BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig33

Length=830
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011089543.1|  PREDICTED: root phototropism protein 2-like        390   3e-129   Sesamum indicum [beniseed]
ref|XP_004243653.1|  PREDICTED: root phototropism protein 2             377   6e-124   Solanum lycopersicum
ref|XP_006353728.1|  PREDICTED: root phototropism protein 2-like        377   7e-124   Solanum tuberosum [potatoes]
emb|CDP04035.1|  unnamed protein product                                377   1e-123   Coffea canephora [robusta coffee]
ref|XP_009611218.1|  PREDICTED: root phototropism protein 2             375   3e-123   Nicotiana tomentosiformis
gb|EYU36889.1|  hypothetical protein MIMGU_mgv1a003487mg                372   5e-122   Erythranthe guttata [common monkey flower]
ref|XP_009777101.1|  PREDICTED: root phototropism protein 2             372   8e-122   Nicotiana sylvestris
gb|KHG08105.1|  Root phototropism 2 -like protein                       367   1e-120   Gossypium arboreum [tree cotton]
gb|KJB26284.1|  hypothetical protein B456_004G235100                    367   5e-120   Gossypium raimondii
ref|XP_002264896.1|  PREDICTED: root phototropism protein 2 isofo...    363   2e-118   Vitis vinifera
ref|XP_012077861.1|  PREDICTED: root phototropism protein 2             361   1e-117   Jatropha curcas
ref|XP_010023564.1|  PREDICTED: root phototropism protein 2             358   1e-116   Eucalyptus grandis [rose gum]
ref|XP_007017103.1|  Phototropic-responsive NPH3 family protein         358   2e-116   
ref|XP_006432046.1|  hypothetical protein CICLE_v10000673mg             356   2e-115   Citrus clementina [clementine]
gb|KDO54917.1|  hypothetical protein CISIN_1g007944mg                   356   2e-115   Citrus sinensis [apfelsine]
ref|XP_010094443.1|  Root phototropism protein 2                        352   5e-114   Morus notabilis
ref|NP_001280845.1|  root phototropism protein 2-like                   348   1e-112   Malus domestica [apple tree]
ref|XP_008366216.1|  PREDICTED: root phototropism protein 2-like        348   2e-112   
gb|ADL36608.1|  BZIP domain class transcription factor                  348   2e-112   Malus domestica [apple tree]
ref|XP_008451888.1|  PREDICTED: root phototropism protein 2 isofo...    348   3e-112   Cucumis melo [Oriental melon]
ref|XP_004294714.1|  PREDICTED: root phototropism protein 2             348   3e-112   Fragaria vesca subsp. vesca
ref|XP_008349518.1|  PREDICTED: LOW QUALITY PROTEIN: root phototr...    347   3e-112   
ref|XP_002325631.1|  ROOT PHOTOTROPISM 2 family protein                 347   5e-112   Populus trichocarpa [western balsam poplar]
ref|XP_009374407.1|  PREDICTED: root phototropism protein 2-like        346   1e-111   Pyrus x bretschneideri [bai li]
ref|XP_004147730.1|  PREDICTED: root phototropism protein 2             346   1e-111   Cucumis sativus [cucumbers]
ref|XP_011011776.1|  PREDICTED: root phototropism protein 2-like        345   4e-111   Populus euphratica
ref|XP_009355145.1|  PREDICTED: root phototropism protein 2-like        344   5e-111   Pyrus x bretschneideri [bai li]
ref|XP_007206420.1|  hypothetical protein PRUPE_ppa003347mg             344   6e-111   Prunus persica
ref|XP_008239637.1|  PREDICTED: root phototropism protein 2 isofo...    344   8e-111   Prunus mume [ume]
ref|XP_008239576.1|  PREDICTED: root phototropism protein 2 isofo...    344   8e-111   Prunus mume [ume]
ref|XP_008451887.1|  PREDICTED: root phototropism protein 2 isofo...    346   1e-110   
ref|XP_006591739.1|  PREDICTED: root phototropism protein 2-like        341   2e-110   Glycine max [soybeans]
ref|NP_001280895.1|  root phototropism protein 2-like                   342   2e-110   Malus domestica [apple tree]
ref|XP_002319980.1|  ROOT PHOTOTROPISM 2 family protein                 342   4e-110   
gb|KGN53487.1|  hypothetical protein Csa_4G056750                       342   4e-110   Cucumis sativus [cucumbers]
gb|AFK45576.1|  unknown                                                 337   1e-109   Medicago truncatula
ref|XP_003600550.1|  Root phototropism protein                          339   3e-109   Medicago truncatula
ref|XP_011015900.1|  PREDICTED: root phototropism protein 2-like        340   3e-109   Populus euphratica
gb|KJB26282.1|  hypothetical protein B456_004G235100                    337   2e-108   Gossypium raimondii
ref|XP_011041764.1|  PREDICTED: root phototropism protein 2-like        337   4e-108   Populus euphratica
ref|XP_004500391.1|  PREDICTED: root phototropism protein 2-like        336   6e-108   Cicer arietinum [garbanzo]
ref|XP_003553189.1|  PREDICTED: root phototropism protein 2-like        335   2e-107   Glycine max [soybeans]
ref|XP_006410156.1|  hypothetical protein EUTSA_v10016728mg             329   2e-107   
ref|XP_006293884.1|  hypothetical protein CARUB_v10022870mg             335   3e-107   Capsella rubella
ref|XP_010677799.1|  PREDICTED: root phototropism protein 2             334   6e-107   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010244564.1|  PREDICTED: root phototropism protein 2             333   1e-106   Nelumbo nucifera [Indian lotus]
ref|XP_010414259.1|  PREDICTED: root phototropism protein 2-like        332   3e-106   Camelina sativa [gold-of-pleasure]
gb|KFK22949.1|  root phototropism protein 2                             331   1e-105   Arabis alpina [alpine rockcress]
dbj|BAJ33924.1|  unnamed protein product                                330   2e-105   Eutrema halophilum
dbj|BAF02185.1|  hypothetical protein                                   330   2e-105   Arabidopsis thaliana [mouse-ear cress]
ref|NP_850147.1|  Root phototropism protein 2                           330   2e-105   Arabidopsis thaliana [mouse-ear cress]
gb|AAF33112.1|AF181683_1  RPT2                                          330   2e-105   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010469846.1|  PREDICTED: root phototropism protein 2 isofo...    330   2e-105   
emb|CDY10743.1|  BnaA05g11930D                                          330   3e-105   Brassica napus [oilseed rape]
ref|XP_009144295.1|  PREDICTED: root phototropism protein 2             330   3e-105   Brassica rapa
ref|XP_010510344.1|  PREDICTED: root phototropism protein 2-like        330   3e-105   Camelina sativa [gold-of-pleasure]
emb|CDY02075.1|  BnaC04g14260D                                          328   1e-104   
ref|XP_002881117.1|  hypothetical protein ARALYDRAFT_481966             328   2e-104   
ref|XP_011080638.1|  PREDICTED: root phototropism protein 2             327   2e-104   Sesamum indicum [beniseed]
ref|XP_010557176.1|  PREDICTED: root phototropism protein 2             327   2e-104   Tarenaya hassleriana [spider flower]
dbj|BAF01791.1|  hypothetical protein                                   327   2e-104   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007146905.1|  hypothetical protein PHAVU_006G080400g             325   8e-104   Phaseolus vulgaris [French bean]
ref|XP_003544940.2|  PREDICTED: root phototropism protein 2-like        320   1e-101   Glycine max [soybeans]
emb|CDY23992.1|  BnaC03g16990D                                          317   1e-100   Brassica napus [oilseed rape]
ref|XP_003519296.1|  PREDICTED: root phototropism protein 2             317   2e-100   
ref|XP_003616056.1|  Root phototropism protein                          317   3e-100   Medicago truncatula
ref|XP_010044625.1|  PREDICTED: root phototropism protein 2-like        314   1e-99    Eucalyptus grandis [rose gum]
gb|KCW86718.1|  hypothetical protein EUGRSUZ_B03325                     314   2e-99    Eucalyptus grandis [rose gum]
ref|XP_009132742.1|  PREDICTED: root phototropism protein 2-like        313   4e-99    Brassica rapa
emb|CDX84827.1|  BnaA03g14030D                                          313   5e-99    
ref|XP_007142019.1|  hypothetical protein PHAVU_008G245700g             312   2e-98    Phaseolus vulgaris [French bean]
gb|EPS73802.1|  hypothetical protein M569_00954                         311   2e-98    Genlisea aurea
ref|XP_004490729.1|  PREDICTED: root phototropism protein 2-like        310   1e-97    Cicer arietinum [garbanzo]
ref|XP_006842585.1|  PREDICTED: root phototropism protein 2             305   6e-96    Amborella trichopoda
ref|XP_010522018.1|  PREDICTED: root phototropism protein 2-like        301   3e-94    Tarenaya hassleriana [spider flower]
emb|CBI15801.3|  unnamed protein product                                287   6e-94    Vitis vinifera
gb|KJB26283.1|  hypothetical protein B456_004G235100                    295   2e-92    Gossypium raimondii
gb|KDO54918.1|  hypothetical protein CISIN_1g007944mg                   292   2e-91    Citrus sinensis [apfelsine]
ref|XP_006432045.1|  hypothetical protein CICLE_v10000673mg             292   2e-91    
ref|XP_010650806.1|  PREDICTED: root phototropism protein 2 isofo...    290   1e-90    
gb|ABI34691.1|  bZIP transcription factor bZIP84                        268   1e-86    Glycine max [soybeans]
ref|XP_008358916.1|  PREDICTED: root phototropism protein 2-like        265   3e-85    
gb|AES70802.2|  root phototropism-like protein                          270   9e-83    Medicago truncatula
ref|NP_001031446.1|  Root phototropism protein 2                        269   2e-82    Arabidopsis thaliana [mouse-ear cress]
gb|AAB63085.1|  unknown protein                                         249   7e-79    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002533880.1|  Root phototropism protein, putative                258   4e-78    
ref|XP_009402205.1|  PREDICTED: root phototropism protein 2 isofo...    254   3e-76    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009384759.1|  PREDICTED: root phototropism protein 2-like ...    251   5e-75    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008803009.1|  PREDICTED: root phototropism protein 2             251   5e-75    Phoenix dactylifera
gb|KEH28209.1|  root phototropism-like protein                          248   1e-74    Medicago truncatula
ref|XP_010922790.1|  PREDICTED: root phototropism protein 2             249   2e-74    Elaeis guineensis
ref|XP_003600551.1|  Root phototropism protein                          244   3e-73    
gb|KHN18647.1|  Root phototropism protein 2                             222   6e-67    Glycine soja [wild soybean]
ref|XP_002978505.1|  hypothetical protein SELMODRAFT_443843             223   2e-64    Selaginella moellendorffii
ref|XP_002970426.1|  hypothetical protein SELMODRAFT_231529             223   3e-64    
gb|KGN61975.1|  hypothetical protein Csa_2G277660                       214   5e-64    Cucumis sativus [cucumbers]
emb|CBI33715.3|  unnamed protein product                                214   2e-61    Vitis vinifera
gb|EYU44474.1|  hypothetical protein MIMGU_mgv1a027075mg                213   7e-61    Erythranthe guttata [common monkey flower]
ref|XP_011649319.1|  PREDICTED: BTB/POZ domain-containing protein...    214   8e-61    Cucumis sativus [cucumbers]
ref|XP_011649320.1|  PREDICTED: BTB/POZ domain-containing protein...    214   8e-61    Cucumis sativus [cucumbers]
ref|XP_008457767.1|  PREDICTED: BTB/POZ domain-containing protein...    213   2e-60    Cucumis melo [Oriental melon]
ref|XP_008457766.1|  PREDICTED: BTB/POZ domain-containing protein...    213   2e-60    
gb|KHG27515.1|  hypothetical protein F383_13864                         209   5e-60    Gossypium arboreum [tree cotton]
ref|XP_002989054.1|  hypothetical protein SELMODRAFT_272040             211   6e-60    Selaginella moellendorffii
ref|XP_007156731.1|  hypothetical protein PHAVU_002G012500g             211   6e-60    Phaseolus vulgaris [French bean]
ref|XP_002983725.1|  hypothetical protein SELMODRAFT_228979             211   8e-60    Selaginella moellendorffii
ref|XP_003538794.2|  PREDICTED: BTB/POZ domain-containing protein...    210   2e-59    Glycine max [soybeans]
ref|XP_004511862.1|  PREDICTED: BTB/POZ domain-containing protein...    210   3e-59    Cicer arietinum [garbanzo]
ref|XP_004511860.1|  PREDICTED: BTB/POZ domain-containing protein...    210   3e-59    Cicer arietinum [garbanzo]
gb|KJB48680.1|  hypothetical protein B456_008G080700                    206   5e-59    Gossypium raimondii
ref|XP_011006799.1|  PREDICTED: BTB/POZ domain-containing protein...    208   8e-59    Populus euphratica
ref|XP_006380639.1|  hypothetical protein POPTR_0007s10060g             208   1e-58    Populus trichocarpa [western balsam poplar]
ref|XP_011012051.1|  PREDICTED: BTB/POZ domain-containing protein...    207   1e-58    Populus euphratica
ref|XP_006339816.1|  PREDICTED: BTB/POZ domain-containing protein...    207   1e-58    Solanum tuberosum [potatoes]
gb|KDO78973.1|  hypothetical protein CISIN_1g006971mg                   204   2e-58    Citrus sinensis [apfelsine]
ref|XP_009628088.1|  PREDICTED: BTB/POZ domain-containing protein...    207   2e-58    Nicotiana tomentosiformis
ref|XP_010086959.1|  BTB/POZ domain-containing protein                  207   2e-58    
ref|XP_002963864.1|  hypothetical protein SELMODRAFT_141980             207   3e-58    Selaginella moellendorffii
ref|XP_002988267.1|  hypothetical protein SELMODRAFT_447227             207   4e-58    Selaginella moellendorffii
gb|KJB43881.1|  hypothetical protein B456_007G221600                    203   4e-58    Gossypium raimondii
ref|XP_007047478.1|  Phototropic-responsive NPH3 family protein         206   5e-58    
ref|XP_002284242.2|  PREDICTED: BTB/POZ domain-containing protein...    206   8e-58    Vitis vinifera
ref|XP_010028106.1|  PREDICTED: BTB/POZ domain-containing protein...    206   1e-57    Eucalyptus grandis [rose gum]
ref|XP_010028107.1|  PREDICTED: BTB/POZ domain-containing protein...    206   1e-57    Eucalyptus grandis [rose gum]
emb|CAN71562.1|  hypothetical protein VITISV_007563                     206   1e-57    Vitis vinifera
ref|XP_002533158.1|  Root phototropism protein, putative                205   1e-57    Ricinus communis
gb|KJB48677.1|  hypothetical protein B456_008G080700                    205   2e-57    Gossypium raimondii
ref|XP_006466487.1|  PREDICTED: BTB/POZ domain-containing protein...    205   2e-57    Citrus sinensis [apfelsine]
ref|XP_004231910.1|  PREDICTED: BTB/POZ domain-containing protein...    204   2e-57    Solanum lycopersicum
gb|KHN36285.1|  BTB/POZ domain-containing protein                       204   3e-57    Glycine soja [wild soybean]
ref|XP_003517336.1|  PREDICTED: BTB/POZ domain-containing protein...    204   3e-57    Glycine max [soybeans]
ref|XP_009402206.1|  PREDICTED: root phototropism protein 2 isofo...    203   3e-57    
ref|XP_010559030.1|  PREDICTED: BTB/POZ domain-containing protein...    203   5e-57    Tarenaya hassleriana [spider flower]
ref|XP_012079373.1|  PREDICTED: BTB/POZ domain-containing protein...    204   6e-57    Jatropha curcas
ref|XP_006426057.1|  hypothetical protein CICLE_v10025164mg             203   7e-57    Citrus clementina [clementine]
gb|KDO78972.1|  hypothetical protein CISIN_1g006971mg                   203   7e-57    Citrus sinensis [apfelsine]
ref|XP_010277089.1|  PREDICTED: BTB/POZ domain-containing protein...    203   8e-57    
ref|XP_011099322.1|  PREDICTED: BTB/POZ domain-containing protein...    202   2e-56    Sesamum indicum [beniseed]
ref|XP_009782405.1|  PREDICTED: BTB/POZ domain-containing protein...    202   2e-56    Nicotiana sylvestris
gb|KJB43880.1|  hypothetical protein B456_007G221600                    202   2e-56    Gossypium raimondii
ref|XP_006590635.1|  PREDICTED: BTB/POZ domain-containing protein...    202   3e-56    Glycine max [soybeans]
ref|XP_010905282.1|  PREDICTED: BTB/POZ domain-containing protein...    202   3e-56    Elaeis guineensis
ref|XP_009384760.1|  PREDICTED: root phototropism protein 2-like ...    200   3e-56    
emb|CDP02580.1|  unnamed protein product                                201   4e-56    Coffea canephora [robusta coffee]
ref|XP_010272171.1|  PREDICTED: BTB/POZ domain-containing protein...    201   4e-56    Nelumbo nucifera [Indian lotus]
ref|XP_008238282.1|  PREDICTED: BTB/POZ domain-containing protein...    201   6e-56    
ref|XP_004233453.1|  PREDICTED: BTB/POZ domain-containing protein...    200   8e-56    
ref|XP_003597110.1|  Root phototropism protein                          201   8e-56    
ref|XP_003608469.1|  BTB/POZ domain-containing protein                  196   8e-56    
ref|XP_006841959.1|  PREDICTED: BTB/POZ domain-containing protein...    200   9e-56    Amborella trichopoda
ref|XP_010679598.1|  PREDICTED: BTB/POZ domain-containing protein...    200   1e-55    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010679597.1|  PREDICTED: BTB/POZ domain-containing protein...    200   1e-55    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009611132.1|  PREDICTED: BTB/POZ domain-containing protein...    199   3e-55    Nicotiana tomentosiformis
ref|XP_010559028.1|  PREDICTED: BTB/POZ domain-containing protein...    198   3e-55    Tarenaya hassleriana [spider flower]
ref|XP_006364419.1|  PREDICTED: BTB/POZ domain-containing protein...    199   3e-55    Solanum tuberosum [potatoes]
ref|XP_001763717.1|  predicted protein                                  197   7e-55    
ref|XP_007208165.1|  hypothetical protein PRUPE_ppa002888mg             198   8e-55    Prunus persica
ref|XP_002866705.1|  signal transducer                                  197   2e-54    Arabidopsis lyrata subsp. lyrata
gb|KHN12984.1|  BTB/POZ domain-containing protein                       197   2e-54    Glycine soja [wild soybean]
gb|AES90666.2|  phototropic-responsive NPH3 family protein              196   2e-54    Medicago truncatula
ref|XP_002521098.1|  protein binding protein, putative                  196   3e-54    Ricinus communis
ref|XP_008352542.1|  PREDICTED: BTB/POZ domain-containing protein...    192   4e-54    
gb|EPS72379.1|  hypothetical protein M569_02379                         195   6e-54    Genlisea aurea
ref|XP_009792130.1|  PREDICTED: BTB/POZ domain-containing protein...    195   6e-54    Nicotiana sylvestris
ref|XP_008382632.1|  PREDICTED: BTB/POZ domain-containing protein...    195   7e-54    
ref|XP_008372448.1|  PREDICTED: BTB/POZ domain-containing protein...    192   8e-54    
ref|XP_010939121.1|  PREDICTED: BTB/POZ domain-containing protein...    195   9e-54    Elaeis guineensis
ref|XP_009599429.1|  PREDICTED: BTB/POZ domain-containing protein...    194   1e-53    Nicotiana tomentosiformis
ref|XP_007201187.1|  hypothetical protein PRUPE_ppa002993mg             194   1e-53    Prunus persica
ref|XP_004288469.1|  PREDICTED: BTB/POZ domain-containing protein...    194   1e-53    Fragaria vesca subsp. vesca
ref|XP_011089690.1|  PREDICTED: BTB/POZ domain-containing protein...    191   1e-53    Sesamum indicum [beniseed]
ref|XP_009334929.1|  PREDICTED: BTB/POZ domain-containing protein...    195   2e-53    Pyrus x bretschneideri [bai li]
ref|XP_004247086.1|  PREDICTED: BTB/POZ domain-containing protein...    194   2e-53    Solanum lycopersicum
ref|XP_006356774.1|  PREDICTED: BTB/POZ domain-containing protein...    194   2e-53    Solanum tuberosum [potatoes]
ref|XP_009342777.1|  PREDICTED: BTB/POZ domain-containing protein...    194   2e-53    Pyrus x bretschneideri [bai li]
ref|XP_008235484.1|  PREDICTED: BTB/POZ domain-containing protein...    194   2e-53    Prunus mume [ume]
ref|XP_008354715.1|  PREDICTED: BTB/POZ domain-containing protein...    194   3e-53    
ref|XP_004511857.1|  PREDICTED: BTB/POZ domain-containing protein...    194   3e-53    
ref|XP_004511859.1|  PREDICTED: BTB/POZ domain-containing protein...    194   3e-53    
ref|XP_001770455.1|  predicted protein                                  194   3e-53    
ref|XP_006380638.1|  hypothetical protein POPTR_0007s10060g             193   4e-53    
ref|XP_011089103.1|  PREDICTED: BTB/POZ domain-containing protein...    192   6e-53    Sesamum indicum [beniseed]
ref|XP_011623754.1|  PREDICTED: BTB/POZ domain-containing protein...    192   1e-52    Amborella trichopoda
ref|XP_010028108.1|  PREDICTED: BTB/POZ domain-containing protein...    191   2e-52    Eucalyptus grandis [rose gum]
ref|XP_010685004.1|  PREDICTED: BTB/POZ domain-containing protein...    191   2e-52    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_011089687.1|  PREDICTED: BTB/POZ domain-containing protein...    191   2e-52    Sesamum indicum [beniseed]
ref|XP_009766799.1|  PREDICTED: BTB/POZ domain-containing protein...    191   2e-52    Nicotiana sylvestris
ref|XP_011089689.1|  PREDICTED: BTB/POZ domain-containing protein...    191   2e-52    Sesamum indicum [beniseed]
ref|XP_010524688.1|  PREDICTED: BTB/POZ domain-containing protein...    191   3e-52    Tarenaya hassleriana [spider flower]
ref|XP_010109730.1|  BTB/POZ domain-containing protein                  191   3e-52    Morus notabilis
emb|CDY43566.1|  BnaC02g16630D                                          184   3e-52    Brassica napus [oilseed rape]
ref|XP_011089686.1|  PREDICTED: BTB/POZ domain-containing protein...    191   3e-52    Sesamum indicum [beniseed]
ref|XP_004240632.1|  PREDICTED: BTB/POZ domain-containing protein...    190   3e-52    Solanum lycopersicum
gb|EYU40606.1|  hypothetical protein MIMGU_mgv1a003057mg                190   5e-52    Erythranthe guttata [common monkey flower]
ref|NP_680473.2|  phototropic-responsive NPH3-like protein              190   5e-52    Arabidopsis thaliana [mouse-ear cress]
gb|AAU05485.1|  At5g67385                                               190   5e-52    Arabidopsis thaliana [mouse-ear cress]
ref|XP_011024680.1|  PREDICTED: BTB/POZ domain-containing protein...    190   6e-52    Populus euphratica
ref|XP_008787157.1|  PREDICTED: BTB/POZ domain-containing protein...    190   6e-52    Phoenix dactylifera
ref|XP_002301784.2|  hypothetical protein POPTR_0002s24380g             190   6e-52    Populus trichocarpa [western balsam poplar]
ref|XP_009411062.1|  PREDICTED: BTB/POZ domain-containing protein...    189   6e-52    Musa acuminata subsp. malaccensis [pisang utan]
gb|KFK28391.1|  hypothetical protein AALP_AA8G509000                    189   7e-52    Arabis alpina [alpine rockcress]
ref|XP_012085112.1|  PREDICTED: BTB/POZ domain-containing protein...    189   8e-52    Jatropha curcas
ref|XP_009780159.1|  PREDICTED: BTB/POZ domain-containing protein...    189   9e-52    Nicotiana sylvestris
gb|KDP26391.1|  hypothetical protein JCGZ_17549                         189   1e-51    Jatropha curcas
ref|XP_010484507.1|  PREDICTED: BTB/POZ domain-containing protein...    189   1e-51    Camelina sativa [gold-of-pleasure]
ref|XP_004509079.1|  PREDICTED: BTB/POZ domain-containing protein...    189   1e-51    Cicer arietinum [garbanzo]
ref|XP_009630230.1|  PREDICTED: BTB/POZ domain-containing protein...    185   2e-51    
gb|KHN13450.1|  BTB/POZ domain-containing protein                       188   2e-51    Glycine soja [wild soybean]
ref|XP_009371616.1|  PREDICTED: BTB/POZ domain-containing protein...    188   3e-51    Pyrus x bretschneideri [bai li]
ref|XP_006393938.1|  hypothetical protein EUTSA_v10003858mg             188   3e-51    Eutrema salsugineum [saltwater cress]
dbj|BAJ34215.1|  unnamed protein product                                188   3e-51    Eutrema halophilum
gb|EYU39234.1|  hypothetical protein MIMGU_mgv1a003527mg                187   3e-51    Erythranthe guttata [common monkey flower]
ref|XP_010464139.1|  PREDICTED: BTB/POZ domain-containing protein...    188   3e-51    Camelina sativa [gold-of-pleasure]
ref|XP_003551322.2|  PREDICTED: BTB/POZ domain-containing protein...    187   4e-51    Glycine max [soybeans]
ref|XP_007049780.1|  Phototropic-responsive NPH3 family protein         187   4e-51    
ref|XP_010277091.1|  PREDICTED: BTB/POZ domain-containing protein...    187   4e-51    
gb|KJB26098.1|  hypothetical protein B456_004G225600                    187   4e-51    Gossypium raimondii
emb|CDY68489.1|  BnaCnng59210D                                          184   4e-51    Brassica napus [oilseed rape]
ref|XP_006395119.1|  hypothetical protein EUTSA_v10003813mg             188   5e-51    
gb|KHG00255.1|  hypothetical protein F383_19997                         187   5e-51    Gossypium arboreum [tree cotton]
gb|KJB42465.1|  hypothetical protein B456_007G154300                    187   5e-51    Gossypium raimondii
ref|XP_006280202.1|  hypothetical protein CARUB_v10026107mg             187   7e-51    Capsella rubella
gb|KHG21232.1|  hypothetical protein F383_08117                         187   7e-51    Gossypium arboreum [tree cotton]
dbj|BAJ33928.1|  unnamed protein product                                187   8e-51    Eutrema halophilum
ref|XP_007050812.1|  Phototropic-responsive NPH3 family protein i...    187   8e-51    Theobroma cacao [chocolate]
ref|XP_007155848.1|  hypothetical protein PHAVU_003G236800g             186   1e-50    Phaseolus vulgaris [French bean]
ref|XP_006443605.1|  hypothetical protein CICLE_v10019330mg             186   1e-50    Citrus clementina [clementine]
ref|XP_003520918.1|  PREDICTED: BTB/POZ domain-containing protein...    186   1e-50    Glycine max [soybeans]
dbj|BAC41926.1|  non-phototropic hypocotyl-like protein                 180   1e-50    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010245988.1|  PREDICTED: BTB/POZ domain-containing protein...    186   1e-50    Nelumbo nucifera [Indian lotus]
ref|XP_011459733.1|  PREDICTED: BTB/POZ domain-containing protein...    186   1e-50    Fragaria vesca subsp. vesca
ref|XP_002961348.1|  hypothetical protein SELMODRAFT_74933              186   1e-50    
ref|XP_006600924.1|  PREDICTED: BTB/POZ domain-containing protein...    186   2e-50    Glycine max [soybeans]
ref|XP_007133999.1|  hypothetical protein PHAVU_010G010500g             186   2e-50    Phaseolus vulgaris [French bean]
ref|XP_008465052.1|  PREDICTED: BTB/POZ domain-containing protein...    185   3e-50    Cucumis melo [Oriental melon]
ref|XP_007050813.1|  Phototropic-responsive NPH3 family protein i...    185   4e-50    Theobroma cacao [chocolate]
ref|XP_009630229.1|  PREDICTED: BTB/POZ domain-containing protein...    185   5e-50    Nicotiana tomentosiformis
ref|XP_011079726.1|  PREDICTED: BTB/POZ domain-containing protein...    185   5e-50    Sesamum indicum [beniseed]
ref|XP_003604967.1|  BTB/POZ domain-containing protein                  184   5e-50    Medicago truncatula
emb|CDY37857.1|  BnaAnng05180D                                          184   6e-50    Brassica napus [oilseed rape]
ref|XP_006579934.1|  PREDICTED: BTB/POZ domain-containing protein...    184   7e-50    Glycine max [soybeans]
ref|XP_009130549.1|  PREDICTED: LOW QUALITY PROTEIN: BTB/POZ doma...    184   7e-50    Brassica rapa
gb|ERN06935.1|  hypothetical protein AMTR_s00005p00262560               184   7e-50    Amborella trichopoda
emb|CBI37309.3|  unnamed protein product                                184   8e-50    Vitis vinifera
ref|XP_002265786.1|  PREDICTED: BTB/POZ domain-containing protein...    184   8e-50    Vitis vinifera
ref|XP_010264099.1|  PREDICTED: BTB/POZ domain-containing protein...    182   8e-50    
ref|XP_004144382.2|  PREDICTED: BTB/POZ domain-containing protein...    184   9e-50    Cucumis sativus [cucumbers]
ref|XP_009103425.1|  PREDICTED: BTB/POZ domain-containing protein...    184   9e-50    Brassica rapa
ref|XP_004506596.1|  PREDICTED: BTB/POZ domain-containing protein...    184   1e-49    Cicer arietinum [garbanzo]
gb|KHG21965.1|  hypothetical protein F383_08186                         184   1e-49    Gossypium arboreum [tree cotton]
dbj|BAK07863.1|  predicted protein                                      183   1e-49    Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CDY57436.1|  BnaAnng14510D                                          183   2e-49    Brassica napus [oilseed rape]
ref|XP_009379310.1|  PREDICTED: BTB/POZ domain-containing protein...    183   2e-49    Pyrus x bretschneideri [bai li]
ref|XP_004136051.1|  PREDICTED: BTB/POZ domain-containing protein...    183   3e-49    Cucumis sativus [cucumbers]
emb|CDP03534.1|  unnamed protein product                                182   3e-49    Coffea canephora [robusta coffee]
ref|XP_002863924.1|  phototropic-responsive NPH3 family protein         182   3e-49    Arabidopsis lyrata subsp. lyrata
ref|XP_004247452.1|  PREDICTED: BTB/POZ domain-containing protein...    182   3e-49    Solanum lycopersicum
ref|XP_010264098.1|  PREDICTED: BTB/POZ domain-containing protein...    183   3e-49    Nelumbo nucifera [Indian lotus]
ref|XP_008451623.1|  PREDICTED: BTB/POZ domain-containing protein...    183   4e-49    Cucumis melo [Oriental melon]
ref|XP_010317168.1|  PREDICTED: BTB/POZ domain-containing protein...    182   4e-49    
ref|XP_006359421.1|  PREDICTED: BTB/POZ domain-containing protein...    182   5e-49    Solanum tuberosum [potatoes]
ref|XP_011659339.1|  PREDICTED: BTB/POZ domain-containing protein...    182   5e-49    Cucumis sativus [cucumbers]
ref|XP_001769248.1|  predicted protein                                  181   5e-49    
gb|KHG21966.1|  hypothetical protein F383_08186                         182   6e-49    Gossypium arboreum [tree cotton]
emb|CDY12841.1|  BnaC07g15920D                                          181   6e-49    Brassica napus [oilseed rape]
ref|XP_008451624.1|  PREDICTED: BTB/POZ domain-containing protein...    181   7e-49    Cucumis melo [Oriental melon]
gb|KJB23203.1|  hypothetical protein B456_004G086600                    182   7e-49    Gossypium raimondii
ref|XP_010439675.1|  PREDICTED: BTB/POZ domain-containing protein...    181   8e-49    Camelina sativa [gold-of-pleasure]
ref|XP_010326604.1|  PREDICTED: BTB/POZ domain-containing protein...    181   9e-49    Solanum lycopersicum
ref|XP_010652500.1|  PREDICTED: BTB/POZ domain-containing protein...    181   9e-49    Vitis vinifera
ref|XP_006359422.1|  PREDICTED: BTB/POZ domain-containing protein...    181   9e-49    Solanum tuberosum [potatoes]
ref|NP_199691.1|  phototropic-responsive NPH3 protein                   181   1e-48    Arabidopsis thaliana [mouse-ear cress]
ref|XP_012082688.1|  PREDICTED: BTB/POZ domain-containing protein...    181   1e-48    Jatropha curcas
gb|EYU46717.1|  hypothetical protein MIMGU_mgv1a003257mg                181   1e-48    Erythranthe guttata [common monkey flower]
gb|KJB41979.1|  hypothetical protein B456_007G130600                    181   1e-48    Gossypium raimondii
ref|XP_006281736.1|  hypothetical protein CARUB_v10027892mg             181   2e-48    Capsella rubella
gb|EMT21744.1|  BTB/POZ domain-containing protein                       179   2e-48    
ref|XP_010036820.1|  PREDICTED: BTB/POZ domain-containing protein...    180   2e-48    Eucalyptus grandis [rose gum]
ref|XP_010112756.1|  BTB/POZ domain-containing protein                  180   2e-48    Morus notabilis
gb|KJB47066.1|  hypothetical protein B456_008G009400                    178   2e-48    
ref|XP_009406358.1|  PREDICTED: BTB/POZ domain-containing protein...    180   2e-48    
ref|XP_002267241.2|  PREDICTED: BTB/POZ domain-containing protein...    180   2e-48    
gb|KFK31290.1|  hypothetical protein AALP_AA6G093300                    180   3e-48    
gb|KDP28100.1|  hypothetical protein JCGZ_13871                         179   3e-48    
ref|XP_003558544.1|  PREDICTED: BTB/POZ domain-containing protein...    179   4e-48    
gb|KHG22134.1|  hypothetical protein F383_09600                         179   5e-48    
ref|XP_009626458.1|  PREDICTED: BTB/POZ domain-containing protein...    179   5e-48    
ref|XP_012082689.1|  PREDICTED: BTB/POZ domain-containing protein...    179   5e-48    
ref|XP_009776597.1|  PREDICTED: BTB/POZ domain-containing protein...    179   5e-48    
ref|XP_006844655.1|  PREDICTED: BTB/POZ domain-containing protein...    179   6e-48    
ref|XP_012082690.1|  PREDICTED: BTB/POZ domain-containing protein...    179   7e-48    
ref|XP_002320358.1|  hypothetical protein POPTR_0014s12800g             179   7e-48    
ref|XP_010241864.1|  PREDICTED: BTB/POZ domain-containing protein...    179   7e-48    
ref|XP_010652066.1|  PREDICTED: BTB/POZ domain-containing protein...    179   8e-48    
ref|XP_009776604.1|  PREDICTED: BTB/POZ domain-containing protein...    178   8e-48    
gb|KJB41980.1|  hypothetical protein B456_007G130600                    178   1e-47    
ref|XP_009626459.1|  PREDICTED: BTB/POZ domain-containing protein...    178   1e-47    
ref|XP_010482146.1|  PREDICTED: BTB/POZ domain-containing protein...    178   1e-47    
gb|KJB47067.1|  hypothetical protein B456_008G009400                    177   1e-47    
ref|XP_011033592.1|  PREDICTED: BTB/POZ domain-containing protein...    178   1e-47    
ref|XP_010652501.1|  PREDICTED: BTB/POZ domain-containing protein...    177   2e-47    
ref|XP_008776569.1|  PREDICTED: LOW QUALITY PROTEIN: BTB/POZ doma...    177   2e-47    
gb|KJB47065.1|  hypothetical protein B456_008G009400                    177   3e-47    
ref|XP_001764279.1|  predicted protein                                  176   3e-47    
ref|XP_009414870.1|  PREDICTED: BTB/POZ domain-containing protein...    177   4e-47    
ref|XP_006404081.1|  hypothetical protein EUTSA_v10010248mg             176   4e-47    
ref|XP_010241873.1|  PREDICTED: BTB/POZ domain-containing protein...    176   4e-47    
ref|XP_010909076.1|  PREDICTED: BTB/POZ domain-containing protein...    177   4e-47    
ref|XP_010921839.1|  PREDICTED: BTB/POZ domain-containing protein...    177   4e-47    
ref|XP_006651150.1|  PREDICTED: BTB/POZ domain-containing protein...    174   4e-47    
ref|XP_004985270.1|  PREDICTED: BTB/POZ domain-containing protein...    176   5e-47    
ref|XP_002520669.1|  protein binding protein, putative                  176   8e-47    
ref|XP_011033590.1|  PREDICTED: BTB/POZ domain-containing protein...    175   1e-46    
ref|XP_002465671.1|  hypothetical protein SORBIDRAFT_01g043470          175   2e-46    
ref|XP_006479889.1|  PREDICTED: BTB/POZ domain-containing protein...    175   2e-46    
ref|XP_007199752.1|  hypothetical protein PRUPE_ppa002803mg             175   2e-46    
ref|XP_010684491.1|  PREDICTED: BTB/POZ domain-containing protein...    174   3e-46    
ref|XP_008386633.1|  PREDICTED: BTB/POZ domain-containing protein...    174   3e-46    
gb|ERN16941.1|  hypothetical protein AMTR_s00057p00189750               174   3e-46    
emb|CAN74119.1|  hypothetical protein VITISV_002050                     177   3e-46    
ref|XP_002877714.1|  predicted protein                                  173   4e-46    
ref|XP_008389180.1|  PREDICTED: BTB/POZ domain-containing protein...    174   4e-46    
emb|CDX86278.1|  BnaA06g29950D                                          174   4e-46    
ref|XP_011468065.1|  PREDICTED: BTB/POZ domain-containing protein...    173   5e-46    
gb|KHG27924.1|  hypothetical protein F383_10949                         174   5e-46    
ref|XP_009151678.1|  PREDICTED: BTB/POZ domain-containing protein...    174   5e-46    
ref|XP_006479890.1|  PREDICTED: BTB/POZ domain-containing protein...    173   6e-46    
emb|CDX85365.1|  BnaC07g26760D                                          173   6e-46    
ref|XP_010684492.1|  PREDICTED: BTB/POZ domain-containing protein...    173   7e-46    
ref|XP_011082488.1|  PREDICTED: BTB/POZ domain-containing protein...    173   8e-46    
gb|KFK34271.1|  hypothetical protein AALP_AA5G123300                    172   1e-45    
ref|XP_011082489.1|  PREDICTED: BTB/POZ domain-containing protein...    172   1e-45    
ref|XP_009378916.1|  PREDICTED: BTB/POZ domain-containing protein...    172   1e-45    
ref|XP_009595976.1|  PREDICTED: BTB/POZ domain-containing protein...    172   1e-45    
ref|XP_011015142.1|  PREDICTED: BTB/POZ domain-containing protein...    172   1e-45    
ref|XP_008386634.1|  PREDICTED: BTB/POZ domain-containing protein...    172   2e-45    
ref|XP_009405608.1|  PREDICTED: BTB/POZ domain-containing protein...    172   2e-45    
ref|XP_006444252.1|  hypothetical protein CICLE_v10019309mg             172   2e-45    
ref|XP_006389692.1|  hypothetical protein POPTR_0020s00510g             172   2e-45    
ref|XP_009757790.1|  PREDICTED: BTB/POZ domain-containing protein...    171   4e-45    
ref|XP_010038174.1|  PREDICTED: BTB/POZ domain-containing protein...    171   4e-45    
ref|XP_006583767.1|  PREDICTED: root phototropism protein 3-like ...    170   7e-45    
ref|XP_004309683.1|  PREDICTED: BTB/POZ domain-containing protein...    171   7e-45    
emb|CDY37449.1|  BnaC08g45870D                                          169   7e-45    
ref|XP_011015143.1|  PREDICTED: BTB/POZ domain-containing protein...    170   1e-44    
ref|XP_006351743.1|  PREDICTED: root phototropism protein 3-like        170   1e-44    
ref|XP_010556761.1|  PREDICTED: BTB/POZ domain-containing protein...    170   1e-44    
ref|XP_004495986.1|  PREDICTED: BTB/POZ domain-containing protein...    170   1e-44    
gb|KCW49991.1|  hypothetical protein EUGRSUZ_K03448                     169   1e-44    
gb|KEH43247.1|  phototropic-responsive NPH3 family protein              169   1e-44    
ref|XP_002522618.1|  hypothetical protein RCOM_0884570                  170   1e-44    
ref|XP_010038175.1|  PREDICTED: BTB/POZ domain-containing protein...    169   2e-44    
gb|KDO42274.1|  hypothetical protein CISIN_1g005842mg                   168   2e-44    
gb|KEH31205.1|  phototropic-responsive NPH3 family protein              168   2e-44    
ref|XP_003528390.2|  PREDICTED: root phototropism protein 3-like ...    170   2e-44    
gb|KHN09117.1|  Root phototropism protein 3                             169   2e-44    
ref|XP_007159131.1|  hypothetical protein PHAVU_002G211400g             169   2e-44    
ref|XP_011470995.1|  PREDICTED: BTB/POZ domain-containing protein...    169   2e-44    
gb|KDO64171.1|  hypothetical protein CISIN_1g035818mg                   168   3e-44    
ref|XP_006481239.1|  PREDICTED: BTB/POZ domain-containing protein...    168   4e-44    
emb|CDX89922.1|  BnaA10g01600D                                          168   4e-44    
ref|XP_009119585.1|  PREDICTED: BTB/POZ domain-containing protein...    168   4e-44    
ref|XP_009766095.1|  PREDICTED: root phototropism protein 3-like ...    167   4e-44    
tpg|DAA43883.1|  TPA: putative phototropic-responsive NPH3 family...    168   4e-44    
ref|XP_006429637.1|  hypothetical protein CICLE_v10011315mg             168   4e-44    
emb|CDY18140.1|  BnaC05g01630D                                          168   5e-44    
ref|XP_009118726.1|  PREDICTED: BTB/POZ domain-containing protein...    167   5e-44    
ref|XP_003608415.1|  Root phototropism protein                          168   5e-44    
ref|XP_008235006.1|  PREDICTED: BTB/POZ domain-containing protein...    168   5e-44    
ref|XP_011092443.1|  PREDICTED: root phototropism protein 3             168   6e-44    
ref|XP_004495987.1|  PREDICTED: BTB/POZ domain-containing protein...    167   6e-44    
ref|XP_006420844.1|  hypothetical protein CICLE_v10004479mg             168   6e-44    
ref|XP_011468062.1|  PREDICTED: BTB/POZ domain-containing protein...    167   6e-44    
ref|XP_004495988.1|  PREDICTED: BTB/POZ domain-containing protein...    167   6e-44    
emb|CDY30615.1|  BnaAnng03900D                                          166   7e-44    
gb|KJB10961.1|  hypothetical protein B456_001G234000                    165   7e-44    
gb|KFK42661.1|  hypothetical protein AALP_AA1G023400                    167   8e-44    
ref|XP_010241172.1|  PREDICTED: BTB/POZ domain-containing protein...    167   8e-44    
ref|XP_003518959.1|  PREDICTED: BTB/POZ domain-containing protein...    167   9e-44    
emb|CDY32492.1|  BnaA09g51040D                                          167   9e-44    
gb|KDO42273.1|  hypothetical protein CISIN_1g005842mg                   167   1e-43    
ref|XP_009118723.1|  PREDICTED: BTB/POZ domain-containing protein...    167   1e-43    
ref|XP_006494598.1|  PREDICTED: root phototropism protein 3-like ...    167   1e-43    
ref|XP_007144554.1|  hypothetical protein PHAVU_007G165600g             167   1e-43    
ref|XP_003536250.1|  PREDICTED: BTB/POZ domain-containing protein...    167   1e-43    
gb|KHN03742.1|  BTB/POZ domain-containing protein                       167   1e-43    
emb|CDX83030.1|  BnaA01g20300D                                          166   1e-43    
ref|XP_006584970.1|  PREDICTED: root phototropism protein 3-like        167   1e-43    
ref|XP_010069979.1|  PREDICTED: BTB/POZ domain-containing protein...    167   1e-43    
ref|XP_009766094.1|  PREDICTED: root phototropism protein 3-like ...    167   1e-43    
ref|XP_006604703.1|  PREDICTED: BTB/POZ domain-containing protein...    167   1e-43    
gb|KHN43539.1|  BTB/POZ domain-containing protein                       167   2e-43    
ref|XP_012069184.1|  PREDICTED: root phototropism protein 3             167   2e-43    
gb|ACL52494.1|  unknown                                                 166   2e-43    
gb|KHN46271.1|  Root phototropism protein 3                             167   2e-43    
ref|XP_010556762.1|  PREDICTED: BTB/POZ domain-containing protein...    166   2e-43    
emb|CDY57361.1|  BnaC08g48680D                                          165   2e-43    
ref|XP_006341291.1|  PREDICTED: BTB/POZ domain-containing protein...    166   2e-43    
gb|KCW63332.1|  hypothetical protein EUGRSUZ_G00960                     166   3e-43    
ref|XP_006841237.1|  PREDICTED: root phototropism protein 3             166   3e-43    
ref|XP_004230550.1|  PREDICTED: root phototropism protein 3-like        166   3e-43    
ref|XP_010065706.1|  PREDICTED: root phototropism protein 3             166   3e-43    
ref|NP_001152299.1|  transposon protein Mutator sub-class               166   3e-43    
ref|XP_007163074.1|  hypothetical protein PHAVU_001G203800g             166   3e-43    
ref|XP_004294000.1|  PREDICTED: BTB/POZ domain-containing protein...    166   3e-43    
ref|NP_182307.1|  phototropic-responsive NPH3 family protein SETH6      166   3e-43    
ref|XP_009631478.1|  PREDICTED: root phototropism protein 3-like        166   3e-43    
gb|ADV56692.1|  NPH3 family protein                                     166   4e-43    
ref|XP_009410500.1|  PREDICTED: BTB/POZ domain-containing protein...    165   4e-43    
ref|XP_006588602.1|  PREDICTED: BTB/POZ domain-containing protein...    165   5e-43    
gb|KDO87367.1|  hypothetical protein CISIN_1g038941mg                   165   5e-43    
ref|NP_001049321.2|  Os03g0206700                                       163   5e-43    
ref|XP_008225559.1|  PREDICTED: BTB/POZ domain-containing protein...    165   6e-43    
ref|XP_009803877.1|  PREDICTED: root phototropism protein 3-like        165   6e-43    
gb|KJB10962.1|  hypothetical protein B456_001G234000                    165   6e-43    
ref|XP_011096666.1|  PREDICTED: BTB/POZ domain-containing protein...    165   6e-43    
ref|XP_006588603.1|  PREDICTED: BTB/POZ domain-containing protein...    165   6e-43    
ref|XP_009608450.1|  PREDICTED: root phototropism protein 3 isofo...    164   6e-43    
dbj|BAJ96209.1|  predicted protein                                      165   6e-43    
ref|XP_007144555.1|  hypothetical protein PHAVU_007G165600g             165   6e-43    
ref|XP_012075651.1|  PREDICTED: BTB/POZ domain-containing protein...    165   7e-43    
ref|XP_009151299.1|  PREDICTED: BTB/POZ domain-containing protein...    165   7e-43    
ref|XP_004978520.1|  PREDICTED: root phototropism protein 2-like        164   7e-43    
ref|XP_009419001.1|  PREDICTED: BTB/POZ domain-containing protein...    165   7e-43    
emb|CAN72130.1|  hypothetical protein VITISV_002335                     165   7e-43    
ref|XP_010098595.1|  BTB/POZ domain-containing protein                  164   8e-43    
emb|CDY52208.1|  BnaC01g42530D                                          164   9e-43    
ref|XP_002269380.1|  PREDICTED: root phototropism protein 3             165   9e-43    
gb|KJB79559.1|  hypothetical protein B456_013G057300                    163   9e-43    
ref|XP_010412682.1|  PREDICTED: putative BTB/POZ domain-containin...    164   1e-42    
ref|NP_171800.1|  phototropic-responsive NPH3 family protein            164   1e-42    
emb|CAN60915.1|  hypothetical protein VITISV_002200                     164   1e-42    
ref|XP_010426528.1|  PREDICTED: putative BTB/POZ domain-containin...    164   1e-42    
ref|XP_002889431.1|  phototropic-responsive NPH3 family protein         164   1e-42    
ref|XP_011014242.1|  PREDICTED: root phototropism protein 3-like ...    164   1e-42    
gb|KHN28223.1|  BTB/POZ domain-containing protein                       164   1e-42    
ref|XP_008660160.1|  PREDICTED: BTB/POZ domain-containing protein...    164   1e-42    
ref|XP_006404279.1|  hypothetical protein EUTSA_v10010186mg             164   1e-42    
ref|XP_009119586.1|  PREDICTED: BTB/POZ domain-containing protein...    164   1e-42    
ref|XP_002880327.1|  phototropic-responsive NPH3 family protein         164   1e-42    
gb|EYU42051.1|  hypothetical protein MIMGU_mgv1a003173mg                164   2e-42    
ref|XP_002863056.1|  phototropic-responsive NPH3 family protein         164   2e-42    
ref|XP_011014241.1|  PREDICTED: root phototropism protein 3-like ...    164   2e-42    
ref|XP_004504830.1|  PREDICTED: root phototropism protein 3-like ...    164   2e-42    
ref|XP_004504832.1|  PREDICTED: root phototropism protein 3-like ...    164   2e-42    
ref|XP_009608443.1|  PREDICTED: root phototropism protein 3 isofo...    164   2e-42    
ref|XP_004504829.1|  PREDICTED: root phototropism protein 3-like ...    164   2e-42    
ref|XP_010481449.1|  PREDICTED: BTB/POZ domain-containing protein...    163   2e-42    
ref|XP_006595180.1|  PREDICTED: root phototropism protein 3-like ...    162   2e-42    
emb|CBI38224.3|  unnamed protein product                                163   2e-42    
ref|XP_006595174.1|  PREDICTED: root phototropism protein 3-like ...    162   2e-42    
ref|XP_009118725.1|  PREDICTED: BTB/POZ domain-containing protein...    163   3e-42    
ref|XP_002323955.2|  hypothetical protein POPTR_0017s07540g             163   3e-42    
ref|XP_003593245.1|  Root phototropism protein                          163   3e-42    
ref|XP_009118724.1|  PREDICTED: BTB/POZ domain-containing protein...    163   3e-42    
ref|XP_004984397.1|  PREDICTED: BTB/POZ domain-containing protein...    163   3e-42    
gb|KHG29755.1|  Root phototropism 3 -like protein                       163   3e-42    
ref|XP_008358392.1|  PREDICTED: root phototropism protein 3-like        163   3e-42    
ref|XP_007033472.1|  Phototropic-responsive NPH3 family protein i...    163   3e-42    
gb|KJB79558.1|  hypothetical protein B456_013G057300                    163   3e-42    
ref|XP_010457308.1|  PREDICTED: BTB/POZ domain-containing protein...    162   3e-42    
ref|XP_009368293.1|  PREDICTED: root phototropism protein 3-like        163   4e-42    
ref|XP_007200957.1|  hypothetical protein PRUPE_ppa002411mg             163   4e-42    
ref|XP_002323684.2|  hypothetical protein POPTR_0016s14670g             162   4e-42    
ref|XP_010457305.1|  PREDICTED: BTB/POZ domain-containing protein...    162   4e-42    
ref|XP_007033473.1|  Phototropic-responsive NPH3 family protein i...    162   4e-42    
gb|AAN77296.1|  Hypothetical protein                                    162   4e-42    
gb|EEC74727.1|  hypothetical protein OsI_10455                          162   4e-42    
ref|XP_011012727.1|  PREDICTED: root phototropism protein 3-like        162   4e-42    
ref|XP_003521542.1|  PREDICTED: BTB/POZ domain-containing protein...    162   5e-42    
gb|KJB32107.1|  hypothetical protein B456_005G224200                    161   5e-42    
ref|XP_011023032.1|  PREDICTED: root phototropism protein 3-like        162   5e-42    
ref|XP_009362255.1|  PREDICTED: BTB/POZ domain-containing protein...    162   5e-42    
ref|NP_001280859.1|  BTB/POZ domain-containing protein At1g30440-...    162   5e-42    
ref|XP_010905431.1|  PREDICTED: BTB/POZ domain-containing protein...    162   5e-42    
ref|XP_006650337.1|  PREDICTED: BTB/POZ domain-containing protein...    162   6e-42    
gb|KHN31896.1|  Root phototropism protein 3                             161   6e-42    
ref|XP_002310495.1|  hypothetical protein POPTR_0007s03550g             162   6e-42    
ref|XP_004977394.1|  PREDICTED: root phototropism protein 2-like        161   7e-42    
ref|XP_010275927.1|  PREDICTED: BTB/POZ domain-containing protein...    162   7e-42    
ref|XP_002531804.1|  Root phototropism protein, putative                162   7e-42    
ref|XP_011095171.1|  PREDICTED: BTB/POZ domain-containing protein...    162   7e-42    
ref|XP_011087936.1|  PREDICTED: root phototropism protein 3-like        162   7e-42    
gb|KJB32105.1|  hypothetical protein B456_005G224200                    161   8e-42    
gb|ABF97835.1|  transposon protein, putative, Mutator sub-class, ...    162   8e-42    
emb|CDO97399.1|  unnamed protein product                                162   8e-42    
ref|XP_009115684.1|  PREDICTED: BTB/POZ domain-containing protein...    161   8e-42    
ref|XP_010474901.1|  PREDICTED: BTB/POZ domain-containing protein...    162   8e-42    
ref|XP_006468280.1|  PREDICTED: BTB/POZ domain-containing protein...    162   8e-42    
ref|XP_004249834.1|  PREDICTED: BTB/POZ domain-containing protein...    161   9e-42    
ref|XP_007214533.1|  hypothetical protein PRUPE_ppa002754mg             162   9e-42    
gb|KHN33549.1|  Root phototropism protein 3                             162   9e-42    
ref|XP_009115683.1|  PREDICTED: BTB/POZ domain-containing protein...    161   9e-42    
ref|XP_010094827.1|  Root phototropism protein 3                        162   9e-42    
ref|XP_003545709.1|  PREDICTED: root phototropism protein 3-like        162   9e-42    
ref|XP_006594679.1|  PREDICTED: root phototropism protein 3-like        162   9e-42    
gb|KHN19000.1|  Root phototropism protein 3                             162   9e-42    
ref|XP_008237216.1|  PREDICTED: root phototropism protein 3             162   1e-41    
ref|XP_002281182.1|  PREDICTED: BTB/POZ domain-containing protein...    161   1e-41    
ref|XP_009366303.1|  PREDICTED: root phototropism protein 3             162   1e-41    



>ref|XP_011089543.1| PREDICTED: root phototropism protein 2-like [Sesamum indicum]
Length=563

 Score =   390 bits (1003),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 202/220 (92%), Positives = 214/220 (97%), Gaps = 0/220 (0%)
 Frame = +1

Query  169  ATRLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLT  348
            A RLSLAMERTGQWVFSQEIPTDVIVEVGEA+FSLHKFMLVAKSN+IRKLI+DSKEADLT
Sbjct  2    ANRLSLAMERTGQWVFSQEIPTDVIVEVGEANFSLHKFMLVAKSNHIRKLILDSKEADLT  61

Query  349  RINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTED  528
            RI+LS IPGGPEIFE+AAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTED
Sbjct  62   RIDLSDIPGGPEIFEKAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTED  121

Query  529  FlsqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVEANFPSRSPPNWWT  708
            FLSQVAL+SLSGALVVLKSCE+LLP+AEDLKIVQRCVE+ASAKACVEANFPSRSPPNWWT
Sbjct  122  FLSQVALTSLSGALVVLKSCEDLLPMAEDLKIVQRCVEIASAKACVEANFPSRSPPNWWT  181

Query  709  EELTILDVAFFARIIATMRSRTAKPLTLASAIITYAERSL  828
            EELTILD+ FFA+IIA+MRSR AK LTLASAIITY ERSL
Sbjct  182  EELTILDITFFAKIIASMRSRGAKGLTLASAIITYTERSL  221



>ref|XP_004243653.1| PREDICTED: root phototropism protein 2 [Solanum lycopersicum]
Length=576

 Score =   377 bits (969),  Expect = 6e-124, Method: Compositional matrix adjust.
 Identities = 194/228 (85%), Positives = 213/228 (93%), Gaps = 1/228 (0%)
 Frame = +1

Query  145  MASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIM  324
            MA+PLK+   RLSLAMERTGQWVFSQEIPTDVIVEVGEA+F+LHKFMLVAKSNYIRKLI+
Sbjct  1    MATPLKNT-NRLSLAMERTGQWVFSQEIPTDVIVEVGEANFNLHKFMLVAKSNYIRKLIL  59

Query  325  DSKEADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDN  504
            D+KE+D++RINLS IPGGPE+FE+AAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDN
Sbjct  60   DTKESDVSRINLSDIPGGPEMFEKAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDN  119

Query  505  NLAGRTEDFlsqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVEANFPS  684
            NLA RTEDFL+QVAL+SLSGALVVLKSCE LLPLA DL I+QRCV++A AKACVEANFPS
Sbjct  120  NLASRTEDFLAQVALTSLSGALVVLKSCENLLPLAHDLNIIQRCVDIAGAKACVEANFPS  179

Query  685  RSPPNWWTEELTILDVAFFARIIATMRSRTAKPLTLASAIITYAERSL  828
            RSPPNWWTEELTILDVAFF RII  M++R AK LT+ASAIITY ERSL
Sbjct  180  RSPPNWWTEELTILDVAFFERIIVAMKTRGAKALTIASAIITYTERSL  227



>ref|XP_006353728.1| PREDICTED: root phototropism protein 2-like [Solanum tuberosum]
Length=576

 Score =   377 bits (968),  Expect = 7e-124, Method: Compositional matrix adjust.
 Identities = 194/228 (85%), Positives = 213/228 (93%), Gaps = 1/228 (0%)
 Frame = +1

Query  145  MASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIM  324
            MA+PLK+   RLSLAMERTGQWVFSQEIPTDVIVEVGEA+F+LHKFMLVAKSNYIRKLI+
Sbjct  1    MATPLKNT-NRLSLAMERTGQWVFSQEIPTDVIVEVGEANFNLHKFMLVAKSNYIRKLIL  59

Query  325  DSKEADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDN  504
            D+KE+D++RINLS IPGGPE+FE+AAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDN
Sbjct  60   DTKESDVSRINLSDIPGGPEMFEKAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDN  119

Query  505  NLAGRTEDFlsqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVEANFPS  684
            NLA RTEDFL+QVAL+SLSGALVVLKSCE LLPLA DL I+QRCV++A AKACVEANFPS
Sbjct  120  NLASRTEDFLAQVALTSLSGALVVLKSCENLLPLAHDLNIIQRCVDIAGAKACVEANFPS  179

Query  685  RSPPNWWTEELTILDVAFFARIIATMRSRTAKPLTLASAIITYAERSL  828
            RSPPNWWTEELTILDVAFF RII  M++R AK LT+ASAIITY ERSL
Sbjct  180  RSPPNWWTEELTILDVAFFERIIVAMKARGAKALTIASAIITYTERSL  227



>emb|CDP04035.1| unnamed protein product [Coffea canephora]
Length=573

 Score =   377 bits (967),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 191/228 (84%), Positives = 216/228 (95%), Gaps = 0/228 (0%)
 Frame = +1

Query  145  MASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIM  324
            MASPL + ++RLSLAMERTGQWVFSQEIPTDV+VEVG+A+FSLHKFMLVAKSN IRKLI+
Sbjct  1    MASPLVNNSSRLSLAMERTGQWVFSQEIPTDVLVEVGKATFSLHKFMLVAKSNCIRKLIL  60

Query  325  DSKEADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDN  504
            +SKEADLTRI+LS IPGGPEIFE+AAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDN
Sbjct  61   ESKEADLTRIDLSDIPGGPEIFEKAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDN  120

Query  505  NLAGRTEDFlsqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVEANFPS  684
            NLAGRTEDFLSQVAL SLSGA+VVLKSCE+LLPLAEDL+IVQRCV++ S+KACVEANFPS
Sbjct  121  NLAGRTEDFLSQVALPSLSGAVVVLKSCEDLLPLAEDLRIVQRCVDVVSSKACVEANFPS  180

Query  685  RSPPNWWTEELTILDVAFFARIIATMRSRTAKPLTLASAIITYAERSL  828
            RSPPNWWTEEL+ILDV FF ++I +M+SR AK  T+ASA+ITY+E+SL
Sbjct  181  RSPPNWWTEELSILDVKFFGKVITSMKSRGAKAFTIASALITYSEKSL  228



>ref|XP_009611218.1| PREDICTED: root phototropism protein 2 [Nicotiana tomentosiformis]
Length=575

 Score =   375 bits (964),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 194/228 (85%), Positives = 215/228 (94%), Gaps = 1/228 (0%)
 Frame = +1

Query  145  MASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIM  324
            MA+P+K+   RLSLAMERTGQWVFSQEIPTDV+VEVGEA+F+LHKFMLVAKSNYIRKLI+
Sbjct  1    MAAPIKNT-NRLSLAMERTGQWVFSQEIPTDVVVEVGEANFNLHKFMLVAKSNYIRKLIL  59

Query  325  DSKEADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDN  504
            +SKE ++TRINLS IPGGPE+FE+AAKFCYGVNFEITVHNVAALRCAA+YLQMTDKYCDN
Sbjct  60   ESKETEVTRINLSEIPGGPEMFEKAAKFCYGVNFEITVHNVAALRCAADYLQMTDKYCDN  119

Query  505  NLAGRTEDFlsqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVEANFPS  684
            NLA RTEDFL+QVAL+SLSGALVVLKSCE LLPLAE+LKIVQRCVE+ASAKACVEANFPS
Sbjct  120  NLASRTEDFLAQVALTSLSGALVVLKSCENLLPLAEELKIVQRCVEIASAKACVEANFPS  179

Query  685  RSPPNWWTEELTILDVAFFARIIATMRSRTAKPLTLASAIITYAERSL  828
            RSPPNWWTEELTILD+AFF RII +M++R AK LT ASAIITY ERSL
Sbjct  180  RSPPNWWTEELTILDIAFFERIIISMKTRGAKALTAASAIITYTERSL  227



>gb|EYU36889.1| hypothetical protein MIMGU_mgv1a003487mg [Erythranthe guttata]
Length=582

 Score =   372 bits (956),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 192/220 (87%), Positives = 210/220 (95%), Gaps = 0/220 (0%)
 Frame = +1

Query  169  ATRLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLT  348
            A R +LAMERTGQWVFSQE+PTDVIVEVGEASFSLHKFMLVAKSN IRKLI+DSKEADLT
Sbjct  2    ANRHNLAMERTGQWVFSQEVPTDVIVEVGEASFSLHKFMLVAKSNLIRKLILDSKEADLT  61

Query  349  RINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTED  528
            RINLSGIPGG EIFE++AKFCYGVNFEITVHNVAALRCAAEYLQMTD YCDNNLAGRTED
Sbjct  62   RINLSGIPGGAEIFEKSAKFCYGVNFEITVHNVAALRCAAEYLQMTDVYCDNNLAGRTED  121

Query  529  FlsqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVEANFPSRSPPNWWT  708
            FLSQVAL+SLSGALVVLKSCE+LLP+AEDL+IVQ+CVE+ASAKACVEANFPSRSPPNWWT
Sbjct  122  FLSQVALTSLSGALVVLKSCEDLLPMAEDLRIVQKCVEIASAKACVEANFPSRSPPNWWT  181

Query  709  EELTILDVAFFARIIATMRSRTAKPLTLASAIITYAERSL  828
            EELTIL++ FF++II +M++R AK LTLASAIITY ERSL
Sbjct  182  EELTILEINFFSKIITSMKTRGAKGLTLASAIITYTERSL  221



>ref|XP_009777101.1| PREDICTED: root phototropism protein 2 [Nicotiana sylvestris]
Length=574

 Score =   372 bits (955),  Expect = 8e-122, Method: Compositional matrix adjust.
 Identities = 193/228 (85%), Positives = 213/228 (93%), Gaps = 1/228 (0%)
 Frame = +1

Query  145  MASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIM  324
            MA P+K+   RLSLAMERTGQWVFSQEIPTDV+VEVGEA+F+LHKFMLVAKSNYIRKLI+
Sbjct  1    MAVPIKNT-NRLSLAMERTGQWVFSQEIPTDVVVEVGEANFNLHKFMLVAKSNYIRKLIL  59

Query  325  DSKEADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDN  504
            +SKE ++TRINLS IPGGPE+FE+AAKFCYGVNFEITVHNVAALRCAA+YLQMTDKYCDN
Sbjct  60   ESKETEVTRINLSEIPGGPEMFEKAAKFCYGVNFEITVHNVAALRCAADYLQMTDKYCDN  119

Query  505  NLAGRTEDFlsqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVEANFPS  684
            NLA RTEDFL+QVAL+SLSGALVVLKSCE LLPLAE+L IVQRCVE+ASAKACVEANFPS
Sbjct  120  NLASRTEDFLAQVALTSLSGALVVLKSCENLLPLAEELNIVQRCVEIASAKACVEANFPS  179

Query  685  RSPPNWWTEELTILDVAFFARIIATMRSRTAKPLTLASAIITYAERSL  828
            RSPPNWWTEELTILD+AFF RII +M++R AK LT ASAIITY ERSL
Sbjct  180  RSPPNWWTEELTILDIAFFERIIISMKTRGAKALTAASAIITYTERSL  227



>gb|KHG08105.1| Root phototropism 2 -like protein [Gossypium arboreum]
Length=507

 Score =   367 bits (941),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 190/228 (83%), Positives = 213/228 (93%), Gaps = 1/228 (0%)
 Frame = +1

Query  145  MASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIM  324
            MA+PL+S  +RLS AMERTGQWVFSQEIPTDVIVEVGEA+F+LHKFMLVAKSNYIRKLIM
Sbjct  1    MATPLRSN-SRLSTAMERTGQWVFSQEIPTDVIVEVGEANFNLHKFMLVAKSNYIRKLIM  59

Query  325  DSKEADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDN  504
            ++ EADLTRINLS IPGGPEIFE+AAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDN
Sbjct  60   ETNEADLTRINLSEIPGGPEIFEKAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDN  119

Query  505  NLAGRTEDFlsqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVEANFPS  684
            NLAGRTEDFLSQVALSSLSGA+VVLKSCE+LLP+AE+LKIVQRC+++ASA+AC EA+FP 
Sbjct  120  NLAGRTEDFLSQVALSSLSGAVVVLKSCEDLLPMAEELKIVQRCIDVASARACNEASFPC  179

Query  685  RSPPNWWTEELTILDVAFFARIIATMRSRTAKPLTLASAIITYAERSL  828
            R+PPNWWTEEL+ILDV  F RII  M+ R AKPLT+A+A+ITYAER L
Sbjct  180  RTPPNWWTEELSILDVELFGRIIGAMKQRGAKPLTIATALITYAERWL  227



>gb|KJB26284.1| hypothetical protein B456_004G235100 [Gossypium raimondii]
Length=574

 Score =   367 bits (942),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 190/228 (83%), Positives = 213/228 (93%), Gaps = 1/228 (0%)
 Frame = +1

Query  145  MASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIM  324
            MA+PL+S  +RLS AMERTGQWVFSQEIPTDVIVEVGEA+F+LHKFMLVAKSNYIRKLIM
Sbjct  1    MATPLRSN-SRLSTAMERTGQWVFSQEIPTDVIVEVGEANFNLHKFMLVAKSNYIRKLIM  59

Query  325  DSKEADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDN  504
            ++ EADLTRINLS IPGGPEIFE+AAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDN
Sbjct  60   ETNEADLTRINLSEIPGGPEIFEKAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDN  119

Query  505  NLAGRTEDFlsqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVEANFPS  684
            NLAGRTEDFLSQVALSSLSGA+VVLKSCE+LLP+AE+LKIVQRC+++ASA+AC EA+FP 
Sbjct  120  NLAGRTEDFLSQVALSSLSGAVVVLKSCEDLLPMAEELKIVQRCIDVASARACNEASFPC  179

Query  685  RSPPNWWTEELTILDVAFFARIIATMRSRTAKPLTLASAIITYAERSL  828
            R+PPNWWTEEL+ILDV  F RII  M+ R AKPLT+A+A+ITYAER L
Sbjct  180  RTPPNWWTEELSILDVELFGRIIGAMKQRGAKPLTIATALITYAERWL  227



>ref|XP_002264896.1| PREDICTED: root phototropism protein 2 isoform X1 [Vitis vinifera]
Length=572

 Score =   363 bits (932),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 188/228 (82%), Positives = 208/228 (91%), Gaps = 1/228 (0%)
 Frame = +1

Query  145  MASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIM  324
            MA+ LK    R SLAMERTGQWVFSQEIPTDV+VEVGEA+FSLHKFMLVAKSNYIRKLIM
Sbjct  1    MAASLK-GNNRRSLAMERTGQWVFSQEIPTDVVVEVGEANFSLHKFMLVAKSNYIRKLIM  59

Query  325  DSKEADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDN  504
            +SKEADLT I+LS IPGGPEIFE+AAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCD 
Sbjct  60   ESKEADLTNIDLSDIPGGPEIFEKAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDG  119

Query  505  NLAGRTEDFlsqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVEANFPS  684
            NL+GRTEDFL QVAL+SLSGA+VVLKSCE+LLP AE+LKIVQRCV++AS KAC EANFPS
Sbjct  120  NLSGRTEDFLKQVALTSLSGAVVVLKSCEDLLPKAEELKIVQRCVDVASTKACNEANFPS  179

Query  685  RSPPNWWTEELTILDVAFFARIIATMRSRTAKPLTLASAIITYAERSL  828
            RSPPNWWTEEL+ILD+ FF +IIA M+ R AK LT+ASA+ITY ER+L
Sbjct  180  RSPPNWWTEELSILDIGFFEKIIAAMKLRGAKSLTVASALITYTERTL  227



>ref|XP_012077861.1| PREDICTED: root phototropism protein 2 [Jatropha curcas]
 gb|KDP45678.1| hypothetical protein JCGZ_17285 [Jatropha curcas]
Length=575

 Score =   361 bits (927),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 188/228 (82%), Positives = 207/228 (91%), Gaps = 1/228 (0%)
 Frame = +1

Query  145  MASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIM  324
            MA+PL++  +RLS+AMERTGQWVFSQEIPTDV+V VGEA+FSLHKFMLV+KSN IRKLIM
Sbjct  1    MATPLRNN-SRLSIAMERTGQWVFSQEIPTDVVVVVGEANFSLHKFMLVSKSNRIRKLIM  59

Query  325  DSKEADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDN  504
            +SKE DLTRI+LS IPGGPEIFE+AAKFCYGVNFEITVHNVAALRCAAEYLQMTD YCDN
Sbjct  60   ESKEPDLTRIDLSDIPGGPEIFEKAAKFCYGVNFEITVHNVAALRCAAEYLQMTDLYCDN  119

Query  505  NLAGRTEDFlsqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVEANFPS  684
            NLAGRT+DFLSQVALSSLSGA+VVLKSCEELLPL EDLKIVQRCV++ S K C EANFPS
Sbjct  120  NLAGRTDDFLSQVALSSLSGAIVVLKSCEELLPLTEDLKIVQRCVDVISVKGCNEANFPS  179

Query  685  RSPPNWWTEELTILDVAFFARIIATMRSRTAKPLTLASAIITYAERSL  828
            RSPPNWW EEL+ILDV F  +II  MR R AKPLTLAS +ITYAER+L
Sbjct  180  RSPPNWWKEELSILDVEFVGKIITAMRQRGAKPLTLASVLITYAERNL  227



>ref|XP_010023564.1| PREDICTED: root phototropism protein 2 [Eucalyptus grandis]
 gb|KCW59867.1| hypothetical protein EUGRSUZ_H02604 [Eucalyptus grandis]
Length=570

 Score =   358 bits (920),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 185/228 (81%), Positives = 208/228 (91%), Gaps = 1/228 (0%)
 Frame = +1

Query  145  MASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIM  324
            MA+P++ A  RLS+AMERTGQWVFSQEIPTDV+V VGEA+FSLHKFML+AKSNYIRKLI+
Sbjct  1    MATPVR-ANERLSIAMERTGQWVFSQEIPTDVVVRVGEANFSLHKFMLLAKSNYIRKLII  59

Query  325  DSKEADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDN  504
            ++KEADL RI+LS IPGGPEIFE+AAKFCYGVNFEITVHNVAALRCAAEYLQMTD+YCDN
Sbjct  60   ETKEADLARIDLSNIPGGPEIFEKAAKFCYGVNFEITVHNVAALRCAAEYLQMTDQYCDN  119

Query  505  NLAGRTEDFlsqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVEANFPS  684
            NLAGRT+DFL+QVALSSLSGA+VVLKSCE+LLP+AEDLKIVQRCV+L S  AC EANFPS
Sbjct  120  NLAGRTDDFLTQVALSSLSGAIVVLKSCEDLLPMAEDLKIVQRCVDLVSFNACNEANFPS  179

Query  685  RSPPNWWTEELTILDVAFFARIIATMRSRTAKPLTLASAIITYAERSL  828
            RSP NWWTEEL+IL V FF +II  M+ R AK LTLASAIITY ER+L
Sbjct  180  RSPTNWWTEELSILSVTFFGKIIMAMKQRGAKSLTLASAIITYTERAL  227



>ref|XP_007017103.1| Phototropic-responsive NPH3 family protein [Theobroma cacao]
 gb|EOY34722.1| Phototropic-responsive NPH3 family protein [Theobroma cacao]
Length=576

 Score =   358 bits (918),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 185/228 (81%), Positives = 209/228 (92%), Gaps = 1/228 (0%)
 Frame = +1

Query  145  MASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIM  324
            MA+P+ S  +R+S AMERTGQWVFSQEIPTDV+VE GEA+F+LHKFMLVAKSNYIRKLI+
Sbjct  1    MATPVMSN-SRMSSAMERTGQWVFSQEIPTDVVVEAGEANFNLHKFMLVAKSNYIRKLIL  59

Query  325  DSKEADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDN  504
            ++KEADLTRINLS IPGGPEIFE+AAKFCYGVNFEITVHNVAALRCAAEYLQMTD YCD+
Sbjct  60   ETKEADLTRINLSDIPGGPEIFEKAAKFCYGVNFEITVHNVAALRCAAEYLQMTDNYCDS  119

Query  505  NLAGRTEDFlsqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVEANFPS  684
            NLAGRTEDFLSQVAL SLSGA+VVLKSCE+LLP+AE+LKIVQRC+++ASA+AC  ANFP 
Sbjct  120  NLAGRTEDFLSQVALHSLSGAVVVLKSCEDLLPMAEELKIVQRCIDIASARACSVANFPC  179

Query  685  RSPPNWWTEELTILDVAFFARIIATMRSRTAKPLTLASAIITYAERSL  828
            R+PPNWWTEEL+ILDV  F RIIA M+ R AK LTLASA+ITYAER L
Sbjct  180  RTPPNWWTEELSILDVDLFGRIIAAMKQRGAKALTLASALITYAERWL  227



>ref|XP_006432046.1| hypothetical protein CICLE_v10000673mg [Citrus clementina]
 ref|XP_006432048.1| hypothetical protein CICLE_v10000673mg [Citrus clementina]
 ref|XP_006464960.1| PREDICTED: root phototropism protein 2-like isoform X1 [Citrus 
sinensis]
 gb|ESR45286.1| hypothetical protein CICLE_v10000673mg [Citrus clementina]
 gb|ESR45288.1| hypothetical protein CICLE_v10000673mg [Citrus clementina]
Length=584

 Score =   356 bits (913),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 184/228 (81%), Positives = 207/228 (91%), Gaps = 3/228 (1%)
 Frame = +1

Query  145  MASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIM  324
            MA+PL     R S A ERTGQWVFSQEIPTD++V VGEA+F LHKFMLVAKSNYIRKLI+
Sbjct  1    MATPLNK---RFSSAKERTGQWVFSQEIPTDIVVAVGEANFPLHKFMLVAKSNYIRKLII  57

Query  325  DSKEADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDN  504
            +SKEADLTRINLS IPGGPE+FE+AAKFCYGVNFEITVHNVAALRCAAE+LQMTDKYC+N
Sbjct  58   ESKEADLTRINLSNIPGGPEMFEKAAKFCYGVNFEITVHNVAALRCAAEFLQMTDKYCEN  117

Query  505  NLAGRTEDFlsqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVEANFPS  684
            NLAGRTEDFLSQVALSSLSGA+VVLKSCE LLPLAEDL IVQRC+++A+AKAC EANFP 
Sbjct  118  NLAGRTEDFLSQVALSSLSGAVVVLKSCEALLPLAEDLLIVQRCIDVATAKACYEANFPC  177

Query  685  RSPPNWWTEELTILDVAFFARIIATMRSRTAKPLTLASAIITYAERSL  828
            R+PPNWWTEEL+I+D+ FF+RIIA M+ R AK LT+ASA+ITY ERSL
Sbjct  178  RTPPNWWTEELSIIDIEFFSRIIAAMKKRGAKALTIASALITYTERSL  225



>gb|KDO54917.1| hypothetical protein CISIN_1g007944mg [Citrus sinensis]
Length=584

 Score =   356 bits (913),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 184/228 (81%), Positives = 207/228 (91%), Gaps = 3/228 (1%)
 Frame = +1

Query  145  MASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIM  324
            MA+PL     R S A ERTGQWVFSQEIPTD++V VGEA+F LHKFMLVAKSNYIRKLI+
Sbjct  1    MATPLNK---RFSSAKERTGQWVFSQEIPTDIVVAVGEANFPLHKFMLVAKSNYIRKLII  57

Query  325  DSKEADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDN  504
            +SKEADLTRINLS IPGGPE+FE+AAKFCYGVNFEITVHNVAALRCAAE+LQMTDKYC+N
Sbjct  58   ESKEADLTRINLSNIPGGPEMFEKAAKFCYGVNFEITVHNVAALRCAAEFLQMTDKYCEN  117

Query  505  NLAGRTEDFlsqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVEANFPS  684
            NLAGRTEDFLSQVALSSLSGA+VVLKSCE LLPLAEDL IVQRC+++A+AKAC EANFP 
Sbjct  118  NLAGRTEDFLSQVALSSLSGAVVVLKSCEALLPLAEDLLIVQRCIDVATAKACYEANFPC  177

Query  685  RSPPNWWTEELTILDVAFFARIIATMRSRTAKPLTLASAIITYAERSL  828
            R+PPNWWTEEL+I+D+ FF+RIIA M+ R AK LT+ASA+ITY ERSL
Sbjct  178  RTPPNWWTEELSIIDIEFFSRIIAAMKKRGAKALTIASALITYTERSL  225



>ref|XP_010094443.1| Root phototropism protein 2 [Morus notabilis]
 gb|EXB56024.1| Root phototropism protein 2 [Morus notabilis]
Length=574

 Score =   352 bits (902),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 180/228 (79%), Positives = 209/228 (92%), Gaps = 1/228 (0%)
 Frame = +1

Query  145  MASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIM  324
            MA+ +K   +RLSLAMERTGQWVFSQ+IPTDV+VEVGEA+FSLHKFMLVAKSNYIRKLI+
Sbjct  1    MAASVK-GNSRLSLAMERTGQWVFSQDIPTDVVVEVGEANFSLHKFMLVAKSNYIRKLIV  59

Query  325  DSKEADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDN  504
            +S E DLTRINLS IPGGPEIFE+AAKFCYGVNFEITVHNVAALRCAAE+LQM +KYC N
Sbjct  60   ESNEPDLTRINLSNIPGGPEIFEKAAKFCYGVNFEITVHNVAALRCAAEFLQMIEKYCPN  119

Query  505  NLAGRTEDFlsqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVEANFPS  684
            NLAGRTEDFL+QVAL+SLSGA+VVLKSCE+LLP+AE+LKIVQRCV++A +KAC EANFPS
Sbjct  120  NLAGRTEDFLTQVALTSLSGAIVVLKSCEDLLPMAEELKIVQRCVDVAISKACNEANFPS  179

Query  685  RSPPNWWTEELTILDVAFFARIIATMRSRTAKPLTLASAIITYAERSL  828
            RSP NWWTEEL+ILD+ FFA+++  M+ R AK LT+ASA+ITY ER+L
Sbjct  180  RSPTNWWTEELSILDIEFFAKVMTAMKQRGAKVLTIASALITYTERAL  227



>ref|NP_001280845.1| root phototropism protein 2-like [Malus domestica]
 gb|ADL36603.1| BZIP domain class transcription factor [Malus domestica]
Length=577

 Score =   348 bits (894),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 177/228 (78%), Positives = 206/228 (90%), Gaps = 1/228 (0%)
 Frame = +1

Query  145  MASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIM  324
            MAS L S   RLSLAMERTGQW+ SQ+IP+DV+VEVGEA+FSLHKFMLVAKSN IRKLIM
Sbjct  1    MASSL-SGGNRLSLAMERTGQWIISQDIPSDVVVEVGEANFSLHKFMLVAKSNRIRKLIM  59

Query  325  DSKEADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDN  504
            +SK+ DLTRINLS IPGGPE FE+AAKFCYGVNFEITVHNVAALRCAAEYL+MTDKYC+N
Sbjct  60   ESKQPDLTRINLSDIPGGPETFEKAAKFCYGVNFEITVHNVAALRCAAEYLEMTDKYCEN  119

Query  505  NLAGRTEDFlsqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVEANFPS  684
            NL GRTEDFL+QVAL+SLSGA+VVLK+CE+LLP+AEDLKIVQRCV++A++K  +EA FPS
Sbjct  120  NLTGRTEDFLAQVALTSLSGAIVVLKTCEDLLPMAEDLKIVQRCVDVATSKVSIEAKFPS  179

Query  685  RSPPNWWTEELTILDVAFFARIIATMRSRTAKPLTLASAIITYAERSL  828
            RSP NWWTEEL+ILD+ FF R+IA+++ R  K LT+ASAIITYAE+ L
Sbjct  180  RSPKNWWTEELSILDIEFFGRVIASLKLRGVKALTVASAIITYAEKWL  227



>ref|XP_008366216.1| PREDICTED: root phototropism protein 2-like [Malus domestica]
Length=577

 Score =   348 bits (892),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 176/228 (77%), Positives = 208/228 (91%), Gaps = 1/228 (0%)
 Frame = +1

Query  145  MASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIM  324
            MASPL + + RLSLAMERTGQW+FSQ+IP+DV+V+VGEA+FSLHKFMLVAKSN IRKLIM
Sbjct  1    MASPL-NGSNRLSLAMERTGQWIFSQDIPSDVVVQVGEANFSLHKFMLVAKSNRIRKLIM  59

Query  325  DSKEADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDN  504
            +SK+ DLTRI+LS +PGGPE FE+AAKFCYGVNFEITVHNVAALRCAAEYL+MT+KYCDN
Sbjct  60   ESKKPDLTRIDLSDVPGGPETFEKAAKFCYGVNFEITVHNVAALRCAAEYLEMTEKYCDN  119

Query  505  NLAGRTEDFlsqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVEANFPS  684
            NL GRTEDFLSQVAL SLSGA+VVLKSCE+LLP+AEDLKIVQ+CV++A++KA +EA FPS
Sbjct  120  NLTGRTEDFLSQVALMSLSGAIVVLKSCEDLLPMAEDLKIVQKCVDVAASKASIEAKFPS  179

Query  685  RSPPNWWTEELTILDVAFFARIIATMRSRTAKPLTLASAIITYAERSL  828
            RSP NWWTEEL+ILD+ FF R+I+ M+ R  K LT++SAIITYAE+ L
Sbjct  180  RSPTNWWTEELSILDIEFFGRVISAMKLRGGKSLTVSSAIITYAEKWL  227



>gb|ADL36608.1| BZIP domain class transcription factor [Malus domestica]
Length=577

 Score =   348 bits (892),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 176/228 (77%), Positives = 208/228 (91%), Gaps = 1/228 (0%)
 Frame = +1

Query  145  MASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIM  324
            MASPL + + RLSLAMERTGQW+FSQ+IP+DV+V+VGEA+FSLHKFMLVAKSN IRKLIM
Sbjct  1    MASPL-NGSNRLSLAMERTGQWIFSQDIPSDVVVQVGEANFSLHKFMLVAKSNRIRKLIM  59

Query  325  DSKEADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDN  504
            +SK+ DLTRI+LS +PGGPE FE+AAKFCYGVNFEITVHNVAALRCAAEYL+MT+KYCDN
Sbjct  60   ESKKPDLTRIDLSDVPGGPETFEKAAKFCYGVNFEITVHNVAALRCAAEYLEMTEKYCDN  119

Query  505  NLAGRTEDFlsqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVEANFPS  684
            NL GRTEDFLSQVAL SLSGA+VVLKSCE+LLP+AEDLKIVQ+CV++A++KA +EA FPS
Sbjct  120  NLTGRTEDFLSQVALMSLSGAIVVLKSCEDLLPMAEDLKIVQKCVDVAASKASIEAKFPS  179

Query  685  RSPPNWWTEELTILDVAFFARIIATMRSRTAKPLTLASAIITYAERSL  828
            RSP NWWTEEL+ILD+ FF R+I+ M+ R  K LT++SAIITYAE+ L
Sbjct  180  RSPTNWWTEELSILDIEFFGRVISVMKLRGGKSLTVSSAIITYAEKWL  227



>ref|XP_008451888.1| PREDICTED: root phototropism protein 2 isoform X2 [Cucumis melo]
Length=582

 Score =   348 bits (892),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 180/228 (79%), Positives = 203/228 (89%), Gaps = 1/228 (0%)
 Frame = +1

Query  145  MASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIM  324
            M+S +K    R+S+AMERTGQW+FSQ+IPTDV+V VGEA F LHKFMLVAKSNYIRKLIM
Sbjct  1    MSSSVK-GNNRMSIAMERTGQWIFSQDIPTDVVVAVGEAHFPLHKFMLVAKSNYIRKLIM  59

Query  325  DSKEADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDN  504
            +S EADLTRI+L+ IPGG EIFE+AAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDN
Sbjct  60   ESTEADLTRIDLTDIPGGAEIFEKAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDN  119

Query  505  NLAGRTEDFlsqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVEANFPS  684
            NL GRTEDFLSQVALSSLSGA+VVLKS   LLP+AEDL IV RCV++ S+KAC EANFPS
Sbjct  120  NLVGRTEDFLSQVALSSLSGAIVVLKSSHHLLPMAEDLYIVHRCVDVISSKACNEANFPS  179

Query  685  RSPPNWWTEELTILDVAFFARIIATMRSRTAKPLTLASAIITYAERSL  828
            RSPPNWWTEELTI+D+ FFA+II  M+SR AK  TL++A+ITYAERSL
Sbjct  180  RSPPNWWTEELTIIDIEFFAKIITAMKSRGAKASTLSAALITYAERSL  227



>ref|XP_004294714.1| PREDICTED: root phototropism protein 2 [Fragaria vesca subsp. 
vesca]
Length=581

 Score =   348 bits (892),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 175/228 (77%), Positives = 205/228 (90%), Gaps = 0/228 (0%)
 Frame = +1

Query  145  MASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIM  324
            MAS  ++ + RLS+AMERTGQW+FSQ+IP DV+VEVGEA+FSLHKFMLVAKSN IR+LI+
Sbjct  1    MASLAQNNSRRLSIAMERTGQWIFSQDIPADVVVEVGEANFSLHKFMLVAKSNRIRQLIL  60

Query  325  DSKEADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDN  504
            +S E DLTRINLS IPGGPE FE+AAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDN
Sbjct  61   ESDEPDLTRINLSDIPGGPETFEKAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDN  120

Query  505  NLAGRTEDFlsqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVEANFPS  684
            NL+GRTEDFL+QVALSSLSGA+VVLKSCE L P+AEDLKIVQRCVE+ ++K  +EANFPS
Sbjct  121  NLSGRTEDFLTQVALSSLSGAIVVLKSCEGLTPMAEDLKIVQRCVEVVTSKVTIEANFPS  180

Query  685  RSPPNWWTEELTILDVAFFARIIATMRSRTAKPLTLASAIITYAERSL  828
            R+P NWWTEEL+ILD+ FF R+I +M+ R +K LT++SAI+TYAER L
Sbjct  181  RAPTNWWTEELSILDIEFFGRVIKSMKQRASKTLTVSSAIVTYAERWL  228



>ref|XP_008349518.1| PREDICTED: LOW QUALITY PROTEIN: root phototropism protein 2-like 
[Malus domestica]
Length=577

 Score =   347 bits (891),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 176/228 (77%), Positives = 207/228 (91%), Gaps = 1/228 (0%)
 Frame = +1

Query  145  MASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIM  324
            MASPL + + RLSLAMERTGQW+FSQ+IP+DV+V+VGEA+FSLHKFMLVAKSN IRKLIM
Sbjct  1    MASPL-NGSNRLSLAMERTGQWIFSQDIPSDVVVQVGEANFSLHKFMLVAKSNRIRKLIM  59

Query  325  DSKEADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDN  504
            +SK+ DLTRI+LS +PGGPE FE+AAKFCYGVNFEITVHNVAALRCAAEYL+MT+KYCDN
Sbjct  60   ESKKPDLTRIDLSDVPGGPETFEKAAKFCYGVNFEITVHNVAALRCAAEYLEMTEKYCDN  119

Query  505  NLAGRTEDFlsqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVEANFPS  684
            NL GRTEDFLSQVAL SLSGA+VVLKSCE+LLP+AEDLKIVQ+CV++A++KA +EA FPS
Sbjct  120  NLTGRTEDFLSQVALMSLSGAIVVLKSCEDLLPMAEDLKIVQKCVDVAASKASIEAKFPS  179

Query  685  RSPPNWWTEELTILDVAFFARIIATMRSRTAKPLTLASAIITYAERSL  828
            RSP NWWTEEL+ILD+ FF R+I  M+ R  K LT++SAIITYAE+ L
Sbjct  180  RSPTNWWTEELSILDIEFFGRVIXAMKLRGGKSLTVSSAIITYAEKWL  227



>ref|XP_002325631.1| ROOT PHOTOTROPISM 2 family protein [Populus trichocarpa]
 gb|EEF00013.1| ROOT PHOTOTROPISM 2 family protein [Populus trichocarpa]
Length=575

 Score =   347 bits (889),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 180/228 (79%), Positives = 204/228 (89%), Gaps = 3/228 (1%)
 Frame = +1

Query  145  MASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIM  324
            MASP++S   RLSLAMERTG+WVFS++IPTDV+V V EASFSLHKFML+AKSNYIRKLI 
Sbjct  1    MASPVRS---RLSLAMERTGKWVFSKDIPTDVVVVVCEASFSLHKFMLLAKSNYIRKLIF  57

Query  325  DSKEADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDN  504
            +SKE +L RI+LSGIPGGPEIF +AAKFCYGVNFEITV NVAALRCAAEYLQMTD YCDN
Sbjct  58   ESKEPELARIDLSGIPGGPEIFVKAAKFCYGVNFEITVQNVAALRCAAEYLQMTDTYCDN  117

Query  505  NLAGRTEDFlsqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVEANFPS  684
            NLAGRTEDF +QVALSSLSGA++VLKSCE+LLPLAED+KIVQRCV+  S KAC EANFPS
Sbjct  118  NLAGRTEDFFAQVALSSLSGAIIVLKSCEDLLPLAEDVKIVQRCVDAISLKACNEANFPS  177

Query  685  RSPPNWWTEELTILDVAFFARIIATMRSRTAKPLTLASAIITYAERSL  828
            R+PPNWWTEEL+ILD+ F  RI++ MR R AK LTLASA+ITY ER+L
Sbjct  178  RTPPNWWTEELSILDIEFIGRILSGMRKRAAKALTLASALITYTERNL  225



>ref|XP_009374407.1| PREDICTED: root phototropism protein 2-like [Pyrus x bretschneideri]
Length=577

 Score =   346 bits (887),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 175/228 (77%), Positives = 207/228 (91%), Gaps = 1/228 (0%)
 Frame = +1

Query  145  MASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIM  324
            MASPL + + RLSLAMERTGQW+FSQ+IP+DV+V+VGEA+FSLHKFMLVAKSN IRKLIM
Sbjct  1    MASPL-NGSNRLSLAMERTGQWIFSQDIPSDVVVQVGEANFSLHKFMLVAKSNRIRKLIM  59

Query  325  DSKEADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDN  504
            +SK+ DLTRI+LS +PGGPE FE+AAKFCYGVNFEITVHNVAALRCAAEYL+MT+KYCDN
Sbjct  60   ESKQPDLTRIDLSDVPGGPETFEKAAKFCYGVNFEITVHNVAALRCAAEYLEMTNKYCDN  119

Query  505  NLAGRTEDFlsqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVEANFPS  684
            NL GRTEDFLSQVAL SLSGA+VVLKSCE+LLP+AEDLKIVQ+CV++A++K  +EA FPS
Sbjct  120  NLIGRTEDFLSQVALMSLSGAIVVLKSCEDLLPMAEDLKIVQKCVDVATSKVSIEAKFPS  179

Query  685  RSPPNWWTEELTILDVAFFARIIATMRSRTAKPLTLASAIITYAERSL  828
            RSP NWWTEEL+ILD+ FF R+I+ M+ R  K LT++SAIITYAE+ L
Sbjct  180  RSPTNWWTEELSILDIEFFGRVISAMKLRGGKSLTVSSAIITYAEKWL  227



>ref|XP_004147730.1| PREDICTED: root phototropism protein 2 [Cucumis sativus]
 ref|XP_011653251.1| PREDICTED: root phototropism protein 2 [Cucumis sativus]
Length=582

 Score =   346 bits (887),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 180/228 (79%), Positives = 203/228 (89%), Gaps = 1/228 (0%)
 Frame = +1

Query  145  MASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIM  324
            M+S +K    R+S+AMERTGQW+FSQ+IPTDV+V VGEA F LHKFMLVAKSNYIRKLIM
Sbjct  1    MSSSMK-GNNRMSIAMERTGQWIFSQDIPTDVVVAVGEAHFPLHKFMLVAKSNYIRKLIM  59

Query  325  DSKEADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDN  504
            +S EADLTRI+L+ IPGG EIFE+AAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDN
Sbjct  60   ESTEADLTRIDLTDIPGGAEIFEKAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDN  119

Query  505  NLAGRTEDFlsqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVEANFPS  684
            NL GRTEDFLSQVALSSLSGA+VVLKS   LLP+AEDL IV RCV++ S+KAC EANFPS
Sbjct  120  NLIGRTEDFLSQVALSSLSGAIVVLKSSHLLLPMAEDLYIVHRCVDVISSKACNEANFPS  179

Query  685  RSPPNWWTEELTILDVAFFARIIATMRSRTAKPLTLASAIITYAERSL  828
            RSPPNWWTEELTI+D+ FFA+II  M+SR AK  TL++A+ITYAERSL
Sbjct  180  RSPPNWWTEELTIIDIEFFAKIITAMKSRGAKASTLSAALITYAERSL  227



>ref|XP_011011776.1| PREDICTED: root phototropism protein 2-like [Populus euphratica]
Length=595

 Score =   345 bits (884),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 180/229 (79%), Positives = 208/229 (91%), Gaps = 1/229 (0%)
 Frame = +1

Query  142  NMASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLI  321
            +MA+P++S  +RLSL MERT +WVFSQ+IPTDV+V V EA+FSLHKFMLVAKSNYIRKLI
Sbjct  17   DMATPVRSN-SRLSLTMERTDRWVFSQDIPTDVVVVVCEATFSLHKFMLVAKSNYIRKLI  75

Query  322  MDSKEADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCD  501
            ++SKE  LT+I+LS IPGGPEIFE+AAKFCYGVNFEITVHNVAALRCAAEYLQMTD YCD
Sbjct  76   LESKEPALTKIDLSEIPGGPEIFEKAAKFCYGVNFEITVHNVAALRCAAEYLQMTDVYCD  135

Query  502  NNLAGRTEDFlsqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVEANFP  681
             NLAGRTEDFL+QVALSSLSGA+VVLKSCE+LLPLAEDLKIVQRCV++ S KAC EANFP
Sbjct  136  YNLAGRTEDFLAQVALSSLSGAIVVLKSCEDLLPLAEDLKIVQRCVDVISLKACNEANFP  195

Query  682  SRSPPNWWTEELTILDVAFFARIIATMRSRTAKPLTLASAIITYAERSL  828
            SR+PPNWWTEEL+ILD+ F  RI++ M+ R +K LTLASA+ITYAER+L
Sbjct  196  SRTPPNWWTEELSILDIEFIGRILSGMKKRGSKALTLASALITYAERNL  244



>ref|XP_009355145.1| PREDICTED: root phototropism protein 2-like [Pyrus x bretschneideri]
Length=577

 Score =   344 bits (882),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 175/228 (77%), Positives = 204/228 (89%), Gaps = 1/228 (0%)
 Frame = +1

Query  145  MASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIM  324
            MASPL S   RLSLAMERTGQW+ SQ+IP+DV+VEVGEA+F LHKFMLVAKSN IRKLIM
Sbjct  1    MASPL-SGGNRLSLAMERTGQWIISQDIPSDVVVEVGEANFPLHKFMLVAKSNRIRKLIM  59

Query  325  DSKEADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDN  504
            +SK+ DLTRI+LS IPGGPE FE+AAKFCYGVNFEITVHNVAALRCA EYL+MTDKYC+N
Sbjct  60   ESKQPDLTRIDLSDIPGGPETFEKAAKFCYGVNFEITVHNVAALRCATEYLEMTDKYCNN  119

Query  505  NLAGRTEDFlsqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVEANFPS  684
            NL  RTEDFL+QVAL+SLSGA+VVLK+CE+LLP+AEDLKIVQRCV++A++K  +EA FPS
Sbjct  120  NLTSRTEDFLTQVALTSLSGAIVVLKTCEDLLPMAEDLKIVQRCVDVATSKVSIEAKFPS  179

Query  685  RSPPNWWTEELTILDVAFFARIIATMRSRTAKPLTLASAIITYAERSL  828
            RSP NWWTEEL+ILD+ FF R+IA+M+ R  K LT+ASAIITYAE+ L
Sbjct  180  RSPTNWWTEELSILDIEFFGRVIASMKLRGVKSLTVASAIITYAEKWL  227



>ref|XP_007206420.1| hypothetical protein PRUPE_ppa003347mg [Prunus persica]
 gb|EMJ07619.1| hypothetical protein PRUPE_ppa003347mg [Prunus persica]
Length=583

 Score =   344 bits (883),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 177/228 (78%), Positives = 205/228 (90%), Gaps = 1/228 (0%)
 Frame = +1

Query  145  MASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIM  324
            MAS +K   +RLS+AMERTGQW+FSQEIP+DV+VEVGEA+FSLHKFMLVAKSN+IRKL++
Sbjct  1    MASSVK-GNSRLSIAMERTGQWIFSQEIPSDVMVEVGEANFSLHKFMLVAKSNHIRKLVL  59

Query  325  DSKEADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDN  504
            +S E DLTRINLS IPGGPE FE+AAKFCYGVNFEITV NVAALRCAAEYL+MTDKYCDN
Sbjct  60   ESTEPDLTRINLSDIPGGPETFEKAAKFCYGVNFEITVQNVAALRCAAEYLEMTDKYCDN  119

Query  505  NLAGRTEDFlsqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVEANFPS  684
            NL GRTEDFL+QVALSSLSGA+VVLKSCEELLP++EDLKIVQRCV++A++KA +EA+FPS
Sbjct  120  NLTGRTEDFLTQVALSSLSGAIVVLKSCEELLPISEDLKIVQRCVDVATSKASIEASFPS  179

Query  685  RSPPNWWTEELTILDVAFFARIIATMRSRTAKPLTLASAIITYAERSL  828
            R+P NWWTEEL ILD+ FF R I  M+ R AK L +ASAIITYAE+ L
Sbjct  180  RTPTNWWTEELAILDIEFFGRFITAMKLRGAKSLIVASAIITYAEKWL  227



>ref|XP_008239637.1| PREDICTED: root phototropism protein 2 isoform X2 [Prunus mume]
Length=584

 Score =   344 bits (882),  Expect = 8e-111, Method: Compositional matrix adjust.
 Identities = 178/228 (78%), Positives = 204/228 (89%), Gaps = 1/228 (0%)
 Frame = +1

Query  145  MASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIM  324
            MAS +K   +RLS+AMERTGQW+FSQEIP+DV+VEVGEA+FSLHKFMLVAKSN+IRKL++
Sbjct  1    MASSVK-GNSRLSIAMERTGQWIFSQEIPSDVMVEVGEANFSLHKFMLVAKSNHIRKLVL  59

Query  325  DSKEADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDN  504
            +S E DLTRINLS IPGGPE FE+AAKFCYGVNFEITV NVAALRCAAEYL+MTDKYCDN
Sbjct  60   ESTEPDLTRINLSDIPGGPETFEKAAKFCYGVNFEITVQNVAALRCAAEYLEMTDKYCDN  119

Query  505  NLAGRTEDFlsqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVEANFPS  684
            NL GRTEDFL+QVALSSLSGA+VVLKSCEELLP+AEDLKIV RCV++A++KA +EA+FPS
Sbjct  120  NLTGRTEDFLTQVALSSLSGAIVVLKSCEELLPIAEDLKIVHRCVDVATSKASIEASFPS  179

Query  685  RSPPNWWTEELTILDVAFFARIIATMRSRTAKPLTLASAIITYAERSL  828
            R+P NWWTEEL ILDV FF R I  M+ R AK L +ASAIITYAE+ L
Sbjct  180  RTPTNWWTEELAILDVEFFGRFITAMKLRGAKSLIVASAIITYAEKWL  227



>ref|XP_008239576.1| PREDICTED: root phototropism protein 2 isoform X1 [Prunus mume]
Length=584

 Score =   344 bits (882),  Expect = 8e-111, Method: Compositional matrix adjust.
 Identities = 178/228 (78%), Positives = 204/228 (89%), Gaps = 1/228 (0%)
 Frame = +1

Query  145  MASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIM  324
            MAS +K   +RLS+AMERTGQW+FSQEIP+DV+VEVGEA+FSLHKFMLVAKSN+IRKL++
Sbjct  1    MASSVK-GNSRLSIAMERTGQWIFSQEIPSDVMVEVGEANFSLHKFMLVAKSNHIRKLVL  59

Query  325  DSKEADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDN  504
            +S E DLTRINLS IPGGPE FE+AAKFCYGVNFEITV NVAALRCAAEYL+MTDKYCDN
Sbjct  60   ESTEPDLTRINLSDIPGGPETFEKAAKFCYGVNFEITVQNVAALRCAAEYLEMTDKYCDN  119

Query  505  NLAGRTEDFlsqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVEANFPS  684
            NL GRTEDFL+QVALSSLSGA+VVLKSCEELLP+AEDLKIV RCV++A++KA +EA+FPS
Sbjct  120  NLTGRTEDFLTQVALSSLSGAIVVLKSCEELLPIAEDLKIVHRCVDVATSKASIEASFPS  179

Query  685  RSPPNWWTEELTILDVAFFARIIATMRSRTAKPLTLASAIITYAERSL  828
            R+P NWWTEEL ILDV FF R I  M+ R AK L +ASAIITYAE+ L
Sbjct  180  RTPTNWWTEELAILDVEFFGRFITAMKLRGAKSLIVASAIITYAEKWL  227



>ref|XP_008451887.1| PREDICTED: root phototropism protein 2 isoform X1 [Cucumis melo]
Length=666

 Score =   346 bits (887),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 180/229 (79%), Positives = 204/229 (89%), Gaps = 1/229 (0%)
 Frame = +1

Query  142  NMASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLI  321
            +M+S +K    R+S+AMERTGQW+FSQ+IPTDV+V VGEA F LHKFMLVAKSNYIRKLI
Sbjct  84   SMSSSVK-GNNRMSIAMERTGQWIFSQDIPTDVVVAVGEAHFPLHKFMLVAKSNYIRKLI  142

Query  322  MDSKEADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCD  501
            M+S EADLTRI+L+ IPGG EIFE+AAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCD
Sbjct  143  MESTEADLTRIDLTDIPGGAEIFEKAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCD  202

Query  502  NNLAGRTEDFlsqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVEANFP  681
            NNL GRTEDFLSQVALSSLSGA+VVLKS   LLP+AEDL IV RCV++ S+KAC EANFP
Sbjct  203  NNLVGRTEDFLSQVALSSLSGAIVVLKSSHHLLPMAEDLYIVHRCVDVISSKACNEANFP  262

Query  682  SRSPPNWWTEELTILDVAFFARIIATMRSRTAKPLTLASAIITYAERSL  828
            SRSPPNWWTEELTI+D+ FFA+II  M+SR AK  TL++A+ITYAERSL
Sbjct  263  SRSPPNWWTEELTIIDIEFFAKIITAMKSRGAKASTLSAALITYAERSL  311



>ref|XP_006591739.1| PREDICTED: root phototropism protein 2-like [Glycine max]
Length=516

 Score =   341 bits (874),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 171/232 (74%), Positives = 200/232 (86%), Gaps = 3/232 (1%)
 Frame = +1

Query  142  NMASPLKSAAT---RLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIR  312
            N   P K  AT   RLSLAMERTGQWVFSQ+IPTDVIVEVGE +FSLHKFMLVAKSNYIR
Sbjct  27   NQNKPHKFMATPNNRLSLAMERTGQWVFSQDIPTDVIVEVGETTFSLHKFMLVAKSNYIR  86

Query  313  KLIMDSKEADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDK  492
            KLI++S E++LTRI+LS IPGGP IFE+ AKFCYGVNFEITVHNVA LRCAAE+LQMTD+
Sbjct  87   KLILESDESELTRIDLSDIPGGPSIFEKTAKFCYGVNFEITVHNVAVLRCAAEFLQMTDQ  146

Query  493  YCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVEA  672
            YC+NNLAGRTE+FL+QVA  +L+GA+ VLKSC  LLP A+D+ +V+RCVE  SAKAC EA
Sbjct  147  YCENNLAGRTEEFLTQVAFFTLTGAVTVLKSCRHLLPYADDINVVKRCVEAVSAKACSEA  206

Query  673  NFPSRSPPNWWTEELTILDVAFFARIIATMRSRTAKPLTLASAIITYAERSL  828
            NFPSRSPPNWWTEEL +LD+ FFAR+I  M+ R+AK LT+A+A+ITY ER+L
Sbjct  207  NFPSRSPPNWWTEELALLDIDFFARVIDAMKQRSAKALTVAAALITYTERAL  258



>ref|NP_001280895.1| root phototropism protein 2-like [Malus domestica]
 gb|ADL36607.1| BZIP domain class transcription factor [Malus domestica]
Length=577

 Score =   342 bits (878),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 175/228 (77%), Positives = 205/228 (90%), Gaps = 1/228 (0%)
 Frame = +1

Query  145  MASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIM  324
            MAS L S   RLSLAMERTGQW+ SQ+IP+DV+VEVGEA+FSLHKFMLVAKSN IRKLIM
Sbjct  1    MASSL-SGGNRLSLAMERTGQWIISQDIPSDVVVEVGEANFSLHKFMLVAKSNRIRKLIM  59

Query  325  DSKEADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDN  504
            +SK+ DLTRI+LS IPGGPE FE+AAKFCYGVNFEITVHNVAALRCAAEYL+MTDKY +N
Sbjct  60   ESKQPDLTRIDLSDIPGGPETFEKAAKFCYGVNFEITVHNVAALRCAAEYLEMTDKYYEN  119

Query  505  NLAGRTEDFlsqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVEANFPS  684
            NL GRTEDFL+QVAL+SLSGA+VVLK+CE+LLP+AEDLKIVQRCV++A++K  +EA FPS
Sbjct  120  NLTGRTEDFLAQVALTSLSGAIVVLKTCEDLLPMAEDLKIVQRCVDVATSKVSIEAKFPS  179

Query  685  RSPPNWWTEELTILDVAFFARIIATMRSRTAKPLTLASAIITYAERSL  828
            RSP NWWTEEL+ILD+ FF R+IA+++ R  K LT+ASAIITYAE+ L
Sbjct  180  RSPKNWWTEELSILDIEFFGRVIASLKLRGVKALTVASAIITYAEKWL  227



>ref|XP_002319980.1| ROOT PHOTOTROPISM 2 family protein [Populus trichocarpa]
 gb|EEE95903.1| ROOT PHOTOTROPISM 2 family protein [Populus trichocarpa]
Length=578

 Score =   342 bits (877),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 180/228 (79%), Positives = 206/228 (90%), Gaps = 1/228 (0%)
 Frame = +1

Query  145  MASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIM  324
            MA+P++S  +RLSLAMERT QWVFSQ+IPTDV+V V EA+FSLHKFMLVAKSN IRKLI+
Sbjct  1    MATPVRSN-SRLSLAMERTDQWVFSQDIPTDVVVVVCEATFSLHKFMLVAKSNCIRKLIL  59

Query  325  DSKEADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDN  504
            +SKE  LT+I+LS IPGGPEIFE+AAKFCYGVNFEITVHNVAALRCAAEYLQMTD YCD 
Sbjct  60   ESKEPALTKIDLSEIPGGPEIFEKAAKFCYGVNFEITVHNVAALRCAAEYLQMTDVYCDY  119

Query  505  NLAGRTEDFlsqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVEANFPS  684
            NLAGRTEDFL+QVALSSLSGA+VVLKSCE+LLPLAEDLKIVQRCV++ S KAC EANFPS
Sbjct  120  NLAGRTEDFLAQVALSSLSGAIVVLKSCEDLLPLAEDLKIVQRCVDVISLKACNEANFPS  179

Query  685  RSPPNWWTEELTILDVAFFARIIATMRSRTAKPLTLASAIITYAERSL  828
            R+PPNWWTEEL+ILD+ F  RI++ M+ R +K LTLASA+ITY ER+L
Sbjct  180  RTPPNWWTEELSILDIEFIGRILSGMKKRGSKALTLASALITYTERNL  227



>gb|KGN53487.1| hypothetical protein Csa_4G056750 [Cucumis sativus]
Length=572

 Score =   342 bits (876),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 176/217 (81%), Positives = 197/217 (91%), Gaps = 0/217 (0%)
 Frame = +1

Query  178  LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRIN  357
            +S+AMERTGQW+FSQ+IPTDV+V VGEA F LHKFMLVAKSNYIRKLIM+S EADLTRI+
Sbjct  1    MSIAMERTGQWIFSQDIPTDVVVAVGEAHFPLHKFMLVAKSNYIRKLIMESTEADLTRID  60

Query  358  LSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFls  537
            L+ IPGG EIFE+AAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNL GRTEDFLS
Sbjct  61   LTDIPGGAEIFEKAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLIGRTEDFLS  120

Query  538  qvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVEANFPSRSPPNWWTEEL  717
            QVALSSLSGA+VVLKS   LLP+AEDL IV RCV++ S+KAC EANFPSRSPPNWWTEEL
Sbjct  121  QVALSSLSGAIVVLKSSHLLLPMAEDLYIVHRCVDVISSKACNEANFPSRSPPNWWTEEL  180

Query  718  TILDVAFFARIIATMRSRTAKPLTLASAIITYAERSL  828
            TI+D+ FFA+II  M+SR AK  TL++A+ITYAERSL
Sbjct  181  TIIDIEFFAKIITAMKSRGAKASTLSAALITYAERSL  217



>gb|AFK45576.1| unknown [Medicago truncatula]
Length=468

 Score =   337 bits (865),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 169/218 (78%), Positives = 193/218 (89%), Gaps = 0/218 (0%)
 Frame = +1

Query  175  RLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRI  354
            RLSLAMERTGQWVFSQE+PTDVIVEVGEA F LHKFMLVAKSNYIRKLIM+S E  LTRI
Sbjct  7    RLSLAMERTGQWVFSQEVPTDVIVEVGEARFCLHKFMLVAKSNYIRKLIMESDETHLTRI  66

Query  355  NLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFl  534
            +LS IPGG  IFE+AAKFCYGVNFEITVHNVA LRCAAE+LQMTD+YCDNNLAGRT++FL
Sbjct  67   DLSDIPGGSGIFEKAAKFCYGVNFEITVHNVAVLRCAAEFLQMTDQYCDNNLAGRTDEFL  126

Query  535  sqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVEANFPSRSPPNWWTEE  714
            S+VA  +L+G++ VLKSC  LLP A+DL IV+RCVE ASAKAC EANFPSRSP NWWTEE
Sbjct  127  SKVAFFTLTGSVAVLKSCHHLLPYADDLNIVKRCVEAASAKACSEANFPSRSPANWWTEE  186

Query  715  LTILDVAFFARIIATMRSRTAKPLTLASAIITYAERSL  828
            L +LD+ FF+R+IA M+ R AKP T+A+A+ITY+ERSL
Sbjct  187  LAVLDIDFFSRVIACMKQRGAKPPTIAAALITYSERSL  224



>ref|XP_003600550.1| Root phototropism protein [Medicago truncatula]
 gb|AES70801.1| root phototropism-like protein [Medicago truncatula]
Length=568

 Score =   339 bits (870),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 169/218 (78%), Positives = 193/218 (89%), Gaps = 0/218 (0%)
 Frame = +1

Query  175  RLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRI  354
            RLSLAMERTGQWVFSQE+PTDVIVEVGEA F LHKFMLVAKSNYIRKLIM+S E  LTRI
Sbjct  7    RLSLAMERTGQWVFSQEVPTDVIVEVGEARFCLHKFMLVAKSNYIRKLIMESDETHLTRI  66

Query  355  NLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFl  534
            +LS IPGG  IFE+AAKFCYGVNFEITVHNVA LRCAAE+LQMTD+YCDNNLAGRT++FL
Sbjct  67   DLSDIPGGSGIFEKAAKFCYGVNFEITVHNVAVLRCAAEFLQMTDQYCDNNLAGRTDEFL  126

Query  535  sqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVEANFPSRSPPNWWTEE  714
            S+VA  +L+G++ VLKSC  LLP A+DL IV+RCVE ASAKAC EANFPSRSP NWWTEE
Sbjct  127  SKVAFFTLTGSVAVLKSCHHLLPYADDLNIVKRCVEAASAKACSEANFPSRSPANWWTEE  186

Query  715  LTILDVAFFARIIATMRSRTAKPLTLASAIITYAERSL  828
            L +LD+ FF+R+IA M+ R AKP T+A+A+ITY+ERSL
Sbjct  187  LAVLDIDFFSRVIACMKQRGAKPPTIAAALITYSERSL  224



>ref|XP_011015900.1| PREDICTED: root phototropism protein 2-like [Populus euphratica]
Length=579

 Score =   340 bits (871),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 177/228 (78%), Positives = 201/228 (88%), Gaps = 3/228 (1%)
 Frame = +1

Query  145  MASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIM  324
            MASP++S   RLSLAMERTG+WVFS++IPTDV+V V EASFSLHK ML+AKSNYIRKLI 
Sbjct  1    MASPVRS---RLSLAMERTGKWVFSKDIPTDVVVVVCEASFSLHKSMLMAKSNYIRKLIF  57

Query  325  DSKEADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDN  504
            +SKE +L RINLSGIPGGPEIF +AAKFCYG NFEITVHNVAALRCAAEYLQMTD YCDN
Sbjct  58   ESKEPELDRINLSGIPGGPEIFVKAAKFCYGFNFEITVHNVAALRCAAEYLQMTDLYCDN  117

Query  505  NLAGRTEDFlsqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVEANFPS  684
            NLAGRTEDF +QVALSSLSGA+ VLKSCE+LLPLAED+ IVQRC++  S KAC EANFPS
Sbjct  118  NLAGRTEDFFAQVALSSLSGAIFVLKSCEDLLPLAEDVNIVQRCIDAISLKACNEANFPS  177

Query  685  RSPPNWWTEELTILDVAFFARIIATMRSRTAKPLTLASAIITYAERSL  828
            R+PPNWWTEEL+IL++ F  RI++ MR R AK LTLASA+ITY ER+L
Sbjct  178  RTPPNWWTEELSILNIEFIGRILSGMRKRGAKALTLASALITYTERNL  225



>gb|KJB26282.1| hypothetical protein B456_004G235100 [Gossypium raimondii]
Length=558

 Score =   337 bits (864),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 174/206 (84%), Positives = 194/206 (94%), Gaps = 0/206 (0%)
 Frame = +1

Query  211  VFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGIPGGPEIF  390
            VFSQEIPTDVIVEVGEA+F+LHKFMLVAKSNYIRKLIM++ EADLTRINLS IPGGPEIF
Sbjct  6    VFSQEIPTDVIVEVGEANFNLHKFMLVAKSNYIRKLIMETNEADLTRINLSEIPGGPEIF  65

Query  391  ERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgal  570
            E+AAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFLSQVALSSLSGA+
Sbjct  66   EKAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFLSQVALSSLSGAV  125

Query  571  vvlksCEELLPLAEDLKIVQRCVELASAKACVEANFPSRSPPNWWTEELTILDVAFFARI  750
            VVLKSCE+LLP+AE+LKIVQRC+++ASA+AC EA+FP R+PPNWWTEEL+ILDV  F RI
Sbjct  126  VVLKSCEDLLPMAEELKIVQRCIDVASARACNEASFPCRTPPNWWTEELSILDVELFGRI  185

Query  751  IATMRSRTAKPLTLASAIITYAERSL  828
            I  M+ R AKPLT+A+A+ITYAER L
Sbjct  186  IGAMKQRGAKPLTIATALITYAERWL  211



>ref|XP_011041764.1| PREDICTED: root phototropism protein 2-like [Populus euphratica]
Length=574

 Score =   337 bits (863),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 177/228 (78%), Positives = 201/228 (88%), Gaps = 3/228 (1%)
 Frame = +1

Query  145  MASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIM  324
            MASP++S   RLSLAMERTG+WVFS++IPTDV+V V EASFSLHK ML+AKSNYIRKLI 
Sbjct  1    MASPVRS---RLSLAMERTGKWVFSKDIPTDVVVVVCEASFSLHKSMLMAKSNYIRKLIF  57

Query  325  DSKEADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDN  504
            +SKE +L RINLSGIPGGPEIF +AAKFCYG NFEITVHNVAALRCAAEYLQMTD YCD 
Sbjct  58   ESKEPELDRINLSGIPGGPEIFVKAAKFCYGFNFEITVHNVAALRCAAEYLQMTDVYCDY  117

Query  505  NLAGRTEDFlsqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVEANFPS  684
            NLAGRTEDFL+QVALSSLSGA+ VLKSCE+LLPLAED+ IVQRC++  S KAC EANFPS
Sbjct  118  NLAGRTEDFLAQVALSSLSGAIFVLKSCEDLLPLAEDVNIVQRCIDAISLKACNEANFPS  177

Query  685  RSPPNWWTEELTILDVAFFARIIATMRSRTAKPLTLASAIITYAERSL  828
            R+PPNWWTEEL+IL++ F  RI++ MR R AK LTLASA+ITY ER+L
Sbjct  178  RTPPNWWTEELSILNIEFIGRILSGMRKRGAKALTLASALITYTERNL  225



>ref|XP_004500391.1| PREDICTED: root phototropism protein 2-like [Cicer arietinum]
Length=569

 Score =   336 bits (861),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 171/228 (75%), Positives = 195/228 (86%), Gaps = 4/228 (2%)
 Frame = +1

Query  145  MASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIM  324
            MA+P      RLSLAMERTGQW+FSQEIPTDVIVEVGEA FSLHKFMLVAKSNYIRKLIM
Sbjct  1    MATP----PNRLSLAMERTGQWIFSQEIPTDVIVEVGEACFSLHKFMLVAKSNYIRKLIM  56

Query  325  DSKEADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDN  504
            +++E +LTRI+LS IPGG  IFE+AAKFCYGVNFEITVHNVA LRCAAE+LQMTD+YCDN
Sbjct  57   EAEETELTRIDLSDIPGGSGIFEKAAKFCYGVNFEITVHNVAVLRCAAEFLQMTDQYCDN  116

Query  505  NLAGRTEDFlsqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVEANFPS  684
            NLAGRT++FLS+VA  +L+G++ VLKSC  LLP AEDL IV+RCVE  SAKAC EANFPS
Sbjct  117  NLAGRTDEFLSKVAFFTLTGSVTVLKSCSYLLPYAEDLNIVKRCVEAVSAKACSEANFPS  176

Query  685  RSPPNWWTEELTILDVAFFARIIATMRSRTAKPLTLASAIITYAERSL  828
            RSP +WWTEEL +LD+ FF R+I  M+ R AK  TLASA+ITY ERSL
Sbjct  177  RSPASWWTEELAVLDIDFFGRVITGMKQRGAKSPTLASALITYTERSL  224



>ref|XP_003553189.1| PREDICTED: root phototropism protein 2-like [Glycine max]
Length=573

 Score =   335 bits (858),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 168/228 (74%), Positives = 194/228 (85%), Gaps = 4/228 (2%)
 Frame = +1

Query  145  MASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIM  324
            MA+P      RLSLAMERTGQWVFSQ+IPTDVIVEVGE  FSLHKFMLVAKSNYIRKLI+
Sbjct  1    MATP----NNRLSLAMERTGQWVFSQDIPTDVIVEVGETIFSLHKFMLVAKSNYIRKLIL  56

Query  325  DSKEADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDN  504
            +S E +LTRI LS IPGGP IFE+ AKFCYGVNFEITVHNVA LRCAAE+LQMTD+YC+N
Sbjct  57   ESNEGELTRIYLSDIPGGPSIFEKTAKFCYGVNFEITVHNVAVLRCAAEFLQMTDQYCEN  116

Query  505  NLAGRTEDFlsqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVEANFPS  684
            NLAGRTE+FL+QVA  +L+GA+ VLKSC  LLP A+++ +V+RCVE  SAKAC EANFPS
Sbjct  117  NLAGRTEEFLTQVAFFTLTGAVTVLKSCRHLLPYADEINVVKRCVEAVSAKACSEANFPS  176

Query  685  RSPPNWWTEELTILDVAFFARIIATMRSRTAKPLTLASAIITYAERSL  828
            RSPPNWWTEEL +LD+ FF  +I  M+ R AKPLT+A+AIITY ER+L
Sbjct  177  RSPPNWWTEELAVLDIDFFGNVIVAMKQRGAKPLTVAAAIITYTERAL  224



>ref|XP_006410156.1| hypothetical protein EUTSA_v10016728mg [Eutrema salsugineum]
 gb|ESQ51609.1| hypothetical protein EUTSA_v10016728mg [Eutrema salsugineum]
Length=412

 Score =   329 bits (844),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 168/217 (77%), Positives = 197/217 (91%), Gaps = 0/217 (0%)
 Frame = +1

Query  178  LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRIN  357
            +S +++RTGQWVFSQ+IPTDV+VEVGEA+FSLHKFMLVAKSNYIRKLIM+SK++D+TRI+
Sbjct  14   MSSSLQRTGQWVFSQDIPTDVVVEVGEANFSLHKFMLVAKSNYIRKLIMESKDSDVTRID  73

Query  358  LSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFls  537
            LS IPGGPE+FE+AAKFCYGVNFEITV NVAAL CAAE+LQMTDKYCDNNLAGRT+DFLS
Sbjct  74   LSDIPGGPEMFEKAAKFCYGVNFEITVQNVAALHCAAEFLQMTDKYCDNNLAGRTQDFLS  133

Query  538  qvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVEANFPSRSPPNWWTEEL  717
            QVALSSLSGA+VVLKSCE LLP++ DL IV+RCV++  AKAC EA FP RSPPNWWTEEL
Sbjct  134  QVALSSLSGAIVVLKSCEILLPISRDLGIVRRCVDVVGAKACNEAMFPCRSPPNWWTEEL  193

Query  718  TILDVAFFARIIATMRSRTAKPLTLASAIITYAERSL  828
             ILDV FF+ ++A+M+ R  KP +LASAIITY E+SL
Sbjct  194  CILDVDFFSDVVASMKQRGLKPSSLASAIITYTEKSL  230



>ref|XP_006293884.1| hypothetical protein CARUB_v10022870mg [Capsella rubella]
 gb|EOA26782.1| hypothetical protein CARUB_v10022870mg [Capsella rubella]
Length=593

 Score =   335 bits (859),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 171/217 (79%), Positives = 198/217 (91%), Gaps = 0/217 (0%)
 Frame = +1

Query  178  LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRIN  357
            +S +++RTGQWVFSQ+IPTDVIVEVGEA+FSLHKFMLVAKSNYIRKLIM+SK++D+TRI+
Sbjct  14   MSSSLQRTGQWVFSQDIPTDVIVEVGEANFSLHKFMLVAKSNYIRKLIMESKDSDVTRID  73

Query  358  LSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFls  537
            LS IPGGPEIFE+AAKFCYGVNFEITV NVAAL CAAE+LQMTDKYCDNNLAGRT+DFLS
Sbjct  74   LSDIPGGPEIFEKAAKFCYGVNFEITVQNVAALHCAAEFLQMTDKYCDNNLAGRTQDFLS  133

Query  538  qvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVEANFPSRSPPNWWTEEL  717
            QVALSSLSGA+VVLKSCE LLP++ DL IV+RCV++  AKAC EA FP R+PPNWWTEEL
Sbjct  134  QVALSSLSGAIVVLKSCEILLPISRDLGIVRRCVDVVGAKACNEAMFPCRTPPNWWTEEL  193

Query  718  TILDVAFFARIIATMRSRTAKPLTLASAIITYAERSL  828
             ILDVAFFA ++A+M+ R  KP +LASAIITY E+SL
Sbjct  194  CILDVAFFADVVASMKQRGVKPSSLASAIITYTEKSL  230



>ref|XP_010677799.1| PREDICTED: root phototropism protein 2 [Beta vulgaris subsp. 
vulgaris]
Length=581

 Score =   334 bits (856),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 166/214 (78%), Positives = 196/214 (92%), Gaps = 0/214 (0%)
 Frame = +1

Query  187  AMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSG  366
            A+ERTGQWVFSQEIPTD++++VGEA+FSLHKFMLVAKSNYIR+LI++SKE+DL R++L+ 
Sbjct  23   ALERTGQWVFSQEIPTDIVIQVGEAAFSLHKFMLVAKSNYIRRLILESKESDLGRLDLTD  82

Query  367  IPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqva  546
            IPGGPEIFE+AAKFCYGVNFEIT+HNVAALRCAAEYLQMTDK CDNNLA RTEDFL QVA
Sbjct  83   IPGGPEIFEKAAKFCYGVNFEITIHNVAALRCAAEYLQMTDKSCDNNLANRTEDFLCQVA  142

Query  547  lsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVEANFPSRSPPNWWTEELTIL  726
            L++LSGAL+VLK+CE+LLP+A DL IVQR V++ SAKAC EA FPSR+PPNWWTEEL+IL
Sbjct  143  LTNLSGALIVLKTCEDLLPMALDLNIVQRSVDVISAKACSEATFPSRTPPNWWTEELSIL  202

Query  727  DVAFFARIIATMRSRTAKPLTLASAIITYAERSL  828
            DV  F ++I+ MR R AK LT+ASAIITYAE+SL
Sbjct  203  DVVSFEKVISAMRLRGAKTLTIASAIITYAEKSL  236



>ref|XP_010244564.1| PREDICTED: root phototropism protein 2 [Nelumbo nucifera]
Length=571

 Score =   333 bits (853),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 168/228 (74%), Positives = 205/228 (90%), Gaps = 1/228 (0%)
 Frame = +1

Query  145  MASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIM  324
            MA+ +K++ +R+SLAMERTGQWVFSQEIP+DV++E+GEA+F+LHKFMLVAKS YIR+ IM
Sbjct  1    MATTVKNS-SRVSLAMERTGQWVFSQEIPSDVVIEIGEANFALHKFMLVAKSGYIRRKIM  59

Query  325  DSKEADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDN  504
            +SKE DLTRI+LS IPGGPEIFE+AAKFCYGVNFEITVHNVAALRCAAEYL+MTDK  ++
Sbjct  60   ESKEPDLTRIDLSDIPGGPEIFEKAAKFCYGVNFEITVHNVAALRCAAEYLEMTDKCSES  119

Query  505  NLAGRTEDFlsqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVEANFPS  684
            NLAGRTEDFLS VAL++L GA+VVLKSCE LLP+A DLKIVQRC+++ASAKAC EANFPS
Sbjct  120  NLAGRTEDFLSHVALTTLPGAVVVLKSCELLLPMAADLKIVQRCIDVASAKACSEANFPS  179

Query  685  RSPPNWWTEELTILDVAFFARIIATMRSRTAKPLTLASAIITYAERSL  828
            RSP NWWTEEL+ILD+  F ++  +M++R AK LTLAS ++ YAE++L
Sbjct  180  RSPTNWWTEELSILDINSFQKVFTSMKTRGAKTLTLASCLMVYAEKAL  227



>ref|XP_010414259.1| PREDICTED: root phototropism protein 2-like [Camelina sativa]
Length=595

 Score =   332 bits (852),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 168/217 (77%), Positives = 198/217 (91%), Gaps = 0/217 (0%)
 Frame = +1

Query  178  LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRIN  357
            +S +++RTGQWVFSQ+IPTDV+VEVGEA+FSLHKFMLVAKSNYIRKLIM+SKE+D+TRI+
Sbjct  14   MSSSLQRTGQWVFSQDIPTDVVVEVGEANFSLHKFMLVAKSNYIRKLIMESKESDVTRID  73

Query  358  LSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFls  537
            LS +PGGPEIFE+AAKFCYGVNFEITV NVAAL CAAE+LQMTDKYCDNNLAGRT+DFLS
Sbjct  74   LSDMPGGPEIFEKAAKFCYGVNFEITVQNVAALHCAAEFLQMTDKYCDNNLAGRTQDFLS  133

Query  538  qvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVEANFPSRSPPNWWTEEL  717
            QVALSSLSGA+VVLKSCE LLP++ DL IV+RCV++ +AKAC EA FP R+PPNWWTEEL
Sbjct  134  QVALSSLSGAIVVLKSCEILLPISRDLGIVRRCVDVVAAKACNEAMFPCRTPPNWWTEEL  193

Query  718  TILDVAFFARIIATMRSRTAKPLTLASAIITYAERSL  828
             ILDV FFA ++A+M+ R  KP +LAS+IITY E+SL
Sbjct  194  CILDVGFFADVVASMKQRGVKPSSLASSIITYTEKSL  230



>gb|KFK22949.1| root phototropism protein 2 [Arabis alpina]
Length=596

 Score =   331 bits (848),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 168/217 (77%), Positives = 198/217 (91%), Gaps = 0/217 (0%)
 Frame = +1

Query  178  LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRIN  357
            +S +++RTGQWVFSQ+IPTDV+VEVGEA+FSLHKFMLVAKSNYIRKLIM+SK++D+TRI+
Sbjct  14   MSSSLQRTGQWVFSQDIPTDVVVEVGEANFSLHKFMLVAKSNYIRKLIMESKDSDVTRID  73

Query  358  LSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFls  537
            LS IPGGPE+FE+AAKFCYGVNFEITV NVAAL CAAE+LQMTDKYCDNNLAGRT+DFLS
Sbjct  74   LSDIPGGPEMFEKAAKFCYGVNFEITVQNVAALHCAAEFLQMTDKYCDNNLAGRTQDFLS  133

Query  538  qvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVEANFPSRSPPNWWTEEL  717
            QVALSSLSGA+VVLKSCE LLP++ DL IV+RCV++ +AKAC EA FP RSPPNWWTEEL
Sbjct  134  QVALSSLSGAIVVLKSCEILLPISRDLGIVRRCVDVVAAKACNEAMFPCRSPPNWWTEEL  193

Query  718  TILDVAFFARIIATMRSRTAKPLTLASAIITYAERSL  828
             ILDV FF+ ++A+M+ R  KP +LASAIITY E+SL
Sbjct  194  CILDVDFFSDVVASMKQRGLKPSSLASAIITYTEKSL  230



>dbj|BAJ33924.1| unnamed protein product [Thellungiella halophila]
Length=597

 Score =   330 bits (847),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 168/217 (77%), Positives = 197/217 (91%), Gaps = 0/217 (0%)
 Frame = +1

Query  178  LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRIN  357
            +S +++RTGQWVFSQ+IPTDV+VEVGEA+FSLHKFMLVAKSNYIRKLIM+SK++D+TRI+
Sbjct  14   MSSSLQRTGQWVFSQDIPTDVVVEVGEANFSLHKFMLVAKSNYIRKLIMESKDSDVTRID  73

Query  358  LSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFls  537
            LS IPGGPE+FE+AAKFCYGVNFEITV NVAAL CAAE+LQMTDKYCDNNLAGRT+DFLS
Sbjct  74   LSDIPGGPEMFEKAAKFCYGVNFEITVQNVAALHCAAEFLQMTDKYCDNNLAGRTQDFLS  133

Query  538  qvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVEANFPSRSPPNWWTEEL  717
            QVALSSLSGA+VVLKSCE LLP++ DL IV+RCV++  AKAC EA FP RSPPNWWTEEL
Sbjct  134  QVALSSLSGAIVVLKSCEILLPISRDLGIVRRCVDVVGAKACNEAMFPCRSPPNWWTEEL  193

Query  718  TILDVAFFARIIATMRSRTAKPLTLASAIITYAERSL  828
             ILDV FF+ ++A+M+ R  KP +LASAIITY E+SL
Sbjct  194  CILDVDFFSDVVASMKQRGLKPSSLASAIITYTEKSL  230



>dbj|BAF02185.1| hypothetical protein [Arabidopsis thaliana]
Length=593

 Score =   330 bits (847),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 168/217 (77%), Positives = 196/217 (90%), Gaps = 0/217 (0%)
 Frame = +1

Query  178  LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRIN  357
            +S ++ RTGQWVFSQ+IPTDV+VEVGEA+FSLHKFMLVAKSNYIRKLIM+SK++D+TRIN
Sbjct  14   MSSSLARTGQWVFSQDIPTDVVVEVGEANFSLHKFMLVAKSNYIRKLIMESKDSDVTRIN  73

Query  358  LSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFls  537
            LS IPGGPEIFE+AAKFCYGVNFEITV NVAAL CAAE+LQMTDKYCDNNLAGRT+DFLS
Sbjct  74   LSDIPGGPEIFEKAAKFCYGVNFEITVQNVAALHCAAEFLQMTDKYCDNNLAGRTQDFLS  133

Query  538  qvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVEANFPSRSPPNWWTEEL  717
            QVALSSLSGA+VVLKSCE LLP++ DL IV+RCV++  AKAC EA FP R+PPNWWTEEL
Sbjct  134  QVALSSLSGAIVVLKSCEILLPISRDLGIVRRCVDVVGAKACNEAMFPCRTPPNWWTEEL  193

Query  718  TILDVAFFARIIATMRSRTAKPLTLASAIITYAERSL  828
             ILDV FF+ ++++M+ R  KP +LASAIITY E+SL
Sbjct  194  CILDVDFFSDVVSSMKQRGVKPSSLASAIITYTEKSL  230



>ref|NP_850147.1| Root phototropism protein 2 [Arabidopsis thaliana]
 sp|Q682S0.2|RPT2_ARATH RecName: Full=Root phototropism protein 2; AltName: Full=BTB/POZ 
domain-containing protein RPT2 [Arabidopsis thaliana]
 gb|AAK59568.1| unknown protein [Arabidopsis thaliana]
 gb|AAL07245.1| unknown protein [Arabidopsis thaliana]
 gb|AAN31821.1| unknown protein [Arabidopsis thaliana]
 dbj|BAD94074.1| hypothetical protein [Arabidopsis thaliana]
 dbj|BAD94572.1| hypothetical protein [Arabidopsis thaliana]
 dbj|BAD95385.1| hypothetical protein [Arabidopsis thaliana]
 dbj|BAF01595.1| hypothetical protein [Arabidopsis thaliana]
 dbj|BAF01673.1| hypothetical protein [Arabidopsis thaliana]
 dbj|BAF02233.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEC08401.1| Root phototropism protein 2 [Arabidopsis thaliana]
Length=593

 Score =   330 bits (847),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 168/217 (77%), Positives = 196/217 (90%), Gaps = 0/217 (0%)
 Frame = +1

Query  178  LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRIN  357
            +S ++ RTGQWVFSQ+IPTDV+VEVGEA+FSLHKFMLVAKSNYIRKLIM+SK++D+TRIN
Sbjct  14   MSSSLARTGQWVFSQDIPTDVVVEVGEANFSLHKFMLVAKSNYIRKLIMESKDSDVTRIN  73

Query  358  LSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFls  537
            LS IPGGPEIFE+AAKFCYGVNFEITV NVAAL CAAE+LQMTDKYCDNNLAGRT+DFLS
Sbjct  74   LSDIPGGPEIFEKAAKFCYGVNFEITVQNVAALHCAAEFLQMTDKYCDNNLAGRTQDFLS  133

Query  538  qvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVEANFPSRSPPNWWTEEL  717
            QVALSSLSGA+VVLKSCE LLP++ DL IV+RCV++  AKAC EA FP R+PPNWWTEEL
Sbjct  134  QVALSSLSGAIVVLKSCEILLPISRDLGIVRRCVDVVGAKACNEAMFPCRTPPNWWTEEL  193

Query  718  TILDVAFFARIIATMRSRTAKPLTLASAIITYAERSL  828
             ILDV FF+ ++++M+ R  KP +LASAIITY E+SL
Sbjct  194  CILDVDFFSDVVSSMKQRGVKPSSLASAIITYTEKSL  230



>gb|AAF33112.1|AF181683_1 RPT2 [Arabidopsis thaliana]
Length=593

 Score =   330 bits (846),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 168/217 (77%), Positives = 196/217 (90%), Gaps = 0/217 (0%)
 Frame = +1

Query  178  LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRIN  357
            +S ++ RTGQWVFSQ+IPTDV+VEVGEA+FSLHKFMLVAKSNYIRKLIM+SK++D+TRIN
Sbjct  14   MSSSLARTGQWVFSQDIPTDVVVEVGEANFSLHKFMLVAKSNYIRKLIMESKDSDVTRIN  73

Query  358  LSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFls  537
            LS IPGGPEIFE+AAKFCYGVNFEITV NVAAL CAAE+LQMTDKYCDNNLAGRT+DFLS
Sbjct  74   LSDIPGGPEIFEKAAKFCYGVNFEITVQNVAALHCAAEFLQMTDKYCDNNLAGRTQDFLS  133

Query  538  qvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVEANFPSRSPPNWWTEEL  717
            QVALSSLSGA+VVLKSCE LLP++ DL IV+RCV++  AKAC EA FP R+PPNWWTEEL
Sbjct  134  QVALSSLSGAIVVLKSCEILLPISRDLGIVRRCVDVVGAKACNEAMFPCRTPPNWWTEEL  193

Query  718  TILDVAFFARIIATMRSRTAKPLTLASAIITYAERSL  828
             ILDV FF+ ++++M+ R  KP +LASAIITY E+SL
Sbjct  194  CILDVDFFSDVVSSMKQRGVKPSSLASAIITYTEKSL  230



>ref|XP_010469846.1| PREDICTED: root phototropism protein 2 isoform X1 [Camelina sativa]
 ref|XP_010469847.1| PREDICTED: root phototropism protein 2 isoform X2 [Camelina sativa]
Length=595

 Score =   330 bits (846),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 167/217 (77%), Positives = 198/217 (91%), Gaps = 0/217 (0%)
 Frame = +1

Query  178  LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRIN  357
            +S +++RTGQWVFSQ+IPTDV+VEVGEA+FSLHKFMLVAKSNYIRKLI++SK++D+TRI+
Sbjct  14   MSSSLQRTGQWVFSQDIPTDVVVEVGEANFSLHKFMLVAKSNYIRKLIIESKDSDVTRID  73

Query  358  LSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFls  537
            LS +PGGPEIFE+AAKFCYGVNFEITV NVAAL CAAE+LQMTDKYCDNNLAGRT+DFLS
Sbjct  74   LSDMPGGPEIFEKAAKFCYGVNFEITVQNVAALHCAAEFLQMTDKYCDNNLAGRTQDFLS  133

Query  538  qvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVEANFPSRSPPNWWTEEL  717
            QVALSSLSGA+VVLKSCE LLP++ DL IV+RCV++ +AKAC EA FP R+PPNWWTEEL
Sbjct  134  QVALSSLSGAIVVLKSCEILLPISRDLGIVRRCVDVVAAKACNEAMFPCRTPPNWWTEEL  193

Query  718  TILDVAFFARIIATMRSRTAKPLTLASAIITYAERSL  828
             ILDV FFA ++A+M+ R  KP +LASAIITY E+SL
Sbjct  194  CILDVGFFADVVASMKQRGVKPSSLASAIITYTEKSL  230



>emb|CDY10743.1| BnaA05g11930D [Brassica napus]
Length=581

 Score =   330 bits (845),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 168/217 (77%), Positives = 196/217 (90%), Gaps = 0/217 (0%)
 Frame = +1

Query  178  LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRIN  357
            +S +++RTGQWVFSQ+IPTDV+VEVGEA+FSLHKFMLVAKSNYIRKLIM+SK++D+TRI+
Sbjct  14   MSSSLQRTGQWVFSQDIPTDVVVEVGEANFSLHKFMLVAKSNYIRKLIMESKDSDVTRID  73

Query  358  LSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFls  537
            LS IPGGPE+FE+AAKFCYGVNFEITV NVAAL CAAE+LQMTDKYCDNNLAGRT+DFLS
Sbjct  74   LSDIPGGPEMFEKAAKFCYGVNFEITVQNVAALHCAAEFLQMTDKYCDNNLAGRTQDFLS  133

Query  538  qvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVEANFPSRSPPNWWTEEL  717
            QVALSSLSGA+VVLKSCE LLP++ DL IV+RCV++  AKAC EA FP R+PPNWWTEEL
Sbjct  134  QVALSSLSGAVVVLKSCEILLPISRDLGIVRRCVDVVGAKACNEAMFPCRTPPNWWTEEL  193

Query  718  TILDVAFFARIIATMRSRTAKPLTLASAIITYAERSL  828
             ILDV FF  ++A+M+ R  KP +LASAIITY ERSL
Sbjct  194  CILDVDFFTDVVASMKQRGLKPSSLASAIITYTERSL  230



>ref|XP_009144295.1| PREDICTED: root phototropism protein 2 [Brassica rapa]
Length=591

 Score =   330 bits (845),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 168/217 (77%), Positives = 196/217 (90%), Gaps = 0/217 (0%)
 Frame = +1

Query  178  LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRIN  357
            +S +++RTGQWVFSQ+IPTDV+VEVGEA+FSLHKFMLVAKSNYIRKLIM+SK++D+TRI+
Sbjct  14   MSSSLQRTGQWVFSQDIPTDVVVEVGEANFSLHKFMLVAKSNYIRKLIMESKDSDVTRID  73

Query  358  LSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFls  537
            LS IPGGPE+FE+AAKFCYGVNFEITV NVAAL CAAE+LQMTDKYCDNNLAGRT+DFLS
Sbjct  74   LSDIPGGPEMFEKAAKFCYGVNFEITVQNVAALHCAAEFLQMTDKYCDNNLAGRTQDFLS  133

Query  538  qvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVEANFPSRSPPNWWTEEL  717
            QVALSSLSGA+VVLKSCE LLP++ DL IV+RCV++  AKAC EA FP R+PPNWWTEEL
Sbjct  134  QVALSSLSGAVVVLKSCEILLPISRDLGIVRRCVDVVGAKACNEAMFPCRTPPNWWTEEL  193

Query  718  TILDVAFFARIIATMRSRTAKPLTLASAIITYAERSL  828
             ILDV FF  ++A+M+ R  KP +LASAIITY ERSL
Sbjct  194  CILDVDFFTDVVASMKQRGLKPSSLASAIITYTERSL  230



>ref|XP_010510344.1| PREDICTED: root phototropism protein 2-like [Camelina sativa]
Length=596

 Score =   330 bits (845),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 167/217 (77%), Positives = 198/217 (91%), Gaps = 0/217 (0%)
 Frame = +1

Query  178  LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRIN  357
            +S +++RTGQWVFSQ+IPTDV+VEVGEA+FSLHKFMLVAKSNYIRKLIM+SK++D+TRI+
Sbjct  14   MSSSLQRTGQWVFSQDIPTDVVVEVGEANFSLHKFMLVAKSNYIRKLIMESKDSDVTRID  73

Query  358  LSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFls  537
            LS +PGGPEIFE+AAKFCYGVNFEITV NVAAL CAAE+LQMTDKYC+NNLAGRT+DFLS
Sbjct  74   LSDMPGGPEIFEKAAKFCYGVNFEITVQNVAALHCAAEFLQMTDKYCNNNLAGRTQDFLS  133

Query  538  qvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVEANFPSRSPPNWWTEEL  717
            QVALSSLSGA+VVLKSCE LLP++ DL IV+RCV++ +AKAC EA FP R+PPNWWTEEL
Sbjct  134  QVALSSLSGAIVVLKSCEILLPISRDLGIVRRCVDVVAAKACNEAMFPCRTPPNWWTEEL  193

Query  718  TILDVAFFARIIATMRSRTAKPLTLASAIITYAERSL  828
             ILDV FFA ++A+M+ R  KP +LASAIITY E+SL
Sbjct  194  CILDVGFFADVVASMKQRGVKPSSLASAIITYTEKSL  230



>emb|CDY02075.1| BnaC04g14260D [Brassica napus]
Length=580

 Score =   328 bits (840),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 167/217 (77%), Positives = 195/217 (90%), Gaps = 0/217 (0%)
 Frame = +1

Query  178  LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRIN  357
            +S +++RTGQWVFSQ+IPTDV+VEVGEA+FSLHKFMLVAKSNYIRKLIM+SK+ D+TRI+
Sbjct  14   MSSSLQRTGQWVFSQDIPTDVVVEVGEANFSLHKFMLVAKSNYIRKLIMESKDIDVTRID  73

Query  358  LSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFls  537
            +S IPGGPE+FE+AAKFCYGVNFEITV NVAAL CAAE+LQMTDKYCDNNLAGRT+DFLS
Sbjct  74   ISDIPGGPEMFEKAAKFCYGVNFEITVQNVAALHCAAEFLQMTDKYCDNNLAGRTQDFLS  133

Query  538  qvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVEANFPSRSPPNWWTEEL  717
            QVALSSLSGA+VVLKSCE LLP++ DL IV+RCV++  AKAC EA FP R+PPNWWTEEL
Sbjct  134  QVALSSLSGAVVVLKSCEILLPISRDLGIVRRCVDVVGAKACNEAMFPCRTPPNWWTEEL  193

Query  718  TILDVAFFARIIATMRSRTAKPLTLASAIITYAERSL  828
             ILDV FF  ++A+M+ R  KP +LASAIITY ERSL
Sbjct  194  CILDVDFFTDVVASMKQRGLKPSSLASAIITYTERSL  230



>ref|XP_002881117.1| hypothetical protein ARALYDRAFT_481966 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57376.1| hypothetical protein ARALYDRAFT_481966 [Arabidopsis lyrata subsp. 
lyrata]
Length=593

 Score =   328 bits (840),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 167/217 (77%), Positives = 196/217 (90%), Gaps = 0/217 (0%)
 Frame = +1

Query  178  LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRIN  357
            +S ++ RTGQWVFSQ+IPTDVIVEVGEA+FSLHKFMLVAKSNYIRKLIM+SK++D+TRI+
Sbjct  14   MSSSLARTGQWVFSQDIPTDVIVEVGEANFSLHKFMLVAKSNYIRKLIMESKDSDVTRID  73

Query  358  LSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFls  537
            LS IPGGPEIFE+AAKFCYGVNFEITV NVAAL CAAE+LQMTDKYCDNNLAGRT+DFLS
Sbjct  74   LSDIPGGPEIFEKAAKFCYGVNFEITVQNVAALHCAAEFLQMTDKYCDNNLAGRTQDFLS  133

Query  538  qvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVEANFPSRSPPNWWTEEL  717
            QVALSSLSGA+VVLKSCE LLP++ DL +V+RCV++  AKAC EA FP R+PPNWWTEEL
Sbjct  134  QVALSSLSGAIVVLKSCEILLPISRDLGLVRRCVDVVGAKACNEAMFPCRTPPNWWTEEL  193

Query  718  TILDVAFFARIIATMRSRTAKPLTLASAIITYAERSL  828
             ILDV FFA ++++M+ R  KP +LASAII+Y E+SL
Sbjct  194  CILDVDFFADVVSSMKQRGVKPSSLASAIISYTEKSL  230



>ref|XP_011080638.1| PREDICTED: root phototropism protein 2 [Sesamum indicum]
Length=570

 Score =   327 bits (838),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 170/227 (75%), Positives = 193/227 (85%), Gaps = 1/227 (0%)
 Frame = +1

Query  145  MASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIM  324
            M +P+K  +  +SLAMER GQWVFSQE+PTDV+VEVGE SFSLHKFMLV KSN+IR+LI+
Sbjct  1    MPNPIKHNSN-ISLAMERAGQWVFSQELPTDVVVEVGEMSFSLHKFMLVGKSNHIRELIL  59

Query  325  DSKEADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDN  504
            +SK+ D  RI+LSG+PGG E FE  A FCYG NFEITVHNVAALRCAAEYLQMTD YC N
Sbjct  60   ESKDVDCARIDLSGVPGGAETFETVANFCYGFNFEITVHNVAALRCAAEYLQMTDSYCKN  119

Query  505  NLAGRTEDFlsqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVEANFPS  684
            + AGRTEDFLSQVAL+S+SGAL VLKSCEELLP+AEDLKIVQRCVE+ASA+ C EANFPS
Sbjct  120  SFAGRTEDFLSQVALTSMSGALAVLKSCEELLPMAEDLKIVQRCVEIASAEVCFEANFPS  179

Query  685  RSPPNWWTEELTILDVAFFARIIATMRSRTAKPLTLASAIITYAERS  825
            RSP NWW EELT + +AFFA+IIA+M  R AK  TLAS II YAERS
Sbjct  180  RSPQNWWVEELTTVGIAFFAKIIASMTWRGAKVFTLASVIIAYAERS  226



>ref|XP_010557176.1| PREDICTED: root phototropism protein 2 [Tarenaya hassleriana]
Length=575

 Score =   327 bits (838),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 171/217 (79%), Positives = 194/217 (89%), Gaps = 0/217 (0%)
 Frame = +1

Query  178  LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRIN  357
            +S AMERT QWVFSQ+IPTDV+VEV EA+FSLHKFMLVAKSNYIRKLIM+SK+ DLTRI+
Sbjct  12   MSSAMERTDQWVFSQDIPTDVVVEVCEANFSLHKFMLVAKSNYIRKLIMESKDTDLTRID  71

Query  358  LSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFls  537
            LS IPGGPE+FE+AAKFCYGVNFEITV NVAAL CAAE+LQMTDKYCD+NLAGRT+DFLS
Sbjct  72   LSDIPGGPEMFEKAAKFCYGVNFEITVQNVAALHCAAEFLQMTDKYCDSNLAGRTQDFLS  131

Query  538  qvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVEANFPSRSPPNWWTEEL  717
            QVALSSLSGA+VVLKSCE LLP+A+DL IV+RC ++ S+KAC EA FP RSPPNWWTEEL
Sbjct  132  QVALSSLSGAVVVLKSCELLLPMAQDLGIVKRCFDVISSKACNEATFPCRSPPNWWTEEL  191

Query  718  TILDVAFFARIIATMRSRTAKPLTLASAIITYAERSL  828
             ILD+ FFA I+A M+ R AK  TLASA+ITY ERSL
Sbjct  192  CILDIDFFAEILAGMKQRGAKASTLASALITYTERSL  228



>dbj|BAF01791.1| hypothetical protein [Arabidopsis thaliana]
 dbj|BAF01873.1| hypothetical protein [Arabidopsis thaliana]
 dbj|BAF01940.1| hypothetical protein [Arabidopsis thaliana]
Length=593

 Score =   327 bits (839),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 167/217 (77%), Positives = 195/217 (90%), Gaps = 0/217 (0%)
 Frame = +1

Query  178  LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRIN  357
            +S ++ RTGQWVFSQ+IPTDV+VEVGEA+FSLHKFMLVAKSNYIRKLIM+SK++D+TRIN
Sbjct  14   MSSSLARTGQWVFSQDIPTDVVVEVGEANFSLHKFMLVAKSNYIRKLIMESKDSDVTRIN  73

Query  358  LSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFls  537
            LS IPG PEIFE+AAKFCYGVNFEITV NVAAL CAAE+LQMTDKYCDNNLAGRT+DFLS
Sbjct  74   LSDIPGDPEIFEKAAKFCYGVNFEITVQNVAALHCAAEFLQMTDKYCDNNLAGRTQDFLS  133

Query  538  qvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVEANFPSRSPPNWWTEEL  717
            QVALSSLSGA+VVLKSCE LLP++ DL IV+RCV++  AKAC EA FP R+PPNWWTEEL
Sbjct  134  QVALSSLSGAIVVLKSCEILLPISRDLGIVRRCVDVVGAKACNEAMFPCRTPPNWWTEEL  193

Query  718  TILDVAFFARIIATMRSRTAKPLTLASAIITYAERSL  828
             ILDV FF+ ++++M+ R  KP +LASAIITY E+SL
Sbjct  194  CILDVDFFSDVVSSMKQRGVKPSSLASAIITYTEKSL  230



>ref|XP_007146905.1| hypothetical protein PHAVU_006G080400g [Phaseolus vulgaris]
 gb|ESW18899.1| hypothetical protein PHAVU_006G080400g [Phaseolus vulgaris]
Length=573

 Score =   325 bits (834),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 163/228 (71%), Positives = 195/228 (86%), Gaps = 4/228 (2%)
 Frame = +1

Query  145  MASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIM  324
            MA+P      RLSLAMERTGQWVFSQ+IPTDVIVEVGE SFSLHKFMLVAKSNYIRKLI+
Sbjct  1    MATP----NNRLSLAMERTGQWVFSQDIPTDVIVEVGETSFSLHKFMLVAKSNYIRKLIL  56

Query  325  DSKEADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDN  504
            ++ E ++TRI+LS IPGGP IFE+ AKFCYGVNFEITV+NVA LRCAAE+LQMTD+YC+N
Sbjct  57   EANENEVTRIDLSDIPGGPAIFEKTAKFCYGVNFEITVNNVAVLRCAAEFLQMTDQYCEN  116

Query  505  NLAGRTEDFlsqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVEANFPS  684
            NL GRTE+FL+QVA  +L+GA+ VLKSC  LLP A+D+ +V+RCVE  SAKAC EANFPS
Sbjct  117  NLTGRTEEFLTQVAFFTLTGAVTVLKSCRNLLPYADDINVVKRCVEAVSAKACSEANFPS  176

Query  685  RSPPNWWTEELTILDVAFFARIIATMRSRTAKPLTLASAIITYAERSL  828
             SPPNWWTEEL +LD+ FF+R+I  M+ R A+ LT+A+A+ITY ER+L
Sbjct  177  CSPPNWWTEELAVLDIDFFSRVIDAMKQRGARTLTVAAALITYTERAL  224



>ref|XP_003544940.2| PREDICTED: root phototropism protein 2-like [Glycine max]
Length=579

 Score =   320 bits (820),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 164/228 (72%), Positives = 191/228 (84%), Gaps = 3/228 (1%)
 Frame = +1

Query  145  MASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIM  324
            MA+P     TR SLAMERTGQWVFS EIPTDVIV VGE++FSLHKF+L AKSNYIRK+IM
Sbjct  1    MATP---NPTRFSLAMERTGQWVFSPEIPTDVIVAVGESTFSLHKFILAAKSNYIRKVIM  57

Query  325  DSKEADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDN  504
            +S+E+DLTRI +S IPGG E FE+AAKFCYGVNFEITVHNVAAL CAA +LQMTD+YCD 
Sbjct  58   ESEESDLTRIEISNIPGGQEAFEKAAKFCYGVNFEITVHNVAALHCAAVFLQMTDEYCDG  117

Query  505  NLAGRTEDFlsqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVEANFPS  684
            NLAGRTEDFLSQV LS+L  A+ VLKSC++LLP A ++ IV RCVE  S+KAC EANFPS
Sbjct  118  NLAGRTEDFLSQVGLSTLHSAVAVLKSCQKLLPFAVEVNIVDRCVEFISSKACSEANFPS  177

Query  685  RSPPNWWTEELTILDVAFFARIIATMRSRTAKPLTLASAIITYAERSL  828
            +SPPNWWTEEL +LDV  FA++I  M+ R AK LT+A A+ITY ER+L
Sbjct  178  QSPPNWWTEELAVLDVDSFAKVITAMKQRGAKYLTVAGALITYTERAL  225



>emb|CDY23992.1| BnaC03g16990D [Brassica napus]
Length=565

 Score =   317 bits (812),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 162/217 (75%), Positives = 193/217 (89%), Gaps = 0/217 (0%)
 Frame = +1

Query  178  LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRIN  357
            +S  ++RTGQWVFSQ+IPTDV+VEVGEA+FSLHKFMLVAKSNYIRKLIM+SK++D+TRI+
Sbjct  14   MSSTLQRTGQWVFSQDIPTDVVVEVGEANFSLHKFMLVAKSNYIRKLIMESKDSDVTRID  73

Query  358  LSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFls  537
            LS IPGG E+FE+AAKFCYGV+FEITV NVAAL+CAAE+LQMTDKYCDNNLAGRT+DFLS
Sbjct  74   LSDIPGGAEMFEKAAKFCYGVSFEITVQNVAALQCAAEFLQMTDKYCDNNLAGRTQDFLS  133

Query  538  qvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVEANFPSRSPPNWWTEEL  717
            QVALSSLSGA+VVLKSCE LLP++ DL IV+RCV++   KAC EA  P RSPPNWWTEEL
Sbjct  134  QVALSSLSGAIVVLKSCEILLPISRDLGIVRRCVDVVGTKACDEAMLPCRSPPNWWTEEL  193

Query  718  TILDVAFFARIIATMRSRTAKPLTLASAIITYAERSL  828
             IL++ F A ++A+M+ +  KP +LASAIITY ERSL
Sbjct  194  CILNINFLADVLASMKQKGLKPSSLASAIITYTERSL  230



>ref|XP_003519296.1| PREDICTED: root phototropism protein 2 [Glycine max]
Length=580

 Score =   317 bits (812),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 161/228 (71%), Positives = 191/228 (84%), Gaps = 3/228 (1%)
 Frame = +1

Query  145  MASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIM  324
            MA+P     TR SLAMERTGQWVFS EIPTDVIV VG+ +FSLHKF+L AKSNY+RK+IM
Sbjct  1    MATP---NPTRFSLAMERTGQWVFSPEIPTDVIVAVGQTNFSLHKFILAAKSNYVRKVIM  57

Query  325  DSKEADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDN  504
            +S+E+DLTRI +S IPGG E FE+AAKFCYGVNFEITVHNVAAL CAA +LQMTD+YCD 
Sbjct  58   ESEESDLTRIEISDIPGGSEAFEKAAKFCYGVNFEITVHNVAALHCAAVFLQMTDEYCDG  117

Query  505  NLAGRTEDFlsqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVEANFPS  684
            NLAGRTEDFLSQV LS+L  A+ VLKSC+++LP A ++ +V RCVE+ S KAC EANFPS
Sbjct  118  NLAGRTEDFLSQVGLSTLHSAVAVLKSCQKILPFAAEVNVVDRCVEVISCKACNEANFPS  177

Query  685  RSPPNWWTEELTILDVAFFARIIATMRSRTAKPLTLASAIITYAERSL  828
            +SPPNWWTEEL +LDV  FA++IA M+ R AK LT+A A+ITY ER+L
Sbjct  178  QSPPNWWTEELAVLDVDSFAKVIAAMKQRGAKYLTVAGALITYTERAL  225



>ref|XP_003616056.1| Root phototropism protein [Medicago truncatula]
 gb|AES99014.1| root phototropism-like protein [Medicago truncatula]
Length=579

 Score =   317 bits (811),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 159/219 (73%), Positives = 191/219 (87%), Gaps = 0/219 (0%)
 Frame = +1

Query  172  TRLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTR  351
            +RLSLAMERTGQW+FSQEIP+DVIV +GEA++SLHKFMLVAKSNYIRKLIM+S E++LTR
Sbjct  7    SRLSLAMERTGQWIFSQEIPSDVIVTIGEATYSLHKFMLVAKSNYIRKLIMESNESELTR  66

Query  352  INLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDF  531
            ++LS IPGG E FE+AAKFCYGVNFEITV+NVA+L CAA +LQMTD+YCD NLAGRTE F
Sbjct  67   LDLSDIPGGQEAFEKAAKFCYGVNFEITVNNVASLHCAAMFLQMTDEYCDGNLAGRTEGF  126

Query  532  lsqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVEANFPSRSPPNWWTE  711
            LSQVAL++LSGA VVLKSC +L+P+A++L IV+RCV+  S+K C EANFPSRSPPNWWTE
Sbjct  127  LSQVALTTLSGAAVVLKSCRQLIPVADELNIVKRCVDAVSSKVCNEANFPSRSPPNWWTE  186

Query  712  ELTILDVAFFARIIATMRSRTAKPLTLASAIITYAERSL  828
            EL +LDV  F ++I  M+ R AK LTLA A+I Y ER+L
Sbjct  187  ELAVLDVESFGKVITAMKQRGAKYLTLAGALIAYTERTL  225



>ref|XP_010044625.1| PREDICTED: root phototropism protein 2-like [Eucalyptus grandis]
 gb|KCW86717.1| hypothetical protein EUGRSUZ_B03325 [Eucalyptus grandis]
Length=570

 Score =   314 bits (805),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 163/228 (71%), Positives = 193/228 (85%), Gaps = 1/228 (0%)
 Frame = +1

Query  145  MASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIM  324
            MAS +KS     S+AMERT QW+ S++ PTDV V V +A+FSLHKFMLVAKSNY+RK++M
Sbjct  1    MASHVKSNGGN-SIAMERTSQWLLSKKFPTDVDVIVSKANFSLHKFMLVAKSNYMRKMVM  59

Query  325  DSKEADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDN  504
            +SKEADLTRI+LS  PGGPEIFE+AA FCY ++FEITV NVAALRCAAEYL+MTD+YCDN
Sbjct  60   ESKEADLTRIDLSDFPGGPEIFEKAANFCYNIDFEITVKNVAALRCAAEYLEMTDQYCDN  119

Query  505  NLAGRTEDFlsqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVEANFPS  684
            NLAGRTEDFL QVA SSLSG ++VLKSCE+LLP+AEDLKIVQRC+++ASAK C E  FPS
Sbjct  120  NLAGRTEDFLVQVAFSSLSGTILVLKSCEDLLPMAEDLKIVQRCLDVASAKVCKEVIFPS  179

Query  685  RSPPNWWTEELTILDVAFFARIIATMRSRTAKPLTLASAIITYAERSL  828
            RSP NWWT EL++L+V FF +IIA M+ R AK   LA AI+TYAERSL
Sbjct  180  RSPSNWWTVELSVLNVVFFGKIIAAMQQRGAKACFLAMAIVTYAERSL  227



>gb|KCW86718.1| hypothetical protein EUGRSUZ_B03325 [Eucalyptus grandis]
Length=577

 Score =   314 bits (805),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 163/228 (71%), Positives = 193/228 (85%), Gaps = 1/228 (0%)
 Frame = +1

Query  145  MASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIM  324
            MAS +KS     S+AMERT QW+ S++ PTDV V V +A+FSLHKFMLVAKSNY+RK++M
Sbjct  1    MASHVKSNGGN-SIAMERTSQWLLSKKFPTDVDVIVSKANFSLHKFMLVAKSNYMRKMVM  59

Query  325  DSKEADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDN  504
            +SKEADLTRI+LS  PGGPEIFE+AA FCY ++FEITV NVAALRCAAEYL+MTD+YCDN
Sbjct  60   ESKEADLTRIDLSDFPGGPEIFEKAANFCYNIDFEITVKNVAALRCAAEYLEMTDQYCDN  119

Query  505  NLAGRTEDFlsqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVEANFPS  684
            NLAGRTEDFL QVA SSLSG ++VLKSCE+LLP+AEDLKIVQRC+++ASAK C E  FPS
Sbjct  120  NLAGRTEDFLVQVAFSSLSGTILVLKSCEDLLPMAEDLKIVQRCLDVASAKVCKEVIFPS  179

Query  685  RSPPNWWTEELTILDVAFFARIIATMRSRTAKPLTLASAIITYAERSL  828
            RSP NWWT EL++L+V FF +IIA M+ R AK   LA AI+TYAERSL
Sbjct  180  RSPSNWWTVELSVLNVVFFGKIIAAMQQRGAKACFLAMAIVTYAERSL  227



>ref|XP_009132742.1| PREDICTED: root phototropism protein 2-like [Brassica rapa]
Length=575

 Score =   313 bits (802),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 161/217 (74%), Positives = 193/217 (89%), Gaps = 0/217 (0%)
 Frame = +1

Query  178  LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRIN  357
            +S +++RTGQ  FSQ+IPTDV+VEVGEA+FSLHKFMLVAKSNYIRKLIM+SK++D+TRI+
Sbjct  14   MSSSLQRTGQLGFSQDIPTDVVVEVGEANFSLHKFMLVAKSNYIRKLIMESKDSDVTRID  73

Query  358  LSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFls  537
            LS IPGG E+FE+AAKFCYGV+FEITV NVAAL+CAAE+LQMTDKYCDNNLAGR +DFLS
Sbjct  74   LSDIPGGAEMFEKAAKFCYGVSFEITVQNVAALQCAAEFLQMTDKYCDNNLAGRIQDFLS  133

Query  538  qvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVEANFPSRSPPNWWTEEL  717
            QVALSSLSGA+VVLKSCE LLP++ DL IV+RCV++   KAC EA FP RSPPNWWTEEL
Sbjct  134  QVALSSLSGAIVVLKSCEILLPISRDLGIVRRCVDVVGTKACNEAMFPCRSPPNWWTEEL  193

Query  718  TILDVAFFARIIATMRSRTAKPLTLASAIITYAERSL  828
             IL++ FF+ ++A+M+ R  KP +LASAIITY ERSL
Sbjct  194  CILNIDFFSDVLASMKQRGLKPSSLASAIITYTERSL  230



>emb|CDX84827.1| BnaA03g14030D [Brassica napus]
Length=565

 Score =   313 bits (802),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 161/217 (74%), Positives = 193/217 (89%), Gaps = 0/217 (0%)
 Frame = +1

Query  178  LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRIN  357
            +S +++RTGQ  FSQ+IPTDV+VEVGEA+FSLHKFMLVAKSNYIRKLIM+SK++D+TRI+
Sbjct  14   MSSSLQRTGQLGFSQDIPTDVVVEVGEANFSLHKFMLVAKSNYIRKLIMESKDSDVTRID  73

Query  358  LSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFls  537
            LS IPGG E+FE+AAKFCYGV+FEITV NVAAL+CAAE+LQMTDKYCDNNLAGR +DFLS
Sbjct  74   LSDIPGGAEMFEKAAKFCYGVSFEITVQNVAALQCAAEFLQMTDKYCDNNLAGRIQDFLS  133

Query  538  qvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVEANFPSRSPPNWWTEEL  717
            QVALSSLSGA+VVLKSCE LLP++ DL IV+RCV++   KAC EA FP RSPPNWWTEEL
Sbjct  134  QVALSSLSGAIVVLKSCEILLPISRDLGIVRRCVDVVGTKACNEAMFPCRSPPNWWTEEL  193

Query  718  TILDVAFFARIIATMRSRTAKPLTLASAIITYAERSL  828
             IL++ FF+ ++A+M+ R  KP +LASAIITY ERSL
Sbjct  194  CILNIDFFSDVLASMKQRGLKPSSLASAIITYTERSL  230



>ref|XP_007142019.1| hypothetical protein PHAVU_008G245700g [Phaseolus vulgaris]
 gb|ESW14013.1| hypothetical protein PHAVU_008G245700g [Phaseolus vulgaris]
Length=580

 Score =   312 bits (799),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 157/228 (69%), Positives = 191/228 (84%), Gaps = 3/228 (1%)
 Frame = +1

Query  145  MASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIM  324
            MA+P   + TRLSLAMERTGQW+FS EIPTDVIV VGEA+FSLHKF+L AKSN IRK+IM
Sbjct  1    MATP---SPTRLSLAMERTGQWIFSPEIPTDVIVAVGEANFSLHKFILAAKSNSIRKVIM  57

Query  325  DSKEADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDN  504
            +S+E+DLTRI+L+ IPGG E FE+  KFCYGVNFEITVHNVA L CAA +LQMTD+YCD 
Sbjct  58   ESEESDLTRIDLTNIPGGQEAFEKVVKFCYGVNFEITVHNVAPLHCAAVFLQMTDEYCDG  117

Query  505  NLAGRTEDFlsqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVEANFPS  684
            NLAGRTEDFLSQV +S+L  A+ VLKSC +LLPLA ++ +V RCV++ S+KAC E NFPS
Sbjct  118  NLAGRTEDFLSQVGVSTLHSAIAVLKSCRQLLPLATEINVVDRCVDVISSKACREMNFPS  177

Query  685  RSPPNWWTEELTILDVAFFARIIATMRSRTAKPLTLASAIITYAERSL  828
            +SPPNWWTEEL +LDV  FA++IA M+ R A+ L++A A+ITY ER+L
Sbjct  178  QSPPNWWTEELAVLDVNSFAKVIAAMKQRGARYLSVAGALITYTERAL  225



>gb|EPS73802.1| hypothetical protein M569_00954 [Genlisea aurea]
Length=566

 Score =   311 bits (797),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 166/222 (75%), Positives = 188/222 (85%), Gaps = 5/222 (2%)
 Frame = +1

Query  166  AATRLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKE-AD  342
            A  RLS AMERTGQWV SQ+IPTDV+V VG A FSLHKF L+AKSN +R LI++S+E +D
Sbjct  2    ADDRLSHAMERTGQWVLSQQIPTDVVVAVGTARFSLHKFTLIAKSNLLRTLILESEELSD  61

Query  343  LTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRT  522
             T I+LS IPGG EIFERAAKFCYGVNFEITV+NVAALRCAAEYLQMTD      L GRT
Sbjct  62   PTTIDLSEIPGGSEIFERAAKFCYGVNFEITVNNVAALRCAAEYLQMTD----GTLGGRT  117

Query  523  EDFlsqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVEANFPSRSPPNW  702
            EDFLS+VAL+SLS A+ VLK+CE+LLP+AEDLKIVQRCVE+ SAKACVEANFPSR+P NW
Sbjct  118  EDFLSKVALTSLSAAVTVLKTCEDLLPIAEDLKIVQRCVEVVSAKACVEANFPSRTPANW  177

Query  703  WTEELTILDVAFFARIIATMRSRTAKPLTLASAIITYAERSL  828
            WTEE+T+L V FF RII TM++R AK  TLASAIITY ERSL
Sbjct  178  WTEEMTVLGVPFFKRIITTMKTRGAKGQTLASAIITYTERSL  219



>ref|XP_004490729.1| PREDICTED: root phototropism protein 2-like [Cicer arietinum]
Length=573

 Score =   310 bits (793),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 157/220 (71%), Positives = 190/220 (86%), Gaps = 0/220 (0%)
 Frame = +1

Query  169  ATRLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLT  348
            ++RLSLAMERTGQW+ SQE+P+DVIV VGEAS+SLHKFMLVAKSNYIRKLI++S +++LT
Sbjct  6    SSRLSLAMERTGQWISSQELPSDVIVTVGEASYSLHKFMLVAKSNYIRKLIIESNDSELT  65

Query  349  RINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTED  528
            RI+LS IPGG E FE+AAKFCYGVNFEITV+NVA+L CAA +LQMT++YCD NLAGRTE 
Sbjct  66   RIDLSDIPGGKEAFEKAAKFCYGVNFEITVNNVASLHCAALFLQMTEEYCDGNLAGRTEG  125

Query  529  FlsqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVEANFPSRSPPNWWT  708
            FLSQVAL++LS A+VVLKSC +LLP+A++L IV RC+E  S+K C EA  PSRSPPNWWT
Sbjct  126  FLSQVALTNLSSAVVVLKSCSQLLPVADELNIVNRCIEAVSSKVCSEAMLPSRSPPNWWT  185

Query  709  EELTILDVAFFARIIATMRSRTAKPLTLASAIITYAERSL  828
            EEL ILDV  F ++IA M+ R+AK LTLA A+ITY E+ L
Sbjct  186  EELAILDVKSFGKVIAAMKKRSAKYLTLAGALITYTEKKL  225



>ref|XP_006842585.1| PREDICTED: root phototropism protein 2 [Amborella trichopoda]
 gb|ERN04260.1| hypothetical protein AMTR_s00077p00161250 [Amborella trichopoda]
Length=564

 Score =   305 bits (781),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 156/222 (70%), Positives = 185/222 (83%), Gaps = 0/222 (0%)
 Frame = +1

Query  163  SAATRLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEAD  342
            S   RLSLAMERTG+WVFSQEIPTDV+VEVGEA+FSLHKFMLVAKS YIRKLIM+SKEAD
Sbjct  4    STKNRLSLAMERTGKWVFSQEIPTDVVVEVGEANFSLHKFMLVAKSGYIRKLIMESKEAD  63

Query  343  LTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRT  522
            L+RI L  IPGGPE FE+AAKFCYG +FEITV NVAAL CAAEYL+M++KYC+ NL  R 
Sbjct  64   LSRIELPDIPGGPETFEKAAKFCYGASFEITVKNVAALLCAAEYLEMSEKYCEGNLISRA  123

Query  523  EDFlsqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVEANFPSRSPPNW  702
            EDFL  VAL+SLSGA+ VLKSCEEL  +AE+L IV RC++ AS KAC E+NFP+RSPP+W
Sbjct  124  EDFLVGVALTSLSGAVAVLKSCEELQRMAEELNIVTRCIDTASIKACNESNFPTRSPPDW  183

Query  703  WTEELTILDVAFFARIIATMRSRTAKPLTLASAIITYAERSL  828
            W EEL  L+V  F RI+A M+ R A+P + A+A++ Y+ERSL
Sbjct  184  WIEELLPLNVETFQRIVAGMKGRGARPQSFATALMAYSERSL  225



>ref|XP_010522018.1| PREDICTED: root phototropism protein 2-like [Tarenaya hassleriana]
Length=572

 Score =   301 bits (770),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 158/217 (73%), Positives = 185/217 (85%), Gaps = 0/217 (0%)
 Frame = +1

Query  178  LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRIN  357
            + +AMERT QWV SQ+ P DV+V+V EASFSLHKF+LV KSNYIRKLIM+SK+ DLT I+
Sbjct  10   MDMAMERTDQWVSSQDTPADVVVDVCEASFSLHKFLLVGKSNYIRKLIMESKDTDLTIID  69

Query  358  LSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFls  537
            LS IPGGPE+FE+AAKFCYGVNFEITV NVAAL CAAE+LQMTD+YC++NLA RT DFLS
Sbjct  70   LSDIPGGPEMFEKAAKFCYGVNFEITVQNVAALHCAAEFLQMTDEYCESNLASRTLDFLS  129

Query  538  qvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVEANFPSRSPPNWWTEEL  717
            QVALSSLSGA+VVLKSCE LLP A+DL IV+RC+++ S+KAC EA FPSRSPPNWWTEEL
Sbjct  130  QVALSSLSGAIVVLKSCELLLPAAQDLGIVKRCLDVISSKACSEATFPSRSPPNWWTEEL  189

Query  718  TILDVAFFARIIATMRSRTAKPLTLASAIITYAERSL  828
             ILD+ FFA ++  M+ R AK   LASAI TY E+SL
Sbjct  190  CILDIDFFAEVLTGMKQRGAKASALASAITTYTEKSL  226



>emb|CBI15801.3| unnamed protein product [Vitis vinifera]
Length=191

 Score =   287 bits (735),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 151/170 (89%), Positives = 163/170 (96%), Gaps = 0/170 (0%)
 Frame = +1

Query  190  MERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGI  369
            MERTGQWVFSQEIPTDV+VEVGEA+FSLHKFMLVAKSNYIRKLIM+SKEADLT I+LS I
Sbjct  1    MERTGQWVFSQEIPTDVVVEVGEANFSLHKFMLVAKSNYIRKLIMESKEADLTNIDLSDI  60

Query  370  PGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqval  549
            PGGPEIFE+AAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCD NL+GRTEDFL QVAL
Sbjct  61   PGGPEIFEKAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDGNLSGRTEDFLKQVAL  120

Query  550  sslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVEANFPSRSPPN  699
            +SLSGA+VVLKSCE+LLP AE+LKIVQRCV++AS KAC EANFPSRSPPN
Sbjct  121  TSLSGAVVVLKSCEDLLPKAEELKIVQRCVDVASTKACNEANFPSRSPPN  170



>gb|KJB26283.1| hypothetical protein B456_004G235100 [Gossypium raimondii]
Length=532

 Score =   295 bits (754),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 153/184 (83%), Positives = 172/184 (93%), Gaps = 0/184 (0%)
 Frame = +1

Query  277  KFMLVAKSNYIRKLIMDSKEADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAAL  456
            +FMLVAKSNYIRKLIM++ EADLTRINLS IPGGPEIFE+AAKFCYGVNFEITVHNVAAL
Sbjct  2    QFMLVAKSNYIRKLIMETNEADLTRINLSEIPGGPEIFEKAAKFCYGVNFEITVHNVAAL  61

Query  457  RCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLPLAEDLKIVQRC  636
            RCAAEYLQMTDKYCDNNLAGRTEDFLSQVALSSLSGA+VVLKSCE+LLP+AE+LKIVQRC
Sbjct  62   RCAAEYLQMTDKYCDNNLAGRTEDFLSQVALSSLSGAVVVLKSCEDLLPMAEELKIVQRC  121

Query  637  VELASAKACVEANFPSRSPPNWWTEELTILDVAFFARIIATMRSRTAKPLTLASAIITYA  816
            +++ASA+AC EA+FP R+PPNWWTEEL+ILDV  F RII  M+ R AKPLT+A+A+ITYA
Sbjct  122  IDVASARACNEASFPCRTPPNWWTEELSILDVELFGRIIGAMKQRGAKPLTIATALITYA  181

Query  817  ERSL  828
            ER L
Sbjct  182  ERWL  185



>gb|KDO54918.1| hypothetical protein CISIN_1g007944mg [Citrus sinensis]
Length=541

 Score =   292 bits (748),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 152/182 (84%), Positives = 171/182 (94%), Gaps = 0/182 (0%)
 Frame = +1

Query  283  MLVAKSNYIRKLIMDSKEADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRC  462
            MLVAKSNYIRKLI++SKEADLTRINLS IPGGPE+FE+AAKFCYGVNFEITVHNVAALRC
Sbjct  1    MLVAKSNYIRKLIIESKEADLTRINLSNIPGGPEMFEKAAKFCYGVNFEITVHNVAALRC  60

Query  463  AAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLPLAEDLKIVQRCVE  642
            AAE+LQMTDKYC+NNLAGRTEDFLSQVALSSLSGA+VVLKSCE LLPLAEDL IVQRC++
Sbjct  61   AAEFLQMTDKYCENNLAGRTEDFLSQVALSSLSGAVVVLKSCEALLPLAEDLLIVQRCID  120

Query  643  LASAKACVEANFPSRSPPNWWTEELTILDVAFFARIIATMRSRTAKPLTLASAIITYAER  822
            +A+AKAC EANFP R+PPNWWTEEL+I+D+ FF+RIIA M+ R AK LT+ASA+ITY ER
Sbjct  121  VATAKACYEANFPCRTPPNWWTEELSIIDIEFFSRIIAAMKKRGAKALTIASALITYTER  180

Query  823  SL  828
            SL
Sbjct  181  SL  182



>ref|XP_006432045.1| hypothetical protein CICLE_v10000673mg [Citrus clementina]
 ref|XP_006432047.1| hypothetical protein CICLE_v10000673mg [Citrus clementina]
 gb|ESR45285.1| hypothetical protein CICLE_v10000673mg [Citrus clementina]
 gb|ESR45287.1| hypothetical protein CICLE_v10000673mg [Citrus clementina]
Length=541

 Score =   292 bits (748),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 152/182 (84%), Positives = 171/182 (94%), Gaps = 0/182 (0%)
 Frame = +1

Query  283  MLVAKSNYIRKLIMDSKEADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRC  462
            MLVAKSNYIRKLI++SKEADLTRINLS IPGGPE+FE+AAKFCYGVNFEITVHNVAALRC
Sbjct  1    MLVAKSNYIRKLIIESKEADLTRINLSNIPGGPEMFEKAAKFCYGVNFEITVHNVAALRC  60

Query  463  AAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLPLAEDLKIVQRCVE  642
            AAE+LQMTDKYC+NNLAGRTEDFLSQVALSSLSGA+VVLKSCE LLPLAEDL IVQRC++
Sbjct  61   AAEFLQMTDKYCENNLAGRTEDFLSQVALSSLSGAVVVLKSCEALLPLAEDLLIVQRCID  120

Query  643  LASAKACVEANFPSRSPPNWWTEELTILDVAFFARIIATMRSRTAKPLTLASAIITYAER  822
            +A+AKAC EANFP R+PPNWWTEEL+I+D+ FF+RIIA M+ R AK LT+ASA+ITY ER
Sbjct  121  VATAKACYEANFPCRTPPNWWTEELSIIDIEFFSRIIAAMKKRGAKALTIASALITYTER  180

Query  823  SL  828
            SL
Sbjct  181  SL  182



>ref|XP_010650806.1| PREDICTED: root phototropism protein 2 isoform X2 [Vitis vinifera]
Length=527

 Score =   290 bits (742),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 151/182 (83%), Positives = 168/182 (92%), Gaps = 0/182 (0%)
 Frame = +1

Query  283  MLVAKSNYIRKLIMDSKEADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRC  462
            MLVAKSNYIRKLIM+SKEADLT I+LS IPGGPEIFE+AAKFCYGVNFEITVHNVAALRC
Sbjct  1    MLVAKSNYIRKLIMESKEADLTNIDLSDIPGGPEIFEKAAKFCYGVNFEITVHNVAALRC  60

Query  463  AAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLPLAEDLKIVQRCVE  642
            AAEYLQMTDKYCD NL+GRTEDFL QVAL+SLSGA+VVLKSCE+LLP AE+LKIVQRCV+
Sbjct  61   AAEYLQMTDKYCDGNLSGRTEDFLKQVALTSLSGAVVVLKSCEDLLPKAEELKIVQRCVD  120

Query  643  LASAKACVEANFPSRSPPNWWTEELTILDVAFFARIIATMRSRTAKPLTLASAIITYAER  822
            +AS KAC EANFPSRSPPNWWTEEL+ILD+ FF +IIA M+ R AK LT+ASA+ITY ER
Sbjct  121  VASTKACNEANFPSRSPPNWWTEELSILDIGFFEKIIAAMKLRGAKSLTVASALITYTER  180

Query  823  SL  828
            +L
Sbjct  181  TL  182



>gb|ABI34691.1| bZIP transcription factor bZIP84 [Glycine max]
Length=183

 Score =   268 bits (686),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 135/183 (74%), Positives = 158/183 (86%), Gaps = 0/183 (0%)
 Frame = +1

Query  196  RTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGIPG  375
            RTGQWVFS EIPTDVIV VG+ +FSLHKF+L AKSNY+RK+IM+S+E+DLTRI +S IPG
Sbjct  1    RTGQWVFSPEIPTDVIVAVGQTNFSLHKFILAAKSNYVRKVIMESEESDLTRIEISDIPG  60

Query  376  GPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalss  555
            G E FE+AAKFCYGVNFEITVHNVAAL CAA +LQMTD+YCD NLAGRTEDFLSQV LS+
Sbjct  61   GSEAFEKAAKFCYGVNFEITVHNVAALHCAAVFLQMTDEYCDGNLAGRTEDFLSQVGLST  120

Query  556  lsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVEANFPSRSPPNWWTEELTILDVA  735
            L  A+ VLKSC+++LP A ++ +V RCVE+ S KAC EANFPS+SPPNWWTEEL +LDV 
Sbjct  121  LHSAVAVLKSCQKILPFAAEVNVVDRCVEVISCKACNEANFPSQSPPNWWTEELAVLDVD  180

Query  736  FFA  744
             FA
Sbjct  181  SFA  183



>ref|XP_008358916.1| PREDICTED: root phototropism protein 2-like [Malus domestica]
Length=175

 Score =   265 bits (676),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 139/171 (81%), Positives = 162/171 (95%), Gaps = 1/171 (1%)
 Frame = +1

Query  145  MASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIM  324
            MASPL + + RLSLAMERTGQW+FSQ+IP+DV+V+VGEA+FSLHKFMLVAKSN IRKLIM
Sbjct  1    MASPL-NGSNRLSLAMERTGQWIFSQDIPSDVVVQVGEANFSLHKFMLVAKSNRIRKLIM  59

Query  325  DSKEADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDN  504
            +SK+ DLTRI+LS +PGGPE FE+AAKFCYGVNFEITVHNVAALRCAAEYL+MT+KYCDN
Sbjct  60   ESKKPDLTRIDLSDVPGGPETFEKAAKFCYGVNFEITVHNVAALRCAAEYLEMTEKYCDN  119

Query  505  NLAGRTEDFlsqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAK  657
            NL GRTEDFLSQVAL SLSGA+VVLKSCE+LLP+AEDLKIVQ+CV++A++K
Sbjct  120  NLTGRTEDFLSQVALMSLSGAIVVLKSCEDLLPMAEDLKIVQKCVDVAASK  170



>gb|AES70802.2| root phototropism-like protein [Medicago truncatula]
Length=526

 Score =   270 bits (689),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 136/182 (75%), Positives = 159/182 (87%), Gaps = 0/182 (0%)
 Frame = +1

Query  283  MLVAKSNYIRKLIMDSKEADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRC  462
            MLVAKSNYIRKLIM+S E  LTRI+LS IPGG  IFE+AAKFCYGVNFEITVHNVA LRC
Sbjct  1    MLVAKSNYIRKLIMESDETHLTRIDLSDIPGGSGIFEKAAKFCYGVNFEITVHNVAVLRC  60

Query  463  AAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLPLAEDLKIVQRCVE  642
            AAE+LQMTD+YCDNNLAGRT++FLS+VA  +L+G++ VLKSC  LLP A+DL IV+RCVE
Sbjct  61   AAEFLQMTDQYCDNNLAGRTDEFLSKVAFFTLTGSVAVLKSCHHLLPYADDLNIVKRCVE  120

Query  643  LASAKACVEANFPSRSPPNWWTEELTILDVAFFARIIATMRSRTAKPLTLASAIITYAER  822
             ASAKAC EANFPSRSP NWWTEEL +LD+ FF+R+IA M+ R AKP T+A+A+ITY+ER
Sbjct  121  AASAKACSEANFPSRSPANWWTEELAVLDIDFFSRVIACMKQRGAKPPTIAAALITYSER  180

Query  823  SL  828
            SL
Sbjct  181  SL  182



>ref|NP_001031446.1| Root phototropism protein 2 [Arabidopsis thaliana]
 ref|NP_001077982.1| Root phototropism protein 2 [Arabidopsis thaliana]
 dbj|BAD43060.1| unknown protein [Arabidopsis thaliana]
 gb|AEC08402.1| Root phototropism protein 2 [Arabidopsis thaliana]
 gb|AEC08403.1| Root phototropism protein 2 [Arabidopsis thaliana]
Length=545

 Score =   269 bits (688),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 141/182 (77%), Positives = 163/182 (90%), Gaps = 0/182 (0%)
 Frame = +1

Query  283  MLVAKSNYIRKLIMDSKEADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRC  462
            MLVAKSNYIRKLIM+SK++D+TRINLS IPGGPEIFE+AAKFCYGVNFEITV NVAAL C
Sbjct  1    MLVAKSNYIRKLIMESKDSDVTRINLSDIPGGPEIFEKAAKFCYGVNFEITVQNVAALHC  60

Query  463  AAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLPLAEDLKIVQRCVE  642
            AAE+LQMTDKYCDNNLAGRT+DFLSQVALSSLSGA+VVLKSCE LLP++ DL IV+RCV+
Sbjct  61   AAEFLQMTDKYCDNNLAGRTQDFLSQVALSSLSGAIVVLKSCEILLPISRDLGIVRRCVD  120

Query  643  LASAKACVEANFPSRSPPNWWTEELTILDVAFFARIIATMRSRTAKPLTLASAIITYAER  822
            +  AKAC EA FP R+PPNWWTEEL ILDV FF+ ++++M+ R  KP +LASAIITY E+
Sbjct  121  VVGAKACNEAMFPCRTPPNWWTEELCILDVDFFSDVVSSMKQRGVKPSSLASAIITYTEK  180

Query  823  SL  828
            SL
Sbjct  181  SL  182



>gb|AAB63085.1| unknown protein [Arabidopsis thaliana]
Length=185

 Score =   249 bits (635),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 131/160 (82%), Positives = 150/160 (94%), Gaps = 0/160 (0%)
 Frame = +1

Query  178  LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRIN  357
            +S ++ RTGQWVFSQ+IPTDV+VEVGEA+FSLHKFMLVAKSNYIRKLIM+SK++D+TRIN
Sbjct  14   MSSSLARTGQWVFSQDIPTDVVVEVGEANFSLHKFMLVAKSNYIRKLIMESKDSDVTRIN  73

Query  358  LSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFls  537
            LS IPGGPEIFE+AAKFCYGVNFEITV NVAAL CAAE+LQMTDKYCDNNLAGRT+DFLS
Sbjct  74   LSDIPGGPEIFEKAAKFCYGVNFEITVQNVAALHCAAEFLQMTDKYCDNNLAGRTQDFLS  133

Query  538  qvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAK  657
            QVALSSLSGA+VVLKSCE LLP++ DL IV+RCV++  AK
Sbjct  134  QVALSSLSGAIVVLKSCEILLPISRDLGIVRRCVDVVGAK  173



>ref|XP_002533880.1| Root phototropism protein, putative [Ricinus communis]
 gb|EEF28503.1| Root phototropism protein, putative [Ricinus communis]
Length=549

 Score =   258 bits (660),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 135/165 (82%), Positives = 149/165 (90%), Gaps = 0/165 (0%)
 Frame = +1

Query  334  EADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLA  513
            E DLTRINLSGIPGGPE+FE+AAKFCYGVNFEITV NVAALRCAAEYLQMTD YCDNNLA
Sbjct  38   ETDLTRINLSGIPGGPEMFEKAAKFCYGVNFEITVQNVAALRCAAEYLQMTDLYCDNNLA  97

Query  514  GRTEDFlsqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVEANFPSRSP  693
            GRT+DFL QVALSSLSGA+VVLKSCE+LLP+AEDLKIVQRCV + S KAC EANFPSRSP
Sbjct  98   GRTDDFLGQVALSSLSGAVVVLKSCEDLLPMAEDLKIVQRCVNVISIKACNEANFPSRSP  157

Query  694  PNWWTEELTILDVAFFARIIATMRSRTAKPLTLASAIITYAERSL  828
            PNWWTEEL+ILD+ F  +II+ M+ R AK LTLASA+ITY ER+L
Sbjct  158  PNWWTEELSILDIEFVGKIISAMKQRGAKALTLASAVITYTERNL  202



>ref|XP_009402205.1| PREDICTED: root phototropism protein 2 isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=581

 Score =   254 bits (649),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 127/221 (57%), Positives = 172/221 (78%), Gaps = 1/221 (0%)
 Frame = +1

Query  169  ATRLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLT  348
            ++RL  AME+T QWV SQ+IP+D+IV+VG+ +F LHKFMLVA S YIR+ +M+S+ A+L 
Sbjct  7    SSRLCAAMEKTSQWVLSQDIPSDIIVQVGDDTFRLHKFMLVANSGYIRRKVMESERANLG  66

Query  349  RINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTED  528
             I+LS +PGG E+FE+AAKFCYG+NFEI+VHNV ALRCAAEYLQMT+ Y   NLA R E+
Sbjct  67   CIDLSDVPGGAEVFEKAAKFCYGMNFEISVHNVTALRCAAEYLQMTEDYSRGNLAERAEE  126

Query  529  FlsqvalsslsgalvvlksCE-ELLPLAEDLKIVQRCVELASAKACVEANFPSRSPPNWW  705
            F++Q A+ +L GA+ +L+SCE  LLP+AE+++IVQR V+  S KA  EAN P+RSPP+WW
Sbjct  127  FINQAAVKTLPGAVALLRSCEGSLLPMAEEVRIVQRSVDAISLKAFNEANIPTRSPPDWW  186

Query  706  TEELTILDVAFFARIIATMRSRTAKPLTLASAIITYAERSL  828
              EL  L  A   +I++ M+SR   P +LA+A++ YAE+SL
Sbjct  187  AGELAALAPASLQKILSAMKSRGVAPKSLAAAVVVYAEKSL  227



>ref|XP_009384759.1| PREDICTED: root phototropism protein 2-like isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=582

 Score =   251 bits (641),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 126/218 (58%), Positives = 168/218 (77%), Gaps = 1/218 (0%)
 Frame = +1

Query  169  ATRLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLT  348
            ++RLS AME T  W FSQ+IP+D++V++G+A+F LHKF+L AKS YIR+ +M+S+ A+L+
Sbjct  10   SSRLSAAMETTSHWDFSQDIPSDIVVQIGDATFQLHKFVLAAKSGYIRRKVMESESANLS  69

Query  349  RINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTED  528
             I+LS +  G E+FER AKFCYGVNFEI+V NVAALRCAAEYLQMT++YC  NLA RTE+
Sbjct  70   CIDLSDLSIGAEVFERVAKFCYGVNFEISVRNVAALRCAAEYLQMTEEYCRGNLAARTEE  129

Query  529  FlsqvalsslsgalvvlksCEE-LLPLAEDLKIVQRCVELASAKACVEANFPSRSPPNWW  705
            F++Q A+ +L GA+ +L+SCE  LLP+AE L++VQR V+  S KAC E N P+RSPPNWW
Sbjct  130  FINQAAVKTLPGAVALLRSCEGPLLPMAESLRVVQRSVDAISLKACKELNRPTRSPPNWW  189

Query  706  TEELTILDVAFFARIIATMRSRTAKPLTLASAIITYAE  819
              EL +L       I+  M+SR A P +LA+AI+ YAE
Sbjct  190  AGELAVLSPTSLQMILIAMKSRGADPKSLAAAIVVYAE  227



>ref|XP_008803009.1| PREDICTED: root phototropism protein 2 [Phoenix dactylifera]
Length=583

 Score =   251 bits (641),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 134/215 (62%), Positives = 169/215 (79%), Gaps = 1/215 (0%)
 Frame = +1

Query  187  AMERTGQWVFS-QEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLS  363
            A ERTGQWV S Q+IPTD+I+ VG+ SF LHKFMLVAKS YIR+ IMDS   ++ RI+LS
Sbjct  13   ATERTGQWVPSDQDIPTDIIIHVGDVSFPLHKFMLVAKSGYIRRKIMDSDRTNVARIDLS  72

Query  364  GIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqv  543
             +PGG E FE+AAKFCYGVNFEI+V+NV ALRCAAEYL+MT+KYC+ NL GRTE+FL+Q 
Sbjct  73   EVPGGVEAFEKAAKFCYGVNFEISVYNVVALRCAAEYLEMTEKYCEGNLEGRTEEFLAQA  132

Query  544  alsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVEANFPSRSPPNWWTEELTI  723
            AL +L GA++VL+SCEELLP+A +++I +RC +  S KAC EANFP+R PP WW  EL  
Sbjct  133  ALKTLPGAVIVLRSCEELLPMAGEIQIAKRCFDAISLKACNEANFPTRCPPEWWAAELAA  192

Query  724  LDVAFFARIIATMRSRTAKPLTLASAIITYAERSL  828
            L  +   +I++ MRSR A   TLA+A+  YAER+L
Sbjct  193  LSPSSLQKILSAMRSRGASTKTLAAAVAAYAERNL  227



>gb|KEH28209.1| root phototropism-like protein [Medicago truncatula]
Length=536

 Score =   248 bits (634),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 129/182 (71%), Positives = 155/182 (85%), Gaps = 0/182 (0%)
 Frame = +1

Query  283  MLVAKSNYIRKLIMDSKEADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRC  462
            MLVAKSNYIRKLIM+S E++LTR++LS IPGG E FE+AAKFCYGVNFEITV+NVA+L C
Sbjct  1    MLVAKSNYIRKLIMESNESELTRLDLSDIPGGQEAFEKAAKFCYGVNFEITVNNVASLHC  60

Query  463  AAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLPLAEDLKIVQRCVE  642
            AA +LQMTD+YCD NLAGRTE FLSQVAL++LSGA VVLKSC +L+P+A++L IV+RCV+
Sbjct  61   AAMFLQMTDEYCDGNLAGRTEGFLSQVALTTLSGAAVVLKSCRQLIPVADELNIVKRCVD  120

Query  643  LASAKACVEANFPSRSPPNWWTEELTILDVAFFARIIATMRSRTAKPLTLASAIITYAER  822
              S+K C EANFPSRSPPNWWTEEL +LDV  F ++I  M+ R AK LTLA A+I Y ER
Sbjct  121  AVSSKVCNEANFPSRSPPNWWTEELAVLDVESFGKVITAMKQRGAKYLTLAGALIAYTER  180

Query  823  SL  828
            +L
Sbjct  181  TL  182



>ref|XP_010922790.1| PREDICTED: root phototropism protein 2 [Elaeis guineensis]
Length=577

 Score =   249 bits (636),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 138/224 (62%), Positives = 179/224 (80%), Gaps = 3/224 (1%)
 Frame = +1

Query  157  LKSAATRLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKE  336
            L S+++RL  AMERTGQW+ SQ+I TD+I+++G+ SF LHKF+LVAKS YIR+ IMDS  
Sbjct  3    LSSSSSRLPSAMERTGQWILSQDIQTDIIIDIGDVSFPLHKFILVAKSGYIRRKIMDS--  60

Query  337  ADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAG  516
             D  RINLS +PGG E FE+AAKFCYGVNFEI+VHNV  LRCAAEYL+MT++YC+ NLAG
Sbjct  61   -DDGRINLSEVPGGVEAFEKAAKFCYGVNFEISVHNVVVLRCAAEYLEMTERYCEGNLAG  119

Query  517  RTEDFlsqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVEANFPSRSPP  696
            RTE+FL+Q AL +L GA+++L+SCE+LLP+AE+L+IV+RCV+  S+KAC EANFP+R PP
Sbjct  120  RTEEFLAQAALKTLPGAVILLQSCEDLLPMAEELQIVKRCVDTISSKACNEANFPTRIPP  179

Query  697  NWWTEELTILDVAFFARIIATMRSRTAKPLTLASAIITYAERSL  828
             WW  EL  L  A   +I++ MR R A P +LA+ +  YAER+L
Sbjct  180  EWWAAELAALSPASLQKILSAMRFRAASPKSLATVVAAYAERNL  223



>ref|XP_003600551.1| Root phototropism protein [Medicago truncatula]
Length=513

 Score =   244 bits (624),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 123/169 (73%), Positives = 146/169 (86%), Gaps = 0/169 (0%)
 Frame = +1

Query  322  MDSKEADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCD  501
            M+S E  LTRI+LS IPGG  IFE+AAKFCYGVNFEITVHNVA LRCAAE+LQMTD+YCD
Sbjct  1    MESDETHLTRIDLSDIPGGSGIFEKAAKFCYGVNFEITVHNVAVLRCAAEFLQMTDQYCD  60

Query  502  NNLAGRTEDFlsqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVEANFP  681
            NNLAGRT++FLS+VA  +L+G++ VLKSC  LLP A+DL IV+RCVE ASAKAC EANFP
Sbjct  61   NNLAGRTDEFLSKVAFFTLTGSVAVLKSCHHLLPYADDLNIVKRCVEAASAKACSEANFP  120

Query  682  SRSPPNWWTEELTILDVAFFARIIATMRSRTAKPLTLASAIITYAERSL  828
            SRSP NWWTEEL +LD+ FF+R+IA M+ R AKP T+A+A+ITY+ERSL
Sbjct  121  SRSPANWWTEELAVLDIDFFSRVIACMKQRGAKPPTIAAALITYSERSL  169



>gb|KHN18647.1| Root phototropism protein 2 [Glycine soja]
Length=312

 Score =   222 bits (566),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 104/129 (81%), Positives = 114/129 (88%), Gaps = 4/129 (3%)
 Frame = +1

Query  145  MASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIM  324
            MA+P      RLSLAMERTGQWVFSQ+IPTDVIVEVGE  FSLHKFMLVAKSNYIRKLI+
Sbjct  1    MATP----NNRLSLAMERTGQWVFSQDIPTDVIVEVGETIFSLHKFMLVAKSNYIRKLIL  56

Query  325  DSKEADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDN  504
            +S E +LTRI LS IPGGP IFE+ AKFCYGVNFEITVHNVA LRCAAE+LQMTD+YC+N
Sbjct  57   ESNEGELTRIYLSDIPGGPSIFEKTAKFCYGVNFEITVHNVAVLRCAAEFLQMTDQYCEN  116

Query  505  NLAGRTEDF  531
            NLAGRTE+F
Sbjct  117  NLAGRTEEF  125



>ref|XP_002978505.1| hypothetical protein SELMODRAFT_443843 [Selaginella moellendorffii]
 gb|EFJ20491.1| hypothetical protein SELMODRAFT_443843 [Selaginella moellendorffii]
Length=615

 Score =   223 bits (569),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 118/235 (50%), Positives = 159/235 (68%), Gaps = 18/235 (8%)
 Frame = +1

Query  178  LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIM-DSKEADLTRI  354
            +S A +RT +WV S ++PTDV+VE G  SF+LHKF LV++S  IRKL+  DS+E D++ I
Sbjct  18   VSSAAKRTAEWVMSTDVPTDVLVEAGGVSFALHKFPLVSRSGKIRKLVAGDSRELDVSFI  77

Query  355  NLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFl  534
             LS +PGGPE FE AAKFCYG+NFEI+V NVA LRCAAEYL MT+ Y D NL  RTE F+
Sbjct  78   KLSDLPGGPEAFELAAKFCYGINFEISVTNVATLRCAAEYLDMTEDYGDGNLVARTEAFI  137

Query  535  sqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVEA--------------  672
             ++A  +LS A+ VL SCE LLPLAE+LKIV RCV+ A+ + C E               
Sbjct  138  DEIATQNLSNAVAVLHSCESLLPLAEELKIVNRCVDAAATEVCREQLSSLSSHTDFSNSE  197

Query  673  ---NFPSRSPPNWWTEELTILDVAFFARIIATMRSRTAKPLTLASAIITYAERSL  828
               +   + P +WW E+L+IL + F+ R++A M SR  +  T+ +A++ YA R+L
Sbjct  198  RMESLQPKGPVDWWAEDLSILRIDFYQRVLAAMMSRGLRHETIGAALMHYAHRAL  252



>ref|XP_002970426.1| hypothetical protein SELMODRAFT_231529 [Selaginella moellendorffii]
 gb|EFJ28556.1| hypothetical protein SELMODRAFT_231529 [Selaginella moellendorffii]
Length=603

 Score =   223 bits (568),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 118/235 (50%), Positives = 158/235 (67%), Gaps = 18/235 (8%)
 Frame = +1

Query  178  LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIM-DSKEADLTRI  354
            +S A +RT +WV S ++PTDV+VE G  SF+LHKF LV++S  IRKL+  DS+E D++ I
Sbjct  6    VSSAAKRTAEWVMSTDVPTDVLVEAGGVSFALHKFPLVSRSGKIRKLVAGDSRELDVSFI  65

Query  355  NLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFl  534
             LS +PGGPE FE AAKFCYG+NFEI+V NVA LRCAAEYL MT+ Y D NL  RTE F+
Sbjct  66   KLSDLPGGPEAFELAAKFCYGINFEISVTNVATLRCAAEYLDMTEDYGDGNLVARTEAFI  125

Query  535  sqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVEA--------------  672
             ++A  +LS A+ VL SCE LLPLAE+LKIV RCV+ A+ + C E               
Sbjct  126  DEIATQNLSNAVAVLHSCESLLPLAEELKIVNRCVDAAATEVCREQLSSLSSHTDFSNSE  185

Query  673  ---NFPSRSPPNWWTEELTILDVAFFARIIATMRSRTAKPLTLASAIITYAERSL  828
                   + P +WW E+L+IL + F+ R++A M SR  +  T+ +A++ YA R+L
Sbjct  186  RMETLQPKGPVDWWAEDLSILRIDFYQRVLAAMMSRGLRHETIGAALMHYAHRAL  240



>gb|KGN61975.1| hypothetical protein Csa_2G277660 [Cucumis sativus]
Length=299

 Score =   214 bits (545),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 117/247 (47%), Positives = 163/247 (66%), Gaps = 18/247 (7%)
 Frame = +1

Query  142  NMASPLKSAATR--LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRK  315
             ++S L  +A +  LS AM+RT +W+FSQEIP+DV V VGEASFSLHKF LV+K  +IRK
Sbjct  10   QLSSSLNMSAKKELLSTAMKRTSEWIFSQEIPSDVTVHVGEASFSLHKFPLVSKCGHIRK  69

Query  316  LIMDSKEADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKY  495
            L+ +S +ADL  + L   PGG E FE AA FCYG+NFEI   N+A LRCAAEYL+MT++Y
Sbjct  70   LVSESTDADLATVELPNCPGGAEAFELAAMFCYGINFEIGTENIAMLRCAAEYLEMTEEY  129

Query  496  CDNNLAGRTEDFlsqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVEAN  675
               NL GRTE ++++VAL SL+GA+ VL   + LLP AE +K+V RC++  +  AC +++
Sbjct  130  AVGNLVGRTEAYINEVALKSLAGAVSVLHMSQSLLPTAEKVKLVSRCIDAIAFVACKDSH  189

Query  676  F----------------PSRSPPNWWTEELTILDVAFFARIIATMRSRTAKPLTLASAII  807
            F                PS+   +WW E+LT+L +  F R++  M SR  K  +L   ++
Sbjct  190  FSMLGRASDIGHHNKGLPSKPIVDWWAEDLTVLRIDIFQRVLVAMMSRGYKHYSLGPVLM  249

Query  808  TYAERSL  828
             YA++SL
Sbjct  250  LYAQKSL  256



>emb|CBI33715.3| unnamed protein product [Vitis vinifera]
Length=529

 Score =   214 bits (545),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 111/217 (51%), Positives = 151/217 (70%), Gaps = 3/217 (1%)
 Frame = +1

Query  178  LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRIN  357
            LS AM+RT +W+FSQEIP+DV V  GE SFSLHKF LV+K  YIRKL+ +S +ADL+ I 
Sbjct  9    LSTAMKRTSEWIFSQEIPSDVTVHAGEVSFSLHKFPLVSKCGYIRKLVSESSDADLSVIE  68

Query  358  LSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFls  537
            +  +PGG E FE AAKFCYG+NFEI+  N+A LRC AEYL+MT+ Y   NL GR E +L+
Sbjct  69   VHDVPGGAEAFELAAKFCYGINFEISTENIAMLRCVAEYLEMTEDYSVGNLVGRAEAYLN  128

Query  538  qvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVEANFPSRSPPNWWTEEL  717
            +VAL SL+GA+ +L   E LLP+AE +K+V RC++  +  AC E+ F   S  +WW E+L
Sbjct  129  EVALKSLAGAVTILHLSEALLPMAEKVKVVSRCIDAIAYIACKESQF---SMSDWWAEDL  185

Query  718  TILDVAFFARIIATMRSRTAKPLTLASAIITYAERSL  828
             +L +  F R++  M +R  K   L   ++ YA++SL
Sbjct  186  IVLRIDIFQRVLIAMMARGFKQYALGPILMLYAQKSL  222



>gb|EYU44474.1| hypothetical protein MIMGU_mgv1a027075mg [Erythranthe guttata]
Length=577

 Score =   213 bits (543),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 115/229 (50%), Positives = 156/229 (68%), Gaps = 12/229 (5%)
 Frame = +1

Query  178  LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRIN  357
            LS AM+RT +W+FSQEIP+DV V  G  SFSLHKF LV+K  YIRKL+ +S +ADL  + 
Sbjct  9    LSTAMKRTSEWIFSQEIPSDVTVNAGGTSFSLHKFPLVSKCGYIRKLVTESTDADLAVVE  68

Query  358  LSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFls  537
            +   PGGPE FE AA FCYG+NFEIT  N+A LRCAAEYL+MT++Y   NL GRTE +++
Sbjct  69   IPDFPGGPEGFELAANFCYGINFEITTENIATLRCAAEYLEMTEEYSVGNLVGRTESYVN  128

Query  538  qvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVEANF--PSR--------  687
            +VAL SL+GA+ +L S E LLP+AE +K+V RC++  +  AC ++ F  P R        
Sbjct  129  EVALKSLAGAVSILHSAENLLPIAEKVKLVSRCIDAIALVACKDSQFAAPVRAGGTGLND  188

Query  688  SPP--NWWTEELTILDVAFFARIIATMRSRTAKPLTLASAIITYAERSL  828
            S P  +WW E+LT+L +  F R++  M +R  K   L   ++ YA++SL
Sbjct  189  SKPVVDWWAEDLTVLRIDLFQRVLIAMMARGFKQYALGPILMLYAQKSL  237



>ref|XP_011649319.1| PREDICTED: BTB/POZ domain-containing protein At5g67385 isoform 
X1 [Cucumis sativus]
Length=621

 Score =   214 bits (545),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 117/247 (47%), Positives = 163/247 (66%), Gaps = 18/247 (7%)
 Frame = +1

Query  142  NMASPLKSAATR--LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRK  315
             ++S L  +A +  LS AM+RT +W+FSQEIP+DV V VGEASFSLHKF LV+K  +IRK
Sbjct  10   QLSSSLNMSAKKELLSTAMKRTSEWIFSQEIPSDVTVHVGEASFSLHKFPLVSKCGHIRK  69

Query  316  LIMDSKEADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKY  495
            L+ +S +ADL  + L   PGG E FE AA FCYG+NFEI   N+A LRCAAEYL+MT++Y
Sbjct  70   LVSESTDADLATVELPNCPGGAEAFELAAMFCYGINFEIGTENIAMLRCAAEYLEMTEEY  129

Query  496  CDNNLAGRTEDFlsqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVEAN  675
               NL GRTE ++++VAL SL+GA+ VL   + LLP AE +K+V RC++  +  AC +++
Sbjct  130  AVGNLVGRTEAYINEVALKSLAGAVSVLHMSQSLLPTAEKVKLVSRCIDAIAFVACKDSH  189

Query  676  F----------------PSRSPPNWWTEELTILDVAFFARIIATMRSRTAKPLTLASAII  807
            F                PS+   +WW E+LT+L +  F R++  M SR  K  +L   ++
Sbjct  190  FSMLGRASDIGHHNKGLPSKPIVDWWAEDLTVLRIDIFQRVLVAMMSRGYKHYSLGPVLM  249

Query  808  TYAERSL  828
             YA++SL
Sbjct  250  LYAQKSL  256



>ref|XP_011649320.1| PREDICTED: BTB/POZ domain-containing protein At5g67385 isoform 
X2 [Cucumis sativus]
Length=620

 Score =   214 bits (545),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 117/247 (47%), Positives = 163/247 (66%), Gaps = 18/247 (7%)
 Frame = +1

Query  142  NMASPLKSAATR--LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRK  315
             ++S L  +A +  LS AM+RT +W+FSQEIP+DV V VGEASFSLHKF LV+K  +IRK
Sbjct  10   QLSSSLNMSAKKELLSTAMKRTSEWIFSQEIPSDVTVHVGEASFSLHKFPLVSKCGHIRK  69

Query  316  LIMDSKEADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKY  495
            L+ +S +ADL  + L   PGG E FE AA FCYG+NFEI   N+A LRCAAEYL+MT++Y
Sbjct  70   LVSESTDADLATVELPNCPGGAEAFELAAMFCYGINFEIGTENIAMLRCAAEYLEMTEEY  129

Query  496  CDNNLAGRTEDFlsqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVEAN  675
               NL GRTE ++++VAL SL+GA+ VL   + LLP AE +K+V RC++  +  AC +++
Sbjct  130  AVGNLVGRTEAYINEVALKSLAGAVSVLHMSQSLLPTAEKVKLVSRCIDAIAFVACKDSH  189

Query  676  F----------------PSRSPPNWWTEELTILDVAFFARIIATMRSRTAKPLTLASAII  807
            F                PS+   +WW E+LT+L +  F R++  M SR  K  +L   ++
Sbjct  190  FSMLGRASDIGHHNKGLPSKPIVDWWAEDLTVLRIDIFQRVLVAMMSRGYKHYSLGPVLM  249

Query  808  TYAERSL  828
             YA++SL
Sbjct  250  LYAQKSL  256



>ref|XP_008457767.1| PREDICTED: BTB/POZ domain-containing protein At5g67385 isoform 
X2 [Cucumis melo]
Length=620

 Score =   213 bits (543),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 115/241 (48%), Positives = 158/241 (66%), Gaps = 17/241 (7%)
 Frame = +1

Query  157  LKSAATRLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKE  336
            + S    LS AM+RT +W+FSQEIP+DV V VGEASFSLHKF LV+K  +IRKL+ +S +
Sbjct  14   MSSKKELLSTAMKRTSEWIFSQEIPSDVTVHVGEASFSLHKFPLVSKCGHIRKLVSESTD  73

Query  337  ADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAG  516
            ADL  + L   PGG E FE AA FCYG+NFEI   N+A LRCAAEYL+MT++Y   NL G
Sbjct  74   ADLATVELPNCPGGAEAFELAAMFCYGINFEIGTENIAMLRCAAEYLEMTEEYAVGNLVG  133

Query  517  RTEDFlsqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVEANF------  678
            RTE ++++VAL SL+GA+ VL   + LLP AE +K+V RC++  +  AC +++F      
Sbjct  134  RTEAYINEVALKSLAGAVSVLHMSQSLLPTAEKVKLVSRCIDAIAFVACKDSHFSMLGRA  193

Query  679  -----------PSRSPPNWWTEELTILDVAFFARIIATMRSRTAKPLTLASAIITYAERS  825
                       PS+   +WW E+LT+L +  F R++  M SR  K  +L   ++ YA++S
Sbjct  194  SDHIGHHNKGLPSKPIVDWWAEDLTVLRIDIFQRVLVAMMSRGYKHYSLGPVLMLYAQKS  253

Query  826  L  828
            L
Sbjct  254  L  254



>ref|XP_008457766.1| PREDICTED: BTB/POZ domain-containing protein At5g67385 isoform 
X1 [Cucumis melo]
Length=621

 Score =   213 bits (542),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 115/241 (48%), Positives = 158/241 (66%), Gaps = 17/241 (7%)
 Frame = +1

Query  157  LKSAATRLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKE  336
            + S    LS AM+RT +W+FSQEIP+DV V VGEASFSLHKF LV+K  +IRKL+ +S +
Sbjct  14   MSSKKELLSTAMKRTSEWIFSQEIPSDVTVHVGEASFSLHKFPLVSKCGHIRKLVSESTD  73

Query  337  ADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAG  516
            ADL  + L   PGG E FE AA FCYG+NFEI   N+A LRCAAEYL+MT++Y   NL G
Sbjct  74   ADLATVELPNCPGGAEAFELAAMFCYGINFEIGTENIAMLRCAAEYLEMTEEYAVGNLVG  133

Query  517  RTEDFlsqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVEANF------  678
            RTE ++++VAL SL+GA+ VL   + LLP AE +K+V RC++  +  AC +++F      
Sbjct  134  RTEAYINEVALKSLAGAVSVLHMSQSLLPTAEKVKLVSRCIDAIAFVACKDSHFSMLGRA  193

Query  679  -----------PSRSPPNWWTEELTILDVAFFARIIATMRSRTAKPLTLASAIITYAERS  825
                       PS+   +WW E+LT+L +  F R++  M SR  K  +L   ++ YA++S
Sbjct  194  SDHIGHHNKGLPSKPIVDWWAEDLTVLRIDIFQRVLVAMMSRGYKHYSLGPVLMLYAQKS  253

Query  826  L  828
            L
Sbjct  254  L  254



>gb|KHG27515.1| hypothetical protein F383_13864 [Gossypium arboreum]
Length=471

 Score =   209 bits (531),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 112/243 (46%), Positives = 159/243 (65%), Gaps = 19/243 (8%)
 Frame = +1

Query  157  LKSAATRLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKE  336
            + S    LS AM+RT +W+FSQEIP+DV V+VG  SFSLHKF L++KS Y+RK++ +S +
Sbjct  16   MSSKKELLSTAMKRTSEWIFSQEIPSDVTVQVGGVSFSLHKFPLISKSGYVRKVVTESND  75

Query  337  ADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAG  516
            AD + I +  +PGG + FE AAKFCYG+NFEI+  N+A LRCAAEYL+MT+ Y   NL G
Sbjct  76   ADHSIIEIPNVPGGADSFELAAKFCYGINFEISSENIAMLRCAAEYLEMTEDYAVGNLVG  135

Query  517  RTEDFlsqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVEANF------  678
            RTE +L++VAL SL+GA+ VL   E LLP+AE++K+V RC++  +  AC E+ F      
Sbjct  136  RTEAYLNEVALKSLAGAVSVLHMSESLLPIAEEVKLVSRCIDAIAYLACKESQFYMSSRS  195

Query  679  -------------PSRSPPNWWTEELTILDVAFFARIIATMRSRTAKPLTLASAIITYAE  819
                          SRS  +WW E+L +L +  F R++  M +R  K   L   ++ YA+
Sbjct  196  DSGNDGTISLTTTNSRSIVDWWAEDLAVLRIDIFQRVLIAMVARGFKQYDLGPVLMLYAQ  255

Query  820  RSL  828
            ++L
Sbjct  256  KAL  258



>ref|XP_002989054.1| hypothetical protein SELMODRAFT_272040 [Selaginella moellendorffii]
 gb|EFJ09848.1| hypothetical protein SELMODRAFT_272040 [Selaginella moellendorffii]
Length=607

 Score =   211 bits (538),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 109/228 (48%), Positives = 156/228 (68%), Gaps = 10/228 (4%)
 Frame = +1

Query  175  RLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRI  354
            R S +M RT  WV S ++PTD+ V++   SF+LHKF LV++S  +RKL+ +++++DL+R+
Sbjct  11   RNSFSMRRTNDWVMSTDVPTDITVDICGTSFALHKFPLVSRSGRLRKLVAEARDSDLSRV  70

Query  355  NLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFl  534
              + IPGGPE FE AAKFCYG+NFEIT  NVA LRC AEYL+MTD +   NLA R+E F+
Sbjct  71   EFNDIPGGPEGFEMAAKFCYGINFEITASNVAILRCVAEYLEMTDDFGQANLASRSEAFI  130

Query  535  sqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVEA-NFPSR-------S  690
              V + S   ++ VL SCE+LLP+AE L IV RCV+ A AKA  EA +  +R       +
Sbjct  131  EDVVMHSFGSSITVLHSCEKLLPMAEQLNIVNRCVQAAGAKASHEALSLAARPEYRNAKT  190

Query  691  PP--NWWTEELTILDVAFFARIIATMRSRTAKPLTLASAIITYAERSL  828
            PP  +WW E+L+IL + F+ R++A MRS+      L  +++ YA+++L
Sbjct  191  PPQLDWWAEDLSILSLDFYQRVLAVMRSQGMPQENLWGSLMHYAQQAL  238



>ref|XP_007156731.1| hypothetical protein PHAVU_002G012500g [Phaseolus vulgaris]
 ref|XP_007156732.1| hypothetical protein PHAVU_002G012500g [Phaseolus vulgaris]
 gb|ESW28725.1| hypothetical protein PHAVU_002G012500g [Phaseolus vulgaris]
 gb|ESW28726.1| hypothetical protein PHAVU_002G012500g [Phaseolus vulgaris]
Length=617

 Score =   211 bits (538),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 114/236 (48%), Positives = 156/236 (66%), Gaps = 19/236 (8%)
 Frame = +1

Query  178  LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRIN  357
            LS AM+RT +W+FSQEIP+DV V+VGE SFSLHKF LV+K  YIRKL+ +S +AD++ I 
Sbjct  23   LSSAMKRTSEWIFSQEIPSDVNVQVGEDSFSLHKFPLVSKCGYIRKLVSESNDADVSSIE  82

Query  358  LSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFls  537
            LS +PGG E FE AAKFCYG+NFEI V N+A LRC AEYL+MT+ Y   NL GRT+ +L+
Sbjct  83   LSDVPGGAEAFELAAKFCYGINFEINVENIATLRCVAEYLEMTEDYSVGNLVGRTDAYLN  142

Query  538  qvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVEANF-------------  678
            +VAL +++GA+ VL   E LLP+AE  K+V RC++  +  AC E+ F             
Sbjct  143  EVALKTIAGAVSVLHMSETLLPIAERTKLVSRCIDAIAYIACKESQFCSSARSDSGSAGV  202

Query  679  ----PSRSPP--NWWTEELTILDVAFFARIIATMRSRTAKPLTLASAIITYAERSL  828
                 S   P  +WW E++T+L +  F R+I  M +R  K   +   ++ YA++SL
Sbjct  203  VSSVASNQKPIVDWWAEDMTVLRIDIFQRVIIAMMARGFKQYAIGPILMLYAQKSL  258



>ref|XP_002983725.1| hypothetical protein SELMODRAFT_228979 [Selaginella moellendorffii]
 gb|EFJ15221.1| hypothetical protein SELMODRAFT_228979 [Selaginella moellendorffii]
Length=604

 Score =   211 bits (537),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 109/228 (48%), Positives = 154/228 (68%), Gaps = 10/228 (4%)
 Frame = +1

Query  175  RLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRI  354
            R S +M RT  WV S ++PTD+ V++   SF+LHKF LV++S  +RKL+ +++++DL+R+
Sbjct  11   RNSFSMRRTNDWVMSTDVPTDITVDICGTSFALHKFPLVSRSGRLRKLVAEARDSDLSRV  70

Query  355  NLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFl  534
              + IPGGPE FE AAKFCYG+NFEIT  NVA LRC AEYL+MTD +   NLA R+E F+
Sbjct  71   EFNDIPGGPEGFEMAAKFCYGINFEITASNVAILRCVAEYLEMTDDFGQANLASRSEAFI  130

Query  535  sqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVEA-NFPSR-------S  690
              V   S   ++ VL SCE+LLP+AE L IV RCV+ A AKA  EA +  +R       +
Sbjct  131  EDVVTHSFGSSITVLHSCEKLLPMAEQLNIVNRCVQAAGAKASHEALSLAARPEYRNAKT  190

Query  691  PP--NWWTEELTILDVAFFARIIATMRSRTAKPLTLASAIITYAERSL  828
            PP  +WW E+L+IL + F+ R++A MRS       L  +++ YA+++L
Sbjct  191  PPQLDWWAEDLSILSLDFYQRVLAVMRSHGMPQENLWGSLMHYAQQAL  238



>ref|XP_003538794.2| PREDICTED: BTB/POZ domain-containing protein At5g67385-like isoform 
X1 [Glycine max]
Length=618

 Score =   210 bits (535),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 113/236 (48%), Positives = 156/236 (66%), Gaps = 19/236 (8%)
 Frame = +1

Query  178  LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRIN  357
            LS AM+RT +W+FSQEIP+DV V+VGEASFSLHKF LV+K  YIRKL+ +S +AD++ I 
Sbjct  24   LSSAMKRTSEWIFSQEIPSDVNVQVGEASFSLHKFPLVSKCGYIRKLVSESNDADVSFIE  83

Query  358  LSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFls  537
            L  +PGG E FE AAKFCYG+NF+I V N+A LRC AEYL+MT+ Y   NL GRT+ +L+
Sbjct  84   LPEVPGGAEAFELAAKFCYGINFDINVENIATLRCVAEYLEMTEDYSVGNLVGRTDAYLN  143

Query  538  qvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVEANFPS-----------  684
            +VAL +++GA+ +L   E LLP+AE  K+V RC++  +  AC E+ F S           
Sbjct  144  EVALKTIAGAVSILHMSENLLPIAERAKLVSRCIDAIAFIACKESQFCSSARSESGSVGV  203

Query  685  --------RSPPNWWTEELTILDVAFFARIIATMRSRTAKPLTLASAIITYAERSL  828
                    R   +WW E+LT+L +  F R+I  M +R  K   +   ++ YA++SL
Sbjct  204  VSSMASNQRPVVDWWAEDLTVLRIDIFQRVIIAMMARGFKQYAIGPILMLYAQKSL  259



>ref|XP_004511862.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like isoform 
X6 [Cicer arietinum]
Length=627

 Score =   210 bits (534),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 111/237 (47%), Positives = 156/237 (66%), Gaps = 20/237 (8%)
 Frame = +1

Query  178  LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRIN  357
            LS AM+RT +W+FSQEIP+DV V VGEASFS+HKF LV+K  YIRKL+ +S +AD+  I 
Sbjct  24   LSSAMKRTSEWIFSQEIPSDVKVRVGEASFSIHKFPLVSKCGYIRKLVSESGDADVPLIE  83

Query  358  LSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFls  537
            LS +PGG E FE AAKFCYG+NFEI V N+A LRC AEYL+MT++Y   NL GRT+ +L+
Sbjct  84   LSDVPGGAEAFELAAKFCYGINFEINVENIATLRCVAEYLEMTEEYAVGNLVGRTDAYLN  143

Query  538  qvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVEANF-------------  678
             VAL +++GA+ +L   E LLP+AE  K++ +C++  +  AC E+               
Sbjct  144  DVALKTIAGAVSILHMSESLLPIAEKAKLMSKCIDAIAYIACKESQLSTSGRSDNSGSDG  203

Query  679  -----PSRSPP--NWWTEELTILDVAFFARIIATMRSRTAKPLTLASAIITYAERSL  828
                 PS+  P  +WW E+LT+L +  F R++  M +R  K   +   ++ YA++SL
Sbjct  204  VASSIPSQQRPVVDWWAEDLTVLRIDIFQRVLIAMMARGFKQFAIGPILMLYAQKSL  260



>ref|XP_004511860.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like isoform 
X4 [Cicer arietinum]
 ref|XP_004511861.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like isoform 
X5 [Cicer arietinum]
Length=628

 Score =   210 bits (534),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 111/237 (47%), Positives = 156/237 (66%), Gaps = 20/237 (8%)
 Frame = +1

Query  178  LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRIN  357
            LS AM+RT +W+FSQEIP+DV V VGEASFS+HKF LV+K  YIRKL+ +S +AD+  I 
Sbjct  24   LSSAMKRTSEWIFSQEIPSDVKVRVGEASFSIHKFPLVSKCGYIRKLVSESGDADVPLIE  83

Query  358  LSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFls  537
            LS +PGG E FE AAKFCYG+NFEI V N+A LRC AEYL+MT++Y   NL GRT+ +L+
Sbjct  84   LSDVPGGAEAFELAAKFCYGINFEINVENIATLRCVAEYLEMTEEYAVGNLVGRTDAYLN  143

Query  538  qvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVEANF-------------  678
             VAL +++GA+ +L   E LLP+AE  K++ +C++  +  AC E+               
Sbjct  144  DVALKTIAGAVSILHMSESLLPIAEKAKLMSKCIDAIAYIACKESQLSTSGRSDNSGSDG  203

Query  679  -----PSRSPP--NWWTEELTILDVAFFARIIATMRSRTAKPLTLASAIITYAERSL  828
                 PS+  P  +WW E+LT+L +  F R++  M +R  K   +   ++ YA++SL
Sbjct  204  VASSIPSQQRPVVDWWAEDLTVLRIDIFQRVLIAMMARGFKQFAIGPILMLYAQKSL  260



>gb|KJB48680.1| hypothetical protein B456_008G080700 [Gossypium raimondii]
Length=447

 Score =   206 bits (523),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 110/243 (45%), Positives = 158/243 (65%), Gaps = 19/243 (8%)
 Frame = +1

Query  157  LKSAATRLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKE  336
            + S    LS AM+RT +W+FSQEIP+DV V+VG  SFSLHKF L++KS ++RK++ +S +
Sbjct  16   MSSKKELLSSAMKRTSEWIFSQEIPSDVTVQVGGVSFSLHKFPLISKSGFVRKVVSESND  75

Query  337  ADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAG  516
            AD + I +  +PGG + FE AAKFCYG+NFEI+  N+A LRCAAEYL+MT+ Y   NL G
Sbjct  76   ADHSIIEIPNVPGGADSFELAAKFCYGINFEISTENIAMLRCAAEYLEMTEDYAVGNLVG  135

Query  517  RTEDFlsqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVEANF------  678
            RTE +L++VAL SL+GA+ VL   E LLP+AE++K+V RC++  +  AC E+ F      
Sbjct  136  RTEAYLNEVALKSLAGAVSVLHMSESLLPIAEEVKLVSRCIDAIAYLACKESQFYMSSRS  195

Query  679  -------------PSRSPPNWWTEELTILDVAFFARIIATMRSRTAKPLTLASAIITYAE  819
                          SR   +WW E+L +L +  F R++  M +R  K   L   ++ YA+
Sbjct  196  DSGNDSTISLTTTNSRPIVDWWAEDLAVLRIDIFQRVLIAMVARGFKQYDLGPVLMLYAQ  255

Query  820  RSL  828
            ++L
Sbjct  256  KAL  258



>ref|XP_011006799.1| PREDICTED: BTB/POZ domain-containing protein At5g67385 isoform 
X1 [Populus euphratica]
Length=599

 Score =   208 bits (530),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 113/243 (47%), Positives = 156/243 (64%), Gaps = 19/243 (8%)
 Frame = +1

Query  157  LKSAATRLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKE  336
            + S    LS AM+RT +W+FSQEIP+DV V  G ASFSLHKF LV+K  YIRK++ +S +
Sbjct  1    MSSKKELLSTAMKRTSEWIFSQEIPSDVTVHAGGASFSLHKFPLVSKCGYIRKMVSESSD  60

Query  337  ADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAG  516
            ADL+ I +  +PGG E FE AAKFCYG+NFEI+  N+A LRC AEYL+MT+ Y   NL  
Sbjct  61   ADLSEIKIPNVPGGAEAFELAAKFCYGINFEISTENIAMLRCVAEYLEMTEDYAAGNLVS  120

Query  517  RTEDFlsqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVEANFP-----  681
            RT+ +L++VAL SL+GA+ VL   E LLP+AE +K+V RC++  +  AC E+ F      
Sbjct  121  RTDAYLNEVALKSLAGAVSVLHLSENLLPMAEKVKLVSRCIDAIALAACKESQFSMSGRS  180

Query  682  ------------SRSPP--NWWTEELTILDVAFFARIIATMRSRTAKPLTLASAIITYAE  819
                        S+  P  +WW E+LT+L +  F R++  M +R  K   L   ++ YA+
Sbjct  181  DSGNEVVISSIVSQPKPIVDWWAEDLTVLRIDIFQRVLIAMMARGFKQYALGPVLMLYAQ  240

Query  820  RSL  828
            +SL
Sbjct  241  KSL  243



>ref|XP_006380639.1| hypothetical protein POPTR_0007s10060g [Populus trichocarpa]
 gb|ERP58436.1| hypothetical protein POPTR_0007s10060g [Populus trichocarpa]
Length=601

 Score =   208 bits (529),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 112/235 (48%), Positives = 154/235 (66%), Gaps = 19/235 (8%)
 Frame = +1

Query  181  SLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINL  360
            S AM+RT +W+FSQEIP+DV V  G ASFSLHKF LV+KS YIRK++ +S +ADL+ I +
Sbjct  10   STAMKRTSEWIFSQEIPSDVTVHAGGASFSLHKFPLVSKSGYIRKMVSESSDADLSEIKI  69

Query  361  SGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsq  540
              +PGG E FE AAKFCYG+NFEI+  N+A LRC AEYL+MT+ Y   NL  RT+ +L++
Sbjct  70   PNVPGGAEAFELAAKFCYGINFEISTENIAMLRCVAEYLEMTEDYAVGNLVSRTDAYLNE  129

Query  541  valsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVEANFP-------------  681
            VAL SL+GA+ VL   E LLP+AE +K+V RC++  +  AC E+ F              
Sbjct  130  VALKSLAGAVSVLHLSENLLPMAEKVKLVSRCLDAIALAACKESQFSMSGRSDSGNEVVI  189

Query  682  ----SRSPP--NWWTEELTILDVAFFARIIATMRSRTAKPLTLASAIITYAERSL  828
                S+  P  +WW E+LT+L +  F R++  M +R  K   L   ++ YA++SL
Sbjct  190  SSIVSQPKPIVDWWAEDLTVLRIDIFQRVLIAMMARGFKQYALGPVLMLYAQKSL  244



>ref|XP_011012051.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like isoform 
X1 [Populus euphratica]
Length=599

 Score =   207 bits (528),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 113/243 (47%), Positives = 156/243 (64%), Gaps = 19/243 (8%)
 Frame = +1

Query  157  LKSAATRLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKE  336
            + S    LS AM+RT +W+FSQEIP+DV V  G ASFSLHKF LV+K  YIRK++ +S +
Sbjct  1    MSSKKELLSTAMKRTSEWIFSQEIPSDVTVHAGGASFSLHKFPLVSKCGYIRKMVSESSD  60

Query  337  ADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAG  516
            ADL+ I +  +PGG E FE AAKFCYG+NFEI+  N+A LRC AEYL+MT+ Y   NL  
Sbjct  61   ADLSEIKIPNVPGGAEAFELAAKFCYGINFEISTENIAMLRCVAEYLEMTEDYAVGNLVS  120

Query  517  RTEDFlsqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVEANFP-----  681
            RT+ +L++VAL SL+GA+ VL   E LLP+AE +K+V RC++  +  AC E+ F      
Sbjct  121  RTDAYLNEVALKSLAGAVSVLHLSENLLPMAEKVKLVSRCIDAIALAACKESQFSMSGRS  180

Query  682  ------------SRSPP--NWWTEELTILDVAFFARIIATMRSRTAKPLTLASAIITYAE  819
                        S+  P  +WW E+LT+L +  F R++  M +R  K   L   ++ YA+
Sbjct  181  DSGNEVVISSIVSQPKPIVDWWAEDLTVLRIDIFQRVLIAMMARGFKQYALGPVLMLYAQ  240

Query  820  RSL  828
            +SL
Sbjct  241  KSL  243



>ref|XP_006339816.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like [Solanum 
tuberosum]
Length=596

 Score =   207 bits (528),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 112/233 (48%), Positives = 157/233 (67%), Gaps = 16/233 (7%)
 Frame = +1

Query  178  LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRIN  357
            LS AM+RT  W+FSQEIP+DV V  G  SF+LHKF LV+KS YIRKL+ +S +AD++ IN
Sbjct  9    LSSAMKRTSDWIFSQEIPSDVTVNAGGTSFALHKFPLVSKSGYIRKLVSESNDADVSTIN  68

Query  358  LSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFls  537
            +  IPGG E FE AAKFCYG+NFEI+  N+A LRCAAEYL+MT+ Y   NL  RTE + +
Sbjct  69   IPDIPGGGEAFELAAKFCYGINFEISTENIALLRCAAEYLEMTEDYAVANLVERTEAYFN  128

Query  538  qvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVEANFPSR----------  687
            +VA+ SL+GA+ +L+S E LLP+AE +K+V RC++  +  AC +  F +           
Sbjct  129  EVAIKSLAGAVTILRSSENLLPIAEKVKLVSRCIDTIAYTACKDNQFSTSGRAEAGINGS  188

Query  688  --SPP----NWWTEELTILDVAFFARIIATMRSRTAKPLTLASAIITYAERSL  828
              S P    +WW+E++T+L + FF R++  M +R  K   L   ++ YA++SL
Sbjct  189  TFSNPKPIVDWWSEDITVLRIDFFQRVLIAMMARGFKRYALGPILMLYAQKSL  241



>gb|KDO78973.1| hypothetical protein CISIN_1g006971mg [Citrus sinensis]
Length=457

 Score =   204 bits (520),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 112/236 (47%), Positives = 151/236 (64%), Gaps = 19/236 (8%)
 Frame = +1

Query  178  LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRIN  357
            LS AM+RT +W+FSQEIP+DV V VG  SFSLHKF LV+K  YIRKL+  S EADL+ I 
Sbjct  24   LSTAMKRTSEWIFSQEIPSDVTVHVGGTSFSLHKFPLVSKCGYIRKLVSVSSEADLSVIE  83

Query  358  LSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFls  537
            +  +PGG E FE AAKFCYG+NFEI   NVA LRC AEYL+MT+ Y   NL GR E +L+
Sbjct  84   IPDVPGGAEAFELAAKFCYGINFEINTENVAGLRCVAEYLEMTEDYAVGNLVGRAEAYLN  143

Query  538  qvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVEANFPS-----------  684
            +VAL+SL+GA+ VL   + LLP+AE +K+V +C++  +  AC E  F             
Sbjct  144  EVALTSLTGAVTVLHKSQGLLPIAEKVKLVGQCIDAIAYIACKENQFSGSGRAESGTDNA  203

Query  685  --------RSPPNWWTEELTILDVAFFARIIATMRSRTAKPLTLASAIITYAERSL  828
                    ++  +WW E+LT+L +  F R++  M +R  K   L   ++ YA++SL
Sbjct  204  ISDMVSHPKTIVDWWAEDLTVLRIDVFQRVLIAMMARGFKQYALGPVLMLYAQKSL  259



>ref|XP_009628088.1| PREDICTED: BTB/POZ domain-containing protein At5g67385 [Nicotiana 
tomentosiformis]
Length=620

 Score =   207 bits (528),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 112/236 (47%), Positives = 155/236 (66%), Gaps = 19/236 (8%)
 Frame = +1

Query  178  LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRIN  357
            LS AM+RT  W+FSQEIP+DV V  G ++FSLHKF LV+KS YIRK+I +S +AD++ + 
Sbjct  26   LSTAMKRTSDWIFSQEIPSDVTVNAGGSAFSLHKFPLVSKSGYIRKIISESNDADVSTVE  85

Query  358  LSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFls  537
            +  IPGG + FE AAKFCYG+NFEI+  N+A LRC AEYL+MT+ Y   NL GRTE +L+
Sbjct  86   IPDIPGGSDAFELAAKFCYGINFEISTENIALLRCTAEYLEMTEDYAVGNLVGRTEAYLN  145

Query  538  qvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVEANF--PSRSPP-----  696
            +VAL SL+GA+ +L S E LLP+AE +K+V RC++  +  AC +  F    R+ P     
Sbjct  146  EVALKSLAGAVSILHSSESLLPIAEKVKLVSRCIDTIAYIACKDNQFCTSGRAEPGTNGL  205

Query  697  ------------NWWTEELTILDVAFFARIIATMRSRTAKPLTLASAIITYAERSL  828
                        +WW E+LT+L + FF R++  M  R  K   L   ++ YA++SL
Sbjct  206  NSSTFSNPKPMVDWWAEDLTVLRIDFFQRVLIAMMGRGFKQYALGPILMLYAQKSL  261



>ref|XP_010086959.1| BTB/POZ domain-containing protein [Morus notabilis]
 gb|EXB25095.1| BTB/POZ domain-containing protein [Morus notabilis]
Length=624

 Score =   207 bits (528),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 112/236 (47%), Positives = 156/236 (66%), Gaps = 19/236 (8%)
 Frame = +1

Query  178  LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRIN  357
            LS A++RT +W+FSQEIP+DV ++VG  SFSLHKF LV+K  YIRKL+ +S ++DL+ I 
Sbjct  24   LSTALKRTSEWIFSQEIPSDVTIDVGGVSFSLHKFPLVSKCGYIRKLVSESNDSDLSIIE  83

Query  358  LSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFls  537
            L+ IPGG E FE AAKFCYG+NFEI+  N+A LRCAAEYL+MT+ Y   NL GRT+ +L+
Sbjct  84   LADIPGGAEAFELAAKFCYGINFEISTENIAMLRCAAEYLEMTEDYAVGNLVGRTDAYLN  143

Query  538  qvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVEANF-------------  678
            +VAL SL+ A  +L   E  LP+AE +K+V +C++  +  AC E+ F             
Sbjct  144  EVALKSLASAASILHISENFLPIAEKVKLVSKCIDAIAYIACKESQFCMSGRSESGSEGV  203

Query  679  -PSR-SPP----NWWTEELTILDVAFFARIIATMRSRTAKPLTLASAIITYAERSL  828
             PS  S P    +WW E+LT+L +  F R++  M +R  K   L   ++ YA++SL
Sbjct  204  IPSAVSEPKPIVDWWAEDLTVLRIDMFHRVLVAMMARGFKQYALGPILMLYAQKSL  259



>ref|XP_002963864.1| hypothetical protein SELMODRAFT_141980 [Selaginella moellendorffii]
 gb|EFJ35735.1| hypothetical protein SELMODRAFT_141980 [Selaginella moellendorffii]
Length=631

 Score =   207 bits (527),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 110/248 (44%), Positives = 155/248 (63%), Gaps = 25/248 (10%)
 Frame = +1

Query  160  KSAATRLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEA  339
            K   +R S   +RTGQW+ S ++PTDV+VE    SFSLHKF LVA+   IR+ + +++E 
Sbjct  11   KRLVSRTSYNKKRTGQWIMSADVPTDVVVEAAGTSFSLHKFPLVARCGRIRRAVAEAREM  70

Query  340  DLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGR  519
            DL+RI    +PGG E FE AAKFCYG+NFEIT  NVAALRCAAEYL+M D+Y   NL GR
Sbjct  71   DLSRIEFPDVPGGAETFELAAKFCYGINFEITTANVAALRCAAEYLEMKDEYGQGNLLGR  130

Query  520  TEDFlsqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVE----------  669
            TE F+++V L S + +L VL SCEELLP+AED  +V RC++  ++ AC +          
Sbjct  131  TEAFVNEVVLPSFANSLCVLHSCEELLPIAEDNNLVSRCIDAIASIACKDQKPASSLSGS  190

Query  670  -----ANFPSRSPPN----------WWTEELTILDVAFFARIIATMRSRTAKPLTLASAI  804
                     S+  PN          WW E+L++L + F+ R++  M+S+  +  +L   +
Sbjct  191  DYGSSGRLGSKGKPNATLPKSAFTEWWAEDLSLLRIDFYQRVLEAMKSKGVREESLWGTL  250

Query  805  ITYAERSL  828
            + YA++SL
Sbjct  251  MHYAQQSL  258



>ref|XP_002988267.1| hypothetical protein SELMODRAFT_447227 [Selaginella moellendorffii]
 gb|EFJ10686.1| hypothetical protein SELMODRAFT_447227 [Selaginella moellendorffii]
Length=631

 Score =   207 bits (527),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 110/248 (44%), Positives = 155/248 (63%), Gaps = 25/248 (10%)
 Frame = +1

Query  160  KSAATRLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEA  339
            K   +R S   +RTGQW+ S ++PTDV+VE    SFSLHKF LVA+   IR+ + +++E 
Sbjct  11   KRLVSRTSYNKKRTGQWIMSADVPTDVVVEAAGTSFSLHKFPLVARCGRIRRAVAEAREM  70

Query  340  DLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGR  519
            DL+RI    +PGG E FE AAKFCYG+NFEIT  NVAALRCAAEYL+M D+Y   NL GR
Sbjct  71   DLSRIEFPDVPGGAETFELAAKFCYGINFEITTANVAALRCAAEYLEMKDEYGQGNLLGR  130

Query  520  TEDFlsqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVE----------  669
            TE F+++V L S + +L VL SCEELLP+AED  +V RC++  ++ AC +          
Sbjct  131  TEAFVNEVVLPSFANSLCVLHSCEELLPIAEDNNLVSRCIDAIASIACKDQKPASSLSSS  190

Query  670  -----ANFPSRSPPN----------WWTEELTILDVAFFARIIATMRSRTAKPLTLASAI  804
                     S+  PN          WW E+L++L + F+ R++  M+S+  +  +L   +
Sbjct  191  DYGSSGRLGSKGKPNATLPKSAFTEWWAEDLSLLRIDFYQRVLEAMKSKGVREESLWGTL  250

Query  805  ITYAERSL  828
            + YA++SL
Sbjct  251  MHYAQQSL  258



>gb|KJB43881.1| hypothetical protein B456_007G221600 [Gossypium raimondii]
Length=437

 Score =   203 bits (516),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 108/226 (48%), Positives = 155/226 (69%), Gaps = 9/226 (4%)
 Frame = +1

Query  178  LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRIN  357
            +S AM+RT +W+FSQEIP+DV V+V   SFSLHKF LV+K  YIRK++ +S +AD++ I 
Sbjct  24   MSTAMKRTSEWIFSQEIPSDVTVQVAGVSFSLHKFPLVSKCGYIRKVVSESNDADVSVIV  83

Query  358  LSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFls  537
            +  +PGG E FE AAKFCYG+NFEI   N+AALRC AEYL+MT+ Y   +L  RTE FL+
Sbjct  84   IPDVPGGAESFELAAKFCYGINFEINTENIAALRCVAEYLEMTEDYAVGSLVERTEAFLN  143

Query  538  qvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVEANFP---------SRS  690
            +VAL SL+GA+ VL + E LLP+AE++K+V RC++  +  AC E+            S++
Sbjct  144  EVALQSLAGAISVLHASENLLPIAEEVKLVGRCIDAIAYLACKESGNDIAMSSTISNSKT  203

Query  691  PPNWWTEELTILDVAFFARIIATMRSRTAKPLTLASAIITYAERSL  828
              +WW E+L +L +  F R++  M +R  KP  L   ++ YA+++L
Sbjct  204  VVDWWAEDLAVLRIDIFQRVLIAMIARGFKPYALGPVLMLYAQKAL  249



>ref|XP_007047478.1| Phototropic-responsive NPH3 family protein [Theobroma cacao]
 gb|EOX91635.1| Phototropic-responsive NPH3 family protein [Theobroma cacao]
Length=623

 Score =   206 bits (525),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 116/248 (47%), Positives = 163/248 (66%), Gaps = 22/248 (9%)
 Frame = +1

Query  142  NMASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLI  321
            NM+S  K     LS AM+RT +W+FSQEIP+DV V+VG ASFSLHKF LV+K  +IRK++
Sbjct  15   NMSSKKKEL---LSTAMKRTSEWIFSQEIPSDVTVQVGGASFSLHKFPLVSKCGFIRKVV  71

Query  322  MDSKEADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCD  501
             +S +AD++ I +  +PGG + FE AAKFCYG+NFEI+  N+A LRCAAEYL+MT+ Y  
Sbjct  72   SESNDADVSVIEIPDVPGGADSFELAAKFCYGINFEISTENIAMLRCAAEYLEMTEDYAV  131

Query  502  NNLAGRTEDFlsqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVEANF-  678
             NL GRTE +L++VAL SL+GA+ VL + E LLPLAE +K+V +C++  +  AC E+ F 
Sbjct  132  GNLVGRTEAYLNEVALKSLAGAVSVLHTSENLLPLAEKVKLVSQCIDAIAYLACKESQFC  191

Query  679  ----------------PSRSPP--NWWTEELTILDVAFFARIIATMRSRTAKPLTLASAI  804
                             S S P  +WW E+L +L +  F R++  M +R  K   L   +
Sbjct  192  ISGRSESGNESAISSTISNSKPIVDWWAEDLAVLRIDIFQRVLVAMIARGFKQYALGPVL  251

Query  805  ITYAERSL  828
            + YA+++L
Sbjct  252  MLYAQKAL  259



>ref|XP_002284242.2| PREDICTED: BTB/POZ domain-containing protein At5g67385 [Vitis 
vinifera]
Length=636

 Score =   206 bits (525),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 116/248 (47%), Positives = 157/248 (63%), Gaps = 22/248 (9%)
 Frame = +1

Query  142  NMASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLI  321
            NM+S  K     LS AM+RT +W+FSQEIP+DV V  GE SFSLHKF LV+K  YIRKL+
Sbjct  15   NMSSKKKEL---LSTAMKRTSEWIFSQEIPSDVTVHAGEVSFSLHKFPLVSKCGYIRKLV  71

Query  322  MDSKEADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCD  501
             +S +ADL+ I +  +PGG E FE AAKFCYG+NFEI+  N+A LRC AEYL+MT+ Y  
Sbjct  72   SESSDADLSVIEVHDVPGGAEAFELAAKFCYGINFEISTENIAMLRCVAEYLEMTEDYSV  131

Query  502  NNLAGRTEDFlsqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVEANFP  681
             NL GR E +L++VAL SL+GA+ +L   E LLP+AE +K+V RC++  +  AC E+ F 
Sbjct  132  GNLVGRAEAYLNEVALKSLAGAVTILHLSEALLPMAEKVKVVSRCIDAIAYIACKESQFS  191

Query  682  SR---------------SPP----NWWTEELTILDVAFFARIIATMRSRTAKPLTLASAI  804
                             S P    +WW E+L +L +  F R++  M +R  K   L   +
Sbjct  192  MSGRVESGTDLLNSSLVSHPKHIVDWWAEDLIVLRIDIFQRVLIAMMARGFKQYALGPIL  251

Query  805  ITYAERSL  828
            + YA++SL
Sbjct  252  MLYAQKSL  259



>ref|XP_010028106.1| PREDICTED: BTB/POZ domain-containing protein At5g67385 isoform 
X1 [Eucalyptus grandis]
Length=615

 Score =   206 bits (523),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 114/236 (48%), Positives = 150/236 (64%), Gaps = 19/236 (8%)
 Frame = +1

Query  178  LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRIN  357
            LS  MERT  W+FSQEIP+DV V     SF+LHKF LV++   IRKL+ +S EADL+ I 
Sbjct  21   LSTVMERTSAWIFSQEIPSDVTVHAAGTSFALHKFPLVSRCGCIRKLVSESSEADLSNIE  80

Query  358  LSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFls  537
            L GIPGG E FE AAKFCYG+NFEI+  N+A LRCAAEYL+MT+ Y   NL GRTE +L 
Sbjct  81   LVGIPGGAEAFELAAKFCYGINFEISTKNIAMLRCAAEYLEMTEDYAVGNLVGRTEAYLK  140

Query  538  qvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVEANFP------------  681
            +VAL S++GA+ VL   E LLP+AE +K+V RC++  +  AC E+ F             
Sbjct  141  EVALKSIAGAITVLHMTESLLPIAEKVKLVVRCIDAIAFLACKESQFSVNGGNEDGNAMI  200

Query  682  ------SRSP-PNWWTEELTILDVAFFARIIATMRSRTAKPLTLASAIITYAERSL  828
                   +SP   WW E+LT+L +  F R++  M +R  K   L   ++ YA++SL
Sbjct  201  SSMVSHQKSPFVEWWAEDLTVLRIDIFQRVLVAMTARGYKQYALGPILMLYAQKSL  256



>ref|XP_010028107.1| PREDICTED: BTB/POZ domain-containing protein At5g67385 isoform 
X2 [Eucalyptus grandis]
 gb|KCW54768.1| hypothetical protein EUGRSUZ_I00715 [Eucalyptus grandis]
Length=614

 Score =   206 bits (523),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 114/236 (48%), Positives = 150/236 (64%), Gaps = 19/236 (8%)
 Frame = +1

Query  178  LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRIN  357
            LS  MERT  W+FSQEIP+DV V     SF+LHKF LV++   IRKL+ +S EADL+ I 
Sbjct  21   LSTVMERTSAWIFSQEIPSDVTVHAAGTSFALHKFPLVSRCGCIRKLVSESSEADLSNIE  80

Query  358  LSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFls  537
            L GIPGG E FE AAKFCYG+NFEI+  N+A LRCAAEYL+MT+ Y   NL GRTE +L 
Sbjct  81   LVGIPGGAEAFELAAKFCYGINFEISTKNIAMLRCAAEYLEMTEDYAVGNLVGRTEAYLK  140

Query  538  qvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVEANFP------------  681
            +VAL S++GA+ VL   E LLP+AE +K+V RC++  +  AC E+ F             
Sbjct  141  EVALKSIAGAITVLHMTESLLPIAEKVKLVVRCIDAIAFLACKESQFSVNGGNEDGNAMI  200

Query  682  ------SRSP-PNWWTEELTILDVAFFARIIATMRSRTAKPLTLASAIITYAERSL  828
                   +SP   WW E+LT+L +  F R++  M +R  K   L   ++ YA++SL
Sbjct  201  SSMVSHQKSPFVEWWAEDLTVLRIDIFQRVLVAMTARGYKQYALGPILMLYAQKSL  256



>emb|CAN71562.1| hypothetical protein VITISV_007563 [Vitis vinifera]
Length=621

 Score =   206 bits (523),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 112/236 (47%), Positives = 152/236 (64%), Gaps = 19/236 (8%)
 Frame = +1

Query  178  LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRIN  357
            LS AM+RT +W+FSQEIP+DV V  GE SFSLHKF LV+K  YIRKL+ +S +ADL+ I 
Sbjct  9    LSTAMKRTSEWIFSQEIPSDVTVHAGEVSFSLHKFPLVSKCGYIRKLVSESSDADLSVIE  68

Query  358  LSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFls  537
            +  +PGG E FE AAKFCYG+NFEI+  N+A LRC AEYL+MT+ Y   NL GR E +L+
Sbjct  69   VHDVPGGAEAFELAAKFCYGINFEISTENIAMLRCVAEYLEMTEDYSVGNLVGRAEAYLN  128

Query  538  qvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVEANFPSR----------  687
            +VAL SL+GA+ +L   E LLP+AE +K+V RC++  +  AC E+ F             
Sbjct  129  EVALKSLAGAVTILHLSEALLPMAEKVKVVSRCIDAIAYIACKESQFSMSGRVESGTDLL  188

Query  688  -----SPP----NWWTEELTILDVAFFARIIATMRSRTAKPLTLASAIITYAERSL  828
                 S P    +WW E+L +L +  F R++  M +R  K   L   ++ YA++SL
Sbjct  189  NSSLVSHPKHIVDWWAEDLIVLRIDIFQRVLIAMMARGFKQYALGPILMLYAQKSL  244



>ref|XP_002533158.1| Root phototropism protein, putative [Ricinus communis]
 gb|EEF29217.1| Root phototropism protein, putative [Ricinus communis]
Length=621

 Score =   205 bits (522),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 114/248 (46%), Positives = 157/248 (63%), Gaps = 22/248 (9%)
 Frame = +1

Query  142  NMASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLI  321
            NM+S  K     L+ AM+RT +W+FSQEIP+DV V  G  SFSLHKF LV+K  YIRKL+
Sbjct  20   NMSSKKKEL---LTTAMKRTSEWIFSQEIPSDVTVHAGGVSFSLHKFPLVSKCGYIRKLV  76

Query  322  MDSKEADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCD  501
             +S +ADL  I +  IPGG E FE AAKFCYG+NFEI+  N+A LRC A+YL+MT+ Y  
Sbjct  77   SESSDADLGEIEIPDIPGGAEAFELAAKFCYGINFEISTENIALLRCGADYLEMTEDYAV  136

Query  502  NNLAGRTEDFlsqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVEANFP  681
             NL  R+E +L++VAL SL+GA+ +L   E LLP+AE +K+V RC++  +  AC E+ F 
Sbjct  137  GNLVARSESYLNEVALKSLAGAVTILHLAENLLPVAEKVKLVSRCIDAIAYMACKESQFS  196

Query  682  -----------------SRSPP--NWWTEELTILDVAFFARIIATMRSRTAKPLTLASAI  804
                             S+  P  +WW E+LT+L +  F R+++ M  R  K   L   +
Sbjct  197  ISGRSDSGNKDVLSSLTSQPKPIVDWWAEDLTVLRIDIFQRVLSAMMGRGFKQYALGPIL  256

Query  805  ITYAERSL  828
            + YA++SL
Sbjct  257  MLYAQKSL  264



>gb|KJB48677.1| hypothetical protein B456_008G080700 [Gossypium raimondii]
Length=614

 Score =   205 bits (522),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 110/243 (45%), Positives = 158/243 (65%), Gaps = 19/243 (8%)
 Frame = +1

Query  157  LKSAATRLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKE  336
            + S    LS AM+RT +W+FSQEIP+DV V+VG  SFSLHKF L++KS ++RK++ +S +
Sbjct  16   MSSKKELLSSAMKRTSEWIFSQEIPSDVTVQVGGVSFSLHKFPLISKSGFVRKVVSESND  75

Query  337  ADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAG  516
            AD + I +  +PGG + FE AAKFCYG+NFEI+  N+A LRCAAEYL+MT+ Y   NL G
Sbjct  76   ADHSIIEIPNVPGGADSFELAAKFCYGINFEISTENIAMLRCAAEYLEMTEDYAVGNLVG  135

Query  517  RTEDFlsqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVEANF------  678
            RTE +L++VAL SL+GA+ VL   E LLP+AE++K+V RC++  +  AC E+ F      
Sbjct  136  RTEAYLNEVALKSLAGAVSVLHMSESLLPIAEEVKLVSRCIDAIAYLACKESQFYMSSRS  195

Query  679  -------------PSRSPPNWWTEELTILDVAFFARIIATMRSRTAKPLTLASAIITYAE  819
                          SR   +WW E+L +L +  F R++  M +R  K   L   ++ YA+
Sbjct  196  DSGNDSTISLTTTNSRPIVDWWAEDLAVLRIDIFQRVLIAMVARGFKQYDLGPVLMLYAQ  255

Query  820  RSL  828
            ++L
Sbjct  256  KAL  258



>ref|XP_006466487.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like [Citrus 
sinensis]
Length=623

 Score =   205 bits (522),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 112/236 (47%), Positives = 152/236 (64%), Gaps = 19/236 (8%)
 Frame = +1

Query  178  LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRIN  357
            LS AM+RT +W+FSQEIP+DV V VG  SFSLHKF LV+K  YIRKL+ +S EADL+ I 
Sbjct  24   LSTAMKRTSEWIFSQEIPSDVTVHVGGTSFSLHKFPLVSKCGYIRKLVSESSEADLSVIE  83

Query  358  LSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFls  537
            +  +PGG E FE AAKFCYG+NFEI   NVA LRC AEYL+MT+ Y   NL GR E +L+
Sbjct  84   IPDVPGGAEAFELAAKFCYGINFEINTENVAGLRCVAEYLEMTEDYAVGNLVGRAEAYLN  143

Query  538  qvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVEANFPS-----------  684
            +VAL+SL+GA+ VL   + LLP+AE +K+V +C++  +  AC E  F             
Sbjct  144  EVALTSLTGAVTVLHKSQGLLPIAEKVKLVGQCIDAIAYIACKENQFSGSGRAESGTDNA  203

Query  685  --------RSPPNWWTEELTILDVAFFARIIATMRSRTAKPLTLASAIITYAERSL  828
                    ++  +WW E+LT+L +  F R++  M +R  K   L   ++ YA++SL
Sbjct  204  ISDMVSHPKTIVDWWAEDLTVLRIDVFQRVLIAMMARGFKQYALGPVLMLYAQKSL  259



>ref|XP_004231910.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like [Solanum 
lycopersicum]
Length=596

 Score =   204 bits (520),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 110/230 (48%), Positives = 155/230 (67%), Gaps = 16/230 (7%)
 Frame = +1

Query  187  AMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSG  366
            AM+RT  W+FSQEIP+DV V  G  SF+LHKF LV+KS YIRKLI +S EAD++ I++  
Sbjct  12   AMKRTSDWIFSQEIPSDVTVNAGGTSFTLHKFPLVSKSGYIRKLISESNEADVSTIDIPD  71

Query  367  IPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqva  546
            IPGG E FE AAKFCYG+NFEI+  N+A LRC AEYL+MT+ Y   NL  RTE + ++VA
Sbjct  72   IPGGGEAFELAAKFCYGINFEISTENIALLRCVAEYLEMTEDYAVANLVERTEAYFNEVA  131

Query  547  lsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVEANFPSR------------S  690
            ++SL+GA+ +L+S E LLP+AE +K+V RC++  +  AC +  F +             S
Sbjct  132  ITSLAGAVTILRSSENLLPIAEKVKLVSRCIDTIAYTACKDNQFSTSGRAEAGINGSTFS  191

Query  691  PP----NWWTEELTILDVAFFARIIATMRSRTAKPLTLASAIITYAERSL  828
             P    +WW+E++T+L + FF R++  M +R  K   L   ++ YA++SL
Sbjct  192  NPKPIVDWWSEDITVLRIDFFQRVLIAMMARGFKRYALGPILMLYAQKSL  241



>gb|KHN36285.1| BTB/POZ domain-containing protein [Glycine soja]
Length=618

 Score =   204 bits (520),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 113/236 (48%), Positives = 154/236 (65%), Gaps = 19/236 (8%)
 Frame = +1

Query  178  LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRIN  357
            LS AM+RT +W+FSQEIP+DV V+VGEASFSLHKF LV+K  YIRKL+ +S +AD++ I 
Sbjct  24   LSSAMKRTSEWIFSQEIPSDVNVQVGEASFSLHKFPLVSKCGYIRKLVSESNDADVSFIE  83

Query  358  LSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFls  537
            L  +PGG E FE AAKFCYG+NFEI V N+A L C AEYL+MT+ Y   NL GRT+ +L+
Sbjct  84   LPDVPGGAEAFELAAKFCYGINFEINVENIATLCCVAEYLEMTEDYSVGNLMGRTDAYLN  143

Query  538  qvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVEANFPS-----------  684
            +VAL +++GA+ VL   E LL +AE  K+V RC++  +  AC E+ F S           
Sbjct  144  EVALKTIAGAVSVLHMSENLLAIAERAKLVSRCIDAIAFIACKESQFCSSARSESGSVGV  203

Query  685  --------RSPPNWWTEELTILDVAFFARIIATMRSRTAKPLTLASAIITYAERSL  828
                    R   +WW E+LT+L +  F R+I  M +R  K   +   ++ YA++SL
Sbjct  204  VSSMASNQRPVVDWWAEDLTVLRIDIFQRVIIAMMARGFKQYAIGPILMLYAQKSL  259



>ref|XP_003517336.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like [Glycine 
max]
Length=618

 Score =   204 bits (520),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 113/236 (48%), Positives = 154/236 (65%), Gaps = 19/236 (8%)
 Frame = +1

Query  178  LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRIN  357
            LS AM+RT +W+FSQEIP+DV V+VGEASFSLHKF LV+K  YIRKL+ +S +AD++ I 
Sbjct  24   LSSAMKRTSEWIFSQEIPSDVNVQVGEASFSLHKFPLVSKCGYIRKLVSESNDADVSFIE  83

Query  358  LSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFls  537
            L  +PGG E FE AAKFCYG+NFEI V N+A L C AEYL+MT+ Y   NL GRT+ +L+
Sbjct  84   LPDVPGGAEAFELAAKFCYGINFEINVENIATLCCVAEYLEMTEDYSVGNLMGRTDAYLN  143

Query  538  qvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVEANFPS-----------  684
            +VAL +++GA+ VL   E LL +AE  K+V RC++  +  AC E+ F S           
Sbjct  144  EVALKTIAGAVSVLHMSENLLAIAERAKLVSRCIDAIAFIACKESQFCSSARSESGSVGV  203

Query  685  --------RSPPNWWTEELTILDVAFFARIIATMRSRTAKPLTLASAIITYAERSL  828
                    R   +WW E+LT+L +  F R+I  M +R  K   +   ++ YA++SL
Sbjct  204  VSSMASNQRPVVDWWAEDLTVLRIDIFQRVIIAMMARGFKQYAIGPILMLYAQKSL  259



>ref|XP_009402206.1| PREDICTED: root phototropism protein 2 isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=540

 Score =   203 bits (516),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 105/185 (57%), Positives = 142/185 (77%), Gaps = 1/185 (1%)
 Frame = +1

Query  277  KFMLVAKSNYIRKLIMDSKEADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAAL  456
            +FMLVA S YIR+ +M+S+ A+L  I+LS +PGG E+FE+AAKFCYG+NFEI+VHNV AL
Sbjct  2    QFMLVANSGYIRRKVMESERANLGCIDLSDVPGGAEVFEKAAKFCYGMNFEISVHNVTAL  61

Query  457  RCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCE-ELLPLAEDLKIVQR  633
            RCAAEYLQMT+ Y   NLA R E+F++Q A+ +L GA+ +L+SCE  LLP+AE+++IVQR
Sbjct  62   RCAAEYLQMTEDYSRGNLAERAEEFINQAAVKTLPGAVALLRSCEGSLLPMAEEVRIVQR  121

Query  634  CVELASAKACVEANFPSRSPPNWWTEELTILDVAFFARIIATMRSRTAKPLTLASAIITY  813
             V+  S KA  EAN P+RSPP+WW  EL  L  A   +I++ M+SR   P +LA+A++ Y
Sbjct  122  SVDAISLKAFNEANIPTRSPPDWWAGELAALAPASLQKILSAMKSRGVAPKSLAAAVVVY  181

Query  814  AERSL  828
            AE+SL
Sbjct  182  AEKSL  186



>ref|XP_010559030.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like isoform 
X2 [Tarenaya hassleriana]
Length=588

 Score =   203 bits (517),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 111/235 (47%), Positives = 155/235 (66%), Gaps = 18/235 (8%)
 Frame = +1

Query  178  LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSK-EADLTRI  354
            +S AM+RT +W+ SQEIP+DV   VGEASFSLHKF LV+KS +IRKL+ +S  E+D++ I
Sbjct  9    MSSAMKRTSEWISSQEIPSDVTAHVGEASFSLHKFPLVSKSGFIRKLVSESNNESDISVI  68

Query  355  NLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFl  534
             +  IPGG E FE AAKFCYG+NFEIT  N+A LRCAAEYL+MT+++   NL GR E +L
Sbjct  69   GIHEIPGGAEAFEMAAKFCYGINFEITTENIAMLRCAAEYLEMTEEHSVGNLLGRAEAYL  128

Query  535  sqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVEANFPSRSPPN-----  699
            ++VAL SLS ++ VL   E+LLP+AE +K+V RC++  +  AC E+ F   +  N     
Sbjct  129  NEVALKSLSSSITVLHKAEDLLPMAERVKLVSRCIDAIAYAACQESQFCCTASSNGGNNE  188

Query  700  ------------WWTEELTILDVAFFARIIATMRSRTAKPLTLASAIITYAERSL  828
                        WW E+LT+L +  F R++  M +R  K   L   ++ YA+++L
Sbjct  189  VSVSQNKQLAVDWWAEDLTVLRIDTFQRVLIAMMARGFKQYGLGPVLMLYAQKAL  243



>ref|XP_012079373.1| PREDICTED: BTB/POZ domain-containing protein At5g67385 [Jatropha 
curcas]
 gb|KDP32052.1| hypothetical protein JCGZ_12513 [Jatropha curcas]
Length=622

 Score =   204 bits (518),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 112/236 (47%), Positives = 152/236 (64%), Gaps = 19/236 (8%)
 Frame = +1

Query  178  LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRIN  357
            LS  M+RT +W+FSQEIP+DV V  G ASFSLHKF LV+K  YIRKL+ +  +ADLT I+
Sbjct  25   LSTVMKRTSEWIFSQEIPSDVTVLAGGASFSLHKFPLVSKCGYIRKLVSECNDADLTEIH  84

Query  358  LSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFls  537
            +  IPGG E FE AAKFCYG+NFEI   N+A LRC AEYL+MT+ Y   NL  RTE +L+
Sbjct  85   IPDIPGGGEAFELAAKFCYGINFEIGTENIAMLRCVAEYLEMTEDYAVGNLVARTEAYLN  144

Query  538  qvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVEANFPS-----------  684
            +VAL SL+GA+ +L S E  LPLA+ +K+V RC++  +  AC E+ F +           
Sbjct  145  EVALKSLAGAVSILYSSENFLPLADKVKLVSRCIDAIAFMACRESQFSTSGRSDSGNEGV  204

Query  685  --------RSPPNWWTEELTILDVAFFARIIATMRSRTAKPLTLASAIITYAERSL  828
                    +S  +WW E+LT+L +  F R++  M +R  K   L   ++ YA++SL
Sbjct  205  LSSAISQPKSIADWWAEDLTVLRIDIFQRVLIAMMARGFKQYALGPILMLYAQKSL  260



>ref|XP_006426057.1| hypothetical protein CICLE_v10025164mg [Citrus clementina]
 gb|ESR39297.1| hypothetical protein CICLE_v10025164mg [Citrus clementina]
Length=623

 Score =   203 bits (517),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 112/236 (47%), Positives = 151/236 (64%), Gaps = 19/236 (8%)
 Frame = +1

Query  178  LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRIN  357
            LS AM+RT +W+FSQEIP+DV V VG  SFSLHKF LV+K  YIRKL+  S EADL+ I 
Sbjct  24   LSTAMKRTSEWIFSQEIPSDVTVHVGGTSFSLHKFPLVSKCGYIRKLVSVSSEADLSVIE  83

Query  358  LSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFls  537
            +  +PGG E FE AAKFCYG+NFEI   NVA LRC AEYL+MT+ Y   NL GR E +L+
Sbjct  84   IPDVPGGAEAFELAAKFCYGINFEINTENVAGLRCVAEYLEMTEDYAVGNLVGRAEAYLN  143

Query  538  qvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVEANFPS-----------  684
            +VAL+SL+GA+ VL   + LLP+AE +K+V +C++  +  AC E  F             
Sbjct  144  EVALTSLTGAVTVLHKSQGLLPIAEKVKLVGQCIDAIAYIACKENQFSGSGRAESGTDNA  203

Query  685  --------RSPPNWWTEELTILDVAFFARIIATMRSRTAKPLTLASAIITYAERSL  828
                    ++  +WW E+LT+L +  F R++  M +R  K   L   ++ YA++SL
Sbjct  204  ISDMVSHPKTIVDWWAEDLTVLRIDVFQRVLIAMMARGFKQYALGPVLMLYAQKSL  259



>gb|KDO78972.1| hypothetical protein CISIN_1g006971mg [Citrus sinensis]
Length=623

 Score =   203 bits (517),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 112/236 (47%), Positives = 151/236 (64%), Gaps = 19/236 (8%)
 Frame = +1

Query  178  LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRIN  357
            LS AM+RT +W+FSQEIP+DV V VG  SFSLHKF LV+K  YIRKL+  S EADL+ I 
Sbjct  24   LSTAMKRTSEWIFSQEIPSDVTVHVGGTSFSLHKFPLVSKCGYIRKLVSVSSEADLSVIE  83

Query  358  LSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFls  537
            +  +PGG E FE AAKFCYG+NFEI   NVA LRC AEYL+MT+ Y   NL GR E +L+
Sbjct  84   IPDVPGGAEAFELAAKFCYGINFEINTENVAGLRCVAEYLEMTEDYAVGNLVGRAEAYLN  143

Query  538  qvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVEANFPS-----------  684
            +VAL+SL+GA+ VL   + LLP+AE +K+V +C++  +  AC E  F             
Sbjct  144  EVALTSLTGAVTVLHKSQGLLPIAEKVKLVGQCIDAIAYIACKENQFSGSGRAESGTDNA  203

Query  685  --------RSPPNWWTEELTILDVAFFARIIATMRSRTAKPLTLASAIITYAERSL  828
                    ++  +WW E+LT+L +  F R++  M +R  K   L   ++ YA++SL
Sbjct  204  ISDMVSHPKTIVDWWAEDLTVLRIDVFQRVLIAMMARGFKQYALGPVLMLYAQKSL  259



>ref|XP_010277089.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like isoform 
X1 [Nelumbo nucifera]
 ref|XP_010277090.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like isoform 
X1 [Nelumbo nucifera]
Length=605

 Score =   203 bits (516),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 111/235 (47%), Positives = 153/235 (65%), Gaps = 19/235 (8%)
 Frame = +1

Query  181  SLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINL  360
            S AMERT +W+FSQEIP+D+ V  G ASFSLHKF LV+K  YIRKL+ +  +AD++ + L
Sbjct  10   STAMERTSEWIFSQEIPSDITVHAGGASFSLHKFPLVSKCGYIRKLVSEDSDADVSVVEL  69

Query  361  SGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsq  540
              +PGG E FE AAKFCYG+NFEI+  N+A LRC AEYL+MT+ Y   NL GRTED+L++
Sbjct  70   PDVPGGEEAFELAAKFCYGINFEISTENIATLRCVAEYLEMTEDYAVGNLVGRTEDYLNE  129

Query  541  valsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVEANF--PSRSPP------  696
            VAL SL+GA+ VL + E LLP AE +K+V R ++  +  A  E+ F  P R+        
Sbjct  130  VALKSLAGAISVLHTSENLLPTAEKVKLVSRSIDAVAYLAYKESQFCLPGRTETRHESIN  189

Query  697  -----------NWWTEELTILDVAFFARIIATMRSRTAKPLTLASAIITYAERSL  828
                       +WW E+LT+L +  F R++  M +R  K  +L   ++ YA++SL
Sbjct  190  SYSGSHLKPIVDWWAEDLTVLRIDIFHRVLMAMLARGFKQYSLGPILMIYAQKSL  244



>ref|XP_011099322.1| PREDICTED: BTB/POZ domain-containing protein At5g67385 [Sesamum 
indicum]
Length=616

 Score =   202 bits (515),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 110/232 (47%), Positives = 150/232 (65%), Gaps = 15/232 (6%)
 Frame = +1

Query  178  LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRIN  357
            LS AM+RT +W+FSQEIP+D+ V  G  SFSLHKF LV+K  YIRKL+ +S +ADL+ I 
Sbjct  24   LSTAMKRTSEWIFSQEIPSDITVNAGGTSFSLHKFPLVSKCGYIRKLVSESSDADLSAIE  83

Query  358  LSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFls  537
            +  +PGG E FE AAKFCYG+NFEI+  N+A LRC AEYL+MT+ Y   NL GRTE +L+
Sbjct  84   IPDVPGGAEAFELAAKFCYGINFEISTENIARLRCVAEYLEMTEDYAVGNLVGRTEAYLN  143

Query  538  qvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVEANFPSRSPPN------  699
            +VAL SL+GA+ VL S E  LP AE +K+V RC++  +   C ++ F +    N      
Sbjct  144  EVALKSLAGAVSVLHSSESFLPTAEKVKLVSRCIDTIAFVICKDSQFAAGGGQNDLVSST  203

Query  700  ---------WWTEELTILDVAFFARIIATMRSRTAKPLTLASAIITYAERSL  828
                     WW E+L+IL +  F R++  M +R  K   L   ++ YA++SL
Sbjct  204  MTTSKPIVDWWAEDLSILRIDLFQRVLIAMIARGFKQYALGPILMLYAQKSL  255



>ref|XP_009782405.1| PREDICTED: BTB/POZ domain-containing protein At5g67385 [Nicotiana 
sylvestris]
Length=620

 Score =   202 bits (514),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 111/236 (47%), Positives = 154/236 (65%), Gaps = 19/236 (8%)
 Frame = +1

Query  178  LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRIN  357
            LS AM+RT  W+FSQEIP+DV V  G ++FSLHKF LV+KS YIRK+I +S +AD++ + 
Sbjct  26   LSTAMKRTSDWIFSQEIPSDVTVNAGGSAFSLHKFPLVSKSGYIRKIISESNDADVSIVE  85

Query  358  LSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFls  537
            +  IPGG + FE AAKFCYG+NFEI+  N+A LRC AEYL+MT+ Y   NL GRTE +L+
Sbjct  86   IPDIPGGSDAFELAAKFCYGINFEISTENIALLRCTAEYLEMTEDYAVGNLVGRTEAYLN  145

Query  538  qvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVEANF-------------  678
            +VAL SL+GA+ +L S E LLP+AE +K+V RC++  +  AC +  F             
Sbjct  146  EVALKSLAGAVSILHSSESLLPIAEKVKMVSRCIDTIAYIACKDNQFCTSGRAEAGTNGL  205

Query  679  --PSRSPP----NWWTEELTILDVAFFARIIATMRSRTAKPLTLASAIITYAERSL  828
               + S P    +WW E+L +L + FF R++  M  R  K   L   ++ YA++SL
Sbjct  206  NSSTFSNPKPMVDWWAEDLAVLRIDFFQRVLIAMMGRGFKQYALGPILMLYAQKSL  261



>gb|KJB43880.1| hypothetical protein B456_007G221600 [Gossypium raimondii]
Length=611

 Score =   202 bits (513),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 108/226 (48%), Positives = 155/226 (69%), Gaps = 9/226 (4%)
 Frame = +1

Query  178  LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRIN  357
            +S AM+RT +W+FSQEIP+DV V+V   SFSLHKF LV+K  YIRK++ +S +AD++ I 
Sbjct  24   MSTAMKRTSEWIFSQEIPSDVTVQVAGVSFSLHKFPLVSKCGYIRKVVSESNDADVSVIV  83

Query  358  LSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFls  537
            +  +PGG E FE AAKFCYG+NFEI   N+AALRC AEYL+MT+ Y   +L  RTE FL+
Sbjct  84   IPDVPGGAESFELAAKFCYGINFEINTENIAALRCVAEYLEMTEDYAVGSLVERTEAFLN  143

Query  538  qvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVEANFP---------SRS  690
            +VAL SL+GA+ VL + E LLP+AE++K+V RC++  +  AC E+            S++
Sbjct  144  EVALQSLAGAISVLHASENLLPIAEEVKLVGRCIDAIAYLACKESGNDIAMSSTISNSKT  203

Query  691  PPNWWTEELTILDVAFFARIIATMRSRTAKPLTLASAIITYAERSL  828
              +WW E+L +L +  F R++  M +R  KP  L   ++ YA+++L
Sbjct  204  VVDWWAEDLAVLRIDIFQRVLIAMIARGFKPYALGPVLMLYAQKAL  249



>ref|XP_006590635.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like isoform 
X2 [Glycine max]
Length=628

 Score =   202 bits (514),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 113/246 (46%), Positives = 156/246 (63%), Gaps = 29/246 (12%)
 Frame = +1

Query  178  LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHK----------FMLVAKSNYIRKLIMD  327
            LS AM+RT +W+FSQEIP+DV V+VGEASFSLHK          F LV+K  YIRKL+ +
Sbjct  24   LSSAMKRTSEWIFSQEIPSDVNVQVGEASFSLHKVANQFKYDSLFPLVSKCGYIRKLVSE  83

Query  328  SKEADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNN  507
            S +AD++ I L  +PGG E FE AAKFCYG+NF+I V N+A LRC AEYL+MT+ Y   N
Sbjct  84   SNDADVSFIELPEVPGGAEAFELAAKFCYGINFDINVENIATLRCVAEYLEMTEDYSVGN  143

Query  508  LAGRTEDFlsqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVEANFPS-  684
            L GRT+ +L++VAL +++GA+ +L   E LLP+AE  K+V RC++  +  AC E+ F S 
Sbjct  144  LVGRTDAYLNEVALKTIAGAVSILHMSENLLPIAERAKLVSRCIDAIAFIACKESQFCSS  203

Query  685  ------------------RSPPNWWTEELTILDVAFFARIIATMRSRTAKPLTLASAIIT  810
                              R   +WW E+LT+L +  F R+I  M +R  K   +   ++ 
Sbjct  204  ARSESGSVGVVSSMASNQRPVVDWWAEDLTVLRIDIFQRVIIAMMARGFKQYAIGPILML  263

Query  811  YAERSL  828
            YA++SL
Sbjct  264  YAQKSL  269



>ref|XP_010905282.1| PREDICTED: BTB/POZ domain-containing protein At5g67385 isoform 
X1 [Elaeis guineensis]
Length=609

 Score =   202 bits (513),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 104/235 (44%), Positives = 157/235 (67%), Gaps = 18/235 (8%)
 Frame = +1

Query  178  LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRIN  357
            LS AM+RT +W+ SQEIP+D+ +  G ++F+LHKF LV+K  YIR+L+ ++ +++++ I 
Sbjct  22   LSTAMKRTSEWILSQEIPSDITIHAGGSTFALHKFPLVSKCGYIRRLVSEANDSNMSVIE  81

Query  358  LSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFls  537
            +  +PGG E FE AAKFCYG+NFEIT+ N+A LRCAAE+L+MT+ Y   NL  RTED+L 
Sbjct  82   IPDVPGGSEAFELAAKFCYGINFEITMENIAMLRCAAEHLEMTEDYAAGNLVNRTEDYLE  141

Query  538  qvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVEANF-------------  678
            +VAL SLSGA+ +L+  E+LLP+AE +K+V RC++  +  AC ++ F             
Sbjct  142  EVALLSLSGAVTLLQKSEDLLPMAEKVKLVSRCIDAVAYIACKDSQFCISLRTESSHENL  201

Query  679  -----PSRSPPNWWTEELTILDVAFFARIIATMRSRTAKPLTLASAIITYAERSL  828
                   ++  +WW EELT+L +  F R++  M++R  K   L   I+ YA++SL
Sbjct  202  TSSGLQPKAIVDWWAEELTVLRIDTFQRVLMAMKARGFKQYGLGPVIMLYAQKSL  256



>ref|XP_009384760.1| PREDICTED: root phototropism protein 2-like isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=538

 Score =   200 bits (509),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 105/182 (58%), Positives = 138/182 (76%), Gaps = 1/182 (1%)
 Frame = +1

Query  277  KFMLVAKSNYIRKLIMDSKEADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAAL  456
            +F+L AKS YIR+ +M+S+ A+L+ I+LS +  G E+FER AKFCYGVNFEI+V NVAAL
Sbjct  2    QFVLAAKSGYIRRKVMESESANLSCIDLSDLSIGAEVFERVAKFCYGVNFEISVRNVAAL  61

Query  457  RCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEE-LLPLAEDLKIVQR  633
            RCAAEYLQMT++YC  NLA RTE+F++Q A+ +L GA+ +L+SCE  LLP+AE L++VQR
Sbjct  62   RCAAEYLQMTEEYCRGNLAARTEEFINQAAVKTLPGAVALLRSCEGPLLPMAESLRVVQR  121

Query  634  CVELASAKACVEANFPSRSPPNWWTEELTILDVAFFARIIATMRSRTAKPLTLASAIITY  813
             V+  S KAC E N P+RSPPNWW  EL +L       I+  M+SR A P +LA+AI+ Y
Sbjct  122  SVDAISLKACKELNRPTRSPPNWWAGELAVLSPTSLQMILIAMKSRGADPKSLAAAIVVY  181

Query  814  AE  819
            AE
Sbjct  182  AE  183



>emb|CDP02580.1| unnamed protein product [Coffea canephora]
Length=620

 Score =   201 bits (512),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 112/248 (45%), Positives = 157/248 (63%), Gaps = 22/248 (9%)
 Frame = +1

Query  142  NMASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLI  321
            NM+S  K     LS AM+RT +W+FSQEIP+DVIV  G   FSLHKF LV+K  YIRKL+
Sbjct  16   NMSSKKKEL---LSTAMKRTSEWIFSQEIPSDVIVHAGGTPFSLHKFPLVSKCGYIRKLV  72

Query  322  MDSKEADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCD  501
             +S +ADL+ I +  IPGG E FE AAKFCYG+NFEI+  N+A LRC AEYL MT++   
Sbjct  73   SESNDADLSEIEVPDIPGGAEAFELAAKFCYGINFEISTENIAMLRCGAEYLGMTEECAI  132

Query  502  NNLAGRTEDFlsqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVEANFP  681
             NL GRTE +L++VAL SL+ A+ +L S E  LP+AE++K+V RC++  +  AC +  F 
Sbjct  133  GNLVGRTEAYLNEVALKSLASAVSILHSTESFLPVAEEVKLVSRCIDTIAYIACKDNQFA  192

Query  682  S-------------------RSPPNWWTEELTILDVAFFARIIATMRSRTAKPLTLASAI  804
            +                   ++  +WW E+LT+L +  F R++  M +R  K  +L   +
Sbjct  193  TLGRADSGNHGINSSMVFQPKAIVDWWAEDLTVLRIDMFQRVLIAMMARGFKQYSLGPIL  252

Query  805  ITYAERSL  828
            + Y ++SL
Sbjct  253  MLYVQKSL  260



>ref|XP_010272171.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like [Nelumbo 
nucifera]
Length=620

 Score =   201 bits (512),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 118/248 (48%), Positives = 160/248 (65%), Gaps = 23/248 (9%)
 Frame = +1

Query  142  NMASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLI  321
            NM+S  K     LS AM+RT +W+FSQEIP+DV V  G ASFSLHKF LV+K  YIRKL+
Sbjct  15   NMSSKKKQL---LSTAMKRTSEWIFSQEIPSDVTVHAGGASFSLHKFPLVSKCGYIRKLV  71

Query  322  MDSKEADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCD  501
             ++ +A ++ I L  +PGG E FE AAKFCYG+NFEI+  N+A LRC AEYL+MT+ Y  
Sbjct  72   SEASDAAVSVIELPDVPGG-EAFELAAKFCYGINFEISTENIAMLRCMAEYLEMTEDYAV  130

Query  502  NNLAGRTEDFlsqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVEANF-  678
             NL GRTED+L++VAL SLSGA+ VL + E LLP+AE +K+V R ++  +  AC E+ F 
Sbjct  131  GNLVGRTEDYLNEVALKSLSGAISVLHASENLLPMAEKVKLVSRSIDAVAYIACKESQFC  190

Query  679  -PSRSPP-----------------NWWTEELTILDVAFFARIIATMRSRTAKPLTLASAI  804
             P ++                   +WW E+LT+L +  F R+I  M +R  K   L   +
Sbjct  191  MPGKTENRHEVVNSSSGSHLKPIVDWWAEDLTVLRIDVFHRVIMAMLARGFKQYALGPIL  250

Query  805  ITYAERSL  828
            + YA++SL
Sbjct  251  MLYAQKSL  258



>ref|XP_008238282.1| PREDICTED: BTB/POZ domain-containing protein At5g67385 [Prunus 
mume]
 ref|XP_008238290.1| PREDICTED: BTB/POZ domain-containing protein At5g67385 [Prunus 
mume]
Length=624

 Score =   201 bits (511),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 113/248 (46%), Positives = 155/248 (63%), Gaps = 22/248 (9%)
 Frame = +1

Query  142  NMASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLI  321
            NM S  K     LS A++RT +W+FSQEIP+DV + VG  SFSLHKF L++K  YIRKLI
Sbjct  17   NMTSKKKEL---LSSALKRTSEWIFSQEIPSDVNIHVGGVSFSLHKFPLISKCGYIRKLI  73

Query  322  MDSKEADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCD  501
             +S +ADL+ I L  +PGG E FE AAKFCYG+NFEI+  N+A LRC AEYL MT+ +  
Sbjct  74   SESSDADLSVIELPDVPGGAEAFELAAKFCYGINFEISTENIAMLRCVAEYLVMTEDHAV  133

Query  502  NNLAGRTEDFlsqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVEANF-  678
             NL GRT+ +L++VAL SL+GA+ VL   E  LP+AE +K+V RC++  +   C E+ F 
Sbjct  134  GNLVGRTDAYLNEVALESLAGAVSVLHISESFLPMAEKVKLVSRCIDAIALIVCKESQFC  193

Query  679  ------------------PSRSPPNWWTEELTILDVAFFARIIATMRSRTAKPLTLASAI  804
                               S+   +WW E+LT+L +  F R++  M +R  K   L   +
Sbjct  194  VSGMGDSVNESAVSSAVYHSKPVVDWWAEDLTVLRIDIFQRVLIAMMARGFKQYALGPVL  253

Query  805  ITYAERSL  828
            + YA++SL
Sbjct  254  MLYAQKSL  261



>ref|XP_004233453.1| PREDICTED: BTB/POZ domain-containing protein At5g67385 isoform 
X1 [Solanum lycopersicum]
Length=605

 Score =   200 bits (509),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 100/218 (46%), Positives = 148/218 (68%), Gaps = 1/218 (0%)
 Frame = +1

Query  178  LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRIN  357
            LS  M+RT +W+ SQ+IP+D+ + VG  SF+LHKF LV+K  YIRKL+  S +A L+ I 
Sbjct  22   LSNVMKRTSEWILSQDIPSDITIHVGRTSFALHKFPLVSKCGYIRKLVSKSNDAKLSTIE  81

Query  358  LSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFls  537
            +  IPGGPE FE AAKFCY +NFEI+  N+A +RC AEYL+MTD Y   NL G TE +L+
Sbjct  82   IPDIPGGPEAFELAAKFCYEINFEISPENIALIRCVAEYLEMTDDYAVGNLVGLTETYLT  141

Query  538  qvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVEANFPSRSPP-NWWTEE  714
            +V L S++ ++ +L S E+LLP+AED+K+V R ++  +   C ++ +   S   +WW ++
Sbjct  142  EVGLKSIASSVSILHSSEKLLPIAEDIKLVNRSIDTIAYIVCKDSQYGLNSSTFDWWADD  201

Query  715  LTILDVAFFARIIATMRSRTAKPLTLASAIITYAERSL  828
            LT+L + FF R++  M +R  K   L   ++ YA++SL
Sbjct  202  LTVLRIEFFQRVLIAMMARGFKQYALGPILMLYAQKSL  239



>ref|XP_003597110.1| Root phototropism protein [Medicago truncatula]
 ref|XP_003611625.1| Root phototropism protein [Medicago truncatula]
 gb|AES94583.1| phototropic-responsive NPH3 family protein [Medicago truncatula]
Length=630

 Score =   201 bits (510),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 103/237 (43%), Positives = 152/237 (64%), Gaps = 20/237 (8%)
 Frame = +1

Query  178  LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRIN  357
            LS AM+RT  W+FSQEIP+DV V++GE+SF+LHK+ LV+K  YIRKL+ +S ++D++ + 
Sbjct  24   LSSAMKRTSDWIFSQEIPSDVNVQIGESSFTLHKYPLVSKCGYIRKLVSESNDSDVSFVE  83

Query  358  LSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFls  537
            LS +PGG E FE AAKFCYG+NFEI V N+A LRC AEYL+MT+ Y   NL  RT+ +L+
Sbjct  84   LSDVPGGAEAFELAAKFCYGINFEINVENIAMLRCVAEYLEMTEDYSVGNLVARTDAYLN  143

Query  538  qvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVEANF-------------  678
             VAL +++G++ +L   E LLP+AE  K+V +C++  +  AC E+               
Sbjct  144  DVALKTIAGSVSILHISESLLPIAEKTKLVSKCIDAIAYIACNESQLCTSVRSESGSDGV  203

Query  679  -------PSRSPPNWWTEELTILDVAFFARIIATMRSRTAKPLTLASAIITYAERSL  828
                     R   +WW E+LT+L +  F R++  M +R  K   +   ++ YA++SL
Sbjct  204  MSSSVSSQQRPVVDWWAEDLTVLRIDLFQRVLIAMMARGFKQFAIGPILMLYAQKSL  260



>ref|XP_003608469.1| BTB/POZ domain-containing protein [Medicago truncatula]
Length=424

 Score =   196 bits (499),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 108/236 (46%), Positives = 153/236 (65%), Gaps = 23/236 (10%)
 Frame = +1

Query  190  MERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEA--DLTRINLS  363
            M+RT +W +SQEIP+DV +++GEAS+SLHKF L++KS YIRKLI +S +A  D+  I L 
Sbjct  1    MKRTSEWNYSQEIPSDVAIQIGEASYSLHKFPLISKSGYIRKLISESSDAVDDVPLIELI  60

Query  364  GIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqv  543
             +PGG E FE AAKFCYG+NFEI+V N+A LRC AEYL+MT+ Y   NL GRT+ +L++V
Sbjct  61   DVPGGSEAFELAAKFCYGINFEISVENIAMLRCVAEYLEMTEDYSVGNLVGRTDSYLNEV  120

Query  544  alsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVEANFP--------------  681
            AL S+SGA+ +L + E LLP+AE  K+V RC++  +  A  E+ F               
Sbjct  121  ALKSMSGAISILHTSETLLPIAEKAKLVSRCIDAIAFIASKESQFGSSGRSDGSSNERVM  180

Query  682  -------SRSPPNWWTEELTILDVAFFARIIATMRSRTAKPLTLASAIITYAERSL  828
                    R   +WW E+LT+L + FF R++  M +R  K   +   I+ Y+++SL
Sbjct  181  NSSAASHQRPAVDWWAEDLTVLKIDFFQRVLIAMMARGFKNCGIGPIIMLYSQKSL  236



>ref|XP_006841959.1| PREDICTED: BTB/POZ domain-containing protein At5g67385 [Amborella 
trichopoda]
 gb|ERN03634.1| hypothetical protein AMTR_s00144p00020600 [Amborella trichopoda]
Length=609

 Score =   200 bits (509),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 108/235 (46%), Positives = 152/235 (65%), Gaps = 18/235 (8%)
 Frame = +1

Query  178  LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRIN  357
            LS AM+RT +W+FSQEIP+DV V+ G A+FSLHKF LV+K  Y+RKL+ ++ +ADL+ I 
Sbjct  20   LSSAMKRTSEWIFSQEIPSDVTVQAGGATFSLHKFPLVSKCGYMRKLVSEANDADLSMIE  79

Query  358  LSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFls  537
            +  IPGG E FE AAKFCYG+NFEI+  NVA LRC AEYL+MT+ Y   NL  RTE +++
Sbjct  80   IPDIPGGAEAFELAAKFCYGINFEISTENVAMLRCVAEYLEMTEDYTTGNLVNRTEAYVT  139

Query  538  qvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVEANFPSRSPP-------  696
            +VAL SLSGA+ VL   E LLP+AE +K+V RC++  +     E+ F   S         
Sbjct  140  EVALKSLSGAITVLHRSESLLPMAEKVKLVSRCIDAVAYLTFKESQFSGSSRTDSQESSG  199

Query  697  -----------NWWTEELTILDVAFFARIIATMRSRTAKPLTLASAIITYAERSL  828
                       +WW ++LT+L +  F R++  +++R  K   L   ++ YA++SL
Sbjct  200  SSSVSHPKAIVDWWADDLTVLRIDIFQRVLIALKARGLKEYALGPILMLYAQKSL  254



>ref|XP_010679598.1| PREDICTED: BTB/POZ domain-containing protein At5g67385 isoform 
X2 [Beta vulgaris subsp. vulgaris]
 ref|XP_010679599.1| PREDICTED: BTB/POZ domain-containing protein At5g67385 isoform 
X2 [Beta vulgaris subsp. vulgaris]
 ref|XP_010679600.1| PREDICTED: BTB/POZ domain-containing protein At5g67385 isoform 
X2 [Beta vulgaris subsp. vulgaris]
 ref|XP_010679601.1| PREDICTED: BTB/POZ domain-containing protein At5g67385 isoform 
X2 [Beta vulgaris subsp. vulgaris]
 ref|XP_010679602.1| PREDICTED: BTB/POZ domain-containing protein At5g67385 isoform 
X2 [Beta vulgaris subsp. vulgaris]
 ref|XP_010679603.1| PREDICTED: BTB/POZ domain-containing protein At5g67385 isoform 
X2 [Beta vulgaris subsp. vulgaris]
 ref|XP_010679604.1| PREDICTED: BTB/POZ domain-containing protein At5g67385 isoform 
X2 [Beta vulgaris subsp. vulgaris]
Length=624

 Score =   200 bits (509),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 106/238 (45%), Positives = 150/238 (63%), Gaps = 21/238 (9%)
 Frame = +1

Query  178  LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRIN  357
            L+ AM+RT +W+ SQEIP+DV + + +ASFSLHKF LV+KS YI+KL+ +S ++++  + 
Sbjct  14   LTSAMKRTSEWIISQEIPSDVTINIDDASFSLHKFPLVSKSGYIKKLLSESNDSEICNLE  73

Query  358  LSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFls  537
            +  IPGG E FE AAKFCYG+NFEI   N+A LRC AEYL+MT+ Y   NL GRTE +L+
Sbjct  74   IHDIPGGAEAFELAAKFCYGINFEICTENIAMLRCVAEYLEMTEDYAVGNLVGRTETYLN  133

Query  538  qvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVEANF-------------  678
            +VA+ SLS    +L + E LLP+AE +K+V RCV+  +  AC +  F             
Sbjct  134  EVAVKSLSSCASILLTSENLLPMAEQVKVVSRCVDAIAYLACKDGQFSGSSRVEGGNIEG  193

Query  679  ------PSRSP--PNWWTEELTILDVAFFARIIATMRSRTAKPLTLASAIITYAERSL  828
                  P + P    WW E+LT+L +  F RI+  M +R  K   L   ++ YA++SL
Sbjct  194  GSSSLVPQQKPIVEFWWAEDLTVLRIDMFQRILIAMTARGFKQFALGPLLMLYAQKSL  251



>ref|XP_010679597.1| PREDICTED: BTB/POZ domain-containing protein At5g67385 isoform 
X1 [Beta vulgaris subsp. vulgaris]
Length=634

 Score =   200 bits (509),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 106/238 (45%), Positives = 150/238 (63%), Gaps = 21/238 (9%)
 Frame = +1

Query  178  LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRIN  357
            L+ AM+RT +W+ SQEIP+DV + + +ASFSLHKF LV+KS YI+KL+ +S ++++  + 
Sbjct  24   LTSAMKRTSEWIISQEIPSDVTINIDDASFSLHKFPLVSKSGYIKKLLSESNDSEICNLE  83

Query  358  LSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFls  537
            +  IPGG E FE AAKFCYG+NFEI   N+A LRC AEYL+MT+ Y   NL GRTE +L+
Sbjct  84   IHDIPGGAEAFELAAKFCYGINFEICTENIAMLRCVAEYLEMTEDYAVGNLVGRTETYLN  143

Query  538  qvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVEANF-------------  678
            +VA+ SLS    +L + E LLP+AE +K+V RCV+  +  AC +  F             
Sbjct  144  EVAVKSLSSCASILLTSENLLPMAEQVKVVSRCVDAIAYLACKDGQFSGSSRVEGGNIEG  203

Query  679  ------PSRSP--PNWWTEELTILDVAFFARIIATMRSRTAKPLTLASAIITYAERSL  828
                  P + P    WW E+LT+L +  F RI+  M +R  K   L   ++ YA++SL
Sbjct  204  GSSSLVPQQKPIVEFWWAEDLTVLRIDMFQRILIAMTARGFKQFALGPLLMLYAQKSL  261



>ref|XP_009611132.1| PREDICTED: BTB/POZ domain-containing protein At5g48800-like [Nicotiana 
tomentosiformis]
Length=606

 Score =   199 bits (505),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 103/240 (43%), Positives = 156/240 (65%), Gaps = 22/240 (9%)
 Frame = +1

Query  172  TRLSLAM---ERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEAD  342
            ++LSLA    +R  +WVF +++P+D+ +EV   +FSLHKF LV++S  IRKL+   +++D
Sbjct  6    SQLSLAKCSRQRYSEWVF-RDVPSDITIEVDGGTFSLHKFPLVSRSGRIRKLVAGHRDSD  64

Query  343  LTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRT  522
            ++RI L  +PGG E FE AAKFCYGVNFEIT  NVA L C ++YL+MT+ Y  NNL  R 
Sbjct  65   ISRIELLSLPGGAESFELAAKFCYGVNFEITAANVAQLCCVSDYLEMTEDYSKNNLGSRA  124

Query  523  EDFlsqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVEA----------  672
            E++L  VA  +L   + VLK CE LLPLA++LKIV RC++  ++KACVE           
Sbjct  125  EEYLDIVACKNLEMCVEVLKQCENLLPLADELKIVTRCIDAIASKACVEQIASSFSRLEY  184

Query  673  --------NFPSRSPPNWWTEELTILDVAFFARIIATMRSRTAKPLTLASAIITYAERSL  828
                    N  ++   +WW E+L++L +  + R+I  M+ R  +P ++A++++ YA++ L
Sbjct  185  SSSGRLHMNRQAKCEGDWWIEDLSVLRIDLYQRVITAMKCRGVRPESIAASLVNYAQKEL  244



>ref|XP_010559028.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like isoform 
X1 [Tarenaya hassleriana]
Length=589

 Score =   198 bits (504),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 111/236 (47%), Positives = 155/236 (66%), Gaps = 19/236 (8%)
 Frame = +1

Query  178  LSLAMERTGQW-VFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSK-EADLTR  351
            +S AM+RT +W + SQEIP+DV   VGEASFSLHKF LV+KS +IRKL+ +S  E+D++ 
Sbjct  9    MSSAMKRTSEWWISSQEIPSDVTAHVGEASFSLHKFPLVSKSGFIRKLVSESNNESDISV  68

Query  352  INLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDF  531
            I +  IPGG E FE AAKFCYG+NFEIT  N+A LRCAAEYL+MT+++   NL GR E +
Sbjct  69   IGIHEIPGGAEAFEMAAKFCYGINFEITTENIAMLRCAAEYLEMTEEHSVGNLLGRAEAY  128

Query  532  lsqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVEANFPSRSPPN----  699
            L++VAL SLS ++ VL   E+LLP+AE +K+V RC++  +  AC E+ F   +  N    
Sbjct  129  LNEVALKSLSSSITVLHKAEDLLPMAERVKLVSRCIDAIAYAACQESQFCCTASSNGGNN  188

Query  700  -------------WWTEELTILDVAFFARIIATMRSRTAKPLTLASAIITYAERSL  828
                         WW E+LT+L +  F R++  M +R  K   L   ++ YA+++L
Sbjct  189  EVSVSQNKQLAVDWWAEDLTVLRIDTFQRVLIAMMARGFKQYGLGPVLMLYAQKAL  244



>ref|XP_006364419.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like [Solanum 
tuberosum]
Length=602

 Score =   199 bits (505),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 101/218 (46%), Positives = 146/218 (67%), Gaps = 1/218 (0%)
 Frame = +1

Query  178  LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRIN  357
            LS  M+RT +W+ SQ+IP+D+ + VG  SFSLHKF LV+K  YIRKL+  S +A L+ I 
Sbjct  22   LSNVMKRTSEWILSQDIPSDITIHVGRTSFSLHKFPLVSKCGYIRKLVSKSSDAKLSAIE  81

Query  358  LSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFls  537
            +  IPGG E FE AAKFCY +NFEI   N+A +RC AEYL+MTD+Y   NL G TE +L+
Sbjct  82   IPDIPGGAEAFELAAKFCYDINFEINPENIALIRCVAEYLEMTDEYAVGNLVGLTEAYLN  141

Query  538  qvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVEANFPSRSPP-NWWTEE  714
            +V L S++ ++ +L S E+LLP+AED+K+V R ++  +   C ++ +   S   +WW E+
Sbjct  142  EVGLKSIASSVSILHSSEKLLPIAEDIKLVNRSIDTIAYIVCKDSQYGLNSSTFDWWAED  201

Query  715  LTILDVAFFARIIATMRSRTAKPLTLASAIITYAERSL  828
            LT+L + FF R++  M +R  K   L   +  YA++SL
Sbjct  202  LTVLGIEFFQRVLIAMMARGFKQYALGPILTLYAQKSL  239



>ref|XP_001763717.1| predicted protein [Physcomitrella patens]
 gb|EDQ71359.1| predicted protein [Physcomitrella patens]
Length=599

 Score =   197 bits (502),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 106/212 (50%), Positives = 151/212 (71%), Gaps = 8/212 (4%)
 Frame = +1

Query  211  VFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLI---MDSKEADLTRINLSGIPGGP  381
            V + ++P+D++VE G  +FSLHKF LVA+S  IRKL+   +D++  +L R  L+ +PGG 
Sbjct  22   VLTTDVPSDLVVEAGGMNFSLHKFPLVARSGRIRKLVPNLVDNENPNLLR--LTDVPGGA  79

Query  382  EIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalssls  561
            E F+ AAKFCYG+NFEIT  NVA LRCAAEYL+MT+ Y +NNL  RTE FLS+V L SL+
Sbjct  80   EAFDLAAKFCYGINFEITTSNVAVLRCAAEYLEMTEPYGENNLVARTETFLSEVVLQSLA  139

Query  562  galvvlksCEELLPLAEDLKIVQRCVELASAKACVEANFP--SRSP-PNWWTEELTILDV  732
             ++ VL +CE LLPLAEDL IV +C+E A+ KAC  +NF   S+ P  +WW E+L +L +
Sbjct  140  DSIAVLHNCENLLPLAEDLGIVSKCIESAATKACSSSNFSHASKVPMADWWAEDLAVLRI  199

Query  733  AFFARIIATMRSRTAKPLTLASAIITYAERSL  828
              + R++A MR++  +  ++  A++ +A RSL
Sbjct  200  DLYQRLLAAMRTKGLRVESIGGALMHFAHRSL  231



>ref|XP_007208165.1| hypothetical protein PRUPE_ppa002888mg [Prunus persica]
 gb|EMJ09364.1| hypothetical protein PRUPE_ppa002888mg [Prunus persica]
Length=624

 Score =   198 bits (503),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 113/248 (46%), Positives = 153/248 (62%), Gaps = 22/248 (9%)
 Frame = +1

Query  142  NMASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLI  321
            NM S  K     LS A++RT +W+FSQEIP+DV + VG  SFSLHKF L++K  YIRKLI
Sbjct  17   NMTSKKKEL---LSSALKRTSEWIFSQEIPSDVNIHVGGVSFSLHKFPLISKCGYIRKLI  73

Query  322  MDSKEADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCD  501
             +S +ADL+ I L  +PGG E FE AAKFCYG+NFEI+  N+A LRC AEYL MT+    
Sbjct  74   SESSDADLSVIELPDVPGGAEAFELAAKFCYGINFEISTENIAMLRCVAEYLVMTEDNAV  133

Query  502  NNLAGRTEDFlsqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVEANF-  678
             NL GRT+ +L++VAL SL+GA+ VL   E  LP+AE +K+V RC++  +   C E  F 
Sbjct  134  GNLVGRTDAYLNEVALKSLAGAVSVLHISESFLPMAEKVKLVSRCIDAIALIVCKENQFC  193

Query  679  ------------------PSRSPPNWWTEELTILDVAFFARIIATMRSRTAKPLTLASAI  804
                               S+   +WW E+LT+L +  F R++  M +R  K   L   +
Sbjct  194  VSGMGDSVNESAVSSAVYHSKPVVDWWAEDLTVLRIDIFQRVLIAMMARGFKQYALGPVL  253

Query  805  ITYAERSL  828
            + YA++SL
Sbjct  254  MLYAQKSL  261



>ref|XP_002866705.1| signal transducer [Arabidopsis lyrata subsp. lyrata]
 gb|EFH42964.1| signal transducer [Arabidopsis lyrata subsp. lyrata]
Length=604

 Score =   197 bits (500),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 108/236 (46%), Positives = 155/236 (66%), Gaps = 19/236 (8%)
 Frame = +1

Query  178  LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDS-KEADLTRI  354
            LS AM+RT +W+ SQE+ +DV V VGEASFSLHKF L++K  +I+KL+ +S K++D T I
Sbjct  9    LSSAMKRTSEWISSQEVSSDVTVHVGEASFSLHKFPLLSKCGFIKKLVSESNKDSDSTVI  68

Query  355  NLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFl  534
            N++ IPGG E FE AAKFCYG+NF+++  N+A LRCAAEYL+MT+++   NL  R E +L
Sbjct  69   NITDIPGGSEAFELAAKFCYGINFDMSTENIAMLRCAAEYLEMTEEHSVENLVVRAESYL  128

Query  535  sqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVEANF------------  678
             +VAL SLS ++ VL   EELLP+AE +K+V RC++  +   C E+ F            
Sbjct  129  DEVALKSLSSSITVLHKSEELLPIAERVKLVSRCIDAIAYMTCQESQFCSPSSSNSGNNE  188

Query  679  -----PSRSP-PNWWTEELTILDVAFFARIIATMRSRTAKPLTLASAIITYAERSL  828
                  S+ P  +WW E+LT+L +  F R++  M +R  K   L   ++ YA++SL
Sbjct  189  VVVQQQSKQPVVDWWAEDLTVLRIDLFQRVLIAMMARGFKQYGLGPVLMLYAQKSL  244



>gb|KHN12984.1| BTB/POZ domain-containing protein [Glycine soja]
Length=640

 Score =   197 bits (501),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 113/258 (44%), Positives = 156/258 (60%), Gaps = 41/258 (16%)
 Frame = +1

Query  178  LSLAMERTGQW----------------------VFSQEIPTDVIVEVGEASFSLHKFMLV  291
            LS AM+RT +W                      +FSQEIP+DV V+VGEASFSLHKF LV
Sbjct  24   LSSAMKRTSEWYASCPLNETNTLVAFMSNVHNLIFSQEIPSDVNVQVGEASFSLHKFPLV  83

Query  292  AKSNYIRKLIMDSKEADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAE  471
            +K  YIRKL+ +S +AD++ I L  +PGG E FE AAKFCYG+NF+I V N+A LRC AE
Sbjct  84   SKCGYIRKLVSESNDADVSFIELPEVPGGAEAFELAAKFCYGINFDINVENIATLRCVAE  143

Query  472  YLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELAS  651
            YL+MT+ Y   NL GRT+ +L++VAL +++GA+ +L   E LLP+AE  K+V RC++  +
Sbjct  144  YLEMTEDYSVGNLVGRTDAYLNEVALKTIAGAVSILHMSENLLPIAERAKLVSRCIDAIA  203

Query  652  AKACVEANFPS-------------------RSPPNWWTEELTILDVAFFARIIATMRSRT  774
              AC E+ F S                   R   +WW E+LT+L +  F R+I  M +R 
Sbjct  204  FIACKESQFCSSARSESGSVGVVSSMASNQRPVVDWWAEDLTVLRIDIFQRVIIAMMARG  263

Query  775  AKPLTLASAIITYAERSL  828
             K   +   ++ YA++SL
Sbjct  264  FKQYAIGPILMLYAQKSL  281



>gb|AES90666.2| phototropic-responsive NPH3 family protein [Medicago truncatula]
Length=595

 Score =   196 bits (499),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 108/236 (46%), Positives = 153/236 (65%), Gaps = 23/236 (10%)
 Frame = +1

Query  190  MERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEA--DLTRINLS  363
            M+RT +W +SQEIP+DV +++GEAS+SLHKF L++KS YIRKLI +S +A  D+  I L 
Sbjct  1    MKRTSEWNYSQEIPSDVAIQIGEASYSLHKFPLISKSGYIRKLISESSDAVDDVPLIELI  60

Query  364  GIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqv  543
             +PGG E FE AAKFCYG+NFEI+V N+A LRC AEYL+MT+ Y   NL GRT+ +L++V
Sbjct  61   DVPGGSEAFELAAKFCYGINFEISVENIAMLRCVAEYLEMTEDYSVGNLVGRTDSYLNEV  120

Query  544  alsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVEANFP--------------  681
            AL S+SGA+ +L + E LLP+AE  K+V RC++  +  A  E+ F               
Sbjct  121  ALKSMSGAISILHTSETLLPIAEKAKLVSRCIDAIAFIASKESQFGSSGRSDGSSNERVM  180

Query  682  -------SRSPPNWWTEELTILDVAFFARIIATMRSRTAKPLTLASAIITYAERSL  828
                    R   +WW E+LT+L + FF R++  M +R  K   +   I+ Y+++SL
Sbjct  181  NSSAASHQRPAVDWWAEDLTVLKIDFFQRVLIAMMARGFKNCGIGPIIMLYSQKSL  236



>ref|XP_002521098.1| protein binding protein, putative [Ricinus communis]
 gb|EEF41249.1| protein binding protein, putative [Ricinus communis]
Length=610

 Score =   196 bits (499),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 94/244 (39%), Positives = 156/244 (64%), Gaps = 22/244 (9%)
 Frame = +1

Query  160  KSAATRLSLAM---ERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDS  330
            K    +LSLA    +R  +W+F +++P+D+ +EV   +F+LHKF LV++S  IRKL+ + 
Sbjct  3    KQQQQQLSLAKCSRQRCNEWIF-RDVPSDITIEVSGGTFALHKFPLVSRSGRIRKLVAEH  61

Query  331  KEADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNL  510
            ++AD++R+ L  +PGGPE FE AAKFCYG+NFEIT  NVA L C ++YL+MT+++  +NL
Sbjct  62   RDADISRVELLNLPGGPETFELAAKFCYGINFEITSTNVAQLCCVSDYLEMTEEFSKDNL  121

Query  511  AGRTEDFlsqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVEA------  672
              R E+++  +   +L   + VL+ CE LLPLA++LKIV RC++  ++KAC E       
Sbjct  122  GSRAEEYVESIVCKNLEMCVEVLQQCENLLPLADELKIVSRCIDAIASKACAEQIASSFS  181

Query  673  ------------NFPSRSPPNWWTEELTILDVAFFARIIATMRSRTAKPLTLASAIITYA  816
                        N  ++   +WW E+L+IL +  + R++  M+ R  +P ++ ++++ YA
Sbjct  182  RLEYSSSGRLHMNKQAKCEGDWWIEDLSILRIDLYQRVMTAMKCRGVRPESIGASLVNYA  241

Query  817  ERSL  828
            ++ L
Sbjct  242  QKEL  245



>ref|XP_008352542.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like [Malus 
domestica]
Length=448

 Score =   192 bits (489),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 107/237 (45%), Positives = 150/237 (63%), Gaps = 20/237 (8%)
 Frame = +1

Query  178  LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSK-EADLTRI  354
            LS A++RT +W+FSQEIP+D+ + VG  SFSLHKF L++K  +I+KLI +S   ADL+ I
Sbjct  9    LSSALKRTSEWIFSQEIPSDISINVGGVSFSLHKFPLISKCGHIKKLISESSYAADLSVI  68

Query  355  NLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFl  534
             LS +PGG E FE AA+FCYG+NFE++  N+A LRC AEYL MT+ Y   NL GR + +L
Sbjct  69   ELSDVPGGSEAFELAARFCYGINFELSTGNIAMLRCVAEYLLMTEDYAVGNLVGRADAYL  128

Query  535  sqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVEANFP-----------  681
            ++VAL SL+GA+ VL   E  LP+AE +K+V RC++  +  AC E  F            
Sbjct  129  NEVALKSLAGAVTVLHMSENFLPMAEKVKLVSRCIDAIAFMACKEGQFSVSGRTDGGIEG  188

Query  682  ------SRSPP--NWWTEELTILDVAFFARIIATMRSRTAKPLTLASAIITYAERSL  828
                  S   P  +WW E+LT+L +  F R++  M +R  K   L   ++ YA++SL
Sbjct  189  AVFSAVSHPKPVVDWWAEDLTVLRIDIFQRVMIAMLARGFKQYALGPVLMLYAQKSL  245



>gb|EPS72379.1| hypothetical protein M569_02379, partial [Genlisea aurea]
Length=583

 Score =   195 bits (495),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 107/225 (48%), Positives = 152/225 (68%), Gaps = 9/225 (4%)
 Frame = +1

Query  181  SLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADL-TRIN  357
            S AM+RT +W+FSQEIP+D+ ++VG+ SFSLHKF LV+K  YIR+ + +S EAD  T + 
Sbjct  14   STAMKRTSEWIFSQEIPSDITIKVGDNSFSLHKFPLVSKCGYIRRFVSESDEADDPTTLE  73

Query  358  LSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFls  537
            +  IPGG E F+ AAKFCYG+NFE+   N+AA+RCAAE+L+MT+ Y   NL  R E ++S
Sbjct  74   IDDIPGGAESFDYAAKFCYGINFEMNAGNIAAIRCAAEFLEMTEDYAVGNLVSRAESYIS  133

Query  538  qvalsslsgalvvlksCE--ELLPLAEDLKIVQRCVELASAKACVEANFPSRSPPN----  699
            +VAL+SLS A+ VL +CE   LLP+AED+K+V RC++  +  AC  +       PN    
Sbjct  134  EVALTSLSVAVSVLHTCENNNLLPVAEDVKLVSRCIDAIALFACRGSRLNHLPSPNARPK  193

Query  700  --WWTEELTILDVAFFARIIATMRSRTAKPLTLASAIITYAERSL  828
               WTE+LT+L +  F R++  M SR   P +L   ++ YA++S 
Sbjct  194  VDLWTEDLTLLRIDLFQRVLIAMSSRGFDPPSLGQILMLYAQKSF  238



>ref|XP_009792130.1| PREDICTED: BTB/POZ domain-containing protein At5g48800-like [Nicotiana 
sylvestris]
Length=606

 Score =   195 bits (496),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 98/230 (43%), Positives = 149/230 (65%), Gaps = 19/230 (8%)
 Frame = +1

Query  193  ERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGIP  372
            +R  +WVF +++P+D+ +EV   +FSLHKF LV++S  IRKL+   +++D++RI L  +P
Sbjct  16   QRYSEWVF-RDVPSDITIEVDGGTFSLHKFPLVSRSGRIRKLVAGHRDSDISRIELLSLP  74

Query  373  GGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvals  552
            GG E FE AAKFCYGVNFEIT  NVA L C ++YL+MT+ Y  NNL  R E++L  VA  
Sbjct  75   GGVESFELAAKFCYGVNFEITAANVAQLCCVSDYLEMTEDYSKNNLGSRAEEYLDIVACK  134

Query  553  slsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVEA------------------NF  678
            +L   + VLK CE LLPLA++LKIV RC++  ++KAC E                   N 
Sbjct  135  NLEMCVEVLKQCENLLPLADELKIVTRCIDAIASKACAEQIASSFSRLEYSSSGRLHMNR  194

Query  679  PSRSPPNWWTEELTILDVAFFARIIATMRSRTAKPLTLASAIITYAERSL  828
             ++   +WW E+L++L +  + R+I  M+ R  +P ++A++++ YA++ L
Sbjct  195  QAKCEGDWWIEDLSVLRIDLYQRVITAMKCRGVRPESIAASLVNYAQKEL  244



>ref|XP_008382632.1| PREDICTED: BTB/POZ domain-containing protein At5g48800 [Malus 
domestica]
Length=621

 Score =   195 bits (496),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 95/239 (40%), Positives = 157/239 (66%), Gaps = 23/239 (10%)
 Frame = +1

Query  178  LSLA----MERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADL  345
            LSLA     +R  +W+F +++P+D+ ++V   +FSLHKF LV++S  IR+L+ + +++D+
Sbjct  18   LSLAKSSRQQRYNEWIF-RDVPSDITIQVNGGAFSLHKFPLVSRSGRIRRLVAEHRDSDI  76

Query  346  TRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTE  525
            +R+ L  +PGG E FE AAKFCYG+NFEIT  NVA L CA++YL+MT+++  +NL  RTE
Sbjct  77   SRVELLNLPGGAESFELAAKFCYGINFEITSSNVAQLCCASDYLEMTEEFSKDNLGSRTE  136

Query  526  DFlsqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVEA-----------  672
            ++L  V   +L   + VL+ CE LLPLA++L+IV RC++  ++KACVE            
Sbjct  137  EYLESVVCKNLEMCVEVLQQCESLLPLADELRIVSRCIDAIASKACVEQIASSFSRLEYS  196

Query  673  -------NFPSRSPPNWWTEELTILDVAFFARIIATMRSRTAKPLTLASAIITYAERSL  828
                   N  ++S  +WW E+L+++ V  + R+I  M+ R  +P ++ ++++ YA++ L
Sbjct  197  SSGRLHMNRQAKSDGDWWIEDLSVIRVDLYERVITAMKCRGVRPESIGASLVNYAQKEL  255



>ref|XP_008372448.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like [Malus 
domestica]
Length=448

 Score =   192 bits (487),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 107/237 (45%), Positives = 149/237 (63%), Gaps = 20/237 (8%)
 Frame = +1

Query  178  LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSK-EADLTRI  354
            LS A++RT +W+FSQEIP+D+ + VG  SFSLHKF L+ K  +I+KLI +S   ADL+ I
Sbjct  9    LSSALKRTSEWIFSQEIPSDISINVGGVSFSLHKFPLIXKCGHIKKLISESSYAADLSVI  68

Query  355  NLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFl  534
             LS +PGG E FE AA+FCYG+NFE++  N+A LRC AEYL MT+ Y   NL GR + +L
Sbjct  69   ELSDVPGGSEAFELAARFCYGINFELSTGNIAMLRCVAEYLLMTEDYAVGNLVGRADAYL  128

Query  535  sqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVEANFP-----------  681
            ++VAL SL+GA+ VL   E  LP+AE +K+V RC++  +  AC E  F            
Sbjct  129  NEVALKSLAGAVTVLHMSENFLPMAEKVKLVSRCIDAIAFMACKEGQFSVSGRTDGGIEG  188

Query  682  ------SRSPP--NWWTEELTILDVAFFARIIATMRSRTAKPLTLASAIITYAERSL  828
                  S   P  +WW E+LT+L +  F R++  M +R  K   L   ++ YA++SL
Sbjct  189  AVFSAVSHPKPVVDWWAEDLTVLRIDIFQRVMIAMLARGFKQYALGPVLMLYAQKSL  245



>ref|XP_010939121.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like [Elaeis 
guineensis]
Length=606

 Score =   195 bits (495),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 103/234 (44%), Positives = 151/234 (65%), Gaps = 17/234 (7%)
 Frame = +1

Query  178  LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRIN  357
            LS  M+RT +W+ SQE+P+D+ V  G A+F+LHKF L++K  YIR+L+ ++ +++++ I 
Sbjct  20   LSTTMKRTSEWILSQEVPSDITVHAGGATFALHKFPLISKCGYIRRLVSEANDSNISLIE  79

Query  358  LSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFls  537
            +  +PGG E F  AAKFCYG+NFEIT  N+A LRC AEYL+MT+ Y   NL  RTE FL 
Sbjct  80   IPDVPGGAEAFGFAAKFCYGINFEITTENIAMLRCVAEYLEMTEDYVVGNLVSRTEIFLE  139

Query  538  qvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVEAN--FPS---------  684
            +VAL SL  A+ VL   EELLP+AE +K+V RC++  +  AC +++   PS         
Sbjct  140  EVALMSLPDAVTVLHKSEELLPMAEKVKLVSRCIDAVAYIACKDSHICIPSGTENSHGSL  199

Query  685  ------RSPPNWWTEELTILDVAFFARIIATMRSRTAKPLTLASAIITYAERSL  828
                  ++  +WW EELT+L +  F R++  M++R  K   L   I+ YA++SL
Sbjct  200  YSGLQPKAILDWWAEELTVLRIDTFQRVLMAMKARGFKEYALGPVIMLYAQKSL  253



>ref|XP_009599429.1| PREDICTED: BTB/POZ domain-containing protein At5g48800-like [Nicotiana 
tomentosiformis]
Length=598

 Score =   194 bits (494),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 97/244 (40%), Positives = 153/244 (63%), Gaps = 25/244 (10%)
 Frame = +1

Query  154  PLKSAATRLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSK  333
            PL  + +R     +R  +WVF +++P+D+ +EV    FSLHKF LV++S  IRKL+ + +
Sbjct  9    PLTKSTSR-----QRYNEWVF-RDVPSDITIEVDGGIFSLHKFPLVSRSGRIRKLVAEHR  62

Query  334  EADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLA  513
            ++D++RI L  +PGG E FE AAKFCYGVNFEIT  NVA L C ++YL+M++ Y  NNL 
Sbjct  63   DSDISRIELVSLPGGAESFELAAKFCYGVNFEITAANVAQLCCVSDYLEMSEDYSKNNLG  122

Query  514  GRTEDFlsqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVEA-------  672
             R E++L  +   +L   + VL+ CE LLPLA++LK+V RC++  ++KACVE        
Sbjct  123  SRAEEYLDSIVCKNLEMCVEVLRQCENLLPLADELKVVSRCIDAVASKACVEQIASSFSR  182

Query  673  ------------NFPSRSPPNWWTEELTILDVAFFARIIATMRSRTAKPLTLASAIITYA  816
                        N  +    +WW E++++L +  + R+I  M+ R  +P ++A++++ YA
Sbjct  183  LEYSSSGGRLHMNKQANCELDWWIEDISVLRIDLYQRVITAMKFRGVRPESIAASLVNYA  242

Query  817  ERSL  828
            +R L
Sbjct  243  QREL  246



>ref|XP_007201187.1| hypothetical protein PRUPE_ppa002993mg [Prunus persica]
 gb|EMJ02386.1| hypothetical protein PRUPE_ppa002993mg [Prunus persica]
Length=614

 Score =   194 bits (494),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 95/240 (40%), Positives = 155/240 (65%), Gaps = 23/240 (10%)
 Frame = +1

Query  175  RLSLA----MERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEAD  342
            +LSLA     +R  +W+F +++P+D+ ++V   +FSLHKF LV++S  IRKL+ + +++D
Sbjct  10   QLSLAKSSRQQRNNEWIF-RDVPSDITIQVNGGAFSLHKFPLVSRSGRIRKLVAEHRDSD  68

Query  343  LTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRT  522
            ++R+ L  +PGG E FE AAKFCYG+NFEIT  NVA L CA++YL+MT+++  +NL  R 
Sbjct  69   ISRVELLNLPGGAESFELAAKFCYGINFEITSGNVAQLCCASDYLEMTEEFSKDNLGSRA  128

Query  523  EDFlsqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVEA----------  672
            E++L  +   +L   + VL  CE LLPLA++LKIV RC++  ++KACVE           
Sbjct  129  EEYLECIVCKNLEMCVEVLLQCESLLPLADELKIVSRCIDAIASKACVEQIASSFSRLEY  188

Query  673  --------NFPSRSPPNWWTEELTILDVAFFARIIATMRSRTAKPLTLASAIITYAERSL  828
                    N  ++   +WW E+L++L V  + R+I  M+ R  +P ++ ++++ YA++ L
Sbjct  189  SSSGRLHMNRQAKCDGDWWIEDLSVLRVDLYQRVITAMKCRGVRPESIGASLVNYAQKEL  248



>ref|XP_004288469.1| PREDICTED: BTB/POZ domain-containing protein At5g67385 isoform 
X1 [Fragaria vesca subsp. vesca]
Length=623

 Score =   194 bits (494),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 111/248 (45%), Positives = 157/248 (63%), Gaps = 22/248 (9%)
 Frame = +1

Query  142  NMASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLI  321
            NM+S  K     L+ A++RT +W+FSQEIP+DV V VGE SFSLHKF LV+K  YIRKL+
Sbjct  18   NMSSKKKEL---LTSALKRTSEWIFSQEIPSDVSVRVGEVSFSLHKFPLVSKCGYIRKLV  74

Query  322  MDSKEADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCD  501
             +S + +++ I L  +PGG E FE AAKFCYG+NFEI+  N+A LRC +EYL MT++Y  
Sbjct  75   SESTDDEISVIELPDVPGGAEAFELAAKFCYGINFEISTENIAMLRCVSEYLLMTEEYAI  134

Query  502  NNLAGRTEDFlsqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVEANF-  678
             NL GRT+ +L++VAL SL+GA+ VL + E  LP+AE +K+V RC++  +   C ++ F 
Sbjct  135  GNLVGRTDAYLNEVALKSLAGAVSVLHTAESFLPIAEKVKLVSRCIDAIAYMTCKDSQFC  194

Query  679  -PSRSPP-----------------NWWTEELTILDVAFFARIIATMRSRTAKPLTLASAI  804
               RS                   +WW E+LT+L +  F R +  M +R  K   L   +
Sbjct  195  LSGRSDSGNESLSSSAVYQTKPIVDWWAEDLTVLRIDTFQRALIAMMARGFKQYALGPIL  254

Query  805  ITYAERSL  828
            + YA++SL
Sbjct  255  MLYAQKSL  262



>ref|XP_011089690.1| PREDICTED: BTB/POZ domain-containing protein At5g48800-like isoform 
X4 [Sesamum indicum]
Length=423

 Score =   191 bits (484),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 94/230 (41%), Positives = 153/230 (67%), Gaps = 19/230 (8%)
 Frame = +1

Query  193  ERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGIP  372
            +R  +WVF +++P+D+I++V   +FSLHKF LV++S  IRKL+ + +++D++RI L  +P
Sbjct  17   QRCSEWVF-RDVPSDIIIDVDGGTFSLHKFPLVSRSGRIRKLVAEHRDSDISRIELLSLP  75

Query  373  GGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvals  552
            GG + FE AA+FCYG+NFEIT  NVA L C ++YL+MT++Y  NNL  R E++L  V   
Sbjct  76   GGAKSFELAAQFCYGINFEITAANVAQLCCVSDYLEMTEEYSKNNLGSRAEEYLESVVCK  135

Query  553  slsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVE---ANFP------------SR  687
            +L   + VL+ CE LLPLA++L IV RC++  ++KACVE   ++F             S+
Sbjct  136  NLEMCVEVLQQCENLLPLADELNIVPRCIDAIASKACVEQIASSFSRLEYSSSGRLHMSK  195

Query  688  SPP---NWWTEELTILDVAFFARIIATMRSRTAKPLTLASAIITYAERSL  828
             P    +WW E+L++L +  + R+I  ++ R  +P ++ ++++ YAE+ L
Sbjct  196  QPKCEGDWWIEDLSVLRIDLYQRVITAIKCRGVRPESIGASLVNYAEKEL  245



>ref|XP_009334929.1| PREDICTED: BTB/POZ domain-containing protein At5g48800-like [Pyrus 
x bretschneideri]
Length=687

 Score =   195 bits (496),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 95/239 (40%), Positives = 157/239 (66%), Gaps = 23/239 (10%)
 Frame = +1

Query  178  LSLA----MERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADL  345
            LSLA     +R  +W+F +++P+D+ ++V   +FSLHKF LV++S  IR+L+ + +++D+
Sbjct  84   LSLAKSSRQQRYNEWIF-RDVPSDITIQVNGGAFSLHKFPLVSRSGRIRRLVAEHRDSDI  142

Query  346  TRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTE  525
            +R+ L  +PGG E FE AAKFCYG+NFEIT  NVA L CA++YL+MT+++  +NL  RTE
Sbjct  143  SRVELLNLPGGAESFELAAKFCYGINFEITSSNVAQLCCASDYLEMTEEFSKDNLGSRTE  202

Query  526  DFlsqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVEA-----------  672
            ++L  V   +L   + VL+ CE LLPLA++L+IV RC++  ++KACVE            
Sbjct  203  EYLESVVCKNLEMCVEVLQQCESLLPLADELRIVSRCIDAIASKACVEQIASSFSRLEYS  262

Query  673  -------NFPSRSPPNWWTEELTILDVAFFARIIATMRSRTAKPLTLASAIITYAERSL  828
                   N  ++S  +WW E+L+++ V  + R+I  M+ R  +P ++ ++++ YA++ L
Sbjct  263  SSGRLHMNRQAKSDGDWWIEDLSVIRVDLYERVITAMKCRGVRPESIGASLVNYAQKEL  321



>ref|XP_004247086.1| PREDICTED: BTB/POZ domain-containing protein At5g48800 [Solanum 
lycopersicum]
Length=607

 Score =   194 bits (493),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 96/230 (42%), Positives = 149/230 (65%), Gaps = 19/230 (8%)
 Frame = +1

Query  193  ERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGIP  372
            +R  +WVF +++P+D+++ V   +FSLHKF LV++S  IRKL+   +++D++ I L  +P
Sbjct  17   QRYNEWVF-RDVPSDIMIVVDGGTFSLHKFPLVSRSGRIRKLVAGHRDSDISMIELHSLP  75

Query  373  GGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvals  552
            GG E FE AAKFCYGVNFEIT  NVA L C ++YL+MT++Y  NNL  R E++L  V   
Sbjct  76   GGAESFELAAKFCYGVNFEITSANVAQLYCVSDYLEMTEEYSKNNLGSRAEEYLEVVVSK  135

Query  553  slsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVEA------------------NF  678
            +L   + VLK CE LLPLA++LKIV RC++  ++KACVE                   N 
Sbjct  136  NLEMCVEVLKQCENLLPLADELKIVIRCIDAIASKACVEQIASSFSRLEYSSSGRLHMNR  195

Query  679  PSRSPPNWWTEELTILDVAFFARIIATMRSRTAKPLTLASAIITYAERSL  828
             ++   +WW E+L++L +  + R+I  M+ R  +P ++A++++ YA++ L
Sbjct  196  QAKCEGDWWIEDLSVLRIDLYQRVITAMKCRGVRPESIAASLVNYAQKEL  245



>ref|XP_006356774.1| PREDICTED: BTB/POZ domain-containing protein At5g48800-like [Solanum 
tuberosum]
Length=607

 Score =   194 bits (493),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 96/230 (42%), Positives = 149/230 (65%), Gaps = 19/230 (8%)
 Frame = +1

Query  193  ERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGIP  372
            +R  +WVF +++P+D+++ V   +FSLHKF LV++S  IRKL+   +++D++ I L  +P
Sbjct  17   QRYNEWVF-RDVPSDIMIVVDGGTFSLHKFPLVSRSGRIRKLVAGHRDSDISMIELLSLP  75

Query  373  GGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvals  552
            GG E FE AAKFCYGVNFEIT  NVA L C ++YL+MTD+Y  NNL  R E++L  V   
Sbjct  76   GGAESFELAAKFCYGVNFEITAANVAQLCCVSDYLEMTDEYSKNNLGSRAEEYLEVVVSK  135

Query  553  slsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVEA------------------NF  678
            +L   + VLK CE LLPLA++LK+V RC++  ++KACVE                   N 
Sbjct  136  NLEMCVEVLKQCENLLPLADELKVVIRCIDAIASKACVEQIASSFSRLEYSSSGRLHMNR  195

Query  679  PSRSPPNWWTEELTILDVAFFARIIATMRSRTAKPLTLASAIITYAERSL  828
             ++   +WW E+L++L +  + R+I  M+ R  +P ++A++++ YA++ L
Sbjct  196  QAKCEGDWWIEDLSVLRIDLYQRVITAMKCRGVRPESIAASLVNYAQKEL  245



>ref|XP_009342777.1| PREDICTED: BTB/POZ domain-containing protein At5g67385 [Pyrus 
x bretschneideri]
Length=629

 Score =   194 bits (494),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 111/249 (45%), Positives = 154/249 (62%), Gaps = 23/249 (9%)
 Frame = +1

Query  142  NMASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLI  321
            NM+S  K     LS A++RT +W+FSQEIP+D+ + VG  SFSLHKF L++K  +IRKLI
Sbjct  21   NMSSKKKEL---LSSALKRTSEWIFSQEIPSDISINVGGVSFSLHKFPLISKCGHIRKLI  77

Query  322  MDSKEA-DLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYC  498
             +S +A DL+ I LS +PGG E FE AAKFCYG+NFEI+  N+A LRC AEYL MT+ Y 
Sbjct  78   SESSDAADLSIIELSDVPGGSEAFELAAKFCYGINFEISTENIAMLRCVAEYLLMTEDYA  137

Query  499  DNNLAGRTEDFlsqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVEANF  678
              NL GR + +L++VAL S +GA+ VL   E  LP+AE +K+V RC++  +  AC E+ F
Sbjct  138  VGNLVGRADAYLNEVALKSPAGAVTVLHMSESFLPMAEKVKLVNRCIDAIAFIACKESQF  197

Query  679  PSRSPP-------------------NWWTEELTILDVAFFARIIATMRSRTAKPLTLASA  801
               S                     +WW E+L +L +  F R++  M +R  K   L   
Sbjct  198  SVSSRADGGNEGVVSSVVYHPKPVVDWWAEDLIVLRIDMFQRVMIAMMARGFKQYALGPV  257

Query  802  IITYAERSL  828
            ++ YA++SL
Sbjct  258  LMLYAQKSL  266



>ref|XP_008235484.1| PREDICTED: BTB/POZ domain-containing protein At5g48800 [Prunus 
mume]
Length=614

 Score =   194 bits (493),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 95/240 (40%), Positives = 155/240 (65%), Gaps = 23/240 (10%)
 Frame = +1

Query  175  RLSLA----MERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEAD  342
            +LSLA     +R  +W+F +++P+D+ ++V   +FSLHKF LV++S  IRKL+ + +++D
Sbjct  10   QLSLAKSSRQQRNNEWIF-RDVPSDITIQVNGGAFSLHKFPLVSRSGRIRKLVAEHRDSD  68

Query  343  LTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRT  522
            ++R+ L  +PGG E FE AAKFCYG+NFEIT  NVA L CA++YL+MT+++  +NL  R 
Sbjct  69   ISRVELLHLPGGAESFELAAKFCYGINFEITSGNVAQLCCASDYLEMTEEFSKDNLGSRA  128

Query  523  EDFlsqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVEA----------  672
            E++L  +   +L   + VL  CE LLPLA++LKIV RC++  ++KACVE           
Sbjct  129  EEYLECIVCKNLEMCVEVLLQCESLLPLADELKIVSRCIDAIASKACVEQIASSFSRLEY  188

Query  673  --------NFPSRSPPNWWTEELTILDVAFFARIIATMRSRTAKPLTLASAIITYAERSL  828
                    N  ++   +WW E+L++L V  + R+I  M+ R  +P ++ ++++ YA++ L
Sbjct  189  SSSGRLHMNRQAKCDGDWWIEDLSVLRVDLYQRVITAMKCRGVRPESIGASLVNYAQKEL  248



>ref|XP_008354715.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like [Malus 
domestica]
Length=626

 Score =   194 bits (492),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 108/237 (46%), Positives = 150/237 (63%), Gaps = 20/237 (8%)
 Frame = +1

Query  178  LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEA-DLTRI  354
            LS A++RT +W+FSQEIP+D+ + VG  SFSLHKF L++K  +IRKLI +S +A DL+ I
Sbjct  27   LSSALKRTSEWIFSQEIPSDISINVGGVSFSLHKFPLISKCGHIRKLISESSDAADLSVI  86

Query  355  NLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFl  534
             LS +PGG E FE AAKFCYG+NFEI+  N+A LRC AEYL MT+ Y   NL GR + +L
Sbjct  87   ELSDVPGGSEAFELAAKFCYGINFEISTENIAMLRCVAEYLLMTEDYGVGNLVGRADAYL  146

Query  535  sqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVEANFPSRSPP------  696
            ++VAL SL+GA+ VL   E  LP+AE +K+V RC++  +  AC E+ F   S        
Sbjct  147  NEVALKSLAGAVTVLHMSESFLPMAEKVKLVNRCIDAIAFIACKESQFSVSSRADGGNEG  206

Query  697  -------------NWWTEELTILDVAFFARIIATMRSRTAKPLTLASAIITYAERSL  828
                         +WW E+L +L +  F R++  M +R  K   L   ++ YA++SL
Sbjct  207  AVSSAVYHPKPVVDWWAEDLIVLRIDMFQRVMIAMMARGFKQYALGPVLMLYAQKSL  263



>ref|XP_004511857.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like isoform 
X1 [Cicer arietinum]
 ref|XP_004511858.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like isoform 
X2 [Cicer arietinum]
Length=679

 Score =   194 bits (494),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 104/226 (46%), Positives = 147/226 (65%), Gaps = 20/226 (9%)
 Frame = +1

Query  211  VFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGIPGGPEIF  390
            +FSQEIP+DV V VGEASFS+HKF LV+K  YIRKL+ +S +AD+  I LS +PGG E F
Sbjct  86   IFSQEIPSDVKVRVGEASFSIHKFPLVSKCGYIRKLVSESGDADVPLIELSDVPGGAEAF  145

Query  391  ERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgal  570
            E AAKFCYG+NFEI V N+A LRC AEYL+MT++Y   NL GRT+ +L+ VAL +++GA+
Sbjct  146  ELAAKFCYGINFEINVENIATLRCVAEYLEMTEEYAVGNLVGRTDAYLNDVALKTIAGAV  205

Query  571  vvlksCEELLPLAEDLKIVQRCVELASAKACVEANF------------------PSRSPP  696
             +L   E LLP+AE  K++ +C++  +  AC E+                    PS+  P
Sbjct  206  SILHMSESLLPIAEKAKLMSKCIDAIAYIACKESQLSTSGRSDNSGSDGVASSIPSQQRP  265

Query  697  --NWWTEELTILDVAFFARIIATMRSRTAKPLTLASAIITYAERSL  828
              +WW E+LT+L +  F R++  M +R  K   +   ++ YA++SL
Sbjct  266  VVDWWAEDLTVLRIDIFQRVLIAMMARGFKQFAIGPILMLYAQKSL  311



>ref|XP_004511859.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like isoform 
X3 [Cicer arietinum]
Length=678

 Score =   194 bits (494),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 104/226 (46%), Positives = 147/226 (65%), Gaps = 20/226 (9%)
 Frame = +1

Query  211  VFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGIPGGPEIF  390
            +FSQEIP+DV V VGEASFS+HKF LV+K  YIRKL+ +S +AD+  I LS +PGG E F
Sbjct  86   IFSQEIPSDVKVRVGEASFSIHKFPLVSKCGYIRKLVSESGDADVPLIELSDVPGGAEAF  145

Query  391  ERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgal  570
            E AAKFCYG+NFEI V N+A LRC AEYL+MT++Y   NL GRT+ +L+ VAL +++GA+
Sbjct  146  ELAAKFCYGINFEINVENIATLRCVAEYLEMTEEYAVGNLVGRTDAYLNDVALKTIAGAV  205

Query  571  vvlksCEELLPLAEDLKIVQRCVELASAKACVEANF------------------PSRSPP  696
             +L   E LLP+AE  K++ +C++  +  AC E+                    PS+  P
Sbjct  206  SILHMSESLLPIAEKAKLMSKCIDAIAYIACKESQLSTSGRSDNSGSDGVASSIPSQQRP  265

Query  697  --NWWTEELTILDVAFFARIIATMRSRTAKPLTLASAIITYAERSL  828
              +WW E+LT+L +  F R++  M +R  K   +   ++ YA++SL
Sbjct  266  VVDWWAEDLTVLRIDIFQRVLIAMMARGFKQFAIGPILMLYAQKSL  311



>ref|XP_001770455.1| predicted protein [Physcomitrella patens]
 gb|EDQ64792.1| predicted protein [Physcomitrella patens]
Length=622

 Score =   194 bits (492),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 110/224 (49%), Positives = 151/224 (67%), Gaps = 20/224 (9%)
 Frame = +1

Query  211  VFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIM---DSKEADLTRINLSGIPGGP  381
            V + ++P+D++VE G  +FSLHKF LVA+S  IRKL+    DS+  +L  + L+ +PGG 
Sbjct  27   VLTTDVPSDIVVEAGGMNFSLHKFPLVARSGRIRKLVANLADSENPNL--LQLTDVPGGA  84

Query  382  EIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalssls  561
            E F+ AAKFCYG+NFEIT  NVA LRCAAEYL MT+ Y +NNL  RTE FLS+V L SL+
Sbjct  85   EAFDLAAKFCYGINFEITTSNVAVLRCAAEYLDMTESYGENNLVARTEAFLSEVVLQSLA  144

Query  562  galvvlksCEELLPLAEDLKIVQRCVELASAKACVE----ANFP----------SRSP-P  696
             ++ VL +CE LLPLAEDL IV RC+E A+ KAC E    ANF           S+ P  
Sbjct  145  DSIAVLHNCENLLPLAEDLGIVSRCIESAATKACREQNSNANFKLSSSSNLSHASKVPMA  204

Query  697  NWWTEELTILDVAFFARIIATMRSRTAKPLTLASAIITYAERSL  828
            +WW E+L +L + F+ R++A MR +  +  ++  A++ +A+RSL
Sbjct  205  DWWAEDLAVLRIDFYQRVLAAMRMKGLRVESIGGALMHFAQRSL  248



>ref|XP_006380638.1| hypothetical protein POPTR_0007s10060g [Populus trichocarpa]
 gb|ERP58435.1| hypothetical protein POPTR_0007s10060g [Populus trichocarpa]
Length=643

 Score =   193 bits (491),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 106/225 (47%), Positives = 146/225 (65%), Gaps = 19/225 (8%)
 Frame = +1

Query  211  VFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGIPGGPEIF  390
            +FSQEIP+DV V  G ASFSLHKF LV+KS YIRK++ +S +ADL+ I +  +PGG E F
Sbjct  62   IFSQEIPSDVTVHAGGASFSLHKFPLVSKSGYIRKMVSESSDADLSEIKIPNVPGGAEAF  121

Query  391  ERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgal  570
            E AAKFCYG+NFEI+  N+A LRC AEYL+MT+ Y   NL  RT+ +L++VAL SL+GA+
Sbjct  122  ELAAKFCYGINFEISTENIAMLRCVAEYLEMTEDYAVGNLVSRTDAYLNEVALKSLAGAV  181

Query  571  vvlksCEELLPLAEDLKIVQRCVELASAKACVEANFP-----------------SRSPP-  696
             VL   E LLP+AE +K+V RC++  +  AC E+ F                  S+  P 
Sbjct  182  SVLHLSENLLPMAEKVKLVSRCLDAIALAACKESQFSMSGRSDSGNEVVISSIVSQPKPI  241

Query  697  -NWWTEELTILDVAFFARIIATMRSRTAKPLTLASAIITYAERSL  828
             +WW E+LT+L +  F R++  M +R  K   L   ++ YA++SL
Sbjct  242  VDWWAEDLTVLRIDIFQRVLIAMMARGFKQYALGPVLMLYAQKSL  286



>ref|XP_011089103.1| PREDICTED: BTB/POZ domain-containing protein At5g48800 [Sesamum 
indicum]
Length=612

 Score =   192 bits (489),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 93/230 (40%), Positives = 150/230 (65%), Gaps = 19/230 (8%)
 Frame = +1

Query  193  ERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGIP  372
            +R  +WVF +++P+D+ +EV  A+FSLHKF LV++S  IRKL+ + +++D++ I L G+P
Sbjct  17   QRCSEWVF-RDVPSDITIEVDGAAFSLHKFPLVSRSGRIRKLVAEHRDSDISGIELPGLP  75

Query  373  GGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvals  552
            GG E FE AA+FCYGVNFEIT  NVA L C ++YL+MT++Y  NNL  R E++L  +   
Sbjct  76   GGAESFELAAQFCYGVNFEITAANVAQLCCVSDYLEMTEEYSKNNLGLRCEEYLESIVCK  135

Query  553  slsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVEA------------------NF  678
            +L   + VL+ CE L PLA++LKIV RC++  ++KAC E                   + 
Sbjct  136  NLEMCVEVLQQCENLFPLADELKIVTRCIDATASKACAEQIASSFSRLEYSSSGRLHMSK  195

Query  679  PSRSPPNWWTEELTILDVAFFARIIATMRSRTAKPLTLASAIITYAERSL  828
             ++   +WW E+L++L +  + R+IA M+ R  +P ++ ++++ YA++ L
Sbjct  196  QTKCEGDWWIEDLSVLRIDLYQRVIAAMKCRGVRPESIGASLVNYAQKEL  245



>ref|XP_011623754.1| PREDICTED: BTB/POZ domain-containing protein At5g48800 [Amborella 
trichopoda]
Length=615

 Score =   192 bits (487),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 95/230 (41%), Positives = 146/230 (63%), Gaps = 19/230 (8%)
 Frame = +1

Query  193  ERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGIP  372
            +R  +W+FS ++P+D+++EV  A+F LHKF LV++S  IRKLI + +++D++R+ L  +P
Sbjct  19   QRRNEWIFS-DVPSDIMIEVNGATFPLHKFPLVSRSGRIRKLIAERRDSDISRLELFNLP  77

Query  373  GGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvals  552
            GG   FE AAKFCYG+NFEIT  NVA L C +EYL+MT+ Y   NLA R E +L  V   
Sbjct  78   GGAVAFELAAKFCYGINFEITASNVAQLYCVSEYLEMTEDYAKENLASRAEAYLDGVVCK  137

Query  553  slsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVE------------------ANF  678
            +L  ++ VL  CE LLPLAE+LK+V RC +  ++KAC E                   N 
Sbjct  138  NLEKSVEVLHQCENLLPLAEELKLVGRCTDAIASKACTEQIASSFSRLEYSSSGRLHTNR  197

Query  679  PSRSPPNWWTEELTILDVAFFARIIATMRSRTAKPLTLASAIITYAERSL  828
             ++   +WW E+L++L +  + R+I  MR R  +P ++ ++++ YA++ L
Sbjct  198  QAKCSGDWWIEDLSVLRIDMYQRVITAMRCRGVRPESIGASLVNYAQKFL  247



>ref|XP_010028108.1| PREDICTED: BTB/POZ domain-containing protein At5g67385 isoform 
X3 [Eucalyptus grandis]
Length=597

 Score =   191 bits (486),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 107/225 (48%), Positives = 143/225 (64%), Gaps = 19/225 (8%)
 Frame = +1

Query  211  VFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGIPGGPEIF  390
            +FSQEIP+DV V     SF+LHKF LV++   IRKL+ +S EADL+ I L GIPGG E F
Sbjct  14   IFSQEIPSDVTVHAAGTSFALHKFPLVSRCGCIRKLVSESSEADLSNIELVGIPGGAEAF  73

Query  391  ERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgal  570
            E AAKFCYG+NFEI+  N+A LRCAAEYL+MT+ Y   NL GRTE +L +VAL S++GA+
Sbjct  74   ELAAKFCYGINFEISTKNIAMLRCAAEYLEMTEDYAVGNLVGRTEAYLKEVALKSIAGAI  133

Query  571  vvlksCEELLPLAEDLKIVQRCVELASAKACVEANFP------------------SRSP-  693
             VL   E LLP+AE +K+V RC++  +  AC E+ F                    +SP 
Sbjct  134  TVLHMTESLLPIAEKVKLVVRCIDAIAFLACKESQFSVNGGNEDGNAMISSMVSHQKSPF  193

Query  694  PNWWTEELTILDVAFFARIIATMRSRTAKPLTLASAIITYAERSL  828
              WW E+LT+L +  F R++  M +R  K   L   ++ YA++SL
Sbjct  194  VEWWAEDLTVLRIDIFQRVLVAMTARGYKQYALGPILMLYAQKSL  238



>ref|XP_010685004.1| PREDICTED: BTB/POZ domain-containing protein At5g48800 [Beta 
vulgaris subsp. vulgaris]
Length=610

 Score =   191 bits (486),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 95/230 (41%), Positives = 151/230 (66%), Gaps = 19/230 (8%)
 Frame = +1

Query  193  ERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGIP  372
            +R+ +W+F +++P+D+ +EV   +F+LHKF LV++S  +RKL+ D +++D+++I L  +P
Sbjct  17   QRSNEWIF-RDVPSDITLEVPGGTFALHKFPLVSRSGRLRKLVADYRDSDISKIELPNLP  75

Query  373  GGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvals  552
            GG E FE AAKFCYG NFEIT  NVA L C ++YL+MT+ Y  ++L  R E++L  V   
Sbjct  76   GGAESFELAAKFCYGNNFEITPANVAQLCCVSDYLEMTENYSKDSLGSRAEEYLDSVVCK  135

Query  553  slsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVEA------------------NF  678
            +L   + VLK CE LLPLA++LKIV RC++  ++KACVE                   + 
Sbjct  136  NLEMCVEVLKQCENLLPLADELKIVGRCIDAIASKACVEQIASSFSRLEYSSSGRLNLSR  195

Query  679  PSRSPPNWWTEELTILDVAFFARIIATMRSRTAKPLTLASAIITYAERSL  828
            P +   +WW E+L++L V F+ R+I+ M+ R  +P ++ +++I YAE+ L
Sbjct  196  PVKCEGDWWIEDLSVLRVDFYQRVISAMKCRGVRPESVGASLINYAEKEL  245



>ref|XP_011089687.1| PREDICTED: BTB/POZ domain-containing protein At5g48800-like isoform 
X2 [Sesamum indicum]
 ref|XP_011089688.1| PREDICTED: BTB/POZ domain-containing protein At5g48800-like isoform 
X2 [Sesamum indicum]
Length=607

 Score =   191 bits (486),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 94/230 (41%), Positives = 153/230 (67%), Gaps = 19/230 (8%)
 Frame = +1

Query  193  ERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGIP  372
            +R  +WVF +++P+D+I++V   +FSLHKF LV++S  IRKL+ + +++D++RI L  +P
Sbjct  17   QRCSEWVF-RDVPSDIIIDVDGGTFSLHKFPLVSRSGRIRKLVAEHRDSDISRIELLSLP  75

Query  373  GGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvals  552
            GG + FE AA+FCYG+NFEIT  NVA L C ++YL+MT++Y  NNL  R E++L  V   
Sbjct  76   GGAKSFELAAQFCYGINFEITAANVAQLCCVSDYLEMTEEYSKNNLGSRAEEYLESVVCK  135

Query  553  slsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVE---ANFP------------SR  687
            +L   + VL+ CE LLPLA++L IV RC++  ++KACVE   ++F             S+
Sbjct  136  NLEMCVEVLQQCENLLPLADELNIVPRCIDAIASKACVEQIASSFSRLEYSSSGRLHMSK  195

Query  688  SPP---NWWTEELTILDVAFFARIIATMRSRTAKPLTLASAIITYAERSL  828
             P    +WW E+L++L +  + R+I  ++ R  +P ++ ++++ YAE+ L
Sbjct  196  QPKCEGDWWIEDLSVLRIDLYQRVITAIKCRGVRPESIGASLVNYAEKEL  245



>ref|XP_009766799.1| PREDICTED: BTB/POZ domain-containing protein At5g48800-like isoform 
X1 [Nicotiana sylvestris]
Length=598

 Score =   191 bits (484),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 97/244 (40%), Positives = 153/244 (63%), Gaps = 25/244 (10%)
 Frame = +1

Query  154  PLKSAATRLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSK  333
            PL  + +R     +R  +WVF +++P+D+ +EV    FSLHKF LV++S  IR+L+ + +
Sbjct  9    PLTKSTSR-----QRYNEWVF-RDVPSDITIEVDGGIFSLHKFPLVSRSGRIRRLVAEHR  62

Query  334  EADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLA  513
            ++D++RI L  +PGG E FE AAKFCYGVNFEIT  NVA L C ++YL+M++ Y  NNL 
Sbjct  63   DSDISRIELVSLPGGTESFELAAKFCYGVNFEITAANVAQLCCVSDYLEMSEDYSKNNLG  122

Query  514  GRTEDFlsqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVEANFPSRS-  690
             R E++L  +   +L   + VL+ CE LLPLA++LKIV RC++  ++KACVE    S S 
Sbjct  123  SRAEEYLDSIVCKNLEMCVEVLRQCENLLPLADELKIVSRCIDAVASKACVEQIASSFSR  182

Query  691  ------------------PPNWWTEELTILDVAFFARIIATMRSRTAKPLTLASAIITYA  816
                                +WW E++++L +  + R+I  M+ R  +P ++A++++ YA
Sbjct  183  LEYSSSGGRLHMIKQANCELDWWIEDISMLRIDLYQRVITAMKFRGVRPESIAASLVNYA  242

Query  817  ERSL  828
            ++ L
Sbjct  243  QKEL  246



>ref|XP_011089689.1| PREDICTED: BTB/POZ domain-containing protein At5g48800-like isoform 
X3 [Sesamum indicum]
Length=603

 Score =   191 bits (485),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 94/230 (41%), Positives = 153/230 (67%), Gaps = 19/230 (8%)
 Frame = +1

Query  193  ERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGIP  372
            +R  +WVF +++P+D+I++V   +FSLHKF LV++S  IRKL+ + +++D++RI L  +P
Sbjct  17   QRCSEWVF-RDVPSDIIIDVDGGTFSLHKFPLVSRSGRIRKLVAEHRDSDISRIELLSLP  75

Query  373  GGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvals  552
            GG + FE AA+FCYG+NFEIT  NVA L C ++YL+MT++Y  NNL  R E++L  V   
Sbjct  76   GGAKSFELAAQFCYGINFEITAANVAQLCCVSDYLEMTEEYSKNNLGSRAEEYLESVVCK  135

Query  553  slsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVE---ANFP------------SR  687
            +L   + VL+ CE LLPLA++L IV RC++  ++KACVE   ++F             S+
Sbjct  136  NLEMCVEVLQQCENLLPLADELNIVPRCIDAIASKACVEQIASSFSRLEYSSSGRLHMSK  195

Query  688  SPP---NWWTEELTILDVAFFARIIATMRSRTAKPLTLASAIITYAERSL  828
             P    +WW E+L++L +  + R+I  ++ R  +P ++ ++++ YAE+ L
Sbjct  196  QPKCEGDWWIEDLSVLRIDLYQRVITAIKCRGVRPESIGASLVNYAEKEL  245



>ref|XP_010524688.1| PREDICTED: BTB/POZ domain-containing protein At5g48800 [Tarenaya 
hassleriana]
Length=633

 Score =   191 bits (485),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 88/227 (39%), Positives = 149/227 (66%), Gaps = 19/227 (8%)
 Frame = +1

Query  202  GQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGIPGGP  381
             +W+F +++P+D+ ++V   +F+LHKF LV++S  IRK+I + ++AD++++ L  +PGG 
Sbjct  38   SEWIF-RDVPSDITIDVNSGTFALHKFPLVSRSGRIRKIIAEHRDADISKVELLNLPGGA  96

Query  382  EIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalssls  561
            E FE AAKFCYG+NFEIT  NVA L C ++YL+MT+ Y  +NLA R E++L  +   +L 
Sbjct  97   ETFEMAAKFCYGINFEITSSNVAQLCCVSDYLEMTEDYSKDNLASRAEEYLESIVCKNLE  156

Query  562  galvvlksCEELLPLAEDLKIVQRCVELASAKACVEA------------------NFPSR  687
              + VL+ CE LLPLA++LKIV RC++  ++KAC E                   +  ++
Sbjct  157  MCVQVLQQCESLLPLADELKIVSRCIDSIASKACAEQIASSFSRLEYSSSGRLHMSRQAK  216

Query  688  SPPNWWTEELTILDVAFFARIIATMRSRTAKPLTLASAIITYAERSL  828
            S  +WW E+L++L +  + R+I  M+ R  +P ++ +++++YA++ L
Sbjct  217  SEGDWWIEDLSVLRIDLYQRVITAMKCRGVRPESIGASLVSYAQKEL  263



>ref|XP_010109730.1| BTB/POZ domain-containing protein [Morus notabilis]
 gb|EXC24200.1| BTB/POZ domain-containing protein [Morus notabilis]
Length=626

 Score =   191 bits (485),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 93/238 (39%), Positives = 152/238 (64%), Gaps = 22/238 (9%)
 Frame = +1

Query  178  LSLAM---ERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLT  348
            LSLA     R  +W+F +++P+D+ +EV   +FSLHKF LV++S  IR+L+ + +++D++
Sbjct  16   LSLAKSSRHRCSEWIF-RDVPSDITLEVSGGTFSLHKFPLVSRSGRIRRLVAEYRDSDVS  74

Query  349  RINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTED  528
            R+ L  +PGG E FE AAKFCYG+NFEIT  NVA L C ++YL+MT++Y  +NL  R E+
Sbjct  75   RVELLNLPGGAETFELAAKFCYGINFEITSTNVAQLCCVSDYLEMTEEYSKDNLGSRAEE  134

Query  529  FlsqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVEA------------  672
            ++  +   +L   + VL+ CE LLPLA++LKIV RC++  ++KAC E             
Sbjct  135  YIESIVCKNLEMCVEVLQQCENLLPLADELKIVSRCIDAIASKACAEQIASSFSRLEYSS  194

Query  673  ------NFPSRSPPNWWTEELTILDVAFFARIIATMRSRTAKPLTLASAIITYAERSL  828
                  N  ++   +WW E+L+IL +  + R+I  M+ R  +P ++ ++++ YA++ L
Sbjct  195  SGRLHMNRQAKCEGDWWIEDLSILRIDLYQRVITAMKCRGVRPESIGASLVNYAQKEL  252



>emb|CDY43566.1| BnaC02g16630D [Brassica napus]
Length=295

 Score =   184 bits (466),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 101/220 (46%), Positives = 149/220 (68%), Gaps = 3/220 (1%)
 Frame = +1

Query  178  LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDS-KEADLTRI  354
            LS AM+RT +W+ SQE+ +DV V VGEASFSLHKF L++K    +KL+ +S  ++D T I
Sbjct  9    LSSAMKRTSEWISSQEVSSDVTVHVGEASFSLHKFPLLSKCGLFKKLVSESTNDSDATVI  68

Query  355  NLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFl  534
             +  IPG  E FE   KFCYG+NF+++  N+A LRCA+EYL+MT+++   NL  R+E +L
Sbjct  69   KIPDIPGSSEAFELTTKFCYGINFDMSTENIAMLRCASEYLEMTEEHSVENLVSRSEAYL  128

Query  535  sqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVEAN-FPSRSP-PNWWT  708
            ++VAL SLS A+ VL   EELLP+AE +K+V RC++  +   C E++   S+ P  +WW 
Sbjct  129  NEVALKSLSSAITVLHKSEELLPIAERVKLVSRCIDAIAYMTCQESHEVVSKQPVVDWWA  188

Query  709  EELTILDVAFFARIIATMRSRTAKPLTLASAIITYAERSL  828
            E+LT+L +  F R++  M +R  K   L   ++ YA++SL
Sbjct  189  EDLTVLRIDSFQRVLIEMMARGFKQYGLGPVLMLYAQKSL  228



>ref|XP_011089686.1| PREDICTED: BTB/POZ domain-containing protein At5g48800-like isoform 
X1 [Sesamum indicum]
Length=620

 Score =   191 bits (484),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 94/230 (41%), Positives = 153/230 (67%), Gaps = 19/230 (8%)
 Frame = +1

Query  193  ERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGIP  372
            +R  +WVF +++P+D+I++V   +FSLHKF LV++S  IRKL+ + +++D++RI L  +P
Sbjct  17   QRCSEWVF-RDVPSDIIIDVDGGTFSLHKFPLVSRSGRIRKLVAEHRDSDISRIELLSLP  75

Query  373  GGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvals  552
            GG + FE AA+FCYG+NFEIT  NVA L C ++YL+MT++Y  NNL  R E++L  V   
Sbjct  76   GGAKSFELAAQFCYGINFEITAANVAQLCCVSDYLEMTEEYSKNNLGSRAEEYLESVVCK  135

Query  553  slsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVE---ANFP------------SR  687
            +L   + VL+ CE LLPLA++L IV RC++  ++KACVE   ++F             S+
Sbjct  136  NLEMCVEVLQQCENLLPLADELNIVPRCIDAIASKACVEQIASSFSRLEYSSSGRLHMSK  195

Query  688  SPP---NWWTEELTILDVAFFARIIATMRSRTAKPLTLASAIITYAERSL  828
             P    +WW E+L++L +  + R+I  ++ R  +P ++ ++++ YAE+ L
Sbjct  196  QPKCEGDWWIEDLSVLRIDLYQRVITAIKCRGVRPESIGASLVNYAEKEL  245



>ref|XP_004240632.1| PREDICTED: BTB/POZ domain-containing protein At5g48800-like [Solanum 
lycopersicum]
Length=599

 Score =   190 bits (483),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 97/243 (40%), Positives = 155/243 (64%), Gaps = 24/243 (10%)
 Frame = +1

Query  154  PLKSAATRLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSK  333
            PL  +A+R     +R  +WVF +++P+D+ +EV  A FSLHKF LV++S  IR+L+ + +
Sbjct  12   PLTKSASR-----QRYNEWVF-RDVPSDITIEVDGAIFSLHKFPLVSRSGRIRRLVAEHR  65

Query  334  EADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLA  513
            ++D++RI L  +PGG E FE AAKFCYGVNFEIT  NVA L C ++YL+M++ +  NNL 
Sbjct  66   DSDISRIELVSLPGGSESFELAAKFCYGVNFEITSSNVAQLCCVSDYLEMSEDHSKNNLG  125

Query  514  GRTEDFlsqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVEANFPSRS-  690
             R E++L  +   +L   + VL+  E LLPLA++LKI+ RC++  ++KACVE    S S 
Sbjct  126  SRAEEYLDSIVCKNLEMCVEVLRQSENLLPLADELKIITRCIDAVASKACVEQIASSFSR  185

Query  691  -----------------PPNWWTEELTILDVAFFARIIATMRSRTAKPLTLASAIITYAE  819
                               +WW E+L++L +  + R+I  M+ R  +P ++A+++++YA+
Sbjct  186  LEYSSSGRLHMSKQANCEGDWWIEDLSVLRIDLYQRVITAMKFRGVRPESIAASLVSYAQ  245

Query  820  RSL  828
            + L
Sbjct  246  KEL  248



>gb|EYU40606.1| hypothetical protein MIMGU_mgv1a003057mg [Erythranthe guttata]
Length=611

 Score =   190 bits (483),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 91/230 (40%), Positives = 153/230 (67%), Gaps = 19/230 (8%)
 Frame = +1

Query  193  ERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGIP  372
            ++  +WVF +++P+D+I+EV  A+FSLHKF LV++S  +RKL+ + +E+D++RI L  +P
Sbjct  20   QKCSEWVF-RDVPSDIIIEVDGATFSLHKFPLVSRSGRMRKLVAEHRESDISRIELLSLP  78

Query  373  GGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvals  552
            GG   FE AA+FCYG+NFEI+  NVA L C ++YL+MT++Y +NNL+ R E++L+ +   
Sbjct  79   GGAASFELAAQFCYGINFEISTSNVAHLCCVSDYLEMTEEYSNNNLSSRAEEYLNTIVCK  138

Query  553  slsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVEANFPS----------------  684
            +L   + VL  C+ LLPL+++LKIV RC++  ++KACVE    S                
Sbjct  139  NLEMCVQVLHHCQTLLPLSDNLKIVTRCIDGIASKACVEQIASSFSRLEYSSSGRLHMSK  198

Query  685  --RSPPNWWTEELTILDVAFFARIIATMRSRTAKPLTLASAIITYAERSL  828
              ++  +WW E+L+IL +  + R+I  ++ R  +P ++ ++++ YAE+ L
Sbjct  199  QIKTEGDWWIEDLSILRIDLYERVITAIKCRGVRPESIGASLVNYAEKKL  248



>ref|NP_680473.2| phototropic-responsive NPH3-like protein [Arabidopsis thaliana]
 sp|Q66GP0.2|Y5738_ARATH RecName: Full=BTB/POZ domain-containing protein At5g67385 [Arabidopsis 
thaliana]
 gb|AED98336.1| phototropic-responsive NPH3-like protein [Arabidopsis thaliana]
Length=604

 Score =   190 bits (482),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 106/236 (45%), Positives = 155/236 (66%), Gaps = 19/236 (8%)
 Frame = +1

Query  178  LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDS-KEADLTRI  354
            LS AM+RT +W+ SQE+ +DV V VGEASFSLHKF L++K  +I+KL+ +S K++D T I
Sbjct  9    LSSAMKRTSEWISSQEVSSDVTVHVGEASFSLHKFPLMSKCGFIKKLVSESSKDSDSTVI  68

Query  355  NLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFl  534
             +  IPGG E FE AAKFCYG+NF+++  N+A LRCAAEYL+MT+++   NL  R E +L
Sbjct  69   KIPDIPGGSEAFELAAKFCYGINFDMSTENIAMLRCAAEYLEMTEEHSVENLVVRAEAYL  128

Query  535  sqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVEANF------------  678
            ++VAL SLS ++ VL   E+LLP+AE +K+V RC++  +   C E++F            
Sbjct  129  NEVALKSLSSSITVLHKSEKLLPIAERVKLVSRCIDAIAYMTCQESHFCSPSSSNSGNNE  188

Query  679  -----PSRSP-PNWWTEELTILDVAFFARIIATMRSRTAKPLTLASAIITYAERSL  828
                  S+ P  +WW E+LT+L +  F R++  M +R  K   L   ++ YA++SL
Sbjct  189  VVVQQQSKQPVVDWWAEDLTVLRIDSFQRVLIAMMARGFKQYGLGPVLMLYAQKSL  244



>gb|AAU05485.1| At5g67385 [Arabidopsis thaliana]
 gb|AAU95431.1| At5g67385 [Arabidopsis thaliana]
Length=604

 Score =   190 bits (482),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 106/236 (45%), Positives = 155/236 (66%), Gaps = 19/236 (8%)
 Frame = +1

Query  178  LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDS-KEADLTRI  354
            LS AM+RT +W+ SQE+ +DV V VGEASFSLHKF L++K  +I+KL+ +S K++D T I
Sbjct  9    LSSAMKRTSEWISSQEVSSDVTVHVGEASFSLHKFPLMSKCGFIKKLVSESSKDSDSTVI  68

Query  355  NLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFl  534
             +  IPGG E FE AAKFCYG+NF+++  N+A LRCAAEYL+MT+++   NL  R E +L
Sbjct  69   KIPDIPGGSEAFELAAKFCYGINFDMSTENIAMLRCAAEYLEMTEEHSVENLVVRAEAYL  128

Query  535  sqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVEANF------------  678
            ++VAL SLS ++ VL   E+LLP+AE +K+V RC++  +   C E++F            
Sbjct  129  NEVALKSLSSSITVLHKSEKLLPIAERVKLVSRCIDAIAYMTCQESHFCSPSSSNSGNNE  188

Query  679  -----PSRSP-PNWWTEELTILDVAFFARIIATMRSRTAKPLTLASAIITYAERSL  828
                  S+ P  +WW E+LT+L +  F R++  M +R  K   L   ++ YA++SL
Sbjct  189  VVVQQQSKQPVVDWWAEDLTVLRIDSFQRVLIAMMARGFKQYGLGPVLMLYAQKSL  244



>ref|XP_011024680.1| PREDICTED: BTB/POZ domain-containing protein At5g48800 [Populus 
euphratica]
Length=610

 Score =   190 bits (482),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 91/244 (37%), Positives = 154/244 (63%), Gaps = 22/244 (9%)
 Frame = +1

Query  160  KSAATRLSLAM---ERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDS  330
            K    +LSLA    ++  +W+F +++P+D+ +EV   +F+LHKF LV++S  IRKL+ + 
Sbjct  3    KHQQQQLSLAKCSRQKYSEWIF-RDVPSDITIEVSGGTFALHKFPLVSRSGRIRKLVAEH  61

Query  331  KEADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNL  510
            ++AD++R+ L  +PGG E FE AAKFCYG+NFEIT  NVA L C +EYL+MT+ +  +NL
Sbjct  62   RDADISRVELLNLPGGAEAFELAAKFCYGINFEITSSNVAQLCCVSEYLEMTEDFSKDNL  121

Query  511  AGRTEDFlsqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVEA------  672
              R E++L  +   +L   + VL+ CE L+PLA++L+IV RC++  ++KAC E       
Sbjct  122  GSRAEEYLESIVCKNLEMCVEVLQQCENLIPLADELRIVSRCIDAIASKACAEQIVSSFS  181

Query  673  ------------NFPSRSPPNWWTEELTILDVAFFARIIATMRSRTAKPLTLASAIITYA  816
                        N  ++   +WW E+L++L +  + R++  M+ R  +P ++ ++++ YA
Sbjct  182  RLEYSSSGRLHMNKQAKREGDWWIEDLSVLRIDLYQRVMTAMKCRGVRPESIGASLVNYA  241

Query  817  ERSL  828
            ++ L
Sbjct  242  QKEL  245



>ref|XP_008787157.1| PREDICTED: BTB/POZ domain-containing protein At5g67385 [Phoenix 
dactylifera]
Length=610

 Score =   190 bits (482),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 100/234 (43%), Positives = 149/234 (64%), Gaps = 18/234 (8%)
 Frame = +1

Query  181  SLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINL  360
            S AM+RT +W+ SQEIP+D+ +  G ++F+LHK  LV+K  YIR+L+ ++  ++++ I +
Sbjct  23   STAMKRTSEWILSQEIPSDITIHAGGSAFALHKLPLVSKCGYIRRLVSEANGSNISVIEI  82

Query  361  SGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsq  540
              +PGG E F+ AAKFCYG+NFEIT  N+A LRC A YL+MT+ Y   NL  RTE +L +
Sbjct  83   PDVPGGAEAFKFAAKFCYGINFEITTENIAMLRCVAGYLEMTEDYAAGNLVNRTEGYLEE  142

Query  541  valsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVEANF--------------  678
            VAL SLSGA+ VL   E+LLP+AE +K+V RC++  +  AC ++ F              
Sbjct  143  VALMSLSGAVTVLHKSEDLLPMAEKVKLVSRCIDAVAYTACKDSQFGISLRTENSHENLT  202

Query  679  ----PSRSPPNWWTEELTILDVAFFARIIATMRSRTAKPLTLASAIITYAERSL  828
                 +++  +WW EELT+L +  F R++  M++R  K   L   I+ YA+ SL
Sbjct  203  SSGLQTKAIVDWWAEELTVLRIDTFQRVLMAMKARGFKQYALGPVIMLYAQESL  256



>ref|XP_002301784.2| hypothetical protein POPTR_0002s24380g [Populus trichocarpa]
 gb|EEE81057.2| hypothetical protein POPTR_0002s24380g [Populus trichocarpa]
Length=610

 Score =   190 bits (482),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 91/244 (37%), Positives = 154/244 (63%), Gaps = 22/244 (9%)
 Frame = +1

Query  160  KSAATRLSLAM---ERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDS  330
            K    +LSLA    ++  +W+F +++P+D+ +EV   +F+LHKF LV++S  IRKL+ + 
Sbjct  3    KHQQQQLSLAKCSRQKYSEWIF-RDVPSDITIEVSGGTFALHKFPLVSRSGRIRKLVAEH  61

Query  331  KEADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNL  510
            ++AD++R+ L  +PGG E FE AAKFCYG+NFEIT  NVA L C +EYL+MT+ +  +NL
Sbjct  62   RDADISRVELLNLPGGAEAFELAAKFCYGINFEITSSNVAQLCCVSEYLEMTEDFSKDNL  121

Query  511  AGRTEDFlsqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVEA------  672
              R E++L  +   +L   + VL+ CE L+PLA++L+IV RC++  ++KAC E       
Sbjct  122  GSRAEEYLESIVCKNLEMCVEVLQQCENLIPLADELRIVSRCIDAIASKACAEQIASSFS  181

Query  673  ------------NFPSRSPPNWWTEELTILDVAFFARIIATMRSRTAKPLTLASAIITYA  816
                        N  ++   +WW E+L++L +  + R++  M+ R  +P ++ ++++ YA
Sbjct  182  RLEYSSSGRLHMNKQAKREGDWWIEDLSVLRIDLYQRVMTAMKCRGVRPESIGASLVNYA  241

Query  817  ERSL  828
            ++ L
Sbjct  242  QKEL  245



>ref|XP_009411062.1| PREDICTED: BTB/POZ domain-containing protein At5g67385 [Musa 
acuminata subsp. malaccensis]
Length=583

 Score =   189 bits (481),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 102/230 (44%), Positives = 145/230 (63%), Gaps = 17/230 (7%)
 Frame = +1

Query  190  MERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGI  369
            M+RTG+W++S E+P+D+ V+VG + F LHK++LV+K  YIRKL  ++ + + + I +  +
Sbjct  1    MKRTGEWIYSPEVPSDIDVKVGGSIFPLHKYLLVSKCGYIRKLASEANQPNTSAIEIPDV  60

Query  370  PGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqval  549
            PGG E FE   K+CYGVNFEIT  N+A LRC AEYL+MT+ Y   NL  R E +L +VAL
Sbjct  61   PGGAEAFELVTKYCYGVNFEITAENIAMLRCVAEYLEMTEDYTVGNLVSRAEAYLEEVAL  120

Query  550  sslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVEAN-------------FPSRS  690
             SLS A+ VL   EELLP++E +K+V RC++  +  AC ++              F S S
Sbjct  121  LSLSAAVTVLHKSEELLPVSEKVKMVSRCIDAVAYMACNDSQLCSSSRTDNFQERFSSSS  180

Query  691  PPN----WWTEELTILDVAFFARIIATMRSRTAKPLTLASAIITYAERSL  828
             PN    WW EELT+L +  F R++  M+ R  K   L   I+ YA++SL
Sbjct  181  QPNAIVDWWAEELTVLRIDTFQRVLMAMKGRGFKQYALGPVIMLYAQKSL  230



>gb|KFK28391.1| hypothetical protein AALP_AA8G509000 [Arabis alpina]
Length=604

 Score =   189 bits (481),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 106/233 (45%), Positives = 152/233 (65%), Gaps = 17/233 (7%)
 Frame = +1

Query  181  SLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSK-EADLTRIN  357
            S AM+RT +W+ SQE+ +DV V +GEASFSLHKF L++K  +I+KL+ +SK +AD T + 
Sbjct  10   SSAMKRTSEWISSQEVSSDVTVHIGEASFSLHKFPLLSKCGFIKKLVSESKTDADSTIVK  69

Query  358  LSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFls  537
            +  IPGG E FE AAKFCYG+NF++   N+A LRCAAEYL+MT+++   NL  RTE +L+
Sbjct  70   IPDIPGGSEAFELAAKFCYGINFDMGTENIAMLRCAAEYLEMTEEHSVENLVVRTEAYLN  129

Query  538  qvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVEANF-------------  678
            +VAL SLS ++ VL   EELLP AE +K+V RC++  +   C E+ F             
Sbjct  130  EVALKSLSSSITVLHKSEELLPTAERVKLVSRCIDAIAYMTCQESQFCSPSSSNNSNNEV  189

Query  679  --PSRSP-PNWWTEELTILDVAFFARIIATMRSRTAKPLTLASAIITYAERSL  828
               S+ P  +WW E+LT+L +  F R++  M +R  K   L   ++ YA++SL
Sbjct  190  VVQSKQPVVDWWAEDLTVLRIDSFQRVLIAMMARGFKQYGLGPVLMLYAQKSL  242



>ref|XP_012085112.1| PREDICTED: BTB/POZ domain-containing protein At5g48800 [Jatropha 
curcas]
Length=613

 Score =   189 bits (481),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 92/238 (39%), Positives = 153/238 (64%), Gaps = 22/238 (9%)
 Frame = +1

Query  178  LSLAM---ERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLT  348
            LSLA    +R  +W+F +++P+D+ +EV   +F+LHKF LV++S  IRKL+ + ++AD++
Sbjct  12   LSLAKSSRQRCNEWIF-RDVPSDITIEVSGGTFALHKFPLVSRSGRIRKLVAEHRDADIS  70

Query  349  RINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTED  528
            R+ L  +PGG E FE AAKFCYG+NFEIT  NVA L C ++YL+MT+++  +NL  R E+
Sbjct  71   RVELLNLPGGAESFELAAKFCYGINFEITSANVAQLCCVSDYLEMTEEFSKDNLGSRAEE  130

Query  529  FlsqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVEA------------  672
            +L  +   +L   + VL+ CE LLPLA++LKIV RC++  ++KAC E             
Sbjct  131  YLESIVCKNLEMCVEVLQQCENLLPLADELKIVSRCIDAIASKACAEQIASSFSRLEYSS  190

Query  673  ------NFPSRSPPNWWTEELTILDVAFFARIIATMRSRTAKPLTLASAIITYAERSL  828
                  N  ++   +WW E+L+IL +  + +++  M+ R  +P ++ ++++ YA++ L
Sbjct  191  SGRLHMNKQAKCEGDWWIEDLSILRIDLYQKVMTAMKCRGVRPESIGASLVNYAQKEL  248



>ref|XP_009780159.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like [Nicotiana 
sylvestris]
Length=621

 Score =   189 bits (481),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 104/238 (44%), Positives = 149/238 (63%), Gaps = 21/238 (9%)
 Frame = +1

Query  178  LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRIN  357
            LS  M+RT +W+ SQEIP+D+ V V   SF+LHKF LV+K  YIRKL+  S +A+L+   
Sbjct  26   LSNVMKRTSEWILSQEIPSDITVHVAGTSFALHKFPLVSKCGYIRKLVAKSNDANLSVFE  85

Query  358  LSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFls  537
            +  IPGG E FE AAKFCYG+NFEI+  NVA LRC AEYL MTD Y   NL G +E +L+
Sbjct  86   IPDIPGGAEAFEFAAKFCYGINFEISSGNVALLRCVAEYLDMTDDYAVGNLVGLSEAYLN  145

Query  538  qvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVEANF-------------  678
            ++AL S++GA+ VL S E+LLP+AE++K+V R ++  +   C +++F             
Sbjct  146  ELALKSIAGAVSVLHSSEKLLPIAENIKLVNRSIDTIAYMVCKDSHFCKSGRIEVDANSL  205

Query  679  --------PSRSPPNWWTEELTILDVAFFARIIATMRSRTAKPLTLASAIITYAERSL  828
                    P     +WW E+LT+L + FF R++  M +R  K   L   ++ Y+++SL
Sbjct  206  TNSSTFSNPRTIVVDWWAEDLTVLRIDFFQRVLIAMMARGYKQYALGPVLMLYSQKSL  263



>gb|KDP26391.1| hypothetical protein JCGZ_17549 [Jatropha curcas]
Length=619

 Score =   189 bits (481),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 92/238 (39%), Positives = 153/238 (64%), Gaps = 22/238 (9%)
 Frame = +1

Query  178  LSLAM---ERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLT  348
            LSLA    +R  +W+F +++P+D+ +EV   +F+LHKF LV++S  IRKL+ + ++AD++
Sbjct  12   LSLAKSSRQRCNEWIF-RDVPSDITIEVSGGTFALHKFPLVSRSGRIRKLVAEHRDADIS  70

Query  349  RINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTED  528
            R+ L  +PGG E FE AAKFCYG+NFEIT  NVA L C ++YL+MT+++  +NL  R E+
Sbjct  71   RVELLNLPGGAESFELAAKFCYGINFEITSANVAQLCCVSDYLEMTEEFSKDNLGSRAEE  130

Query  529  FlsqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVEA------------  672
            +L  +   +L   + VL+ CE LLPLA++LKIV RC++  ++KAC E             
Sbjct  131  YLESIVCKNLEMCVEVLQQCENLLPLADELKIVSRCIDAIASKACAEQIASSFSRLEYSS  190

Query  673  ------NFPSRSPPNWWTEELTILDVAFFARIIATMRSRTAKPLTLASAIITYAERSL  828
                  N  ++   +WW E+L+IL +  + +++  M+ R  +P ++ ++++ YA++ L
Sbjct  191  SGRLHMNKQAKCEGDWWIEDLSILRIDLYQKVMTAMKCRGVRPESIGASLVNYAQKEL  248



>ref|XP_010484507.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like isoform 
X1 [Camelina sativa]
 ref|XP_010484508.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like isoform 
X1 [Camelina sativa]
Length=603

 Score =   189 bits (480),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 107/236 (45%), Positives = 153/236 (65%), Gaps = 19/236 (8%)
 Frame = +1

Query  178  LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDS-KEADLTRI  354
            LS AM+RT +W+ SQE+ +DV V VGEASFSLHKF L++K  +I+KL+  S K++D + I
Sbjct  9    LSSAMKRTSEWISSQEVSSDVTVHVGEASFSLHKFPLLSKCGFIKKLMSGSNKDSDSSVI  68

Query  355  NLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFl  534
             +  IPGG E FE AAKFCYG+NF+++  N+A LRCAAEYL+MTD++   NL  R E +L
Sbjct  69   KILDIPGGSEAFELAAKFCYGINFDMSTENIAMLRCAAEYLEMTDEHSVENLVVRAEAYL  128

Query  535  sqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVEANF------------  678
            ++VAL SLS ++ VL   EELLP AE +K+V RC++  +   C E++F            
Sbjct  129  NEVALKSLSSSITVLHKSEELLPTAERVKLVSRCIDAIAYMTCQESHFCSPSSSNSGNNE  188

Query  679  -----PSRSP-PNWWTEELTILDVAFFARIIATMRSRTAKPLTLASAIITYAERSL  828
                  S+ P  +WW E+LT+L +  F R++  M +R  K   L   ++ YA++SL
Sbjct  189  VVVQQQSKQPVVDWWAEDLTVLRIDSFQRVLIAMMARGFKQYGLGPVLMLYAQKSL  244



>ref|XP_004509079.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like isoform 
X1 [Cicer arietinum]
 ref|XP_004509080.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like isoform 
X2 [Cicer arietinum]
Length=598

 Score =   189 bits (480),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 104/233 (45%), Positives = 149/233 (64%), Gaps = 20/233 (9%)
 Frame = +1

Query  190  MERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMD-SKEADLTRINLSG  366
            M+RT +W +SQEIP+DV +++GEAS+SLHKF L++KS YIRK I + S  A++  I L  
Sbjct  1    MKRTSEWNYSQEIPSDVTIQIGEASYSLHKFPLISKSGYIRKFISEYSDAAEVPTIELFD  60

Query  367  IPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqva  546
            +PGG E FE AAKFCYG+NFEI+V N+A LRC AEYL+MT+ Y   NL GRT+ +L++VA
Sbjct  61   VPGGSEAFELAAKFCYGINFEISVENIAMLRCVAEYLEMTEDYSVGNLVGRTDSYLNEVA  120

Query  547  lsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVEANFPS--------------  684
            L S SGA+ +L   E LLP+AE  K++ RC++  +  A  E+ F S              
Sbjct  121  LKSFSGAISILHISETLLPIAEKAKLISRCIDAIAYLASKESQFCSSGRSDSSNERMNSS  180

Query  685  -----RSPPNWWTEELTILDVAFFARIIATMRSRTAKPLTLASAIITYAERSL  828
                 R   +WW E+LT+L +  F R++  + +R  K   +   I+ Y+++SL
Sbjct  181  TASQQRPVVDWWAEDLTVLRIDIFQRVLVALMARGFKQCGIGPIIMLYSQKSL  233



>ref|XP_009630230.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like isoform 
X2 [Nicotiana tomentosiformis]
Length=446

 Score =   185 bits (470),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 105/238 (44%), Positives = 151/238 (63%), Gaps = 21/238 (9%)
 Frame = +1

Query  178  LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRIN  357
            LS  M+RT +W+ SQEIP+D+ V V   SF+LHKF LV+K  YIRKL+  S +A+L+ I 
Sbjct  26   LSNVMKRTSEWILSQEIPSDITVHVAGTSFALHKFPLVSKCGYIRKLVAKSNDANLSEIE  85

Query  358  LSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFls  537
            +  IPGG E FE AAKFCYG+NFEI+  N+A LRC AEYL MTD Y   NL G +E +L+
Sbjct  86   IPDIPGGAEAFEFAAKFCYGINFEISSGNIALLRCVAEYLDMTDYYAVGNLVGLSEAYLN  145

Query  538  qvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVEANF-------------  678
            +VAL S++GA+ VL S E+LLP+AE++K+V R ++  +   C +++F             
Sbjct  146  EVALKSIAGAVSVLHSSEKLLPIAENIKLVNRSIDTIAYIVCKDSHFCKSGRIEVDANSL  205

Query  679  ---PSRSPP-----NWWTEELTILDVAFFARIIATMRSRTAKPLTLASAIITYAERSL  828
                + S P     + W E+LT+L + FF R++  M +R  K   L   ++ Y+++SL
Sbjct  206  MNSSTLSNPRPIVVDCWAEDLTVLRIDFFQRVLIAMMARGYKQYALGPVLMLYSQKSL  263



>gb|KHN13450.1| BTB/POZ domain-containing protein [Glycine soja]
Length=624

 Score =   188 bits (478),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 95/246 (39%), Positives = 152/246 (62%), Gaps = 30/246 (12%)
 Frame = +1

Query  178  LSLAM---ERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLT  348
            LSLA    +R  +W+F +++P+DV +EV   +FSLHKF LV++S  IR+L+ + +++D++
Sbjct  15   LSLAKGTRQRNNEWIF-RDVPSDVTIEVNGGTFSLHKFPLVSRSGRIRRLVAEHRDSDIS  73

Query  349  RINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTED  528
            R+ L  +PGG E FE AAKFCYG+NFEIT  NVA L C ++YL+MT+ +  +NL  R E+
Sbjct  74   RVELLNLPGGAECFELAAKFCYGINFEITSTNVAQLCCVSDYLEMTEDFSKDNLGSRAEE  133

Query  529  FlsqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVE-------------  669
            +L  +   +L   + VL+ CE LLPLA++LK+V RC++  ++KAC E             
Sbjct  134  YLDSIVCKNLEMCVEVLQQCESLLPLADELKVVSRCIDAIASKACAEQIASSFSRLEYSS  193

Query  670  -ANFPSRSPP------------NWWTEELTILDVAFFARIIATMRSRTAKPLTLASAIIT  810
                 S  PP            +WW E+L++L +  + RII  M+ R  +P ++ ++++ 
Sbjct  194  SGRHSSLLPPPRETMHVVKCDGDWWIEDLSVLRIDMYQRIITAMKCRGVRPESIGASLVN  253

Query  811  YAERSL  828
            YA++ L
Sbjct  254  YAQKEL  259



>ref|XP_009371616.1| PREDICTED: BTB/POZ domain-containing protein At5g48800-like [Pyrus 
x bretschneideri]
Length=599

 Score =   188 bits (477),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 87/221 (39%), Positives = 146/221 (66%), Gaps = 18/221 (8%)
 Frame = +1

Query  220  QEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGIPGGPEIFERA  399
            +++P+D+ ++V   +FSLHKF LV++S  IR+L+ + +++D++R+ L  +PGG E FE A
Sbjct  13   RDVPSDITIQVNGGAFSLHKFPLVSRSGRIRRLVAEHRDSDISRVELLNLPGGAESFELA  72

Query  400  AKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvl  579
            AKFCYG+NFEIT  N++ L CA++YL+MT++Y  +NL  R E++L  V   +L   + VL
Sbjct  73   AKFCYGINFEITSSNISQLCCASDYLEMTEEYSKDNLGSRAEEYLESVVCKNLEMCVEVL  132

Query  580  ksCEELLPLAEDLKIVQRCVELASAKACVEA------------------NFPSRSPPNWW  705
            + CE LLPLA++L+IV RC++  ++KACVE                   N  ++S  +WW
Sbjct  133  QQCESLLPLADELRIVSRCIDAIASKACVEQIASSFSRLEYSSSGRLHMNRQAKSDGDWW  192

Query  706  TEELTILDVAFFARIIATMRSRTAKPLTLASAIITYAERSL  828
             E+L++L V  + R+I  M+ R  +P ++ ++++ YA++ L
Sbjct  193  IEDLSVLRVDLYQRVITAMKCRGVRPESIGASLVNYAQKEL  233



>ref|XP_006393938.1| hypothetical protein EUTSA_v10003858mg [Eutrema salsugineum]
 gb|ESQ31224.1| hypothetical protein EUTSA_v10003858mg [Eutrema salsugineum]
Length=603

 Score =   188 bits (477),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 106/236 (45%), Positives = 152/236 (64%), Gaps = 20/236 (8%)
 Frame = +1

Query  181  SLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSK-EADLTRIN  357
            S AM+RT +W+ SQE+ +DV V VGEASFSLHKF L++K  +I+KL+ +SK ++D T I 
Sbjct  10   SSAMKRTSEWISSQEVSSDVTVHVGEASFSLHKFPLLSKCGFIKKLVSESKSDSDATVIK  69

Query  358  LSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFls  537
            L  IPGG E FE  AKFCYG+NF+++  N+A LRCAAEYL+MT+++   NL  R E +L+
Sbjct  70   LPDIPGGSEAFELTAKFCYGINFDMSTENIAMLRCAAEYLEMTEEHSVENLVVRAEAYLN  129

Query  538  qvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVEANF-------------  678
            +VAL SLS ++ VL   EELLP+AE +K+V RC++  +   C E+ F             
Sbjct  130  EVALKSLSSSITVLHKSEELLPVAERVKLVSRCIDAIAYMTCQESLFCSPSSSSNNSNNE  189

Query  679  -----PSRSP-PNWWTEELTILDVAFFARIIATMRSRTAKPLTLASAIITYAERSL  828
                  S+ P  +WW E+LT+L +  F R++  M +R  K   L   ++ YA++SL
Sbjct  190  VVVQQQSKQPVVDWWAEDLTVLRIDLFQRVLIAMMARGFKQYGLGPVLMLYAQKSL  245



>dbj|BAJ34215.1| unnamed protein product [Thellungiella halophila]
Length=603

 Score =   188 bits (477),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 106/236 (45%), Positives = 152/236 (64%), Gaps = 20/236 (8%)
 Frame = +1

Query  181  SLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSK-EADLTRIN  357
            S AM+RT +W+ SQE+ +DV V VGEASFSLHKF L++K  +I+KL+ +SK ++D T I 
Sbjct  10   SSAMKRTSEWISSQEVSSDVTVHVGEASFSLHKFPLLSKCGFIKKLVSESKSDSDATVIK  69

Query  358  LSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFls  537
            L  IPGG E FE  AKFCYG+NF+++  N+A LRCAAEYL+MT+++   NL  R E +L+
Sbjct  70   LPDIPGGSEAFELTAKFCYGINFDMSTENIAMLRCAAEYLEMTEEHSVENLVVRAEAYLN  129

Query  538  qvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVEANF-------------  678
            +VAL SLS ++ VL   EELLP+AE +K+V RC++  +   C E+ F             
Sbjct  130  EVALKSLSSSITVLHKSEELLPVAERVKLVSRCIDAIAYMTCQESLFCSPSSSSNNSNNE  189

Query  679  -----PSRSP-PNWWTEELTILDVAFFARIIATMRSRTAKPLTLASAIITYAERSL  828
                  S+ P  +WW E+LT+L +  F R++  M +R  K   L   ++ YA++SL
Sbjct  190  VVVQQQSKQPVVDWWAEDLTVLRIDLFQRVLIAMMARGFKQYGLGPVLMLYAQKSL  245



>gb|EYU39234.1| hypothetical protein MIMGU_mgv1a003527mg [Erythranthe guttata]
Length=580

 Score =   187 bits (476),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 96/231 (42%), Positives = 148/231 (64%), Gaps = 20/231 (9%)
 Frame = +1

Query  193  ERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGIP  372
            +R  +WVF +++P+D+ +EV   +F LHKF LV++S  IRKL+ D +++D++RI L  + 
Sbjct  8    QRCSEWVF-RDVPSDITIEVDGTTFLLHKFPLVSRSGRIRKLVADHRDSDISRIELVSLQ  66

Query  373  GGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvals  552
            GG + FE AA+FCYGVNFEIT  NVA L C ++YL+MT+ Y  NNL  R E++L  +   
Sbjct  67   GGADSFELAAQFCYGVNFEITPTNVAHLYCISDYLEMTEDYSKNNLFTRAEEYLEIIVSK  126

Query  553  slsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVEANFPSRS--------------  690
            SL   + VL+ CE+LLPLA++LKIVQ C++  ++KACVE    S S              
Sbjct  127  SLEMCVKVLQQCEKLLPLADELKIVQICIDSIASKACVEQIASSFSRLEYSNSGRLHMSK  186

Query  691  -----PPNWWTEELTILDVAFFARIIATMRSRTAKPLTLASAIITYAERSL  828
                   +WW E+L+IL + F+ R++  M+ R  +P ++ S+++ YA++ L
Sbjct  187  NQTNCESDWWIEDLSILGIDFYQRVVKAMKCRGVRPESIGSSLMNYAKKEL  237



>ref|XP_010464139.1| PREDICTED: BTB/POZ domain-containing protein At5g67385 [Camelina 
sativa]
Length=603

 Score =   188 bits (477),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 106/236 (45%), Positives = 154/236 (65%), Gaps = 19/236 (8%)
 Frame = +1

Query  178  LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDS-KEADLTRI  354
            LS AM+RT +W+ SQE+ +DV V VGEASFSLHKF L++K  +I+KL+ +S K++D + I
Sbjct  9    LSSAMKRTSEWISSQEVSSDVTVHVGEASFSLHKFPLLSKCGFIKKLMSESNKDSDSSVI  68

Query  355  NLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFl  534
             +  IPGG E FE AAKFCYG+NF+++  N+A LRCAAEYL+MT+++   NL  R E +L
Sbjct  69   KILDIPGGSEAFELAAKFCYGINFDMSTENIAMLRCAAEYLEMTEEHSVENLVVRAEAYL  128

Query  535  sqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVEANF------------  678
            ++VAL SLS ++ VL   EELLP AE +K+V RC++  +   C E++F            
Sbjct  129  NEVALKSLSSSITVLHKSEELLPTAERVKLVSRCIDAIAYMTCQESHFCSPSSSNSGNNE  188

Query  679  -----PSRSP-PNWWTEELTILDVAFFARIIATMRSRTAKPLTLASAIITYAERSL  828
                  S+ P  +WW E+LT+L +  F R++  M +R  K   L   ++ YA++SL
Sbjct  189  VVVQQQSKQPVVDWWAEDLTVLRIDSFQRVLIAMMARGFKQYGLGPVLMLYAQKSL  244



>ref|XP_003551322.2| PREDICTED: BTB/POZ domain-containing protein At5g48800-like [Glycine 
max]
Length=616

 Score =   187 bits (476),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 91/238 (38%), Positives = 151/238 (63%), Gaps = 22/238 (9%)
 Frame = +1

Query  178  LSLAM---ERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLT  348
            LSLA    +R  +W+F +++P+DV +EV   +FSLHKF LV++S  IR+L+ + +++D++
Sbjct  15   LSLAKGTRQRNNEWIF-RDVPSDVTIEVNRGTFSLHKFPLVSRSGRIRRLVAEHRDSDIS  73

Query  349  RINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTED  528
            R+ L  +PGG E FE AAKFCYG+NFEI   NVA L C ++YL+MT+ +  +NL  R E+
Sbjct  74   RVELLNLPGGAECFELAAKFCYGINFEIRSTNVAQLCCVSDYLEMTEDFSKDNLGSRAEE  133

Query  529  FlsqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVEA------------  672
            +L  +   +L   + VL+ CE LLPLA++LK+V RC++  ++KAC E             
Sbjct  134  YLDSIVCKNLEMCVEVLQQCESLLPLADELKVVSRCIDAIASKACAEQIASSFSRLEYSS  193

Query  673  ------NFPSRSPPNWWTEELTILDVAFFARIIATMRSRTAKPLTLASAIITYAERSL  828
                  +  ++   +WW E+L++L +  + RII  M+ R  +P ++ ++++ YA++ L
Sbjct  194  SGRLHMSRQAKCDGDWWIEDLSVLRIDMYQRIITAMKCRGVRPESIGASLVNYAQKEL  251



>ref|XP_007049780.1| Phototropic-responsive NPH3 family protein [Theobroma cacao]
 gb|EOX93937.1| Phototropic-responsive NPH3 family protein [Theobroma cacao]
Length=619

 Score =   187 bits (476),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 90/238 (38%), Positives = 153/238 (64%), Gaps = 22/238 (9%)
 Frame = +1

Query  178  LSLAM---ERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLT  348
            LSLA    +R  +W+F +++P+D+ +EV   +F+LHKF LV++S  IRKL+ + +++D++
Sbjct  17   LSLAKSSRQRYNEWIF-RDVPSDITIEVNGGTFALHKFPLVSRSGRIRKLVAEHRDSDIS  75

Query  349  RINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTED  528
            R+ L  +PGG E FE AAKFCYG+NFEIT  NVA L C ++YL+MT+++  +NL  R E+
Sbjct  76   RVELLNLPGGAESFELAAKFCYGINFEITSLNVAQLCCVSDYLEMTEEFSKDNLGSRAEE  135

Query  529  FlsqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVEA------------  672
            +L  +   +L   + VL+ CE LLPLA++LKIV RC++  ++KAC E             
Sbjct  136  YLESIVCKNLEMCVEVLQQCENLLPLADELKIVSRCIDAIASKACAEQIASSFSRLEYSS  195

Query  673  ------NFPSRSPPNWWTEELTILDVAFFARIIATMRSRTAKPLTLASAIITYAERSL  828
                  N  ++   +WW E+L+++ +  + R++  M+ R  +P ++ ++++ YA++ L
Sbjct  196  SGRLHMNRQAKCEGDWWIEDLSVIRIDLYQRVMTAMKCRGVRPESIGASLVNYAQKEL  253



>ref|XP_010277091.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like isoform 
X2 [Nelumbo nucifera]
Length=594

 Score =   187 bits (475),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 104/225 (46%), Positives = 145/225 (64%), Gaps = 19/225 (8%)
 Frame = +1

Query  211  VFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGIPGGPEIF  390
            +FSQEIP+D+ V  G ASFSLHKF LV+K  YIRKL+ +  +AD++ + L  +PGG E F
Sbjct  9    IFSQEIPSDITVHAGGASFSLHKFPLVSKCGYIRKLVSEDSDADVSVVELPDVPGGEEAF  68

Query  391  ERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgal  570
            E AAKFCYG+NFEI+  N+A LRC AEYL+MT+ Y   NL GRTED+L++VAL SL+GA+
Sbjct  69   ELAAKFCYGINFEISTENIATLRCVAEYLEMTEDYAVGNLVGRTEDYLNEVALKSLAGAI  128

Query  571  vvlksCEELLPLAEDLKIVQRCVELASAKACVEANF--PSRSPP----------------  696
             VL + E LLP AE +K+V R ++  +  A  E+ F  P R+                  
Sbjct  129  SVLHTSENLLPTAEKVKLVSRSIDAVAYLAYKESQFCLPGRTETRHESINSYSGSHLKPI  188

Query  697  -NWWTEELTILDVAFFARIIATMRSRTAKPLTLASAIITYAERSL  828
             +WW E+LT+L +  F R++  M +R  K  +L   ++ YA++SL
Sbjct  189  VDWWAEDLTVLRIDIFHRVLMAMLARGFKQYSLGPILMIYAQKSL  233



>gb|KJB26098.1| hypothetical protein B456_004G225600 [Gossypium raimondii]
Length=612

 Score =   187 bits (476),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 87/230 (38%), Positives = 149/230 (65%), Gaps = 19/230 (8%)
 Frame = +1

Query  193  ERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGIP  372
            +R  +W+F +++P+D+ +EV   SF+LHKF LV++S  I+KL+ + +++D+ R+ L  +P
Sbjct  16   QRCNEWIF-RDVPSDITIEVNGVSFALHKFPLVSRSGRIQKLVAEHRDSDMLRVELVNVP  74

Query  373  GGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvals  552
            GG E FE AAKFCYG+NFEIT  NVA L C ++YL+MT+++  +NL  RTE++L  V   
Sbjct  75   GGAESFELAAKFCYGINFEITSFNVAQLYCVSDYLEMTEEFSKDNLGSRTEEYLEIVVCK  134

Query  553  slsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVEA------------------NF  678
            +L   + VL+ CE LLPLA++LKI+ RC++  ++KAC E                   N 
Sbjct  135  NLEMCVEVLQQCESLLPLADELKIISRCIDAIASKACAEQIASSFSRLEYSSSGRLHMNR  194

Query  679  PSRSPPNWWTEELTILDVAFFARIIATMRSRTAKPLTLASAIITYAERSL  828
             ++   +WW E+L+++ +  + R+I  M+ R  +P ++ ++++ +A++ L
Sbjct  195  QTKCEGDWWIEDLSVIRIDLYQRLITAMKCRGVRPESIGASLVNFAQKEL  244



>emb|CDY68489.1| BnaCnng59210D [Brassica napus]
Length=449

 Score =   184 bits (468),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 103/231 (45%), Positives = 149/231 (65%), Gaps = 14/231 (6%)
 Frame = +1

Query  178  LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDS-KEADLTRI  354
            LS AM+RT  W+ SQE+ +DV V VGEASFSLHKF L++K    +KL+ +S  ++D T I
Sbjct  9    LSSAMKRTSVWISSQEVSSDVTVHVGEASFSLHKFPLLSKCGLFKKLVSESTNDSDATVI  68

Query  355  NLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFl  534
             +  IPGG E FE   KFCYG+NF+++  N+A LRCA+EYL+MT+++   NL  R+E +L
Sbjct  69   KIPDIPGGSEAFELTTKFCYGINFDMSTENIAMLRCASEYLEMTEEHSVENLVSRSEAYL  128

Query  535  sqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVEANFPSRSPPN-----  699
            ++VAL SLS A+ VL   EELLP+AE +K+V RC++  +   C E+ F S +  N     
Sbjct  129  NEVALKSLSSAITVLHKSEELLPIAERVKLVSRCIDAIAYMTCQESQFCSPTSNNSNSEV  188

Query  700  --------WWTEELTILDVAFFARIIATMRSRTAKPLTLASAIITYAERSL  828
                    WW E+LT+L++  F R++  M +R  K   L   ++ YA++SL
Sbjct  189  VSKQPVVDWWAEDLTVLNIDSFQRVLIAMMARGFKQYGLGPVLMLYAQKSL  239



>ref|XP_006395119.1| hypothetical protein EUTSA_v10003813mg [Eutrema salsugineum]
 gb|ESQ32405.1| hypothetical protein EUTSA_v10003813mg [Eutrema salsugineum]
Length=640

 Score =   188 bits (477),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 92/241 (38%), Positives = 154/241 (64%), Gaps = 24/241 (10%)
 Frame = +1

Query  175  RLSLAM---ERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADL  345
            +LSLA    +   +W+F +++P+D+ +EV   +F+LHKF LV++S  IR+++ + +++D+
Sbjct  21   KLSLAKSSRQSCSEWIF-RDVPSDITIEVNGGNFALHKFPLVSRSGRIRRIVAEHRDSDI  79

Query  346  TRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTE  525
            +++ L  +PGG EIFE AAKFCYG+NFEIT  NVA L C ++YL+MT++Y  +NLA RTE
Sbjct  80   SKVELLNLPGGAEIFELAAKFCYGINFEITSSNVAQLFCVSDYLEMTEEYSKDNLASRTE  139

Query  526  DFlsqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVEA-----------  672
            ++L  +   +L   + VLK  E LLPLA++L I+ RC++  ++KAC E            
Sbjct  140  EYLESIVCKNLEMCVEVLKQSENLLPLADELNIISRCIDAIASKACAEQIASSFSRLEYS  199

Query  673  ---------NFPSRSPPNWWTEELTILDVAFFARIIATMRSRTAKPLTLASAIITYAERS  825
                        S    +WW E+L++L + F+ R++  M+ R  +P ++ +++++YAER 
Sbjct  200  SSGRLHMSRQAKSSDGGDWWIEDLSVLRIDFYQRVMNAMKCRGVRPESIGASLVSYAERE  259

Query  826  L  828
            L
Sbjct  260  L  260



>gb|KHG00255.1| hypothetical protein F383_19997 [Gossypium arboreum]
Length=611

 Score =   187 bits (476),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 90/244 (37%), Positives = 154/244 (63%), Gaps = 22/244 (9%)
 Frame = +1

Query  160  KSAATRLSLAM---ERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDS  330
            K    +LSLA    +R  +W+F +++ +D+ +EV   +F+LHKF LV++S  IRKL+ + 
Sbjct  3    KQQHHQLSLAKSSRQRCNEWIF-RDVKSDITIEVNGGTFALHKFPLVSRSGRIRKLVAEH  61

Query  331  KEADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNL  510
            +++D++R+ L  +PGG E FE AAKFCYG+NFEIT  NVA L C ++YL+MT+++  +NL
Sbjct  62   RDSDISRVELLNLPGGAETFELAAKFCYGINFEITSSNVAQLCCVSDYLEMTEEFSKDNL  121

Query  511  AGRTEDFlsqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVEA------  672
              R E++L  +   +L   + VL+ CE LLPLA++LKIV RC++  ++KAC E       
Sbjct  122  GSRAEEYLESIVCKNLEMCVEVLQQCENLLPLADELKIVSRCIDAIASKACAEQIASSFS  181

Query  673  ------------NFPSRSPPNWWTEELTILDVAFFARIIATMRSRTAKPLTLASAIITYA  816
                        N  ++   +WW E+L+++ +  + R++  M+ R  +P ++ ++++ YA
Sbjct  182  RLEYSSSGRLHMNRQAKCDGDWWIEDLSVIRIDLYQRVMTAMKCRGVRPESIGASLVNYA  241

Query  817  ERSL  828
            ++ L
Sbjct  242  QKEL  245



>gb|KJB42465.1| hypothetical protein B456_007G154300 [Gossypium raimondii]
Length=611

 Score =   187 bits (475),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 90/244 (37%), Positives = 154/244 (63%), Gaps = 22/244 (9%)
 Frame = +1

Query  160  KSAATRLSLAM---ERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDS  330
            K    +LSLA    +R  +W+F +++ +D+ +EV   +F+LHKF LV++S  IRKL+ + 
Sbjct  3    KQQHHQLSLAKSSRQRCNEWIF-RDVKSDITIEVNGGTFALHKFPLVSRSGRIRKLVAEH  61

Query  331  KEADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNL  510
            +++D++R+ L  +PGG E FE AAKFCYG+NFEIT  NVA L C ++YL+MT+++  +NL
Sbjct  62   RDSDISRVELLNLPGGAETFELAAKFCYGINFEITSSNVAQLCCVSDYLEMTEEFSKDNL  121

Query  511  AGRTEDFlsqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVEA------  672
              R E++L  +   +L   + VL+ CE LLPLA++LKIV RC++  ++KAC E       
Sbjct  122  GSRAEEYLESIVCKNLEMCVEVLQQCENLLPLADELKIVSRCIDAIASKACAEQIASSFS  181

Query  673  ------------NFPSRSPPNWWTEELTILDVAFFARIIATMRSRTAKPLTLASAIITYA  816
                        N  ++   +WW E+L+++ +  + R++  M+ R  +P ++ ++++ YA
Sbjct  182  RLEYSSSGRLHMNRQAKCDGDWWIEDLSVIRIDLYQRVMTAMKCRGVRPESIGASLVNYA  241

Query  817  ERSL  828
            ++ L
Sbjct  242  QKEL  245



>ref|XP_006280202.1| hypothetical protein CARUB_v10026107mg [Capsella rubella]
 gb|EOA13100.1| hypothetical protein CARUB_v10026107mg [Capsella rubella]
Length=605

 Score =   187 bits (474),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 104/236 (44%), Positives = 154/236 (65%), Gaps = 19/236 (8%)
 Frame = +1

Query  178  LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDS-KEADLTRI  354
            L+ AM+RT +W+ SQE+ +D+ V VGEASFSLHKF L++K  +I+KL+ +S K++D T I
Sbjct  9    LTSAMKRTSEWISSQEVSSDITVHVGEASFSLHKFPLLSKCGFIKKLMSESTKDSDSTVI  68

Query  355  NLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFl  534
             +  IPGG E FE AAKFCYG+NF+++  N+A LRCAAEYL+MT+++   NL  R E ++
Sbjct  69   KIPDIPGGSEAFELAAKFCYGINFDMSTENIAMLRCAAEYLEMTEEHSVENLVVRAEAYV  128

Query  535  sqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVEANF------------  678
            ++VAL SLS ++ VL   EELLP+AE +K+V RC++  +   C E+ F            
Sbjct  129  NEVALKSLSSSITVLHKSEELLPIAERVKLVSRCIDAIAYLTCQESLFCSPSSSNSGNNE  188

Query  679  -----PSRSP-PNWWTEELTILDVAFFARIIATMRSRTAKPLTLASAIITYAERSL  828
                  S+ P  +WW E+LT+L +  F R++  M +R  K   L   ++ YA++SL
Sbjct  189  VVVQQQSKQPVVDWWAEDLTVLRIDSFQRVLIAMMARGFKQYGLGPVLMLYAQKSL  244



>gb|KHG21232.1| hypothetical protein F383_08117 [Gossypium arboreum]
 gb|KHG21831.1| hypothetical protein F383_08674 [Gossypium arboreum]
Length=616

 Score =   187 bits (475),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 86/230 (37%), Positives = 149/230 (65%), Gaps = 19/230 (8%)
 Frame = +1

Query  193  ERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGIP  372
            +R  +W+F +++P+D+ +EV   +F+LHKF LV++S  I+KL+ + +++D+ R+ L  +P
Sbjct  20   QRCNEWIF-RDVPSDITIEVNGVAFALHKFPLVSRSGRIQKLVAEHRDSDMLRVELVNVP  78

Query  373  GGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvals  552
            GG E FE AAKFCYG+NFEIT  NVA L C ++YL+MT+++  +NL  RTE++L  V   
Sbjct  79   GGAESFELAAKFCYGINFEITSFNVAQLYCVSDYLEMTEEFSKDNLGSRTEEYLEIVVCK  138

Query  553  slsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVEA------------------NF  678
            +L   + VL+ CE LLPLA++LKI+ RC++  ++KAC E                   N 
Sbjct  139  NLEMCVEVLQQCESLLPLADELKIISRCIDAIASKACAEQIASSFSRLEYSSSGRLHMNR  198

Query  679  PSRSPPNWWTEELTILDVAFFARIIATMRSRTAKPLTLASAIITYAERSL  828
             ++   +WW E+L+++ +  + R+I  M+ R  +P ++ ++++ +A++ L
Sbjct  199  QTKCEGDWWIEDLSVIQIDLYQRLITAMKCRGVRPESIGASLVNFAQKEL  248



>dbj|BAJ33928.1| unnamed protein product [Thellungiella halophila]
Length=617

 Score =   187 bits (474),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 92/241 (38%), Positives = 153/241 (63%), Gaps = 24/241 (10%)
 Frame = +1

Query  175  RLSLAM---ERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADL  345
            +LSLA    +   +W+F +++P+D+ +EV   +F+LHKF LV++S  IR+++ + +++D+
Sbjct  21   KLSLAKSSRQSCSEWIF-RDVPSDITIEVNGGNFALHKFPLVSRSGRIRRIVAEHRDSDI  79

Query  346  TRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTE  525
            +++ L  +PGG EIFE AAKFCYG+NFEIT  NVA L C ++YL+MT++Y  +NLA RTE
Sbjct  80   SKVELLNLPGGAEIFELAAKFCYGINFEITSSNVAQLFCVSDYLEMTEEYSKDNLASRTE  139

Query  526  DFlsqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVEA-----------  672
            ++L  +   +L   + VLK  E LLPLA+ L I+ RC++  ++KAC E            
Sbjct  140  EYLESIVCKNLEMCVEVLKQSENLLPLADGLNIISRCIDAIASKACAEQIASSFSRLEYS  199

Query  673  ---------NFPSRSPPNWWTEELTILDVAFFARIIATMRSRTAKPLTLASAIITYAERS  825
                        S    +WW E+L++L + F+ R++  M+ R  +P ++ +++++YAER 
Sbjct  200  SSGRLHMSRQAKSSDGGDWWIEDLSVLRIDFYQRVMNAMKCRGVRPESIGASLVSYAERE  259

Query  826  L  828
            L
Sbjct  260  L  260



>ref|XP_007050812.1| Phototropic-responsive NPH3 family protein isoform 1 [Theobroma 
cacao]
 gb|EOX94969.1| Phototropic-responsive NPH3 family protein isoform 1 [Theobroma 
cacao]
Length=631

 Score =   187 bits (475),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 94/236 (40%), Positives = 153/236 (65%), Gaps = 19/236 (8%)
 Frame = +1

Query  175  RLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRI  354
            R S ++    +W  S ++ +D+ +EVG +SF+LHKF LV++S  IRKL++D+K+A ++R+
Sbjct  20   RPSSSIRHATEWPIS-DVSSDLTIEVGASSFALHKFPLVSRSGRIRKLLIDAKDAKISRV  78

Query  355  NLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFl  534
            N+S +PGGPE FE AAKFCYG+N EIT+ NVA LRCA+ +L+MT+++ + NL  RTE +L
Sbjct  79   NISSVPGGPEAFELAAKFCYGINVEITLSNVAMLRCASHFLEMTEEFAEKNLEARTEAYL  138

Query  535  sqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVEA----------NFPS  684
              + L ++S ++ VL  CE LLP++E++ +V R +   +  AC E           N+PS
Sbjct  139  KDMVLPNISSSISVLHRCESLLPISEEINLVNRLINAIANNACKEQLTSGLLKLDHNYPS  198

Query  685  RSPPN--------WWTEELTILDVAFFARIIATMRSRTAKPLTLASAIITYAERSL  828
            ++ PN        WW + L +L++ FF R+++ ++S+  K   ++  +I Y   SL
Sbjct  199  KAMPNMEPETPSDWWGKSLAVLNLDFFQRVLSAVKSKGLKQDMISKILINYTHNSL  254



>ref|XP_007155848.1| hypothetical protein PHAVU_003G236800g [Phaseolus vulgaris]
 ref|XP_007155849.1| hypothetical protein PHAVU_003G236800g [Phaseolus vulgaris]
 gb|ESW27842.1| hypothetical protein PHAVU_003G236800g [Phaseolus vulgaris]
 gb|ESW27843.1| hypothetical protein PHAVU_003G236800g [Phaseolus vulgaris]
Length=591

 Score =   186 bits (473),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 102/228 (45%), Positives = 138/228 (61%), Gaps = 15/228 (7%)
 Frame = +1

Query  190  MERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGI  369
            M+RT  W FS EIP+DV V+VGE SFSLHKF LV+K  YI KL+ +S   D++ I L  +
Sbjct  1    MKRTSGWAFSHEIPSDVTVQVGEVSFSLHKFPLVSKCGYIEKLVSESSGEDVSFIELYDV  60

Query  370  PGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqval  549
            PGG E FE A KFCYGVNFEI+V N+A LRC AEYL+MT+ Y   NL GR + +L+++AL
Sbjct  61   PGGAEAFELATKFCYGVNFEISVENIAMLRCVAEYLEMTEDYSVGNLVGRADSYLNEMAL  120

Query  550  sslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVEANFPS---------------  684
             ++SGA+ +L      LP+AE  K+V RC++  +  A  E    S               
Sbjct  121  KTISGAVSILHVSARFLPIAEKAKLVSRCIDAIAFIASKETQLFSSMRGDISSDGIASHQ  180

Query  685  RSPPNWWTEELTILDVAFFARIIATMRSRTAKPLTLASAIITYAERSL  828
            R    WW E+ T+L +  F R++  M +R  K   L   I+ YA++SL
Sbjct  181  RPVVQWWAEDFTVLRIDIFQRVVIAMMARGFKQFALGPIIMLYAQKSL  228



>ref|XP_006443605.1| hypothetical protein CICLE_v10019330mg [Citrus clementina]
 ref|XP_006479282.1| PREDICTED: BTB/POZ domain-containing protein At5g48800-like [Citrus 
sinensis]
 gb|ESR56845.1| hypothetical protein CICLE_v10019330mg [Citrus clementina]
 gb|KDO65925.1| hypothetical protein CISIN_1g007123mg [Citrus sinensis]
Length=617

 Score =   186 bits (473),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 90/239 (38%), Positives = 152/239 (64%), Gaps = 22/239 (9%)
 Frame = +1

Query  175  RLSLAM---ERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADL  345
            +LSLA    +R  +W+F +++P+D+ ++V   +F+LHKF LV++S  IRKL+ + +++D+
Sbjct  13   QLSLAKSSRQRCNEWIF-RDVPSDITIDVNGGTFALHKFPLVSRSGRIRKLVAEHRDSDI  71

Query  346  TRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTE  525
            +RI L  +PGG E FE AAKFCYG+NFEIT  NVA L C ++YL+MT+ +  +NL  R E
Sbjct  72   SRIELLNLPGGAETFELAAKFCYGINFEITSANVAQLCCVSDYLEMTEDFSKDNLGSRAE  131

Query  526  DFlsqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVEA-----------  672
            +++  +   +L   + VL+ CE LLPLA++LKIV RC++  ++KAC E            
Sbjct  132  EYIDCIVCKNLEMCVEVLQQCESLLPLADELKIVSRCIDAVASKACAEQIASSFSRLEYS  191

Query  673  -------NFPSRSPPNWWTEELTILDVAFFARIIATMRSRTAKPLTLASAIITYAERSL  828
                   N  ++   +WW E+L++L    + R++  M+ R  +P ++ ++++ YA++ L
Sbjct  192  SSGRLHMNKHTKCEGDWWIEDLSVLRFDLYQRVMTAMKCRGVRPESIGASLMNYAQKEL  250



>ref|XP_003520918.1| PREDICTED: BTB/POZ domain-containing protein At5g48800-like [Glycine 
max]
 gb|KHN29840.1| BTB/POZ domain-containing protein [Glycine soja]
Length=612

 Score =   186 bits (473),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 90/239 (38%), Positives = 152/239 (64%), Gaps = 22/239 (9%)
 Frame = +1

Query  175  RLSLAM---ERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADL  345
            +LSLA    +R  +W+F +++P+D+ +EV   +FSLHKF LV++S  IR+L+ + +++D+
Sbjct  10   QLSLAKGTRQRYNEWIF-RDVPSDITIEVNGGTFSLHKFPLVSRSGRIRRLVAEHRDSDI  68

Query  346  TRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTE  525
            +R+ L  +PGG E FE AAKFCYG+NFEIT  NVA L C ++YL+MT+ +  +NL  R E
Sbjct  69   SRVELLNLPGGAECFELAAKFCYGINFEITSTNVAQLCCVSDYLEMTEDFSKDNLGSRAE  128

Query  526  DFlsqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVEA-----------  672
            ++L  +   +L   + VL+ CE LLPLA+ LK+V RC++  ++KAC E            
Sbjct  129  EYLDSIVCKNLEMCVEVLQQCESLLPLADALKVVSRCIDAIASKACAEQIASSFSRLEYS  188

Query  673  -------NFPSRSPPNWWTEELTILDVAFFARIIATMRSRTAKPLTLASAIITYAERSL  828
                   +  ++   +WW E+L++L +  + R+I  M+ R  +P ++ ++++ YA++ L
Sbjct  189  SSGRLHMSRQAKCDGDWWIEDLSVLRIDMYQRVITAMKCRGVRPESIGASLVNYAQKEL  247



>dbj|BAC41926.1| non-phototropic hypocotyl-like protein [Arabidopsis thaliana]
Length=321

 Score =   180 bits (457),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 91/242 (38%), Positives = 155/242 (64%), Gaps = 25/242 (10%)
 Frame = +1

Query  175  RLSLA---MERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADL  345
            +LSLA    +   +W+F +++P+D+ +EV   +F+LHKF LV++S  IR+++ + +++D+
Sbjct  22   KLSLAKSSRQSCSEWIF-RDVPSDITIEVNGGNFALHKFPLVSRSGRIRRIVAEHRDSDI  80

Query  346  TRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTE  525
            +++ L  +PGG E FE AAKFCYG+NFEIT  NVA L C ++YL+MT++Y  +NLA RTE
Sbjct  81   SKVELLNLPGGAETFELAAKFCYGINFEITSSNVAQLFCVSDYLEMTEEYSKDNLASRTE  140

Query  526  DFlsqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVE---ANF------  678
            ++L  +   +L   + VLK  E LLPLA++L I+ RC++  ++KAC E   ++F      
Sbjct  141  EYLESIVCKNLEMCVQVLKQSEILLPLADELNIIGRCIDAIASKACAEQIASSFSRLEYS  200

Query  679  ------------PSRSPPNWWTEELTILDVAFFARIIATMRSRTAKPLTLASAIITYAER  822
                         S    +WW E+L++L +  + R++  M+ R  +P ++ +++++YAER
Sbjct  201  SSGRLHMSRQVKSSGDGGDWWIEDLSVLRIDLYQRVMNAMKCRGVRPESIGASLVSYAER  260

Query  823  SL  828
             L
Sbjct  261  EL  262



>ref|XP_010245988.1| PREDICTED: BTB/POZ domain-containing protein At5g48800-like isoform 
X1 [Nelumbo nucifera]
Length=620

 Score =   186 bits (473),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 91/228 (40%), Positives = 148/228 (65%), Gaps = 19/228 (8%)
 Frame = +1

Query  199  TGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGIPGG  378
              +W+FS ++P+D+ +EV   +F+LHKF LV++S  IRKL+ + +++D++R+ L  +PGG
Sbjct  25   NNEWIFS-DVPSDITIEVSGCTFNLHKFPLVSRSGRIRKLVAEHRDSDISRMELLNLPGG  83

Query  379  PEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalssl  558
             + F+ AAKFCYG+NFEIT  NVA L C +++L+MT++Y  +NL  R E +L  V   SL
Sbjct  84   ADSFDLAAKFCYGINFEITSSNVAQLCCVSDFLEMTEEYSKDNLGSRAEAYLDSVVCKSL  143

Query  559  sgalvvlksCEELLPLAEDLKIVQRCVELASAKACVEA------------------NFPS  684
               + VL+ CE LLPLA++LKIV RC +  ++KACVE                   N  +
Sbjct  144  EMCVEVLQWCENLLPLADELKIVSRCTDAIASKACVEQIASSFSRLEYSSSGRLHMNKQA  203

Query  685  RSPPNWWTEELTILDVAFFARIIATMRSRTAKPLTLASAIITYAERSL  828
            +   +WW E+L++L +  + R+IATM+ R  +P ++ ++++ YA++ L
Sbjct  204  KCDGDWWIEDLSVLRIDLYQRVIATMKCRGVRPESIGASLVDYAQKFL  251



>ref|XP_011459733.1| PREDICTED: BTB/POZ domain-containing protein At5g48800, partial 
[Fragaria vesca subsp. vesca]
Length=611

 Score =   186 bits (472),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 90/234 (38%), Positives = 149/234 (64%), Gaps = 19/234 (8%)
 Frame = +1

Query  181  SLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINL  360
            S    R  +W+F +++P+D+ +EV   +FSLHKF LV++S  IRKL+ + +++D++R+ L
Sbjct  12   SARQHRYNEWIF-RDVPSDITIEVNGGAFSLHKFPLVSRSGRIRKLVAEHRDSDISRVEL  70

Query  361  SGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsq  540
              +PGG E FE AAKFCYG+NFEIT  NVA L C +++L+MT+++  +NL  R E++L  
Sbjct  71   LNLPGGAETFELAAKFCYGINFEITSANVAQLCCISDFLEMTEEFSKDNLGSRAEEYLES  130

Query  541  valsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVEA----------------  672
            +   SL   + VL+ CE LLPLA++L++V RC++  ++KACVE                 
Sbjct  131  IVCKSLEMCVEVLQQCEALLPLADELRVVSRCIDAIASKACVEQIASSFSRLEYSSSGRL  190

Query  673  --NFPSRSPPNWWTEELTILDVAFFARIIATMRSRTAKPLTLASAIITYAERSL  828
              N  ++   +WW E+L+ L V  + R+I  M+ R  +P ++ ++++ YA++ L
Sbjct  191  HMNRQAKCDGDWWIEDLSGLRVDLYQRVITAMKCRGVRPESIGASLMNYAQKEL  244



>ref|XP_002961348.1| hypothetical protein SELMODRAFT_74933 [Selaginella moellendorffii]
 ref|XP_002983215.1| hypothetical protein SELMODRAFT_118052 [Selaginella moellendorffii]
 gb|EFJ15557.1| hypothetical protein SELMODRAFT_118052 [Selaginella moellendorffii]
 gb|EFJ38887.1| hypothetical protein SELMODRAFT_74933 [Selaginella moellendorffii]
Length=573

 Score =   186 bits (471),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 103/228 (45%), Positives = 143/228 (63%), Gaps = 25/228 (11%)
 Frame = +1

Query  214  FSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGIPGGPEIFE  393
             + ++PTD+ VEV   SF+LHKF LV++S  IRKL++++++ D ++I L  IPGG E+FE
Sbjct  1    MTSDVPTDISVEVAGTSFALHKFPLVSRSGRIRKLVVETRDLDPSQIKLLEIPGGAEVFE  60

Query  394  RAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalv  573
              AKFCYG+NFEIT  NVA LRCAA YL+MTD Y + NL  RTE +L++V +   S +L 
Sbjct  61   LVAKFCYGINFEITTANVAVLRCAAHYLEMTDDYGEGNLVVRTETYLNEVVIQDFSVSLA  120

Query  574  vlksCEELLPLAEDLKIVQRCVELASAKACVEANFPSRSP--------------------  693
            VL +CE L+PLAE+LKIV RCV+  +A A   A+ PSR                      
Sbjct  121  VLHNCENLVPLAEELKIVSRCVDAVAAIAT--ASLPSREQLSSSMEYNGSSGWIDSQVQS  178

Query  694  ---PNWWTEELTILDVAFFARIIATMRSRTAKPLTLASAIITYAERSL  828
                +WW+E+L IL + F+ R +A M SR     ++  A+I YA+R L
Sbjct  179  CKTDHWWSEDLAILRIDFYQRTLAAMMSRGLLHESIGGALIIYAQRYL  226



>ref|XP_006600924.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like [Glycine 
max]
 gb|KHN28330.1| BTB/POZ domain-containing protein [Glycine soja]
Length=583

 Score =   186 bits (471),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 103/231 (45%), Positives = 141/231 (61%), Gaps = 21/231 (9%)
 Frame = +1

Query  190  MERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGI  369
            M+R  +W +S EIP+DV ++VGE SFSLHKF LV+KS YI KL+ +S +A    I L  +
Sbjct  1    MKRASEWAYSHEIPSDVTIQVGEVSFSLHKFPLVSKSGYIGKLVSESSDA---FIELYDV  57

Query  370  PGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqval  549
            PGG E FE A KFCYG+NFEI++ N+A LRC AEYL MT+ Y   NL GR + +L++VAL
Sbjct  58   PGGAEAFELATKFCYGINFEISIENIAMLRCVAEYLDMTEDYSVGNLVGRADSYLNEVAL  117

Query  550  sslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVEANFPS---------------  684
             ++SGA  +L   E LLP+AE  K+V RC++  +  A  E  F S               
Sbjct  118  KTISGAASILHVSERLLPIAEKAKLVSRCIDAIAFIASKETQFCSSMRGDIIGTDGIGMA  177

Query  685  ---RSPPNWWTEELTILDVAFFARIIATMRSRTAKPLTLASAIITYAERSL  828
               R   +WW E+LT+L +  F R++  M +R  K   L   I+ YA++SL
Sbjct  178  SHQRPVVHWWAEDLTVLRIDIFQRVLIAMMARGFKQFALGPVIMLYAQKSL  228



>ref|XP_007133999.1| hypothetical protein PHAVU_010G010500g [Phaseolus vulgaris]
 gb|ESW05993.1| hypothetical protein PHAVU_010G010500g [Phaseolus vulgaris]
Length=610

 Score =   186 bits (471),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 86/230 (37%), Positives = 150/230 (65%), Gaps = 19/230 (8%)
 Frame = +1

Query  193  ERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGIP  372
            +R  +W+F +++P+D+ +EV   +FSLHKF LV++S  IR+++ ++++ D++R+ L+ +P
Sbjct  17   QRYNEWIF-RDVPSDITIEVNGGAFSLHKFPLVSRSGRIRRIVAENRDDDISRVVLNNLP  75

Query  373  GGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvals  552
            GG E FE AAKFCYG+NFEIT  NVA L C ++YL+MT+ +  +NL  R E++L  V   
Sbjct  76   GGAECFELAAKFCYGINFEITSTNVAQLCCVSDYLEMTEDFSKDNLGSRAEEYLESVVCK  135

Query  553  slsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVEA------------------NF  678
            +L   + VL+ CE LLPLA++LK+V RC++  ++KAC E                   + 
Sbjct  136  NLEMCVEVLQQCESLLPLADELKVVIRCIDAIASKACAEQIASSFSRLEYSSSGRLHMSR  195

Query  679  PSRSPPNWWTEELTILDVAFFARIIATMRSRTAKPLTLASAIITYAERSL  828
             ++   +WW E+L++L +  + R+I+ M+ R  +P ++ ++++ YA++ L
Sbjct  196  QAKCDSDWWIEDLSVLRIDMYQRVISAMKCRGVRPESIGASLVNYAQKEL  245



>ref|XP_008465052.1| PREDICTED: BTB/POZ domain-containing protein At5g48800 [Cucumis 
melo]
Length=616

 Score =   185 bits (470),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 86/229 (38%), Positives = 147/229 (64%), Gaps = 19/229 (8%)
 Frame = +1

Query  196  RTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGIPG  375
            R  +W+F +++P+D+ +EV   +FSLHKF LV++S  IR+L+ + +++D++++ L  +PG
Sbjct  22   RCNEWIF-RDVPSDITIEVAGVTFSLHKFPLVSRSGRIRRLVAEHRDSDISKVELLNLPG  80

Query  376  GPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalss  555
            G E FE AAKFCYG+NFEIT  NVA L C ++YL+MT+++  +NL  R E++L  +   +
Sbjct  81   GAESFELAAKFCYGINFEITPGNVAQLCCVSDYLEMTEEFAKDNLGSRAEEYLESIVSKN  140

Query  556  lsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVEA------------------NFP  681
            L   + VL+ CE LLPLA++LK+V RC++  ++KAC E                   +  
Sbjct  141  LEMCVEVLQQCENLLPLADELKVVSRCIDAIASKACSEQIASSFSRLEYSSSGRLHMSKQ  200

Query  682  SRSPPNWWTEELTILDVAFFARIIATMRSRTAKPLTLASAIITYAERSL  828
            ++   +WW E++++L V  + R+I  M+ R  +P ++  +++ YA+R L
Sbjct  201  TKCESDWWIEDISVLRVDLYERVITAMKCRGVRPESIGVSLVNYAQREL  249



>ref|XP_007050813.1| Phototropic-responsive NPH3 family protein isoform 2 [Theobroma 
cacao]
 gb|EOX94970.1| Phototropic-responsive NPH3 family protein isoform 2 [Theobroma 
cacao]
Length=626

 Score =   185 bits (469),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 90/220 (41%), Positives = 146/220 (66%), Gaps = 18/220 (8%)
 Frame = +1

Query  223  EIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGIPGGPEIFERAA  402
            ++ +D+ +EVG +SF+LHKF LV++S  IRKL++D+K+A ++R+N+S +PGGPE FE AA
Sbjct  30   DVSSDLTIEVGASSFALHKFPLVSRSGRIRKLLIDAKDAKISRVNISSVPGGPEAFELAA  89

Query  403  KFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlk  582
            KFCYG+N EIT+ NVA LRCA+ +L+MT+++ + NL  RTE +L  + L ++S ++ VL 
Sbjct  90   KFCYGINVEITLSNVAMLRCASHFLEMTEEFAEKNLEARTEAYLKDMVLPNISSSISVLH  149

Query  583  sCEELLPLAEDLKIVQRCVELASAKACVEA----------NFPSRSPPN--------WWT  708
             CE LLP++E++ +V R +   +  AC E           N+PS++ PN        WW 
Sbjct  150  RCESLLPISEEINLVNRLINAIANNACKEQLTSGLLKLDHNYPSKAMPNMEPETPSDWWG  209

Query  709  EELTILDVAFFARIIATMRSRTAKPLTLASAIITYAERSL  828
            + L +L++ FF R+++ ++S+  K   ++  +I Y   SL
Sbjct  210  KSLAVLNLDFFQRVLSAVKSKGLKQDMISKILINYTHNSL  249



>ref|XP_009630229.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like isoform 
X1 [Nicotiana tomentosiformis]
Length=618

 Score =   185 bits (469),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 105/238 (44%), Positives = 151/238 (63%), Gaps = 21/238 (9%)
 Frame = +1

Query  178  LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRIN  357
            LS  M+RT +W+ SQEIP+D+ V V   SF+LHKF LV+K  YIRKL+  S +A+L+ I 
Sbjct  26   LSNVMKRTSEWILSQEIPSDITVHVAGTSFALHKFPLVSKCGYIRKLVAKSNDANLSEIE  85

Query  358  LSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFls  537
            +  IPGG E FE AAKFCYG+NFEI+  N+A LRC AEYL MTD Y   NL G +E +L+
Sbjct  86   IPDIPGGAEAFEFAAKFCYGINFEISSGNIALLRCVAEYLDMTDYYAVGNLVGLSEAYLN  145

Query  538  qvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVEANF-------------  678
            +VAL S++GA+ VL S E+LLP+AE++K+V R ++  +   C +++F             
Sbjct  146  EVALKSIAGAVSVLHSSEKLLPIAENIKLVNRSIDTIAYIVCKDSHFCKSGRIEVDANSL  205

Query  679  ---PSRSPP-----NWWTEELTILDVAFFARIIATMRSRTAKPLTLASAIITYAERSL  828
                + S P     + W E+LT+L + FF R++  M +R  K   L   ++ Y+++SL
Sbjct  206  MNSSTLSNPRPIVVDCWAEDLTVLRIDFFQRVLIAMMARGYKQYALGPVLMLYSQKSL  263



>ref|XP_011079726.1| PREDICTED: BTB/POZ domain-containing protein At1g03010 [Sesamum 
indicum]
Length=632

 Score =   185 bits (469),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 97/235 (41%), Positives = 148/235 (63%), Gaps = 18/235 (8%)
 Frame = +1

Query  175  RLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRI  354
            R S +     +W  S ++ +D+ +EVG ASF+LHKF LV++S  IRKL+ ++K++ ++R+
Sbjct  20   RPSSSARHVTEWPLS-DVSSDLTIEVGTASFALHKFPLVSRSGRIRKLVSEAKDSKISRL  78

Query  355  NLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFl  534
            NLSG+PGG + FE AAKFCYGVN EITV NV  LRCAA +L+MT+++ D NL  RTE +L
Sbjct  79   NLSGVPGGSQAFELAAKFCYGVNIEITVSNVGMLRCAAHFLEMTEEFSDKNLEARTEVYL  138

Query  535  sqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKAC----------VEANFPS  684
                L S+  ++ VL  CE LLP AE++ +  R +   +  AC          +E NFPS
Sbjct  139  KDTVLPSIPNSITVLHYCEGLLPTAEEINLASRLINGIANNACKEQLTSGLSKLEHNFPS  198

Query  685  RS-------PPNWWTEELTILDVAFFARIIATMRSRTAKPLTLASAIITYAERSL  828
            +        P +WW + LT+L + FF R+++ ++++  K   ++  +I YA+ SL
Sbjct  199  KHSGADGEIPSDWWGKSLTLLSLDFFQRVLSAVKTKGLKQDMISRILINYAQNSL  253



>ref|XP_003604967.1| BTB/POZ domain-containing protein [Medicago truncatula]
 gb|AES87164.1| phototropic-responsive NPH3 family protein [Medicago truncatula]
Length=617

 Score =   184 bits (468),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 89/238 (37%), Positives = 151/238 (63%), Gaps = 22/238 (9%)
 Frame = +1

Query  178  LSLAM---ERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLT  348
            LSLA    +R  +W+F +++P+D+ +EV   +FSLHKF LV++S  IR+L+ + +++D++
Sbjct  16   LSLAKNVRQRYNEWIF-RDVPSDITIEVCGVTFSLHKFPLVSRSGRIRRLVAEHRDSDIS  74

Query  349  RINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTED  528
            R+    +PGG E FE AAKFCYG+NFEIT  NVA L C ++YL+MTD +  +NL+ R E+
Sbjct  75   RVEFLNLPGGAECFELAAKFCYGINFEITSSNVAQLCCVSDYLEMTDDFSKDNLSSRAEE  134

Query  529  FlsqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVEA------------  672
            +L  +   +L   + VL+ CE L+PLA++LKIV RC++  ++K C E             
Sbjct  135  YLDCIVCKNLEMCVGVLQQCESLIPLADELKIVTRCIDAIASKTCAEQIASSFSRLEYSS  194

Query  673  ------NFPSRSPPNWWTEELTILDVAFFARIIATMRSRTAKPLTLASAIITYAERSL  828
                  +  ++   +WW E++++L +  + R+I  M+ R  +P ++ ++++ YAE+ L
Sbjct  195  SGRLHMSRQAKCDGDWWIEDISVLRIDMYQRVITAMKCRGVRPESIGASLVNYAEKEL  252



>emb|CDY37857.1| BnaAnng05180D [Brassica napus]
Length=600

 Score =   184 bits (468),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 103/231 (45%), Positives = 149/231 (65%), Gaps = 14/231 (6%)
 Frame = +1

Query  178  LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDS-KEADLTRI  354
            LS AM+RT +W+ SQE+ +DV V VGEASFSLHKF L++K    +KL+ +S  ++D T I
Sbjct  9    LSSAMKRTSEWISSQEVSSDVTVHVGEASFSLHKFPLLSKCGLFKKLVSESTNDSDATVI  68

Query  355  NLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFl  534
             +  IPGG E FE   KFCYG+NF+++  N+A LRCA+EYL+MT+++   NL  R+E +L
Sbjct  69   KIPDIPGGSEAFELTTKFCYGINFDMSTENIAMLRCASEYLEMTEEHSVENLISRSEAYL  128

Query  535  sqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVEANFPSRSPPN-----  699
            ++VAL SLS A+ VL   EELLP+AE +K+V RC++  +   C E+ F S +  N     
Sbjct  129  NEVALKSLSSAITVLHKSEELLPIAERVKLVSRCIDAIAYMTCQESQFCSPTSNNSNSEV  188

Query  700  --------WWTEELTILDVAFFARIIATMRSRTAKPLTLASAIITYAERSL  828
                    WW E+LT+L +  F R++  M +R  K   L   ++ YA++SL
Sbjct  189  VSKQPVVDWWAEDLTVLRIDSFQRVLIAMMARGFKQYGLGPVLMLYAQKSL  239



>ref|XP_006579934.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like [Glycine 
max]
 gb|KHN06007.1| BTB/POZ domain-containing protein [Glycine soja]
Length=590

 Score =   184 bits (467),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 103/229 (45%), Positives = 142/229 (62%), Gaps = 17/229 (7%)
 Frame = +1

Query  190  MERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGI  369
            M+R  +W +S EI +DV V+VGE SFSLHKF LV+KS YI KL+ +S + D++ I L  +
Sbjct  1    MKRASEWAYSHEILSDVTVQVGEVSFSLHKFPLVSKSGYIGKLVSESSD-DVSFIELYDV  59

Query  370  PGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqval  549
            PGG E FE A KFCYG+NFEI+V N+A LRC AEYL MT+ Y   NL GR + +L++VAL
Sbjct  60   PGGAEAFELATKFCYGINFEISVENIATLRCVAEYLDMTEDYSVGNLVGRADSYLNEVAL  119

Query  550  sslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVEANFPS---------------  684
             ++SGA+ +L   E  LP+AE  K+V RC++  +  A  E  F S               
Sbjct  120  KTISGAVSILHMSERFLPIAEKAKLVSRCIDAIAFIASKETQFCSPMRGDIIGTDGMASH  179

Query  685  -RSPPNWWTEELTILDVAFFARIIATMRSRTAKPLTLASAIITYAERSL  828
             R   +WW E+LT+L +  F R++  M +R  K   L   I+ YA++SL
Sbjct  180  QRPVVHWWAEDLTVLRIDIFQRVLIAMMARGFKQFALGPIIMLYAQKSL  228



>ref|XP_009130549.1| PREDICTED: LOW QUALITY PROTEIN: BTB/POZ domain-containing protein 
At5g67385-like [Brassica rapa]
Length=600

 Score =   184 bits (467),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 103/231 (45%), Positives = 149/231 (65%), Gaps = 14/231 (6%)
 Frame = +1

Query  178  LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDS-KEADLTRI  354
            LS AM+RT +W+ SQE+ +DV V VGEASFSLHKF L++K    +KL+ +S  ++D T I
Sbjct  9    LSSAMKRTSEWISSQEVSSDVTVHVGEASFSLHKFPLLSKCGLFKKLVSESTNDSDATVI  68

Query  355  NLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFl  534
             +  IPGG E FE   KFCYG+NF+++  N+A LRCA+EYL+MT+++   NL  R+E +L
Sbjct  69   KIPDIPGGSEAFELTTKFCYGINFDMSTENIAMLRCASEYLEMTEEHSVENLISRSEAYL  128

Query  535  sqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVEANFPSRSPPN-----  699
            ++VAL SLS A+ VL   EELLP+AE +K+V RC++  +   C E+ F S +  N     
Sbjct  129  NEVALKSLSSAITVLHKSEELLPIAERVKLVSRCIDAIAYMTCQESQFCSPTSNNSNSEV  188

Query  700  --------WWTEELTILDVAFFARIIATMRSRTAKPLTLASAIITYAERSL  828
                    WW E+LT+L +  F R++  M +R  K   L   ++ YA++SL
Sbjct  189  VSKQPVVDWWAEDLTVLRIDSFQRVLIAMMARGFKQYGLGPVLMLYAQKSL  239



>gb|ERN06935.1| hypothetical protein AMTR_s00005p00262560 [Amborella trichopoda]
Length=615

 Score =   184 bits (467),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 93/224 (42%), Positives = 142/224 (63%), Gaps = 19/224 (8%)
 Frame = +1

Query  211  VFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGIPGGPEIF  390
            +FS ++P+D+++EV  A+F LHKF LV++S  IRKLI + +++D++R+ L  +PGG   F
Sbjct  25   IFS-DVPSDIMIEVNGATFPLHKFPLVSRSGRIRKLIAERRDSDISRLELFNLPGGAVAF  83

Query  391  ERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgal  570
            E AAKFCYG+NFEIT  NVA L C +EYL+MT+ Y   NLA R E +L  V   +L  ++
Sbjct  84   ELAAKFCYGINFEITASNVAQLYCVSEYLEMTEDYAKENLASRAEAYLDGVVCKNLEKSV  143

Query  571  vvlksCEELLPLAEDLKIVQRCVELASAKACVE------------------ANFPSRSPP  696
             VL  CE LLPLAE+LK+V RC +  ++KAC E                   N  ++   
Sbjct  144  EVLHQCENLLPLAEELKLVGRCTDAIASKACTEQIASSFSRLEYSSSGRLHTNRQAKCSG  203

Query  697  NWWTEELTILDVAFFARIIATMRSRTAKPLTLASAIITYAERSL  828
            +WW E+L++L +  + R+I  MR R  +P ++ ++++ YA++ L
Sbjct  204  DWWIEDLSVLRIDMYQRVITAMRCRGVRPESIGASLVNYAQKFL  247



>emb|CBI37309.3| unnamed protein product [Vitis vinifera]
Length=605

 Score =   184 bits (467),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 90/230 (39%), Positives = 147/230 (64%), Gaps = 19/230 (8%)
 Frame = +1

Query  193  ERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGIP  372
            +R  +W+F +++P+D+ +EV    F+LHKF LV++S  IRKL+ + ++++ +RI L  +P
Sbjct  26   QRCNEWIF-RDVPSDITIEVSGGMFALHKFPLVSRSGRIRKLVAERRDSENSRIELLSLP  84

Query  373  GGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvals  552
            GG E FE AAKFCYGVNFEIT  NVA L C ++YL+MT+++  +NL  R E++L  V   
Sbjct  85   GGAESFELAAKFCYGVNFEITSANVAQLCCVSDYLEMTEEFSKDNLGSRAEEYLESVVCK  144

Query  553  slsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVEA------------------NF  678
            +L   + VL+ CE LLPLA++LKIV RC++  ++KACVE                   N 
Sbjct  145  NLEMCVEVLQQCENLLPLADELKIVGRCIDAIASKACVEQIASSFSRLEYSSSGRLHMNR  204

Query  679  PSRSPPNWWTEELTILDVAFFARIIATMRSRTAKPLTLASAIITYAERSL  828
             ++   +WW E+L+ L +  + ++I  M+ R  +P ++ ++++ YA++ L
Sbjct  205  QAKCDGDWWIEDLSALRIDLYQKVITAMKCRGVRPESIGASLVNYAQKEL  254



>ref|XP_002265786.1| PREDICTED: BTB/POZ domain-containing protein At5g48800 isoform 
X1 [Vitis vinifera]
Length=616

 Score =   184 bits (467),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 90/230 (39%), Positives = 147/230 (64%), Gaps = 19/230 (8%)
 Frame = +1

Query  193  ERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGIP  372
            +R  +W+F +++P+D+ +EV    F+LHKF LV++S  IRKL+ + ++++ +RI L  +P
Sbjct  26   QRCNEWIF-RDVPSDITIEVSGGMFALHKFPLVSRSGRIRKLVAERRDSENSRIELLSLP  84

Query  373  GGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvals  552
            GG E FE AAKFCYGVNFEIT  NVA L C ++YL+MT+++  +NL  R E++L  V   
Sbjct  85   GGAESFELAAKFCYGVNFEITSANVAQLCCVSDYLEMTEEFSKDNLGSRAEEYLESVVCK  144

Query  553  slsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVEA------------------NF  678
            +L   + VL+ CE LLPLA++LKIV RC++  ++KACVE                   N 
Sbjct  145  NLEMCVEVLQQCENLLPLADELKIVGRCIDAIASKACVEQIASSFSRLEYSSSGRLHMNR  204

Query  679  PSRSPPNWWTEELTILDVAFFARIIATMRSRTAKPLTLASAIITYAERSL  828
             ++   +WW E+L+ L +  + ++I  M+ R  +P ++ ++++ YA++ L
Sbjct  205  QAKCDGDWWIEDLSALRIDLYQKVITAMKCRGVRPESIGASLVNYAQKEL  254



>ref|XP_010264099.1| PREDICTED: BTB/POZ domain-containing protein At5g48800 isoform 
X2 [Nelumbo nucifera]
Length=504

 Score =   182 bits (463),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 89/228 (39%), Positives = 146/228 (64%), Gaps = 19/228 (8%)
 Frame = +1

Query  199  TGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGIPGG  378
              +W+FS ++P+D+ +EV  A+F+LHKF LV++S  IRKL+ + ++ ++++I L  +PGG
Sbjct  80   NNEWIFS-DVPSDITIEVSGATFALHKFPLVSRSGRIRKLVAEHRDFNISQIELPSLPGG  138

Query  379  PEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalssl  558
             + F+ AAKFCYG+NFEIT  NVA L C ++YL+MT++Y  +NL  R E +L  V   SL
Sbjct  139  ADSFDMAAKFCYGINFEITASNVAQLCCVSDYLEMTEEYSKDNLGSRAEAYLDSVVCKSL  198

Query  559  sgalvvlksCEELLPLAEDLKIVQRCVELASAKACVEA------------------NFPS  684
               + VL+ CE LLPLA++LKIV RC +  ++KACVE                   N  +
Sbjct  199  EMCVEVLQKCENLLPLADELKIVSRCTDAIASKACVEQIASSFSRLEYSSSGRLHMNKQA  258

Query  685  RSPPNWWTEELTILDVAFFARIIATMRSRTAKPLTLASAIITYAERSL  828
            +   +WW E+L++L +  + ++I  M+ R  +P ++ ++++ YA++ L
Sbjct  259  KCDGDWWIEDLSVLRIDLYQKVIEAMKCRGVRPESIGASLVNYAQKFL  306



>ref|XP_004144382.2| PREDICTED: BTB/POZ domain-containing protein At5g48800 [Cucumis 
sativus]
 gb|KGN58361.1| hypothetical protein Csa_3G627720 [Cucumis sativus]
Length=616

 Score =   184 bits (467),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 85/229 (37%), Positives = 147/229 (64%), Gaps = 19/229 (8%)
 Frame = +1

Query  196  RTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGIPG  375
            R  +W+F +++P+D+ +EV   +FSLHKF LV++S  IR+L+ + +++D++++ L  +PG
Sbjct  22   RCNEWIF-RDVPSDITIEVAGVTFSLHKFPLVSRSGRIRRLVAEHRDSDISKVELLNLPG  80

Query  376  GPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalss  555
            G E FE AAKFCYG+NFEIT  NVA L C ++YL+M +++  +NL  R E++L  +   +
Sbjct  81   GAESFELAAKFCYGINFEITPGNVAQLCCVSDYLEMAEEFSKDNLGSRAEEYLESIVSKN  140

Query  556  lsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVEA------------------NFP  681
            L   + VL+ CE LLPLA++LK+V RC++  ++KAC E                   +  
Sbjct  141  LEMCVEVLQQCENLLPLADELKVVSRCIDAIASKACSEQIASSFSRLEYSSSGRLHMSKQ  200

Query  682  SRSPPNWWTEELTILDVAFFARIIATMRSRTAKPLTLASAIITYAERSL  828
            ++   +WW E++++L V  + R+I  M+ R  +P ++ ++++ YA+R L
Sbjct  201  AKCDSDWWIEDISVLRVDLYERVITAMKCRGVRPESIGASLVNYAQREL  249



>ref|XP_009103425.1| PREDICTED: BTB/POZ domain-containing protein At5g67385 [Brassica 
rapa]
Length=601

 Score =   184 bits (466),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 105/234 (45%), Positives = 151/234 (65%), Gaps = 17/234 (7%)
 Frame = +1

Query  178  LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSK-EADLTRI  354
            LS AM+RT +W+ SQE+ +DV V VGEASFSLHKF L++K   I+KL+ +SK ++D + I
Sbjct  9    LSSAMKRTSEWISSQEVSSDVTVHVGEASFSLHKFPLLSKCGLIKKLMSESKNDSDASVI  68

Query  355  NLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFl  534
             +  IPGG E FE  AKFCYG+NF+++  N+A LRCAAEYL MT+++   NL  R E +L
Sbjct  69   KIPDIPGGFEAFELTAKFCYGINFDMSTENIAMLRCAAEYLDMTEEHSVENLVVRAEAYL  128

Query  535  sqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVEANF------------  678
            ++VAL SLS A+ VL   E+LLP+AE +K+V RC++  +   C E+ F            
Sbjct  129  NEVALKSLSSAITVLHKSEDLLPIAERVKLVSRCIDAIAYMTCQESQFCSPTSNNSNNEI  188

Query  679  ---PSRSP-PNWWTEELTILDVAFFARIIATMRSRTAKPLTLASAIITYAERSL  828
                S+ P  +WW E+LT+L +  F R++  M +R  K   L   ++ YA++SL
Sbjct  189  VVQQSKQPVVDWWAEDLTVLRIDSFQRVLIAMMARGFKQYGLGPVLMLYAQKSL  242



>ref|XP_004506596.1| PREDICTED: BTB/POZ domain-containing protein At5g48800-like [Cicer 
arietinum]
Length=616

 Score =   184 bits (466),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 89/239 (37%), Positives = 153/239 (64%), Gaps = 22/239 (9%)
 Frame = +1

Query  175  RLSLAM---ERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADL  345
            +LSLA    +R  +W+F +++P+D+ +EV   +FSLHKF LV++S  IR+L+ + +++D+
Sbjct  13   QLSLAKNGRQRYNEWIF-RDVPSDITIEVNGVTFSLHKFPLVSRSGRIRRLVAEHRDSDI  71

Query  346  TRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTE  525
            +R+ L  +PGG E FE AAKFCYG+NFEIT  NVA L C ++YL+MT+ +  +NL+ R E
Sbjct  72   SRVELLNLPGGAECFELAAKFCYGINFEITSTNVAQLCCVSDYLEMTEDFSKDNLSSRAE  131

Query  526  DFlsqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVEA-----------  672
            ++L  +   +L   + VL+ CE L+PLA++++IV RC++  ++KAC E            
Sbjct  132  EYLDCIVCKNLEMCVEVLQQCESLIPLADEMRIVTRCIDAIASKACAEQIASSFSRLEYS  191

Query  673  -------NFPSRSPPNWWTEELTILDVAFFARIIATMRSRTAKPLTLASAIITYAERSL  828
                   +  ++   +WW E+L+ L +  + R+I  M+ R  +P ++ ++++ YAE+ L
Sbjct  192  SSGRLHMSRQAKCDGDWWIEDLSGLRIDIYQRVITAMKCRGVRPESIGASLVNYAEKEL  250



>gb|KHG21965.1| hypothetical protein F383_08186 [Gossypium arboreum]
Length=632

 Score =   184 bits (466),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 95/236 (40%), Positives = 147/236 (62%), Gaps = 19/236 (8%)
 Frame = +1

Query  175  RLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRI  354
            R S ++    +W  S ++ +D+ +EVG +SF+LHKF LV++S  IRKL++D+K+  ++RI
Sbjct  20   RPSSSIRHATEWPIS-DVSSDLKIEVGTSSFALHKFPLVSRSGRIRKLLIDTKDTKISRI  78

Query  355  NLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFl  534
            NLS  PGGPE FE AAKFCYG+N EIT+ NVA LRC + YL+M +++ +NNL  RTE +L
Sbjct  79   NLSSAPGGPEAFELAAKFCYGINVEITLSNVAMLRCISHYLEMAEEFAENNLEARTEAYL  138

Query  535  sqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVEA----------NFPS  684
              + L ++S  + VL  CE LLP++E++ +V R +   +  AC E           NFPS
Sbjct  139  KDMVLPNISSTIAVLHRCESLLPISEEINLVNRLINAIANNACKEQLTSGLLKLDHNFPS  198

Query  685  RSPPN--------WWTEELTILDVAFFARIIATMRSRTAKPLTLASAIITYAERSL  828
            ++ PN        WW + L +L++ FF R++  ++S+  +   +   +I Y   SL
Sbjct  199  KAIPNMEPETPSDWWGKSLAVLNIDFFQRVLLAIKSKGLRQDMICKILINYTHNSL  254



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1779792308916