELYE+L A        G      R   ALSPEDLTE+EWFYLMC SF+F    G
Sbjct  80   RSQQIRELYETLLA--------GESSTEARACTALSPEDLTETEWFYLMCASFTFSPPSG  131

Query  546  L  548
            +
Sbjct  132  M  132



>gb|ABR17818.1| unknown [Picea sitchensis]
Length=757

 Score =   150 bits (380),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 75/131 (57%), Positives = 91/131 (69%), Gaps = 9/131 (7%)
 Frame = +3

Query  156  VMAETPGGAAHLQTLLQTAVQSVHWTYSLFWNLCPHNGMLVWSDGYYNGAIKTRKTVQGT  335
            VMA     A   Q  L++ VQS+ WTYS+FW L    G+L WSDGYYNG IKTRKTVQ  
Sbjct  8    VMASANSSAIRKQ--LESVVQSIQWTYSIFWQLSNQQGVLEWSDGYYNGDIKTRKTVQPM  65

Query  336  EVSAEEASLHRSQQIKELYESLSATAEESNGGGGQQPARRPSAALSPEDLTESEWFYLMC  515
            E+S EE  L R+ Q++ELYESLSA       G   QPARRP AALSPEDLT++EW+YL+C
Sbjct  66   ELSNEELCLQRTLQLRELYESLSA-------GESNQPARRPCAALSPEDLTDTEWYYLVC  118

Query  516  ISFSFPSAVGL  548
            +S++F   VGL
Sbjct  119  MSYTFAPGVGL  129



>tpg|DAA60017.1| TPA: intensifier1 [Zea mays]
 gb|AIB04534.1| bHLH transcription factor, partial [Zea mays]
Length=405

 Score =   146 bits (369),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 74/141 (52%), Positives = 88/141 (62%), Gaps = 22/141 (16%)
 Frame = +3

Query  192  QTLLQTAVQSVHWTYSLFWNLCPHNGMLVWSDGYYNGAIKTRKTVQGT--------EVSA  347
            Q  LQ+  QS  WTYSL W LCP  G LVW++GYYNGAI+TRKT   T        +   
Sbjct  12   QKALQSVAQSTGWTYSLLWRLCPRQGALVWAEGYYNGAIRTRKTTMTTVRQPAGAEDAGD  71

Query  348  EEASLHRSQQIKELYESLSATAEESNGGGG--------------QQPARRPSAALSPEDL  485
            EE +L RS+Q+KELY+SL+A     +GGGG                P RRP AAL+PEDL
Sbjct  72   EETALRRSRQLKELYDSLAAGEAAYDGGGGVGDPQQQHQQQVAVVPPPRRPVAALAPEDL  131

Query  486  TESEWFYLMCISFSFPSAVGL  548
            TE+EWFYLMC S+ FP AVGL
Sbjct  132  TETEWFYLMCASYCFPPAVGL  152



>ref|XP_008652187.1| PREDICTED: LOW QUALITY PROTEIN: basic helix-loop-helix protein 
A [Zea mays]
Length=750

 Score =   147 bits (371),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 74/141 (52%), Positives = 88/141 (62%), Gaps = 22/141 (16%)
 Frame = +3

Query  192  QTLLQTAVQSVHWTYSLFWNLCPHNGMLVWSDGYYNGAIKTRKTVQGT--------EVSA  347
            Q  LQ+  QS  WTYSL W LCP  G LVW++GYYNGAI+TRKT   T        +   
Sbjct  80   QKALQSVAQSTGWTYSLLWRLCPRQGALVWAEGYYNGAIRTRKTTMTTVRQPAGAEDAGD  139

Query  348  EEASLHRSQQIKELYESLSATAEESNGGGG--------------QQPARRPSAALSPEDL  485
            EE +L RS+Q+KELY+SL+A     +GGGG                P RRP AAL+PEDL
Sbjct  140  EETALRRSRQLKELYDSLAAGEAAYDGGGGVGDPQQQHQQQVAVVPPPRRPVAALAPEDL  199

Query  486  TESEWFYLMCISFSFPSAVGL  548
            TE+EWFYLMC S+ FP AVGL
Sbjct  200  TETEWFYLMCASYCFPPAVGL  220



>ref|XP_010230009.1| PREDICTED: basic helix-loop-helix protein A-like [Brachypodium 
distachyon]
Length=670

 Score =   146 bits (368),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 72/134 (54%), Positives = 89/134 (66%), Gaps = 18/134 (13%)
 Frame = +3

Query  201  LQTAVQSVHWTYSLFWNLCPHNGMLVWSDGYYNGAIKTRKTVQ-----GTEVSAEEASLH  365
            LQ   Q + WTY+L W LCP  G LVW++G+YNGAIKTRKTVQ     G    A++A+ H
Sbjct  11   LQAVAQGLRWTYALLWQLCPDQGALVWAEGHYNGAIKTRKTVQQAHGHGAPAPADQAARH  70

Query  366  RSQQIKELYESLSATAEESNGGGG-------------QQPARRPSAALSPEDLTESEWFY  506
            RS+Q+KEL+ESL+  A    G GG             +  ARRP+AAL+PEDLTE+EWFY
Sbjct  71   RSRQLKELFESLAREAAACGGPGGIMMMTGCRAEAVQEASARRPTAALAPEDLTETEWFY  130

Query  507  LMCISFSFPSAVGL  548
            LMC S+SFP  VGL
Sbjct  131  LMCASYSFPPHVGL  144



>ref|XP_010545177.1| PREDICTED: truncated basic helix-loop-helix protein A [Tarenaya 
hassleriana]
Length=556

 Score =   143 bits (361),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 79/124 (64%), Positives = 89/124 (72%), Gaps = 10/124 (8%)
 Frame = +3

Query  177  GAAHLQTLLQTAVQSVHWTYSLFWNLCPHNGMLVWSDGYYNGAIKTRKTVQGTEVSAEEA  356
            G+  LQ +LQ AVQSV WTYSLFW  CP    LVW +GYYNGAIKTRKTVQ  E +AEEA
Sbjct  2    GSRCLQEMLQAAVQSVRWTYSLFWQFCPQQRGLVWGEGYYNGAIKTRKTVQPAEETAEEA  61

Query  357  SLHRSQQIKELYESLSATAEESNGGGGQQPARRPSAALSPEDLTESEWFYLMCISFSFPS  536
            +  RS Q++ELY SL A AE++         +RPS ALSPEDLTESEWFYLMC SFSFP 
Sbjct  62   AGQRSHQLRELYHSLLA-AEDT---------KRPSTALSPEDLTESEWFYLMCASFSFPP  111

Query  537  AVGL  548
              GL
Sbjct  112  PSGL  115



>gb|AEO53065.1| transcription factor TT8 [Raphanus sativus var. niger]
Length=313

 Score =   140 bits (352),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 69/135 (51%), Positives = 87/135 (64%), Gaps = 12/135 (9%)
 Frame = +3

Query  144  AWSIVMAETPGGAAHLQTLLQTAVQSVHWTYSLFWNLCPHNGMLVWSDGYYNGAIKTRKT  323
             W ++ AE       +Q LL+  VQSV WTYSLFW LCP    LVWS G+YNGAIKTRKT
Sbjct  9    VWKVIGAE----EKEIQGLLKAVVQSVGWTYSLFWQLCPQRRKLVWSSGFYNGAIKTRKT  64

Query  324  VQGTEVSAEEASLHRSQQIKELYESLSATAEESNGGGGQQPARRPSAALSPEDLTESEWF  503
             Q  E+ AEEA+L RSQQ+ ELY++L A        G      R   ALSPEDLT++EWF
Sbjct  65   TQPAEIMAEEAALERSQQLMELYQTLFA--------GESSMEARACTALSPEDLTDTEWF  116

Query  504  YLMCISFSFPSAVGL  548
            Y++C+++SF    G+
Sbjct  117  YVLCLTYSFEPPSGM  131



>ref|XP_011022678.1| PREDICTED: transcription factor GLABRA 3 isoform X1 [Populus 
euphratica]
Length=634

 Score =   140 bits (352),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 68/122 (56%), Positives = 89/122 (73%), Gaps = 8/122 (7%)
 Frame = +3

Query  186  HLQTLLQTAVQSVHWTYSLFW-NLCPHNGMLVWSDGYYNGAIKTRKTVQGTEVSAEEASL  362
            +L+  L  AV+S+ W+Y++FW N    +G+L W+DGYYNG IKTRKTVQ  E++A+E  L
Sbjct  14   NLKKQLALAVRSIQWSYAIFWSNPTGQSGVLEWADGYYNGDIKTRKTVQSLELNADELGL  73

Query  363  HRSQQIKELYESLSATAEESNGGGGQQPARRPSAALSPEDLTESEWFYLMCISFSFPSAV  542
             RS+Q++ELYESLSA       G     ARRPSAALSPEDLT++EW+YL+C+SF F S  
Sbjct  74   QRSEQLRELYESLSA-------GEANPQARRPSAALSPEDLTDTEWYYLVCMSFVFDSGQ  126

Query  543  GL  548
            GL
Sbjct  127  GL  128



>ref|XP_011022679.1| PREDICTED: transcription factor GLABRA 3 isoform X2 [Populus 
euphratica]
Length=629

 Score =   140 bits (352),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 68/122 (56%), Positives = 89/122 (73%), Gaps = 8/122 (7%)
 Frame = +3

Query  186  HLQTLLQTAVQSVHWTYSLFW-NLCPHNGMLVWSDGYYNGAIKTRKTVQGTEVSAEEASL  362
            +L+  L  AV+S+ W+Y++FW N    +G+L W+DGYYNG IKTRKTVQ  E++A+E  L
Sbjct  14   NLKKQLALAVRSIQWSYAIFWSNPTGQSGVLEWADGYYNGDIKTRKTVQSLELNADELGL  73

Query  363  HRSQQIKELYESLSATAEESNGGGGQQPARRPSAALSPEDLTESEWFYLMCISFSFPSAV  542
             RS+Q++ELYESLSA       G     ARRPSAALSPEDLT++EW+YL+C+SF F S  
Sbjct  74   QRSEQLRELYESLSA-------GEANPQARRPSAALSPEDLTDTEWYYLVCMSFVFDSGQ  126

Query  543  GL  548
            GL
Sbjct  127  GL  128



>gb|AAS86304.1| myc-like anthocyanin regulatory protein [Cornus unalaschkensis]
Length=624

 Score =   139 bits (350),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 69/126 (55%), Positives = 90/126 (71%), Gaps = 8/126 (6%)
 Frame = +3

Query  174  GGAAHLQTLLQTAVQSVHWTYSLFWNLCPHN-GMLVWSDGYYNGAIKTRKTVQGTEVSAE  350
            G   +L+  L  AV+S+ W+Y++FW++     G+L W DGYYNG IKTRKTVQ  E +A+
Sbjct  11   GLLENLKNRLAIAVRSIQWSYAIFWSISSRQPGVLEWGDGYYNGDIKTRKTVQAVEFNAD  70

Query  351  EASLHRSQQIKELYESLSATAEESNGGGGQQPARRPSAALSPEDLTESEWFYLMCISFSF  530
            +  L RS+Q+KELYESL+ T  ESN     Q ARRPSAALSPEDLT++EW+YL+C+SF F
Sbjct  71   QLGLQRSEQLKELYESLAVT--ESN-----QQARRPSAALSPEDLTDTEWYYLVCMSFVF  123

Query  531  PSAVGL  548
                GL
Sbjct  124  NIGQGL  129



>gb|AAS86282.1| myc-like anthocyanin regulatory protein [Cornus cf. canadensis 
Xiang and Fan 9-1]
Length=625

 Score =   139 bits (349),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 69/126 (55%), Positives = 90/126 (71%), Gaps = 8/126 (6%)
 Frame = +3

Query  174  GGAAHLQTLLQTAVQSVHWTYSLFWNLCPHN-GMLVWSDGYYNGAIKTRKTVQGTEVSAE  350
            G   +L+  L  AV+S+ W+Y++FW++     G+L W DGYYNG IKTRKTVQ  E +A+
Sbjct  11   GLLENLKNRLAIAVRSIQWSYAIFWSISSRQPGVLEWGDGYYNGDIKTRKTVQAVEFNAD  70

Query  351  EASLHRSQQIKELYESLSATAEESNGGGGQQPARRPSAALSPEDLTESEWFYLMCISFSF  530
            +  L RS+Q+KELYESL+ T  ESN     Q ARRPSAALSPEDLT++EW+YL+C+SF F
Sbjct  71   QLGLQRSEQLKELYESLAVT--ESN-----QQARRPSAALSPEDLTDTEWYYLVCMSFVF  123

Query  531  PSAVGL  548
                GL
Sbjct  124  NIGQGL  129



>gb|AAS86267.1| myc-like anthocyanin regulatory protein [Cornus canadensis]
Length=620

 Score =   139 bits (349),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 68/122 (56%), Positives = 89/122 (73%), Gaps = 8/122 (7%)
 Frame = +3

Query  186  HLQTLLQTAVQSVHWTYSLFWNLCPHN-GMLVWSDGYYNGAIKTRKTVQGTEVSAEEASL  362
            +L+  L  AV+S+ W+Y++FW++     G+L W DGYYNG IKTRKTVQ  E +A++  L
Sbjct  15   NLKNRLAIAVRSIQWSYAIFWSISSRQPGVLEWGDGYYNGDIKTRKTVQAVEFNADQLGL  74

Query  363  HRSQQIKELYESLSATAEESNGGGGQQPARRPSAALSPEDLTESEWFYLMCISFSFPSAV  542
             RS+Q+KELYESL+ T  ESN     Q ARRPSAALSPEDLT++EW+YL+C+SF F    
Sbjct  75   QRSEQLKELYESLAVT--ESN-----QQARRPSAALSPEDLTDTEWYYLVCMSFVFNIGQ  127

Query  543  GL  548
            GL
Sbjct  128  GL  129



>gb|AAR21665.1| myc-like anthocyanin regulatory protein [Cornus canadensis]
Length=620

 Score =   139 bits (349),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 68/122 (56%), Positives = 89/122 (73%), Gaps = 8/122 (7%)
 Frame = +3

Query  186  HLQTLLQTAVQSVHWTYSLFWNLCPHN-GMLVWSDGYYNGAIKTRKTVQGTEVSAEEASL  362
            +L+  L  AV+S+ W+Y++FW++     G+L W DGYYNG IKTRKTVQ  E +A++  L
Sbjct  15   NLKNRLAIAVRSIQWSYAIFWSISSRQPGVLEWGDGYYNGDIKTRKTVQAVEFNADQLGL  74

Query  363  HRSQQIKELYESLSATAEESNGGGGQQPARRPSAALSPEDLTESEWFYLMCISFSFPSAV  542
             RS+Q+KELYESL+ T  ESN     Q ARRPSAALSPEDLT++EW+YL+C+SF F    
Sbjct  75   QRSEQLKELYESLAVT--ESN-----QQARRPSAALSPEDLTDTEWYYLVCMSFVFNIGQ  127

Query  543  GL  548
            GL
Sbjct  128  GL  129



>gb|AAS86272.1| myc-like anthocyanin regulatory protein [Cornus canadensis]
Length=620

 Score =   139 bits (349),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 68/122 (56%), Positives = 89/122 (73%), Gaps = 8/122 (7%)
 Frame = +3

Query  186  HLQTLLQTAVQSVHWTYSLFWNLCPHN-GMLVWSDGYYNGAIKTRKTVQGTEVSAEEASL  362
            +L+  L  AV+S+ W+Y++FW++     G+L W DGYYNG IKTRKTVQ  E +A++  L
Sbjct  15   NLKNRLAIAVRSIQWSYAIFWSISSRQPGVLEWGDGYYNGDIKTRKTVQAVEFNADQLGL  74

Query  363  HRSQQIKELYESLSATAEESNGGGGQQPARRPSAALSPEDLTESEWFYLMCISFSFPSAV  542
             RS+Q+KELYESL+ T  ESN     Q ARRPSAALSPEDLT++EW+YL+C+SF F    
Sbjct  75   QRSEQLKELYESLAVT--ESN-----QQARRPSAALSPEDLTDTEWYYLVCMSFVFNIGQ  127

Query  543  GL  548
            GL
Sbjct  128  GL  129



>gb|AAS86281.1| myc-like anthocyanin regulatory protein [Cornus unalaschkensis]
Length=625

 Score =   138 bits (348),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 68/122 (56%), Positives = 89/122 (73%), Gaps = 8/122 (7%)
 Frame = +3

Query  186  HLQTLLQTAVQSVHWTYSLFWNLCPHN-GMLVWSDGYYNGAIKTRKTVQGTEVSAEEASL  362
            +L+  L  AV+S+ W+Y++FW++     G+L W DGYYNG IKTRKTVQ  E +A++  L
Sbjct  15   NLKNRLAIAVRSIQWSYAIFWSISSRQPGVLEWGDGYYNGDIKTRKTVQAVEFNADQLGL  74

Query  363  HRSQQIKELYESLSATAEESNGGGGQQPARRPSAALSPEDLTESEWFYLMCISFSFPSAV  542
             RS+Q+KELYESL+ T  ESN     Q ARRPSAALSPEDLT++EW+YL+C+SF F    
Sbjct  75   QRSEQLKELYESLAVT--ESN-----QQARRPSAALSPEDLTDTEWYYLVCMSFVFNIGQ  127

Query  543  GL  548
            GL
Sbjct  128  GL  129



>ref|XP_002303592.1| regulator of anthocyanin biosynthesis pathway family protein 
[Populus trichocarpa]
 gb|EEE78571.1| regulator of anthocyanin biosynthesis pathway family protein 
[Populus trichocarpa]
Length=629

 Score =   138 bits (348),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 67/122 (55%), Positives = 88/122 (72%), Gaps = 8/122 (7%)
 Frame = +3

Query  186  HLQTLLQTAVQSVHWTYSLFW-NLCPHNGMLVWSDGYYNGAIKTRKTVQGTEVSAEEASL  362
            +L+  L  AV+S+ W+Y++FW N     G+L W+DGYYNG IKTRKTVQ  E++A+E  L
Sbjct  14   NLKKQLALAVRSIQWSYAIFWSNPTGQPGVLEWADGYYNGDIKTRKTVQSIELNADELGL  73

Query  363  HRSQQIKELYESLSATAEESNGGGGQQPARRPSAALSPEDLTESEWFYLMCISFSFPSAV  542
             RS+Q++ELYESLSA       G     ARRPSAALSPEDLT++EW+YL+C+SF F +  
Sbjct  74   QRSEQLRELYESLSA-------GEANPQARRPSAALSPEDLTDTEWYYLVCMSFVFDNGQ  126

Query  543  GL  548
            GL
Sbjct  127  GL  128



>emb|CDY45357.1| BnaA09g12420D [Brassica napus]
Length=190

 Score =   131 bits (329),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 63/123 (51%), Positives = 88/123 (72%), Gaps = 4/123 (3%)
 Frame = +3

Query  186  HLQTLLQTAVQSVHWTYSLFWNLCPHN-GMLVWSDGYYNGAIKTRKTVQGTEVSAEEASL  362
            +L+  L  +V+++ W+Y +FW++     G+L W DGYYNG IKTRKT+Q  EV A++  L
Sbjct  12   NLKKHLAVSVRNIQWSYGIFWSISASQPGVLEWGDGYYNGDIKTRKTIQAVEVKADQLGL  71

Query  363  HRSQQIKELYESLSATAEESNGGGGQQPARRPSA-ALSPEDLTESEWFYLMCISFSFPSA  539
             RS+Q++ELYESLS    ES+  GG Q +RR SA ALSPEDLT++EW+YL+C+SF F   
Sbjct  72   ERSEQLRELYESLSVA--ESSASGGSQVSRRASATALSPEDLTDTEWYYLVCMSFVFNIG  129

Query  540  VGL  548
             G+
Sbjct  130  EGI  132



>gb|AIN41653.1| TT8 [Brassica juncea]
Length=521

 Score =   137 bits (344),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 69/134 (51%), Positives = 85/134 (63%), Gaps = 12/134 (9%)
 Frame = +3

Query  147  WSIVMAETPGGAAHLQTLLQTAVQSVHWTYSLFWNLCPHNGMLVWSDGYYNGAIKTRKTV  326
            W ++ AE       +Q LL+  VQSV WTYS+FW LCP    L+WS GYYNGAIKTRKT 
Sbjct  10   WKVIGAE----KEEIQGLLKAVVQSVGWTYSVFWQLCPQRRKLMWSSGYYNGAIKTRKTT  65

Query  327  QGTEVSAEEASLHRSQQIKELYESLSATAEESNGGGGQQPARRPSAALSPEDLTESEWFY  506
            Q  EV+AEEA+  RSQQ+ ELYE+L A        G      R   ALSPEDLT+ EWFY
Sbjct  66   QPAEVTAEEAASERSQQLMELYETLFA--------GESSMEARACTALSPEDLTDPEWFY  117

Query  507  LMCISFSFPSAVGL  548
            ++C ++SF    G+
Sbjct  118  VLCFTYSFEPPSGM  131



>gb|ABY59772.1| bHLH DNA-binding domain transcription factor [Brassica napus]
 gb|ADV03941.1| bHLH DNA binding domain transcription factor BnaA.TT8 [Brassica 
napus]
 gb|AEA03281.1| transparent testa 8 [Brassica rapa subsp. rapa]
 emb|CDX86891.1| BnaA09g22810D [Brassica napus]
 gb|AIP94025.1| bHLH transcription factor [Brassica rapa]
Length=521

 Score =   137 bits (344),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 69/134 (51%), Positives = 85/134 (63%), Gaps = 12/134 (9%)
 Frame = +3

Query  147  WSIVMAETPGGAAHLQTLLQTAVQSVHWTYSLFWNLCPHNGMLVWSDGYYNGAIKTRKTV  326
            W ++ AE       +Q LL+  VQSV WTYS+FW LCP    L+WS GYYNGAIKTRKT 
Sbjct  10   WKVIGAE----KEEIQGLLKAVVQSVGWTYSVFWQLCPQRRKLMWSSGYYNGAIKTRKTT  65

Query  327  QGTEVSAEEASLHRSQQIKELYESLSATAEESNGGGGQQPARRPSAALSPEDLTESEWFY  506
            Q  EV+AEEA+  RSQQ+ ELYE+L A        G      R   ALSPEDLT+ EWFY
Sbjct  66   QPAEVTAEEAASERSQQLMELYETLFA--------GESSMEARACTALSPEDLTDPEWFY  117

Query  507  LMCISFSFPSAVGL  548
            ++C ++SF    G+
Sbjct  118  VLCFTYSFEPPSGM  131



>ref|XP_009113574.1| PREDICTED: transcription factor TT8 [Brassica rapa]
 gb|ADV03943.1| bHLH DNA binding domain transcription factor BraA.TT8 [Brassica 
rapa]
Length=521

 Score =   137 bits (344),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 69/134 (51%), Positives = 85/134 (63%), Gaps = 12/134 (9%)
 Frame = +3

Query  147  WSIVMAETPGGAAHLQTLLQTAVQSVHWTYSLFWNLCPHNGMLVWSDGYYNGAIKTRKTV  326
            W ++ AE       +Q LL+  VQSV WTYS+FW LCP    L+WS GYYNGAIKTRKT 
Sbjct  10   WKVIGAE----KEEIQGLLKAVVQSVGWTYSVFWQLCPQRRKLMWSSGYYNGAIKTRKTT  65

Query  327  QGTEVSAEEASLHRSQQIKELYESLSATAEESNGGGGQQPARRPSAALSPEDLTESEWFY  506
            Q  EV+AEEA+  RSQQ+ ELYE+L A        G      R   ALSPEDLT+ EWFY
Sbjct  66   QPAEVTAEEAASERSQQLMELYETLFA--------GESSMEARACTALSPEDLTDPEWFY  117

Query  507  LMCISFSFPSAVGL  548
            ++C ++SF    G+
Sbjct  118  VLCFTYSFEPPSGM  131



>ref|XP_002967013.1| hypothetical protein SELMODRAFT_87033 [Selaginella moellendorffii]
 gb|EFJ31612.1| hypothetical protein SELMODRAFT_87033 [Selaginella moellendorffii]
Length=393

 Score =   135 bits (341),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 66/122 (54%), Positives = 86/122 (70%), Gaps = 5/122 (4%)
 Frame = +3

Query  189  LQTLLQTAVQSVHWTYSLFWNLCPH-NGMLVWSDGYYNGAIKTRKTV-QGTEVSAEEASL  362
            L+  LQ AVQS+ WTY++FW  CP   G LVWSDGYYNG++KTRKT+    E S EE  L
Sbjct  9    LRQRLQAAVQSIQWTYAVFWKPCPPPQGELVWSDGYYNGSVKTRKTIIVSRERSPEEHGL  68

Query  363  HRSQQIKELYESLSATAEESNGGGGQQPARRPSAALSPEDLTESEWFYLMCISFSFPSAV  542
             RS Q++EL+E+LSA+    +G       RRP+AALSPEDLT++EWFYL+C+S +F    
Sbjct  69   QRSDQLRELFENLSASG---DGSQSSTATRRPTAALSPEDLTDTEWFYLVCMSCTFDPGT  125

Query  543  GL  548
            G+
Sbjct  126  GI  127



>ref|XP_002960995.1| hypothetical protein SELMODRAFT_73360 [Selaginella moellendorffii]
 gb|EFJ38534.1| hypothetical protein SELMODRAFT_73360 [Selaginella moellendorffii]
Length=393

 Score =   135 bits (340),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 66/122 (54%), Positives = 86/122 (70%), Gaps = 5/122 (4%)
 Frame = +3

Query  189  LQTLLQTAVQSVHWTYSLFWNLCPH-NGMLVWSDGYYNGAIKTRKTV-QGTEVSAEEASL  362
            L+  LQ AVQS+ WTY++FW  CP   G LVWSDGYYNG++KTRKT+    E S EE  L
Sbjct  9    LRQRLQAAVQSIQWTYAVFWKPCPPPQGELVWSDGYYNGSVKTRKTIIVSRERSPEEHGL  68

Query  363  HRSQQIKELYESLSATAEESNGGGGQQPARRPSAALSPEDLTESEWFYLMCISFSFPSAV  542
             RS Q++EL+E+LSA+    +G       RRP+AALSPEDLT++EWFYL+C+S +F    
Sbjct  69   QRSDQLRELFENLSASG---DGSQSSTATRRPTAALSPEDLTDTEWFYLVCMSCTFDPGT  125

Query  543  GL  548
            G+
Sbjct  126  GI  127



>ref|XP_010255365.1| PREDICTED: transcription factor GLABRA 3-like [Nelumbo nucifera]
 ref|XP_010255366.1| PREDICTED: transcription factor GLABRA 3-like [Nelumbo nucifera]
Length=684

 Score =   138 bits (347),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 65/122 (53%), Positives = 87/122 (71%), Gaps = 8/122 (7%)
 Frame = +3

Query  186  HLQTLLQTAVQSVHWTYSLFWNLCP-HNGMLVWSDGYYNGAIKTRKTVQGTEVSAEEASL  362
            HL+  L  AV+S+ W+Y++FW++     G+L W DGYYNG IKTRKTVQ  E++ ++  L
Sbjct  19   HLRKQLAFAVRSIQWSYAIFWSISTRQQGVLAWGDGYYNGDIKTRKTVQPMELNTDQMGL  78

Query  363  HRSQQIKELYESLSATAEESNGGGGQQPARRPSAALSPEDLTESEWFYLMCISFSFPSAV  542
             RS+Q++ELYESLSA       G   Q ARRPSAALSPEDL+++EW+YL+C+SF F    
Sbjct  79   QRSEQLRELYESLSA-------GDTNQQARRPSAALSPEDLSDAEWYYLVCMSFVFKPGQ  131

Query  543  GL  548
            GL
Sbjct  132  GL  133



>ref|XP_010278113.1| PREDICTED: basic helix-loop-helix protein A-like isoform X3 [Nelumbo 
nucifera]
Length=672

 Score =   137 bits (344),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 69/93 (74%), Positives = 76/93 (82%), Gaps = 7/93 (8%)
 Frame = +3

Query  270  MLVWSDGYYNGAIKTRKTVQGTEVSAEEASLHRSQQIKELYESLSATAEESNGGGGQQPA  449
            +LVW DGYYNG IKTRKTVQ  EVSAEEASL RSQQ++ELYESLS +  E+N     QPA
Sbjct  20   ILVWGDGYYNGQIKTRKTVQPMEVSAEEASLQRSQQLRELYESLSGS--ETN-----QPA  72

Query  450  RRPSAALSPEDLTESEWFYLMCISFSFPSAVGL  548
            RRPSAALSPEDLTE+EWFYLMC+SFSF   V L
Sbjct  73   RRPSAALSPEDLTETEWFYLMCVSFSFAPGVEL  105



>gb|ACA04013.1| bHLH transcriptional regulator, partial [Diplacus aurantiacus]
Length=324

 Score =   133 bits (334),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 64/87 (74%), Positives = 71/87 (82%), Gaps = 7/87 (8%)
 Frame = +3

Query  288  GYYNGAIKTRKTVQGTEVSAEEASLHRSQQIKELYESLSATAEESNGGGGQQPARRPSAA  467
            GYYNGAIKTRKTVQ TEV+ EEA+LHRSQQ++ELYESLS+        G   PARRP+ A
Sbjct  1    GYYNGAIKTRKTVQPTEVTTEEATLHRSQQLRELYESLSS-------AGAGNPARRPTTA  53

Query  468  LSPEDLTESEWFYLMCISFSFPSAVGL  548
            LSPEDLTESEWFYLMC+SFSFP  VGL
Sbjct  54   LSPEDLTESEWFYLMCVSFSFPPGVGL  80



>gb|AAS86303.1| myc-like anthocyanin regulatory protein [Cornus cf. canadensis 
Xiang and Fan 30-1]
Length=624

 Score =   136 bits (342),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 68/126 (54%), Positives = 89/126 (71%), Gaps = 8/126 (6%)
 Frame = +3

Query  174  GGAAHLQTLLQTAVQSVHWTYSLFWNLCPHN-GMLVWSDGYYNGAIKTRKTVQGTEVSAE  350
            G   +L+  L  AV+S+ W+Y++FW++     G+L W DGYYNG IKTRKTVQ  E +A+
Sbjct  11   GLLENLKNRLAIAVRSIQWSYAIFWSISSRQPGVLEWGDGYYNGDIKTRKTVQAVEFNAD  70

Query  351  EASLHRSQQIKELYESLSATAEESNGGGGQQPARRPSAALSPEDLTESEWFYLMCISFSF  530
            +  L RS+Q+KELYESL+ T  ESN       ARRPSAALSPEDLT++EW+YL+C+SF F
Sbjct  71   QLGLQRSEQLKELYESLAVT--ESN-----PQARRPSAALSPEDLTDTEWYYLVCMSFVF  123

Query  531  PSAVGL  548
                GL
Sbjct  124  NIGQGL  129



>gb|AAS86269.1| myc-like anthocyanin regulatory protein [Cornus cf. canadensis 
Xiang and Fan 14-1]
Length=620

 Score =   136 bits (342),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 67/122 (55%), Positives = 88/122 (72%), Gaps = 8/122 (7%)
 Frame = +3

Query  186  HLQTLLQTAVQSVHWTYSLFWNLCPHN-GMLVWSDGYYNGAIKTRKTVQGTEVSAEEASL  362
            +L+  L  AV+S+ W+Y++FW++     G+L W DGYYNG IKTRKTVQ  E +A++  L
Sbjct  15   NLKNRLAIAVRSIQWSYAIFWSISSRQPGVLEWGDGYYNGDIKTRKTVQAVEFNADQLGL  74

Query  363  HRSQQIKELYESLSATAEESNGGGGQQPARRPSAALSPEDLTESEWFYLMCISFSFPSAV  542
             RS+Q+KELYESL+ T  ESN       ARRPSAALSPEDLT++EW+YL+C+SF F    
Sbjct  75   QRSEQLKELYESLAVT--ESN-----PQARRPSAALSPEDLTDTEWYYLVCMSFVFNIGQ  127

Query  543  GL  548
            GL
Sbjct  128  GL  129



>gb|AAS86279.1| myc-like anthocyanin regulatory protein [Cornus unalaschkensis]
Length=625

 Score =   135 bits (341),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 68/126 (54%), Positives = 89/126 (71%), Gaps = 8/126 (6%)
 Frame = +3

Query  174  GGAAHLQTLLQTAVQSVHWTYSLFWNLCPHN-GMLVWSDGYYNGAIKTRKTVQGTEVSAE  350
            G   +L+  L  AV+S+ W+Y++FW++     G+L W DGYYNG IKTRKTVQ  E +A+
Sbjct  11   GLLENLKNRLAIAVRSIQWSYAIFWSISSRQPGVLEWGDGYYNGDIKTRKTVQAVEFNAD  70

Query  351  EASLHRSQQIKELYESLSATAEESNGGGGQQPARRPSAALSPEDLTESEWFYLMCISFSF  530
            +  L RS+Q+KELYESL+ T  ESN       ARRPSAALSPEDLT++EW+YL+C+SF F
Sbjct  71   QLGLQRSEQLKELYESLAVT--ESN-----PQARRPSAALSPEDLTDTEWYYLVCMSFVF  123

Query  531  PSAVGL  548
                GL
Sbjct  124  NIGQGL  129



>gb|AAS86289.1| myc-like anthocyanin regulatory protein [Cornus unalaschkensis]
 gb|AAS86291.1| myc-like anthocyanin regulatory protein [Cornus unalaschkensis]
Length=625

 Score =   135 bits (341),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 68/126 (54%), Positives = 89/126 (71%), Gaps = 8/126 (6%)
 Frame = +3

Query  174  GGAAHLQTLLQTAVQSVHWTYSLFWNLCPHN-GMLVWSDGYYNGAIKTRKTVQGTEVSAE  350
            G   +L+  L  AV+S+ W+Y++FW++     G+L W DGYYNG IKTRKTVQ  E +A+
Sbjct  11   GLLENLKNRLAIAVRSIQWSYAIFWSISSRQPGVLEWGDGYYNGDIKTRKTVQAVEFNAD  70

Query  351  EASLHRSQQIKELYESLSATAEESNGGGGQQPARRPSAALSPEDLTESEWFYLMCISFSF  530
            +  L RS+Q+KELYESL+ T  ESN       ARRPSAALSPEDLT++EW+YL+C+SF F
Sbjct  71   QLGLQRSEQLKELYESLAVT--ESN-----PQARRPSAALSPEDLTDTEWYYLVCMSFVF  123

Query  531  PSAVGL  548
                GL
Sbjct  124  NIGQGL  129



>gb|AAS86268.1| myc-like anthocyanin regulatory protein [Cornus canadensis]
Length=620

 Score =   135 bits (341),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 67/122 (55%), Positives = 88/122 (72%), Gaps = 8/122 (7%)
 Frame = +3

Query  186  HLQTLLQTAVQSVHWTYSLFWNLCPHN-GMLVWSDGYYNGAIKTRKTVQGTEVSAEEASL  362
            +L+  L  AV+S+ W+Y++FW++     G+L W DGYYNG IKTRKTVQ  E +A++  L
Sbjct  15   NLKNRLAIAVRSIQWSYAIFWSISSRQPGVLEWGDGYYNGDIKTRKTVQAVEFNADQLGL  74

Query  363  HRSQQIKELYESLSATAEESNGGGGQQPARRPSAALSPEDLTESEWFYLMCISFSFPSAV  542
             RS+Q+KELYESL+ T  ESN       ARRPSAALSPEDLT++EW+YL+C+SF F    
Sbjct  75   QRSEQLKELYESLAVT--ESN-----PQARRPSAALSPEDLTDTEWYYLVCMSFVFNIGQ  127

Query  543  GL  548
            GL
Sbjct  128  GL  129



>gb|AAS86273.1| myc-like anthocyanin regulatory protein [Cornus canadensis]
Length=620

 Score =   135 bits (341),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 67/122 (55%), Positives = 88/122 (72%), Gaps = 8/122 (7%)
 Frame = +3

Query  186  HLQTLLQTAVQSVHWTYSLFWNLCPHN-GMLVWSDGYYNGAIKTRKTVQGTEVSAEEASL  362
            +L+  L  AV+S+ W+Y++FW++     G+L W DGYYNG IKTRKTVQ  E +A++  L
Sbjct  15   NLKNRLAIAVRSIQWSYAIFWSISSRQPGVLEWGDGYYNGDIKTRKTVQAVEFNADQLGL  74

Query  363  HRSQQIKELYESLSATAEESNGGGGQQPARRPSAALSPEDLTESEWFYLMCISFSFPSAV  542
             RS+Q+KELYESL+ T  ESN       ARRPSAALSPEDLT++EW+YL+C+SF F    
Sbjct  75   QRSEQLKELYESLAVT--ESN-----PQARRPSAALSPEDLTDTEWYYLVCMSFVFNIGQ  127

Query  543  GL  548
            GL
Sbjct  128  GL  129



>gb|AAS86299.1| myc-like anthocyanin regulatory protein [Cornus unalaschkensis]
Length=624

 Score =   135 bits (341),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 67/122 (55%), Positives = 88/122 (72%), Gaps = 8/122 (7%)
 Frame = +3

Query  186  HLQTLLQTAVQSVHWTYSLFWNLCPHN-GMLVWSDGYYNGAIKTRKTVQGTEVSAEEASL  362
            +L+  L  AV+S+ W+Y++FW++     G+L W DGYYNG IKTRKTVQ  E +A++  L
Sbjct  15   NLKNRLAIAVRSIQWSYAIFWSISSRQPGVLEWGDGYYNGDIKTRKTVQAVEFNADQLGL  74

Query  363  HRSQQIKELYESLSATAEESNGGGGQQPARRPSAALSPEDLTESEWFYLMCISFSFPSAV  542
             RS+Q+KELYESL+ T  ESN       ARRPSAALSPEDLT++EW+YL+C+SF F    
Sbjct  75   QRSEQLKELYESLAVT--ESN-----PQARRPSAALSPEDLTDTEWYYLVCMSFVFNIGQ  127

Query  543  GL  548
            GL
Sbjct  128  GL  129



>gb|AAS86295.1| myc-like anthocyanin regulatory protein [Cornus unalaschkensis]
Length=624

 Score =   135 bits (341),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 67/122 (55%), Positives = 88/122 (72%), Gaps = 8/122 (7%)
 Frame = +3

Query  186  HLQTLLQTAVQSVHWTYSLFWNLCPHN-GMLVWSDGYYNGAIKTRKTVQGTEVSAEEASL  362
            +L+  L  AV+S+ W+Y++FW++     G+L W DGYYNG IKTRKTVQ  E +A++  L
Sbjct  15   NLKNRLAIAVRSIQWSYAIFWSISSRQPGVLEWGDGYYNGDIKTRKTVQAVEFNADQLGL  74

Query  363  HRSQQIKELYESLSATAEESNGGGGQQPARRPSAALSPEDLTESEWFYLMCISFSFPSAV  542
             RS+Q+KELYESL+ T  ESN       ARRPSAALSPEDLT++EW+YL+C+SF F    
Sbjct  75   QRSEQLKELYESLAVT--ESN-----PQARRPSAALSPEDLTDTEWYYLVCMSFVFNIGQ  127

Query  543  GL  548
            GL
Sbjct  128  GL  129



>gb|AAS86294.1| myc-like anthocyanin regulatory protein [Cornus unalaschkensis]
Length=624

 Score =   135 bits (341),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 67/122 (55%), Positives = 88/122 (72%), Gaps = 8/122 (7%)
 Frame = +3

Query  186  HLQTLLQTAVQSVHWTYSLFWNLCPHN-GMLVWSDGYYNGAIKTRKTVQGTEVSAEEASL  362
            +L+  L  AV+S+ W+Y++FW++     G+L W DGYYNG IKTRKTVQ  E +A++  L
Sbjct  15   NLKNRLAIAVRSIQWSYAIFWSISSRQPGVLEWGDGYYNGDIKTRKTVQAVEFNADQLGL  74

Query  363  HRSQQIKELYESLSATAEESNGGGGQQPARRPSAALSPEDLTESEWFYLMCISFSFPSAV  542
             RS+Q+KELYESL+ T  ESN       ARRPSAALSPEDLT++EW+YL+C+SF F    
Sbjct  75   QRSEQLKELYESLAVT--ESN-----PQARRPSAALSPEDLTDTEWYYLVCMSFVFNIGQ  127

Query  543  GL  548
            GL
Sbjct  128  GL  129



>gb|AAS86274.1| myc-like anthocyanin regulatory protein [Cornus canadensis]
Length=620

 Score =   135 bits (341),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 67/122 (55%), Positives = 88/122 (72%), Gaps = 8/122 (7%)
 Frame = +3

Query  186  HLQTLLQTAVQSVHWTYSLFWNLCPHN-GMLVWSDGYYNGAIKTRKTVQGTEVSAEEASL  362
            +L+  L  AV+S+ W+Y++FW++     G+L W DGYYNG IKTRKTVQ  E +A++  L
Sbjct  15   NLKNRLAIAVRSIQWSYAIFWSISSRQPGVLEWGDGYYNGDIKTRKTVQAVEFNADQLGL  74

Query  363  HRSQQIKELYESLSATAEESNGGGGQQPARRPSAALSPEDLTESEWFYLMCISFSFPSAV  542
             RS+Q+KELYESL+ T  ESN       ARRPSAALSPEDLT++EW+YL+C+SF F    
Sbjct  75   QRSEQLKELYESLAVT--ESN-----PQARRPSAALSPEDLTDTEWYYLVCMSFVFNIGQ  127

Query  543  GL  548
            GL
Sbjct  128  GL  129



>gb|AAS86286.1| myc-like anthocyanin regulatory protein [Cornus cf. canadensis 
Xiang and Fan 26-1]
Length=625

 Score =   135 bits (341),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 67/122 (55%), Positives = 88/122 (72%), Gaps = 8/122 (7%)
 Frame = +3

Query  186  HLQTLLQTAVQSVHWTYSLFWNLCPHN-GMLVWSDGYYNGAIKTRKTVQGTEVSAEEASL  362
            +L+  L  AV+S+ W+Y++FW++     G+L W DGYYNG IKTRKTVQ  E +A++  L
Sbjct  15   NLKNRLAIAVRSIQWSYAIFWSISSRQPGVLEWGDGYYNGDIKTRKTVQAVEFNADQLGL  74

Query  363  HRSQQIKELYESLSATAEESNGGGGQQPARRPSAALSPEDLTESEWFYLMCISFSFPSAV  542
             RS+Q+KELYESL+ T  ESN       ARRPSAALSPEDLT++EW+YL+C+SF F    
Sbjct  75   QRSEQLKELYESLAVT--ESN-----PQARRPSAALSPEDLTDTEWYYLVCMSFVFNIGQ  127

Query  543  GL  548
            GL
Sbjct  128  GL  129



>gb|AAS86270.1| myc-like anthocyanin regulatory protein [Cornus canadensis]
 gb|AAS86271.1| myc-like anthocyanin regulatory protein [Cornus cf. canadensis 
Xiang and Fan 19-1]
 gb|AAS86276.1| myc-like anthocyanin regulatory protein [Cornus cf. canadensis 
Xiang and Fan 15-1]
Length=620

 Score =   135 bits (341),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 67/122 (55%), Positives = 88/122 (72%), Gaps = 8/122 (7%)
 Frame = +3

Query  186  HLQTLLQTAVQSVHWTYSLFWNLCPHN-GMLVWSDGYYNGAIKTRKTVQGTEVSAEEASL  362
            +L+  L  AV+S+ W+Y++FW++     G+L W DGYYNG IKTRKTVQ  E +A++  L
Sbjct  15   NLKNRLAIAVRSIQWSYAIFWSISSRQPGVLEWGDGYYNGDIKTRKTVQAVEFNADQLGL  74

Query  363  HRSQQIKELYESLSATAEESNGGGGQQPARRPSAALSPEDLTESEWFYLMCISFSFPSAV  542
             RS+Q+KELYESL+ T  ESN       ARRPSAALSPEDLT++EW+YL+C+SF F    
Sbjct  75   QRSEQLKELYESLAVT--ESN-----PQARRPSAALSPEDLTDTEWYYLVCMSFVFNIGQ  127

Query  543  GL  548
            GL
Sbjct  128  GL  129



>gb|AAS86305.1| myc-like anthocyanin regulatory protein [Cornus cf. canadensis 
Xiang and Fan 42-1]
Length=624

 Score =   135 bits (341),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 67/122 (55%), Positives = 88/122 (72%), Gaps = 8/122 (7%)
 Frame = +3

Query  186  HLQTLLQTAVQSVHWTYSLFWNLCPHN-GMLVWSDGYYNGAIKTRKTVQGTEVSAEEASL  362
            +L+  L  AV+S+ W+Y++FW++     G+L W DGYYNG IKTRKTVQ  E +A++  L
Sbjct  15   NLKNRLAIAVRSIQWSYAIFWSISSRQPGVLEWGDGYYNGDIKTRKTVQAVEFNADQLGL  74

Query  363  HRSQQIKELYESLSATAEESNGGGGQQPARRPSAALSPEDLTESEWFYLMCISFSFPSAV  542
             RS+Q+KELYESL+ T  ESN       ARRPSAALSPEDLT++EW+YL+C+SF F    
Sbjct  75   QRSEQLKELYESLAVT--ESN-----PQARRPSAALSPEDLTDTEWYYLVCMSFVFNIGQ  127

Query  543  GL  548
            GL
Sbjct  128  GL  129



>gb|AAS86300.1| myc-like anthocyanin regulatory protein [Cornus unalaschkensis]
 gb|AAS86301.1| myc-like anthocyanin regulatory protein [Cornus unalaschkensis]
Length=624

 Score =   135 bits (341),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 67/122 (55%), Positives = 88/122 (72%), Gaps = 8/122 (7%)
 Frame = +3

Query  186  HLQTLLQTAVQSVHWTYSLFWNLCPHN-GMLVWSDGYYNGAIKTRKTVQGTEVSAEEASL  362
            +L+  L  AV+S+ W+Y++FW++     G+L W DGYYNG IKTRKTVQ  E +A++  L
Sbjct  15   NLKNRLAIAVRSIQWSYAIFWSISSRQPGVLEWGDGYYNGDIKTRKTVQAVEFNADQLGL  74

Query  363  HRSQQIKELYESLSATAEESNGGGGQQPARRPSAALSPEDLTESEWFYLMCISFSFPSAV  542
             RS+Q+KELYESL+ T  ESN       ARRPSAALSPEDLT++EW+YL+C+SF F    
Sbjct  75   QRSEQLKELYESLAVT--ESN-----PQARRPSAALSPEDLTDTEWYYLVCMSFVFNIGQ  127

Query  543  GL  548
            GL
Sbjct  128  GL  129



>gb|AAS86278.1| myc-like anthocyanin regulatory protein [Cornus canadensis]
Length=621

 Score =   135 bits (341),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 67/122 (55%), Positives = 88/122 (72%), Gaps = 8/122 (7%)
 Frame = +3

Query  186  HLQTLLQTAVQSVHWTYSLFWNLCPHN-GMLVWSDGYYNGAIKTRKTVQGTEVSAEEASL  362
            +L+  L  AV+S+ W+Y++FW++     G+L W DGYYNG IKTRKTVQ  E +A++  L
Sbjct  15   NLKNRLAIAVRSIQWSYAIFWSISSRQPGVLEWGDGYYNGDIKTRKTVQAVEFNADQLGL  74

Query  363  HRSQQIKELYESLSATAEESNGGGGQQPARRPSAALSPEDLTESEWFYLMCISFSFPSAV  542
             RS+Q+KELYESL+ T  ESN       ARRPSAALSPEDLT++EW+YL+C+SF F    
Sbjct  75   QRSEQLKELYESLAVT--ESN-----PQARRPSAALSPEDLTDTEWYYLVCMSFVFNIGQ  127

Query  543  GL  548
            GL
Sbjct  128  GL  129



>gb|AAS86297.1| myc-like anthocyanin regulatory protein [Cornus unalaschkensis]
Length=624

 Score =   135 bits (341),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 67/122 (55%), Positives = 88/122 (72%), Gaps = 8/122 (7%)
 Frame = +3

Query  186  HLQTLLQTAVQSVHWTYSLFWNLCPHN-GMLVWSDGYYNGAIKTRKTVQGTEVSAEEASL  362
            +L+  L  AV+S+ W+Y++FW++     G+L W DGYYNG IKTRKTVQ  E +A++  L
Sbjct  15   NLKNRLAIAVRSIQWSYAIFWSISSRQPGVLEWGDGYYNGDIKTRKTVQAVEFNADQLGL  74

Query  363  HRSQQIKELYESLSATAEESNGGGGQQPARRPSAALSPEDLTESEWFYLMCISFSFPSAV  542
             RS+Q+KELYESL+ T  ESN       ARRPSAALSPEDLT++EW+YL+C+SF F    
Sbjct  75   QRSEQLKELYESLAVT--ESN-----PQARRPSAALSPEDLTDTEWYYLVCMSFVFNIGQ  127

Query  543  GL  548
            GL
Sbjct  128  GL  129



>gb|AAS86298.1| myc-like anthocyanin regulatory protein [Cornus unalaschkensis]
Length=624

 Score =   135 bits (341),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 67/122 (55%), Positives = 88/122 (72%), Gaps = 8/122 (7%)
 Frame = +3

Query  186  HLQTLLQTAVQSVHWTYSLFWNLCPHN-GMLVWSDGYYNGAIKTRKTVQGTEVSAEEASL  362
            +L+  L  AV+S+ W+Y++FW++     G+L W DGYYNG IKTRKTVQ  E +A++  L
Sbjct  15   NLKNRLAIAVRSIQWSYAIFWSISSRQPGVLEWGDGYYNGDIKTRKTVQAVEFNADQLGL  74

Query  363  HRSQQIKELYESLSATAEESNGGGGQQPARRPSAALSPEDLTESEWFYLMCISFSFPSAV  542
             RS+Q+KELYESL+ T  ESN       ARRPSAALSPEDLT++EW+YL+C+SF F    
Sbjct  75   QRSEQLKELYESLAVT--ESN-----PQARRPSAALSPEDLTDTEWYYLVCMSFVFNIGQ  127

Query  543  GL  548
            GL
Sbjct  128  GL  129



>ref|XP_010918535.1| PREDICTED: transcription factor GLABRA 3 [Elaeis guineensis]
Length=685

 Score =   136 bits (342),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 63/122 (52%), Positives = 87/122 (71%), Gaps = 8/122 (7%)
 Frame = +3

Query  186  HLQTLLQTAVQSVHWTYSLFWNLCP-HNGMLVWSDGYYNGAIKTRKTVQGTEVSAEEASL  362
            HL+  L  AV+++ W+Y++FW++     G+L WSDGYYNG IKTRKT Q TE  A++  L
Sbjct  19   HLRKQLAAAVRNIQWSYAIFWSISARQQGVLAWSDGYYNGDIKTRKTTQPTEFKADQMGL  78

Query  363  HRSQQIKELYESLSATAEESNGGGGQQPARRPSAALSPEDLTESEWFYLMCISFSFPSAV  542
             RS+Q++ELYESLSA       G   Q ++RP A+LSPEDLT++EW+YL+C+SF+F    
Sbjct  79   QRSEQLRELYESLSA-------GDSNQQSKRPFASLSPEDLTDTEWYYLVCMSFTFSPGQ  131

Query  543  GL  548
            GL
Sbjct  132  GL  133



>gb|AAS86292.1| myc-like anthocyanin regulatory protein [Cornus unalaschkensis]
Length=625

 Score =   135 bits (341),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 67/122 (55%), Positives = 88/122 (72%), Gaps = 8/122 (7%)
 Frame = +3

Query  186  HLQTLLQTAVQSVHWTYSLFWNLCPHN-GMLVWSDGYYNGAIKTRKTVQGTEVSAEEASL  362
            +L+  L  AV+S+ W+Y++FW++     G+L W DGYYNG IKTRKTVQ  E +A++  L
Sbjct  15   NLKNRLAIAVRSIQWSYAIFWSISSRQPGVLEWGDGYYNGDIKTRKTVQAVEFNADQLGL  74

Query  363  HRSQQIKELYESLSATAEESNGGGGQQPARRPSAALSPEDLTESEWFYLMCISFSFPSAV  542
             RS+Q+KELYESL+ T  ESN       ARRPSAALSPEDLT++EW+YL+C+SF F    
Sbjct  75   QRSEQLKELYESLAVT--ESN-----PQARRPSAALSPEDLTDTEWYYLVCMSFVFNIGQ  127

Query  543  GL  548
            GL
Sbjct  128  GL  129



>gb|AAS86285.1| myc-like anthocyanin regulatory protein [Cornus unalaschkensis]
Length=625

 Score =   135 bits (341),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 67/122 (55%), Positives = 88/122 (72%), Gaps = 8/122 (7%)
 Frame = +3

Query  186  HLQTLLQTAVQSVHWTYSLFWNLCPHN-GMLVWSDGYYNGAIKTRKTVQGTEVSAEEASL  362
            +L+  L  AV+S+ W+Y++FW++     G+L W DGYYNG IKTRKTVQ  E +A++  L
Sbjct  15   NLKNRLAIAVRSIQWSYAIFWSISSRQPGVLEWGDGYYNGDIKTRKTVQAVEFNADQLGL  74

Query  363  HRSQQIKELYESLSATAEESNGGGGQQPARRPSAALSPEDLTESEWFYLMCISFSFPSAV  542
             RS+Q+KELYESL+ T  ESN       ARRPSAALSPEDLT++EW+YL+C+SF F    
Sbjct  75   QRSEQLKELYESLAVT--ESN-----PQARRPSAALSPEDLTDTEWYYLVCMSFVFNIGQ  127

Query  543  GL  548
            GL
Sbjct  128  GL  129



>gb|AAS86290.1| myc-like anthocyanin regulatory protein [Cornus unalaschkensis]
Length=625

 Score =   135 bits (341),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 67/122 (55%), Positives = 88/122 (72%), Gaps = 8/122 (7%)
 Frame = +3

Query  186  HLQTLLQTAVQSVHWTYSLFWNLCPHN-GMLVWSDGYYNGAIKTRKTVQGTEVSAEEASL  362
            +L+  L  AV+S+ W+Y++FW++     G+L W DGYYNG IKTRKTVQ  E +A++  L
Sbjct  15   NLKNRLAIAVRSIQWSYAIFWSISSRQPGVLEWGDGYYNGDIKTRKTVQAVEFNADQLGL  74

Query  363  HRSQQIKELYESLSATAEESNGGGGQQPARRPSAALSPEDLTESEWFYLMCISFSFPSAV  542
             RS+Q+KELYESL+ T  ESN       ARRPSAALSPEDLT++EW+YL+C+SF F    
Sbjct  75   QRSEQLKELYESLAVT--ESN-----PQARRPSAALSPEDLTDTEWYYLVCMSFVFNIGQ  127

Query  543  GL  548
            GL
Sbjct  128  GL  129



>gb|AAS86284.1| myc-like anthocyanin regulatory protein [Cornus cf. canadensis 
Xiang and Fan 20-1]
Length=625

 Score =   135 bits (340),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 67/122 (55%), Positives = 88/122 (72%), Gaps = 8/122 (7%)
 Frame = +3

Query  186  HLQTLLQTAVQSVHWTYSLFWNLCPHN-GMLVWSDGYYNGAIKTRKTVQGTEVSAEEASL  362
            +L+  L  AV+S+ W+Y++FW++     G+L W DGYYNG IKTRKTVQ  E +A++  L
Sbjct  15   NLKNRLAIAVRSIQWSYAIFWSISSRQPGVLEWGDGYYNGDIKTRKTVQAVEFNADQLGL  74

Query  363  HRSQQIKELYESLSATAEESNGGGGQQPARRPSAALSPEDLTESEWFYLMCISFSFPSAV  542
             RS+Q+KELYESL+ T  ESN       ARRPSAALSPEDLT++EW+YL+C+SF F    
Sbjct  75   QRSEQLKELYESLAVT--ESN-----PQARRPSAALSPEDLTDTEWYYLVCMSFVFNIGQ  127

Query  543  GL  548
            GL
Sbjct  128  GL  129



>gb|AAS86280.1| myc-like anthocyanin regulatory protein [Cornus unalaschkensis]
Length=625

 Score =   135 bits (340),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 67/122 (55%), Positives = 88/122 (72%), Gaps = 8/122 (7%)
 Frame = +3

Query  186  HLQTLLQTAVQSVHWTYSLFWNLCPHN-GMLVWSDGYYNGAIKTRKTVQGTEVSAEEASL  362
            +L+  L  AV+S+ W+Y++FW++     G+L W DGYYNG IKTRKTVQ  E +A++  L
Sbjct  15   NLKNRLAIAVRSIQWSYAIFWSISSRQPGVLEWGDGYYNGDIKTRKTVQAVEFNADQLGL  74

Query  363  HRSQQIKELYESLSATAEESNGGGGQQPARRPSAALSPEDLTESEWFYLMCISFSFPSAV  542
             RS+Q+KELYESL+ T  ESN       ARRPSAALSPEDLT++EW+YL+C+SF F    
Sbjct  75   QRSEQLKELYESLAVT--ESN-----PQARRPSAALSPEDLTDTEWYYLVCMSFVFNIGQ  127

Query  543  GL  548
            GL
Sbjct  128  GL  129



>gb|AAS86287.1| myc-like anthocyanin regulatory protein [Cornus unalaschkensis]
Length=625

 Score =   135 bits (340),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 67/122 (55%), Positives = 88/122 (72%), Gaps = 8/122 (7%)
 Frame = +3

Query  186  HLQTLLQTAVQSVHWTYSLFWNLCPHN-GMLVWSDGYYNGAIKTRKTVQGTEVSAEEASL  362
            +L+  L  AV+S+ W+Y++FW++     G+L W DGYYNG IKTRKTVQ  E +A++  L
Sbjct  15   NLKNRLAIAVRSIQWSYAIFWSISSRQPGVLEWGDGYYNGDIKTRKTVQAVEFNADQLGL  74

Query  363  HRSQQIKELYESLSATAEESNGGGGQQPARRPSAALSPEDLTESEWFYLMCISFSFPSAV  542
             RS+Q+KELYESL+ T  ESN       ARRPSAALSPEDLT++EW+YL+C+SF F    
Sbjct  75   QRSEQLKELYESLAVT--ESN-----PQARRPSAALSPEDLTDTEWYYLVCMSFVFNIGQ  127

Query  543  GL  548
            GL
Sbjct  128  GL  129



>gb|AAS86302.1| myc-like anthocyanin regulatory protein [Cornus cf. canadensis 
Xiang and Fan 29-2]
Length=624

 Score =   135 bits (340),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 68/126 (54%), Positives = 88/126 (70%), Gaps = 8/126 (6%)
 Frame = +3

Query  174  GGAAHLQTLLQTAVQSVHWTYSLFWNLCPHN-GMLVWSDGYYNGAIKTRKTVQGTEVSAE  350
            G   +L+  L  AV+S+ W+Y++FW++     G+L W DGYYNG IKTRKTVQ  E +A+
Sbjct  11   GLLENLKNQLAIAVRSIQWSYAIFWSISSRQPGVLEWGDGYYNGDIKTRKTVQAVEFNAD  70

Query  351  EASLHRSQQIKELYESLSATAEESNGGGGQQPARRPSAALSPEDLTESEWFYLMCISFSF  530
            +  L RS+Q+KELYESL  T  ESN       ARRPSAALSPEDLT++EW+YL+C+SF F
Sbjct  71   QLGLQRSEQLKELYESLVVT--ESN-----PQARRPSAALSPEDLTDTEWYYLVCMSFVF  123

Query  531  PSAVGL  548
                GL
Sbjct  124  NIGQGL  129



>gb|AAS86307.1| myc-like anthocyanin regulatory protein [Cornus suecica]
Length=624

 Score =   135 bits (340),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 68/126 (54%), Positives = 88/126 (70%), Gaps = 8/126 (6%)
 Frame = +3

Query  174  GGAAHLQTLLQTAVQSVHWTYSLFWNLCPHN-GMLVWSDGYYNGAIKTRKTVQGTEVSAE  350
            G   +L+  L  AV+S+ W+Y++FW++     G+L W DGYYNG IKTRKTVQ  E +A+
Sbjct  11   GLLENLKNQLAIAVRSIQWSYAIFWSISSRQPGVLEWGDGYYNGDIKTRKTVQAVEFNAD  70

Query  351  EASLHRSQQIKELYESLSATAEESNGGGGQQPARRPSAALSPEDLTESEWFYLMCISFSF  530
            +  L RS+Q+KELYESL  T  ESN       ARRPSAALSPEDLT++EW+YL+C+SF F
Sbjct  71   QLGLQRSEQLKELYESLVVT--ESN-----PQARRPSAALSPEDLTDTEWYYLVCMSFVF  123

Query  531  PSAVGL  548
                GL
Sbjct  124  NIGQGL  129



>gb|AAS86309.1| myc-like anthocyanin regulatory protein [Cornus suecica]
Length=624

 Score =   135 bits (340),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 68/126 (54%), Positives = 88/126 (70%), Gaps = 8/126 (6%)
 Frame = +3

Query  174  GGAAHLQTLLQTAVQSVHWTYSLFWNLCPHN-GMLVWSDGYYNGAIKTRKTVQGTEVSAE  350
            G   +L+  L  AV+S+ W+Y++FW++     G+L W DGYYNG IKTRKTVQ  E +A+
Sbjct  11   GLLENLKNQLAIAVRSIQWSYAIFWSISSRQPGVLEWGDGYYNGDIKTRKTVQAVEFNAD  70

Query  351  EASLHRSQQIKELYESLSATAEESNGGGGQQPARRPSAALSPEDLTESEWFYLMCISFSF  530
            +  L RS+Q+KELYESL  T  ESN       ARRPSAALSPEDLT++EW+YL+C+SF F
Sbjct  71   QLGLQRSEQLKELYESLVVT--ESN-----PQARRPSAALSPEDLTDTEWYYLVCMSFVF  123

Query  531  PSAVGL  548
                GL
Sbjct  124  NIGQGL  129



>gb|AAS86296.1| myc-like anthocyanin regulatory protein [Cornus unalaschkensis]
Length=624

 Score =   135 bits (339),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 67/126 (53%), Positives = 88/126 (70%), Gaps = 8/126 (6%)
 Frame = +3

Query  174  GGAAHLQTLLQTAVQSVHWTYSLFWNLCPHN-GMLVWSDGYYNGAIKTRKTVQGTEVSAE  350
            G   +L+  L  AV+S+ W+Y++FW++     G+L W DGYYNG IKTRKTVQ  E +A+
Sbjct  11   GLLENLKNRLAIAVRSIQWSYAIFWSISSRQPGVLEWGDGYYNGDIKTRKTVQAVEFNAD  70

Query  351  EASLHRSQQIKELYESLSATAEESNGGGGQQPARRPSAALSPEDLTESEWFYLMCISFSF  530
            +  L RS+Q+KELYES + T  ESN       ARRPSAALSPEDLT++EW+YL+C+SF F
Sbjct  71   QLGLQRSEQLKELYESFAVT--ESN-----PQARRPSAALSPEDLTDTEWYYLVCMSFVF  123

Query  531  PSAVGL  548
                GL
Sbjct  124  NIGQGL  129



>ref|XP_010241898.1| PREDICTED: transcription factor GLABRA 3-like isoform X1 [Nelumbo 
nucifera]
Length=682

 Score =   135 bits (340),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 65/122 (53%), Positives = 87/122 (71%), Gaps = 8/122 (7%)
 Frame = +3

Query  186  HLQTLLQTAVQSVHWTYSLFWNLCP-HNGMLVWSDGYYNGAIKTRKTVQGTEVSAEEASL  362
            HL   L  AV+S+ W+Y++FW++     G+L W DGYYNG IKTRKT+Q  E++A++  L
Sbjct  19   HLSKQLAFAVRSIQWSYAIFWSISTRQQGVLEWGDGYYNGNIKTRKTIQHMELNADQMGL  78

Query  363  HRSQQIKELYESLSATAEESNGGGGQQPARRPSAALSPEDLTESEWFYLMCISFSFPSAV  542
             RS+Q++ELYESLSA       G   Q ARRPSA+LSPEDLT++EW+YL+C+SF F    
Sbjct  79   RRSEQLRELYESLSA-------GDTIQQARRPSASLSPEDLTDAEWYYLVCMSFIFSPGQ  131

Query  543  GL  548
            GL
Sbjct  132  GL  133



>gb|AAS86283.1| myc-like anthocyanin regulatory protein [Cornus unalaschkensis]
Length=625

 Score =   134 bits (338),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 67/122 (55%), Positives = 88/122 (72%), Gaps = 8/122 (7%)
 Frame = +3

Query  186  HLQTLLQTAVQSVHWTYSLFWNLCPHN-GMLVWSDGYYNGAIKTRKTVQGTEVSAEEASL  362
            +L+  L  AV+S+ W+Y++FW++     G+L W DGYYNG IKTRKTVQ  E +A++  L
Sbjct  15   NLKNRLAIAVRSIQWSYAIFWSISSRQPGVLEWGDGYYNGDIKTRKTVQVVEFNADQLGL  74

Query  363  HRSQQIKELYESLSATAEESNGGGGQQPARRPSAALSPEDLTESEWFYLMCISFSFPSAV  542
             RS+Q+KELYESL+ T  ESN       ARRPSAALSPEDLT++EW+YL+C+SF F    
Sbjct  75   QRSEQLKELYESLAVT--ESN-----PQARRPSAALSPEDLTDTEWYYLVCMSFVFNIGQ  127

Query  543  GL  548
            GL
Sbjct  128  GL  129



>ref|XP_008806796.1| PREDICTED: transcription factor GLABRA 3 [Phoenix dactylifera]
Length=686

 Score =   135 bits (340),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 62/122 (51%), Positives = 86/122 (70%), Gaps = 8/122 (7%)
 Frame = +3

Query  186  HLQTLLQTAVQSVHWTYSLFWNLCP-HNGMLVWSDGYYNGAIKTRKTVQGTEVSAEEASL  362
            HL+  L   V+++ W+Y++FW++     G+L WSDGYYNG IKTRKT Q  E  A++  L
Sbjct  19   HLRKQLAATVRNIQWSYAIFWSISTRQQGVLAWSDGYYNGDIKTRKTTQPVEFKADQMGL  78

Query  363  HRSQQIKELYESLSATAEESNGGGGQQPARRPSAALSPEDLTESEWFYLMCISFSFPSAV  542
             RS+Q++ELYESLSA       G G Q ++RP A+LSPEDLT++EW+YL+C+SF+F    
Sbjct  79   QRSEQLRELYESLSA-------GDGNQQSKRPFASLSPEDLTDTEWYYLVCMSFTFRPGQ  131

Query  543  GL  548
            GL
Sbjct  132  GL  133



>gb|AAS86308.1| myc-like anthocyanin regulatory protein [Cornus cf. canadensis 
Xiang and Fan SC29-1]
Length=624

 Score =   134 bits (338),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 67/126 (53%), Positives = 89/126 (71%), Gaps = 8/126 (6%)
 Frame = +3

Query  174  GGAAHLQTLLQTAVQSVHWTYSLFWNLCPHN-GMLVWSDGYYNGAIKTRKTVQGTEVSAE  350
            G   +L+  L  AV+S+ W+Y++FW++     G+L W DGYYNG IKTRKTVQ  E +A+
Sbjct  11   GLLENLKNQLAIAVRSIQWSYAIFWSISSRQPGVLEWGDGYYNGDIKTRKTVQAVEFNAD  70

Query  351  EASLHRSQQIKELYESLSATAEESNGGGGQQPARRPSAALSPEDLTESEWFYLMCISFSF  530
            +  L RS+Q+KELYESL+ T  ESN       AR+PSAALSPEDLT++EW+YL+C+SF F
Sbjct  71   QLGLQRSEQLKELYESLAVT--ESN-----PQARKPSAALSPEDLTDTEWYYLVCMSFVF  123

Query  531  PSAVGL  548
                GL
Sbjct  124  NIGQGL  129



>dbj|BAC83694.1| putative intensifier [Oryza sativa Japonica Group]
Length=630

 Score =   134 bits (338),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 70/135 (52%), Positives = 87/135 (64%), Gaps = 12/135 (9%)
 Frame = +3

Query  174  GGAAHLQTLLQTAVQSVHWTYSLFWNLCPHNGM-LVWSDGYYNGAIKTRKTV------QG  332
            GG AH    LQ   QS+ WTYSL W LCPH G  LVW +G+YNGA+KTRK+         
Sbjct  3    GGEAH--AALQAVAQSLRWTYSLLWQLCPHQGSSLVWGEGHYNGAVKTRKSTVMQPPPAE  60

Query  333  TEVSAEEASLHRSQQIKELYESLSATAEESNGG---GGQQPARRPSAALSPEDLTESEWF  503
             E  A+ A+ HRS+Q++ELY+ L    E S+GG        +RRP AALSPEDLTE+EWF
Sbjct  61   EEDDADHAARHRSRQLRELYDWLQQAGENSSGGVQTSSTTASRRPGAALSPEDLTETEWF  120

Query  504  YLMCISFSFPSAVGL  548
            +LM  S+SFP  +GL
Sbjct  121  FLMSASYSFPPGIGL  135



>gb|ADP76654.1| TT8 [Brassica oleracea var. botrytis]
Length=521

 Score =   134 bits (336),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 68/134 (51%), Positives = 84/134 (63%), Gaps = 12/134 (9%)
 Frame = +3

Query  147  WSIVMAETPGGAAHLQTLLQTAVQSVHWTYSLFWNLCPHNGMLVWSDGYYNGAIKTRKTV  326
            W ++ AE       +Q LL+  VQSV WTYS+FW LCP    L+WS G YNGAIKTRKT 
Sbjct  10   WKVIGAE----KKEIQGLLKAVVQSVGWTYSVFWQLCPQRRKLLWSSGNYNGAIKTRKTT  65

Query  327  QGTEVSAEEASLHRSQQIKELYESLSATAEESNGGGGQQPARRPSAALSPEDLTESEWFY  506
            Q  EV+AEEA+  RSQQ+ ELYE+L A        G      R   ALSPEDLT+ EWFY
Sbjct  66   QPAEVTAEEAASERSQQLMELYETLFA--------GESSMEARACTALSPEDLTDPEWFY  117

Query  507  LMCISFSFPSAVGL  548
            ++C ++SF    G+
Sbjct  118  VLCFTYSFEPPSGM  131



>gb|AAS86293.1| myc-like anthocyanin regulatory protein [Cornus cf. canadensis 
Xiang and Fan 41-1]
Length=625

 Score =   134 bits (338),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 66/122 (54%), Positives = 88/122 (72%), Gaps = 8/122 (7%)
 Frame = +3

Query  186  HLQTLLQTAVQSVHWTYSLFWNLCPHN-GMLVWSDGYYNGAIKTRKTVQGTEVSAEEASL  362
            +L+  L  AV+S+ W+Y++FW++     G+L W DGYYNG IKTRKTVQ  E +A++  L
Sbjct  15   NLKNRLAIAVRSIQWSYAIFWSISSRQPGVLEWGDGYYNGDIKTRKTVQAVEFNADQLGL  74

Query  363  HRSQQIKELYESLSATAEESNGGGGQQPARRPSAALSPEDLTESEWFYLMCISFSFPSAV  542
             RS+Q+KELYESL+ T  ESN       AR+PSAALSPEDLT++EW+YL+C+SF F    
Sbjct  75   QRSEQLKELYESLAVT--ESN-----PQARKPSAALSPEDLTDTEWYYLVCMSFVFNIGQ  127

Query  543  GL  548
            GL
Sbjct  128  GL  129



>gb|ADV03942.1| bHLH DNA binding domain transcription factor BnaC.TT8 [Brassica 
napus]
 emb|CDX99505.1| BnaC09g24870D [Brassica napus]
Length=521

 Score =   133 bits (335),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 68/134 (51%), Positives = 84/134 (63%), Gaps = 12/134 (9%)
 Frame = +3

Query  147  WSIVMAETPGGAAHLQTLLQTAVQSVHWTYSLFWNLCPHNGMLVWSDGYYNGAIKTRKTV  326
            W ++ AE       +Q LL+  VQSV WTYS+FW LCP    L+WS G YNGAIKTRKT 
Sbjct  10   WKVIGAE----KEEIQGLLKAVVQSVGWTYSVFWQLCPQRRKLLWSSGNYNGAIKTRKTT  65

Query  327  QGTEVSAEEASLHRSQQIKELYESLSATAEESNGGGGQQPARRPSAALSPEDLTESEWFY  506
            Q  EV+AEEA+  RSQQ+ ELYE+L A        G      R   ALSPEDLT+ EWFY
Sbjct  66   QPAEVTAEEAASERSQQLMELYETLFA--------GESSMEARACTALSPEDLTDPEWFY  117

Query  507  LMCISFSFPSAVGL  548
            ++C ++SF    G+
Sbjct  118  VLCFTYSFEPPSGM  131



>gb|ADK36609.1| Rc protein [Oryza rufipogon]
Length=666

 Score =   134 bits (338),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 70/135 (52%), Positives = 87/135 (64%), Gaps = 12/135 (9%)
 Frame = +3

Query  174  GGAAHLQTLLQTAVQSVHWTYSLFWNLCPHNGM-LVWSDGYYNGAIKTRKTV------QG  332
            GG AH    LQ   QS+ WTYSL W LCPH G  LVW +G+YNGA+KTRK+         
Sbjct  3    GGEAH--AALQAVAQSLRWTYSLLWQLCPHQGSSLVWGEGHYNGAVKTRKSTVMQPPPAE  60

Query  333  TEVSAEEASLHRSQQIKELYESLSATAEESNGG---GGQQPARRPSAALSPEDLTESEWF  503
             E  A+ A+ HRS+Q++ELY+ L    E S+GG        +RRP AALSPEDLTE+EWF
Sbjct  61   EEDDADHAARHRSRQLRELYDWLQQAGENSSGGVQTSSTTASRRPGAALSPEDLTETEWF  120

Query  504  YLMCISFSFPSAVGL  548
            +LM  S+SFP  +GL
Sbjct  121  FLMSASYSFPPGIGL  135



>ref|XP_004298802.1| PREDICTED: transcription factor GLABRA 3 [Fragaria vesca subsp. 
vesca]
Length=636

 Score =   134 bits (338),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 64/122 (52%), Positives = 85/122 (70%), Gaps = 8/122 (7%)
 Frame = +3

Query  186  HLQTLLQTAVQSVHWTYSLFWNLCPHN-GMLVWSDGYYNGAIKTRKTVQGTEVSAEEASL  362
            +L+  L  AV+S+ W+Y++FW++ P   G+L W DGYYNG IKTRKTVQ  E+ A++  L
Sbjct  14   NLRKQLAIAVRSIQWSYAIFWSISPRQPGVLEWGDGYYNGDIKTRKTVQAIELDADQMGL  73

Query  363  HRSQQIKELYESLSATAEESNGGGGQQPARRPSAALSPEDLTESEWFYLMCISFSFPSAV  542
             RS+ ++ELYESLSA       G     ARRPSAALSPEDL ++EW+YL+C+SF F    
Sbjct  74   QRSEHLRELYESLSA-------GEASPQARRPSAALSPEDLADTEWYYLVCMSFVFNIGQ  126

Query  543  GL  548
            GL
Sbjct  127  GL  128



>gb|EAZ39105.1| hypothetical protein OsJ_23537 [Oryza sativa Japonica Group]
Length=636

 Score =   134 bits (337),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 70/135 (52%), Positives = 87/135 (64%), Gaps = 12/135 (9%)
 Frame = +3

Query  174  GGAAHLQTLLQTAVQSVHWTYSLFWNLCPHNGM-LVWSDGYYNGAIKTRKTV------QG  332
            GG AH    LQ   QS+ WTYSL W LCPH G  LVW +G+YNGA+KTRK+         
Sbjct  3    GGEAH--AALQAVAQSLRWTYSLLWQLCPHQGSSLVWGEGHYNGAVKTRKSTVMQPPPAE  60

Query  333  TEVSAEEASLHRSQQIKELYESLSATAEESNGG---GGQQPARRPSAALSPEDLTESEWF  503
             E  A+ A+ HRS+Q++ELY+ L    E S+GG        +RRP AALSPEDLTE+EWF
Sbjct  61   EEDDADHAARHRSRQLRELYDWLQQAGENSSGGVQTSSTTASRRPGAALSPEDLTETEWF  120

Query  504  YLMCISFSFPSAVGL  548
            +LM  S+SFP  +GL
Sbjct  121  FLMSASYSFPPGIGL  135



>gb|AAR21674.1| myc-like anthocyanin regulatory protein [Cornus alternifolia]
Length=635

 Score =   134 bits (337),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 66/122 (54%), Positives = 87/122 (71%), Gaps = 8/122 (7%)
 Frame = +3

Query  186  HLQTLLQTAVQSVHWTYSLFWNLCPHN-GMLVWSDGYYNGAIKTRKTVQGTEVSAEEASL  362
            +L+  L  AV+S+ W+Y++FW++     G+L W DGYYNG IKTRKTVQ  E +A++  L
Sbjct  15   NLKNRLAIAVRSIQWSYAIFWSISSRQPGVLEWGDGYYNGDIKTRKTVQAVEFNADQLGL  74

Query  363  HRSQQIKELYESLSATAEESNGGGGQQPARRPSAALSPEDLTESEWFYLMCISFSFPSAV  542
             RS+Q+KELYESLS    E+N       ARRPSAALSPEDLT++EW+YL+C+SF F    
Sbjct  75   QRSEQLKELYESLSVA--ETN-----PQARRPSAALSPEDLTDTEWYYLVCMSFVFNIGQ  127

Query  543  GL  548
            GL
Sbjct  128  GL  129



>gb|ADY17836.1| bHLH transcription factor [Oryza sativa]
Length=671

 Score =   134 bits (338),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 70/135 (52%), Positives = 87/135 (64%), Gaps = 12/135 (9%)
 Frame = +3

Query  174  GGAAHLQTLLQTAVQSVHWTYSLFWNLCPHNGM-LVWSDGYYNGAIKTRKTV------QG  332
            GG AH    LQ   QS+ WTYSL W LCPH G  LVW +G+YNGA+KTRK+         
Sbjct  3    GGEAH--AALQAGAQSLRWTYSLLWQLCPHQGSSLVWGEGHYNGAVKTRKSTVMQPPPAE  60

Query  333  TEVSAEEASLHRSQQIKELYESLSATAEESNGG---GGQQPARRPSAALSPEDLTESEWF  503
             E  A+ A+ HRS+Q++ELY+ L    E S+GG        +RRP AALSPEDLTE+EWF
Sbjct  61   EEDDADHAARHRSRQLRELYDWLQQAGENSSGGVQTSSTTASRRPGAALSPEDLTETEWF  120

Query  504  YLMCISFSFPSAVGL  548
            +LM  S+SFP  +GL
Sbjct  121  FLMSASYSFPPGIGL  135



>gb|ABB17166.1| brown pericarp and seed coat [Oryza sativa Japonica Group]
Length=666

 Score =   134 bits (338),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 70/135 (52%), Positives = 87/135 (64%), Gaps = 12/135 (9%)
 Frame = +3

Query  174  GGAAHLQTLLQTAVQSVHWTYSLFWNLCPHNGM-LVWSDGYYNGAIKTRKTV------QG  332
            GG AH    LQ   QS+ WTYSL W LCPH G  LVW +G+YNGA+KTRK+         
Sbjct  3    GGEAH--AALQAVAQSLRWTYSLLWQLCPHQGSSLVWGEGHYNGAVKTRKSTVMQPPPAE  60

Query  333  TEVSAEEASLHRSQQIKELYESLSATAEESNGG---GGQQPARRPSAALSPEDLTESEWF  503
             E  A+ A+ HRS+Q++ELY+ L    E S+GG        +RRP AALSPEDLTE+EWF
Sbjct  61   EEDDADHAARHRSRQLRELYDWLQQAGENSSGGVQTSSTTASRRPGAALSPEDLTETEWF  120

Query  504  YLMCISFSFPSAVGL  548
            +LM  S+SFP  +GL
Sbjct  121  FLMSASYSFPPGIGL  135



>gb|ADY17842.1| bHLH transcription factor [Oryza glaberrima]
Length=671

 Score =   134 bits (338),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 70/135 (52%), Positives = 87/135 (64%), Gaps = 12/135 (9%)
 Frame = +3

Query  174  GGAAHLQTLLQTAVQSVHWTYSLFWNLCPHNGM-LVWSDGYYNGAIKTRKTV------QG  332
            GG AH    LQ   QS+ WTYSL W LCPH G  LVW +G+YNGA+KTRK+         
Sbjct  3    GGEAH--AALQAVAQSLRWTYSLLWQLCPHQGSSLVWGEGHYNGAVKTRKSTVMQPPPAE  60

Query  333  TEVSAEEASLHRSQQIKELYESLSATAEESNGG---GGQQPARRPSAALSPEDLTESEWF  503
             E  A+ A+ HRS+Q++ELY+ L    E S+GG        +RRP AALSPEDLTE+EWF
Sbjct  61   EEDDADHAARHRSRQLRELYDWLQQAGENSSGGVQTSSTTASRRPGAALSPEDLTETEWF  120

Query  504  YLMCISFSFPSAVGL  548
            +LM  S+SFP  +GL
Sbjct  121  FLMSASYSFPPGIGL  135



>gb|ADV03944.1| bHLH DNA binding domain transcription factor BolC.TT8 [Brassica 
oleracea]
Length=521

 Score =   133 bits (334),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 68/134 (51%), Positives = 83/134 (62%), Gaps = 12/134 (9%)
 Frame = +3

Query  147  WSIVMAETPGGAAHLQTLLQTAVQSVHWTYSLFWNLCPHNGMLVWSDGYYNGAIKTRKTV  326
            W ++ AE       +Q LL+  VQSV WTYS+FW LCP    L+WS G YNGAIKTRKT 
Sbjct  10   WKVIGAE----KEEIQGLLKAVVQSVGWTYSVFWQLCPQRRKLMWSSGNYNGAIKTRKTT  65

Query  327  QGTEVSAEEASLHRSQQIKELYESLSATAEESNGGGGQQPARRPSAALSPEDLTESEWFY  506
            Q  EV AEEA+  RSQQ+ ELYE+L A        G      R   ALSPEDLT+ EWFY
Sbjct  66   QPAEVKAEEAASERSQQLMELYETLFA--------GESSMEARACTALSPEDLTDPEWFY  117

Query  507  LMCISFSFPSAVGL  548
            ++C ++SF    G+
Sbjct  118  VLCFTYSFEPPSGM  131



>gb|AAS86306.1| myc-like anthocyanin regulatory protein [Cornus suecica]
Length=624

 Score =   134 bits (336),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 67/126 (53%), Positives = 88/126 (70%), Gaps = 8/126 (6%)
 Frame = +3

Query  174  GGAAHLQTLLQTAVQSVHWTYSLFWNLCPHN-GMLVWSDGYYNGAIKTRKTVQGTEVSAE  350
            G   +L+  L  AV+S+ W+Y++FW++     G+L W DGYYNG IKTRKTVQ  E +A+
Sbjct  11   GLLENLKNQLAIAVRSIQWSYAIFWSISSRQPGVLEWGDGYYNGDIKTRKTVQAVEFNAD  70

Query  351  EASLHRSQQIKELYESLSATAEESNGGGGQQPARRPSAALSPEDLTESEWFYLMCISFSF  530
            +  L RS+Q+KELYESL  T  ESN       AR+PSAALSPEDLT++EW+YL+C+SF F
Sbjct  71   QLGLQRSEQLKELYESLVVT--ESN-----PQARKPSAALSPEDLTDTEWYYLVCMSFVF  123

Query  531  PSAVGL  548
                GL
Sbjct  124  NIGQGL  129



>ref|XP_010910264.1| PREDICTED: anthocyanin regulatory Lc protein-like isoform X2 
[Elaeis guineensis]
Length=671

 Score =   134 bits (337),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 63/122 (52%), Positives = 87/122 (71%), Gaps = 8/122 (7%)
 Frame = +3

Query  186  HLQTLLQTAVQSVHWTYSLFWNLCP-HNGMLVWSDGYYNGAIKTRKTVQGTEVSAEEASL  362
            HL+  L  AV+++ W+Y++FW++   H G+L WSDGYYNG IKTRKT Q  E  A++ +L
Sbjct  15   HLRKQLAAAVRNIQWSYAIFWSISTRHQGLLAWSDGYYNGDIKTRKTTQPMEFKADQIAL  74

Query  363  HRSQQIKELYESLSATAEESNGGGGQQPARRPSAALSPEDLTESEWFYLMCISFSFPSAV  542
             RS+Q++ELYESL A       G  +Q + RPSA+LSPEDLT +EW+YL+C+SF+F    
Sbjct  75   QRSEQLRELYESLLA-------GDNEQQSTRPSASLSPEDLTGTEWYYLVCMSFTFSPGQ  127

Query  543  GL  548
            GL
Sbjct  128  GL  129



>ref|XP_010910261.1| PREDICTED: anthocyanin regulatory Lc protein-like isoform X1 
[Elaeis guineensis]
 ref|XP_010910262.1| PREDICTED: anthocyanin regulatory Lc protein-like isoform X1 
[Elaeis guineensis]
 ref|XP_010910263.1| PREDICTED: anthocyanin regulatory Lc protein-like isoform X1 
[Elaeis guineensis]
Length=680

 Score =   134 bits (337),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 63/122 (52%), Positives = 87/122 (71%), Gaps = 8/122 (7%)
 Frame = +3

Query  186  HLQTLLQTAVQSVHWTYSLFWNLCP-HNGMLVWSDGYYNGAIKTRKTVQGTEVSAEEASL  362
            HL+  L  AV+++ W+Y++FW++   H G+L WSDGYYNG IKTRKT Q  E  A++ +L
Sbjct  15   HLRKQLAAAVRNIQWSYAIFWSISTRHQGLLAWSDGYYNGDIKTRKTTQPMEFKADQIAL  74

Query  363  HRSQQIKELYESLSATAEESNGGGGQQPARRPSAALSPEDLTESEWFYLMCISFSFPSAV  542
             RS+Q++ELYESL A       G  +Q + RPSA+LSPEDLT +EW+YL+C+SF+F    
Sbjct  75   QRSEQLRELYESLLA-------GDNEQQSTRPSASLSPEDLTGTEWYYLVCMSFTFSPGQ  127

Query  543  GL  548
            GL
Sbjct  128  GL  129



>ref|XP_007040254.1| Basic helix-loop-helix DNA-binding superfamily protein, putative 
isoform 7 [Theobroma cacao]
 gb|EOY24755.1| Basic helix-loop-helix DNA-binding superfamily protein, putative 
isoform 7 [Theobroma cacao]
Length=497

 Score =   132 bits (333),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 64/122 (52%), Positives = 86/122 (70%), Gaps = 8/122 (7%)
 Frame = +3

Query  186  HLQTLLQTAVQSVHWTYSLFWNLCPHN-GMLVWSDGYYNGAIKTRKTVQGTEVSAEEASL  362
            +L+  L  AV+++ W+Y++FW++     G+L W DGYYNG IKTRKTVQ  E++A +  L
Sbjct  16   NLKKQLALAVRNIQWSYAIFWSISARQPGVLEWGDGYYNGDIKTRKTVQAVELNANQLGL  75

Query  363  HRSQQIKELYESLSATAEESNGGGGQQPARRPSAALSPEDLTESEWFYLMCISFSFPSAV  542
             RS+Q++ELYESLSA       G     ARRPSAALSPEDLT++EW+YL+C+SF F    
Sbjct  76   QRSEQLRELYESLSA-------GDSSPQARRPSAALSPEDLTDTEWYYLVCMSFVFNIGQ  128

Query  543  GL  548
            GL
Sbjct  129  GL  130



>ref|XP_002299530.1| regulator of anthocyanin biosynthesis pathway family protein 
[Populus trichocarpa]
 gb|EEE84335.1| regulator of anthocyanin biosynthesis pathway family protein 
[Populus trichocarpa]
Length=629

 Score =   134 bits (336),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 63/123 (51%), Positives = 84/123 (68%), Gaps = 8/123 (7%)
 Frame = +3

Query  183  AHLQTLLQTAVQSVHWTYSLFWNLCPHN-GMLVWSDGYYNGAIKTRKTVQGTEVSAEEAS  359
             +L+  L  AV+S+ W+Y++FW++     G+L W DGYYNG IKTRKT+Q  E+  +E  
Sbjct  13   GNLKKQLAIAVRSIQWSYAIFWSMSARQPGVLEWGDGYYNGDIKTRKTIQSIELDEDELG  72

Query  360  LHRSQQIKELYESLSATAEESNGGGGQQPARRPSAALSPEDLTESEWFYLMCISFSFPSA  539
            L RS+Q++ELYESLS        G     ARRPSAALSPEDLT++EW+YL+C+SF F   
Sbjct  73   LQRSEQLRELYESLSV-------GEASPQARRPSAALSPEDLTDTEWYYLVCMSFIFDIG  125

Query  540  VGL  548
             GL
Sbjct  126  QGL  128



>gb|AAR21667.1| myc-like anthocyanin regulatory protein [Cornus suecica]
Length=624

 Score =   133 bits (335),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 67/126 (53%), Positives = 88/126 (70%), Gaps = 8/126 (6%)
 Frame = +3

Query  174  GGAAHLQTLLQTAVQSVHWTYSLFWNLCPHN-GMLVWSDGYYNGAIKTRKTVQGTEVSAE  350
            G   +L+  L  AV+S+ W+Y++FW++     G+L W DGYYNG IKTRKTVQ  E +A+
Sbjct  11   GLLENLKNQLAIAVRSIQWSYAIFWSISSRQPGVLEWGDGYYNGDIKTRKTVQAVEFNAD  70

Query  351  EASLHRSQQIKELYESLSATAEESNGGGGQQPARRPSAALSPEDLTESEWFYLMCISFSF  530
            +  L RS+Q+KELYESL  T  ESN       AR+PSAALSPEDLT++EW+YL+C+SF F
Sbjct  71   QLGLQRSEQLKELYESLVVT--ESN-----PQARKPSAALSPEDLTDTEWYYLVCMSFVF  123

Query  531  PSAVGL  548
                GL
Sbjct  124  NIGQGL  129



>gb|AAR21672.1| myc-like anthocyanin regulatory protein [Cornus oblonga]
Length=634

 Score =   134 bits (336),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 66/122 (54%), Positives = 87/122 (71%), Gaps = 8/122 (7%)
 Frame = +3

Query  186  HLQTLLQTAVQSVHWTYSLFWNLCPHN-GMLVWSDGYYNGAIKTRKTVQGTEVSAEEASL  362
            +L+  L  AV+S+ W+Y++FW++     G+L W DGYYNG IKTRKTVQ  E +A++  L
Sbjct  15   NLKNRLAIAVRSIQWSYAIFWSISSRQPGVLEWGDGYYNGDIKTRKTVQAVEFNADQLEL  74

Query  363  HRSQQIKELYESLSATAEESNGGGGQQPARRPSAALSPEDLTESEWFYLMCISFSFPSAV  542
             RS+Q+KELYESLS    E+N       ARRPSAALSPEDLT++EW+YL+C+SF F    
Sbjct  75   QRSEQLKELYESLSVA--ETNPH-----ARRPSAALSPEDLTDTEWYYLVCMSFVFNIGQ  127

Query  543  GL  548
            GL
Sbjct  128  GL  129



>ref|XP_007040248.1| Basic helix-loop-helix DNA-binding superfamily protein, putative 
isoform 1 [Theobroma cacao]
 ref|XP_007040249.1| Basic helix-loop-helix DNA-binding superfamily protein, putative 
isoform 1 [Theobroma cacao]
 gb|EOY24749.1| Basic helix-loop-helix DNA-binding superfamily protein, putative 
isoform 1 [Theobroma cacao]
 gb|EOY24750.1| Basic helix-loop-helix DNA-binding superfamily protein, putative 
isoform 1 [Theobroma cacao]
Length=643

 Score =   134 bits (336),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 64/122 (52%), Positives = 86/122 (70%), Gaps = 8/122 (7%)
 Frame = +3

Query  186  HLQTLLQTAVQSVHWTYSLFWNLCPHN-GMLVWSDGYYNGAIKTRKTVQGTEVSAEEASL  362
            +L+  L  AV+++ W+Y++FW++     G+L W DGYYNG IKTRKTVQ  E++A +  L
Sbjct  16   NLKKQLALAVRNIQWSYAIFWSISARQPGVLEWGDGYYNGDIKTRKTVQAVELNANQLGL  75

Query  363  HRSQQIKELYESLSATAEESNGGGGQQPARRPSAALSPEDLTESEWFYLMCISFSFPSAV  542
             RS+Q++ELYESLSA       G     ARRPSAALSPEDLT++EW+YL+C+SF F    
Sbjct  76   QRSEQLRELYESLSA-------GDSSPQARRPSAALSPEDLTDTEWYYLVCMSFVFNIGQ  128

Query  543  GL  548
            GL
Sbjct  129  GL  130



>gb|AAR21669.1| myc-like anthocyanin regulatory protein [Cornus florida]
Length=629

 Score =   133 bits (335),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 66/122 (54%), Positives = 87/122 (71%), Gaps = 8/122 (7%)
 Frame = +3

Query  186  HLQTLLQTAVQSVHWTYSLFWNLCPHN-GMLVWSDGYYNGAIKTRKTVQGTEVSAEEASL  362
            +L+  L  AV+S+ W+Y++FW++     G+L W DGYYNG IKTRKTVQ  E +A++  L
Sbjct  15   NLKNRLAIAVRSIQWSYAIFWSISSRQPGVLEWGDGYYNGDIKTRKTVQAVEFNADQLGL  74

Query  363  HRSQQIKELYESLSATAEESNGGGGQQPARRPSAALSPEDLTESEWFYLMCISFSFPSAV  542
             RS+Q+KELYESLS    E+N       ARRPSAALSPEDLT++EW+YL+C+SF F    
Sbjct  75   QRSEQLKELYESLSVA--ETN-----PQARRPSAALSPEDLTDTEWYYLVCMSFVFNIGQ  127

Query  543  GL  548
            GL
Sbjct  128  GL  129



>gb|KDP25431.1| hypothetical protein JCGZ_20587 [Jatropha curcas]
Length=617

 Score =   133 bits (334),  Expect = 7e-33, Method: Composition-based stats.
 Identities = 64/122 (52%), Positives = 85/122 (70%), Gaps = 8/122 (7%)
 Frame = +3

Query  186  HLQTLLQTAVQSVHWTYSLFWNLCPHN-GMLVWSDGYYNGAIKTRKTVQGTEVSAEEASL  362
            +L+  L  AV+S+ W+Y++FW++     G L W DGYYNG IKTRKTVQ  E++A++  L
Sbjct  9    NLKKQLALAVRSIQWSYAIFWSISTRQPGALEWGDGYYNGDIKTRKTVQSVELNADQLGL  68

Query  363  HRSQQIKELYESLSATAEESNGGGGQQPARRPSAALSPEDLTESEWFYLMCISFSFPSAV  542
             RS+Q++ELYESLSA       G     ARRPS ALSPEDLT++EW+YL+C+SF F    
Sbjct  69   QRSEQLRELYESLSA-------GEASPQARRPSVALSPEDLTDTEWYYLVCMSFLFNIGQ  121

Query  543  GL  548
            GL
Sbjct  122  GL  123



>ref|XP_011029287.1| PREDICTED: transcription factor GLABRA 3 [Populus euphratica]
Length=628

 Score =   133 bits (334),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 63/123 (51%), Positives = 84/123 (68%), Gaps = 8/123 (7%)
 Frame = +3

Query  183  AHLQTLLQTAVQSVHWTYSLFWNLCPHN-GMLVWSDGYYNGAIKTRKTVQGTEVSAEEAS  359
             +L+  L  AV+S+ W+Y++FW++     G+L W DGYYNG IKTRKT+Q  E+  +E  
Sbjct  13   GNLKKQLALAVRSIQWSYAIFWSISARQPGVLEWGDGYYNGDIKTRKTIQSIELDEDELG  72

Query  360  LHRSQQIKELYESLSATAEESNGGGGQQPARRPSAALSPEDLTESEWFYLMCISFSFPSA  539
            L RS+Q++ELYESLS        G     ARRPSAALSPEDLT++EW+YL+C+SF F   
Sbjct  73   LQRSEQLRELYESLSV-------GEASPQARRPSAALSPEDLTDTEWYYLVCMSFIFDIG  125

Query  540  VGL  548
             GL
Sbjct  126  QGL  128



>gb|AAR21670.1| myc-like anthocyanin regulatory protein [Cornus florida]
Length=647

 Score =   133 bits (335),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 66/122 (54%), Positives = 87/122 (71%), Gaps = 8/122 (7%)
 Frame = +3

Query  186  HLQTLLQTAVQSVHWTYSLFWNLCPHN-GMLVWSDGYYNGAIKTRKTVQGTEVSAEEASL  362
            +L+  L  AV+S+ W+Y++FW++     G+L W DGYYNG IKTRKTVQ  E +A++  L
Sbjct  15   NLKNRLAIAVRSIQWSYAIFWSISSRQPGVLEWGDGYYNGDIKTRKTVQAVEFNADQLGL  74

Query  363  HRSQQIKELYESLSATAEESNGGGGQQPARRPSAALSPEDLTESEWFYLMCISFSFPSAV  542
             RS+Q+KELYESLS    E+N       ARRPSAALSPEDLT++EW+YL+C+SF F    
Sbjct  75   QRSEQLKELYESLSVA--ETN-----PQARRPSAALSPEDLTDTEWYYLVCMSFVFNIGQ  127

Query  543  GL  548
            GL
Sbjct  128  GL  129



>ref|XP_006827621.1| PREDICTED: transcription factor EGL1 isoform X1 [Amborella trichopoda]
 gb|ERM95037.1| hypothetical protein AMTR_s00009p00242790 [Amborella trichopoda]
Length=655

 Score =   133 bits (335),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 67/121 (55%), Positives = 82/121 (68%), Gaps = 8/121 (7%)
 Frame = +3

Query  189  LQTLLQTAVQSVHWTYSLFWNLCP-HNGMLVWSDGYYNGAIKTRKTVQGTEVSAEEASLH  365
            L+  L +AVQ + W+Y +FW L   H G+L W DGYYNG IKTRKTVQ  E++ EE  L 
Sbjct  16   LRRRLGSAVQGLQWSYGIFWTLSSQHQGVLEWGDGYYNGDIKTRKTVQPMELTPEEMGLQ  75

Query  366  RSQQIKELYESLSATAEESNGGGGQQPARRPSAALSPEDLTESEWFYLMCISFSFPSAVG  545
            RS Q++ELY SLS        G   Q ARRP AALSPEDLT++EWFYL+C+SF+F    G
Sbjct  76   RSLQLRELYASLSM-------GESSQQARRPCAALSPEDLTDTEWFYLVCMSFTFNPGQG  128

Query  546  L  548
            L
Sbjct  129  L  129



>ref|XP_012086893.1| PREDICTED: transcription factor GLABRA 3-like isoform X1 [Jatropha 
curcas]
Length=622

 Score =   133 bits (334),  Expect = 1e-32, Method: Composition-based stats.
 Identities = 64/122 (52%), Positives = 85/122 (70%), Gaps = 8/122 (7%)
 Frame = +3

Query  186  HLQTLLQTAVQSVHWTYSLFWNLCPHN-GMLVWSDGYYNGAIKTRKTVQGTEVSAEEASL  362
            +L+  L  AV+S+ W+Y++FW++     G L W DGYYNG IKTRKTVQ  E++A++  L
Sbjct  9    NLKKQLALAVRSIQWSYAIFWSISTRQPGALEWGDGYYNGDIKTRKTVQSVELNADQLGL  68

Query  363  HRSQQIKELYESLSATAEESNGGGGQQPARRPSAALSPEDLTESEWFYLMCISFSFPSAV  542
             RS+Q++ELYESLSA       G     ARRPS ALSPEDLT++EW+YL+C+SF F    
Sbjct  69   QRSEQLRELYESLSA-------GEASPQARRPSVALSPEDLTDTEWYYLVCMSFLFNIGQ  121

Query  543  GL  548
            GL
Sbjct  122  GL  123



>ref|XP_012086894.1| PREDICTED: transcription factor GLABRA 3-like isoform X2 [Jatropha 
curcas]
Length=621

 Score =   133 bits (334),  Expect = 1e-32, Method: Composition-based stats.
 Identities = 64/122 (52%), Positives = 85/122 (70%), Gaps = 8/122 (7%)
 Frame = +3

Query  186  HLQTLLQTAVQSVHWTYSLFWNLCPHN-GMLVWSDGYYNGAIKTRKTVQGTEVSAEEASL  362
            +L+  L  AV+S+ W+Y++FW++     G L W DGYYNG IKTRKTVQ  E++A++  L
Sbjct  9    NLKKQLALAVRSIQWSYAIFWSISTRQPGALEWGDGYYNGDIKTRKTVQSVELNADQLGL  68

Query  363  HRSQQIKELYESLSATAEESNGGGGQQPARRPSAALSPEDLTESEWFYLMCISFSFPSAV  542
             RS+Q++ELYESLSA       G     ARRPS ALSPEDLT++EW+YL+C+SF F    
Sbjct  69   QRSEQLRELYESLSA-------GEASPQARRPSVALSPEDLTDTEWYYLVCMSFLFNIGQ  121

Query  543  GL  548
            GL
Sbjct  122  GL  123



>gb|AAR21671.1| myc-like anthocyanin regulatory protein [Cornus capitata]
Length=629

 Score =   133 bits (334),  Expect = 1e-32, Method: Composition-based stats.
 Identities = 66/122 (54%), Positives = 87/122 (71%), Gaps = 8/122 (7%)
 Frame = +3

Query  186  HLQTLLQTAVQSVHWTYSLFWNLCPHN-GMLVWSDGYYNGAIKTRKTVQGTEVSAEEASL  362
            +L+  L  AV+S+ W+Y++FW++     G+L W DGYYNG IKTRKTVQ  E +A++  L
Sbjct  15   NLKNRLAIAVKSIQWSYAIFWSISSRQPGVLEWGDGYYNGDIKTRKTVQAVEFNADQLGL  74

Query  363  HRSQQIKELYESLSATAEESNGGGGQQPARRPSAALSPEDLTESEWFYLMCISFSFPSAV  542
             RS+Q+KELYESLS    E+N       ARRPSAALSPEDLT++EW+YL+C+SF F    
Sbjct  75   RRSEQLKELYESLSVA--ETN-----PQARRPSAALSPEDLTDTEWYYLVCMSFVFNIGQ  127

Query  543  GL  548
            GL
Sbjct  128  GL  129



>ref|XP_010230011.1| PREDICTED: basic helix-loop-helix protein A-like [Brachypodium 
distachyon]
Length=661

 Score =   133 bits (335),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 69/136 (51%), Positives = 85/136 (63%), Gaps = 23/136 (17%)
 Frame = +3

Query  201  LQTAVQSVHWTYSLFWNLCPHNGMLVWSDGYYNGAIKTRKTVQGTEVSAEEASL------  362
            LQ   Q + WTY+L W LCP  G L+W++G+YNGAIKTRKTVQ    +   A        
Sbjct  11   LQAVAQGLRWTYALLWQLCPDQGALLWAEGHYNGAIKTRKTVQQAHGAPAPAPAEAADQA  70

Query  363  --HRSQQIKELYESLSATAEESNGGGG------------QQPARRPSAALSPEDLTESEW  500
              HRS+Q+KEL+ESL   A E+   GG            +  ARRP+AAL+PEDLTE+EW
Sbjct  71   ARHRSRQLKELFESL---AREAAAAGGMMTGCRVDAVQAESAARRPTAALAPEDLTETEW  127

Query  501  FYLMCISFSFPSAVGL  548
            FYLMC S+SFP  VGL
Sbjct  128  FYLMCASYSFPPHVGL  143



>gb|AIS35934.1| bHLH transcription factor [Phalaenopsis equestris]
Length=603

 Score =   132 bits (333),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 67/124 (54%), Positives = 84/124 (68%), Gaps = 8/124 (6%)
 Frame = +3

Query  180  AAHLQTLLQTAVQSVHWTYSLFWNLCPHNGMLVWSDGYYNGAIKTRKTVQGT-EVSAEEA  356
               ++ +LQT VQ + WTYSLFW LC H G+LVW DG YNG IKTRKTVQ T   S+E  
Sbjct  9    TKQIKQMLQTVVQKLGWTYSLFWKLCSHQGLLVWGDGCYNGTIKTRKTVQATGGESSELM  68

Query  357  SLHRSQQIKELYESLSATAEESNGGGGQQPARRPSAALSPEDLTESEWFYLMCISFSFPS  536
             + RS++++EL+E LSA  E      G++  RRP  AL PEDLTE EWFYL+C+SF+F  
Sbjct  69   EIGRSEELRELFEFLSAGEE-----CGER--RRPGLALLPEDLTECEWFYLLCMSFTFSP  121

Query  537  AVGL  548
              GL
Sbjct  122  GCGL  125



>gb|AAB03841.1| IN1 [Zea mays]
Length=685

 Score =   133 bits (335),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 69/139 (50%), Positives = 85/139 (61%), Gaps = 20/139 (14%)
 Frame = +3

Query  192  QTLLQTAVQSVHWTYSLFWNLCPHNGMLVWSDGYYNGAIKTRKTVQGT--------EVSA  347
            Q  LQ+  QS  WTYSL W LCP  G LVW++GYYNGAI+TRKT   T        +   
Sbjct  11   QKALQSVAQSTGWTYSLLWRLCPRQGALVWAEGYYNGAIRTRKTTMTTVRQPAGAEDAGD  70

Query  348  EEASLHRSQQIKELYESLSA------------TAEESNGGGGQQPARRPSAALSPEDLTE  491
            EE +  RS+Q+KELY+SL+A              ++        P RRP+AAL+PEDLTE
Sbjct  71   EETAPRRSRQLKELYDSLAAGEAAYDGGGGVGGPQQQQQAAVVPPPRRPAAALAPEDLTE  130

Query  492  SEWFYLMCISFSFPSAVGL  548
            +EWFYLMC S+ FP AVGL
Sbjct  131  TEWFYLMCASYCFPPAVGL  149



>gb|AAS86277.1| myc-like anthocyanin regulatory protein [Cornus cf. canadensis 
Xiang and Fan 16-1]
Length=620

 Score =   132 bits (333),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 66/122 (54%), Positives = 87/122 (71%), Gaps = 8/122 (7%)
 Frame = +3

Query  186  HLQTLLQTAVQSVHWTYSLFWNLCPHN-GMLVWSDGYYNGAIKTRKTVQGTEVSAEEASL  362
            +L+  L  AV+S+ W+Y++FW++     G+L W DGYYNG IKTRKTVQ  E +A++  L
Sbjct  15   NLKNRLAIAVRSIQWSYAIFWSISSRQPGVLEWGDGYYNGDIKTRKTVQAVEFNADQLGL  74

Query  363  HRSQQIKELYESLSATAEESNGGGGQQPARRPSAALSPEDLTESEWFYLMCISFSFPSAV  542
             RS+Q+KELYESL+ T  ESN       ARR SAALSPEDLT++EW+YL+C+SF F    
Sbjct  75   QRSEQLKELYESLAVT--ESN-----PQARRTSAALSPEDLTDTEWYYLVCMSFVFNIGQ  127

Query  543  GL  548
            GL
Sbjct  128  GL  129



>gb|AAR21675.1| myc-like anthocyanin regulatory protein [Cornus eydeana]
Length=630

 Score =   132 bits (333),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 66/122 (54%), Positives = 86/122 (70%), Gaps = 8/122 (7%)
 Frame = +3

Query  186  HLQTLLQTAVQSVHWTYSLFWNLCPHN-GMLVWSDGYYNGAIKTRKTVQGTEVSAEEASL  362
            +L+  L  AV+S+ W+Y++FW++     G+L W DGYYNG IKTRKTVQ  E  A++  L
Sbjct  15   NLKNRLAIAVRSIQWSYAIFWSISSRQPGVLEWGDGYYNGDIKTRKTVQAVEFDADQLGL  74

Query  363  HRSQQIKELYESLSATAEESNGGGGQQPARRPSAALSPEDLTESEWFYLMCISFSFPSAV  542
             RS+Q+KELY SLS    E+N       ARRPSAALSPEDLT++EW+YL+C+SF F  A 
Sbjct  75   QRSEQLKELYGSLSVA--ETN-----PQARRPSAALSPEDLTDTEWYYLVCMSFVFNVAQ  127

Query  543  GL  548
            GL
Sbjct  128  GL  129



>ref|XP_008238828.1| PREDICTED: transcription factor EGL1 [Prunus mume]
Length=641

 Score =   132 bits (333),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 63/122 (52%), Positives = 86/122 (70%), Gaps = 8/122 (7%)
 Frame = +3

Query  186  HLQTLLQTAVQSVHWTYSLFWNLCPHN-GMLVWSDGYYNGAIKTRKTVQGTEVSAEEASL  362
            +L+  L  AV+S+ W+Y++FW++     G+L W DGYYNG IKTRKTVQ  E++A++  L
Sbjct  14   NLRKQLALAVRSIEWSYAIFWSISARQPGVLEWGDGYYNGDIKTRKTVQAIELNADQMGL  73

Query  363  HRSQQIKELYESLSATAEESNGGGGQQPARRPSAALSPEDLTESEWFYLMCISFSFPSAV  542
             RS+Q++ELYESLSA       G     ARRPSA+LSPEDL ++EW+YL+C+SF F    
Sbjct  74   QRSEQLRELYESLSA-------GEASPQARRPSASLSPEDLADTEWYYLVCMSFVFNVGQ  126

Query  543  GL  548
            GL
Sbjct  127  GL  128



>ref|XP_007209040.1| hypothetical protein PRUPE_ppa002762mg [Prunus persica]
 gb|EMJ10239.1| hypothetical protein PRUPE_ppa002762mg [Prunus persica]
Length=636

 Score =   132 bits (332),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 63/122 (52%), Positives = 86/122 (70%), Gaps = 8/122 (7%)
 Frame = +3

Query  186  HLQTLLQTAVQSVHWTYSLFWNLCPHN-GMLVWSDGYYNGAIKTRKTVQGTEVSAEEASL  362
            +L+  L  AV+S+ W+Y++FW++     G+L W DGYYNG IKTRKTVQ  E++A++  L
Sbjct  14   NLRKQLALAVRSIEWSYAIFWSISARQPGVLEWGDGYYNGDIKTRKTVQAIELNADQMGL  73

Query  363  HRSQQIKELYESLSATAEESNGGGGQQPARRPSAALSPEDLTESEWFYLMCISFSFPSAV  542
             RS+Q++ELYESLSA       G     ARRPSA+LSPEDL ++EW+YL+C+SF F    
Sbjct  74   QRSEQLRELYESLSA-------GEASPQARRPSASLSPEDLADTEWYYLVCMSFVFNVGQ  126

Query  543  GL  548
            GL
Sbjct  127  GL  128



>gb|ADK36601.1| Rc protein [Oryza rufipogon]
Length=664

 Score =   132 bits (332),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 69/135 (51%), Positives = 86/135 (64%), Gaps = 12/135 (9%)
 Frame = +3

Query  174  GGAAHLQTLLQTAVQSVHWTYSLFWNLCPHNGM-LVWSDGYYNGAIKTRKTV------QG  332
            GG AH    LQ   QS+ WTY L W LCPH G  LVW +G+YNGA+KTRK+         
Sbjct  3    GGEAH--AALQAVAQSLRWTYCLLWQLCPHQGSSLVWGEGHYNGAVKTRKSTVMQPPPAE  60

Query  333  TEVSAEEASLHRSQQIKELYESLSATAEESNGG---GGQQPARRPSAALSPEDLTESEWF  503
             E  A+ A+ HRS+Q++ELY+ L    E S+GG        +RRP AALSPEDLTE+EWF
Sbjct  61   EEDDADHAARHRSRQLRELYDWLQQAGENSSGGVQTSSTTASRRPGAALSPEDLTETEWF  120

Query  504  YLMCISFSFPSAVGL  548
            +LM  S+SFP  +GL
Sbjct  121  FLMSASYSFPPGIGL  135



>gb|AGO58373.1| basic helix-loop-helix protein [Morella rubra]
Length=656

 Score =   132 bits (332),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 63/126 (50%), Positives = 86/126 (68%), Gaps = 8/126 (6%)
 Frame = +3

Query  174  GGAAHLQTLLQTAVQSVHWTYSLFWNL-CPHNGMLVWSDGYYNGAIKTRKTVQGTEVSAE  350
            G   +L+  L  AV+S+ W+Y++FW+L     G+L W DGYYNG IKTRKTVQ  E+ A+
Sbjct  10   GLPENLRKRLAVAVRSIQWSYAIFWSLSTTQQGVLEWGDGYYNGDIKTRKTVQAVELKAD  69

Query  351  EASLHRSQQIKELYESLSATAEESNGGGGQQPARRPSAALSPEDLTESEWFYLMCISFSF  530
            +  L RS+Q++ELY+SL         G   Q A+RPSAALSPEDL+++EW+YL+C+SF F
Sbjct  70   KIGLQRSEQLRELYQSLLE-------GEADQQAKRPSAALSPEDLSDAEWYYLVCMSFVF  122

Query  531  PSAVGL  548
                GL
Sbjct  123  SPGEGL  128



>ref|XP_006391734.1| hypothetical protein EUTSA_v10023356mg [Eutrema salsugineum]
 dbj|BAJ34303.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ29020.1| hypothetical protein EUTSA_v10023356mg [Eutrema salsugineum]
Length=615

 Score =   132 bits (331),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 62/122 (51%), Positives = 86/122 (70%), Gaps = 2/122 (2%)
 Frame = +3

Query  186  HLQTLLQTAVQSVHWTYSLFWNLCPHN-GMLVWSDGYYNGAIKTRKTVQGTEVSAEEASL  362
            +L+  L  +V+++ W+Y +FW++     G+L W DGYYNG IKTRKT+Q  EV A++  L
Sbjct  24   NLKKQLAVSVRNIQWSYGIFWSVSASQPGVLEWGDGYYNGDIKTRKTIQAAEVKADKLGL  83

Query  363  HRSQQIKELYESLSATAEESNGGGGQQPARRPSAALSPEDLTESEWFYLMCISFSFPSAV  542
             RS+Q++ELYESLS  AE S  GG Q   R  +AALSPEDLT++EW+YL+C+SF F    
Sbjct  84   ERSEQLRELYESLSV-AESSASGGSQVTRRASAAALSPEDLTDTEWYYLVCMSFVFNIGE  142

Query  543  GL  548
            G+
Sbjct  143  GI  144



>ref|XP_009112753.1| PREDICTED: transcription factor EGL1 [Brassica rapa]
 ref|XP_009112755.1| PREDICTED: transcription factor EGL1 [Brassica rapa]
 ref|XP_009112756.1| PREDICTED: transcription factor EGL1 [Brassica rapa]
Length=606

 Score =   132 bits (331),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 63/123 (51%), Positives = 88/123 (72%), Gaps = 4/123 (3%)
 Frame = +3

Query  186  HLQTLLQTAVQSVHWTYSLFWNLCPHN-GMLVWSDGYYNGAIKTRKTVQGTEVSAEEASL  362
            +L+  L  +V+++ W+Y +FW++     G+L W DGYYNG IKTRKT+Q  EV A++  L
Sbjct  12   NLKKHLAVSVRNIQWSYGIFWSISASQPGVLEWGDGYYNGDIKTRKTIQAVEVKADQLGL  71

Query  363  HRSQQIKELYESLSATAEESNGGGGQQPARRPSA-ALSPEDLTESEWFYLMCISFSFPSA  539
             RS+Q++ELYESLS    ES+  GG Q +RR SA ALSPEDLT++EW+YL+C+SF F   
Sbjct  72   ERSEQLRELYESLSVA--ESSASGGSQVSRRASATALSPEDLTDTEWYYLVCMSFVFNIG  129

Query  540  VGL  548
             G+
Sbjct  130  EGI  132



>gb|AJI76866.1| GL3-like basic helix-loop-helix transcription factor [Populus 
tremula x Populus tremuloides]
Length=628

 Score =   132 bits (331),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 62/117 (53%), Positives = 81/117 (69%), Gaps = 8/117 (7%)
 Frame = +3

Query  201  LQTAVQSVHWTYSLFWNLCPHN-GMLVWSDGYYNGAIKTRKTVQGTEVSAEEASLHRSQQ  377
            L  AV+S+ W+Y++FW++     G+L W DGYYNG IKTRKT+Q  E+  +E  L RS+Q
Sbjct  19   LALAVRSIQWSYAIFWSISARQPGLLEWGDGYYNGDIKTRKTIQSIELDEDELGLQRSEQ  78

Query  378  IKELYESLSATAEESNGGGGQQPARRPSAALSPEDLTESEWFYLMCISFSFPSAVGL  548
            ++ELYESLS        G     ARRPSAALSPEDLT++EW+YL+C+SF F    GL
Sbjct  79   LRELYESLSV-------GEASPQARRPSAALSPEDLTDTEWYYLVCMSFIFDIGQGL  128



>ref|XP_009364930.1| PREDICTED: transcription factor EGL1-like [Pyrus x bretschneideri]
 ref|XP_009364938.1| PREDICTED: transcription factor EGL1-like [Pyrus x bretschneideri]
Length=634

 Score =   132 bits (331),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 63/122 (52%), Positives = 85/122 (70%), Gaps = 8/122 (7%)
 Frame = +3

Query  186  HLQTLLQTAVQSVHWTYSLFWNLCPHN-GMLVWSDGYYNGAIKTRKTVQGTEVSAEEASL  362
            +L+  L  AV+S+ W+Y +FW++     G+L W DGYYNG IKTRKTVQ  E++A++  L
Sbjct  6    NLRKQLALAVRSIQWSYGIFWSISARQPGVLEWGDGYYNGDIKTRKTVQAIELNADQMGL  65

Query  363  HRSQQIKELYESLSATAEESNGGGGQQPARRPSAALSPEDLTESEWFYLMCISFSFPSAV  542
             RS+Q++ELYESLSA       G     ARRPSA+LSPEDL ++EW+YL+C+SF F    
Sbjct  66   QRSEQLRELYESLSA-------GEASPQARRPSASLSPEDLADTEWYYLVCMSFVFNIGQ  118

Query  543  GL  548
            GL
Sbjct  119  GL  120



>gb|AFD29598.1| DEL65 [Gossypium arboreum]
Length=620

 Score =   131 bits (330),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 62/122 (51%), Positives = 87/122 (71%), Gaps = 8/122 (7%)
 Frame = +3

Query  186  HLQTLLQTAVQSVHWTYSLFWNLCPHN-GMLVWSDGYYNGAIKTRKTVQGTEVSAEEASL  362
            +L+  L  AV+++ W+Y++FW++     G+L W DGYYNG IKTRKTVQ  E++ ++ SL
Sbjct  14   NLKKQLALAVRNIQWSYAIFWSISTRQPGVLEWGDGYYNGDIKTRKTVQAVELNTDQLSL  73

Query  363  HRSQQIKELYESLSATAEESNGGGGQQPARRPSAALSPEDLTESEWFYLMCISFSFPSAV  542
             RS+Q+++LYESLSA       G     A+RPSAALSPEDLT++EW+YL+C+SF F    
Sbjct  74   QRSEQLRQLYESLSA-------GESSPQAKRPSAALSPEDLTDTEWYYLVCMSFVFNIGQ  126

Query  543  GL  548
            GL
Sbjct  127  GL  128



>ref|XP_006476561.1| PREDICTED: transcription factor GLABRA 3-like isoform X2 [Citrus 
sinensis]
Length=618

 Score =   131 bits (330),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 65/121 (54%), Positives = 87/121 (72%), Gaps = 6/121 (5%)
 Frame = +3

Query  189  LQTLLQTAVQSVHWTYSLFWNLCPHN-GMLVWSDGYYNGAIKTRKTVQGTEVSAEEASLH  365
            L+  L  AV+S+ W+Y++FW +     G+L W DGYYNG IKTRKT+Q  E+S+ +  L 
Sbjct  16   LKKQLALAVRSIQWSYAIFWTISDTQPGVLEWGDGYYNGDIKTRKTIQSVELSSNQLGLQ  75

Query  366  RSQQIKELYESLSATAEESNGGGGQQPARRPSAALSPEDLTESEWFYLMCISFSFPSAVG  545
            RS+Q++ELYESLSA   ESN    Q  ++RPSAALSPEDLT++EW+YL+C+SF F    G
Sbjct  76   RSEQLRELYESLSAG--ESN---PQAASKRPSAALSPEDLTDTEWYYLVCMSFVFNIGEG  130

Query  546  L  548
            L
Sbjct  131  L  131



>gb|KHG13854.1| Transcription factor GLABRA 3 -like protein [Gossypium arboreum]
Length=628

 Score =   131 bits (330),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 62/122 (51%), Positives = 87/122 (71%), Gaps = 8/122 (7%)
 Frame = +3

Query  186  HLQTLLQTAVQSVHWTYSLFWNLCPHN-GMLVWSDGYYNGAIKTRKTVQGTEVSAEEASL  362
            +L+  L  AV+++ W+Y++FW++     G+L W DGYYNG IKTRKTVQ  E++ ++ SL
Sbjct  14   NLKKQLALAVRNIQWSYAIFWSISTRQPGVLEWGDGYYNGDIKTRKTVQAVELNTDQLSL  73

Query  363  HRSQQIKELYESLSATAEESNGGGGQQPARRPSAALSPEDLTESEWFYLMCISFSFPSAV  542
             RS+Q+++LYESLSA       G     A+RPSAALSPEDLT++EW+YL+C+SF F    
Sbjct  74   QRSEQLRQLYESLSA-------GESSPQAKRPSAALSPEDLTDTEWYYLVCMSFVFNIGQ  126

Query  543  GL  548
            GL
Sbjct  127  GL  128



>ref|XP_008392582.1| PREDICTED: transcription factor EGL1-like [Malus domestica]
Length=634

 Score =   131 bits (330),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 63/122 (52%), Positives = 85/122 (70%), Gaps = 8/122 (7%)
 Frame = +3

Query  186  HLQTLLQTAVQSVHWTYSLFWNLCPHN-GMLVWSDGYYNGAIKTRKTVQGTEVSAEEASL  362
            +L+  L  AV+S+ W+Y +FW++     G+L W DGYYNG IKTRKTVQ  E++A++  L
Sbjct  6    NLRKQLALAVRSIQWSYGIFWSISARQPGVLEWGDGYYNGDIKTRKTVQAIELNADQMGL  65

Query  363  HRSQQIKELYESLSATAEESNGGGGQQPARRPSAALSPEDLTESEWFYLMCISFSFPSAV  542
             RS+Q++ELYESLSA       G     ARRPSA+LSPEDL ++EW+YL+C+SF F    
Sbjct  66   QRSEQLRELYESLSA-------GEASPQARRPSASLSPEDLADTEWYYLVCMSFVFNIGQ  118

Query  543  GL  548
            GL
Sbjct  119  GL  120



>ref|XP_006476560.1| PREDICTED: transcription factor GLABRA 3-like isoform X1 [Citrus 
sinensis]
Length=626

 Score =   131 bits (330),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 65/121 (54%), Positives = 87/121 (72%), Gaps = 6/121 (5%)
 Frame = +3

Query  189  LQTLLQTAVQSVHWTYSLFWNLCPHN-GMLVWSDGYYNGAIKTRKTVQGTEVSAEEASLH  365
            L+  L  AV+S+ W+Y++FW +     G+L W DGYYNG IKTRKT+Q  E+S+ +  L 
Sbjct  16   LKKQLALAVRSIQWSYAIFWTISDTQPGVLEWGDGYYNGDIKTRKTIQSVELSSNQLGLQ  75

Query  366  RSQQIKELYESLSATAEESNGGGGQQPARRPSAALSPEDLTESEWFYLMCISFSFPSAVG  545
            RS+Q++ELYESLSA   ESN    Q  ++RPSAALSPEDLT++EW+YL+C+SF F    G
Sbjct  76   RSEQLRELYESLSAG--ESN---PQAASKRPSAALSPEDLTDTEWYYLVCMSFVFNIGEG  130

Query  546  L  548
            L
Sbjct  131  L  131



>gb|KDO76231.1| hypothetical protein CISIN_1g007527mg [Citrus sinensis]
Length=600

 Score =   131 bits (329),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 65/121 (54%), Positives = 87/121 (72%), Gaps = 6/121 (5%)
 Frame = +3

Query  189  LQTLLQTAVQSVHWTYSLFWNLCPHN-GMLVWSDGYYNGAIKTRKTVQGTEVSAEEASLH  365
            L+  L  AV+S+ W+Y++FW +     G+L W DGYYNG IKTRKT+Q  E+S+ +  L 
Sbjct  16   LKKQLALAVRSIQWSYAIFWTISDTQPGVLEWGDGYYNGDIKTRKTIQSVELSSNQLGLQ  75

Query  366  RSQQIKELYESLSATAEESNGGGGQQPARRPSAALSPEDLTESEWFYLMCISFSFPSAVG  545
            RS+Q++ELYESLSA   ESN    Q  ++RPSAALSPEDLT++EW+YL+C+SF F    G
Sbjct  76   RSEQLRELYESLSAG--ESN---PQAASKRPSAALSPEDLTDTEWYYLVCMSFVFNIGEG  130

Query  546  L  548
            L
Sbjct  131  L  131



>gb|AAR21666.1| myc-like anthocyanin regulatory protein [Cornus unalaschkensis]
Length=625

 Score =   131 bits (329),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 66/126 (52%), Positives = 88/126 (70%), Gaps = 8/126 (6%)
 Frame = +3

Query  174  GGAAHLQTLLQTAVQSVHWTYSLFWNLCPHN-GMLVWSDGYYNGAIKTRKTVQGTEVSAE  350
            G   +L+  L  AV+S+ W+Y++FW++     G+L W DGYYNG IKTRKTVQ  E +A+
Sbjct  11   GLLENLKNRLAIAVRSIQWSYAIFWSISSRQPGVLEWGDGYYNGDIKTRKTVQAVEFNAD  70

Query  351  EASLHRSQQIKELYESLSATAEESNGGGGQQPARRPSAALSPEDLTESEWFYLMCISFSF  530
            +  L RS+Q+KELYESL+ T  ESN       AR+ SAALSPEDLT++EW+YL+C+SF F
Sbjct  71   QLGLQRSEQLKELYESLAVT--ESN-----PQARKSSAALSPEDLTDTEWYYLVCMSFVF  123

Query  531  PSAVGL  548
                GL
Sbjct  124  NIGQGL  129



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 612919574843