BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig13

Length=819
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009788755.1|  PREDICTED: cytochrome P450 76A2-like               282   6e-88   Nicotiana sylvestris
ref|XP_006341182.1|  PREDICTED: cytochrome P450 76A2-like               281   1e-87   Solanum tuberosum [potatoes]
ref|XP_009589554.1|  PREDICTED: cytochrome P450 76A2-like               276   2e-85   Nicotiana tomentosiformis
ref|XP_004246901.1|  PREDICTED: cytochrome P450 76A2-like               272   6e-84   Solanum lycopersicum
dbj|BAC53892.1|  cytochrome P450                                        270   3e-83   Petunia x hybrida [garden petunia]
ref|XP_006339107.1|  PREDICTED: cytochrome P450 76A2-like               269   8e-83   Solanum tuberosum [potatoes]
ref|XP_009602679.1|  PREDICTED: cytochrome P450 76A2-like               265   2e-81   Nicotiana tomentosiformis
ref|XP_009757934.1|  PREDICTED: cytochrome P450 76A2-like               265   5e-81   Nicotiana sylvestris
ref|XP_008241319.1|  PREDICTED: cytochrome P450 76A2-like               264   8e-81   Prunus mume [ume]
ref|XP_006339108.1|  PREDICTED: cytochrome P450 76A2-like               262   4e-80   Solanum tuberosum [potatoes]
ref|XP_006339110.1|  PREDICTED: cytochrome P450 76A2-like               261   3e-79   
ref|XP_006339109.1|  PREDICTED: cytochrome P450 76A2-like               259   3e-79   Solanum tuberosum [potatoes]
sp|P37122.1|C76A2_SOLME  RecName: Full=Cytochrome P450 76A2; AltN...    258   1e-78   Solanum melongena [aubergine]
ref|XP_004249463.1|  PREDICTED: cytochrome P450 76A2-like               258   1e-78   Solanum lycopersicum
ref|XP_006339111.1|  PREDICTED: cytochrome P450 76A2-like               252   2e-76   Solanum tuberosum [potatoes]
gb|AGT03776.1|  CYP76 hydroxylase                                       251   5e-76   Withania somnifera [ashwagandha]
ref|XP_002309107.1|  hypothetical protein POPTR_0006s09580g             251   1e-75   Populus trichocarpa [western balsam poplar]
ref|XP_011094547.1|  PREDICTED: cytochrome P450 76A2-like               250   1e-75   Sesamum indicum [beniseed]
ref|XP_011019179.1|  PREDICTED: cytochrome P450 76A2-like               249   3e-75   Populus euphratica
ref|XP_008392600.1|  PREDICTED: cytochrome P450 76A2-like               249   5e-75   
ref|XP_009785657.1|  PREDICTED: cytochrome P450 76A1-like isoform X2    249   6e-75   Nicotiana sylvestris
ref|XP_009785656.1|  PREDICTED: cytochrome P450 76A1-like isoform X1    249   7e-75   Nicotiana sylvestris
ref|XP_009334561.1|  PREDICTED: cytochrome P450 76A2-like               245   1e-73   Pyrus x bretschneideri [bai li]
ref|XP_009350795.1|  PREDICTED: cytochrome P450 76A2-like               245   1e-73   Pyrus x bretschneideri [bai li]
ref|XP_007203742.1|  hypothetical protein PRUPE_ppa018268mg             245   2e-73   
emb|CDP15344.1|  unnamed protein product                                238   2e-73   Coffea canephora [robusta coffee]
ref|XP_009603940.1|  PREDICTED: cytochrome P450 76A2-like               243   1e-72   Nicotiana tomentosiformis
ref|XP_006430324.1|  hypothetical protein CICLE_v10013315mg             243   1e-72   Citrus clementina [clementine]
ref|XP_008241318.1|  PREDICTED: cytochrome P450 76A2-like               242   2e-72   Prunus mume [ume]
ref|XP_009616474.1|  PREDICTED: cytochrome P450 76A1-like               242   2e-72   Nicotiana tomentosiformis
ref|XP_006482364.1|  PREDICTED: cytochrome P450 76A2-like               242   2e-72   
ref|XP_004249462.1|  PREDICTED: cytochrome P450 76A2-like               241   4e-72   Solanum lycopersicum
gb|KDO61008.1|  hypothetical protein CISIN_1g036305mg                   241   5e-72   Citrus sinensis [apfelsine]
ref|XP_002277725.1|  PREDICTED: cytochrome P450 76A1                    240   8e-72   Vitis vinifera
emb|CAN77399.1|  hypothetical protein VITISV_015277                     239   2e-71   Vitis vinifera
emb|CBI30226.3|  unnamed protein product                                241   1e-70   Vitis vinifera
ref|XP_011100232.1|  PREDICTED: cytochrome P450 76A2-like               238   1e-70   Sesamum indicum [beniseed]
ref|XP_009774708.1|  PREDICTED: cytochrome P450 76A2-like               236   5e-70   Nicotiana sylvestris
ref|XP_004305369.1|  PREDICTED: cytochrome P450 76A2-like               236   7e-70   Fragaria vesca subsp. vesca
ref|XP_010112510.1|  Cytochrome P450 76A2                               234   2e-69   
ref|XP_004303043.1|  PREDICTED: cytochrome P450 76A2-like               234   2e-69   Fragaria vesca subsp. vesca
ref|XP_007027589.1|  Cytochrome P450 76A2                               236   2e-69   
ref|XP_010037101.1|  PREDICTED: cytochrome P450 76A1-like               233   5e-69   Eucalyptus grandis [rose gum]
ref|XP_010037099.1|  PREDICTED: cytochrome P450 76A1-like               233   6e-69   Eucalyptus grandis [rose gum]
ref|XP_004249632.1|  PREDICTED: cytochrome P450 76A2-like               233   7e-69   Solanum lycopersicum
ref|XP_003520677.1|  PREDICTED: cytochrome P450 76A2-like               231   3e-68   Glycine max [soybeans]
ref|XP_010057042.1|  PREDICTED: cytochrome P450 76A2-like               231   4e-68   Eucalyptus grandis [rose gum]
gb|EYU29599.1|  hypothetical protein MIMGU_mgv1a026574mg                230   7e-68   Erythranthe guttata [common monkey flower]
ref|XP_002277661.2|  PREDICTED: cytochrome P450 76A1-like               230   8e-68   Vitis vinifera
gb|KHN18720.1|  Cytochrome P450 76A2                                    230   1e-67   Glycine soja [wild soybean]
ref|XP_010036736.1|  PREDICTED: cytochrome P450 76A1-like               229   1e-67   Eucalyptus grandis [rose gum]
gb|KDP27487.1|  hypothetical protein JCGZ_20022                         229   2e-67   Jatropha curcas
ref|XP_012084532.1|  PREDICTED: cytochrome P450 76A1-like               228   4e-67   Jatropha curcas
gb|KCW48743.1|  hypothetical protein EUGRSUZ_K02382                     228   5e-67   Eucalyptus grandis [rose gum]
ref|XP_010056841.1|  PREDICTED: cytochrome P450 76A1-like               227   1e-66   Eucalyptus grandis [rose gum]
ref|XP_002277746.1|  PREDICTED: cytochrome P450 76A1                    224   1e-65   Vitis vinifera
ref|XP_009786696.1|  PREDICTED: cytochrome P450 76A1-like               224   2e-65   Nicotiana sylvestris
ref|XP_004494132.1|  PREDICTED: cytochrome P450 76A2-like               221   4e-64   Cicer arietinum [garbanzo]
ref|XP_010057043.1|  PREDICTED: cytochrome P450 76A1-like               221   4e-64   Eucalyptus grandis [rose gum]
gb|KCW48764.1|  hypothetical protein EUGRSUZ_K02408                     219   4e-64   Eucalyptus grandis [rose gum]
ref|XP_007162842.1|  hypothetical protein PHAVU_001G185500g             220   6e-64   Phaseolus vulgaris [French bean]
gb|KEH24104.1|  cytochrome P450 family protein                          219   9e-64   Medicago truncatula
emb|CBI30225.3|  unnamed protein product                                225   2e-63   Vitis vinifera
gb|KCW74002.1|  hypothetical protein EUGRSUZ_E02619                     218   3e-63   Eucalyptus grandis [rose gum]
ref|XP_006341183.1|  PREDICTED: cytochrome P450 76A1-like               218   3e-63   Solanum tuberosum [potatoes]
gb|KCW74001.1|  hypothetical protein EUGRSUZ_E02618                     214   3e-62   Eucalyptus grandis [rose gum]
gb|AIW00679.1|  flavonoid 3',5'-hydroxylase                             214   8e-62   Paeonia lactiflora [common garden peony]
ref|XP_004246574.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...    213   2e-61   Solanum lycopersicum
ref|XP_002528645.1|  cytochrome P450, putative                          212   5e-61   Ricinus communis
ref|XP_010683910.1|  PREDICTED: cytochrome P450 76A2-like               212   8e-61   
emb|CAN77400.1|  hypothetical protein VITISV_015278                     209   2e-60   Vitis vinifera
gb|AJD25180.1|  cytochrome P450 CYP76A36                                206   9e-59   Salvia miltiorrhiza [Chinese salvia]
ref|XP_002528647.1|  cytochrome P450, putative                          206   1e-58   Ricinus communis
ref|XP_010045880.1|  PREDICTED: cytochrome P450 76A1-like               205   2e-58   Eucalyptus grandis [rose gum]
gb|KJB62266.1|  hypothetical protein B456_009G409000                    203   1e-57   Gossypium raimondii
dbj|BAC53891.1|  cytochrome P450                                        203   2e-57   Petunia x hybrida [garden petunia]
ref|XP_007204461.1|  hypothetical protein PRUPE_ppa023213mg             201   2e-57   
gb|AHX24365.1|  CYP76A26-like protein                                   200   2e-56   Cinchona calisaya [quinine]
gb|KCW84354.1|  hypothetical protein EUGRSUZ_B01206                     199   2e-56   Eucalyptus grandis [rose gum]
ref|XP_010036151.1|  PREDICTED: cytochrome P450 76A1-like               199   4e-56   Eucalyptus grandis [rose gum]
gb|AHK60833.1|  iridoid oxidase                                         199   6e-56   Catharanthus roseus [chatas]
ref|XP_002283772.1|  PREDICTED: cytochrome P450 76A1                    199   7e-56   Vitis vinifera
gb|AHX24370.1|  CYP76A26                                                199   7e-56   Catharanthus roseus [chatas]
ref|XP_002283777.2|  PREDICTED: cytochrome P450 76A1                    198   1e-55   Vitis vinifera
emb|CAN76784.1|  hypothetical protein VITISV_028823                     198   1e-55   Vitis vinifera
ref|XP_010036177.1|  PREDICTED: cytochrome P450 76A1-like               197   2e-55   Eucalyptus grandis [rose gum]
ref|XP_002267565.2|  PREDICTED: cytochrome P450 76A2-like               197   2e-55   Vitis vinifera
gb|AHX24367.1|  CYP76A26-like protein                                   197   2e-55   Rauvolfia serpentina [devilpepper]
ref|XP_010036187.1|  PREDICTED: cytochrome P450 76A1-like               197   2e-55   Eucalyptus grandis [rose gum]
gb|AHX24366.1|  CYP76A26-like protein                                   197   3e-55   Amsonia hubrichtii
ref|XP_010036165.1|  PREDICTED: cytochrome P450 76A1-like               196   4e-55   Eucalyptus grandis [rose gum]
sp|P37121.1|C76A1_SOLME  RecName: Full=Cytochrome P450 76A1; AltN...    194   1e-54   Solanum melongena [aubergine]
gb|AHX24368.1|  CYP76A26-like protein                                   195   1e-54   Tabernaemontana elegans
ref|XP_010045881.1|  PREDICTED: cytochrome P450 76A1-like               195   2e-54   Eucalyptus grandis [rose gum]
ref|XP_010036221.1|  PREDICTED: cytochrome P450 76A1-like               194   2e-54   
gb|AHX24369.1|  CYP76A26-like protein                                   194   4e-54   Vinca minor [common periwinkle]
gb|AJD20226.1|  putative N-methylcoclaurine 3-hydroxylase               192   2e-53   Podophyllum peltatum
ref|XP_006430323.1|  hypothetical protein CICLE_v10011511mg             189   4e-52   Citrus clementina [clementine]
gb|KDO61009.1|  hypothetical protein CISIN_1g010359mg                   188   4e-52   Citrus sinensis [apfelsine]
ref|XP_006481913.1|  PREDICTED: cytochrome P450 76A2-like               188   4e-52   Citrus sinensis [apfelsine]
ref|XP_012092524.1|  PREDICTED: cytochrome P450 76A1-like               185   7e-51   Jatropha curcas
gb|AHX24364.1|  CYP76A26-like protein                                   185   1e-50   Lonicera japonica [Japanese honeysuckle]
ref|XP_002528653.1|  cytochrome P450, putative                          184   3e-50   Ricinus communis
gb|KDP24880.1|  hypothetical protein JCGZ_25133                         183   4e-50   Jatropha curcas
ref|XP_012066000.1|  PREDICTED: cytochrome P450 76A1-like               183   6e-50   Jatropha curcas
ref|XP_012086044.1|  PREDICTED: cytochrome P450 76A1-like               182   6e-50   Jatropha curcas
ref|XP_002528654.1|  cytochrome P450, putative                          181   2e-49   
ref|XP_012087593.1|  PREDICTED: cytochrome P450 76A1-like               183   2e-49   
ref|XP_002528650.1|  cytochrome P450, putative                          181   3e-49   
ref|XP_011094433.1|  PREDICTED: cytochrome P450 76A1-like               179   1e-48   Sesamum indicum [beniseed]
ref|XP_011094434.1|  PREDICTED: cytochrome P450 76A1-like               179   2e-48   Sesamum indicum [beniseed]
ref|XP_012086045.1|  PREDICTED: cytochrome P450 76A1-like               177   6e-48   Jatropha curcas
ref|XP_012084533.1|  PREDICTED: cytochrome P450 76A1-like               176   2e-47   Jatropha curcas
ref|XP_006381328.1|  hypothetical protein POPTR_0006s11830g             167   2e-45   
ref|XP_002528649.1|  cytochrome P450, putative                          162   2e-42   
gb|KCW84357.1|  hypothetical protein EUGRSUZ_B012102                    152   8e-42   Eucalyptus grandis [rose gum]
gb|AJD25179.1|  cytochrome P450 CYP76A35                                159   2e-41   Salvia miltiorrhiza [Chinese salvia]
emb|CBI30229.3|  unnamed protein product                                158   6e-41   Vitis vinifera
gb|KCW84346.1|  hypothetical protein EUGRSUZ_B011962                    149   2e-40   Eucalyptus grandis [rose gum]
gb|KDP43097.1|  hypothetical protein JCGZ_27046                         152   7e-39   Jatropha curcas
gb|KCW84356.1|  hypothetical protein EUGRSUZ_B01208                     151   8e-39   Eucalyptus grandis [rose gum]
ref|XP_008241321.1|  PREDICTED: cytochrome P450 76A1                    151   2e-38   
ref|XP_007201998.1|  hypothetical protein PRUPE_ppa022979mg             149   1e-37   
ref|XP_009613392.1|  PREDICTED: cytochrome P450 76A2-like               148   2e-37   Nicotiana tomentosiformis
gb|KDP24879.1|  hypothetical protein JCGZ_25132                         140   3e-37   Jatropha curcas
gb|KDP43103.1|  hypothetical protein JCGZ_27052                         144   6e-37   Jatropha curcas
emb|CDP15345.1|  unnamed protein product                                146   8e-37   Coffea canephora [robusta coffee]
ref|XP_004246575.1|  PREDICTED: cytochrome P450 76A1-like               146   1e-36   Solanum lycopersicum
emb|CAB86901.1|  cytochrome P450-like protein                           146   2e-36   Arabidopsis thaliana [mouse-ear cress]
dbj|BAC42682.1|  putative cytochrome P450                               146   2e-36   Arabidopsis thaliana [mouse-ear cress]
ref|NP_190865.2|  cytochrome P450, family 76, subfamily G, polype...    146   2e-36   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011466802.1|  PREDICTED: cytochrome P450 76A1-like               145   2e-36   Fragaria vesca subsp. vesca
ref|XP_008392536.1|  PREDICTED: cytochrome P450 76A1                    145   3e-36   Malus domestica [apple tree]
ref|XP_002877896.1|  CYP76G1                                            145   3e-36   Arabidopsis lyrata subsp. lyrata
ref|XP_002528643.1|  cytochrome P450, putative                          145   3e-36   Ricinus communis
ref|XP_006341260.1|  PREDICTED: cytochrome P450 76A2-like               145   4e-36   Solanum tuberosum [potatoes]
ref|XP_011036815.1|  PREDICTED: cytochrome P450 76A1-like               144   7e-36   Populus euphratica
ref|XP_002528644.1|  cytochrome P450, putative                          144   8e-36   Ricinus communis
gb|EYU38602.1|  hypothetical protein MIMGU_mgv1a006828mg                143   1e-35   Erythranthe guttata [common monkey flower]
gb|KDP26150.1|  hypothetical protein JCGZ_22831                         136   1e-35   Jatropha curcas
ref|XP_006293048.1|  hypothetical protein CARUB_v10019335mg             144   1e-35   Capsella rubella
ref|XP_010431310.1|  PREDICTED: cytochrome P450 76A1-like               143   1e-35   Camelina sativa [gold-of-pleasure]
gb|KCW48752.1|  hypothetical protein EUGRSUZ_K02392                     141   1e-35   Eucalyptus grandis [rose gum]
ref|XP_007142620.1|  hypothetical protein PHAVU_007G003100g             143   2e-35   Phaseolus vulgaris [French bean]
ref|XP_010112509.1|  Cytochrome P450 76A2                               143   2e-35   Morus notabilis
ref|XP_007027586.1|  Cytochrome P450                                    145   2e-35   
gb|KCW84353.1|  hypothetical protein EUGRSUZ_B01205                     142   2e-35   Eucalyptus grandis [rose gum]
gb|KCW47877.1|  hypothetical protein EUGRSUZ_K01623                     142   2e-35   Eucalyptus grandis [rose gum]
ref|XP_010036342.1|  PREDICTED: cytochrome P450 76A1-like               142   2e-35   Eucalyptus grandis [rose gum]
ref|XP_011036810.1|  PREDICTED: cytochrome P450 76A1-like               142   2e-35   Populus euphratica
ref|XP_006382516.1|  hypothetical protein POPTR_0005s02900g             142   3e-35   
emb|CBI30232.3|  unnamed protein product                                142   3e-35   Vitis vinifera
gb|KJB46481.1|  hypothetical protein B456_007G371400                    142   3e-35   Gossypium raimondii
ref|XP_010654031.1|  PREDICTED: cytochrome P450 76A1                    142   3e-35   Vitis vinifera
ref|XP_010112512.1|  Cytochrome P450 76A2                               135   5e-35   
gb|EYU38601.1|  hypothetical protein MIMGU_mgv1a004436mg                142   5e-35   Erythranthe guttata [common monkey flower]
ref|XP_009148756.1|  PREDICTED: cytochrome P450 76A1                    141   7e-35   Brassica rapa
ref|XP_006382524.1|  hypothetical protein POPTR_0005s02990g             141   7e-35   Populus trichocarpa [western balsam poplar]
ref|XP_011101481.1|  PREDICTED: cytochrome P450 76A1                    140   1e-34   Sesamum indicum [beniseed]
ref|XP_006382522.1|  hypothetical protein POPTR_0005s02960g             140   2e-34   
ref|XP_010504051.1|  PREDICTED: cytochrome P450 76A1-like               140   2e-34   
ref|XP_010038981.1|  PREDICTED: cytochrome P450 76A1-like               139   4e-34   Eucalyptus grandis [rose gum]
ref|NP_001190075.1|  cytochrome P450, family 76, subfamily G, pol...    139   4e-34   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006382521.1|  hypothetical protein POPTR_0005s02950g             137   2e-33   
gb|KDO61005.1|  hypothetical protein CISIN_1g0379902mg                  134   2e-33   Citrus sinensis [apfelsine]
gb|AJD25184.1|  cytochrome P450 CYP76G16                                136   5e-33   Salvia miltiorrhiza [Chinese salvia]
emb|CDX76245.1|  BnaA04g05090D                                          135   6e-33   
ref|XP_006382520.1|  hypothetical protein POPTR_0005s02940g             135   6e-33   
ref|XP_006482365.1|  PREDICTED: cytochrome P450 76A2-like               133   4e-32   Citrus sinensis [apfelsine]
emb|CDP18467.1|  unnamed protein product                                132   6e-32   Coffea canephora [robusta coffee]
ref|XP_006439139.1|  hypothetical protein CICLE_v10033708mg             132   7e-32   Citrus clementina [clementine]
ref|NP_001268152.1|  ripening-related P-450 enzyme-like                 132   1e-31   Vitis vinifera
ref|XP_003631427.1|  PREDICTED: geraniol 8-hydroxylase-like             132   1e-31   Vitis vinifera
ref|XP_010658029.1|  PREDICTED: ripening-related P-450 enzyme-lik...    132   1e-31   Vitis vinifera
ref|XP_012082611.1|  PREDICTED: cytochrome P450 76A1                    132   1e-31   Jatropha curcas
ref|XP_009626046.1|  PREDICTED: cytochrome P450 76A1                    132   1e-31   Nicotiana tomentosiformis
ref|XP_007034575.1|  Cytochrome P450, putative                          131   3e-31   
gb|KDO63687.1|  hypothetical protein CISIN_1g040285mg                   128   3e-31   Citrus sinensis [apfelsine]
ref|XP_009793679.1|  PREDICTED: cytochrome P450 76A1                    130   5e-31   Nicotiana sylvestris
ref|XP_010558964.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...    130   7e-31   Tarenaya hassleriana [spider flower]
ref|XP_004138005.1|  PREDICTED: cytochrome P450 76A2                    130   8e-31   Cucumis sativus [cucumbers]
ref|XP_008442789.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...    129   9e-31   Cucumis melo [Oriental melon]
gb|KHN37270.1|  Cytochrome P450 76A2                                    129   1e-30   Glycine soja [wild soybean]
ref|XP_003535793.1|  PREDICTED: cytochrome P450 76A2-like               129   1e-30   Glycine max [soybeans]
ref|XP_006403743.1|  hypothetical protein EUTSA_v10010318mg             129   2e-30   
ref|XP_006440464.1|  hypothetical protein CICLE_v10019826mg             128   2e-30   
ref|XP_002276561.1|  PREDICTED: geraniol 8-hydroxylase                  127   6e-30   Vitis vinifera
ref|XP_006477331.1|  PREDICTED: geraniol 8-hydroxylase-like             126   1e-29   Citrus sinensis [apfelsine]
emb|CBI33813.3|  unnamed protein product                                127   1e-29   Vitis vinifera
ref|XP_010692297.1|  PREDICTED: geraniol 8-hydroxylase-like isofo...    125   2e-29   
ref|XP_003592855.1|  Cytochrome P450                                    124   6e-29   Medicago truncatula
ref|XP_003536316.1|  PREDICTED: geraniol 8-hydroxylase-like             123   1e-28   
ref|XP_002303546.2|  hypothetical protein POPTR_0003s11810g             123   1e-28   
ref|XP_007209932.1|  hypothetical protein PRUPE_ppa004606mg             123   1e-28   Prunus persica
ref|XP_002276576.1|  PREDICTED: geraniol 8-hydroxylase                  123   1e-28   Vitis vinifera
ref|XP_009362819.1|  PREDICTED: geraniol 8-hydroxylase-like             123   2e-28   Pyrus x bretschneideri [bai li]
emb|CDP11721.1|  unnamed protein product                                122   2e-28   Coffea canephora [robusta coffee]
ref|XP_011033851.1|  PREDICTED: geraniol 8-hydroxylase-like isofo...    122   3e-28   Populus euphratica
ref|XP_007040049.1|  Cytochrome P450, putative                          122   3e-28   
ref|XP_011033850.1|  PREDICTED: geraniol 8-hydroxylase-like isofo...    122   3e-28   Populus euphratica
ref|XP_002276053.1|  PREDICTED: geraniol 8-hydroxylase-like             122   3e-28   Vitis vinifera
ref|XP_003600328.1|  Cytochrome P450                                    121   5e-28   Medicago truncatula
ref|XP_010053381.1|  PREDICTED: geraniol 8-hydroxylase-like             121   5e-28   Eucalyptus grandis [rose gum]
gb|AHF22835.1|  drimenol oxidase 1                                      121   6e-28   Persicaria hydropiper [water-pepper]
ref|XP_010692296.1|  PREDICTED: geraniol 8-hydroxylase-like isofo...    121   7e-28   
gb|ACU20890.1|  unknown                                                 121   8e-28   Glycine max [soybeans]
ref|XP_004497404.1|  PREDICTED: cytochrome P450 76A2-like               120   1e-27   
ref|XP_003521519.1|  PREDICTED: geraniol 8-hydroxylase-like             120   2e-27   
emb|CBI38806.3|  unnamed protein product                                123   2e-27   Vitis vinifera
ref|XP_010093536.1|  Cytochrome P450 76C4                               119   2e-27   Morus notabilis
ref|XP_006423671.1|  hypothetical protein CICLE_v10028269mg             119   3e-27   Citrus clementina [clementine]
gb|KEH34024.1|  cytochrome P450 family 71 protein                       119   4e-27   Medicago truncatula
emb|CDP11720.1|  unnamed protein product                                119   4e-27   Coffea canephora [robusta coffee]
gb|KEH34016.1|  cytochrome P450 family 71 protein                       119   5e-27   Medicago truncatula
ref|XP_002276121.1|  PREDICTED: geraniol 8-hydroxylase-like isofo...    118   6e-27   Vitis vinifera
emb|CBI38803.3|  unnamed protein product                                122   6e-27   Vitis vinifera
ref|XP_010661587.1|  PREDICTED: geraniol 8-hydroxylase-like isofo...    118   8e-27   Vitis vinifera
ref|XP_004248582.1|  PREDICTED: premnaspirodiene oxygenase-like i...    118   8e-27   Solanum lycopersicum
gb|KJB37572.1|  hypothetical protein B456_006G211100                    118   1e-26   Gossypium raimondii
gb|AJG35804.1|  CYP76G10                                                118   1e-26   Santalum spicatum
ref|XP_006423653.1|  hypothetical protein CICLE_v10028270mg             117   1e-26   Citrus clementina [clementine]
ref|XP_006487694.1|  PREDICTED: geraniol 8-hydroxylase-like             117   1e-26   Citrus sinensis [apfelsine]
gb|KDO36667.1|  hypothetical protein CISIN_1g011040mg                   117   1e-26   Citrus sinensis [apfelsine]
ref|XP_011626659.1|  PREDICTED: geraniol 8-hydroxylase                  117   1e-26   Amborella trichopoda
ref|XP_006440463.1|  hypothetical protein CICLE_v10019651mg             117   1e-26   
gb|KHG25715.1|  7-ethoxycoumarin O-deethylase                           117   2e-26   Gossypium arboreum [tree cotton]
ref|XP_006829362.2|  PREDICTED: geraniol 8-hydroxylase                  115   2e-26   Amborella trichopoda
sp|O23976.1|C76B1_HELTU  RecName: Full=7-ethoxycoumarin O-deethyl...    117   2e-26   Helianthus tuberosus [Jerusalem artichoke]
ref|XP_006494410.1|  PREDICTED: geraniol 8-hydroxylase-like             117   2e-26   
gb|ERN14964.1|  hypothetical protein AMTR_s00032p00215290               117   2e-26   Amborella trichopoda
ref|XP_010667620.1|  PREDICTED: geraniol 8-hydroxylase-like             115   2e-26   
ref|XP_003557080.2|  PREDICTED: geraniol 8-hydroxylase-like             117   2e-26   Glycine max [soybeans]
gb|AGX93052.1|  geraniol 10-hydroxylase-like protein                    117   2e-26   Amsonia hubrichtii
gb|ERM96778.1|  hypothetical protein AMTR_s01143p00010430               115   2e-26   Amborella trichopoda
ref|XP_009757342.1|  PREDICTED: geraniol 8-hydroxylase-like             117   2e-26   Nicotiana sylvestris
ref|XP_006494407.1|  PREDICTED: geraniol 8-hydroxylase-like             117   2e-26   Citrus sinensis [apfelsine]
ref|XP_006477329.1|  PREDICTED: geraniol 8-hydroxylase-like             117   2e-26   Citrus sinensis [apfelsine]
ref|XP_006606065.1|  PREDICTED: geraniol 8-hydroxylase-like             117   2e-26   Glycine max [soybeans]
gb|AGX93053.1|  geraniol 10-hydroxylase-like protein                    117   2e-26   Rauvolfia serpentina [devilpepper]
gb|KGN58318.1|  Cytochrome P450                                         115   2e-26   Cucumis sativus [cucumbers]
ref|XP_008447652.1|  PREDICTED: geraniol 8-hydroxylase-like             114   3e-26   
ref|XP_003530792.1|  PREDICTED: cytochrome P450 71D9-like               116   3e-26   Glycine max [soybeans]
ref|XP_006419188.1|  hypothetical protein CICLE_v10030448mg             116   3e-26   Citrus clementina [clementine]
ref|XP_006477330.1|  PREDICTED: geraniol 8-hydroxylase-like             116   4e-26   Citrus sinensis [apfelsine]
gb|KJB51557.1|  hypothetical protein B456_008G222600                    116   4e-26   Gossypium raimondii
gb|KHM99472.1|  Cytochrome P450 71D11                                   116   4e-26   Glycine soja [wild soybean]
gb|AHB33940.1|  santalene/bergamotene oxidase                           116   4e-26   Santalum album
gb|AAS92624.1|  cytochrome P450                                         116   4e-26   Hypericum androsaemum
ref|XP_003636948.1|  Cytochrome P450                                    114   5e-26   
ref|XP_004511453.1|  PREDICTED: geraniol 8-hydroxylase-like             115   6e-26   Cicer arietinum [garbanzo]
ref|XP_002299579.2|  hypothetical protein POPTR_0001s08320g             115   6e-26   Populus trichocarpa [western balsam poplar]
emb|CAA71178.1|  7-ethoxycoumarin O-deethylase                          115   6e-26   Helianthus tuberosus [Jerusalem artichoke]
ref|XP_010056209.1|  PREDICTED: geraniol 8-hydroxylase-like             115   6e-26   Eucalyptus grandis [rose gum]
ref|XP_006423672.1|  hypothetical protein CICLE_v10028278mg             115   6e-26   Citrus clementina [clementine]
gb|AHB33947.1|  santalene/bergamotene oxidase                           115   7e-26   Santalum album
gb|AHB33946.1|  santalene/bergamotene oxidase                           115   7e-26   Santalum album
ref|XP_010667793.1|  PREDICTED: geraniol 8-hydroxylase-like             115   7e-26   
ref|XP_009372320.1|  PREDICTED: geraniol 8-hydroxylase-like             115   8e-26   Pyrus x bretschneideri [bai li]
ref|XP_010676979.1|  PREDICTED: geraniol 8-hydroxylase-like             115   8e-26   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_003556053.1|  PREDICTED: geraniol 8-hydroxylase-like             115   8e-26   Glycine max [soybeans]
gb|AHB33948.1|  santalene/bergamotene oxidase                           115   9e-26   Santalum album
gb|KEH34017.1|  cytochrome P450 family 71 protein                       115   9e-26   Medicago truncatula
gb|AHB33943.1|  CYP76F43                                                115   1e-25   Santalum album
ref|XP_004152069.1|  PREDICTED: geraniol 8-hydroxylase-like             114   1e-25   Cucumis sativus [cucumbers]
ref|XP_007146610.1|  hypothetical protein PHAVU_006G054700g             114   2e-25   Phaseolus vulgaris [French bean]
ref|XP_010108078.1|  Cytochrome P450 76C4                               114   2e-25   Morus notabilis
ref|XP_003528904.1|  PREDICTED: geraniol 8-hydroxylase-like             114   2e-25   Glycine max [soybeans]
ref|XP_002528651.1|  cytochrome P450, putative                          111   2e-25   
ref|XP_009787971.1|  PREDICTED: geraniol 8-hydroxylase-like             114   2e-25   Nicotiana sylvestris
ref|XP_010920218.1|  PREDICTED: geraniol 8-hydroxylase-like             114   2e-25   
ref|XP_003600322.1|  Cytochrome P450                                    114   2e-25   Medicago truncatula
ref|XP_006358804.1|  PREDICTED: geraniol 8-hydroxylase-like             114   2e-25   Solanum tuberosum [potatoes]
ref|XP_002301305.2|  cytochrome P450 family protein                     114   2e-25   Populus trichocarpa [western balsam poplar]
ref|XP_009397045.1|  PREDICTED: geraniol 8-hydroxylase-like             111   2e-25   
gb|KEH15784.1|  cytochrome P450 family 71 protein                       114   3e-25   Medicago truncatula
ref|XP_009624917.1|  PREDICTED: geraniol 8-hydroxylase-like             114   3e-25   Nicotiana tomentosiformis
gb|KEH43874.1|  cytochrome P450 family protein                          114   3e-25   Medicago truncatula
ref|XP_006358802.1|  PREDICTED: geraniol 8-hydroxylase-like             114   3e-25   Solanum tuberosum [potatoes]
ref|XP_009780149.1|  PREDICTED: geraniol 8-hydroxylase-like             113   3e-25   Nicotiana sylvestris
ref|XP_006341719.1|  PREDICTED: premnaspirodiene oxygenase-like         113   4e-25   
ref|XP_010053380.1|  PREDICTED: geraniol 8-hydroxylase-like             113   4e-25   
ref|XP_011013817.1|  PREDICTED: geraniol 8-hydroxylase-like             113   4e-25   
ref|XP_010676619.1|  PREDICTED: geraniol 8-hydroxylase-like             114   5e-25   
ref|XP_006423711.1|  hypothetical protein CICLE_v10028239mg             113   6e-25   
gb|KDO43348.1|  hypothetical protein CISIN_1g039787mg                   110   6e-25   
ref|XP_006487449.1|  PREDICTED: geraniol 8-hydroxylase-like             112   6e-25   
ref|XP_010911502.1|  PREDICTED: geraniol 8-hydroxylase-like             113   7e-25   
ref|XP_007227491.1|  hypothetical protein PRUPE_ppa004517mg             113   7e-25   
emb|CAN76783.1|  hypothetical protein VITISV_028822                     110   7e-25   
ref|XP_003609742.1|  Cytochrome P450                                    112   7e-25   
ref|XP_006487469.1|  PREDICTED: geraniol 8-hydroxylase-like             112   7e-25   
ref|XP_012071202.1|  PREDICTED: premnaspirodiene oxygenase-like         112   8e-25   
gb|AET02720.2|  cytochrome P450 family protein                          112   8e-25   
ref|XP_006494538.1|  PREDICTED: geraniol 8-hydroxylase-like             114   8e-25   
gb|AFK46798.1|  unknown                                                 112   9e-25   
ref|XP_002509652.1|  cytochrome P450, putative                          111   9e-25   
ref|XP_002301307.2|  cytochrome P450 family protein                     112   9e-25   
ref|XP_007226675.1|  hypothetical protein PRUPE_ppa021147mg             112   9e-25   
ref|XP_009397046.1|  PREDICTED: geraniol 8-hydroxylase-like             111   9e-25   
dbj|BAP90522.1|  geraniol 10-hydroxylase                                112   1e-24   
ref|XP_011457549.1|  PREDICTED: geraniol 8-hydroxylase-like             114   1e-24   
gb|EMT03552.1|  Cytochrome P450 76C4                                    112   1e-24   
emb|CAN81642.1|  hypothetical protein VITISV_036426                     111   1e-24   
ref|XP_003628247.1|  Cytochrome P450                                    112   1e-24   
ref|XP_003600327.1|  Cytochrome P450                                    112   1e-24   
ref|XP_006853508.1|  PREDICTED: geraniol 8-hydroxylase                  112   1e-24   
gb|AGI97015.1|  geraniol 10-hydroxylase                                 112   1e-24   
gb|AHB33944.1|  santalene/bergamotene oxidase                           112   1e-24   
ref|XP_010540267.1|  PREDICTED: geraniol 8-hydroxylase-like             112   1e-24   
gb|AGX93051.1|  geraniol 10-hydroxylase-like protein                    111   2e-24   
emb|CAN81641.1|  hypothetical protein VITISV_036425                     111   2e-24   
ref|XP_004241762.2|  PREDICTED: geraniol 8-hydroxylase-like             114   2e-24   
gb|AET02723.2|  cytochrome P450 family protein                          112   2e-24   
ref|XP_010661589.1|  PREDICTED: geraniol 8-hydroxylase-like             111   2e-24   
ref|XP_012066137.1|  PREDICTED: geraniol 8-hydroxylase-like             111   2e-24   
ref|XP_010053037.1|  PREDICTED: geraniol 8-hydroxylase-like             111   2e-24   
ref|XP_006423678.1|  hypothetical protein CICLE_v10028268mg             111   2e-24   
ref|XP_006451465.1|  hypothetical protein CICLE_v10008099mg             111   2e-24   
ref|XP_004506686.1|  PREDICTED: cytochrome P450 71D9-like               111   2e-24   
ref|XP_011017515.1|  PREDICTED: geraniol 8-hydroxylase-like             111   2e-24   
ref|XP_006388387.1|  hypothetical protein POPTR_0201s00200g             111   2e-24   
ref|XP_004232059.1|  PREDICTED: geraniol 8-hydroxylase                  111   2e-24   
ref|XP_011457440.1|  PREDICTED: geraniol 8-hydroxylase-like             111   2e-24   
ref|XP_007212458.1|  hypothetical protein PRUPE_ppa017406mg             110   2e-24   
ref|XP_003589660.1|  Cytochrome P450 monooxygenase                      111   2e-24   
ref|XP_009788349.1|  PREDICTED: geraniol 8-hydroxylase-like             109   3e-24   
ref|XP_006494536.1|  PREDICTED: geraniol 8-hydroxylase-like             111   3e-24   
gb|AHB33941.1|  bergamotene oxidase                                     111   3e-24   
gb|EYU21984.1|  hypothetical protein MIMGU_mgv1a019764mg                108   3e-24   
gb|AHB33942.1|  bergamotene oxidase                                     111   3e-24   
gb|AHB33945.1|  bergamotene oxidase                                     111   3e-24   
ref|XP_008222093.1|  PREDICTED: geraniol 8-hydroxylase-like             110   3e-24   
ref|XP_010920220.1|  PREDICTED: geraniol 8-hydroxylase-like isofo...    110   3e-24   
gb|AGX93054.1|  geraniol 10-hydroxylase-like protein                    110   3e-24   
ref|XP_007146608.1|  hypothetical protein PHAVU_006G054500g             111   3e-24   
ref|XP_006358805.1|  PREDICTED: geraniol 8-hydroxylase-like             110   3e-24   
ref|XP_010544671.1|  PREDICTED: cytochrome P450 76C2-like isoform X2    111   3e-24   
ref|XP_006358817.1|  PREDICTED: geraniol 8-hydroxylase-like             110   3e-24   
ref|XP_004506715.1|  PREDICTED: cytochrome P450 71D9-like               110   4e-24   
ref|XP_008337945.1|  PREDICTED: cytochrome P450 71D9-like               110   4e-24   
ref|XP_010920219.1|  PREDICTED: geraniol 8-hydroxylase-like isofo...    110   4e-24   
ref|XP_010544670.1|  PREDICTED: cytochrome P450 76C4-like isoform X1    110   4e-24   
ref|XP_007146609.1|  hypothetical protein PHAVU_006G054600g             110   4e-24   
dbj|BAC53893.1|  cytochrome P450                                        111   4e-24   
ref|XP_006358801.1|  PREDICTED: geraniol 8-hydroxylase-like             110   4e-24   
gb|AHB33939.1|  bergamotene oxidase                                     110   4e-24   
ref|XP_006423673.1|  hypothetical protein CICLE_v10028257mg             110   4e-24   
ref|XP_006487474.1|  PREDICTED: geraniol 8-hydroxylase-like             110   4e-24   
ref|XP_002301306.2|  hypothetical protein POPTR_0002s15150g             110   5e-24   
ref|XP_010692295.1|  PREDICTED: geraniol 8-hydroxylase-like             110   5e-24   
ref|XP_008246006.1|  PREDICTED: cytochrome P450 71D11-like              110   5e-24   
ref|XP_004147600.2|  PREDICTED: geraniol 8-hydroxylase-like             110   6e-24   
gb|KHM99473.1|  Cytochrome P450 71D11                                   109   6e-24   
ref|XP_009780649.1|  PREDICTED: geraniol 8-hydroxylase-like             110   6e-24   
gb|AAS90125.1|  cytochrome P450                                         110   6e-24   
sp|Q8VWZ7.1|C76B6_CATRO  RecName: Full=Geraniol 8-hydroxylase; Al...    110   6e-24   
ref|XP_004304108.2|  PREDICTED: cytochrome P450 71D9-like               112   7e-24   
ref|XP_010687566.1|  PREDICTED: geraniol 8-hydroxylase-like             110   7e-24   
ref|XP_010103208.1|  Cytochrome P450 76C1                               110   8e-24   
ref|XP_007146606.1|  hypothetical protein PHAVU_006G054300g             110   8e-24   
ref|XP_003630839.1|  Cytochrome P450                                    107   8e-24   
gb|AGX93055.1|  geraniol 10-hydroxylase-like protein                    109   9e-24   
ref|XP_007213422.1|  hypothetical protein PRUPE_ppa025696mg             109   9e-24   
ref|XP_011017516.1|  PREDICTED: geraniol 8-hydroxylase-like             109   9e-24   
ref|XP_006423661.1|  hypothetical protein CICLE_v10028273mg             109   9e-24   
emb|CDY58284.1|  BnaCnng32860D                                          105   1e-23   
ref|XP_010038950.1|  PREDICTED: geraniol 8-hydroxylase-like             108   1e-23   
ref|XP_009345818.1|  PREDICTED: cytochrome P450 71D9-like               109   1e-23   
ref|XP_006853505.2|  PREDICTED: geraniol 8-hydroxylase                  109   1e-23   
ref|XP_006423622.1|  hypothetical protein CICLE_v10028275mg             109   1e-23   
ref|XP_006423716.1|  hypothetical protein CICLE_v10028276mg             108   1e-23   
ref|XP_009347232.1|  PREDICTED: cytochrome P450 71D11-like              109   1e-23   
gb|AIO11760.1|  cytochrome p450                                         109   1e-23   
gb|KCW48249.1|  hypothetical protein EUGRSUZ_K01977                     108   1e-23   
ref|XP_006338229.1|  PREDICTED: geraniol 8-hydroxylase-like             109   1e-23   
gb|KGN50167.1|  hypothetical protein Csa_5G157260                       107   1e-23   
ref|XP_007040766.1|  Cytochrome P450, putative                          111   1e-23   
ref|XP_004248012.1|  PREDICTED: geraniol 8-hydroxylase-like             108   1e-23   
ref|XP_009794425.1|  PREDICTED: geraniol 8-hydroxylase-like             109   1e-23   
ref|XP_004248583.1|  PREDICTED: premnaspirodiene oxygenase-like i...    108   1e-23   
gb|KCW77657.1|  hypothetical protein EUGRSUZ_D01955                     108   1e-23   
ref|XP_009763141.1|  PREDICTED: geraniol 8-hydroxylase-like             108   1e-23   
ref|XP_007224608.1|  hypothetical protein PRUPE_ppa026952mg             108   2e-23   
ref|XP_010053379.1|  PREDICTED: geraniol 8-hydroxylase-like             108   2e-23   
ref|XP_006487471.1|  PREDICTED: geraniol 8-hydroxylase-like isofo...    108   2e-23   
ref|XP_006423714.1|  hypothetical protein CICLE_v10028277mg             108   2e-23   
ref|XP_004496721.1|  PREDICTED: geraniol 8-hydroxylase-like             108   2e-23   
ref|XP_004295869.1|  PREDICTED: cytochrome P450 71D11-like              108   2e-23   
ref|XP_010528786.1|  PREDICTED: cytochrome P450 76C4-like isoform X1    108   2e-23   
ref|XP_010528787.1|  PREDICTED: cytochrome P450 76C4-like isoform X2    108   2e-23   
ref|XP_009801952.1|  PREDICTED: geraniol 8-hydroxylase-like             105   2e-23   
ref|XP_007219031.1|  hypothetical protein PRUPE_ppa004503mg             108   2e-23   
ref|XP_007153084.1|  hypothetical protein PHAVU_003G005500g             108   2e-23   
ref|XP_008437176.1|  PREDICTED: geraniol 8-hydroxylase-like             108   2e-23   
ref|XP_004305999.2|  PREDICTED: uncharacterized protein LOC101299609    110   2e-23   
gb|KDO57775.1|  hypothetical protein CISIN_1g011069mg                   108   2e-23   
ref|XP_006365964.1|  PREDICTED: geraniol 8-hydroxylase-like             108   2e-23   
ref|XP_006451469.1|  hypothetical protein CICLE_v10008095mg             108   2e-23   
gb|KEH43873.1|  cytochrome P450 family protein                          108   2e-23   
ref|XP_007020549.1|  Cytochrome P450                                    108   2e-23   
ref|XP_003532168.1|  PREDICTED: cytochrome P450 71D11                   108   3e-23   
gb|KHM99474.1|  Cytochrome P450 71D11                                   108   3e-23   
ref|XP_004505593.1|  PREDICTED: geraniol 8-hydroxylase-like             108   3e-23   
ref|XP_010680621.1|  PREDICTED: geraniol 8-hydroxylase-like             108   3e-23   
ref|XP_007214747.1|  hypothetical protein PRUPE_ppa025066mg             108   3e-23   
ref|XP_007146612.1|  hypothetical protein PHAVU_006G054900g             108   3e-23   
ref|XP_003530791.1|  PREDICTED: cytochrome P450 71D9-like               108   3e-23   
ref|XP_009613834.1|  PREDICTED: geraniol 8-hydroxylase-like             108   3e-23   
ref|XP_008437178.1|  PREDICTED: geraniol 8-hydroxylase-like             108   3e-23   
gb|AGX93050.1|  geraniol 10-hydroxylase-like protein                    108   3e-23   
ref|XP_004295868.2|  PREDICTED: cytochrome P450 71D11-like              108   4e-23   
ref|XP_006423715.1|  hypothetical protein CICLE_v10028276mg             108   4e-23   
ref|XP_003543189.1|  PREDICTED: geraniol 8-hydroxylase-like             107   4e-23   
ref|XP_006495031.1|  PREDICTED: geraniol 8-hydroxylase-like             107   4e-23   
ref|XP_006338232.1|  PREDICTED: geraniol 8-hydroxylase-like             107   4e-23   
gb|KDP39088.1|  hypothetical protein JCGZ_00845                         107   4e-23   
ref|XP_011029123.1|  PREDICTED: geraniol 8-hydroxylase-like             107   4e-23   
ref|XP_008385787.1|  PREDICTED: cytochrome P450 71D11-like              107   5e-23   
gb|KEH26493.1|  cytochrome P450 family 71 protein                       107   5e-23   
ref|XP_002310007.2|  cytochrome P450 family protein                     107   5e-23   
ref|XP_009782145.1|  PREDICTED: geraniol 8-hydroxylase-like             107   5e-23   
ref|XP_003628244.1|  Cytochrome P450                                    107   5e-23   
gb|KDO41057.1|  hypothetical protein CISIN_1g043641mg                   107   5e-23   
ref|XP_002276094.1|  PREDICTED: geraniol 8-hydroxylase                  107   5e-23   
ref|XP_007146291.1|  hypothetical protein PHAVU_006G028100g             107   5e-23   
ref|XP_011651833.1|  PREDICTED: cytochrome P450 71A1-like               107   5e-23   
ref|XP_007159748.1|  hypothetical protein PHAVU_002G263800g             106   6e-23   
ref|XP_004505635.1|  PREDICTED: geraniol 8-hydroxylase-like             107   6e-23   
sp|D1MI46.1|C76BA_SWEMU  RecName: Full=Geraniol 8-hydroxylase; Al...    107   6e-23   
ref|XP_009596429.1|  PREDICTED: geraniol 8-hydroxylase-like             107   6e-23   
ref|XP_006338756.1|  PREDICTED: geraniol 8-hydroxylase-like             107   6e-23   
ref|XP_008222068.1|  PREDICTED: geraniol 8-hydroxylase-like             107   6e-23   
ref|XP_010544668.1|  PREDICTED: cytochrome P450 76C1-like               107   6e-23   
ref|XP_004516468.1|  PREDICTED: geraniol 8-hydroxylase-like             107   6e-23   
ref|XP_011660355.1|  PREDICTED: cytochrome P450 71A1-like               107   7e-23   
gb|KEH34013.1|  cytochrome P450 family 71 protein                       107   7e-23   
ref|XP_010102946.1|  Serine/threonine-protein kinase AFC2               108   7e-23   
ref|XP_011099226.1|  PREDICTED: geraniol 8-hydroxylase-like             107   7e-23   
ref|XP_006338233.1|  PREDICTED: geraniol 8-hydroxylase-like             107   7e-23   
gb|KDO36937.1|  hypothetical protein CISIN_1g044449mg                   103   8e-23   
ref|XP_004147598.2|  PREDICTED: geraniol 8-hydroxylase-like             107   8e-23   
gb|EYU20527.1|  hypothetical protein MIMGU_mgv1a025870mg                103   8e-23   
gb|AFS28686.1|  putative geraniol 10-hydroxylase                        105   9e-23   
gb|ABK24553.1|  unknown                                                 107   9e-23   
ref|XP_007159749.1|  hypothetical protein PHAVU_002G263800g             106   1e-22   
ref|XP_004310057.1|  PREDICTED: geraniol 8-hydroxylase-like             106   1e-22   
gb|ABR17519.1|  unknown                                                 106   1e-22   
ref|XP_004496400.1|  PREDICTED: geraniol 8-hydroxylase-like             106   1e-22   
ref|XP_007224897.1|  hypothetical protein PRUPE_ppa022132mg             106   1e-22   
dbj|BAE97672.1|  CYP76J1                                                107   1e-22   
ref|XP_009777857.1|  PREDICTED: geraniol 8-hydroxylase-like             106   1e-22   
emb|CAN83490.1|  hypothetical protein VITISV_001325                     106   1e-22   
ref|XP_008653482.1|  PREDICTED: geraniol 8-hydroxylase-like             106   1e-22   
ref|XP_007226839.1|  hypothetical protein PRUPE_ppa017329mg             106   1e-22   
ref|XP_004492652.1|  PREDICTED: geraniol 8-hydroxylase-like             106   1e-22   
ref|XP_010687578.1|  PREDICTED: cytochrome P450 71D10-like              106   2e-22   
ref|XP_002270541.1|  PREDICTED: geraniol 8-hydroxylase                  106   2e-22   
ref|XP_008227173.1|  PREDICTED: cytochrome P450 71D9-like               105   2e-22   
ref|XP_002310636.2|  hypothetical protein POPTR_0007s07310g             106   2e-22   
ref|XP_007146615.1|  hypothetical protein PHAVU_006G0551000g            101   2e-22   
gb|KHG19246.1|  Cytochrome P450                                         105   2e-22   
ref|XP_010691493.1|  PREDICTED: geraniol 8-hydroxylase-like             105   2e-22   
gb|ABF94963.1|  Cytochrome P450 family protein, expressed               105   2e-22   
gb|KJB13847.1|  hypothetical protein B456_002G097400                    105   2e-22   
gb|EAY89257.1|  hypothetical protein OsI_10754                          105   2e-22   
gb|ADA70805.1|  cytochrome P450 CYP71D176                               105   2e-22   
ref|XP_004232060.1|  PREDICTED: geraniol 8-hydroxylase-like             105   2e-22   
ref|XP_006423660.1|  hypothetical protein CICLE_v10030225mg             105   2e-22   
ref|XP_010687580.1|  PREDICTED: cytochrome P450 71D11-like              105   3e-22   
ref|XP_003524281.2|  PREDICTED: cytochrome P450 71A1-like isoform X1    105   3e-22   
ref|XP_006841384.1|  PREDICTED: cytochrome P450 71A1                    105   3e-22   
ref|XP_010102947.1|  Cytochrome P450 71A1                               105   3e-22   
gb|EPS66524.1|  hypothetical protein M569_08252                         105   3e-22   
gb|EMS49735.1|  Cytochrome P450 76C4                                    105   3e-22   
ref|XP_010921587.1|  PREDICTED: premnaspirodiene oxygenase-like         105   4e-22   
ref|XP_002509653.1|  cytochrome P450, putative                          105   4e-22   
gb|KJB27712.1|  hypothetical protein B456_005G005900                    105   4e-22   
ref|XP_003537814.1|  PREDICTED: geraniol 8-hydroxylase-like             105   4e-22   
gb|KHG16719.1|  Cytochrome P450                                         104   4e-22   
ref|XP_008227171.1|  PREDICTED: cytochrome P450 71D9-like               103   4e-22   
ref|XP_011012702.1|  PREDICTED: cytochrome P450 71D11-like              105   5e-22   
ref|XP_008439074.1|  PREDICTED: cytochrome P450 71A1-like               104   5e-22   
ref|XP_002276487.1|  PREDICTED: cytochrome P450 CYP736A12               104   6e-22   
ref|XP_006494719.1|  PREDICTED: geraniol 8-hydroxylase-like             104   6e-22   
ref|XP_010523703.1|  PREDICTED: cytochrome P450 76C4-like               104   6e-22   
ref|XP_009372315.1|  PREDICTED: geraniol 8-hydroxylase-like             104   6e-22   
ref|XP_009372314.1|  PREDICTED: geraniol 8-hydroxylase-like             104   6e-22   
ref|XP_010910057.1|  PREDICTED: cytochrome P450 71A9-like               100   7e-22   
ref|XP_010061478.1|  PREDICTED: cytochrome P450 71D9-like               104   7e-22   
ref|XP_011047544.1|  PREDICTED: cytochrome P450 71D11-like isofor...    104   8e-22   
ref|XP_008227138.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...    104   8e-22   
gb|KHG21745.1|  Cytochrome P450 protein                                 104   8e-22   
gb|KJB83173.1|  hypothetical protein B456_013G233400                    101   8e-22   
ref|XP_009626597.1|  PREDICTED: geraniol 8-hydroxylase-like             104   8e-22   
ref|XP_003636936.1|  Cytochrome P450                                    103   8e-22   
ref|XP_008389841.1|  PREDICTED: geraniol 8-hydroxylase-like             104   9e-22   
ref|XP_008447356.1|  PREDICTED: geraniol 8-hydroxylase-like             103   9e-22   
ref|XP_006423677.1|  hypothetical protein CICLE_v10028488mg             103   9e-22   
gb|KHG03596.1|  Cytochrome P450 protein                                 103   9e-22   
ref|XP_007143610.1|  hypothetical protein PHAVU_007G086200g             103   9e-22   



>ref|XP_009788755.1| PREDICTED: cytochrome P450 76A2-like [Nicotiana sylvestris]
Length=505

 Score =   282 bits (722),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 143/218 (66%), Positives = 172/218 (79%), Gaps = 2/218 (1%)
 Frame = +1

Query  169  MEWEWKYLVWSAIFLIPGLVFLLARKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAE  348
            MEWEW Y+VWS I L+P L+ + +RK+SSS Y LPPGPPGLP+ GNM DLG  P+QTIA 
Sbjct  1    MEWEWSYVVWSVIILVPTLIIVFSRKRSSS-YNLPPGPPGLPIFGNMFDLGTLPYQTIAS  59

Query  349  MKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFA  528
             K+KYG ++W  IGSV TM+ILSAK AA+ FKNHD +FA+R +ID M V  Y  GSLA A
Sbjct  60   FKHKYGPIVWFNIGSVKTMSILSAKTAADFFKNHDFAFAERKIIDTMLVHDYNKGSLALA  119

Query  529  PYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEASSVQ-RGTGVHVAHF  705
            PYG+YWRVLRRICTVE+FV+KRINETV +RRKC+ DML WIE EA+ V+ +G+G+ V  F
Sbjct  120  PYGTYWRVLRRICTVEMFVNKRINETVDIRRKCVHDMLQWIEDEANVVEIKGSGIEVTRF  179

Query  706  VFLSTFNLLGNLFLSRDLVDPMSDKASKFFDAMTGIMQ  819
            VFLSTFN+LGNL  SRDLV P S KAS+FF AM  IM+
Sbjct  180  VFLSTFNMLGNLMFSRDLVHPGSKKASEFFTAMMRIME  217



>ref|XP_006341182.1| PREDICTED: cytochrome P450 76A2-like [Solanum tuberosum]
Length=507

 Score =   281 bits (720),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 141/217 (65%), Positives = 171/217 (79%), Gaps = 1/217 (0%)
 Frame = +1

Query  169  MEWEWKYLVWSAIFLIPGLVFLLARKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAE  348
            MEWEW Y+VWS I ++P  + ++  K +SSSY+LPPGPPG P+ GNM DLG  P+QTIAE
Sbjct  1    MEWEWNYVVWSIIIIVPTTLIIVFSKTNSSSYKLPPGPPGFPIFGNMFDLGTLPYQTIAE  60

Query  349  MKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFA  528
             K KYG V+W +IGSV TM+ILSA  A E FKNHD +FA+R +ID M V  Y +GSLA A
Sbjct  61   FKQKYGPVVWFKIGSVKTMSILSANTATEFFKNHDFAFAERKIIDTMLVHDYNLGSLAIA  120

Query  529  PYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEASSVQ-RGTGVHVAHF  705
             YG+YWRVLRRICTVE+FVHKRINETV +RRKC+DDM+ WIEKE +SV+ +G+G+ V  F
Sbjct  121  RYGTYWRVLRRICTVEMFVHKRINETVDIRRKCVDDMIHWIEKEVNSVEVKGSGIEVTRF  180

Query  706  VFLSTFNLLGNLFLSRDLVDPMSDKASKFFDAMTGIM  816
            VFLSTFN+LGNL  SRDLV P S KAS+FF+AM  IM
Sbjct  181  VFLSTFNMLGNLMFSRDLVHPGSKKASEFFNAMMRIM  217



>ref|XP_009589554.1| PREDICTED: cytochrome P450 76A2-like [Nicotiana tomentosiformis]
Length=506

 Score =   276 bits (706),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 138/218 (63%), Positives = 172/218 (79%), Gaps = 2/218 (1%)
 Frame = +1

Query  169  MEWEWKYLVWSAIFLIPGLVFLLARKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAE  348
            MEWEW Y+VWS I L+P L+ + ++++S S Y LPPGPPGLP+ GNM +LG  P+QTIA 
Sbjct  1    MEWEWSYVVWSTIILVPTLIIVFSKRRSCS-YNLPPGPPGLPIFGNMFNLGTLPYQTIAS  59

Query  349  MKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFA  528
             K+KYG ++W  IGSV TM+ILSAK AAE FKNHD +FA+R ++D M V  Y  GSLA A
Sbjct  60   FKHKYGPIVWFNIGSVKTMSILSAKTAAEFFKNHDFAFAERKIMDTMLVHDYNKGSLAIA  119

Query  529  PYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEASSVQ-RGTGVHVAHF  705
            PYG+YWRVLRRICTVE+FV+KRIN TV +R+KC+DDML WIE+EA+ V+ +G+G+ V  F
Sbjct  120  PYGTYWRVLRRICTVEMFVNKRINATVHIRQKCVDDMLQWIEEEANVVEIKGSGIEVTRF  179

Query  706  VFLSTFNLLGNLFLSRDLVDPMSDKASKFFDAMTGIMQ  819
            VFLSTFN+LGNL  SRDLV P S KAS+FF AM  IM+
Sbjct  180  VFLSTFNMLGNLMFSRDLVHPGSKKASEFFTAMMRIME  217



>ref|XP_004246901.1| PREDICTED: cytochrome P450 76A2-like [Solanum lycopersicum]
Length=507

 Score =   272 bits (695),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 134/217 (62%), Positives = 170/217 (78%), Gaps = 1/217 (0%)
 Frame = +1

Query  169  MEWEWKYLVWSAIFLIPGLVFLLARKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAE  348
            M+W+W Y+VWS I ++   + ++  K++SS Y+LPPGPPG+P+ GNM DLGA P+QTIA+
Sbjct  1    MDWDWNYVVWSIIIIVSTTLIIVFSKRNSSCYKLPPGPPGIPIFGNMFDLGALPYQTIAQ  60

Query  349  MKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFA  528
             K KYG ++W +IGSV TM+ILSAK A E FKNHD  FA+R ++D M V  Y +GSLA A
Sbjct  61   YKQKYGPIVWFKIGSVKTMSILSAKTATEFFKNHDFVFAERKIMDTMLVHDYNLGSLAIA  120

Query  529  PYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEASSVQ-RGTGVHVAHF  705
             YG+YWRVLRRICTVE+FVHKRINET+ +RRKC+DDM+ WIE E SS + +G+G+ V  F
Sbjct  121  RYGTYWRVLRRICTVEMFVHKRINETMDIRRKCVDDMIHWIENEVSSKEVKGSGIEVTRF  180

Query  706  VFLSTFNLLGNLFLSRDLVDPMSDKASKFFDAMTGIM  816
            VFLSTFN+LGNL  SRDLV P S KAS+FF+AM  IM
Sbjct  181  VFLSTFNMLGNLMFSRDLVHPGSKKASEFFNAMMRIM  217



>dbj|BAC53892.1| cytochrome P450 [Petunia x hybrida]
Length=510

 Score =   270 bits (691),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 135/214 (63%), Positives = 166/214 (78%), Gaps = 1/214 (0%)
 Frame = +1

Query  178  EWKYLVWSAIFLIPGLVFLLARKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAEMKN  357
            +W Y  W +IFL+P    +L+RKKS S +RLPPGPPG P+ GN+ DLG  PHQTIA MK 
Sbjct  4    DWCYFAWFSIFLVPFFFLVLSRKKSCS-HRLPPGPPGWPIFGNLFDLGTLPHQTIAGMKL  62

Query  358  KYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPYG  537
            +YG V+ LRIGSV T+AILSAK A E FKNHD  FADR +ID M V  Y   SL  APYG
Sbjct  63   RYGPVVLLRIGSVKTIAILSAKVATEFFKNHDACFADRKIIDTMLVHNYNKSSLVLAPYG  122

Query  538  SYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEASSVQRGTGVHVAHFVFLS  717
            +YWRVLRRICTVE+F +KRINET  +R+KCID ML WI+KEA S+++G+G+ VA F+FL+
Sbjct  123  TYWRVLRRICTVEMFTNKRINETAHLRQKCIDSMLQWIDKEAKSMKKGSGIEVARFIFLA  182

Query  718  TFNLLGNLFLSRDLVDPMSDKASKFFDAMTGIMQ  819
            +FN++GNL LSRDLVDP S KAS+FF AM G+M+
Sbjct  183  SFNMMGNLMLSRDLVDPESKKASEFFTAMEGLME  216



>ref|XP_006339107.1| PREDICTED: cytochrome P450 76A2-like [Solanum tuberosum]
Length=506

 Score =   269 bits (688),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 129/218 (59%), Positives = 172/218 (79%), Gaps = 2/218 (1%)
 Frame = +1

Query  169  MEWEWKYLVWSAIFLIPGLVFLLARKKSSS-SYRlppgppglpVIGNMLDLGAFPHQTIA  345
            MEWEW YL +S+I L+P  +   +RKKS+  SY+LPPGPPGLP+ GNM +LG  P++ ++
Sbjct  1    MEWEWSYLFFSSIILLPAFILFFSRKKSTKCSYKLPPGPPGLPIFGNMFELGTEPYKRMS  60

Query  346  EMKNKYGSVIWLRIG-SVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLA  522
             +K KYG V+WL++G S   M + +A+AA ELFKNHD+SFADR + D  +   YY GSLA
Sbjct  61   VLKQKYGPVLWLKLGTSTKIMVVQTAQAAEELFKNHDISFADRFIPDANQAHSYYQGSLA  120

Query  523  FAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEASSVQRGTGVHVAH  702
             APYGS+WR  RRICTVE+FVHKRI+ETVPVRR+C+D+ML WIEKEA+S ++G+G+ V  
Sbjct  121  LAPYGSFWRFKRRICTVEMFVHKRISETVPVRRRCVDNMLKWIEKEANSAEKGSGIEVTR  180

Query  703  FVFLSTFNLLGNLFLSRDLVDPMSDKASKFFDAMTGIM  816
             VFL++FN++GNL LS+DL DP S++AS+FF+AM GIM
Sbjct  181  LVFLASFNMVGNLVLSKDLADPESEEASEFFNAMKGIM  218



>ref|XP_009602679.1| PREDICTED: cytochrome P450 76A2-like [Nicotiana tomentosiformis]
Length=507

 Score =   265 bits (678),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 128/219 (58%), Positives = 174/219 (79%), Gaps = 2/219 (1%)
 Frame = +1

Query  169  MEWEWKYLVWSAIFLIPGLVFLLARKKS-SSSYRlppgppglpVIGNMLDLGAFPHQTIA  345
            MEWEW YL +S I  +P L+ +  +KK+ SSSYRLPPGPPGLP+ GNM +LG  P++ +A
Sbjct  1    MEWEWSYLFFSTIIFLPVLLLIFPKKKAISSSYRLPPGPPGLPIFGNMFELGTLPYKKVA  60

Query  346  EMKNKYGSVIWLRIG-SVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLA  522
             +K KYG V+WL+IG S+++M + +A+AAA+LFKNHD+SFADR  +DV +   YY GS+A
Sbjct  61   VLKQKYGPVLWLKIGPSINSMVVQTAQAAADLFKNHDISFADRCPVDVNQAHNYYQGSMA  120

Query  523  FAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEASSVQRGTGVHVAH  702
               YGS+WR  RRICTVE+FV+K+INETV VRRKC++DM+ WIEKEA+ V++G+G+ +  
Sbjct  121  LGQYGSFWRFQRRICTVEMFVNKKINETVSVRRKCVNDMVKWIEKEANVVKKGSGIELTR  180

Query  703  FVFLSTFNLLGNLFLSRDLVDPMSDKASKFFDAMTGIMQ  819
            FVFL++FN+LGNL  S+DL DP S++AS FF+AM GIM+
Sbjct  181  FVFLASFNMLGNLIFSKDLADPDSEEASDFFNAMKGIME  219



>ref|XP_009757934.1| PREDICTED: cytochrome P450 76A2-like [Nicotiana sylvestris]
Length=506

 Score =   265 bits (676),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 123/218 (56%), Positives = 175/218 (80%), Gaps = 1/218 (0%)
 Frame = +1

Query  169  MEWEWKYLVWSAIFLIPGLVFLLARKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAE  348
            M+WEW YL +S I  +P L+ +  +KK++SSY+LPPGPPGLP+ GNM +LG+ P++ +A 
Sbjct  1    MQWEWSYLFFSTIIFLPVLLLIFPKKKANSSYKLPPGPPGLPIFGNMFELGSLPYKKVAV  60

Query  349  MKNKYGSVIWLRIG-SVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAF  525
            +K KYG ++WL+IG S+++M + +A+AAA+LFKNHD+SFADR  +DV +   YY GS+A 
Sbjct  61   LKQKYGPILWLKIGPSINSMVVQTAQAAADLFKNHDISFADRCTVDVNQAHNYYQGSMAL  120

Query  526  APYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEASSVQRGTGVHVAHF  705
              YGS+WR+ RRICTVE+FV+K+INETV VR KC+++M+ WIEKEA+ V++G+G+ V  F
Sbjct  121  GQYGSFWRLQRRICTVEMFVNKKINETVSVRGKCVNEMVKWIEKEANVVKKGSGIEVTRF  180

Query  706  VFLSTFNLLGNLFLSRDLVDPMSDKASKFFDAMTGIMQ  819
            VFL++FN+LGNL  S+DL DP S++AS FF+AM GIM+
Sbjct  181  VFLASFNMLGNLIFSKDLADPESEEASDFFNAMKGIME  218



>ref|XP_008241319.1| PREDICTED: cytochrome P450 76A2-like [Prunus mume]
Length=509

 Score =   264 bits (674),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 132/218 (61%), Positives = 173/218 (79%), Gaps = 1/218 (0%)
 Frame = +1

Query  169  MEWEWKYLVWSAIFLIPGLVFLLARKKSSSS-YRlppgppglpVIGNMLDLGAFPHQTIA  345
            MEW W +LV+   FL+P L+FL+ R+ S+SS +RLPPGPPGLPV GNM DLG  PHQT+ 
Sbjct  2    MEWPWNFLVYFITFLLPALLFLIRRRSSNSSLHRLPPGPPGLPVFGNMFDLGTMPHQTLT  61

Query  346  EMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAF  525
            E+ +K+G VIWLR+G+ +TM I SAKAAA+LFK+HD+SFA RT  +  +V  Y+ GSLA 
Sbjct  62   ELTHKFGPVIWLRLGARNTMVIQSAKAAADLFKHHDMSFAGRTTTEASRVLDYHKGSLAL  121

Query  526  APYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEASSVQRGTGVHVAHF  705
            APYG++WR+LRR+ TVE+ V+KRINET  +R+KC+D++ LWIE+EAS ++ G GVH+A F
Sbjct  122  APYGAHWRMLRRLVTVEMLVNKRINETAFIRKKCLDNLQLWIEEEASKLEEGHGVHMARF  181

Query  706  VFLSTFNLLGNLFLSRDLVDPMSDKASKFFDAMTGIMQ  819
            VFL +FNLLGNL LSRDLVDP S +  +FF AM G+M+
Sbjct  182  VFLMSFNLLGNLMLSRDLVDPNSREGLEFFSAMAGLME  219



>ref|XP_006339108.1| PREDICTED: cytochrome P450 76A2-like [Solanum tuberosum]
Length=506

 Score =   262 bits (670),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 127/219 (58%), Positives = 172/219 (79%), Gaps = 2/219 (1%)
 Frame = +1

Query  169  MEWEWKYLVWSAIFLIPGLVFLLARKKSSSS-YRlppgppglpVIGNMLDLGAFPHQTIA  345
            MEWEW YL +S+I L+   +   ++KKS+   Y+LPPGPPGLP+ GNM +LG  P + ++
Sbjct  1    MEWEWSYLFFSSIILLSVFILFFSQKKSTKCCYKLPPGPPGLPIFGNMFELGTEPFKKMS  60

Query  346  EMKNKYGSVIWLRIG-SVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLA  522
             +K KYG V+WL++G S + M + +A+AAAELFKNHD+SFADR + DV +   YY GSLA
Sbjct  61   VLKQKYGPVLWLKLGTSTNIMVVQTAQAAAELFKNHDISFADRFIPDVNQAHSYYQGSLA  120

Query  523  FAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEASSVQRGTGVHVAH  702
             APYG +WR  RRICTVE+FVHK+I+ETVPVRRKC+D+ML WIEK A+S ++G+G+ V  
Sbjct  121  LAPYGPFWRFQRRICTVEMFVHKKISETVPVRRKCVDNMLKWIEKAANSAEKGSGIEVTR  180

Query  703  FVFLSTFNLLGNLFLSRDLVDPMSDKASKFFDAMTGIMQ  819
            FVFL++FN+LGNL LS++L DP S++AS+FF+AM GIM+
Sbjct  181  FVFLASFNMLGNLILSKNLADPESEEASEFFNAMKGIME  219



>ref|XP_006339110.1| PREDICTED: cytochrome P450 76A2-like [Solanum tuberosum]
Length=541

 Score =   261 bits (666),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 130/219 (59%), Positives = 171/219 (78%), Gaps = 2/219 (1%)
 Frame = +1

Query  169  MEWEWKYLVWSAIFLIPGLVFLLARKKSSS-SYRlppgppglpVIGNMLDLGAFPHQTIA  345
            MEWEW YL +S+I L+P L+   ++KK++  SY+LPPGPPGLP  GNM +LG  P++ +A
Sbjct  1    MEWEWSYLCFSSIILLPVLILFFSQKKTTKCSYKLPPGPPGLPFFGNMFELGTEPYKRMA  60

Query  346  EMKNKYGSVIWLRIG-SVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLA  522
             +K KYG V+WL++G S + M + +A AAAELFKNHD SFADR + DV +   YY GSLA
Sbjct  61   ALKQKYGPVLWLKLGTSTNIMVVQTAPAAAELFKNHDTSFADRFIPDVNQAHSYYQGSLA  120

Query  523  FAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEASSVQRGTGVHVAH  702
               YGS+WR  RRICTVE+FVHKRI+ETVPVRR+C+D+ML WIEKEA+S ++G+G+ V  
Sbjct  121  IGRYGSFWRFQRRICTVEMFVHKRISETVPVRRRCVDNMLKWIEKEANSAEKGSGIEVTR  180

Query  703  FVFLSTFNLLGNLFLSRDLVDPMSDKASKFFDAMTGIMQ  819
            FVFL++FN+LGNL LS+DL DP S++AS FF+AM  IM+
Sbjct  181  FVFLASFNMLGNLILSKDLADPESEEASDFFNAMKRIME  219



>ref|XP_006339109.1| PREDICTED: cytochrome P450 76A2-like [Solanum tuberosum]
Length=505

 Score =   259 bits (663),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 128/219 (58%), Positives = 170/219 (78%), Gaps = 2/219 (1%)
 Frame = +1

Query  169  MEWEWKYLVWSAIFLIPGLVFLLARKKSSS-SYRlppgppglpVIGNMLDLGAFPHQTIA  345
            MEWEW YL +SAI L+P L+   ++KKS+  SY+LPPGPPGLP+ GNM +LG  P++ ++
Sbjct  1    MEWEWSYLFFSAIILLPVLILFFSQKKSTKCSYKLPPGPPGLPIFGNMFELGKEPYKKMS  60

Query  346  EMKNKYGSVIWLRIG-SVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLA  522
             ++ KYG V+ L++G S + M + +A AAAELFKNHD SFADR ++DV     YY GSLA
Sbjct  61   VLQQKYGPVLGLKLGPSTNIMVVQTAHAAAELFKNHDTSFADRPMVDVNLAHNYYQGSLA  120

Query  523  FAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEASSVQRGTGVHVAH  702
               YGS+WR  RRICTVE+FVHK+I+ETVP+RRKC+D+ML WIEK  SS ++G+G+ V  
Sbjct  121  IGRYGSFWRFQRRICTVEMFVHKKISETVPIRRKCVDNMLKWIEKAGSSAEKGSGIEVTR  180

Query  703  FVFLSTFNLLGNLFLSRDLVDPMSDKASKFFDAMTGIMQ  819
            FVFL++FN+LGNL LS+DL DP S++AS FF+AM GIM+
Sbjct  181  FVFLASFNMLGNLVLSKDLADPESEEASDFFNAMKGIME  219



>sp|P37122.1|C76A2_SOLME RecName: Full=Cytochrome P450 76A2; AltName: Full=CYPLXXVIA2; 
AltName: Full=Cytochrome P-450EG7 [Solanum melongena]
 emb|CAA50648.1| P450 hydroxylase [Solanum melongena]
Length=505

 Score =   258 bits (660),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 121/218 (56%), Positives = 169/218 (78%), Gaps = 1/218 (0%)
 Frame = +1

Query  169  MEWEWKYLVWSAIFLIPGLVFLLARKKSS-SSYRlppgppglpVIGNMLDLGAFPHQTIA  345
            MEWEW Y+ +SAI ++P  +   ++K ++ SSY+ PPGPPGLP+ GNM +LG  P++ +A
Sbjct  1    MEWEWSYVFFSAIIILPAFILFFSQKNTTKSSYKFPPGPPGLPIFGNMFELGTEPYKKMA  60

Query  346  EMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAF  525
             ++ KYG V+WL++GS  TM + +A+A+ ELFKNHD+SFA+R + DV +   YY GSLA 
Sbjct  61   VLRQKYGPVLWLKLGSTYTMVVQTAQASEELFKNHDISFANRVIPDVNQAHSYYQGSLAI  120

Query  526  APYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEASSVQRGTGVHVAHF  705
            APYG +WR  RRICT+E+FVHK+I+ET PVRRKC+D+ML WIEKEA+S ++G+G+ V  F
Sbjct  121  APYGPFWRFQRRICTIEMFVHKKISETEPVRRKCVDNMLKWIEKEANSAEKGSGIEVTRF  180

Query  706  VFLSTFNLLGNLFLSRDLVDPMSDKASKFFDAMTGIMQ  819
            VFL++FN+LGNL LS+DL D  S++AS+FF AM  I +
Sbjct  181  VFLASFNMLGNLILSKDLADLESEEASEFFIAMKRINE  218



>ref|XP_004249463.1| PREDICTED: cytochrome P450 76A2-like [Solanum lycopersicum]
Length=518

 Score =   258 bits (660),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 126/219 (58%), Positives = 169/219 (77%), Gaps = 2/219 (1%)
 Frame = +1

Query  169  MEWEWKYLVWSAIFLIPGLVFLLARKKSSSS-YRlppgppglpVIGNMLDLGAFPHQTIA  345
            MEWEW YL +SAI  +P L+   ++KKSS   Y LPPGPPGLP+ GNM +LG  P++ ++
Sbjct  1    MEWEWSYLFFSAIIFLPILILFFSQKKSSKCCYNLPPGPPGLPIFGNMFELGKEPYKKMS  60

Query  346  EMKNKYGSVIWLRIG-SVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLA  522
             +K KYG V+ L++G S + M + +A+AAAELFKNHD SFADR ++DV +   Y+ GSLA
Sbjct  61   ALKQKYGPVLGLKLGPSTNIMVVQTAEAAAELFKNHDTSFADRPIVDVNQAHNYFQGSLA  120

Query  523  FAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEASSVQRGTGVHVAH  702
               YGS+WR  RRICTVE+FVHK+I+ETVP+RRKC+D+ML WIEK  +S ++G G+ V  
Sbjct  121  VGRYGSFWRFQRRICTVEMFVHKKISETVPIRRKCVDNMLKWIEKTVNSAEKGNGIEVTR  180

Query  703  FVFLSTFNLLGNLFLSRDLVDPMSDKASKFFDAMTGIMQ  819
            FVFL++FN+LGNL LS+DL DP S++AS+FF+AM GIM+
Sbjct  181  FVFLASFNMLGNLILSKDLADPESEEASEFFNAMKGIME  219



>ref|XP_006339111.1| PREDICTED: cytochrome P450 76A2-like [Solanum tuberosum]
Length=506

 Score =   252 bits (644),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 123/219 (56%), Positives = 169/219 (77%), Gaps = 2/219 (1%)
 Frame = +1

Query  169  MEWEWKYLVWSAIFLIPGLVFLLARKKSSS-SYRlppgppglpVIGNMLDLGAFPHQTIA  345
            ME+EW YL +S+  L+   +   ++KK++  SY+LPPGPPGLP+ GNM +LG  P++ ++
Sbjct  1    MEYEWSYLFFSSTILLSIFILFFSKKKTTKCSYKLPPGPPGLPIFGNMFELGTEPYKKMS  60

Query  346  EMKNKYGSVIWLRIG-SVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLA  522
             +K KYG V+ L++G S + M + +A+AAAELFKNHD SFADR ++DV     YY GS A
Sbjct  61   ALKQKYGPVLGLKVGTSTNIMVVQTAQAAAELFKNHDTSFADRPLVDVNSAHNYYQGSPA  120

Query  523  FAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEASSVQRGTGVHVAH  702
             A YG +WR  RRICTVE+FVHK+I+ETVPVRRKC+D+ML WIEK A+S ++G+G+ V  
Sbjct  121  LARYGPFWRFQRRICTVEMFVHKKISETVPVRRKCVDNMLKWIEKAANSAEKGSGIEVTR  180

Query  703  FVFLSTFNLLGNLFLSRDLVDPMSDKASKFFDAMTGIMQ  819
            FVFL++FN+LGNL LS+DL DP S++AS+FF+AM GIM+
Sbjct  181  FVFLASFNMLGNLILSKDLADPESEEASEFFNAMKGIME  219



>gb|AGT03776.1| CYP76 hydroxylase [Withania somnifera]
Length=515

 Score =   251 bits (642),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 124/219 (57%), Positives = 166/219 (76%), Gaps = 3/219 (1%)
 Frame = +1

Query  169  MEWEWKYLVWSAIFLIPGLVFLLARKKSSSSY--RlppgppglpVIGNMLDLGAFPHQTI  342
            MEWEW YL +S I L+P  + L +RKK++  Y   LPPGPPGLP+ GN+  LG  P + +
Sbjct  1    MEWEWSYLFFSTIILLPAFILLFSRKKATKCYYNLLPPGPPGLPIFGNVFQLGTEPFKAM  60

Query  343  AEMKNKYGSVIWLRIG-SVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSL  519
            A ++ KYG V+WL++G S + M + +A+AAAELFKNHD+SFADR +  V +   Y  GS+
Sbjct  61   ACLEQKYGPVLWLKLGTSTNIMVVQTARAAAELFKNHDISFADRFIPIVNQAHNYCQGSM  120

Query  520  AFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEASSVQRGTGVHVA  699
            A   YGSYWR  RRICTVE+F+HK+I+ETVPVRRKC+D+ML WI K A+S ++G+G+ V 
Sbjct  121  ALCQYGSYWRFQRRICTVEMFIHKKISETVPVRRKCVDNMLKWIGKAANSAEKGSGIEVT  180

Query  700  HFVFLSTFNLLGNLFLSRDLVDPMSDKASKFFDAMTGIM  816
             FVFL++FN+LGNL LS+DL DP S++AS+FF+AM GIM
Sbjct  181  RFVFLASFNMLGNLILSKDLADPESEEASEFFNAMKGIM  219



>ref|XP_002309107.1| hypothetical protein POPTR_0006s09580g [Populus trichocarpa]
 gb|EEE92630.1| hypothetical protein POPTR_0006s09580g [Populus trichocarpa]
Length=508

 Score =   251 bits (640),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 110/175 (63%), Positives = 141/175 (81%), Gaps = 0/175 (0%)
 Frame = +1

Query  295  VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT  474
            + GN+ DLG+ PH+T+ +M+ KYG+VIWLR+G+++TM ILSAKAA E FKNHD+SFADRT
Sbjct  44   IFGNLFDLGSMPHRTLTDMRQKYGNVIWLRLGAMNTMVILSAKAATEFFKNHDLSFADRT  103

Query  475  VIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIE  654
            + + M+  GY  GSLA APYGSYWRVLRR+ TV++ V KRINET  +RRKC+DDML WIE
Sbjct  104  ITETMRAHGYDQGSLALAPYGSYWRVLRRLVTVDMIVTKRINETASIRRKCVDDMLQWIE  163

Query  655  KEASSVQRGTGVHVAHFVFLSTFNLLGNLFLSRDLVDPMSDKASKFFDAMTGIMQ  819
            +E+  V +  G+HV+ FVFL TFN+LGNL LSRDL+DP S   S+FFDAM G+M+
Sbjct  164  EESCKVGKAAGIHVSRFVFLMTFNMLGNLMLSRDLLDPESKVGSEFFDAMMGLME  218



>ref|XP_011094547.1| PREDICTED: cytochrome P450 76A2-like [Sesamum indicum]
Length=504

 Score =   250 bits (639),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 122/214 (57%), Positives = 160/214 (75%), Gaps = 4/214 (2%)
 Frame = +1

Query  178  EWKYLVWSAIFLIPGLVFLLARKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAEMKN  357
            E  + V+ AI L+P L+F +   K S S RLPPGP G PV G+M +LG  PH+ IAE++ 
Sbjct  2    ELHFFVYPAIILLPPLIFAIIHSKRSGSERLPPGPLGWPVFGHMFNLGGTPHRAIAELEQ  61

Query  358  KYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPYG  537
            KYG V+WL++GS++TMA+L AK A+E FKNHD+SFADRT+++ M   GY  GSLA APYG
Sbjct  62   KYGPVVWLKLGSINTMALLKAKPASEFFKNHDLSFADRTIVETMTAHGYNYGSLALAPYG  121

Query  538  SYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEASSVQRGTGVHVAHFVFLS  717
            S WRVLRRICTVE+FV KRI+ET  +RRKC+DDML WIEK+ +    G  + V  + FL+
Sbjct  122  SRWRVLRRICTVEMFVSKRISETEGIRRKCVDDMLSWIEKDGN----GNAIPVGRYAFLA  177

Query  718  TFNLLGNLFLSRDLVDPMSDKASKFFDAMTGIMQ  819
            +FN+LGNL +SRDLVDP S+K  +F+DAM  +M+
Sbjct  178  SFNMLGNLMMSRDLVDPESEKGLEFYDAMKKVME  211



>ref|XP_011019179.1| PREDICTED: cytochrome P450 76A2-like [Populus euphratica]
Length=508

 Score =   249 bits (637),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 111/175 (63%), Positives = 139/175 (79%), Gaps = 0/175 (0%)
 Frame = +1

Query  295  VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT  474
            V+GN+ DLG+ PH+T+  M+ KYG VIWLR+G+++TM ILSAKAA E FKNHD+SFADRT
Sbjct  44   VLGNLFDLGSMPHRTLTGMRQKYGDVIWLRLGAMNTMVILSAKAATEFFKNHDLSFADRT  103

Query  475  VIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIE  654
            + + M+  GY  GSLA APYGSYWRVLRR+ TV++ V KRINET   RRKC+DDML WIE
Sbjct  104  ITETMRAHGYDQGSLALAPYGSYWRVLRRLVTVDMIVTKRINETASTRRKCVDDMLQWIE  163

Query  655  KEASSVQRGTGVHVAHFVFLSTFNLLGNLFLSRDLVDPMSDKASKFFDAMTGIMQ  819
            +E+  V +  G+HV+ FVFL TFN+LGNL LSRDL+DP S   S+FFDAM G+M+
Sbjct  164  EESCKVGKAAGIHVSRFVFLMTFNMLGNLMLSRDLLDPESKVGSEFFDAMMGLME  218



>ref|XP_008392600.1| PREDICTED: cytochrome P450 76A2-like [Malus domestica]
Length=513

 Score =   249 bits (635),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 129/215 (60%), Positives = 163/215 (76%), Gaps = 1/215 (0%)
 Frame = +1

Query  178  EWKYLVWSAIFLIPGLVFLLARKKSSSSYRlppgppgl-pVIGNMLDLGAFPHQTIAEMK  354
            EW +LV   IF +P LVFL+ R  SSS +R  P  P   PVIGNM DLG  PH+T+ ++ 
Sbjct  9    EWNFLVCLIIFFLPVLVFLIRRSSSSSGHRRLPPGPKGWPVIGNMFDLGTMPHRTLTDLG  68

Query  355  NKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPY  534
            +K+G VIWL +G  +TM++ SAKAAAE FKNHD+SF +RTV +  +V  Y+ GSLA APY
Sbjct  69   HKFGPVIWLTLGVRNTMSVQSAKAAAEFFKNHDLSFVERTVNENARVHDYHKGSLAMAPY  128

Query  535  GSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEASSVQRGTGVHVAHFVFL  714
            G++WRV+RR+ TVE+ V+KRINET  +RRKCID+M LWIE+EAS V+ G GVHVA FVFL
Sbjct  129  GTHWRVMRRLVTVEMVVNKRINETAFIRRKCIDNMQLWIEEEASKVKEGRGVHVARFVFL  188

Query  715  STFNLLGNLFLSRDLVDPMSDKASKFFDAMTGIMQ  819
             TFNLLGNL LSRDLVDP S++  +FF AM G+M+
Sbjct  189  MTFNLLGNLMLSRDLVDPNSEEGMEFFKAMNGLME  223



>ref|XP_009785657.1| PREDICTED: cytochrome P450 76A1-like isoform X2 [Nicotiana sylvestris]
Length=508

 Score =   249 bits (635),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 125/222 (56%), Positives = 175/222 (79%), Gaps = 6/222 (3%)
 Frame = +1

Query  169  MEWEWKYLVWSAIFLIPGLVFLLARKKSS-SSYRlppgppglpVIGNMLDL-GAFPHQTI  342
            ME EW Y+ WS+I ++P  + L+ + KSS S+ +LPPGPPGLP++GNM DL G+ P++ +
Sbjct  1    MELEWSYIFWSSIIILPAFILLITKNKSSFSNVKLPPGPPGLPIVGNMFDLAGSEPYKKV  60

Query  343  AEMKNKYGSVIWLRIGS-VSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSL  519
            A +K KYG ++WL+IGS ++T+ + +A+AAAELFKNHDV+FADR ++DV     +Y  S+
Sbjct  61   ANLKQKYGPIVWLKIGSSMNTIVVQTAQAAAELFKNHDVTFADRNIVDVNLAHNFYQVSM  120

Query  520  AFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEAS--SVQRGTGVH  693
            A APYG+YWR+ RRICTVE+FV+KRINETV +RRK +D ML WIEK+++  +V R +G+ 
Sbjct  121  ALAPYGNYWRLQRRICTVEMFVNKRINETVQIRRKSMDKMLQWIEKQSNLENVDR-SGIE  179

Query  694  VAHFVFLSTFNLLGNLFLSRDLVDPMSDKASKFFDAMTGIMQ  819
            V  +VFL++FN+LGNL LS+DL DP S+K S+FF AMTGIM+
Sbjct  180  VTRYVFLASFNMLGNLMLSKDLADPESEKGSEFFKAMTGIME  221



>ref|XP_009785656.1| PREDICTED: cytochrome P450 76A1-like isoform X1 [Nicotiana sylvestris]
Length=517

 Score =   249 bits (635),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 125/222 (56%), Positives = 175/222 (79%), Gaps = 6/222 (3%)
 Frame = +1

Query  169  MEWEWKYLVWSAIFLIPGLVFLLARKKSS-SSYRlppgppglpVIGNMLDL-GAFPHQTI  342
            ME EW Y+ WS+I ++P  + L+ + KSS S+ +LPPGPPGLP++GNM DL G+ P++ +
Sbjct  1    MELEWSYIFWSSIIILPAFILLITKNKSSFSNVKLPPGPPGLPIVGNMFDLAGSEPYKKV  60

Query  343  AEMKNKYGSVIWLRIGS-VSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSL  519
            A +K KYG ++WL+IGS ++T+ + +A+AAAELFKNHDV+FADR ++DV     +Y  S+
Sbjct  61   ANLKQKYGPIVWLKIGSSMNTIVVQTAQAAAELFKNHDVTFADRNIVDVNLAHNFYQVSM  120

Query  520  AFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEAS--SVQRGTGVH  693
            A APYG+YWR+ RRICTVE+FV+KRINETV +RRK +D ML WIEK+++  +V R +G+ 
Sbjct  121  ALAPYGNYWRLQRRICTVEMFVNKRINETVQIRRKSMDKMLQWIEKQSNLENVDR-SGIE  179

Query  694  VAHFVFLSTFNLLGNLFLSRDLVDPMSDKASKFFDAMTGIMQ  819
            V  +VFL++FN+LGNL LS+DL DP S+K S+FF AMTGIM+
Sbjct  180  VTRYVFLASFNMLGNLMLSKDLADPESEKGSEFFKAMTGIME  221



>ref|XP_009334561.1| PREDICTED: cytochrome P450 76A2-like [Pyrus x bretschneideri]
 ref|XP_009342774.1| PREDICTED: cytochrome P450 76A2-like [Pyrus x bretschneideri]
Length=513

 Score =   245 bits (626),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 128/215 (60%), Positives = 163/215 (76%), Gaps = 1/215 (0%)
 Frame = +1

Query  178  EWKYLVWSAIFLIPGLVFLLARKKSSSSYRlppgppgl-pVIGNMLDLGAFPHQTIAEMK  354
            EW  LV   IF +P L+FL+ R  S+SS+R  P  P   PVIGNM DLG  PH+T+ ++ 
Sbjct  9    EWNLLVCLIIFFLPVLLFLIRRSSSNSSHRRLPPGPKGWPVIGNMFDLGTMPHRTLTDLG  68

Query  355  NKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPY  534
            +K+G VIWL +G  +TM++ SAKAAAE FKNHD+SF +RTV +  +V  Y+ GSLA APY
Sbjct  69   HKFGPVIWLTLGVRNTMSVQSAKAAAEFFKNHDLSFVERTVNENARVHDYHKGSLAMAPY  128

Query  535  GSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEASSVQRGTGVHVAHFVFL  714
            G++WRV+RR+ TVE+ V+KRINET  +RRKCID+M LWIE+EAS V+ G GVHVA FVFL
Sbjct  129  GTHWRVMRRLVTVEMVVNKRINETAFIRRKCIDNMQLWIEEEASKVKEGRGVHVARFVFL  188

Query  715  STFNLLGNLFLSRDLVDPMSDKASKFFDAMTGIMQ  819
             TFNLLGNL LSRDLVDP S++  +FF AM G+M+
Sbjct  189  MTFNLLGNLMLSRDLVDPNSEEGMEFFKAMNGLMK  223



>ref|XP_009350795.1| PREDICTED: cytochrome P450 76A2-like [Pyrus x bretschneideri]
 ref|XP_009350796.1| PREDICTED: cytochrome P450 76A2-like [Pyrus x bretschneideri]
Length=513

 Score =   245 bits (626),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 128/215 (60%), Positives = 163/215 (76%), Gaps = 1/215 (0%)
 Frame = +1

Query  178  EWKYLVWSAIFLIPGLVFLLARKKSSSSYRlppgppgl-pVIGNMLDLGAFPHQTIAEMK  354
            EW  LV   IF +P L+FL+ R  S+SS+R  P  P   PVIGNM DLG  PH+T+ ++ 
Sbjct  9    EWNLLVCLIIFFLPVLLFLIRRSSSNSSHRRLPPGPKGWPVIGNMFDLGTMPHRTLTDLG  68

Query  355  NKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPY  534
            +K+G VIWL +G  +TM++ SAKAAAE FKNHD+SF +RTV +  +V  Y+ GSLA APY
Sbjct  69   HKFGPVIWLTLGVRNTMSVQSAKAAAEFFKNHDLSFVERTVNENARVHDYHKGSLAMAPY  128

Query  535  GSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEASSVQRGTGVHVAHFVFL  714
            G++WRV+RR+ TVE+ V+KRINET  +RRKCID+M LWIE+EAS V+ G GVHVA FVFL
Sbjct  129  GTHWRVMRRLVTVEMVVNKRINETAFIRRKCIDNMQLWIEEEASKVKEGRGVHVARFVFL  188

Query  715  STFNLLGNLFLSRDLVDPMSDKASKFFDAMTGIMQ  819
             TFNLLGNL LSRDLVDP S++  +FF AM G+M+
Sbjct  189  MTFNLLGNLMLSRDLVDPNSEEGMEFFKAMNGLMK  223



>ref|XP_007203742.1| hypothetical protein PRUPE_ppa018268mg [Prunus persica]
 gb|EMJ04941.1| hypothetical protein PRUPE_ppa018268mg [Prunus persica]
Length=509

 Score =   245 bits (625),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 132/218 (61%), Positives = 173/218 (79%), Gaps = 1/218 (0%)
 Frame = +1

Query  169  MEWEWKYLVWSAIFLIPGLVFLLARKKSSSSY-RlppgppglpVIGNMLDLGAFPHQTIA  345
            MEW W +LV+   FL+P L+FL+ R+ S+SS+ RLPPGPPGLPV GNM DLG  PH+T+ 
Sbjct  2    MEWPWNFLVYFIPFLLPALLFLIRRRSSNSSHHRLPPGPPGLPVFGNMFDLGTMPHKTLT  61

Query  346  EMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAF  525
            ++ +K+G VIWLR+G+ +TM I SAKAAA+LFK+HD+SFA RT  +  +V  Y+ GSLA 
Sbjct  62   DLTHKFGPVIWLRLGARNTMVIQSAKAAADLFKHHDMSFAGRTTTEASRVLDYHKGSLAL  121

Query  526  APYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEASSVQRGTGVHVAHF  705
            APYG++WR+LRR+ TVE+ V+KRINET  +RRKC+D++ LWIE+EAS ++ G GVHVA F
Sbjct  122  APYGAHWRMLRRLMTVEMLVNKRINETTFIRRKCLDNLQLWIEEEASKLEEGHGVHVARF  181

Query  706  VFLSTFNLLGNLFLSRDLVDPMSDKASKFFDAMTGIMQ  819
            VFL +FNLLGNL LSRDLVDP S +  +FF AM G+M+
Sbjct  182  VFLMSFNLLGNLMLSRDLVDPNSREGLEFFSAMAGLME  219



>emb|CDP15344.1| unnamed protein product [Coffea canephora]
Length=282

 Score =   238 bits (607),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 125/218 (57%), Positives = 165/218 (76%), Gaps = 2/218 (1%)
 Frame = +1

Query  169  MEWEWKYLVWSAIFLIPGLVFLLARKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAE  348
            ME      VW    LIP L+ LL R K SS  RLPPGPPG P+ GNM DLG+ PH+T+A 
Sbjct  1    MELHVNQFVWGVAILIPSLL-LLLRHKKSSHNRLPPGPPGWPIFGNMFDLGSMPHRTLAG  59

Query  349  MKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFA  528
            +KNKYG V+WLRIG+++TMA+ S+KAAAELF+NHD+SF +RTV + MK   +   SL+ A
Sbjct  60   LKNKYGPVVWLRIGAMNTMAVQSSKAAAELFRNHDISFVERTVTENMKSHNFDKSSLSLA  119

Query  529  PYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEASSVQRG-TGVHVAHF  705
            PYGSYWRVL+R+ TVE+ V+KRINETV +RRKC+DDM+ WI+KEA + +    G+H+AHF
Sbjct  120  PYGSYWRVLKRMMTVEMIVNKRINETVAIRRKCVDDMVSWIKKEAHAGKESWRGIHLAHF  179

Query  706  VFLSTFNLLGNLFLSRDLVDPMSDKASKFFDAMTGIMQ  819
            VFL++FN+LGNL LS+DLV+P  ++  +FF AM  + +
Sbjct  180  VFLASFNMLGNLMLSKDLVEPEKEEGVEFFSAMVRLAE  217



>ref|XP_009603940.1| PREDICTED: cytochrome P450 76A2-like [Nicotiana tomentosiformis]
Length=511

 Score =   243 bits (620),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 120/220 (55%), Positives = 164/220 (75%), Gaps = 4/220 (2%)
 Frame = +1

Query  169  MEWEWKYLVWS--AIFLIPGLVFLLARKKSSSSYRlppgppgl-pVIGNMLDLGAFPHQT  339
            M+W W Y+ WS  +I +   L+    R++S+ + RL P  P   PV GNM +LG  PH+T
Sbjct  1    MDWNWDYVFWSITSILIPLLLLLHFHRRRSNKNRRLLPPGPQGWPVFGNMFELGNEPHKT  60

Query  340  IAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSL  519
            +  +K KYGSV+WL++GS++TM ILSA+AAAE FKNHDV+FA+R+V +VMK  GY+ GSL
Sbjct  61   LMSLKQKYGSVVWLKLGSINTMVILSAEAAAEFFKNHDVAFAERSVTEVMKSHGYHKGSL  120

Query  520  AFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEASSVQRGTGVHVA  699
            A APYG+YWR+++RI TV++ V+KRINETV +RRKCIDD+  WI  E   +    G+HVA
Sbjct  121  ALAPYGTYWRIMKRIMTVQMLVNKRINETVDIRRKCIDDLTEWINNEG-RINSSGGIHVA  179

Query  700  HFVFLSTFNLLGNLFLSRDLVDPMSDKASKFFDAMTGIMQ  819
             F+FL++FN+LGNL LSR+LVDP S+K S+FF AM  +M+
Sbjct  180  KFIFLASFNMLGNLLLSRELVDPKSEKGSEFFTAMVELME  219



>ref|XP_006430324.1| hypothetical protein CICLE_v10013315mg [Citrus clementina]
 gb|ESR43564.1| hypothetical protein CICLE_v10013315mg [Citrus clementina]
Length=515

 Score =   243 bits (619),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 130/222 (59%), Positives = 163/222 (73%), Gaps = 7/222 (3%)
 Frame = +1

Query  154  KNF*EMEWEWKYLVWSAIFLIPGLVFLLARKKSSSSYRlppgppglpVIGNMLDLGAFPH  333
            +N  +M+W    LV   IF   G V LL R+KSS   + PPGPPG P+IGNM DLG  PH
Sbjct  11   ENSDQMDW-LGLLVCIIIFSASGAVLLLHRRKSSRPKQHPPGPPGWPIIGNMFDLGTVPH  69

Query  334  QTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMG  513
            +T+ E++ KYG V+WL+ G+++TMAILSAKAA + FKNHD +FA+R V + M+V GY   
Sbjct  70   RTLTELRQKYGDVLWLKFGAINTMAILSAKAATDFFKNHDSTFAERKVTETMRVHGYDKS  129

Query  514  SLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEASSVQRGTGVH  693
            SLA APYG++WRVLRR+ TVE+   KRINET  VRRKC++DMLLWIE+EAS      GVH
Sbjct  130  SLALAPYGAFWRVLRRLVTVEMLATKRINETASVRRKCVNDMLLWIEQEAS------GVH  183

Query  694  VAHFVFLSTFNLLGNLFLSRDLVDPMSDKASKFFDAMTGIMQ  819
            VA  VFLSTFNLLGNL LSRDL+D  S+  ++FF AM G+M+
Sbjct  184  VARLVFLSTFNLLGNLMLSRDLLDRESNDGAEFFQAMMGLME  225



>ref|XP_008241318.1| PREDICTED: cytochrome P450 76A2-like [Prunus mume]
Length=509

 Score =   242 bits (618),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 133/219 (61%), Positives = 173/219 (79%), Gaps = 2/219 (1%)
 Frame = +1

Query  169  MEW-EWKYLVWSAIFLIPGLVFLLARKKS-SSSYRlppgppglpVIGNMLDLGAFPHQTI  342
            MEW  W +LV+  IFL+P L+FLL R++S S ++ LPPGPPG P+ GNM DLG  PH+T+
Sbjct  1    MEWCSWNFLVYFLIFLLPALLFLLIRRRSKSGNHLLPPGPPGWPIFGNMFDLGTMPHRTL  60

Query  343  AEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLA  522
             E+  K+G VIWLR+G+ +TM++ SAKAA+E FKNHD+SFA+RT+ +  +V  Y+ GSLA
Sbjct  61   TELTPKFGPVIWLRLGARATMSVQSAKAASEFFKNHDLSFANRTINEACRVYDYHKGSLA  120

Query  523  FAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEASSVQRGTGVHVAH  702
             APYGS+WRVLRR+ TV++ V+KRINET  VRRKC D++ LWIE+EAS ++ G GVHVA 
Sbjct  121  LAPYGSHWRVLRRLMTVDMVVNKRINETAFVRRKCFDNLQLWIEEEASKLKEGHGVHVAR  180

Query  703  FVFLSTFNLLGNLFLSRDLVDPMSDKASKFFDAMTGIMQ  819
            FVFL TFNLLGNL LSRDLVDP S++  +FF AM G+M+
Sbjct  181  FVFLMTFNLLGNLMLSRDLVDPKSNEGLEFFKAMNGLME  219



>ref|XP_009616474.1| PREDICTED: cytochrome P450 76A1-like [Nicotiana tomentosiformis]
Length=508

 Score =   242 bits (618),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 132/221 (60%), Positives = 174/221 (79%), Gaps = 4/221 (2%)
 Frame = +1

Query  169  MEWEWKYLVWSAIFLIPGLVFLLARKKSSSSY-RlppgppglpVIGNMLDL-GAFPHQTI  342
            ME EW+Y+ WS I L+P L+ L+A+ KSSSS  +LPPGPPGLP+ GNM DL G+ PH+ +
Sbjct  1    MELEWRYIFWSIIILLPALILLIAKNKSSSSNIKLPPGPPGLPIFGNMFDLAGSEPHKKV  60

Query  343  AEMKNKYGSVIWLRIGS-VSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSL  519
            A  K KYG ++WL+IGS ++T+ + +A+AAAELFKNHDV+FADR ++DV      Y GS+
Sbjct  61   ANWKQKYGPIVWLKIGSSMNTIVVQTAQAAAELFKNHDVTFADRNIVDVNLAHNIYQGSI  120

Query  520  AFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEASSVQ-RGTGVHV  696
            + APYG+YWR+ RRICT E+FV+KRINETV +RRK +D ML WIEK+A+ V    +G+ V
Sbjct  121  SLAPYGNYWRMQRRICTSEMFVNKRINETVQIRRKSMDKMLQWIEKQANLVNINRSGIEV  180

Query  697  AHFVFLSTFNLLGNLFLSRDLVDPMSDKASKFFDAMTGIMQ  819
             H+VFL++FN+LGNL LS+DL DP SDK S+FF+AMTGIMQ
Sbjct  181  THYVFLASFNMLGNLILSKDLADPESDKGSEFFNAMTGIMQ  221



>ref|XP_006482364.1| PREDICTED: cytochrome P450 76A2-like [Citrus sinensis]
Length=500

 Score =   242 bits (617),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 131/217 (60%), Positives = 160/217 (74%), Gaps = 7/217 (3%)
 Frame = +1

Query  169  MEWEWKYLVWSAIFLIPGLVFLLARKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAE  348
            M+W    LV   IF   G V LL R KSS   + PPGPPG P+IGNM DLG  PH+T+ E
Sbjct  1    MDW-LGLLVCIIIFSASGAVLLLLRIKSSRPKQHPPGPPGWPIIGNMFDLGTVPHRTLTE  59

Query  349  MKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFA  528
            ++ KYG VIWL+ G+++TMAILSAKAA + FKNHD +FA+R V + M+V GY   SLA A
Sbjct  60   LRQKYGDVIWLKFGAINTMAILSAKAATDFFKNHDSTFAERKVTETMRVHGYDKSSLALA  119

Query  529  PYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEASSVQRGTGVHVAHFV  708
            PYG++WRVLRR+ TVE+ V KRINET  VRRKC++DMLLWIE+EAS      GVHVA  V
Sbjct  120  PYGAFWRVLRRLVTVEMLVTKRINETASVRRKCVNDMLLWIEQEAS------GVHVARLV  173

Query  709  FLSTFNLLGNLFLSRDLVDPMSDKASKFFDAMTGIMQ  819
            FLSTFNLLGNL LSRDL+D  S+  ++FF AM G+M+
Sbjct  174  FLSTFNLLGNLMLSRDLLDRESNDGAEFFQAMMGLME  210



>ref|XP_004249462.1| PREDICTED: cytochrome P450 76A2-like [Solanum lycopersicum]
Length=499

 Score =   241 bits (615),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 124/218 (57%), Positives = 162/218 (74%), Gaps = 3/218 (1%)
 Frame = +1

Query  169  MEWEWKYLVWSAIFLIPGLVFLLARKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAE  348
            MEWE  YL +S+I L+   +F+L   K +S+Y LPPGPPGLPV GNM +LG   ++ +A 
Sbjct  1    MEWELSYLFFSSIILLS--IFILFFSKKNSTYNLPPGPPGLPVFGNMFELGTESYKKMAA  58

Query  349  MKNKYGSVIWLRIG-SVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAF  525
            +K KYG V+ L++G S + M + +A+AAAELFKNHD SFADR  +DV     YY GS A 
Sbjct  59   LKQKYGPVLGLKVGTSTNIMVVQTAQAAAELFKNHDTSFADRPQVDVNSAHNYYQGSPAL  118

Query  526  APYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEASSVQRGTGVHVAHF  705
            A YG +WR  RR+CTVE+FVHK+I+ETV VRRKC+DDML WIEK   S ++G+G+ V  F
Sbjct  119  ARYGPFWRFQRRLCTVEMFVHKKISETVRVRRKCVDDMLKWIEKAGCSAEKGSGIEVTRF  178

Query  706  VFLSTFNLLGNLFLSRDLVDPMSDKASKFFDAMTGIMQ  819
            VFL++FN+LGNL LS+DL DP S++AS+FF AM GIM+
Sbjct  179  VFLASFNMLGNLILSKDLADPESEEASEFFHAMKGIME  216



>gb|KDO61008.1| hypothetical protein CISIN_1g036305mg [Citrus sinensis]
Length=515

 Score =   241 bits (616),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 131/222 (59%), Positives = 162/222 (73%), Gaps = 7/222 (3%)
 Frame = +1

Query  154  KNF*EMEWEWKYLVWSAIFLIPGLVFLLARKKSSSSYRlppgppglpVIGNMLDLGAFPH  333
            +N  +M+W    LV   IF   G V LL R KSS   + PPGPPG P+IGNM DLG  PH
Sbjct  11   ENSDQMDW-LGLLVCIIIFSASGAVLLLLRIKSSRPKQHPPGPPGWPIIGNMFDLGTVPH  69

Query  334  QTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMG  513
            +T+ E++ KYG VIWL+ G+++TM ILSAKAA + FKNHD +FA+R V + M+V GY   
Sbjct  70   RTLTELRQKYGDVIWLKFGAINTMVILSAKAATDFFKNHDSTFAERKVTETMRVHGYDKS  129

Query  514  SLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEASSVQRGTGVH  693
            SLA APYG++WRVLRR+ TVE+ V KRINET  VRRKC++DMLLWIE+EAS      GVH
Sbjct  130  SLALAPYGAFWRVLRRLVTVEMLVTKRINETASVRRKCVNDMLLWIEQEAS------GVH  183

Query  694  VAHFVFLSTFNLLGNLFLSRDLVDPMSDKASKFFDAMTGIMQ  819
            VA  VFLSTFNLLGNL LSRDL+D  S+  ++FF AM G+M+
Sbjct  184  VARLVFLSTFNLLGNLMLSRDLLDRESNDGAEFFQAMMGLME  225



>ref|XP_002277725.1| PREDICTED: cytochrome P450 76A1 [Vitis vinifera]
Length=508

 Score =   240 bits (613),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 121/218 (56%), Positives = 162/218 (74%), Gaps = 2/218 (1%)
 Frame = +1

Query  169  MEWEWKYLVWSAIFLIPGLVFLLARKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAE  348
            ++W    L+W  I +IP ++FLL  ++ S S RLPPGPPG PV GNM DLGA PH+T+A 
Sbjct  2    VDWASNILLWCIILVIP-VLFLLLHRRRSGSVRLPPGPPGWPVFGNMFDLGAMPHETLAG  60

Query  349  MKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFA  528
            +++KYG V+WL +G++ T  + S+KAAAELFKN D+ F+DRT+ + M+ QGY+  SLA A
Sbjct  61   LRHKYGDVVWLNLGAIKTTVVQSSKAAAELFKNQDLCFSDRTITETMRAQGYHESSLALA  120

Query  529  PYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEASSV-QRGTGVHVAHF  705
            PYG +WR LRR+ T+E+ V KRINET  VRRKC+DDML WIE+EA  V   G G+ VAHF
Sbjct  121  PYGPHWRSLRRLMTMEMLVTKRINETAGVRRKCVDDMLSWIEEEARGVGGEGRGIQVAHF  180

Query  706  VFLSTFNLLGNLFLSRDLVDPMSDKASKFFDAMTGIMQ  819
            VFL++FN+LGNL LS DL+ P S + S+FF+ M  +M+
Sbjct  181  VFLASFNMLGNLMLSCDLLHPGSKEGSEFFEVMVRVME  218



>emb|CAN77399.1| hypothetical protein VITISV_015277 [Vitis vinifera]
Length=508

 Score =   239 bits (611),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 121/218 (56%), Positives = 162/218 (74%), Gaps = 2/218 (1%)
 Frame = +1

Query  169  MEWEWKYLVWSAIFLIPGLVFLLARKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAE  348
            ++W    L+W  I +IP ++FLL  ++ S S RLPPGPPG PV GNM DLGA PH+T+A 
Sbjct  2    VDWASNILLWCIILVIP-VLFLLLHRRRSGSVRLPPGPPGWPVFGNMFDLGAMPHETLAG  60

Query  349  MKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFA  528
            +++KYG V+WL +G++ T  + S+KAAAELFKN D+ F+DRT+ + M+ QGY+  SLA A
Sbjct  61   LRHKYGDVVWLNLGAIKTTVVQSSKAAAELFKNXDLCFSDRTITETMRAQGYHESSLALA  120

Query  529  PYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEASSV-QRGTGVHVAHF  705
            PYG +WR LRR+ T+E+ V KRINET  VRRKC+DDML WIE+EA  V   G G+ VAHF
Sbjct  121  PYGPHWRSLRRLMTMEMLVTKRINETAGVRRKCVDDMLSWIEEEARGVGGEGRGIQVAHF  180

Query  706  VFLSTFNLLGNLFLSRDLVDPMSDKASKFFDAMTGIMQ  819
            VFL++FN+LGNL LS DL+ P S + S+FF+ M  +M+
Sbjct  181  VFLASFNMLGNLMLSCDLLHPGSKEGSEFFEVMVRVME  218



>emb|CBI30226.3| unnamed protein product [Vitis vinifera]
Length=660

 Score =   241 bits (615),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 121/218 (56%), Positives = 162/218 (74%), Gaps = 2/218 (1%)
 Frame = +1

Query  169  MEWEWKYLVWSAIFLIPGLVFLLARKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAE  348
            ++W    L+W  I +IP ++FLL  ++ S S RLPPGPPG PV GNM DLGA PH+T+A 
Sbjct  2    VDWASNILLWCIILVIP-VLFLLLHRRRSGSVRLPPGPPGWPVFGNMFDLGAMPHETLAG  60

Query  349  MKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFA  528
            +++KYG V+WL +G++ T  + S+KAAAELFKN D+ F+DRT+ + M+ QGY+  SLA A
Sbjct  61   LRHKYGDVVWLNLGAIKTTVVQSSKAAAELFKNQDLCFSDRTITETMRAQGYHESSLALA  120

Query  529  PYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEASSV-QRGTGVHVAHF  705
            PYG +WR LRR+ T+E+ V KRINET  VRRKC+DDML WIE+EA  V   G G+ VAHF
Sbjct  121  PYGPHWRSLRRLMTMEMLVTKRINETAGVRRKCVDDMLSWIEEEARGVGGEGRGIQVAHF  180

Query  706  VFLSTFNLLGNLFLSRDLVDPMSDKASKFFDAMTGIMQ  819
            VFL++FN+LGNL LS DL+ P S + S+FF+ M  +M+
Sbjct  181  VFLASFNMLGNLMLSCDLLHPGSKEGSEFFEVMVRVME  218



>ref|XP_011100232.1| PREDICTED: cytochrome P450 76A2-like [Sesamum indicum]
Length=547

 Score =   238 bits (608),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 124/219 (57%), Positives = 166/219 (76%), Gaps = 3/219 (1%)
 Frame = +1

Query  169  MEWEWKYLVWSAIFLIPGLVFLLARKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAE  348
            M+  W +LVW    L P ++FL  R++ S+S  LPPGPPG PV+GNM DLG+ PH+T+A 
Sbjct  35   MDSMWIFLVWCIGILGP-VLFLFCRQRCSTSGGLPPGPPGWPVVGNMFDLGSMPHKTVAG  93

Query  349  MKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFA  528
            +K  YG V+WLRIGS++T+A+L+AKAAAELFKNHD +FA+RT+ +VMKV  ++  +L+ +
Sbjct  94   LKKDYGPVVWLRIGSINTVALLTAKAAAELFKNHDANFAERTITEVMKVHDFHKTALSLS  153

Query  529  PYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEASSVQRGTG--VHVAH  702
            PYGSYWRV++RI TVE+ V KRI ET P+RR+CI DM+ WI KEA +   G    +HVA 
Sbjct  154  PYGSYWRVMKRIMTVEMLVQKRIKETEPIRRRCIGDMVEWINKEAKAAAGGESGRIHVAR  213

Query  703  FVFLSTFNLLGNLFLSRDLVDPMSDKASKFFDAMTGIMQ  819
            FVFL++FN+LGNL LSRDLV P S + S+FF AM  +M+
Sbjct  214  FVFLASFNMLGNLMLSRDLVSPESVEGSEFFAAMIELME  252



>ref|XP_009774708.1| PREDICTED: cytochrome P450 76A2-like [Nicotiana sylvestris]
Length=508

 Score =   236 bits (602),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 113/218 (52%), Positives = 157/218 (72%), Gaps = 2/218 (1%)
 Frame = +1

Query  169  MEWEWKYLVWSAIFLIPGLVFLLARKKSSSSYRlppgppgl-pVIGNMLDLGAFPHQTIA  345
            M+W W Y+ WS   ++  L+    R++S+ + RL P      PV GNM +LG  PH+T+ 
Sbjct  1    MDWNWDYVFWSITSILILLLLHFHRRRSNKNGRLLPPGSRGWPVFGNMFELGNEPHKTLM  60

Query  346  EMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAF  525
             +K KYG V+WL++GS++TM ILSA AA E FKNHDV+FA+R+V +VMK  GY+ GSLA 
Sbjct  61   GLKQKYGPVVWLKLGSINTMVILSADAATEFFKNHDVAFAERSVTEVMKSHGYHKGSLAL  120

Query  526  APYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEASSVQRGTGVHVAHF  705
            APYG+YWR+++RI TV++ ++KRIN+TV +RRKCIDD++ WI  E   V    G+HVA F
Sbjct  121  APYGTYWRIMKRIMTVQMLINKRINQTVDIRRKCIDDLIEWINNEG-RVNSSGGIHVAKF  179

Query  706  VFLSTFNLLGNLFLSRDLVDPMSDKASKFFDAMTGIMQ  819
            +FL++FN+LG L LSR+LVDP S+  S+FF AM   M+
Sbjct  180  IFLASFNMLGKLLLSRELVDPKSENGSEFFTAMVEFME  217



>ref|XP_004305369.1| PREDICTED: cytochrome P450 76A2-like [Fragaria vesca subsp. vesca]
Length=517

 Score =   236 bits (601),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 126/219 (58%), Positives = 170/219 (78%), Gaps = 7/219 (3%)
 Frame = +1

Query  184  KYLVWSAI-FLIPGLVFLLARKKSSSS--YRlppgppglpVIGNMLDLGAFPHQTIAEMK  354
            ++L+W+ +  +IP L+FL  R++S+SS    LPPGPPG P+IGNMLDLG  PH+T  +++
Sbjct  2    EHLLWNFLSLIIPALLFLFIRRRSNSSKELELPPGPPGWPIIGNMLDLGQMPHKTQTKLR  61

Query  355  NKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPY  534
            + +G VIWLRIG+ +TMAILSAKAA E FKNHD+SFA+R+V +  KV  Y+ GSLA APY
Sbjct  62   HTFGPVIWLRIGARNTMAILSAKAATEFFKNHDISFAERSVTEGSKVLDYHKGSLALAPY  121

Query  535  GSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEASSVQR-GT---GVHVAH  702
            GS+WR+LRR+ TV++  +KRIN+T  +R KC+D+M  WIE+EAS +Q  GT   GVH+A 
Sbjct  122  GSHWRLLRRLLTVDILTNKRINDTAAIRSKCVDNMQKWIEEEASKLQENGTSSRGVHLAR  181

Query  703  FVFLSTFNLLGNLFLSRDLVDPMSDKASKFFDAMTGIMQ  819
            FVFL +FNLLGNL LSRDLVDP S++  +FF+ M G+M+
Sbjct  182  FVFLMSFNLLGNLLLSRDLVDPNSEEGLEFFELMKGVME  220



>ref|XP_010112510.1| Cytochrome P450 76A2 [Morus notabilis]
 gb|EXC33898.1| Cytochrome P450 76A2 [Morus notabilis]
Length=509

 Score =   234 bits (598),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 125/221 (57%), Positives = 163/221 (74%), Gaps = 11/221 (5%)
 Frame = +1

Query  169  MEWEW----KYLVWSAIFLIPGLVFLLARKKSSSSYRlppgppglpVIGNMLDLGAFPHQ  336
            ME  W     ++V S + ++P L     RK +S   RLPPGPPG PV GN  DLG  PH+
Sbjct  1    MECSWVIFLAFIVMSFLLIMPHL-----RKGTSGHRRLPPGPPGWPVFGNTFDLGPMPHR  55

Query  337  TIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGS  516
            ++A++++KYG V+WL++G+++TM ILS+KAAAE FKNHD+SF +RTV +  +V GY+ GS
Sbjct  56   SLAQLRHKYGDVLWLKLGAINTMVILSSKAAAEFFKNHDLSFVERTVTETSRVYGYHKGS  115

Query  517  LAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEASSVQRGTGVHV  696
            +A A YGSYWRV+RR+ TVE+ V+KRI ET  +RRKC+DDMLLWIE+EA       GVHV
Sbjct  116  VALANYGSYWRVMRRLVTVEMLVNKRIRETAFLRRKCVDDMLLWIEEEAGKAN--CGVHV  173

Query  697  AHFVFLSTFNLLGNLFLSRDLVDPMSDKASKFFDAMTGIMQ  819
            A FVFL TFNLLGNL LS+DL  P S++ S+FF AM GIM+
Sbjct  174  ARFVFLMTFNLLGNLMLSKDLFGPDSEEGSEFFVAMEGIME  214



>ref|XP_004303043.1| PREDICTED: cytochrome P450 76A2-like [Fragaria vesca subsp. vesca]
Length=512

 Score =   234 bits (598),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 116/219 (53%), Positives = 157/219 (72%), Gaps = 9/219 (4%)
 Frame = +1

Query  181  WKYLVWSAIFLIPGLVFLLARKKSSSSYRlppgppgl--pVIGNMLDLGAFPHQTIAEMK  354
            W +LV+    +IP L+FLL R +S+S       P     P++GNMLDLGA PH+T+ E++
Sbjct  6    WNFLVY---VVIPSLLFLLIRWRSNSGGEQAFPPGPPGWPILGNMLDLGAMPHKTLTELR  62

Query  355  NKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPY  534
            +++GSV+WLR+G  +TM I SAKAA E FKNHD++F +R +    +V  Y+ GSLA APY
Sbjct  63   HRFGSVLWLRLGVRNTMVIQSAKAATEFFKNHDLTFVERNINIGARVHDYHKGSLALAPY  122

Query  535  GSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEASSVQRG----TGVHVAH  702
            G+ WRVLRR+ TV++  +KRINET  +RRKC+++M  WIE+EA+ ++       GVHVA 
Sbjct  123  GTQWRVLRRLVTVDMLTNKRINETASIRRKCVENMQKWIEEEATKLEENGSSSEGVHVAR  182

Query  703  FVFLSTFNLLGNLFLSRDLVDPMSDKASKFFDAMTGIMQ  819
            FVFL TFNLLGNL LSRDLVDP S +  +FFDAM G+M+
Sbjct  183  FVFLMTFNLLGNLMLSRDLVDPNSKEGLEFFDAMRGLME  221



>ref|XP_007027589.1| Cytochrome P450 76A2 [Theobroma cacao]
 gb|EOY08091.1| Cytochrome P450 76A2 [Theobroma cacao]
Length=598

 Score =   236 bits (603),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 125/220 (57%), Positives = 163/220 (74%), Gaps = 4/220 (2%)
 Frame = +1

Query  169  MEWEWKYLVWSAIFLIPGLVFLLARKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAE  348
            M+W   +LV   IF    ++FL  R+++S+  +LPPGPPG P+IGNM DLG  PH+T+  
Sbjct  90   MDWPTSFLVCLVIF-SSSVLFLFFRRRNSNPGKLPPGPPGWPIIGNMFDLGTMPHRTLTC  148

Query  349  MKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFA  528
            +++KYG VIWLR+G+V+TM +LS KAA ELFKNHD+SFA+R + ++M+   Y+  SLA A
Sbjct  149  LRDKYGPVIWLRLGTVNTMVLLSTKAATELFKNHDLSFAERNITEIMRAHDYHKSSLALA  208

Query  529  PYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEASSVQRGT---GVHVA  699
            PYGSYWRVLRR+ TV++ V+KRINET  +RRKC+DDMLLWIE EA   Q  +   G+HVA
Sbjct  209  PYGSYWRVLRRLVTVDMLVNKRINETTCIRRKCVDDMLLWIEDEARKKQGDSHRDGIHVA  268

Query  700  HFVFLSTFNLLGNLFLSRDLVDPMSDKASKFFDAMTGIMQ  819
             FVFL TFNLLGNL LSRDL DP S + S+ F  M  +M+
Sbjct  269  RFVFLLTFNLLGNLMLSRDLFDPDSKEGSELFMVMLRLME  308



>ref|XP_010037101.1| PREDICTED: cytochrome P450 76A1-like [Eucalyptus grandis]
Length=510

 Score =   233 bits (595),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 115/212 (54%), Positives = 156/212 (74%), Gaps = 2/212 (1%)
 Frame = +1

Query  190  LVWSAIFLIPGLVFLLARKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAEMKNKYGS  369
            LV   I  +   +F+    K S S+RLPPGP   P+ GN+ +LG  PH+T+A ++ KYG 
Sbjct  9    LVLICILFVSTTLFVSFCHKRSRSHRLPPGPSRWPIFGNLFNLGKMPHRTLAGLREKYGP  68

Query  370  VIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPYGSYWR  549
            VIWLR+GS+ TM ILS++ AAE FKNHD++F +RT+ D+M+ Q Y  GS+A APYG+YWR
Sbjct  69   VIWLRLGSIDTMVILSSRVAAEFFKNHDLNFVERTITDLMQSQEYCKGSIALAPYGTYWR  128

Query  550  VLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEASS--VQRGTGVHVAHFVFLSTF  723
            V RR+ T ++ V +R+NET P++RKC+DDML WI + AS+  V+ G GVH+A FVFL  F
Sbjct  129  VSRRLLTADMLVARRLNETAPIQRKCVDDMLTWIGEAASTDKVRLGEGVHLARFVFLMAF  188

Query  724  NLLGNLFLSRDLVDPMSDKASKFFDAMTGIMQ  819
            NLLGNL LSRDL+DP S   S+FF+AM+G+M+
Sbjct  189  NLLGNLMLSRDLLDPDSKVGSEFFEAMSGLME  220



>ref|XP_010037099.1| PREDICTED: cytochrome P450 76A1-like [Eucalyptus grandis]
Length=510

 Score =   233 bits (594),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 115/212 (54%), Positives = 156/212 (74%), Gaps = 2/212 (1%)
 Frame = +1

Query  190  LVWSAIFLIPGLVFLLARKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAEMKNKYGS  369
            LV   I  +   +F+    K S S+RLPPGP   P+ GN+ +LG  PH+T+A ++ KYG 
Sbjct  9    LVLICILFVSTTLFVSFCHKRSRSHRLPPGPSRWPIFGNLFNLGKMPHRTLAGLREKYGP  68

Query  370  VIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPYGSYWR  549
            VIWLR+GS+ TM ILS++ AAE FKNHD++F +RT+ D+M+ Q Y  GS+A APYG+YWR
Sbjct  69   VIWLRLGSIDTMVILSSRVAAEFFKNHDLNFVERTITDLMQSQEYCKGSIALAPYGTYWR  128

Query  550  VLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEASS--VQRGTGVHVAHFVFLSTF  723
            V RR+ T ++ V +R+NET P++RKC+DDML WI + AS+  V+ G GVH+A FVFL  F
Sbjct  129  VSRRLLTADMLVARRLNETAPIQRKCVDDMLTWIGEAASTDKVRLGEGVHLARFVFLMAF  188

Query  724  NLLGNLFLSRDLVDPMSDKASKFFDAMTGIMQ  819
            NLLGNL LSRDL+DP S   S+FF+AM+G+M+
Sbjct  189  NLLGNLMLSRDLLDPDSKVGSEFFEAMSGLME  220



>ref|XP_004249632.1| PREDICTED: cytochrome P450 76A2-like [Solanum lycopersicum]
Length=507

 Score =   233 bits (594),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 123/219 (56%), Positives = 165/219 (75%), Gaps = 5/219 (2%)
 Frame = +1

Query  169  MEWEWKYLVWSAI-FLIPGLVFLLARKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIA  345
            MEW W Y+ +S I  L P L F       +   +LPPGP G PV G+ML+LG  PH+T+ 
Sbjct  1    MEWIWGYIFFSIITVLFPFLHFRWRTLLYNVRQQLPPGPRGWPVFGSMLELGNEPHKTLM  60

Query  346  EMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAF  525
            ++K KYG V+WL++GS++TM ILSAKAA E F+NHD++FA+R+V +VMK  GY  GSLA 
Sbjct  61   DLKQKYGPVVWLKLGSINTMVILSAKAAGEFFRNHDMAFAERSVTEVMKSHGYDKGSLAL  120

Query  526  APYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIE-KEASSVQRGTGVHVAH  702
            APYG+YWR+++RI TV++ V+KRI ETV VRRKCIDD++ WIE +E SS +   G+HVA 
Sbjct  121  APYGTYWRIMKRIMTVQMLVNKRITETVEVRRKCIDDLIEWIENREFSSSE---GIHVAK  177

Query  703  FVFLSTFNLLGNLFLSRDLVDPMSDKASKFFDAMTGIMQ  819
            FVFL++FN+LG L LSR+LVDP S+K ++FF AM G+M+
Sbjct  178  FVFLASFNMLGKLVLSRELVDPKSEKGTEFFAAMVGLME  216



>ref|XP_003520677.1| PREDICTED: cytochrome P450 76A2-like [Glycine max]
Length=516

 Score =   231 bits (590),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 112/192 (58%), Positives = 149/192 (78%), Gaps = 0/192 (0%)
 Frame = +1

Query  244  KKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAK  423
            K SSS++RLPPGPPG PV GNM  LG  PH+T+  +++K+G V+WL+IG+++TMAILSA+
Sbjct  32   KTSSSNHRLPPGPPGWPVFGNMFQLGDMPHRTLTNLRDKFGPVVWLKIGAMNTMAILSAE  91

Query  424  AAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINE  603
            AA   FK+HD +FADRT+ ++M+V  Y   SLA APYG YWR++RR+ TV++ V KRIN+
Sbjct  92   AATVFFKHHDHAFADRTITEIMRVHNYDKSSLALAPYGPYWRLMRRLVTVDMLVSKRIND  151

Query  604  TVPVRRKCIDDMLLWIEKEASSVQRGTGVHVAHFVFLSTFNLLGNLFLSRDLVDPMSDKA  783
            T  +RRKC++DM+ W+ KEAS  + G GVHV+ FVFL TFNL GNL LSRDL DP S+  
Sbjct  152  TASIRRKCVNDMINWVAKEASKSEHGRGVHVSRFVFLMTFNLFGNLMLSRDLFDPESEDG  211

Query  784  SKFFDAMTGIMQ  819
            S+FF AM G+M+
Sbjct  212  SEFFSAMMGLME  223



>ref|XP_010057042.1| PREDICTED: cytochrome P450 76A2-like [Eucalyptus grandis]
Length=511

 Score =   231 bits (589),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 119/213 (56%), Positives = 156/213 (73%), Gaps = 3/213 (1%)
 Frame = +1

Query  187  YLVWSAIFLIPGLVFLLARKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAEMKNKYG  366
            +++ S +FL   L F L RKKS S + LPPGP G P+ GN+  LG  PH+T+A ++ KYG
Sbjct  9    FILISIVFLSTALFFSLRRKKSGS-WVLPPGPSGWPIFGNIFSLGTMPHRTVAGLREKYG  67

Query  367  SVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPYGSYW  546
              IWLR+GS+ TM ILS++ AAE FKN D++FADRTVIDV++ + Y+ GS+A APYG+YW
Sbjct  68   PTIWLRLGSIDTMVILSSRVAAEFFKNQDLNFADRTVIDVLRCRDYHEGSVAVAPYGTYW  127

Query  547  RVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEASS--VQRGTGVHVAHFVFLST  720
            RV+RR+ T ++ V KR+NET  VRRKC+++ML WI + ASS   Q G G+H+A FVFL  
Sbjct  128  RVMRRLLTTDMLVAKRLNETALVRRKCVENMLAWIGEAASSDKAQVGEGIHLARFVFLMN  187

Query  721  FNLLGNLFLSRDLVDPMSDKASKFFDAMTGIMQ  819
            FNLL NL LSRDL DP S   S+FF AM G+M+
Sbjct  188  FNLLANLMLSRDLFDPDSKTGSEFFTAMNGLME  220



>gb|EYU29599.1| hypothetical protein MIMGU_mgv1a026574mg [Erythranthe guttata]
Length=500

 Score =   230 bits (586),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 117/217 (54%), Positives = 158/217 (73%), Gaps = 4/217 (2%)
 Frame = +1

Query  169  MEWEWKYLVWSAIFLIPGLVFLLARKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAE  348
            M+W W   +   I L+     L  R+ S++   LPPGP G PV GNM  LG+ PH+TIA 
Sbjct  1    MDWLWSTFLVCCISLV---AVLYHRRYSTTRANLPPGPRGWPVFGNMFQLGSMPHKTIAG  57

Query  349  MKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFA  528
            +K+ YG V+WLRIGS++TMA+L+A AAAELFKNHD SFA+RT+ DVM    ++  +L+ +
Sbjct  58   LKSHYGPVVWLRIGSINTMALLTAGAAAELFKNHDASFAERTITDVMTSHNFHKAALSLS  117

Query  529  PYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEASSVQRGTGVHVAHFV  708
            PYG YWR ++R+ TVE+ VHKRI ET P+RR+C+ +M+ WI+ E+SS   G GVHVA FV
Sbjct  118  PYGPYWRSMKRMMTVEMLVHKRIVETEPIRRRCVSNMVQWIQNESSS-SGGHGVHVARFV  176

Query  709  FLSTFNLLGNLFLSRDLVDPMSDKASKFFDAMTGIMQ  819
            FL++FN+LGNL LSRDLV P S++ S+FF AM  +M+
Sbjct  177  FLASFNMLGNLMLSRDLVSPESEEGSEFFAAMIDMME  213



>ref|XP_002277661.2| PREDICTED: cytochrome P450 76A1-like [Vitis vinifera]
Length=518

 Score =   230 bits (587),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 122/217 (56%), Positives = 162/217 (75%), Gaps = 2/217 (1%)
 Frame = +1

Query  172  EWEWKYLVWSAIFLIPGLVFLLARKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAEM  351
            +W    L+W  I +IP ++FLL R++ S S RLPPGPPG PV GNM DLGA PH+T+A +
Sbjct  13   DWASNILLWCIILVIP-VLFLLLRRRRSGSVRLPPGPPGWPVFGNMFDLGAMPHETLAGL  71

Query  352  KNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAP  531
            ++KYG V+WL +G++ T  + S+KAAAELFKN D+ F+DRT+ + M+ QGY+  SLA AP
Sbjct  72   RHKYGDVVWLNLGAIKTTVVQSSKAAAELFKNKDLCFSDRTITETMRAQGYHESSLALAP  131

Query  532  YGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEASSV-QRGTGVHVAHFV  708
            YG +WR LRR+ T+E+ V KRINET  VRRKC+DDML WIE+EA  V   G G+ VAHFV
Sbjct  132  YGPHWRSLRRLMTMEMLVTKRINETAGVRRKCVDDMLSWIEEEARGVGGEGRGIQVAHFV  191

Query  709  FLSTFNLLGNLFLSRDLVDPMSDKASKFFDAMTGIMQ  819
            FL++FN+LGNL LS DL+ P S + S+FF+ M  +M+
Sbjct  192  FLASFNMLGNLMLSCDLLHPGSKEGSEFFEVMVRVME  228



>gb|KHN18720.1| Cytochrome P450 76A2 [Glycine soja]
Length=516

 Score =   230 bits (586),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 111/192 (58%), Positives = 148/192 (77%), Gaps = 0/192 (0%)
 Frame = +1

Query  244  KKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAK  423
            K SSS++RLPPGPPG PV GNM  LG  PH+T+  +++K+G V+WL+IG+++TMAI SA+
Sbjct  32   KTSSSNHRLPPGPPGWPVFGNMFQLGDMPHRTLTNLRDKFGPVVWLKIGAMNTMAIFSAE  91

Query  424  AAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINE  603
            AA   FK+HD +FADRT+ ++M+V  Y   SLA APYG YWR++RR+ TV++ V KRIN+
Sbjct  92   AATVFFKHHDHAFADRTITEIMRVHNYDKSSLALAPYGPYWRLMRRLVTVDMLVSKRIND  151

Query  604  TVPVRRKCIDDMLLWIEKEASSVQRGTGVHVAHFVFLSTFNLLGNLFLSRDLVDPMSDKA  783
            T  +RRKC++DM+ W+ KEAS  + G GVHV+ FVFL TFNL GNL LSRDL DP S+  
Sbjct  152  TASIRRKCVNDMINWVAKEASKSEHGRGVHVSRFVFLMTFNLFGNLMLSRDLFDPESEDG  211

Query  784  SKFFDAMTGIMQ  819
            S+FF AM G+M+
Sbjct  212  SEFFSAMMGLME  223



>ref|XP_010036736.1| PREDICTED: cytochrome P450 76A1-like [Eucalyptus grandis]
 gb|KCW48374.1| hypothetical protein EUGRSUZ_K02083 [Eucalyptus grandis]
Length=510

 Score =   229 bits (585),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 117/195 (60%), Positives = 148/195 (76%), Gaps = 2/195 (1%)
 Frame = +1

Query  241  RKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSA  420
            R K S S RLPPGPPG P+ GNM +LG  PH+T+A ++ KYG VIWLR+GS+ TM ILS+
Sbjct  26   RWKKSRSCRLPPGPPGWPIFGNMFNLGMMPHRTLAGLRQKYGPVIWLRLGSIDTMVILSS  85

Query  421  KAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRIN  600
            + A E FKN D++FA+RTV D+M+   Y+ GS+A APYGSYWR+ RR+ TV++ V KR+N
Sbjct  86   RVATEFFKNQDLNFAERTVTDLMRSHDYHEGSVALAPYGSYWRMSRRLLTVDMLVAKRLN  145

Query  601  ETVPVRRKCIDDMLLWIEKEASS--VQRGTGVHVAHFVFLSTFNLLGNLFLSRDLVDPMS  774
            ET P+RRKCID ML WI + AS+  V+ G G+H+A FVFL+TFNLLGNL LSRDL DP S
Sbjct  146  ETAPIRRKCIDKMLTWIGEAASAEKVRLGEGIHLARFVFLTTFNLLGNLMLSRDLFDPDS  205

Query  775  DKASKFFDAMTGIMQ  819
               S FF AM G+M+
Sbjct  206  KVGSDFFVAMAGLME  220



>gb|KDP27487.1| hypothetical protein JCGZ_20022 [Jatropha curcas]
Length=505

 Score =   229 bits (583),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 117/199 (59%), Positives = 150/199 (75%), Gaps = 4/199 (2%)
 Frame = +1

Query  223  LVFLLARKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVST  402
            L FL   +K+   +R PPGPPG P++GN+LDLG  PH+T+ +++ KYG VI LR+GSV+T
Sbjct  20   LFFLFGSRKN---HRFPPGPPGWPILGNLLDLGTMPHRTLTKLREKYGGVIGLRLGSVNT  76

Query  403  MAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELF  582
            M ILSAK A+ELFK HD+SFA+R + + M+  GY  GSLA APYGSYWRVLRR+ TV++ 
Sbjct  77   MVILSAKPASELFKYHDLSFAERNITETMRSHGYNEGSLAIAPYGSYWRVLRRLVTVDML  136

Query  583  VHKRINETVPVRRKCIDDMLLWIEKEASSVQRGTGVHVAHFVFLSTFNLLGNLFLSRDLV  762
            V+KRINET  +RRKC+DDML WI KE +      G+H+A FVFL TFN LGNL  S+DLV
Sbjct  137  VNKRINETASIRRKCVDDMLRWI-KEETYEANDHGIHLARFVFLMTFNSLGNLMFSKDLV  195

Query  763  DPMSDKASKFFDAMTGIMQ  819
            DP S + S+FF AM G+M+
Sbjct  196  DPESKEGSEFFTAMMGLME  214



>ref|XP_012084532.1| PREDICTED: cytochrome P450 76A1-like [Jatropha curcas]
Length=524

 Score =   228 bits (582),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 117/199 (59%), Positives = 150/199 (75%), Gaps = 4/199 (2%)
 Frame = +1

Query  223  LVFLLARKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVST  402
            L FL   +K+   +R PPGPPG P++GN+LDLG  PH+T+ +++ KYG VI LR+GSV+T
Sbjct  39   LFFLFGSRKN---HRFPPGPPGWPILGNLLDLGTMPHRTLTKLREKYGGVIGLRLGSVNT  95

Query  403  MAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELF  582
            M ILSAK A+ELFK HD+SFA+R + + M+  GY  GSLA APYGSYWRVLRR+ TV++ 
Sbjct  96   MVILSAKPASELFKYHDLSFAERNITETMRSHGYNEGSLAIAPYGSYWRVLRRLVTVDML  155

Query  583  VHKRINETVPVRRKCIDDMLLWIEKEASSVQRGTGVHVAHFVFLSTFNLLGNLFLSRDLV  762
            V+KRINET  +RRKC+DDML WI KE +      G+H+A FVFL TFN LGNL  S+DLV
Sbjct  156  VNKRINETASIRRKCVDDMLRWI-KEETYEANDHGIHLARFVFLMTFNSLGNLMFSKDLV  214

Query  763  DPMSDKASKFFDAMTGIMQ  819
            DP S + S+FF AM G+M+
Sbjct  215  DPESKEGSEFFTAMMGLME  233



>gb|KCW48743.1| hypothetical protein EUGRSUZ_K02382 [Eucalyptus grandis]
Length=488

 Score =   228 bits (580),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 109/191 (57%), Positives = 146/191 (76%), Gaps = 2/191 (1%)
 Frame = +1

Query  253  SSSYRlppgppglpVIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAA  432
            S S+RLPPGP   P+ GN+ +LG  P +T+A ++ KYG VIWLR+GS+ TM  LS++ AA
Sbjct  31   SRSHRLPPGPSRWPIFGNLFNLGKMPRRTLAGLREKYGPVIWLRLGSIDTMVTLSSRVAA  90

Query  433  ELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVP  612
            E FKNHD++F +RT+ D+M+ Q YY GS+A APYG+YWRV RR+ T  + V +R+NET P
Sbjct  91   EFFKNHDLNFVERTITDLMQSQEYYKGSIALAPYGTYWRVSRRLLTAGILVARRLNETAP  150

Query  613  VRRKCIDDMLLWIEKEASS--VQRGTGVHVAHFVFLSTFNLLGNLFLSRDLVDPMSDKAS  786
            ++RKC+DDML WI + AS+  V+ G GVH+A FVFL  FNLLGNL LSRDL+DP S   S
Sbjct  151  IQRKCVDDMLTWIGEAASTDKVRLGEGVHLARFVFLMAFNLLGNLMLSRDLLDPDSKVGS  210

Query  787  KFFDAMTGIMQ  819
            +FF+AM+G+M+
Sbjct  211  EFFEAMSGLME  221



>ref|XP_010056841.1| PREDICTED: cytochrome P450 76A1-like [Eucalyptus grandis]
 gb|KCW73724.1| hypothetical protein EUGRSUZ_E02332 [Eucalyptus grandis]
Length=511

 Score =   227 bits (578),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 114/213 (54%), Positives = 154/213 (72%), Gaps = 3/213 (1%)
 Frame = +1

Query  187  YLVWSAIFLIPGLVFLLARKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAEMKNKYG  366
            +++ S +F+   L   L RKKS S   LP GP G P+ GN+  LG  PH+T+A ++ KYG
Sbjct  9    FVLISIVFVSTALFVSLCRKKSGSRV-LPRGPSGWPIFGNIFSLGTMPHRTLAGLREKYG  67

Query  367  SVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPYGSYW  546
             +IWLR+GS+ TM ILS++ AAE FKN D++FADRTVIDV++ + Y+ GS+A APYG+YW
Sbjct  68   PMIWLRLGSIDTMVILSSRVAAEFFKNQDLNFADRTVIDVLRCRDYHEGSVAVAPYGTYW  127

Query  547  RVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEASS--VQRGTGVHVAHFVFLST  720
            RV+RR+ T ++ V KR+NE  P+RRKC+++ML WI + ASS   + G G+H+A FVFL  
Sbjct  128  RVMRRLLTTDMLVTKRLNEMAPIRRKCVENMLAWIGEAASSDKARVGEGIHLARFVFLMN  187

Query  721  FNLLGNLFLSRDLVDPMSDKASKFFDAMTGIMQ  819
            FNLL NL LSRDL DP S   S+FF AM G+M+
Sbjct  188  FNLLANLMLSRDLFDPDSKTGSEFFTAMNGLME  220



>ref|XP_002277746.1| PREDICTED: cytochrome P450 76A1 [Vitis vinifera]
Length=509

 Score =   224 bits (571),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 117/213 (55%), Positives = 154/213 (72%), Gaps = 1/213 (0%)
 Frame = +1

Query  169  MEWEWKYLVWSAIFLIPGLVFLLARKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAE  348
            MEW   +LVW  I  +  L+ LL R KS  +  LPPGPPG P+ GN+ DLG  PHQ +A 
Sbjct  1    MEWTTNFLVWLIIPFLSALLLLLHRLKSGFNKHLPPGPPGWPIFGNIFDLGTLPHQKLAG  60

Query  349  MKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFA  528
            +++ YG V+WL +G + TM + S+KAAAELFKNHD+SF+DR++ + M+V  Y   SL+ A
Sbjct  61   LRDTYGDVVWLNLGYIGTMVVQSSKAAAELFKNHDLSFSDRSIHETMRVHQYNESSLSLA  120

Query  529  PYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEASSVQ-RGTGVHVAHF  705
            PYG YWR LRR+ TV++   KRINETVP+RRKC+DD+LLWIE+EA  +    TG+ +  F
Sbjct  121  PYGPYWRSLRRLVTVDMLTMKRINETVPIRRKCVDDLLLWIEEEARGMDGTATGLELGRF  180

Query  706  VFLSTFNLLGNLFLSRDLVDPMSDKASKFFDAM  804
             FL+TFN++GNL LSRDL+DP S K S+FF AM
Sbjct  181  FFLATFNMIGNLMLSRDLLDPQSRKGSEFFTAM  213



>ref|XP_009786696.1| PREDICTED: cytochrome P450 76A1-like [Nicotiana sylvestris]
Length=508

 Score =   224 bits (570),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 129/221 (58%), Positives = 172/221 (78%), Gaps = 4/221 (2%)
 Frame = +1

Query  169  MEWEWKYLVWSAIFLIPGLVFLLARKKSSS-SYRlppgppglpVIGNMLDL-GAFPHQTI  342
            ME EW Y+ WS I L+P L+ L+ +KKSSS + +LPPGPPGLP+ GNM DL G+ P++  
Sbjct  1    MELEWSYIFWSIIILLPALILLITKKKSSSSNIKLPPGPPGLPIFGNMFDLAGSEPYKKA  60

Query  343  AEMKNKYGSVIWLRIG-SVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSL  519
            A +K KYG ++WL+IG S++T+ + +A+AAAELFKNHDV+FADR ++DV      +  S+
Sbjct  61   ANLKQKYGPIVWLKIGPSMNTIIVQTAQAAAELFKNHDVTFADRYIVDVNLAHNNHQASM  120

Query  520  AFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEASSVQRG-TGVHV  696
            A APYG+YWR+LRRICTVE+FV+KRINETV +RRK +D ML WIEK+A+ V    +G+ V
Sbjct  121  ALAPYGNYWRMLRRICTVEMFVNKRINETVQIRRKSMDKMLQWIEKQANLVNTNRSGIEV  180

Query  697  AHFVFLSTFNLLGNLFLSRDLVDPMSDKASKFFDAMTGIMQ  819
              +VFL++FN+LGNL LS+DL DP S+K S+FF AMTGIMQ
Sbjct  181  TRYVFLASFNMLGNLILSKDLADPESEKGSEFFKAMTGIMQ  221



>ref|XP_004494132.1| PREDICTED: cytochrome P450 76A2-like [Cicer arietinum]
Length=511

 Score =   221 bits (562),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 111/206 (54%), Positives = 153/206 (74%), Gaps = 5/206 (2%)
 Frame = +1

Query  217  PGLVFLLARKK---SSSSYRlppgppglpVIGNMLDLGAFPHQTIAEMKNKYGSVIWLRI  387
            P  +FLL R++   ++ + RLPPGPPG P+ GNM  LG  PH+T+  ++ KYG ++WL+I
Sbjct  16   PVFLFLLNRRRKISATKNRRLPPGPPGWPIFGNMFQLGEMPHRTLTNLREKYGPILWLKI  75

Query  388  GSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPYGSYWRVLRRIC  567
            G+V+TMAILSAK A   FKNHD +F+DRTVI+ M+V  Y   SLA APYGSYWR++RR+ 
Sbjct  76   GAVNTMAILSAKEATIFFKNHDHAFSDRTVIETMRVHNYDKSSLALAPYGSYWRLMRRLV  135

Query  568  TVELFVHKRINETVPVRRKCIDDMLLWIEKEASS--VQRGTGVHVAHFVFLSTFNLLGNL  741
            TV++ V KRIN+TV +RRKC++DML W+ KEA +  ++ G G+HVA F+F  +FN+ GNL
Sbjct  136  TVDMLVLKRINDTVSIRRKCVNDMLAWVAKEARARELEDGRGLHVARFIFFMSFNMFGNL  195

Query  742  FLSRDLVDPMSDKASKFFDAMTGIMQ  819
             LSRDL D  S+  S+FF A+ G+M+
Sbjct  196  MLSRDLFDMESENGSEFFAAVMGMME  221



>ref|XP_010057043.1| PREDICTED: cytochrome P450 76A1-like [Eucalyptus grandis]
Length=511

 Score =   221 bits (562),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 112/213 (53%), Positives = 151/213 (71%), Gaps = 3/213 (1%)
 Frame = +1

Query  187  YLVWSAIFLIPGLVFLLARKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAEMKNKYG  366
            +++ S +F+   L   L RKKS S   L PGP G P+ GN+  LG  PH+ +A +  KYG
Sbjct  9    FVLISIVFVSTALFVSLCRKKSGSRV-LRPGPSGWPIFGNIFSLGTMPHRMLAGLSEKYG  67

Query  367  SVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPYGSYW  546
             +IWLR+GS+ TM ILS++ AAE FKN D++FADRTVIDV++ + Y+ GS+A APYG+YW
Sbjct  68   PMIWLRLGSIDTMVILSSRVAAEFFKNQDLNFADRTVIDVLRCRDYHEGSVAVAPYGTYW  127

Query  547  RVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEASS--VQRGTGVHVAHFVFLST  720
            RV+RR+ T ++ V KR+ ET P+RRKC+++ML WI + A S   + G G+H+A  VFL  
Sbjct  128  RVMRRLLTTDMLVAKRLKETAPIRRKCVENMLAWIGEAAPSDKARVGEGIHLARIVFLMN  187

Query  721  FNLLGNLFLSRDLVDPMSDKASKFFDAMTGIMQ  819
            FNLLGNL LSRDL DP S   S+FF AM G+M+
Sbjct  188  FNLLGNLMLSRDLFDPDSKVGSEFFTAMNGLME  220



>gb|KCW48764.1| hypothetical protein EUGRSUZ_K02408, partial [Eucalyptus grandis]
Length=443

 Score =   219 bits (557),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 97/166 (58%), Positives = 131/166 (79%), Gaps = 2/166 (1%)
 Frame = +1

Query  328  PHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYY  507
            PH+T+A ++ KYG VIWLR+GS+ TM ILS++ AAE FKNHD++F +RT+ D+M+ Q Y 
Sbjct  2    PHRTLAGLREKYGPVIWLRLGSIDTMVILSSRVAAEFFKNHDLNFVERTITDLMQSQEYC  61

Query  508  MGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEASS--VQRG  681
             GS+A APYG+YWRV RR+ T ++ V +R+NET P++RKC+DDML WI + AS+  V+ G
Sbjct  62   KGSIALAPYGTYWRVSRRLLTADMLVARRLNETAPIQRKCVDDMLTWIGEAASTDKVRLG  121

Query  682  TGVHVAHFVFLSTFNLLGNLFLSRDLVDPMSDKASKFFDAMTGIMQ  819
             GVH+A FVFL  FNLLGNL LSRDL+DP S   S+FF+AM+G+M+
Sbjct  122  EGVHLARFVFLMAFNLLGNLMLSRDLLDPDSKVGSEFFEAMSGLME  167



>ref|XP_007162842.1| hypothetical protein PHAVU_001G185500g [Phaseolus vulgaris]
 gb|ESW34836.1| hypothetical protein PHAVU_001G185500g [Phaseolus vulgaris]
Length=515

 Score =   220 bits (560),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 106/193 (55%), Positives = 145/193 (75%), Gaps = 0/193 (0%)
 Frame = +1

Query  241  RKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSA  420
            RK ++ + RLPPGPPG P+ GN+  LG  PH+T+A+++ K+G V+WL+IG++ TM ILSA
Sbjct  26   RKTAARNRRLPPGPPGWPIFGNLFQLGDMPHRTLADLRAKHGPVVWLQIGAMKTMVILSA  85

Query  421  KAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRIN  600
             AA+  FK+HD +FADRT+ + M+   Y   SLA APYG YWR++RR+ TV++ V KRIN
Sbjct  86   DAASVFFKHHDHAFADRTITETMRAHNYNKSSLALAPYGPYWRLMRRLVTVDMLVAKRIN  145

Query  601  ETVPVRRKCIDDMLLWIEKEASSVQRGTGVHVAHFVFLSTFNLLGNLFLSRDLVDPMSDK  780
            ET  VRRKC++DM+ W+ KEA  ++ G GV+VA FVFL +FNL GNL LSRDL DP S+ 
Sbjct  146  ETASVRRKCVNDMITWLSKEAGKLEEGDGVYVARFVFLMSFNLFGNLMLSRDLFDPESET  205

Query  781  ASKFFDAMTGIMQ  819
             S+FF AM G+++
Sbjct  206  GSEFFAAMAGLLE  218



>gb|KEH24104.1| cytochrome P450 family protein [Medicago truncatula]
Length=519

 Score =   219 bits (559),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 110/203 (54%), Positives = 148/203 (73%), Gaps = 2/203 (1%)
 Frame = +1

Query  217  PGLVFLLAR--KKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIG  390
            P  +FLL R  K S++  RLPPGPPG P+ GNM  LG  PH+T+  ++ KYG V+WL+IG
Sbjct  27   PVFLFLLIRRAKISATKRRLPPGPPGWPIFGNMFQLGEMPHRTLTNLRQKYGPVLWLKIG  86

Query  391  SVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPYGSYWRVLRRICT  570
            +V+TMAILSAK A   FKNHD +F+DRTVI+ M+   Y   SLA APYG YWR++RR+ T
Sbjct  87   AVNTMAILSAKEATIFFKNHDHNFSDRTVIETMRAHNYDKSSLALAPYGPYWRLMRRLVT  146

Query  571  VELFVHKRINETVPVRRKCIDDMLLWIEKEASSVQRGTGVHVAHFVFLSTFNLLGNLFLS  750
            V++ V KRIN+T  +RR+C++DML WI KEA  ++ G G+HV+ FVF  +FNL GNL LS
Sbjct  147  VDMLVMKRINDTASIRRRCVNDMLTWIAKEARELEAGRGLHVSRFVFFMSFNLFGNLMLS  206

Query  751  RDLVDPMSDKASKFFDAMTGIMQ  819
            RD+ D  S+  S+FF A+ G+++
Sbjct  207  RDMFDMKSESGSEFFTAVMGLLE  229



>emb|CBI30225.3| unnamed protein product [Vitis vinifera]
Length=1065

 Score =   225 bits (573),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 117/214 (55%), Positives = 155/214 (72%), Gaps = 1/214 (0%)
 Frame = +1

Query  166  EMEWEWKYLVWSAIFLIPGLVFLLARKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIA  345
            +MEW   +LVW  I  +  L+ LL R KS  +  LPPGPPG P+ GN+ DLG  PHQ +A
Sbjct  530  QMEWTTNFLVWLIIPFLSALLLLLHRLKSGFNKHLPPGPPGWPIFGNIFDLGTLPHQKLA  589

Query  346  EMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAF  525
             +++ YG V+WL +G + TM + S+KAAAELFKNHD+SF+DR++ + M+V  Y   SL+ 
Sbjct  590  GLRDTYGDVVWLNLGYIGTMVVQSSKAAAELFKNHDLSFSDRSIHETMRVHQYNESSLSL  649

Query  526  APYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEASSVQ-RGTGVHVAH  702
            APYG YWR LRR+ TV++   KRINETVP+RRKC+DD+LLWIE+EA  +    TG+ +  
Sbjct  650  APYGPYWRSLRRLVTVDMLTMKRINETVPIRRKCVDDLLLWIEEEARGMDGTATGLELGR  709

Query  703  FVFLSTFNLLGNLFLSRDLVDPMSDKASKFFDAM  804
            F FL+TFN++GNL LSRDL+DP S K S+FF AM
Sbjct  710  FFFLATFNMIGNLMLSRDLLDPQSRKGSEFFTAM  743


 Score =   142 bits (359),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 73/176 (41%), Positives = 109/176 (62%), Gaps = 4/176 (2%)
 Frame = +1

Query  295  VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT  474
            V+GN+  LG  PH + A++  K+G ++ L +GS+ST+ I S + A E+FKNHDV  A R 
Sbjct  62   VVGNIFQLGWAPHVSFAKLAGKHGPIMTLWLGSMSTVVISSNEVAREMFKNHDVVLAGRK  121

Query  475  VIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIE  654
            + + MK      GS+  A YG  WR+LRR+CT E FV  R++    VR  CID M+ ++ 
Sbjct  122  IYEAMKGDRGNEGSIITAQYGPQWRMLRRLCTSEFFVTSRLDAMRGVRGGCIDRMVQFVT  181

Query  655  KEASSVQRGT-GVHVAHFVFLSTFNLLGNLFLSRDLVDPMSDKASKFFDAMTGIMQ  819
            +  +S   GT  + V  F+FL  FNL+GNL  S+DL+DP S++ ++FF     +M+
Sbjct  182  EAGTS---GTHAIDVGRFIFLMAFNLIGNLMFSKDLLDPKSERGAEFFYHAGKVME  234



>gb|KCW74002.1| hypothetical protein EUGRSUZ_E02619, partial [Eucalyptus grandis]
Length=482

 Score =   218 bits (554),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 97/177 (55%), Positives = 131/177 (74%), Gaps = 2/177 (1%)
 Frame = +1

Query  295  VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT  474
            + GN+  LG  PH+ +A +  KYG +IWLR+GS+ TM ILS++ AAE FKN D++FADRT
Sbjct  15   IFGNIFSLGTMPHRMLAGLSEKYGPMIWLRLGSIDTMVILSSRVAAEFFKNQDLNFADRT  74

Query  475  VIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIE  654
            VIDV++ + Y+ GS+A APYG+YWRV+RR+ T ++ V KR+ ET P+RRKC+++ML WI 
Sbjct  75   VIDVLRCRDYHEGSVAVAPYGTYWRVMRRLLTTDMLVAKRLKETAPIRRKCVENMLAWIG  134

Query  655  KEASS--VQRGTGVHVAHFVFLSTFNLLGNLFLSRDLVDPMSDKASKFFDAMTGIMQ  819
            + A S   + G G+H+A  VFL  FNLLGNL LSRDL DP S   S+FF AM G+M+
Sbjct  135  EAAPSDKARVGEGIHLARIVFLMNFNLLGNLMLSRDLFDPDSKVGSEFFTAMNGLME  191



>ref|XP_006341183.1| PREDICTED: cytochrome P450 76A1-like [Solanum tuberosum]
Length=513

 Score =   218 bits (556),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 121/224 (54%), Positives = 164/224 (73%), Gaps = 7/224 (3%)
 Frame = +1

Query  169  MEWEWKY--LVWSAIFLIPGLVFLLARKKSS-SSYRlppgppglpVIGNMLDL-GAFPHQ  336
            M+WE  Y  ++ S I  +   +FL+ +KKSS S + LPPGP GLP+ GNM DL G+ P++
Sbjct  1    MDWELNYFYILCSTIIFLLAFIFLIYQKKSSFSKFNLPPGPNGLPIFGNMFDLAGSEPYK  60

Query  337  TIAEMKNKYGSVIWLRIG-SVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMG  513
             IA +K+KYG ++WL+IG S++TM I +A ++ ELFKNHD  F+DR +IDV     +Y G
Sbjct  61   KIASLKDKYGPILWLKIGPSMNTMVIQTAYSSGELFKNHDAIFSDRNIIDVNLAHNFYKG  120

Query  514  SLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEASSVQRG-TGV  690
            S+A APYG+YWR  RRICTVE+FVHKRINET  VR++ ++ ML WIEK+ASS      G+
Sbjct  121  SMALAPYGNYWRFSRRICTVEMFVHKRINETTLVRQESMNKMLGWIEKKASSGGAVLEGI  180

Query  691  HVAHFVFLSTFNLLGNLFLSRDLV-DPMSDKASKFFDAMTGIMQ  819
             V  +VFL++FN+LGNL LS+DLV DP S++ S FF+AM GIM+
Sbjct  181  EVTRYVFLASFNMLGNLILSKDLVTDPESEQGSMFFNAMMGIME  224



>gb|KCW74001.1| hypothetical protein EUGRSUZ_E02618 [Eucalyptus grandis]
Length=458

 Score =   214 bits (545),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 97/166 (58%), Positives = 127/166 (77%), Gaps = 2/166 (1%)
 Frame = +1

Query  328  PHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYY  507
            PH+T+A ++ KYG  IWLR+GS+ TM ILS++ AAE FKN D++FADRTVIDV++ + Y+
Sbjct  2    PHRTVAGLREKYGPTIWLRLGSIDTMVILSSRVAAEFFKNQDLNFADRTVIDVLRCRDYH  61

Query  508  MGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEASS--VQRG  681
             GS+A APYG+YWRV+RR+ T ++ V KR+NET  VRRKC+++ML WI + ASS   Q G
Sbjct  62   EGSVAVAPYGTYWRVMRRLLTTDMLVAKRLNETALVRRKCVENMLAWIGEAASSDKAQVG  121

Query  682  TGVHVAHFVFLSTFNLLGNLFLSRDLVDPMSDKASKFFDAMTGIMQ  819
             G+H+A FVFL  FNLL NL LSRDL DP S   S+FF AM G+M+
Sbjct  122  EGIHLARFVFLMNFNLLANLMLSRDLFDPDSKTGSEFFTAMNGLME  167



>gb|AIW00679.1| flavonoid 3',5'-hydroxylase, partial [Paeonia lactiflora]
Length=503

 Score =   214 bits (545),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 109/214 (51%), Positives = 153/214 (71%), Gaps = 5/214 (2%)
 Frame = +1

Query  178  EWKYLVWSAIFLIPGLVFLLARKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAEMKN  357
            +W  LVW   FL+  LV +++++++    + PPGPPG PVIGN+ DLG  PHQ++  +++
Sbjct  5    DWTSLVWGG-FLLAALVVMVSKRENK---QRPPGPPGWPVIGNLFDLGTMPHQSLYHLRS  60

Query  358  KYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPYG  537
            KYG V+WL+ GS++TM I S KAAA+LFKNHD++F+DR    V+K   Y+ G+LAF  YG
Sbjct  61   KYGPVLWLKFGSMNTMVIQSPKAAAQLFKNHDLNFSDRKCPGVLKAHDYFQGTLAFGRYG  120

Query  538  SYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEASSVQRGTGVHVAHFVFLS  717
             YWRVLRR+C+ E+ V KRINE  P+R+KCID M+ WIEK+A   + G  V +  F+F  
Sbjct  121  PYWRVLRRLCSSEMLVTKRINEIAPLRQKCIDAMIGWIEKDAREKESGE-VKLPDFLFPM  179

Query  718  TFNLLGNLFLSRDLVDPMSDKASKFFDAMTGIMQ  819
            TFN++GNL LSRDL+D  S +   F++AM GIM+
Sbjct  180  TFNVVGNLMLSRDLLDLNSKEGHDFYNAMGGIME  213



>ref|XP_004246574.1| PREDICTED: LOW QUALITY PROTEIN: cytochrome P450 76A1-like [Solanum 
lycopersicum]
Length=512

 Score =   213 bits (543),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 117/223 (52%), Positives = 164/223 (74%), Gaps = 6/223 (3%)
 Frame = +1

Query  169  MEWEWK-YLVWSAIFLIPGLVFLLARKKSS-SSYRlppgppglpVIGNMLDL-GAFPHQT  339
            M+WE+  Y++ S I  +   +FL+ +K SS S Y LPPGP GLP+ GN  DL G+ P++ 
Sbjct  1    MDWEFNFYILCSTIIFLLAFIFLIYQKNSSFSKYNLPPGPNGLPIFGNXFDLAGSEPYKK  60

Query  340  IAEMKNKYGSVIWLRIG-SVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGS  516
            IA +K+KYG ++WL+IG S++ M I ++ +++ELFK HDV+F+DR ++DV     +Y GS
Sbjct  61   IASLKDKYGPILWLKIGPSMNIMVIQTSYSSSELFKYHDVTFSDRNIVDVNLAHNFYKGS  120

Query  517  LAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEASSVQRG-TGVH  693
            +A APYG+YWR  RRICTVE+FVHKRINET  +R+K ++ ML WIEK+ASS      G+ 
Sbjct  121  MALAPYGNYWRFSRRICTVEMFVHKRINETTLIRQKSMNRMLGWIEKKASSGGGVIEGIE  180

Query  694  VAHFVFLSTFNLLGNLFLSRDLV-DPMSDKASKFFDAMTGIMQ  819
            V  +VFL++FN+LGN+ LS+DLV DP S+K S FF+AM GIM+
Sbjct  181  VTRYVFLASFNMLGNMILSKDLVTDPESEKGSMFFNAMMGIME  223



>ref|XP_002528645.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF33748.1| cytochrome P450, putative [Ricinus communis]
Length=502

 Score =   212 bits (540),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 97/175 (55%), Positives = 136/175 (78%), Gaps = 3/175 (2%)
 Frame = +1

Query  295  VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT  474
            ++GN+LDLG+ PH T+ +++ KYG ++ LR+G+++T+ ILSAKAA+ELFKNHD++FA+R 
Sbjct  43   ILGNLLDLGSVPHSTLTDLRQKYGDILGLRLGAINTVVILSAKAASELFKNHDLTFAERF  102

Query  475  VIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIE  654
            +   M+V GY  GSLA APYGSYWRV++R+ TV++ V K+INET  VRRKC+DDML WIE
Sbjct  103  LTITMRVHGYDQGSLALAPYGSYWRVMKRLVTVDMLVSKKINETAFVRRKCMDDMLRWIE  162

Query  655  KEASSVQRGTGVHVAHFVFLSTFNLLGNLFLSRDLVDPMSDKASKFFDAMTGIMQ  819
             E+    +G G  VA FVFL + NLLGNL LS +LVDP S + ++FF ++TG+ +
Sbjct  163  GES---YKGCGSQVARFVFLMSTNLLGNLMLSCNLVDPESREGTQFFRSITGLTE  214



>ref|XP_010683910.1| PREDICTED: cytochrome P450 76A2-like [Beta vulgaris subsp. vulgaris]
Length=511

 Score =   212 bits (539),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 108/219 (49%), Positives = 152/219 (69%), Gaps = 3/219 (1%)
 Frame = +1

Query  169  MEWEWKYLVWSAIFLIPGLVFLLARKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAE  348
            MEW +   +W AIFLI   +F + +++  ++ RLPPGP GLP+IGNM DLG  PH+ +A+
Sbjct  1    MEWPFSIPLW-AIFLIFLPIFTIIQQRIRTTRRLPPGPRGLPIIGNMFDLGTMPHRALAK  59

Query  349  MKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFA  528
            +  K+G VIWLR+GS   M IL+A+ AAE FK+HD+SF DR + + M+V  Y+ GSL  A
Sbjct  60   LGTKHGPVIWLRLGSQRIMVILTAEIAAEFFKHHDLSFVDRNINETMRVLDYHKGSLILA  119

Query  529  PYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEASSVQRG--TGVHVAH  702
            PYG +WRV++++C +E+   KRI E+  VR KC+ D++ WIE  A     G    + VAH
Sbjct  120  PYGPHWRVMKKLCVIEMLTSKRIRESASVREKCVADLIKWIEDAARVDDDGEIQAIEVAH  179

Query  703  FVFLSTFNLLGNLFLSRDLVDPMSDKASKFFDAMTGIMQ  819
            FVFL+ FNLLGNL LS++L+DP S + S+F+ AM G+ Q
Sbjct  180  FVFLAEFNLLGNLLLSKNLLDPSSMRGSEFYAAMNGLTQ  218



>emb|CAN77400.1| hypothetical protein VITISV_015278 [Vitis vinifera]
Length=456

 Score =   209 bits (532),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 93/165 (56%), Positives = 126/165 (76%), Gaps = 1/165 (1%)
 Frame = +1

Query  328  PHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYY  507
            PH+T+A +++KYG V+WL +G++ T  + S+KAAAELFKN D+ F+DRT+ + M+ QGY+
Sbjct  2    PHETLAGLRHKYGDVVWLNLGAIKTTVVQSSKAAAELFKNQDLCFSDRTITETMRAQGYH  61

Query  508  MGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEASSV-QRGT  684
              SLA APYG +WR LRR+ T+E+ V KRINET  VRRKC+DDML WIE+EA  V   G 
Sbjct  62   ESSLALAPYGPHWRSLRRLMTMEMLVTKRINETAGVRRKCVDDMLSWIEEEARGVGGEGR  121

Query  685  GVHVAHFVFLSTFNLLGNLFLSRDLVDPMSDKASKFFDAMTGIMQ  819
            G+ VAHFVFL++FN+LGNL LS DL+ P S + S+FF+ M  +M+
Sbjct  122  GIQVAHFVFLASFNMLGNLMLSCDLLHPGSKEGSEFFEVMVRVME  166



>gb|AJD25180.1| cytochrome P450 CYP76A36 [Salvia miltiorrhiza]
Length=513

 Score =   206 bits (525),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 109/226 (48%), Positives = 152/226 (67%), Gaps = 13/226 (6%)
 Frame = +1

Query  169  MEWEWKYLVWSAIFLIPGLVFLLARKK--SSSSYRlppgppglpVIGNMLDLGAFPHQTI  342
            M+W W   V    FL+P +V L  R++   SS+ RLPPGP G PV GNM +LG  PH+TI
Sbjct  1    MDWIWTLCVG---FLVPFVVLLHYRRQRAGSSASRLPPGPRGWPVFGNMFELGPMPHKTI  57

Query  343  AEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLA  522
            A +  ++G V+WLRIGS+ TM + +A AAA+LFKNHD SF +RT+ +VM+  G+   +++
Sbjct  58   AGLSREHGPVVWLRIGSIDTMVVQTAAAAADLFKNHDASFVERTITEVMRAHGFDRAAVS  117

Query  523  FAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKE--------ASSVQR  678
             +P G YWR ++R+ T E+ V KRI E+  VRR+C+ DM+ WI +E        AS    
Sbjct  118  LSPPGPYWRAMKRMMTAEMLVQKRIGESEAVRRRCVGDMVEWIGREAGKGNAVRASRTCD  177

Query  679  GTGVHVAHFVFLSTFNLLGNLFLSRDLVDPMSDKASKFFDAMTGIM  816
            G GVHVA FVFL++FN+L NL LS+DLV P +++ S+FF AM  +M
Sbjct  178  GGGVHVARFVFLASFNMLANLMLSQDLVSPDAEEGSEFFAAMIELM  223



>ref|XP_002528647.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF33750.1| cytochrome P450, putative [Ricinus communis]
Length=512

 Score =   206 bits (524),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 96/177 (54%), Positives = 125/177 (71%), Gaps = 3/177 (2%)
 Frame = +1

Query  295  VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT  474
            VIGN+ DLG  PHQT+ +++ KYG V+WLR+GS +TM I SA AA ELFKNHD SF DR+
Sbjct  42   VIGNIFDLGTMPHQTLYKLRFKYGPVLWLRLGSKNTMVIQSAAAAEELFKNHDSSFCDRS  101

Query  475  VIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIE  654
             +DV+    Y  GSLA   YG +WRVLRRICT+EL  +KR+NET P+RRKCID M+ +IE
Sbjct  102  SLDVLTSHNYCKGSLAIGRYGPFWRVLRRICTMELMTNKRVNETAPLRRKCIDQMIKYIE  161

Query  655  KE---ASSVQRGTGVHVAHFVFLSTFNLLGNLFLSRDLVDPMSDKASKFFDAMTGIM  816
            +    AS+ +  T V + H +FL+ FN++GNL LSRDL+DP   +   F+ AM   M
Sbjct  162  ENVAAASAREEATEVDLVHLLFLTAFNVVGNLTLSRDLLDPHCKEGHDFYKAMDKFM  218



>ref|XP_010045880.1| PREDICTED: cytochrome P450 76A1-like, partial [Eucalyptus grandis]
Length=475

 Score =   205 bits (521),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 94/177 (53%), Positives = 127/177 (72%), Gaps = 2/177 (1%)
 Frame = +1

Query  295  VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT  474
            VIGN+LDLG  PHQ +   + K+G V WL++GSV+TM I SA+AAAE FK HD +FADR 
Sbjct  8    VIGNILDLGTMPHQNLHNFRAKHGPVTWLKLGSVNTMVIQSAQAAAEFFKGHDSAFADRK  67

Query  475  VIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIE  654
                +   GY  GSLA   YGSYWRVLRR+C+ EL V KR+NET  +R+KC+D+M +++E
Sbjct  68   CPHALTALGYDQGSLAIGRYGSYWRVLRRLCSAELLVTKRVNETAHLRQKCVDNMAMYLE  127

Query  655  KEASSVQRGT--GVHVAHFVFLSTFNLLGNLFLSRDLVDPMSDKASKFFDAMTGIMQ  819
            +E ++ Q  T  G+ ++HF+FL TFN++GN+ LSRDL+DP S    +FFDAM   M+
Sbjct  128  EEMAAKQVTTEQGIDLSHFLFLMTFNVVGNMVLSRDLLDPKSKDGPEFFDAMNWFME  184



>gb|KJB62266.1| hypothetical protein B456_009G409000 [Gossypium raimondii]
Length=512

 Score =   203 bits (517),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 115/213 (54%), Positives = 155/213 (73%), Gaps = 5/213 (2%)
 Frame = +1

Query  169  MEWEWKYLVWSAIFLIPGLVFLLARKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAE  348
            M+    +L+   +F    L   + R+ +S + +LPPGPPG P+ GNM DLG  PH+T+  
Sbjct  1    MDLSPSFLLCFIVFASSALFLFIQRRNNSVTGKLPPGPPGWPIFGNMFDLGTMPHRTLTR  60

Query  349  MKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFA  528
            +++KYG VIWLR+G+V+TM ILS KAA E FKN+D++FA+R + ++M+  GY+  S+A A
Sbjct  61   LRDKYGQVIWLRLGAVNTMVILSTKAATEFFKNYDLTFAERHITEIMRAHGYHKSSVALA  120

Query  529  PYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEASSVQRG----TGVHV  696
            PYGSYWRVLRR+ TV++ V+KRINET  VRRKC+DDML WIE EAS + RG     G+HV
Sbjct  121  PYGSYWRVLRRLVTVDMLVNKRINETACVRRKCLDDMLGWIEDEASKI-RGESNRNGIHV  179

Query  697  AHFVFLSTFNLLGNLFLSRDLVDPMSDKASKFF  795
            A F+FL + NLLGNL LS+DL DP S + S+FF
Sbjct  180  ARFMFLLSLNLLGNLMLSQDLFDPNSKEGSEFF  212



>dbj|BAC53891.1| cytochrome P450 [Petunia x hybrida]
Length=507

 Score =   203 bits (516),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 107/199 (54%), Positives = 145/199 (73%), Gaps = 2/199 (1%)
 Frame = +1

Query  226  VFLLARKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTM  405
            VF    KK+S SY+LPPGP GLP++GNM DLG  PH  +  M+N+YG V+WL+IG+++T+
Sbjct  20   VFFFLLKKTSRSYKLPPGPSGLPIVGNMFDLGDLPHIKMEGMRNQYGPVMWLKIGAINTL  79

Query  406  AILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFV  585
             I SA+AA   FKNHD +F +R V++V +V  Y  GSLA APYG+YWR+LRRIC++ELFV
Sbjct  80   VIQSAQAATAFFKNHDANFLERVVVEVNRVCNYLQGSLALAPYGNYWRMLRRICSMELFV  139

Query  586  HKRINETVPVRRKCIDDMLLWIEKEASSVQRGTGVHVAHFVFLSTFNLLGNLFLSRDL-V  762
            H RIN +  +RRK +D M+ WIE      Q G G+ +  FVFL++FN+LGNL +S++L  
Sbjct  140  HSRINNSESIRRKSVDKMIQWIETHGKKEQ-GQGIEITRFVFLASFNMLGNLIMSKELAA  198

Query  763  DPMSDKASKFFDAMTGIMQ  819
            DP S  AS+FFDAM G ++
Sbjct  199  DPDSTTASEFFDAMMGQVE  217



>ref|XP_007204461.1| hypothetical protein PRUPE_ppa023213mg [Prunus persica]
 gb|EMJ05660.1| hypothetical protein PRUPE_ppa023213mg [Prunus persica]
Length=462

 Score =   201 bits (512),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 106/195 (54%), Positives = 140/195 (72%), Gaps = 15/195 (8%)
 Frame = +1

Query  235  LARKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAIL  414
            + R+  S ++ LPPGPPG P+ GNM DLG  PH+T+ E+  K+G VIWLR+G+ +TM++ 
Sbjct  23   IRRRSKSGNHLLPPGPPGWPIFGNMFDLGTMPHRTLTELTPKFGPVIWLRLGARATMSVQ  82

Query  415  SAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKR  594
            SAKAA+E FKNHD+SFA+RT  +V +V  Y+ G               R+ TV++ V+KR
Sbjct  83   SAKAASEFFKNHDLSFANRTTNEVCRVYDYHKG---------------RLMTVDMVVNKR  127

Query  595  INETVPVRRKCIDDMLLWIEKEASSVQRGTGVHVAHFVFLSTFNLLGNLFLSRDLVDPMS  774
            INET  VRRKC D++ LWIE+EAS ++ G GVHVA FVFL TFNLLGNL LSRDLVDP S
Sbjct  128  INETAFVRRKCFDNLQLWIEEEASKLKEGHGVHVARFVFLMTFNLLGNLMLSRDLVDPKS  187

Query  775  DKASKFFDAMTGIMQ  819
            ++  +FF AM G+M+
Sbjct  188  NEGLEFFKAMNGLME  202



>gb|AHX24365.1| CYP76A26-like protein [Cinchona calisaya]
Length=516

 Score =   200 bits (509),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 109/225 (48%), Positives = 149/225 (66%), Gaps = 8/225 (4%)
 Frame = +1

Query  169  MEWEWKYLVWSAIFLIPGLVFLL-----ARKKSSSSYRlppgppglpVIGNMLDLGAFPH  333
            MEW  K L    I +  GLV LL      R ++ SS R PPGPPG P+ GNM DLG  PH
Sbjct  1    MEWTLKSLNPITIAISAGLVILLLISFIKRSRNGSSKRKPPGPPGWPIFGNMFDLGDLPH  60

Query  334  QTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMG  513
            QT+  +++KYG VIWL++GS++TM + +A AAAELFK HDV FADR V D +    +  G
Sbjct  61   QTLYRLRSKYGPVIWLQLGSINTMVVQNAVAAAELFKKHDVPFADRKVPDALTAFEFNQG  120

Query  514  SLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKE--ASSVQRGTG  687
            SL    +G +WRVLRR+C++E  V+K++NET  +RR+  D+M+ WIE E  +S  Q G G
Sbjct  121  SLGMNTFGGHWRVLRRLCSMEFLVNKKMNETTDLRRRIEDNMIRWIEDECVSSKAQGGNG  180

Query  688  -VHVAHFVFLSTFNLLGNLFLSRDLVDPMSDKASKFFDAMTGIMQ  819
             V ++  +FL  FNL+GNL LSRDL+D    ++ +FFD+M  I++
Sbjct  181  AVQLSRLLFLMAFNLVGNLMLSRDLLDNRDPESKEFFDSMNEILE  225



>gb|KCW84354.1| hypothetical protein EUGRSUZ_B01206 [Eucalyptus grandis]
Length=498

 Score =   199 bits (507),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 92/177 (52%), Positives = 125/177 (71%), Gaps = 2/177 (1%)
 Frame = +1

Query  295  VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT  474
            VIGN+LDLG  PHQ +   + K+G V WL++GSV+TM I SA+AAAE FK HD +FADR 
Sbjct  39   VIGNILDLGTTPHQNLHNFRAKHGPVTWLKLGSVNTMVIQSAQAAAEFFKGHDSAFADRK  98

Query  475  VIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIE  654
                +   GY  GSLA   YG YWRVLRR+C+ EL V KR+NET  +R+KC+D+M++++E
Sbjct  99   CPHALTALGYDQGSLAIGRYGGYWRVLRRLCSAELLVTKRVNETAHLRQKCVDNMVVYLE  158

Query  655  KEASSVQRGT--GVHVAHFVFLSTFNLLGNLFLSRDLVDPMSDKASKFFDAMTGIMQ  819
            +E +  Q  T  G+ ++HF+FL  FN++GN+ LSRDL+DP S    +FFDAM   M+
Sbjct  159  EEMAVKQVTTEQGIDLSHFLFLMAFNVVGNMVLSRDLLDPKSKDGPEFFDAMNRFME  215



>ref|XP_010036151.1| PREDICTED: cytochrome P450 76A1-like [Eucalyptus grandis]
 gb|KCW84344.1| hypothetical protein EUGRSUZ_B01192 [Eucalyptus grandis]
Length=507

 Score =   199 bits (506),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 89/177 (50%), Positives = 125/177 (71%), Gaps = 2/177 (1%)
 Frame = +1

Query  295  VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT  474
            VIGN+LDLG  PHQ +  ++ K+G V+WL++GSV+TM I SA+AA ELFK HD  FADR 
Sbjct  40   VIGNILDLGTMPHQNLHNLRAKHGPVLWLKLGSVNTMVIQSARAAMELFKGHDFVFADRK  99

Query  475  VIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIE  654
                    GY  GSLA   +G YWR LRR+C+ EL V+KR+N+T  +R+KC+D M+++IE
Sbjct  100  CSQAFTALGYDQGSLALGRHGDYWRALRRLCSAELLVNKRVNDTAHLRQKCVDSMIMYIE  159

Query  655  KEASSVQ--RGTGVHVAHFVFLSTFNLLGNLFLSRDLVDPMSDKASKFFDAMTGIMQ  819
            +E +  Q  +G G+ ++HF+FL  FN++GN+ LSRDL+DP S    +F+DAM   M+
Sbjct  160  EEMAVKQATKGQGIDLSHFLFLLAFNVVGNMVLSRDLLDPKSKDGPEFYDAMNRFME  216



>gb|AHK60833.1| iridoid oxidase [Catharanthus roseus]
Length=515

 Score =   199 bits (506),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 103/210 (49%), Positives = 146/210 (70%), Gaps = 5/210 (2%)
 Frame = +1

Query  199  SAIFLIPGLVFLLARKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAEMKNKYGSVIW  378
            SA FL+  L+ +  + ++ SS R PPGPPG P+ GNM DLG  PHQT+ ++K+KYG ++W
Sbjct  17   SAGFLL--LLIIFVKSRTGSSKRKPPGPPGWPIFGNMFDLGDLPHQTLYKLKSKYGPIVW  74

Query  379  LRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPYGSYWRVLR  558
            L++GS++TM + +A +AAELFK HDV F DR V D +    +  GSL    YG +WRVLR
Sbjct  75   LQLGSINTMVVQNAVSAAELFKKHDVPFCDRKVPDTLTAFNFNQGSLGMNTYGGHWRVLR  134

Query  559  RICTVELFVHKRINETVPVRRKCIDDMLLWIEKE--ASSVQRGTG-VHVAHFVFLSTFNL  729
            R+C++E  V+KR+NET  +RR+  D+M+ WIE++  AS  Q GTG V ++ F+FL  FNL
Sbjct  135  RLCSMEFLVNKRMNETTDLRRRIEDNMVRWIEEDSLASKAQGGTGAVQLSRFLFLMAFNL  194

Query  730  LGNLFLSRDLVDPMSDKASKFFDAMTGIMQ  819
            +GNL LSRDL+D    +  +FFD M  I++
Sbjct  195  VGNLMLSRDLMDNKDPEGREFFDCMNEILE  224



>ref|XP_002283772.1| PREDICTED: cytochrome P450 76A1 [Vitis vinifera]
 ref|XP_010654032.1| PREDICTED: cytochrome P450 76A1 [Vitis vinifera]
Length=511

 Score =   199 bits (505),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 99/216 (46%), Positives = 141/216 (65%), Gaps = 7/216 (3%)
 Frame = +1

Query  190  LVWSAIFLIPGLVFLLAR---KKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAEMKNK  360
            L+W + F    L+ LL R   +K S+  R P       ++GN+ DLG  PHQT+  ++++
Sbjct  4    LLWWSAFFSAALLVLLRRIKPRKGSTKLRPPGPQGWP-ILGNIFDLGTMPHQTLYRLRSQ  62

Query  361  YGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPYGS  540
            YG V+WL++G+++T+ I SAK AAELFKNHD+ F+DR V   +    Y  GS+A + YG+
Sbjct  63   YGPVLWLQLGAINTVVIQSAKVAAELFKNHDLPFSDRKVPCALTALNYNQGSMAMSNYGT  122

Query  541  YWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEAS--SVQRGTG-VHVAHFVF  711
            YWR LR++C+ EL V KRINE  P+R KC+D M+ WIE +A+   VQ G+G V V+H VF
Sbjct  123  YWRTLRKVCSSELLVIKRINEMAPLRHKCVDRMIQWIEDDATMARVQGGSGEVEVSHLVF  182

Query  712  LSTFNLLGNLFLSRDLVDPMSDKASKFFDAMTGIMQ  819
               FNL+ NL LSRD  D    + ++F+DAM  IM+
Sbjct  183  CVAFNLIANLMLSRDFFDMKPKEGNEFYDAMNKIME  218



>gb|AHX24370.1| CYP76A26 [Catharanthus roseus]
Length=515

 Score =   199 bits (505),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 103/210 (49%), Positives = 146/210 (70%), Gaps = 5/210 (2%)
 Frame = +1

Query  199  SAIFLIPGLVFLLARKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAEMKNKYGSVIW  378
            SA FL+  L+ +  + ++ SS R PPGPPG P+ GNM DLG  PHQT+ ++K+KYG ++W
Sbjct  17   SAGFLL--LLIIFVKSRTGSSKRKPPGPPGWPIFGNMFDLGDLPHQTLYKLKSKYGPIVW  74

Query  379  LRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPYGSYWRVLR  558
            L++GS++TM + +A +AAELFK HDV F DR V D +    +  GSL    YG +WRVLR
Sbjct  75   LQLGSINTMVVQNAVSAAELFKKHDVPFCDRKVPDTLTAFNFNQGSLGMNTYGGHWRVLR  134

Query  559  RICTVELFVHKRINETVPVRRKCIDDMLLWIEKE--ASSVQRGTG-VHVAHFVFLSTFNL  729
            R+C++E  V+KR+NET  +RR+  D+M+ WIE++  AS  Q GTG V ++ F+FL  FNL
Sbjct  135  RLCSMEFLVNKRMNETTDLRRRIEDNMVRWIEEDSLASKAQGGTGAVQLSRFLFLMAFNL  194

Query  730  LGNLFLSRDLVDPMSDKASKFFDAMTGIMQ  819
            +GNL LSRDL+D    +  +FFD M  I++
Sbjct  195  VGNLMLSRDLMDNKDPEGREFFDCMNEILE  224



>ref|XP_002283777.2| PREDICTED: cytochrome P450 76A1 [Vitis vinifera]
Length=512

 Score =   198 bits (504),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 100/212 (47%), Positives = 141/212 (67%), Gaps = 4/212 (2%)
 Frame = +1

Query  196  WSAIFLIPGLVFL-LARKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAEMKNKYGSV  372
            WS  F    L+FL L +    S+   PPGP G P+ GN+ DLG  PHQT+  ++ ++G V
Sbjct  11   WSCFFSAALLLFLRLIKFTKGSTKSTPPGPQGWPIFGNIFDLGTLPHQTLHRLRPQHGPV  70

Query  373  IWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPYGSYWRV  552
            +WL++G+++TM + SAKAAAELFKNHD+ F+DR V   +    Y  GS+A   YG YWR+
Sbjct  71   LWLQLGAINTMVVQSAKAAAELFKNHDLPFSDRNVPFTLTAHNYDQGSMALGKYGPYWRM  130

Query  553  LRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEAS---SVQRGTGVHVAHFVFLSTF  723
            +R++C  EL V+KRINE   +RRKC+DDM+ WIE++A+   +  R   V + HF+F   F
Sbjct  131  IRKVCASELLVNKRINEMGSLRRKCVDDMIRWIEEDAAKSGAEGRAGEVELPHFLFCMAF  190

Query  724  NLLGNLFLSRDLVDPMSDKASKFFDAMTGIMQ  819
            NL+GN+ LSRD+VD  S    +FF AM G+M+
Sbjct  191  NLIGNITLSRDVVDIKSKDGHEFFQAMNGVME  222



>emb|CAN76784.1| hypothetical protein VITISV_028823 [Vitis vinifera]
Length=511

 Score =   198 bits (503),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 98/216 (45%), Positives = 141/216 (65%), Gaps = 7/216 (3%)
 Frame = +1

Query  190  LVWSAIFLIPGLVFLLAR---KKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAEMKNK  360
            L+W + F    L+ LL R   +K S+  R P       ++GN+ DLG  PHQT+  ++++
Sbjct  4    LLWWSAFFSAALLVLLRRIKPRKGSTKLRPPGPQGWP-ILGNIFDLGTMPHQTLYRLRSQ  62

Query  361  YGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPYGS  540
            YG V+WL++G+++T+ I SAK AAELFKNHD+ F+DR V   +    Y  GS+A + YG+
Sbjct  63   YGPVLWLQLGAINTVVIQSAKVAAELFKNHDLPFSDRKVPCALTALNYNQGSMAMSNYGT  122

Query  541  YWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEAS--SVQRGTG-VHVAHFVF  711
            YWR LR++C+ EL V KRINE  P+R KC+D M+ WIE +A+   VQ G+G V V+H VF
Sbjct  123  YWRTLRKVCSSELLVIKRINEMAPLRHKCVDRMIQWIEDDATMARVQGGSGEVEVSHLVF  182

Query  712  LSTFNLLGNLFLSRDLVDPMSDKASKFFDAMTGIMQ  819
               FNL+ NL LSRD  D    + ++F++AM  IM+
Sbjct  183  CVAFNLIANLMLSRDFFDMKPKEGNEFYBAMNKIME  218



>ref|XP_010036177.1| PREDICTED: cytochrome P450 76A1-like [Eucalyptus grandis]
Length=507

 Score =   197 bits (502),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 88/177 (50%), Positives = 124/177 (70%), Gaps = 2/177 (1%)
 Frame = +1

Query  295  VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT  474
            VIGN+ DLG  PHQ +  ++ K+G V+WL++GSV+TM I SA+AA ELFK HD  FADR 
Sbjct  40   VIGNIFDLGTMPHQNLHNLRAKHGPVLWLKLGSVNTMVIQSARAAMELFKGHDFVFADRK  99

Query  475  VIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIE  654
                    GY  GSLA   +G YWR LRR+C+ EL V+KR+N+T  +R+KC+D M+++IE
Sbjct  100  CSQAFTALGYDQGSLALGRHGDYWRALRRLCSAELLVNKRVNDTAHLRQKCVDSMIMYIE  159

Query  655  KEASSVQ--RGTGVHVAHFVFLSTFNLLGNLFLSRDLVDPMSDKASKFFDAMTGIMQ  819
            +E +  Q  +G G+ ++HF+FL  FN++GN+ LSRDL+DP S    +F+DAM   M+
Sbjct  160  EEMAVKQATKGQGIDLSHFLFLLAFNVVGNMVLSRDLLDPKSKDGPEFYDAMNRFME  216



>ref|XP_002267565.2| PREDICTED: cytochrome P450 76A2-like [Vitis vinifera]
Length=512

 Score =   197 bits (502),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 100/212 (47%), Positives = 142/212 (67%), Gaps = 4/212 (2%)
 Frame = +1

Query  196  WSAIFLIPGLVFL-LARKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAEMKNKYGSV  372
            WS  F    L+FL L +    S+   PPGP G P+ GN+ DLG  PHQT+  ++ ++G V
Sbjct  11   WSCFFSAALLLFLRLIKFTKGSTKSTPPGPQGWPIFGNIFDLGTLPHQTLYRLRPQHGPV  70

Query  373  IWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPYGSYWRV  552
            +WL++G+++TM + SAKAAAELFKNHD+SF+DR V   +    Y  GS+A   YG YWR+
Sbjct  71   LWLQLGAINTMVVQSAKAAAELFKNHDLSFSDRNVPFTLTAHNYDQGSMALGKYGPYWRM  130

Query  553  LRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEAS---SVQRGTGVHVAHFVFLSTF  723
            +R++C  EL V+KRINE   +RRKC+DDM+ WIE++A+   +  R   V + HF+F   F
Sbjct  131  IRKVCASELLVNKRINEMGSLRRKCVDDMIRWIEEDAAKSGAEGRAGEVELPHFLFCMAF  190

Query  724  NLLGNLFLSRDLVDPMSDKASKFFDAMTGIMQ  819
            NL+GN+ LSRD+VD  S    +FF AM G+++
Sbjct  191  NLIGNITLSRDVVDIKSKDGHEFFQAMNGVVE  222



>gb|AHX24367.1| CYP76A26-like protein [Rauvolfia serpentina]
Length=514

 Score =   197 bits (502),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 103/210 (49%), Positives = 147/210 (70%), Gaps = 5/210 (2%)
 Frame = +1

Query  199  SAIFLIPGLVFLLARKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAEMKNKYGSVIW  378
            S  FL+  ++F+ AR++SS   R PPGPPG P+ GNM DLG  PHQT+ ++++KYG ++W
Sbjct  16   SVGFLLLLVIFVKARRRSSK--RTPPGPPGWPIFGNMFDLGDLPHQTLYKLRSKYGPIVW  73

Query  379  LRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPYGSYWRVLR  558
            L++GS++TM + +A +AAELFK HDV F DR V D +    +  GSL    YG +WRVLR
Sbjct  74   LQLGSINTMVVQNAVSAAELFKKHDVPFCDRKVPDTLTAFNFNQGSLGMNTYGGHWRVLR  133

Query  559  RICTVELFVHKRINETVPVRRKCIDDMLLWIEKE--ASSVQRGTG-VHVAHFVFLSTFNL  729
            R+C++E  V+KR+NET  +RR+  D+M+ WIE++  AS  Q GTG V ++ F+FL  FNL
Sbjct  134  RLCSMEFLVNKRMNETTDLRRRIEDNMVRWIEEDSLASKAQGGTGAVQLSRFLFLMAFNL  193

Query  730  LGNLFLSRDLVDPMSDKASKFFDAMTGIMQ  819
            +GNL LSRDL+D    +  +FFD M  I++
Sbjct  194  VGNLMLSRDLLDNKDPEGREFFDCMNEILE  223



>ref|XP_010036187.1| PREDICTED: cytochrome P450 76A1-like [Eucalyptus grandis]
Length=506

 Score =   197 bits (501),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 91/177 (51%), Positives = 125/177 (71%), Gaps = 2/177 (1%)
 Frame = +1

Query  295  VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT  474
            VIGN+LDLG  PHQ +   + K+G V WL++GSV+TM I SA+AAAE FK HD +FADR 
Sbjct  39   VIGNILDLGTTPHQNLHNFRAKHGPVTWLKLGSVNTMVIQSAQAAAEFFKGHDFAFADRK  98

Query  475  VIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIE  654
                +    Y  GSLA   YG YWRVLRR+C+VE  V KR+NETV +R+KC+D++++++E
Sbjct  99   CPHALTALNYDQGSLAVGRYGGYWRVLRRLCSVEFLVTKRVNETVHLRQKCVDNVIVYLE  158

Query  655  KEASSVQRGT--GVHVAHFVFLSTFNLLGNLFLSRDLVDPMSDKASKFFDAMTGIMQ  819
            +E +  Q  T  G+ ++HF+FL  FN++GN+ LSRDL+DP S    +FFDAM   M+
Sbjct  159  EEMAVKQVTTEQGIDLSHFLFLMAFNVVGNMVLSRDLLDPKSKDGPEFFDAMNRFME  215



>gb|AHX24366.1| CYP76A26-like protein [Amsonia hubrichtii]
Length=514

 Score =   197 bits (501),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 106/223 (48%), Positives = 148/223 (66%), Gaps = 6/223 (3%)
 Frame = +1

Query  169  MEWEWKYLVWSAIFLIPGLVFLLA---RKKSSSSYRlppgppglpVIGNMLDLGAFPHQT  339
            MEW +  +    I +  G + LL    + +S SS   PPGPPG P+ GNM DLG  PHQT
Sbjct  1    MEWTFDSVNPVTIAVSAGFLLLLVIFVKGRSGSSKSKPPGPPGWPIFGNMFDLGDLPHQT  60

Query  340  IAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSL  519
            + + ++KYG V+WLR+GS++TM + +A +AAELFK HDV F+DR V D +    +  GSL
Sbjct  61   LYKFRSKYGPVVWLRLGSINTMVVQNAVSAAELFKKHDVPFSDRKVPDTLTAFQFNQGSL  120

Query  520  AFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKE--ASSVQRGTG-V  690
                YG +WRVLRR+C++E  V+KR+NET  +RR+  D+M+ WIE++  AS  Q GTG V
Sbjct  121  GMNTYGGHWRVLRRLCSMEFLVNKRMNETTDLRRRIEDNMVRWIEEDSLASKAQGGTGAV  180

Query  691  HVAHFVFLSTFNLLGNLFLSRDLVDPMSDKASKFFDAMTGIMQ  819
             ++ F+FL  FNL+GNL LSRDL+D    +  +FFD M  I++
Sbjct  181  QLSRFLFLMAFNLVGNLMLSRDLLDNKDPEGREFFDCMNEILE  223



>ref|XP_010036165.1| PREDICTED: cytochrome P450 76A1-like [Eucalyptus grandis]
Length=506

 Score =   196 bits (499),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 91/177 (51%), Positives = 123/177 (69%), Gaps = 2/177 (1%)
 Frame = +1

Query  295  VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT  474
            VIGN+LDLG  PHQ +   + K+G V WL++GSV+TM I SA+AA E FK HD +FADR 
Sbjct  39   VIGNILDLGTTPHQNLHNFRAKHGPVTWLKLGSVNTMVIQSAQAATEFFKGHDFAFADRK  98

Query  475  VIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIE  654
                +    Y  GSLA   YG YWRVLRR+C+VE  V KR+NET  +R+KC+D+M++++E
Sbjct  99   CPHALTALNYDQGSLAVGRYGGYWRVLRRLCSVEFLVTKRVNETAHLRQKCVDNMVVYLE  158

Query  655  KEASSVQRGT--GVHVAHFVFLSTFNLLGNLFLSRDLVDPMSDKASKFFDAMTGIMQ  819
            +E +  Q  T  G+ ++HF+FL  FN++GNL LSRDL+DP S    +FFDAM   M+
Sbjct  159  EEMAVKQVTTEQGIDLSHFLFLMAFNVVGNLVLSRDLLDPKSKDGPEFFDAMNRFME  215



>sp|P37121.1|C76A1_SOLME RecName: Full=Cytochrome P450 76A1; AltName: Full=CYPLXXVIA1; 
AltName: Full=Cytochrome P-450EG8, partial [Solanum melongena]
 emb|CAA50649.1| unnamed protein product [Solanum melongena]
Length=467

 Score =   194 bits (494),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 97/177 (55%), Positives = 134/177 (76%), Gaps = 4/177 (2%)
 Frame = +1

Query  301  GNMLDL-GAFPHQTIAEMKNKYGSVIWLRIGS-VSTMAILSAKAAAELFKNHDVSFADRT  474
            GNM DL G+ P++ IA +K KYG ++WL+IGS ++TM I +A +A+ELF+NHDVSF+DR 
Sbjct  2    GNMFDLAGSAPYKKIACLKEKYGPILWLKIGSSMNTMVIQTANSASELFRNHDVSFSDRP  61

Query  475  VIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDML-LWI  651
            ++DV     YY GS+A APYG+YWR  RRICTVE+FVHKRINET  +R++ +D ML L  
Sbjct  62   IVDVNLAHNYYKGSMALAPYGNYWRFSRRICTVEMFVHKRINETTNIRQESVDKMLRLDE  121

Query  652  EKEASSVQRGTGVHVAHFVFLSTFNLLGNLFLSRDLV-DPMSDKASKFFDAMTGIMQ  819
            EK +SS   G G+ V  ++FL++FN++GN+  S+DLV DP S + S+FF+AM GIM+
Sbjct  122  EKASSSGGGGEGIEVTRYMFLASFNMVGNMIFSKDLVTDPESKQGSEFFNAMIGIME  178



>gb|AHX24368.1| CYP76A26-like protein [Tabernaemontana elegans]
Length=514

 Score =   195 bits (496),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 104/223 (47%), Positives = 150/223 (67%), Gaps = 6/223 (3%)
 Frame = +1

Query  169  MEWEWKYLVWSAIFLIPGLVFLLA---RKKSSSSYRlppgppglpVIGNMLDLGAFPHQT  339
            MEW +  +    I +  G + LL    + +S SS R PPGPPG P+ GNM DLG  PHQ+
Sbjct  1    MEWTFDSVNSVTIAVSAGFLLLLVSFVKARSGSSKRRPPGPPGWPIFGNMFDLGDLPHQS  60

Query  340  IAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSL  519
            + ++++KYG ++WL++GS++TM + +A +AAELFK HDV F DR V D +    +  GSL
Sbjct  61   MYKLRSKYGPIVWLQLGSINTMVVQNAVSAAELFKKHDVPFCDRKVPDTLTAFDFNRGSL  120

Query  520  AFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKE--ASSVQRGTG-V  690
                YG +WRVLRR+C++E  V+KR+NET  +RR+  D+M+ WIE++  AS  Q GTG V
Sbjct  121  GMNTYGGHWRVLRRLCSMEFLVNKRMNETTDLRRRIEDNMVRWIEEDSLASKAQGGTGAV  180

Query  691  HVAHFVFLSTFNLLGNLFLSRDLVDPMSDKASKFFDAMTGIMQ  819
             ++ F+FL  FNL+GNL LSRDL+D    ++ +FFD M  I++
Sbjct  181  QLSRFLFLMAFNLVGNLMLSRDLLDSKDPESREFFDCMNEILE  223



>ref|XP_010045881.1| PREDICTED: cytochrome P450 76A1-like [Eucalyptus grandis]
Length=507

 Score =   195 bits (495),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 88/177 (50%), Positives = 126/177 (71%), Gaps = 2/177 (1%)
 Frame = +1

Query  295  VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT  474
            VIGN+LDLG   HQ +  ++ K+G V+WL++GSV+T+AI SA+AA ELFK HD  FADR 
Sbjct  40   VIGNILDLGTMAHQNLHNLRAKHGPVLWLKLGSVNTVAIQSAQAAMELFKGHDFVFADRK  99

Query  475  VIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIE  654
                +   GY  GSLA   YG YWR LRR+C+ ELFV+KR+N+   +R+KC+D M+++IE
Sbjct  100  CPHALTALGYDQGSLAVGRYGDYWRALRRLCSAELFVNKRVNDAAHLRQKCVDSMIMYIE  159

Query  655  KEASSVQ--RGTGVHVAHFVFLSTFNLLGNLFLSRDLVDPMSDKASKFFDAMTGIMQ  819
            +E +  Q  +  G+ ++HF+FL  FN++GN+ LSRDL+DP S    +F+DAM  +M+
Sbjct  160  EEMAVKQATKEQGIDLSHFLFLLAFNVVGNMVLSRDLLDPKSKDGPEFYDAMNLVME  216



>ref|XP_010036221.1| PREDICTED: cytochrome P450 76A1-like [Eucalyptus grandis]
Length=506

 Score =   194 bits (494),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 92/177 (52%), Positives = 122/177 (69%), Gaps = 2/177 (1%)
 Frame = +1

Query  295  VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT  474
            VIGN+LDLG  PHQ +   + K+G V WL++GSV+TM I SA+AAAE FK HD +FADR 
Sbjct  39   VIGNILDLGTTPHQNLHHFRAKHGPVTWLKLGSVNTMVIQSAQAAAEFFKGHDFAFADRK  98

Query  475  VIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIE  654
                M    Y  GSLA   YG YWRVLRR+C+VEL V KR+NET  +R+KC+D+M+ ++E
Sbjct  99   CPHAMTALNYDQGSLAVGRYGGYWRVLRRLCSVELLVTKRVNETAHLRQKCVDNMVAYLE  158

Query  655  KEASSVQRGT--GVHVAHFVFLSTFNLLGNLFLSRDLVDPMSDKASKFFDAMTGIMQ  819
            +E +  Q  T  G+ ++HF+ L  FN++GN+ LSRDL DP S    +FFDAM   M+
Sbjct  159  EEMAVKQVTTEQGIDLSHFLLLMGFNVVGNMVLSRDLWDPKSKDGPEFFDAMNRFME  215



>gb|AHX24369.1| CYP76A26-like protein [Vinca minor]
Length=514

 Score =   194 bits (493),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 102/206 (50%), Positives = 144/206 (70%), Gaps = 6/206 (3%)
 Frame = +1

Query  220  GLVFLLA---RKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIG  390
            G +FLLA   + ++ SS R PPGPPG PV GNM DLG  PHQT+ ++++KYG ++WL++G
Sbjct  18   GFLFLLAIFLKSRTGSSKRRPPGPPGWPVFGNMFDLGDLPHQTLYKLRSKYGPIVWLQLG  77

Query  391  SVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPYGSYWRVLRRICT  570
            S++TM + +A AA ELFK HDV F DR V D +    +   SL    YG +WRVLRR+C+
Sbjct  78   SINTMVVQNAVAAGELFKKHDVPFCDRKVPDTLTTFNFNSSSLGMNTYGGHWRVLRRLCS  137

Query  571  VELFVHKRINETVPVRRKCIDDMLLWIEKE--ASSVQRGTG-VHVAHFVFLSTFNLLGNL  741
            +E  V+KR+NET  +RR+  D+M+ WIE++  AS  Q GTG V ++ F+FL  FNL+GNL
Sbjct  138  MEFLVNKRMNETTDLRRRIEDNMVRWIEEDSLASKSQGGTGAVQLSRFLFLMAFNLVGNL  197

Query  742  FLSRDLVDPMSDKASKFFDAMTGIMQ  819
             LSRDL+D    ++ +FFD+M  I++
Sbjct  198  MLSRDLLDNKDPESREFFDSMNEILE  223



>gb|AJD20226.1| putative N-methylcoclaurine 3-hydroxylase [Podophyllum peltatum]
 gb|AJD20230.1| corytuberine synthase [Podophyllum peltatum]
Length=510

 Score =   192 bits (488),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 99/221 (45%), Positives = 152/221 (69%), Gaps = 7/221 (3%)
 Frame = +1

Query  169  MEWEWKYLVWSAIFLIPGLVFLLAR----KKSSSSYRlppgppglpVIGNMLDLGAFPHQ  336
            MEW+   LV+S + L    + L+      K ++ S +LPPGPPG P+ GNM DLG+ P++
Sbjct  1    MEWDLILLVFSTVCLATAFLLLIPSRIKPKPNAGSRKLPPGPPGWPLFGNMFDLGSTPNE  60

Query  337  TIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGS  516
             +A +  KYG V+WLR+G  +T+ I S +AA E+FKNHD++F +R + + ++V  Y+ G+
Sbjct  61   ALANLSKKYGPVLWLRLGLQNTIVISSTEAAMEMFKNHDLTFVNRNITEALRVHSYHQGA  120

Query  517  LAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEASSVQRGTGVHV  696
            ++   YG YWR+LRRI T ELF + RI+ +  +R+KC+D+M+ WI  E  S+++G  V +
Sbjct  121  ISTMNYGPYWRMLRRITTTELFSNNRIDNSENLRQKCVDNMIKWISNE--SMEKGV-VEI  177

Query  697  AHFVFLSTFNLLGNLFLSRDLVDPMSDKASKFFDAMTGIMQ  819
            AHF+ L +FN++GNL LSRDLVDP S +A++FF A   ++Q
Sbjct  178  AHFISLMSFNVIGNLMLSRDLVDPSSIRAAEFFTAAEKVVQ  218



>ref|XP_006430323.1| hypothetical protein CICLE_v10011511mg [Citrus clementina]
 gb|ESR43563.1| hypothetical protein CICLE_v10011511mg [Citrus clementina]
Length=512

 Score =   189 bits (479),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 89/178 (50%), Positives = 123/178 (69%), Gaps = 3/178 (2%)
 Frame = +1

Query  295  VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT  474
            + GN  DLG  PHQ++ +++ KYG V+WL++GSV+T+ I SAKAA E+FKN D  F DR 
Sbjct  46   IFGNFFDLGNMPHQSLYKLRAKYGPVLWLKLGSVNTVVIQSAKAANEMFKNQDHIFCDRK  105

Query  475  VIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIE  654
            V D +  + YY GSLAF  YG YWR+LRR+C  EL V++RINET P+RRKCID  +  IE
Sbjct  106  VPDALIARNYYQGSLAFGRYGVYWRILRRLCASELSVNRRINETAPIRRKCIDKTIQCIE  165

Query  655  KEASSVQ-RGTG--VHVAHFVFLSTFNLLGNLFLSRDLVDPMSDKASKFFDAMTGIMQ  819
             + +  Q RG    V ++H++FL  F+L+GNL LSR+L++  S +  +FF AM   M+
Sbjct  166  NDVAEAQARGESGQVDLSHYLFLMAFSLIGNLTLSRELLNLQSKQELEFFAAMVKCME  223



>gb|KDO61009.1| hypothetical protein CISIN_1g010359mg [Citrus sinensis]
Length=512

 Score =   188 bits (478),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 89/178 (50%), Positives = 123/178 (69%), Gaps = 3/178 (2%)
 Frame = +1

Query  295  VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT  474
            + GN  DLG  PHQ++ +++ KYG V+WL++GSV+T+ I SAKAA E+FKN D  F DR 
Sbjct  46   IFGNFFDLGNMPHQSLYKLRAKYGPVLWLKLGSVNTVVIQSAKAANEMFKNQDHIFCDRK  105

Query  475  VIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIE  654
            V D +  + YY GSLAF  YG YWR+LRR+C  EL V++RINET P+RRKCID  +  IE
Sbjct  106  VPDALIARNYYQGSLAFGRYGVYWRILRRLCASELSVNRRINETAPIRRKCIDKTIQCIE  165

Query  655  KEASSVQ-RGTG--VHVAHFVFLSTFNLLGNLFLSRDLVDPMSDKASKFFDAMTGIMQ  819
             + +  Q RG    V ++H++FL  F+L+GNL LSR+L++  S +  +FF AM   M+
Sbjct  166  NDVAEAQARGESGQVDLSHYLFLMAFSLIGNLTLSRELLNLQSKQELEFFAAMVKCME  223



>ref|XP_006481913.1| PREDICTED: cytochrome P450 76A2-like [Citrus sinensis]
Length=512

 Score =   188 bits (478),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 89/178 (50%), Positives = 123/178 (69%), Gaps = 3/178 (2%)
 Frame = +1

Query  295  VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT  474
            + GN  DLG  PHQ++ +++ KYG V+WL++GSV+T+ I SAKAA E+FKN D  F DR 
Sbjct  46   IFGNFFDLGNMPHQSLYKLRAKYGPVLWLKLGSVNTVVIQSAKAANEMFKNQDHIFCDRK  105

Query  475  VIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIE  654
            V D +  + YY GSLAF  YG YWR+LRR+C  EL V++RINET P+RRKCID  +  IE
Sbjct  106  VPDALIARNYYQGSLAFGRYGVYWRILRRLCASELSVNRRINETAPIRRKCIDKTIQCIE  165

Query  655  KEASSVQ-RGTG--VHVAHFVFLSTFNLLGNLFLSRDLVDPMSDKASKFFDAMTGIMQ  819
             + +  Q RG    V ++H++FL  F+L+GNL LSR+L++  S +  +FF AM   M+
Sbjct  166  NDVAEAQARGESGQVDLSHYLFLMAFSLIGNLTLSRELLNLQSKQELEFFAAMVKCME  223



>ref|XP_012092524.1| PREDICTED: cytochrome P450 76A1-like [Jatropha curcas]
 gb|KDP20523.1| hypothetical protein JCGZ_05069 [Jatropha curcas]
Length=513

 Score =   185 bits (470),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 98/220 (45%), Positives = 140/220 (64%), Gaps = 5/220 (2%)
 Frame = +1

Query  169  MEWEWKYL-VWSAIFLIPGLVFLLARKKSSSSYRlppgppglpVI-GNMLDLGAFPHQTI  342
            MEW +  L  W +   +  +  LL  +KS S  +L P  P   +I GN+ +LG  PHQ +
Sbjct  1    MEWRYSNLFTWFSFLFLATVFLLLKHRKSKSGAKLRPPGPKPWLIFGNIFNLGTTPHQNL  60

Query  343  AEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLA  522
             + + KYG ++WLR+GS++T+ I SAKAA ELFKNHD SF DR V +      Y   S++
Sbjct  61   YKYRFKYGPILWLRLGSINTLVIQSAKAAEELFKNHDFSFCDRKVPECYTAHNYNQSSVS  120

Query  523  FAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEASSVQ-RGTG--VH  693
               YGS WR  RR+ TVEL  +KRIN+T  +R+KC+++ML +IE++ SS Q RG    V 
Sbjct  121  LGQYGSRWRFHRRLVTVELMTNKRINDTTSIRQKCVNNMLQFIEEDISSAQARGESMEVE  180

Query  694  VAHFVFLSTFNLLGNLFLSRDLVDPMSDKASKFFDAMTGI  813
            VA +VF+ +FNL+GNL LS DL++  S +  +FFDA+  +
Sbjct  181  VARYVFIMSFNLIGNLVLSWDLLNSQSKEGPEFFDALNKV  220



>gb|AHX24364.1| CYP76A26-like protein [Lonicera japonica]
Length=510

 Score =   185 bits (469),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 81/175 (46%), Positives = 123/175 (70%), Gaps = 2/175 (1%)
 Frame = +1

Query  295  VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT  474
            V GNM +LG  PHQT+ ++++KYG ++WLR+GS+ T+ + S  AAAELFK HDV+F+DR 
Sbjct  46   VFGNMFELGDLPHQTMYKLRSKYGPLVWLRLGSIHTLVVQSPAAAAELFKKHDVAFSDRK  105

Query  475  VIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIE  654
            V D +    +  GSL    YG +WRVLRR+C++E  V+KR+N+T  +RR+ +D+M+ WIE
Sbjct  106  VPDALTAFNFNAGSLGMNAYGGHWRVLRRLCSMEFLVNKRMNDTTALRRRIMDNMVHWIE  165

Query  655  KEASSVQRGTGVHVAHFVFLSTFNLLGNLFLSRDLVDPMSDKASKFFDAMTGIMQ  819
            +E+    R   V ++ F+FL  FNL+GNL LSRDL++    +  +FFD+M  +++
Sbjct  166  EESQGGTR--EVQLSRFLFLMAFNLVGNLMLSRDLLNAGDPEGREFFDSMNKVLE  218



>ref|XP_002528653.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF33756.1| cytochrome P450, putative [Ricinus communis]
Length=515

 Score =   184 bits (466),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 99/214 (46%), Positives = 144/214 (67%), Gaps = 4/214 (2%)
 Frame = +1

Query  190  LVW-SAIFLIPGLVFLLARKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAEMKNKYG  366
            L W + +F +  +V L  R+    + + PPGPP  P+IGN+ DLGA PHQ + ++  KYG
Sbjct  10   LAWFTLLFSVTIVVLLKKRRPRHDAKQRPPGPPAWPIIGNIFDLGANPHQNLYKLGFKYG  69

Query  367  SVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPYGSYW  546
             V+WLR+G ++TM I SAKAA ELFK+HD+SF DR V      + Y   +LA   Y S+W
Sbjct  70   PVLWLRLGYINTMVIQSAKAAEELFKHHDISFCDRKVPQSFTARNYCKAALALGRYDSHW  129

Query  547  RVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEASSVQ-RGTGVH--VAHFVFLS  717
            R  RR  T+EL  +KRINET  +R+KCID M+ +I+++AS+ + RG      ++H+VF+ 
Sbjct  130  RFHRRFVTLELMTNKRINETAVLRQKCIDKMIRYIDEDASAARARGESGELVISHYVFVM  189

Query  718  TFNLLGNLFLSRDLVDPMSDKASKFFDAMTGIMQ  819
            +FNL+GNL LSRDL++  S++ ++FFDAM   M+
Sbjct  190  SFNLIGNLALSRDLLNSHSEEGTEFFDAMDKAME  223



>gb|KDP24880.1| hypothetical protein JCGZ_25133 [Jatropha curcas]
Length=510

 Score =   183 bits (465),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 91/177 (51%), Positives = 120/177 (68%), Gaps = 3/177 (2%)
 Frame = +1

Query  295  VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT  474
            ++GN+ DLG   H+ + E+K KYG V+ LR+GSV T+ I SAKAA ELFKNHD SF DRT
Sbjct  44   LVGNIFDLGIMAHRILYELKLKYGPVLRLRLGSVDTVVIQSAKAAMELFKNHDASFCDRT  103

Query  475  VIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIE  654
            V  V+    Y  GSLA   +G YWR LRRIC +EL  ++R+NETV +RRKCID M+  IE
Sbjct  104  VPCVLTPHNYKDGSLALGRFGPYWRTLRRICAIELLANRRMNETVQIRRKCIDVMIRSIE  163

Query  655  KE--ASSVQRGTG-VHVAHFVFLSTFNLLGNLFLSRDLVDPMSDKASKFFDAMTGIM  816
             +  A      +G VH+ H++F+ TFNL+GNL LS+DL D    +  +FF+AM  +M
Sbjct  164  DDMAAGKASGESGIVHIPHYLFVMTFNLIGNLMLSKDLFDSKCKEGYEFFEAMDKVM  220



>ref|XP_012066000.1| PREDICTED: cytochrome P450 76A1-like [Jatropha curcas]
 gb|KDP43102.1| hypothetical protein JCGZ_27051 [Jatropha curcas]
Length=512

 Score =   183 bits (464),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 87/178 (49%), Positives = 126/178 (71%), Gaps = 3/178 (2%)
 Frame = +1

Query  295  VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT  474
            + GN+L LG+ PH+T+  ++ KYG V+WL +G  +T+ I SAKAA ELFKNHD++F+DR 
Sbjct  47   IFGNILHLGSMPHRTLYNLRFKYGPVLWLSLGCSNTLVIQSAKAAEELFKNHDITFSDRK  106

Query  475  VIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIE  654
            V +      YY GSLAF  YGSYW+ LRR  TVEL   K+IN++  +R+KCID M+ +IE
Sbjct  107  VPESWTAHNYYQGSLAFGRYGSYWQFLRRTVTVELMTSKKINDSALIRQKCIDKMIEYIE  166

Query  655  KE-ASSVQRGTG--VHVAHFVFLSTFNLLGNLFLSRDLVDPMSDKASKFFDAMTGIMQ  819
            ++ A++  +G    V VA +VF+  FNL+GNL LS+DL++  S + ++FFDAM  +M+
Sbjct  167  EDVATANAKGDSGEVVVARYVFVMAFNLIGNLVLSKDLLNAQSKEGTEFFDAMDKVME  224



>ref|XP_012086044.1| PREDICTED: cytochrome P450 76A1-like [Jatropha curcas]
 gb|KDP26153.1| hypothetical protein JCGZ_22834 [Jatropha curcas]
Length=510

 Score =   182 bits (463),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 90/177 (51%), Positives = 118/177 (67%), Gaps = 3/177 (2%)
 Frame = +1

Query  295  VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT  474
            ++GN+ DLG   H+ + E+K KYG V+ LRIGSV T+ I SAKAA ELFKNHD SF  RT
Sbjct  44   LVGNIFDLGTLAHRILYELKFKYGPVLRLRIGSVDTVVIQSAKAAMELFKNHDASFCART  103

Query  475  VIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIE  654
            V  V     Y  GSLA   +G YWR LRRIC +EL  ++RINETV +RRKCID M+  IE
Sbjct  104  VPCVFTSHNYKEGSLALGRFGPYWRTLRRICAIELLANRRINETVQIRRKCIDVMIRSIE  163

Query  655  KEASSVQ---RGTGVHVAHFVFLSTFNLLGNLFLSRDLVDPMSDKASKFFDAMTGIM  816
             + ++ +       VH+ H++FL +FNL+GNL LS+DL D    +  +FF+AM  +M
Sbjct  164  DDMAAGKASGESGKVHIPHYLFLMSFNLIGNLMLSKDLFDSKCKEGYEFFEAMDKVM  220



>ref|XP_002528654.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF33757.1| cytochrome P450, putative [Ricinus communis]
Length=514

 Score =   181 bits (460),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 100/222 (45%), Positives = 146/222 (66%), Gaps = 8/222 (4%)
 Frame = +1

Query  178  EWKY----LVW-SAIFLIPGLVFLLARKKSSSSYRlppgppglpVIGNMLDLGAFPHQTI  342
            E++Y    L W + +F +   V L  R+    + + PP PPG P+IGN+ DLGA PHQ +
Sbjct  2    EFRYSTYSLAWFTLLFSVTIAVLLTKRRPIHDAKQTPPAPPGWPIIGNIFDLGANPHQNL  61

Query  343  AEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLA  522
             ++  KYG V+WLR+G ++TM I SAKAA ELF++HD+SF DR V        Y   +LA
Sbjct  62   YKLGIKYGPVLWLRLGYINTMVIQSAKAAEELFRHHDISFCDRKVPQSFTACNYSKAALA  121

Query  523  FAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEASSVQ-RGTGVH--  693
               Y S+WR  RR  T+EL  +KRINET  +R+KCID M+ +IE++AS+ + RG      
Sbjct  122  LGRYDSHWRFHRRFVTLELMTNKRINETAVLRQKCIDKMIQYIEEDASAARARGESGELV  181

Query  694  VAHFVFLSTFNLLGNLFLSRDLVDPMSDKASKFFDAMTGIMQ  819
            ++H+VF+ +FNL+GNL  SRDL++  S++ ++FFDAM  +M+
Sbjct  182  ISHYVFVMSFNLIGNLAFSRDLLNSHSEEGTEFFDAMDKVME  223



>ref|XP_012087593.1| PREDICTED: cytochrome P450 76A1-like [Jatropha curcas]
Length=647

 Score =   183 bits (465),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 91/177 (51%), Positives = 120/177 (68%), Gaps = 3/177 (2%)
 Frame = +1

Query  295  VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT  474
            ++GN+ DLG   H+ + E+K KYG V+ LR+GSV T+ I SAKAA ELFKNHD SF DRT
Sbjct  181  LVGNIFDLGIMAHRILYELKLKYGPVLRLRLGSVDTVVIQSAKAAMELFKNHDASFCDRT  240

Query  475  VIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIE  654
            V  V+    Y  GSLA   +G YWR LRRIC +EL  ++R+NETV +RRKCID M+  IE
Sbjct  241  VPCVLTPHNYKDGSLALGRFGPYWRTLRRICAIELLANRRMNETVQIRRKCIDVMIRSIE  300

Query  655  KE--ASSVQRGTG-VHVAHFVFLSTFNLLGNLFLSRDLVDPMSDKASKFFDAMTGIM  816
             +  A      +G VH+ H++F+ TFNL+GNL LS+DL D    +  +FF+AM  +M
Sbjct  301  DDMAAGKASGESGIVHIPHYLFVMTFNLIGNLMLSKDLFDSKCKEGYEFFEAMDKVM  357


 Score =   141 bits (355),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 66/116 (57%), Positives = 83/116 (72%), Gaps = 0/116 (0%)
 Frame = +1

Query  295  VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT  474
            ++GN+ DLG   H+ + E+K KYG V+ LR+GSV T+ I SAKAA ELFKNHD SF DRT
Sbjct  44   LVGNIFDLGIMAHRILYELKLKYGPVLRLRLGSVDTVVIQSAKAAMELFKNHDASFCDRT  103

Query  475  VIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDML  642
            V  V+    Y  GSLA   +G YWR LRRIC +EL  ++R+NETV +RRKCID M+
Sbjct  104  VPCVLTPHNYKDGSLALGRFGPYWRTLRRICAIELLANRRMNETVQIRRKCIDVMI  159



>ref|XP_002528650.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF33753.1| cytochrome P450, putative [Ricinus communis]
Length=504

 Score =   181 bits (459),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 94/211 (45%), Positives = 141/211 (67%), Gaps = 3/211 (1%)
 Frame = +1

Query  196  WSAIFLIPGLVFLLARKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAEMKNKYGSVI  375
            ++ +F++  +V L  R+   ++ + PPGPP  P+IGN+ DLG  PHQ + +++ KYG V+
Sbjct  16   FTLLFVLTIVVLLKKRRPRHNAKQRPPGPPAWPIIGNIFDLGGNPHQNLYKLRFKYGPVL  75

Query  376  WLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPYGSYWRVL  555
            WLR+G ++T+ I S KAA ELFK HD+SF+DR V        +   SLA   Y S+WR  
Sbjct  76   WLRLGCINTLVIQSTKAAEELFKRHDISFSDRKVPQSFTAHNFNKASLALGQYDSHWRFH  135

Query  556  RRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEASSVQ-RGTGVH--VAHFVFLSTFN  726
            RR  T+EL   KR++ET  +R+KCID+M+ +IE +AS+ + RG      ++H VF+ +FN
Sbjct  136  RRFVTLELMTKKRVHETAAIRQKCIDNMIRYIEDDASAARARGESGELVISHHVFVLSFN  195

Query  727  LLGNLFLSRDLVDPMSDKASKFFDAMTGIMQ  819
            L+GNL LSRDL++  S++ +KFFDAM   M+
Sbjct  196  LIGNLVLSRDLLNSHSEEGTKFFDAMGKAME  226



>ref|XP_011094433.1| PREDICTED: cytochrome P450 76A1-like [Sesamum indicum]
Length=511

 Score =   179 bits (455),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 76/171 (44%), Positives = 116/171 (68%), Gaps = 3/171 (2%)
 Frame = +1

Query  298  IGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTV  477
            +GN+ DLG  PHQT  +++ KYG VIWL++G+V+TM + SA+ A ELFK  D+ FADR  
Sbjct  45   VGNIFDLGEIPHQTFYQLQAKYGPVIWLKLGAVNTMVVQSAETATELFKKCDLPFADRKA  104

Query  478  IDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEK  657
             D +    Y+ GS+A   Y  YWR LRRIC  E  VHKR++ ++P+RR C++  + WI++
Sbjct  105  PDSLTALDYHQGSVAIGAYREYWRTLRRICMTEFLVHKRVDASIPIRRNCLEKTIKWIKE  164

Query  658  EASSVQRGTG---VHVAHFVFLSTFNLLGNLFLSRDLVDPMSDKASKFFDA  801
            +    ++  G   + +  F+FL++FN++GNL LSR++++   DKA +FFDA
Sbjct  165  DVEKSKKNGGSGEIQLDRFLFLNSFNIIGNLMLSREVMESKLDKAGEFFDA  215



>ref|XP_011094434.1| PREDICTED: cytochrome P450 76A1-like [Sesamum indicum]
Length=511

 Score =   179 bits (453),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 96/220 (44%), Positives = 142/220 (65%), Gaps = 3/220 (1%)
 Frame = +1

Query  169  MEWEWKYLVWSAIFLIPGLVFLLARKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAE  348
            MEW    +   AI +  GL+ L+   +  +S + PPGP G+P+ GN+L LG  PH+T+ +
Sbjct  1    MEWALTSINPLAISIFAGLLLLVLFLRPKNSGKKPPGPKGVPIFGNLLQLGDLPHETMHK  60

Query  349  MKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFA  528
             K  YG VIWL++GSV TM +  A +A+ELFK HD+ FADR V DV+    +  G+L   
Sbjct  61   WKQTYGPVIWLKLGSVYTMVVQDAASASELFKKHDLPFADRKVPDVLTAYDFNQGTLGMN  120

Query  529  PYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWI--EKEASSVQRGTG-VHVA  699
             +G +WRVLRR+C++E  V+KR+NET  +R +  ++M  WI  E  A+  Q GTG + ++
Sbjct  121  QFGGHWRVLRRLCSMEFLVNKRMNETTELRHRIRENMERWILEESAAARAQGGTGAIQLS  180

Query  700  HFVFLSTFNLLGNLFLSRDLVDPMSDKASKFFDAMTGIMQ  819
             F+FL  FNL+GNL LSRDL+D    ++ +FFD M  +++
Sbjct  181  RFLFLLAFNLVGNLMLSRDLLDAKDPESREFFDCMNKVLE  220



>ref|XP_012086045.1| PREDICTED: cytochrome P450 76A1-like [Jatropha curcas]
Length=510

 Score =   177 bits (450),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 88/177 (50%), Positives = 117/177 (66%), Gaps = 3/177 (2%)
 Frame = +1

Query  295  VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT  474
            ++GN+  LG   H+ + E K KYG V+ LRIGS+ T+ I SAKAA ELFKNHD SF DRT
Sbjct  44   LVGNIFYLGTLAHRILYEHKFKYGPVLRLRIGSMDTVVIQSAKAAMELFKNHDASFCDRT  103

Query  475  VIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIE  654
            V  V     Y  GSLA   +G YWR LRRIC +EL  ++RINETV +RRKCID M+  IE
Sbjct  104  VPCVFTSHNYKEGSLALGRFGPYWRTLRRICAIELLANRRINETVQIRRKCIDVMIRSIE  163

Query  655  KEASSVQ---RGTGVHVAHFVFLSTFNLLGNLFLSRDLVDPMSDKASKFFDAMTGIM  816
             + ++ +       VH+ H++FL +FNL+GNL LS+DL D    +  +FF+AM  ++
Sbjct  164  DDMAAGKASGESGKVHIPHYLFLMSFNLIGNLMLSKDLFDSKCKEGYEFFEAMDKVV  220



>ref|XP_012084533.1| PREDICTED: cytochrome P450 76A1-like [Jatropha curcas]
 gb|KDP27489.1| hypothetical protein JCGZ_20024 [Jatropha curcas]
Length=510

 Score =   176 bits (447),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 86/174 (49%), Positives = 115/174 (66%), Gaps = 3/174 (2%)
 Frame = +1

Query  304  NMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVID  483
            N+ DLG   H+ + E+K KYG V+ LRIG V T+ I SAKA  ELFKNHD SF DRTV  
Sbjct  47   NIFDLGTMAHRILYELKFKYGPVLRLRIGLVDTVVIQSAKAVMELFKNHDASFCDRTVPC  106

Query  484  VMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEA  663
            V+    Y  GS+A   +G YWR +RRIC +EL  ++RINETV +RRKCID M+  IE + 
Sbjct  107  VLTSHNYKEGSIAVGRFGPYWRTIRRICAIELLANRRINETVQIRRKCIDVMIRSIEDDM  166

Query  664  SSVQ---RGTGVHVAHFVFLSTFNLLGNLFLSRDLVDPMSDKASKFFDAMTGIM  816
            ++ +       VH+ H++F+ TFNL+GNL LS+DL D    +  +FF+AM  +M
Sbjct  167  AAGKASGESGKVHIPHYLFVMTFNLIGNLMLSKDLFDSKCKEGYEFFEAMDKVM  220



>ref|XP_006381328.1| hypothetical protein POPTR_0006s11830g, partial [Populus trichocarpa]
 gb|ERP59125.1| hypothetical protein POPTR_0006s11830g, partial [Populus trichocarpa]
Length=343

 Score =   167 bits (423),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 84/178 (47%), Positives = 120/178 (67%), Gaps = 11/178 (6%)
 Frame = +1

Query  295  VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT  474
            V GN+ DLGA PHQT+ ++K KYG VIWL++G  +T+ I SA+ AA LFKNHD++F+DR 
Sbjct  19   VFGNIFDLGAIPHQTLYKLKEKYGPVIWLKLGYTNTLVIQSAETAAGLFKNHDLAFSDRK  78

Query  475  VIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIE  654
            V+ V     YY GSLA A       +L +    +  + K+I++T  +R+KCIDDM+ +IE
Sbjct  79   VLLVFTAHNYYQGSLALA------SLLNKAH--DKLITKQIDQTAVLRQKCIDDMIRYIE  130

Query  655  KEASSVQ-RGTGVHV--AHFVFLSTFNLLGNLFLSRDLVDPMSDKASKFFDAMTGIMQ  819
            ++ +  Q +G    +  AH++FL TFNL+GNL LSRDLV+P S    KF+DAM  +M+
Sbjct  131  EDVAEAQAQGESGEIKGAHYLFLMTFNLIGNLVLSRDLVNPRSKDGHKFYDAMNNVMK  188



>ref|XP_002528649.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF33752.1| cytochrome P450, putative [Ricinus communis]
Length=524

 Score =   162 bits (411),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 78/176 (44%), Positives = 117/176 (66%), Gaps = 3/176 (2%)
 Frame = +1

Query  295  VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT  474
            + GN+ DLG  PH+ + + + KYG V+WLR+G  +T+ I SA+AA ELFKNHD+SF DR 
Sbjct  56   IFGNIFDLGTIPHRNLYKFRYKYGPVLWLRLGFTNTLVIQSARAAEELFKNHDISFCDRK  115

Query  475  VIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIE  654
            V D      Y  G+++   YGS WR  RR+ T++L  +KRI E+  +R KCI+ M+ +IE
Sbjct  116  VPDCCTAHNYDQGAVSLGRYGSIWRFHRRLITLDLMTNKRIKESAFLRIKCINSMIQYIE  175

Query  655  KEASSVQ-RGT--GVHVAHFVFLSTFNLLGNLFLSRDLVDPMSDKASKFFDAMTGI  813
            ++ ++ + RG    V +AH++F+ TFNL+GNL LS+DL +  S++  +F  AM  I
Sbjct  176  EDTAAARARGELGEVVIAHYLFVMTFNLIGNLVLSQDLANSQSNEGLEFSHAMDKI  231



>gb|KCW84357.1| hypothetical protein EUGRSUZ_B012102, partial [Eucalyptus grandis]
Length=166

 Score =   152 bits (385),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 69/127 (54%), Positives = 92/127 (72%), Gaps = 0/127 (0%)
 Frame = +1

Query  295  VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT  474
            VIGN+LDLG  PHQ +   + ++G V WL++GSV+TM I SA+AAAE FK HD++FADR 
Sbjct  40   VIGNILDLGIMPHQNLHSFRAEHGPVTWLKLGSVNTMVIQSAQAAAEFFKGHDLAFADRK  99

Query  475  VIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIE  654
                +   GY  GSLA   YG YWRVLRR+C+VEL V KRINET  +R+KC+D M+ ++E
Sbjct  100  CPHALTALGYDQGSLAVGRYGGYWRVLRRLCSVELLVTKRINETAHLRQKCVDSMIGYLE  159

Query  655  KEASSVQ  675
            +E ++ Q
Sbjct  160  EEMAAKQ  166



>gb|AJD25179.1| cytochrome P450 CYP76A35 [Salvia miltiorrhiza]
Length=503

 Score =   159 bits (402),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 91/205 (44%), Positives = 133/205 (65%), Gaps = 3/205 (1%)
 Frame = +1

Query  190  LVWSAIFLIPGLVFLLARKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAEMKNKYGS  369
            L W  I  +  L+F    K  SS  RLPPGPPG P+IGN+ DLG  PH+    ++++YG 
Sbjct  7    LTWFTISFLVALLFWFKLKNRSSKLRLPPGPPGWPIIGNIFDLGTQPHRDFHILQSRYGP  66

Query  370  VIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPYGSYWR  549
            V+WL++G+++T+ + SA AAAELFK +D++FADR   D M    Y  GSLA APY  YWR
Sbjct  67   VLWLKLGNLNTVVVQSAAAAAELFKRNDLAFADRKTPDSMTACDYINGSLAQAPYNEYWR  126

Query  550  VLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEASSVQRGTGVHVAHFVFLSTFNL  729
            +LRR+ + EL V KRIN +   R+KCID M+ WI ++AS       + +  ++ + +FNL
Sbjct  127  ILRRLSSSELMVQKRINSSAQQRKKCIDKMIQWIREDASEFGE---IQLDRYLLIMSFNL  183

Query  730  LGNLFLSRDLVDPMSDKASKFFDAM  804
            + N  L+RD++D  S+  ++F +AM
Sbjct  184  VSNFMLTRDIMDFKSEMGNEFLEAM  208



>emb|CBI30229.3| unnamed protein product [Vitis vinifera]
Length=514

 Score =   158 bits (400),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 85/191 (45%), Positives = 123/191 (64%), Gaps = 2/191 (1%)
 Frame = +1

Query  100  KHRLTRI*VTWKLQNLKSKNF*EMEWEWKYLV-WSAIFLIPGLVFL-LARKKSSSSYRlp  273
            K  L  + V W     +++   +ME     +V WS  F    L+FL L +    S+   P
Sbjct  25   KKNLYGVHVVWGGPKRRTQAETKMELSTASIVFWSCFFSAALLLFLRLIKFTKGSTKSTP  84

Query  274  pgppglpVIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHD  453
            PGP G P+ GN+ DLG  PHQT+  ++ ++G V+WL++G+++TM + SAKAAAELFKNHD
Sbjct  85   PGPQGWPIFGNIFDLGTLPHQTLYRLRPQHGPVLWLQLGAINTMVVQSAKAAAELFKNHD  144

Query  454  VSFADRTVIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCID  633
            +SF+DR V   +    Y  GS+A   YG YWR++R++C  EL V+KRINE   +RRKC+D
Sbjct  145  LSFSDRNVPFTLTAHNYDQGSMALGKYGPYWRMIRKVCASELLVNKRINEMGSLRRKCVD  204

Query  634  DMLLWIEKEAS  666
            DM+ WIE++A+
Sbjct  205  DMIRWIEEDAA  215



>gb|KCW84346.1| hypothetical protein EUGRSUZ_B011962, partial [Eucalyptus grandis]
Length=169

 Score =   149 bits (376),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 65/127 (51%), Positives = 89/127 (70%), Gaps = 0/127 (0%)
 Frame = +1

Query  295  VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT  474
            VIGN+ DLG  PHQ +  ++ K+G V+WL++GSV+TM I SA+AA ELFK HD  FADR 
Sbjct  40   VIGNIFDLGTMPHQNLHNLRAKHGPVLWLKLGSVNTMVIQSARAAMELFKGHDFVFADRK  99

Query  475  VIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIE  654
                    GY  GSLA   +G YWR LRR+C+ EL V+KR+N+T  +R+KC+D M+++IE
Sbjct  100  CSQAFTALGYDQGSLALGRHGDYWRALRRLCSAELLVNKRVNDTAHLRQKCVDSMIMYIE  159

Query  655  KEASSVQ  675
            +E +  Q
Sbjct  160  EEMAVKQ  166



>gb|KDP43097.1| hypothetical protein JCGZ_27046 [Jatropha curcas]
Length=493

 Score =   152 bits (385),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 85/200 (43%), Positives = 123/200 (62%), Gaps = 20/200 (10%)
 Frame = +1

Query  223  LVFLLARK-KSSSSYRlppgppglpVIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVS  399
            L+ L  RK +  ++ R PPGP   P+ GN+LDLG+ PH+T+ +++ KYG V+WLR+G  +
Sbjct  22   LLLLNQRKARHGANRRRPPGPKAWPIFGNILDLGSMPHRTLYKLRFKYGPVLWLRLGCAN  81

Query  400  TMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVEL  579
            T+ I SAKAA ELFKNHD++F+DR V +      YY GSL+   YGSYWR LRRI TVEL
Sbjct  82   TLVIQSAKAAEELFKNHDITFSDRKVAESWTAHNYYQGSLSLGRYGSYWRFLRRIVTVEL  141

Query  580  FVHKRINETVPVRRKCIDDMLLWIEKEASSVQRGTGVHVAHFVFLSTFNLLGNLFLSRDL  759
               K+INE+  +R+KCID M  +IE++ ++                  N  G+     DL
Sbjct  142  MTSKKINESTLIRQKCIDKMTEYIEEDVAAA-----------------NAKGD--SGEDL  182

Query  760  VDPMSDKASKFFDAMTGIMQ  819
            ++  S + ++F  AM  +M+
Sbjct  183  LNARSKEGTEFSGAMDEVME  202



>gb|KCW84356.1| hypothetical protein EUGRSUZ_B01208 [Eucalyptus grandis]
Length=441

 Score =   151 bits (382),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 69/127 (54%), Positives = 90/127 (71%), Gaps = 0/127 (0%)
 Frame = +1

Query  295  VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT  474
            VIGN+LDLG  PHQ +   + K+G V WL++GSV+TM I SA+AAAE FK HD +FADR 
Sbjct  39   VIGNILDLGTTPHQNLHHFRAKHGPVTWLKLGSVNTMVIQSAQAAAEFFKGHDFAFADRK  98

Query  475  VIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIE  654
                M    Y  GSLA   YG YWRVLRR+C+VEL V KR+NET  +R+KC+D+M+ ++E
Sbjct  99   CPHAMTALNYDQGSLAVGRYGGYWRVLRRLCSVELLVTKRVNETAHLRQKCVDNMVAYLE  158

Query  655  KEASSVQ  675
            +E +  Q
Sbjct  159  EEMAVKQ  165



>ref|XP_008241321.1| PREDICTED: cytochrome P450 76A1 [Prunus mume]
Length=516

 Score =   151 bits (382),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 88/212 (42%), Positives = 129/212 (61%), Gaps = 2/212 (1%)
 Frame = +1

Query  190  LVWSAIFLIPGLVFLLARKKSSSSYRlppgppglpVIGNMLDLG-AFPHQTIAEMKNKYG  366
            L+W A+ +I  +  L  R+    +  LPPGP   PV+GN+  LG   PH++ A +   +G
Sbjct  3    LIWVALSIILLVTHLRRRRLEEVAGHLPPGPRWWPVVGNIFQLGLGPPHESFAILARNHG  62

Query  367  SVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPYGSYW  546
             ++ L +GS+ST+ I S++ A E+FKNHDV  A R + + MK      GSL  A YG +W
Sbjct  63   PIMTLWLGSMSTVVISSSQVAREMFKNHDVVLAGRKIYEAMKGDYGNEGSLITAQYGPHW  122

Query  547  RVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEASSVQRGT-GVHVAHFVFLSTF  723
            R+LRR+CT E FV  R++    VR KCID M+ +IE  AS +   T G+ +  F+FL  F
Sbjct  123  RMLRRLCTTEFFVTSRLDAMCRVRAKCIDGMVQFIEDAASEMSTKTDGIDLGRFIFLMAF  182

Query  724  NLLGNLFLSRDLVDPMSDKASKFFDAMTGIMQ  819
            NL+GNL  S+DL+DP S++ + FF     +M+
Sbjct  183  NLIGNLMFSKDLLDPKSERGAMFFYHAGKVME  214



>ref|XP_007201998.1| hypothetical protein PRUPE_ppa022979mg [Prunus persica]
 gb|EMJ03197.1| hypothetical protein PRUPE_ppa022979mg [Prunus persica]
Length=528

 Score =   149 bits (377),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 76/177 (43%), Positives = 111/177 (63%), Gaps = 2/177 (1%)
 Frame = +1

Query  295  VIGNMLDLG-AFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADR  471
            ++GN+  LG   PH++ A +   +G ++ L +GS+ST+ I S++ A E+FKNHDV  A R
Sbjct  50   MVGNIFQLGLGPPHESFAMLARNHGPIMTLWLGSMSTVVISSSQVAREMFKNHDVVLAGR  109

Query  472  TVIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWI  651
             + + MK      GSL  A YG +WR+LRR+CT E FV  RI+    VR KCID M+ +I
Sbjct  110  KIYEAMKGDYGNEGSLITAQYGPHWRMLRRLCTTEFFVTSRIDAMCRVRAKCIDGMVQFI  169

Query  652  EKEASSVQRGT-GVHVAHFVFLSTFNLLGNLFLSRDLVDPMSDKASKFFDAMTGIMQ  819
            E  AS +   T G+ +  F+FL  FNL+GNL  S+DL+DP S++ + FF     +M+
Sbjct  170  EDAASEMSTKTDGIDLGRFIFLMAFNLIGNLMFSKDLLDPKSERGAMFFYHAGKVME  226



>ref|XP_009613392.1| PREDICTED: cytochrome P450 76A2-like [Nicotiana tomentosiformis]
Length=453

 Score =   148 bits (373),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 66/114 (58%), Positives = 87/114 (76%), Gaps = 0/114 (0%)
 Frame = +1

Query  478  IDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEK  657
            +D+  V  Y   SLA APYG+YWR+LRRICT E+F +KRINETV +RRKCID ML WI+K
Sbjct  45   VDLEVVHNYNSSSLALAPYGTYWRMLRRICTTEMFTNKRINETVHLRRKCIDYMLQWIDK  104

Query  658  EASSVQRGTGVHVAHFVFLSTFNLLGNLFLSRDLVDPMSDKASKFFDAMTGIMQ  819
            EA+S++ G GV V+ FV+L++FN++GNL LS DLVDP S  AS FF  +  +++
Sbjct  105  EANSLENGKGVEVSRFVYLASFNMIGNLMLSHDLVDPESKTASDFFTTLKKVIE  158



>gb|KDP24879.1| hypothetical protein JCGZ_25132 [Jatropha curcas]
Length=160

 Score =   140 bits (353),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 66/116 (57%), Positives = 83/116 (72%), Gaps = 0/116 (0%)
 Frame = +1

Query  295  VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT  474
            ++GN+ DLG   H+ + E+K KYG V+ LR+GSV T+ I SAKAA ELFKNHD SF DRT
Sbjct  44   LVGNIFDLGIMAHRILYELKLKYGPVLRLRLGSVDTVVIQSAKAAMELFKNHDASFCDRT  103

Query  475  VIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDML  642
            V  V+    Y  GSLA   +G YWR LRRIC +EL  ++R+NETV +RRKCID M+
Sbjct  104  VPCVLTPHNYKDGSLALGRFGPYWRTLRRICAIELLANRRMNETVQIRRKCIDVMI  159



>gb|KDP43103.1| hypothetical protein JCGZ_27052 [Jatropha curcas]
Length=330

 Score =   144 bits (364),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 73/160 (46%), Positives = 98/160 (61%), Gaps = 2/160 (1%)
 Frame = +1

Query  340  IAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSL  519
            I  ++      + LR+G V T+    AKAA ELFKNHD  F DR V  V+    Y  GSL
Sbjct  4    ITNLQGHQDGRLSLRLGLVDTVVTQLAKAATELFKNHDARFCDRMVPYVLTSHNYCEGSL  63

Query  520  AFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEASSVQRGTG--VH  693
            A   +G YWR+LRR+C  EL  +KRINETV +R KCID  +  IE   ++  +G    V 
Sbjct  64   AIGRFGPYWRMLRRVCAAELLANKRINETVHIRHKCIDQRIWSIEDNLTAANKGESGKVK  123

Query  694  VAHFVFLSTFNLLGNLFLSRDLVDPMSDKASKFFDAMTGI  813
            VAH++FL +FNL+GNL LS+DL+D    +  +FF+A+  I
Sbjct  124  VAHYLFLMSFNLIGNLSLSKDLLDSKCKEGYEFFEALDKI  163



>emb|CDP15345.1| unnamed protein product [Coffea canephora]
Length=480

 Score =   146 bits (369),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 79/168 (47%), Positives = 107/168 (64%), Gaps = 3/168 (2%)
 Frame = +1

Query  193  VWSAIFLIPGLVF-LLARKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAEMKNKYGS  369
            V S + L+    F L+ R+  S   R PPGP G P+ GNM +LG  PHQT+   KNKYG 
Sbjct  18   VSSGLLLVVLFAFSLIKRRFGSPDKRRPPGPLGWPIFGNMFELGELPHQTMYRWKNKYGP  77

Query  370  VIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPYGSYWR  549
            V+WL++GS++TM + +A AAAELFK HDV FADR V D +    +  G+L    +G +WR
Sbjct  78   VMWLQLGSINTMVVQNATAAAELFKKHDVPFADRKVPDTLTAFDFNQGTLGMNTFGGHWR  137

Query  550  VLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKE--ASSVQRGTG  687
            VLRR+C++E  V+KR+NET  +R +   +M+ WIE E   S  Q G G
Sbjct  138  VLRRLCSMEFLVNKRMNETTDLRNRLERNMVAWIEDEHRTSKAQGGDG  185



>ref|XP_004246575.1| PREDICTED: cytochrome P450 76A1-like [Solanum lycopersicum]
Length=514

 Score =   146 bits (369),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 74/175 (42%), Positives = 109/175 (62%), Gaps = 2/175 (1%)
 Frame = +1

Query  295  VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT  474
            ++ N+   G  PH + A++ NK+G ++ L +GS++T+ I S + A E+FKNHD+  A R 
Sbjct  44   LLANIFQSGFAPHVSFAKLANKHGPMMTLWLGSMTTIVISSNEVAREMFKNHDIVLAGRK  103

Query  475  VIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIE  654
            + + MK      GSL    YG  WR+LRR+CT E F+  R++    VR KCID ML ++E
Sbjct  104  IYESMKGDIGNEGSLITNQYGPQWRMLRRLCTTEFFITSRLDAMRGVRTKCIDQMLEFME  163

Query  655  KEASSVQRGTGVHVAHFVFLSTFNLLGNLFLSRDLVDPMSDKASKFFDAMTGIMQ  819
              A+S    T + V  F FL +FNL+GNL +S+DLVDP SD+ +KFF     +M+
Sbjct  164  DAANSST--TSIDVGRFFFLMSFNLIGNLMISKDLVDPTSDRGAKFFYHAGKVME  216



>emb|CAB86901.1| cytochrome P450-like protein [Arabidopsis thaliana]
Length=512

 Score =   146 bits (368),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 74/177 (42%), Positives = 111/177 (63%), Gaps = 5/177 (3%)
 Frame = +1

Query  295  VIGNMLDL-GAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADR  471
            VIGN+  L G  PH ++ ++  ++G ++ LRIGS+ T+ I S++ A E+FK HD + A R
Sbjct  45   VIGNIFQLAGLPPHDSLTKLSRRHGPIMTLRIGSMLTVVISSSEVAREIFKKHDAALAGR  104

Query  472  TVIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWI  651
             + + MK      GSL  A YG+YWR+LRR+CT + FV +R++    VR +C+D ML ++
Sbjct  105  KIYEAMKGGKSSDGSLITAQYGAYWRMLRRLCTTQFFVTRRLDAMSDVRSRCVDQMLRFV  164

Query  652  EKEASSVQRGTG-VHVAHFVFLSTFNLLGNLFLSRDLVDPMSDKASKFFDAMTGIMQ  819
            E+     Q GT  + V  + FL  FNL+GNL  SRDL+DP S + S+FF     +M+
Sbjct  165  EEGG---QNGTKTIDVGRYFFLMAFNLIGNLMFSRDLLDPDSKRGSEFFYHTGKVME  218



>dbj|BAC42682.1| putative cytochrome P450 [Arabidopsis thaliana]
Length=516

 Score =   146 bits (368),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 74/177 (42%), Positives = 111/177 (63%), Gaps = 5/177 (3%)
 Frame = +1

Query  295  VIGNMLDL-GAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADR  471
            VIGN+  L G  PH ++ ++  ++G ++ LRIGS+ T+ I S++ A E+FK HD + A R
Sbjct  45   VIGNIFQLAGLPPHDSLTKLSRRHGPIMTLRIGSMLTVVISSSEVAREIFKKHDAALAGR  104

Query  472  TVIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWI  651
             + + MK      GSL  A YG+YWR+LRR+CT + FV +R++    VR +C+D ML ++
Sbjct  105  EIYEAMKGGKSSDGSLITAQYGAYWRMLRRLCTTQFFVTRRLDAMSDVRSRCVDQMLRFV  164

Query  652  EKEASSVQRGTG-VHVAHFVFLSTFNLLGNLFLSRDLVDPMSDKASKFFDAMTGIMQ  819
            E+     Q GT  + V  + FL  FNL+GNL  SRDL+DP S + S+FF     +M+
Sbjct  165  EEGG---QNGTKTIDVGRYFFLMAFNLIGNLMFSRDLLDPDSKRGSEFFYHTGKVME  218



>ref|NP_190865.2| cytochrome P450, family 76, subfamily G, polypeptide 1 [Arabidopsis 
thaliana]
 gb|AEE79019.1| cytochrome P450, family 76, subfamily G, polypeptide 1 [Arabidopsis 
thaliana]
Length=516

 Score =   146 bits (368),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 74/177 (42%), Positives = 111/177 (63%), Gaps = 5/177 (3%)
 Frame = +1

Query  295  VIGNMLDL-GAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADR  471
            VIGN+  L G  PH ++ ++  ++G ++ LRIGS+ T+ I S++ A E+FK HD + A R
Sbjct  45   VIGNIFQLAGLPPHDSLTKLSRRHGPIMTLRIGSMLTVVISSSEVAREIFKKHDAALAGR  104

Query  472  TVIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWI  651
             + + MK      GSL  A YG+YWR+LRR+CT + FV +R++    VR +C+D ML ++
Sbjct  105  KIYEAMKGGKSSDGSLITAQYGAYWRMLRRLCTTQFFVTRRLDAMSDVRSRCVDQMLRFV  164

Query  652  EKEASSVQRGTG-VHVAHFVFLSTFNLLGNLFLSRDLVDPMSDKASKFFDAMTGIMQ  819
            E+     Q GT  + V  + FL  FNL+GNL  SRDL+DP S + S+FF     +M+
Sbjct  165  EEGG---QNGTKTIDVGRYFFLMAFNLIGNLMFSRDLLDPDSKRGSEFFYHTGKVME  218



>ref|XP_011466802.1| PREDICTED: cytochrome P450 76A1-like [Fragaria vesca subsp. vesca]
Length=528

 Score =   145 bits (367),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 76/181 (42%), Positives = 112/181 (62%), Gaps = 6/181 (3%)
 Frame = +1

Query  295  VIGNMLDLG-AFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADR  471
            V+GN+  LG A PH++ A +  K+G ++ L +GS++T+ I S+  A E+FKNHDV  A R
Sbjct  46   VVGNIFQLGWAPPHESFAILARKHGPIMTLWLGSMTTVVISSSNVAREMFKNHDVVLAGR  105

Query  472  TVIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWI  651
             + + MK      GSL  A YGS+WR+LRR+C  E FV  R++    VR +CID M+ +I
Sbjct  106  KIYEAMKGDYGNEGSLITAQYGSHWRMLRRLCNTEFFVSSRLDAMRGVRGRCIDRMVQFI  165

Query  652  EKEASSVQRGTGVH-----VAHFVFLSTFNLLGNLFLSRDLVDPMSDKASKFFDAMTGIM  816
            E  ++S +   GV+     V  F FL  FNL+GNL  S+DL+DP S++ + FF     +M
Sbjct  166  EDASTSDKSDNGVNVKSIDVGRFFFLMAFNLIGNLMFSKDLLDPKSERGAGFFYHAGNVM  225

Query  817  Q  819
            +
Sbjct  226  E  226



>ref|XP_008392536.1| PREDICTED: cytochrome P450 76A1 [Malus domestica]
Length=529

 Score =   145 bits (366),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 89/224 (40%), Positives = 132/224 (59%), Gaps = 16/224 (7%)
 Frame = +1

Query  181  WKYLVWSAIFLIPGLVFLLAR-----KKSSSSYRlppgppglpVIGNMLDLG-AFPHQTI  342
            W  L+W A       + LLAR     +    + +LPPGP   PV+GN+  LG   PH+++
Sbjct  12   WVVLIWVAT-----AILLLARQLRRWRSEDVAGQLPPGPRRWPVVGNIFQLGLGPPHESL  66

Query  343  AEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLA  522
            A +   +G ++ L +GS+ST+ I S++ A E+FKNHDV+ A R + + MK      GSL 
Sbjct  67   AVLARNHGPIMTLWLGSMSTVVISSSQVAREMFKNHDVALAGRKIYEAMKGDYGNEGSLI  126

Query  523  FAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWI----EKEASSVQRGT-G  687
             A YG +WR+LRR+CT E FV  R++    VR KCID ML +I     + +S +   T G
Sbjct  127  TAQYGPHWRMLRRLCTTEFFVTSRLDAMRGVRGKCIDGMLQFIMDASSRTSSEISASTDG  186

Query  688  VHVAHFVFLSTFNLLGNLFLSRDLVDPMSDKASKFFDAMTGIMQ  819
            + +  F+FL  FNL+GNL  S+DL+DP S++ + FF     +M+
Sbjct  187  IDLGRFIFLMAFNLIGNLIFSKDLLDPKSERGAMFFYHAGKVME  230



>ref|XP_002877896.1| CYP76G1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH54155.1| CYP76G1 [Arabidopsis lyrata subsp. lyrata]
Length=516

 Score =   145 bits (366),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 74/177 (42%), Positives = 110/177 (62%), Gaps = 5/177 (3%)
 Frame = +1

Query  295  VIGNMLDL-GAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADR  471
            VIGNM  L G+ PH ++ ++  ++G ++ LRI S+ T+ I S++ A E+FK HD   A R
Sbjct  45   VIGNMFQLAGSPPHDSLTKLSRRHGPIMSLRIASMLTVVISSSEVAREIFKKHDAVLAGR  104

Query  472  TVIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWI  651
             + + MK      GSL  A YG+YWR+LRR+CT + FV +R++    VR +C+D ML ++
Sbjct  105  KIYEAMKGGKSSDGSLITAQYGAYWRMLRRLCTTQFFVTRRLDAMSDVRSRCVDQMLRFV  164

Query  652  EKEASSVQRGTG-VHVAHFVFLSTFNLLGNLFLSRDLVDPMSDKASKFFDAMTGIMQ  819
            E+     Q GT  + V  + FL  FNL+GNL  SRDL+DP S + S+FF     +M+
Sbjct  165  EEGG---QNGTKTIDVGRYFFLMAFNLIGNLMFSRDLLDPDSKRGSEFFYHTGKVME  218



>ref|XP_002528643.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF33746.1| cytochrome P450, putative [Ricinus communis]
Length=525

 Score =   145 bits (366),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 75/176 (43%), Positives = 113/176 (64%), Gaps = 4/176 (2%)
 Frame = +1

Query  295  VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT  474
            ++GNM  LG  PH++ A++   +G ++ + +GS+ T+ I S +AA ++FKNHD+  A R 
Sbjct  45   IVGNMFQLGWSPHESFAKLARIHGPIMTIWLGSMCTVVISSDRAAHDMFKNHDMVLAGRK  104

Query  475  VIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIE  654
            + + MK      GS+  + YGS+WR+LRR+C+ E FV  R++    VR +CID M+ +IE
Sbjct  105  IYEAMKGDIGNEGSIITSQYGSHWRMLRRLCSTEFFVTSRLDAMRGVRSRCIDGMVQFIE  164

Query  655  KEASSVQRGT-GVHVAHFVFLSTFNLLGNLFLSRDLVDPMSDKASKFFDAMTGIMQ  819
             EAS    GT  + V  F FL +FNL+GNL  S+DL+DP S+K SKFF     +M+
Sbjct  165  -EASG--NGTQAIDVGRFFFLMSFNLIGNLLFSKDLLDPKSEKGSKFFYHAGKVME  217



>ref|XP_006341260.1| PREDICTED: cytochrome P450 76A2-like [Solanum tuberosum]
Length=509

 Score =   145 bits (365),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 72/175 (41%), Positives = 108/175 (62%), Gaps = 2/175 (1%)
 Frame = +1

Query  295  VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT  474
            ++ N+   G  PH + A++ NK+G ++ L +GS++T+ I S + A E+FKNHD+  A R 
Sbjct  44   LVTNIFQSGFAPHVSFAKLANKHGPIMTLWLGSMTTVVISSNEVAREMFKNHDIVLAGRK  103

Query  475  VIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIE  654
            + + MK      GSL    YG  WR+LRR+CT E F+  R++    VR KCID M+ ++E
Sbjct  104  IYESMKGDIGNEGSLITNQYGPQWRMLRRLCTTEFFITSRLDAMRGVRTKCIDQMIKFME  163

Query  655  KEASSVQRGTGVHVAHFVFLSTFNLLGNLFLSRDLVDPMSDKASKFFDAMTGIMQ  819
               +S    T + V  F FL +FNL+GNL +S+DLVDP SD+ +KFF     +M+
Sbjct  164  DAGNSGT--TSIDVGRFFFLMSFNLIGNLLISKDLVDPTSDRGAKFFYHAGKVME  216



>ref|XP_011036815.1| PREDICTED: cytochrome P450 76A1-like [Populus euphratica]
Length=517

 Score =   144 bits (363),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 68/175 (39%), Positives = 107/175 (61%), Gaps = 2/175 (1%)
 Frame = +1

Query  295  VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT  474
            V+GN+  LG  PH++ A++   +G ++ + +GS+S + I S++ A E+FKNHD   A R 
Sbjct  44   VVGNIFQLGWAPHESFAKLARVHGPIMTIWLGSMSNVVISSSEVAREMFKNHDAVLAGRK  103

Query  475  VIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIE  654
            + + MK      GS+  A YG +WR+LRR+CT E FV  R++     R +CID ML +IE
Sbjct  104  IYEAMKGDFGNEGSIITAQYGPHWRMLRRLCTTEFFVTSRLDSMQGARTRCIDGMLQYIE  163

Query  655  KEASSVQRGTGVHVAHFVFLSTFNLLGNLFLSRDLVDPMSDKASKFFDAMTGIMQ  819
                S    + + +  ++FL  FNL+GNL  S+DL+DP S++ +KFF     +M+
Sbjct  164  D--GSANGTSAIDLGRYIFLMAFNLIGNLMFSKDLLDPKSERGAKFFQHAGKVME  216



>ref|XP_002528644.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF33747.1| cytochrome P450, putative [Ricinus communis]
Length=514

 Score =   144 bits (363),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 71/176 (40%), Positives = 109/176 (62%), Gaps = 4/176 (2%)
 Frame = +1

Query  295  VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT  474
            ++GNM  LG  P Q+ A++   +G ++ + +GS+ T+ I S + A ++FKNHD   A R 
Sbjct  45   IVGNMFQLGLSPQQSFAKLAGIHGPIMTIWLGSMCTVVISSNEVARDMFKNHDAVLAGRK  104

Query  475  VIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIE  654
            +++ MK +G   GS+  A YG +WR+LRR+ T E F   R++    VR +CID M+ ++E
Sbjct  105  ILEAMKGEGNNEGSMITAQYGQHWRMLRRLSTTEFFAASRLDSFQGVRSRCIDRMVQFVE  164

Query  655  KEASSVQRGT-GVHVAHFVFLSTFNLLGNLFLSRDLVDPMSDKASKFFDAMTGIMQ  819
            +     + GT  + V  FVFL  FNLLGNL  S+DL+DP S+K +KFF     +M+
Sbjct  165  EAG---RNGTQAIDVGRFVFLMAFNLLGNLMFSKDLLDPKSEKGAKFFYHAGKVME  217



>gb|EYU38602.1| hypothetical protein MIMGU_mgv1a006828mg [Erythranthe guttata]
Length=430

 Score =   143 bits (360),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 62/132 (47%), Positives = 93/132 (70%), Gaps = 0/132 (0%)
 Frame = +1

Query  403  MAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELF  582
            M + SA+AAAELFK +D+ +ADR V D +    Y+ GS+A   YG+YWR LRRICT E  
Sbjct  1    MVVQSAEAAAELFKKYDLPYADRKVPDSLTALDYHKGSVAIGAYGAYWRKLRRICTTEFL  60

Query  583  VHKRINETVPVRRKCIDDMLLWIEKEASSVQRGTGVHVAHFVFLSTFNLLGNLFLSRDLV  762
            VHKR+N ++ +R+KCIDD++ WI++E+     G G+ +  F+F+++FN +GN+ LS+D+V
Sbjct  61   VHKRVNASMKLRQKCIDDLVGWIKEESEKEYSGGGIRLDRFLFVTSFNAIGNIMLSKDVV  120

Query  763  DPMSDKASKFFD  798
                  +S+FFD
Sbjct  121  QSKEKVSSEFFD  132



>gb|KDP26150.1| hypothetical protein JCGZ_22831 [Jatropha curcas]
Length=162

 Score =   136 bits (343),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 66/116 (57%), Positives = 80/116 (69%), Gaps = 0/116 (0%)
 Frame = +1

Query  295  VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT  474
            ++GN+  LG   H+ + E K KYG V+ LRIGS+ T+ I SAKAA ELFKNHD SF DRT
Sbjct  44   LVGNIFYLGTLAHRILYEHKFKYGPVLRLRIGSMDTVVIQSAKAAMELFKNHDASFCDRT  103

Query  475  VIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDML  642
            V  V     Y  GSLA   +G YWR LRRIC +EL  ++RINETV +RRKCID M+
Sbjct  104  VPCVFTSHNYKEGSLALGRFGPYWRTLRRICAIELLANRRINETVQIRRKCIDVMI  159



>ref|XP_006293048.1| hypothetical protein CARUB_v10019335mg [Capsella rubella]
 gb|EOA25946.1| hypothetical protein CARUB_v10019335mg [Capsella rubella]
Length=517

 Score =   144 bits (362),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 72/177 (41%), Positives = 111/177 (63%), Gaps = 5/177 (3%)
 Frame = +1

Query  295  VIGNMLDL-GAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADR  471
            VIGNM  L G+ PH ++ ++  +YG ++ LR+GS+ T+ I S++ A E+FK HD + A R
Sbjct  44   VIGNMFQLAGSPPHHSLTKLSGRYGPIMALRLGSMLTVVISSSEVAREIFKKHDAALAGR  103

Query  472  TVIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWI  651
             + + MK +     SL  A YG+YWR+LRR+CT + FV +R++    VR +C++ ML ++
Sbjct  104  KIYEAMKGRDNSDASLITAQYGAYWRMLRRLCTTQFFVTRRLDAMSAVRSECVEQMLRFV  163

Query  652  EKEASSVQRGTG-VHVAHFVFLSTFNLLGNLFLSRDLVDPMSDKASKFFDAMTGIMQ  819
             +     Q GT  + V  + FL  FNL+GNL  SRDL+DP S + S+FF     +M+
Sbjct  164  MEGG---QNGTKTIDVGRYFFLMAFNLIGNLMFSRDLLDPDSKRGSEFFYHTGKVME  217



>ref|XP_010431310.1| PREDICTED: cytochrome P450 76A1-like [Camelina sativa]
Length=515

 Score =   143 bits (361),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 72/177 (41%), Positives = 112/177 (63%), Gaps = 5/177 (3%)
 Frame = +1

Query  295  VIGNMLDL-GAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADR  471
            VIGNM  L G+ PH ++ ++  ++G ++ LR+GS+ T+ I S++ A E+FK HD + A R
Sbjct  44   VIGNMFQLAGSPPHHSLTKLSRRHGPIMTLRLGSMLTVVISSSEVAREIFKKHDAALAGR  103

Query  472  TVIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWI  651
             + + MK +     SL  A YG+YWR+LRR+CT + FV +R++    VR KC++ ML ++
Sbjct  104  KIYEAMKGRKSSDTSLITAQYGAYWRMLRRLCTTQFFVTRRLDAMSDVRSKCVEQMLQFV  163

Query  652  EKEASSVQRGTG-VHVAHFVFLSTFNLLGNLFLSRDLVDPMSDKASKFFDAMTGIMQ  819
            ++     Q GT  + V  + FL  FNL+GNL  SRDL+DP S + S+FF     +M+
Sbjct  164  KEGG---QNGTKTIDVGRYFFLMAFNLIGNLMFSRDLLDPDSKRGSEFFYHTGKVME  217



>gb|KCW48752.1| hypothetical protein EUGRSUZ_K02392 [Eucalyptus grandis]
Length=354

 Score =   141 bits (355),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 65/113 (58%), Positives = 86/113 (76%), Gaps = 2/113 (2%)
 Frame = +1

Query  487  MKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEAS  666
            M+ Q YY GS+A APYG+YW   R++  V++ V +R+NET P+RRKC+DDML WI + AS
Sbjct  1    MRSQDYYKGSIALAPYGAYWWGSRQLLMVDMLVARRLNETAPIRRKCVDDMLTWIGEAAS  60

Query  667  S--VQRGTGVHVAHFVFLSTFNLLGNLFLSRDLVDPMSDKASKFFDAMTGIMQ  819
            +  V+ G GVH+A FVFL TFNLLGNL LSRDL+DP S   S+ F+AM+G+M+
Sbjct  61   TDKVRLGEGVHLARFVFLMTFNLLGNLMLSRDLLDPDSKVGSELFEAMSGLME  113



>ref|XP_007142620.1| hypothetical protein PHAVU_007G003100g [Phaseolus vulgaris]
 gb|ESW14614.1| hypothetical protein PHAVU_007G003100g [Phaseolus vulgaris]
Length=520

 Score =   143 bits (360),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 70/175 (40%), Positives = 108/175 (62%), Gaps = 2/175 (1%)
 Frame = +1

Query  295  VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT  474
            V+GNM  LG  PH++ A++  K+G ++ L +GS+ T+ I S++ A E+FKNHDV  A R 
Sbjct  51   VVGNMFQLGWSPHESFAKLAQKHGPIMTLWLGSMCTVVISSSEVAGEMFKNHDVVLAGRK  110

Query  475  VIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIE  654
            + + M+ +    GS+  + Y S+WR+LRR+CT E FV  R++    VR KCI  ML  IE
Sbjct  111  IYEAMRGENGSEGSIVTSQYNSHWRMLRRLCTTEFFVTSRLDAMRGVRAKCIHRMLQLIE  170

Query  655  KEASSVQRGTGVHVAHFVFLSTFNLLGNLFLSRDLVDPMSDKASKFFDAMTGIMQ  819
            +   S  R   V V  F+FL  FNL+GNL  S+DL++  +++  +F+     +M+
Sbjct  171  EAGESGTR--AVDVGRFLFLMDFNLIGNLIFSKDLLESETERGDRFYYHALKVME  223



>ref|XP_010112509.1| Cytochrome P450 76A2 [Morus notabilis]
 gb|EXC33897.1| Cytochrome P450 76A2 [Morus notabilis]
Length=517

 Score =   143 bits (360),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 71/175 (41%), Positives = 109/175 (62%), Gaps = 2/175 (1%)
 Frame = +1

Query  295  VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT  474
            V+GN+  L   PH++  ++   +G ++ L +GS+ST+ I S + A E+FKNHD+  A R 
Sbjct  44   VVGNIFQLDRTPHKSFVKLAQTHGPIMTLWLGSMSTVVISSHEVAREMFKNHDMVLAGRK  103

Query  475  VIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIE  654
            + + MK +    GSL  A YG +WR+LRR+CT E FV  R++    VR +CID M+ +I+
Sbjct  104  IYEAMKGEQSNEGSLITAQYGPHWRMLRRLCTTEFFVTSRLDAMQGVRARCIDRMVNFID  163

Query  655  KEASSVQRGTGVHVAHFVFLSTFNLLGNLFLSRDLVDPMSDKASKFFDAMTGIMQ  819
               +S    + V V  F FL +FNL+GNL  S+DL+DP S++ +KFF     +M+
Sbjct  164  D--ASAHGTSPVDVGRFFFLMSFNLIGNLMFSKDLLDPKSERGAKFFFHAGKVME  216



>ref|XP_007027586.1| Cytochrome P450 [Theobroma cacao]
 gb|EOY08088.1| Cytochrome P450 [Theobroma cacao]
Length=1008

 Score =   145 bits (367),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 73/176 (41%), Positives = 112/176 (64%), Gaps = 4/176 (2%)
 Frame = +1

Query  295  VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT  474
            V+GN+  LG  PH++ A++  ++G ++ L +GS+ST+ I S + A E+FKNHDV  A R 
Sbjct  43   VVGNIFQLGWAPHESFAKLARQHGPIMTLWLGSMSTVVISSNEVAREMFKNHDVVLAGRK  102

Query  475  VIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIE  654
            + + MK    + GSL  + YGS+WR+LRR+CT E FV  R++    VR +C+D M+ ++E
Sbjct  103  IYEAMKGDFGHEGSLITSQYGSHWRMLRRLCTTEFFVTSRLDAMQGVRERCVDRMVQFVE  162

Query  655  KEASSVQRGTG-VHVAHFVFLSTFNLLGNLFLSRDLVDPMSDKASKFFDAMTGIMQ  819
               ++   GT  V V  F FL  FNL+GNL  S+DL+D  S++ +KFF     +M+
Sbjct  163  GAGAN---GTNSVDVGRFFFLMAFNLIGNLIFSKDLLDTKSERGAKFFYHAGKVME  215


 Score =   125 bits (313),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 65/169 (38%), Positives = 99/169 (59%), Gaps = 4/169 (2%)
 Frame = +1

Query  295  VIGNMLDLG--AFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFAD  468
            V GN+  L     PH +I ++  ++G +  L +GS+ T+ I S + A E+FKNHDV  A 
Sbjct  542  VAGNIFQLSWREPPHLSITKLACQHGPITTLWLGSMCTVVISSGEVAREMFKNHDVVLAG  601

Query  469  RTVIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLW  648
            R + + MK      GS+  + YGS+WR+LRR+CT+E FV  R++    VR KC+D M+ +
Sbjct  602  RKIYESMKGNYGNEGSIITSQYGSHWRMLRRLCTMEFFVSSRLDAMKGVRSKCVDQMVEF  661

Query  649  IEKEASSVQRGTGVHVAHFVFLSTFNLLGNLFLSRDLVDPMSDKASKFF  795
            I+   +S      + +  F  L TFNL+GNL  S DL+DP S++ +   
Sbjct  662  IQN--ASAFGTNAIDIGRFFLLLTFNLIGNLLFSYDLLDPKSERGANLL  708



>gb|KCW84353.1| hypothetical protein EUGRSUZ_B01205 [Eucalyptus grandis]
Length=423

 Score =   142 bits (357),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 63/131 (48%), Positives = 90/131 (69%), Gaps = 2/131 (2%)
 Frame = +1

Query  433  ELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVP  612
            ELFK HD  FADR     +   GY  GSLA   YG YWR LRR+C+ ELFV+KR+N+   
Sbjct  2    ELFKGHDFVFADRKCPHALTALGYDQGSLAVGRYGDYWRALRRLCSAELFVNKRVNDAAH  61

Query  613  VRRKCIDDMLLWIEKEASSVQ--RGTGVHVAHFVFLSTFNLLGNLFLSRDLVDPMSDKAS  786
            +R+KC+D M+++IE+E +  Q  +  G+ ++HF+FL  FN++GN+ LSRDL+DP S    
Sbjct  62   LRQKCVDSMIMYIEEEMAVKQATKEQGIDLSHFLFLLAFNVVGNMVLSRDLLDPKSKDGP  121

Query  787  KFFDAMTGIMQ  819
            +F+DAM  +M+
Sbjct  122  EFYDAMNLVME  132



>gb|KCW47877.1| hypothetical protein EUGRSUZ_K01623, partial [Eucalyptus grandis]
Length=514

 Score =   142 bits (359),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 73/176 (41%), Positives = 107/176 (61%), Gaps = 4/176 (2%)
 Frame = +1

Query  295  VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT  474
            V+GN+  L   PH++ A +  +YG ++ L +GS+ T+ I S + A E+FKNHDV  A R 
Sbjct  44   VVGNIFQLSWTPHKSFANLAREYGPIMTLWLGSMCTVVISSDEVAREMFKNHDVVLAGRK  103

Query  475  VIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIE  654
            + + MK      GS+  A YG +WR+LRR+ T E FV +R++ T  VR +C+D M+ +IE
Sbjct  104  IYEAMKGDYSNEGSIITAQYGPHWRMLRRLSTTEFFVARRLDATESVRSRCVDRMVRFIE  163

Query  655  KEASSVQRGT-GVHVAHFVFLSTFNLLGNLFLSRDLVDPMSDKASKFFDAMTGIMQ  819
                S   GT  + V  F FL  FNL+GNL  S+DL+DP S + +KFF     +M+
Sbjct  164  DAGES---GTKSIDVGRFFFLMAFNLIGNLMFSKDLLDPKSKRGAKFFYHAGKVME  216



>ref|XP_010036342.1| PREDICTED: cytochrome P450 76A1-like [Eucalyptus grandis]
Length=523

 Score =   142 bits (359),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 71/175 (41%), Positives = 106/175 (61%), Gaps = 2/175 (1%)
 Frame = +1

Query  295  VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT  474
            V+GN+  L   PH++ A +  +YG ++ L +GS+ T+ I S + A E+FKNHDV  A R 
Sbjct  44   VVGNIFQLSWTPHKSFANLAREYGPIMTLWLGSMCTVVISSDEVAREMFKNHDVVLAGRK  103

Query  475  VIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIE  654
            + + MK      GS+  A YG +WR+LRR+ T E FV +R++ T  VR +C+D M+ +IE
Sbjct  104  IYEAMKGDYSNEGSIITAQYGPHWRMLRRLSTTEFFVARRLDATESVRSRCVDRMVRFIE  163

Query  655  KEASSVQRGTGVHVAHFVFLSTFNLLGNLFLSRDLVDPMSDKASKFFDAMTGIMQ  819
                S  +   + V  F FL  FNL+GNL  S+DL+DP S + +KFF     +M+
Sbjct  164  DAGESGTK--SIDVGRFFFLMAFNLIGNLMFSKDLLDPKSKRGAKFFYHAGKVME  216



>ref|XP_011036810.1| PREDICTED: cytochrome P450 76A1-like [Populus euphratica]
Length=516

 Score =   142 bits (359),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 67/175 (38%), Positives = 106/175 (61%), Gaps = 2/175 (1%)
 Frame = +1

Query  295  VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT  474
            V+GN+  LG  PH++ A++   +G ++ + +GS+  + + S++ A E+FKNHD   A R 
Sbjct  44   VVGNIFQLGWAPHESFAKLARVHGPIMTIWLGSMCNVVVSSSEVAREMFKNHDAVLAGRK  103

Query  475  VIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIE  654
            + + MK      GS+  A YG +WR+LRR+CT E FV  R++     R +CID ML +IE
Sbjct  104  IYEAMKGDFGNEGSIITAQYGPHWRMLRRLCTTEFFVTSRLDAMQGARTRCIDGMLQYIE  163

Query  655  KEASSVQRGTGVHVAHFVFLSTFNLLGNLFLSRDLVDPMSDKASKFFDAMTGIMQ  819
                S    + + +  ++FL  FNL+GNL  S+DL+DP S+K +KFF     +M+
Sbjct  164  D--GSANGTSAIDLGRYIFLMAFNLIGNLMFSKDLLDPKSEKGAKFFQHAGKVME  216



>ref|XP_006382516.1| hypothetical protein POPTR_0005s02900g [Populus trichocarpa]
 gb|ERP60313.1| hypothetical protein POPTR_0005s02900g [Populus trichocarpa]
Length=505

 Score =   142 bits (359),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 68/175 (39%), Positives = 106/175 (61%), Gaps = 2/175 (1%)
 Frame = +1

Query  295  VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT  474
            V+GN+  LG  PH++ A +   +G ++ + +GS+  + I S++ A E+FKNHD   A R 
Sbjct  44   VVGNIFLLGWAPHESFANLARVHGPIMTIWLGSMCNVVISSSEVAREMFKNHDAVLAGRK  103

Query  475  VIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIE  654
            + + M+      GS+  A YG +WR+LRR+CT E FV  R++     R +CID MLL+IE
Sbjct  104  IYEAMRGDFGNEGSIITAQYGPHWRMLRRLCTTEFFVTSRLDAMQGARTRCIDGMLLYIE  163

Query  655  KEASSVQRGTGVHVAHFVFLSTFNLLGNLFLSRDLVDPMSDKASKFFDAMTGIMQ  819
                S    + + +  ++FL  FNL+GNL  S+DL+DP S+K +KFF     +M+
Sbjct  164  D--GSANGTSAIDLGRYIFLMAFNLIGNLMFSKDLLDPKSEKGAKFFQHAGKVME  216



>emb|CBI30232.3| unnamed protein product [Vitis vinifera]
Length=446

 Score =   142 bits (357),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 68/149 (46%), Positives = 98/149 (66%), Gaps = 4/149 (3%)
 Frame = +1

Query  190  LVWSAIFLIPGLVFLLAR---KKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAEMKNK  360
            L+W + F    L+ LL R   +K S+  R P       ++GN+ DLG  PHQT+  ++++
Sbjct  10   LLWWSAFFSAALLVLLRRIKPRKGSTKLRPPGPQGWP-ILGNIFDLGTMPHQTLYRLRSQ  68

Query  361  YGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPYGS  540
            YG V+WL++G+++T+ I SAK AAELFKNHD+ F+DR V   +    Y  GS+A + YG+
Sbjct  69   YGPVLWLQLGAINTVVIQSAKVAAELFKNHDLPFSDRKVPCALTALNYNQGSMAMSNYGT  128

Query  541  YWRVLRRICTVELFVHKRINETVPVRRKC  627
            YWR LR++C+ EL V KRINE  P+R KC
Sbjct  129  YWRTLRKVCSSELLVIKRINEMAPLRHKC  157



>gb|KJB46481.1| hypothetical protein B456_007G371400 [Gossypium raimondii]
Length=513

 Score =   142 bits (359),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 75/176 (43%), Positives = 109/176 (62%), Gaps = 3/176 (2%)
 Frame = +1

Query  295  VIGNMLDLG-AFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADR  471
            V+GN+  LG A PH + A++  ++G ++ L +GS+ST+ I S + A E+FKNHDV  A R
Sbjct  44   VVGNIFQLGLAPPHVSFAKLACRHGPIMTLWLGSMSTVVISSNEVAREMFKNHDVVLAGR  103

Query  472  TVIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWI  651
             + + MK    + GSL  + YG +WR+LRR+CT E FV  R++    VRR+CID ML  +
Sbjct  104  KIYEAMKGDFGHEGSLITSQYGPHWRMLRRLCTTEFFVTSRLDAMRGVRRRCIDQMLQSV  163

Query  652  EKEASSVQRGTGVHVAHFVFLSTFNLLGNLFLSRDLVDPMSDKASKFFDAMTGIMQ  819
            +   +S      + V  FVFL  FNL+GNL  S+DL+D  S+K  KFF     +M+
Sbjct  164  QD--ASANGTNPIDVGRFVFLMAFNLIGNLIFSKDLLDHKSEKGVKFFYHAGKVME  217



>ref|XP_010654031.1| PREDICTED: cytochrome P450 76A1 [Vitis vinifera]
Length=515

 Score =   142 bits (358),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 73/176 (41%), Positives = 109/176 (62%), Gaps = 4/176 (2%)
 Frame = +1

Query  295  VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT  474
            V+GN+  LG  PH + A++  K+G ++ L +GS+ST+ I S + A E+FKNHDV  A R 
Sbjct  44   VVGNIFQLGWAPHVSFAKLAGKHGPIMTLWLGSMSTVVISSNEVAREMFKNHDVVLAGRK  103

Query  475  VIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIE  654
            + + MK      GS+  A YG  WR+LRR+CT E FV  R++    VR  CID M+ ++ 
Sbjct  104  IYEAMKGDRGNEGSIITAQYGPQWRMLRRLCTSEFFVTSRLDAMRGVRGGCIDRMVQFVT  163

Query  655  KEASSVQRGT-GVHVAHFVFLSTFNLLGNLFLSRDLVDPMSDKASKFFDAMTGIMQ  819
            +  +S   GT  + V  F+FL  FNL+GNL  S+DL+DP S++ ++FF     +M+
Sbjct  164  EAGTS---GTHAIDVGRFIFLMAFNLIGNLMFSKDLLDPKSERGAEFFYHAGKVME  216



>ref|XP_010112512.1| Cytochrome P450 76A2 [Morus notabilis]
 gb|EXC33900.1| Cytochrome P450 76A2 [Morus notabilis]
Length=184

 Score =   135 bits (340),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 69/146 (47%), Positives = 91/146 (62%), Gaps = 7/146 (5%)
 Frame = +1

Query  403  MAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELF  582
            M ILS+KA  ELFKN+D+SF +  V    +   ++   +A APYG YW ++RR+ T  + 
Sbjct  1    MVILSSKATTELFKNNDMSFVECAVTATSRAHNFHELFVALAPYGLYWHLMRRLMTRNML  60

Query  583  VHKRINETVPVRRKCIDDMLLWIEKEASSVQRG-------TGVHVAHFVFLSTFNLLGNL  741
            V KR+++T P+R+KCI++M  WIE EA    R         GVH+A FVFL  FNLL NL
Sbjct  61   VGKRVSKTTPLRQKCINNMSFWIEGEARKKARNREAVDHVQGVHLARFVFLMVFNLLANL  120

Query  742  FLSRDLVDPMSDKASKFFDAMTGIMQ  819
             LSRDLVD   +  SKFF  M  IM+
Sbjct  121  MLSRDLVDLNKEDRSKFFAVMERIME  146



>gb|EYU38601.1| hypothetical protein MIMGU_mgv1a004436mg [Erythranthe guttata]
Length=527

 Score =   142 bits (357),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 74/180 (41%), Positives = 110/180 (61%), Gaps = 6/180 (3%)
 Frame = +1

Query  295  VIGNMLDLGAF-----PHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVS  459
            V+GNML L A      PH++ AE+  ++GSV+ L +GS++T+ + S++AA  +FKNHD  
Sbjct  44   VVGNMLQLAAAGSASAPHRSFAELAKQHGSVMTLHLGSMTTVVVSSSEAARVMFKNHDAV  103

Query  460  FADRTVIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDM  639
             A R + + MK      GSL  A +G +WR LRR+CT E F    ++    VR +C+D M
Sbjct  104  LAGRKIYESMKGDIGNEGSLITAQHGHHWRTLRRLCTAEFFAAAPLDAMRGVRARCVDQM  163

Query  640  LLWIEKEASSVQRGTGVHVAHFVFLSTFNLLGNLFLSRDLVDPMSDKASKFFDAMTGIMQ  819
            + +I ++ASS   G  V V  F FL  FNL+GNL  S+DL+ P S++ +KFF     +M+
Sbjct  164  VQYI-RDASSAGGGGSVDVGKFFFLMAFNLIGNLMFSKDLLGPESERGAKFFYHAGKVME  222



>ref|XP_009148756.1| PREDICTED: cytochrome P450 76A1 [Brassica rapa]
Length=516

 Score =   141 bits (356),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 72/177 (41%), Positives = 107/177 (60%), Gaps = 5/177 (3%)
 Frame = +1

Query  295  VIGNMLDL-GAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADR  471
            VIGNM  L G  PH ++  +  ++G ++ LR+GS+ T+ I S++ A E+ K HD + A R
Sbjct  45   VIGNMFQLAGLPPHHSLTNLSRRHGPIMTLRLGSMLTVVISSSEVAREILKKHDAALAGR  104

Query  472  TVIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWI  651
             + + MK      GSL  A YG YWR+LRR+CT + FV +R++    VR +C+D ML ++
Sbjct  105  KIYEAMKGGKSSDGSLITAQYGPYWRMLRRLCTTQFFVTRRLDAMSDVRSRCVDQMLRFV  164

Query  652  EKEASSVQRGTG-VHVAHFVFLSTFNLLGNLFLSRDLVDPMSDKASKFFDAMTGIMQ  819
            E+     Q GT  + V  + FL  FNL+GNL  SRDL+DP S + S+F      +M+
Sbjct  165  EEGG---QNGTKTIDVGRYFFLMAFNLIGNLMFSRDLLDPDSKRGSEFLYHTGKVME  218



>ref|XP_006382524.1| hypothetical protein POPTR_0005s02990g [Populus trichocarpa]
 gb|ERP60321.1| hypothetical protein POPTR_0005s02990g [Populus trichocarpa]
Length=516

 Score =   141 bits (356),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 67/175 (38%), Positives = 104/175 (59%), Gaps = 2/175 (1%)
 Frame = +1

Query  295  VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT  474
            V+GN+  LG  PH++   +   +G ++ + +GS+  + I S++ A E+FKNHD   A R 
Sbjct  44   VVGNIFQLGWAPHESFTNLARVHGPIMTIWLGSMCNVVISSSEVAREMFKNHDAVLAGRK  103

Query  475  VIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIE  654
            + + MK      GS+  A YG +WR+LRR+CT E FV  R++     R +CID ML +IE
Sbjct  104  IYEAMKGDFGNEGSIITAQYGPHWRMLRRLCTTEFFVTSRLDAMQGARTRCIDGMLQYIE  163

Query  655  KEASSVQRGTGVHVAHFVFLSTFNLLGNLFLSRDLVDPMSDKASKFFDAMTGIMQ  819
                S    + + +  ++FL  FNL+GNL  S+DL+DP S+K +KFF     +M+
Sbjct  164  D--GSANGTSAIDLGRYIFLMAFNLIGNLMFSKDLLDPKSEKGAKFFQHAGKVME  216



>ref|XP_011101481.1| PREDICTED: cytochrome P450 76A1 [Sesamum indicum]
 ref|XP_011101482.1| PREDICTED: cytochrome P450 76A1 [Sesamum indicum]
Length=511

 Score =   140 bits (354),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 74/170 (44%), Positives = 106/170 (62%), Gaps = 6/170 (4%)
 Frame = +1

Query  295  VIGNMLDL--GAF-PHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFA  465
            V+GN+  L   AF PHQ+ A++  K+G V+ L +GS++T+ I S++AA  +FKNHDV  A
Sbjct  45   VVGNIFQLLGAAFAPHQSFAKLAKKHGPVMTLHLGSMTTVVISSSEAARVMFKNHDVVLA  104

Query  466  DRTVIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLL  645
             R + + MK +    GSL  A YG  WR+LRR+CT E F    ++    VR KC+  M+ 
Sbjct  105  GRKIYESMKSEIGNEGSLITAQYGPRWRMLRRLCTTEFFAAAPLDAMRGVRAKCVHQMVQ  164

Query  646  WIEKEASSVQRGTGVHVAHFVFLSTFNLLGNLFLSRDLVDPMSDKASKFF  795
            +I   A++   G G+ V  F FL  FNL+GNL  S+DL+DP S+  +KFF
Sbjct  165  YIRDAAAN---GLGIDVGRFFFLMAFNLIGNLIFSKDLLDPESETGAKFF  211



>ref|XP_006382522.1| hypothetical protein POPTR_0005s02960g [Populus trichocarpa]
 gb|ERP60319.1| hypothetical protein POPTR_0005s02960g [Populus trichocarpa]
Length=516

 Score =   140 bits (353),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 66/167 (40%), Positives = 103/167 (62%), Gaps = 2/167 (1%)
 Frame = +1

Query  295  VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT  474
            V+GN+  LG  PH++   +   +G ++ + +GS+  + I S++ A E+FKNHD   A R 
Sbjct  44   VVGNIFQLGWAPHESFTNLARVHGPIMTIWLGSMCNVVISSSEVAREMFKNHDAVLAGRK  103

Query  475  VIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIE  654
            + + MK      GS+  A YG +WR+LRR+CT E FV  R++     R +CID ML +IE
Sbjct  104  IYEAMKGDFGNEGSIITAQYGPHWRMLRRLCTTEFFVSSRLDAMQGARTRCIDGMLQYIE  163

Query  655  KEASSVQRGTGVHVAHFVFLSTFNLLGNLFLSRDLVDPMSDKASKFF  795
              +++  R   + +  ++FL  FNL+GNL  S+DL+DP S+K +KFF
Sbjct  164  DGSANGTR--AIDLGRYIFLMAFNLIGNLMFSKDLLDPKSEKGAKFF  208



>ref|XP_010504051.1| PREDICTED: cytochrome P450 76A1-like [Camelina sativa]
Length=516

 Score =   140 bits (352),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 80/201 (40%), Positives = 124/201 (62%), Gaps = 5/201 (2%)
 Frame = +1

Query  223  LVFLLARKKSSSSYRlppgppglpVIGNMLDL-GAFPHQTIAEMKNKYGSVIWLRIGSVS  399
            L+++     + S  RLPPGP   PVIGNM  L G+ PH ++ ++  ++G ++ LR+GS+ 
Sbjct  21   LIYVTCLLHTKSRTRLPPGPNPWPVIGNMFQLAGSPPHHSLTKLSRRHGPIMTLRLGSML  80

Query  400  TMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVEL  579
            T+ I S++ A E+FK HD + A R + + MK +     SL  A YG+YWR+LRR+CT + 
Sbjct  81   TVVISSSEVAREIFKKHDAALAGRKIYEAMKGRKSSDTSLITAQYGAYWRMLRRLCTTQF  140

Query  580  FVHKRINETVPVRRKCIDDMLLWIEKEASSVQRGTG-VHVAHFVFLSTFNLLGNLFLSRD  756
            FV +R++    VR KC++ ML ++++     Q GT  + V  + FL  FNL+GNL  SRD
Sbjct  141  FVTRRLDAMSDVRSKCVEQMLRFVKEGG---QNGTKTIDVGRYFFLMAFNLIGNLMFSRD  197

Query  757  LVDPMSDKASKFFDAMTGIMQ  819
            L+D  S + S+FF     +M+
Sbjct  198  LLDADSKRGSEFFYHTGKVME  218



>ref|XP_010038981.1| PREDICTED: cytochrome P450 76A1-like [Eucalyptus grandis]
 gb|KCW48371.1| hypothetical protein EUGRSUZ_K02081 [Eucalyptus grandis]
Length=523

 Score =   139 bits (351),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 69/175 (39%), Positives = 105/175 (60%), Gaps = 2/175 (1%)
 Frame = +1

Query  295  VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT  474
            V+GN+  L   PH++ A +  +YG ++ L +GS+ T+ I S + A E+F+NHDV  A R 
Sbjct  44   VVGNIFQLSWTPHKSFANLAREYGPIMTLWLGSMCTVVISSDEVAREMFRNHDVVLAGRK  103

Query  475  VIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIE  654
            + + MK      GS+  A YG +WR+LRR+ T E FV +R++    VR +C+D M+ +IE
Sbjct  104  IYEAMKGDYSNEGSIITAQYGPHWRMLRRLSTTEFFVARRLDAMESVRSRCVDRMVRFIE  163

Query  655  KEASSVQRGTGVHVAHFVFLSTFNLLGNLFLSRDLVDPMSDKASKFFDAMTGIMQ  819
                S  +   + V  F FL  FNL+GNL  S+DL+DP S + +KFF     +M+
Sbjct  164  DAGESGTK--SIDVGRFFFLMAFNLIGNLMFSKDLLDPKSKRGAKFFYHAGKVME  216



>ref|NP_001190075.1| cytochrome P450, family 76, subfamily G, polypeptide 1 [Arabidopsis 
thaliana]
 gb|AEE79020.1| cytochrome P450, family 76, subfamily G, polypeptide 1 [Arabidopsis 
thaliana]
Length=530

 Score =   139 bits (350),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 72/188 (38%), Positives = 110/188 (59%), Gaps = 13/188 (7%)
 Frame = +1

Query  295  VIGNMLDL-GAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADR  471
            VIGN+  L G  PH ++ ++  ++G ++ LRIGS+ T+ I S++ A E+FK HD + A R
Sbjct  45   VIGNIFQLAGLPPHDSLTKLSRRHGPIMTLRIGSMLTVVISSSEVAREIFKKHDAALAGR  104

Query  472  TVIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWI  651
             + + MK      GSL  A YG+YWR+LRR+CT + FV +R++    VR +C+D ML ++
Sbjct  105  KIYEAMKGGKSSDGSLITAQYGAYWRMLRRLCTTQFFVTRRLDAMSDVRSRCVDQMLRFV  164

Query  652  EKEASSVQRGT------------GVHVAHFVFLSTFNLLGNLFLSRDLVDPMSDKASKFF  795
            E+   +    T             + V  + FL  FNL+GNL  SRDL+DP S + S+FF
Sbjct  165  EEGGQNGMYYTINNIMTCIICTKTIDVGRYFFLMAFNLIGNLMFSRDLLDPDSKRGSEFF  224

Query  796  DAMTGIMQ  819
                 +M+
Sbjct  225  YHTGKVME  232



>ref|XP_006382521.1| hypothetical protein POPTR_0005s02950g [Populus trichocarpa]
 gb|ERP60318.1| hypothetical protein POPTR_0005s02950g [Populus trichocarpa]
Length=516

 Score =   137 bits (346),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 79/210 (38%), Positives = 125/210 (60%), Gaps = 3/210 (1%)
 Frame = +1

Query  169  MEWEWKYLVWSAIFLIPGLVFLLAR-KKSSSSYRlppgppglpVIGNMLDLGAFPHQTIA  345
            M++E   LV + +  +   V    R ++S    +LPPGP  LPV+GN+  LG  PH++ A
Sbjct  1    MDYEIAGLVLAVLLWVAWAVVTQRRYRRSEEQGQLPPGPRPLPVVGNIFLLGWAPHESFA  60

Query  346  EMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAF  525
             +   +G ++ + +GS+  + I S++ A E+FKNHD   A R + + ++      GS+  
Sbjct  61   NLARVHGPIMTIWLGSMCNVVISSSEVAREMFKNHDAVLAGRKIYEAIRGDFGNEGSIIT  120

Query  526  APYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEASSVQRGTGVHVAHF  705
            A YG +WR+LRR+CT E FV  R++     R +CID ML +IE +  S    + + +  +
Sbjct  121  AQYGPHWRMLRRLCTTEFFVTSRLDAMQGARTRCIDGMLQYIEDD--SANGTSAIDLGRY  178

Query  706  VFLSTFNLLGNLFLSRDLVDPMSDKASKFF  795
            +FL  FNL+GNL  S+DL+DP S+K +KFF
Sbjct  179  IFLMAFNLIGNLMFSKDLLDPKSEKGAKFF  208



>gb|KDO61005.1| hypothetical protein CISIN_1g0379902mg, partial [Citrus sinensis]
Length=283

 Score =   134 bits (337),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 67/169 (40%), Positives = 105/169 (62%), Gaps = 7/169 (4%)
 Frame = +1

Query  295  VIGNMLDLGAFP---HQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFA  465
            V+GN+  LG  P   H + A + +K+G ++ L +GS+ T+ + S + A ++FKNHDV  A
Sbjct  27   VVGNIFQLGWMPMPPHASFAILAHKHGPLMTLWLGSMCTVVVSSNEVARDMFKNHDVVLA  86

Query  466  DRTVIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLL  645
             R + + MK      GS+  + YG++WR+LRR+CT E FV  R++ T  VR KCID M+ 
Sbjct  87   GRKIYEAMKGDYGTEGSIITSQYGAHWRMLRRLCTTEFFVTSRLDATRGVRSKCIDRMVQ  146

Query  646  WIEKEASSVQRGTGVHVAHFVFLSTFNLLGNLFLSRDLVDPMSDKASKF  792
            ++E+  +       + V  F+FL  FNL+GNL  S+DL+ P S++ +KF
Sbjct  147  FVEEAEACAP----IDVGRFIFLMAFNLIGNLMFSKDLLGPESERGAKF  191



>gb|AJD25184.1| cytochrome P450 CYP76G16 [Salvia miltiorrhiza]
Length=508

 Score =   136 bits (342),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 72/170 (42%), Positives = 108/170 (64%), Gaps = 4/170 (2%)
 Frame = +1

Query  295  VIGNMLDLG---AFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFA  465
            V+GNML L    + PHQ+ AE+  K+G+V+ L +GS++T+ + SA+AA  +FK+HD + A
Sbjct  38   VVGNMLQLARSASAPHQSFAELAGKHGAVMTLWLGSMTTVVVSSAEAARAMFKHHDAALA  97

Query  466  DRTVIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLL  645
             R + + MK      GSL  A YG +WR LRR+CT E F    ++    VR +C+  ML 
Sbjct  98   GRKIYESMKGDVGNEGSLITAQYGPHWRTLRRLCTAEFFAAGPLDAMRGVRARCVAQMLH  157

Query  646  WIEKEASSVQRGTGVHVAHFVFLSTFNLLGNLFLSRDLVDPMSDKASKFF  795
            ++ +EA++   G G  V  F FL  FNL+GNL  S+DL+DP S++ ++FF
Sbjct  158  YV-REAAAADDGAGTDVGRFFFLMAFNLIGNLMFSKDLLDPASERGAEFF  206



>emb|CDX76245.1| BnaA04g05090D [Brassica napus]
Length=530

 Score =   135 bits (341),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 72/191 (38%), Positives = 107/191 (56%), Gaps = 19/191 (10%)
 Frame = +1

Query  295  VIGNMLDL-GAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADR  471
            VIGNM  L G  PH ++  +  ++G ++ LR+GS+ T+ I S++ A E+ K HD + A R
Sbjct  45   VIGNMFQLAGLPPHHSLTNLSRRHGPIMTLRLGSMLTVVISSSEVAREILKKHDAALAGR  104

Query  472  TVIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWI  651
             + + MK      GSL  A YG YWR+LRR+CT + FV +R++    VR +C+D ML ++
Sbjct  105  KIYEAMKGGKSSDGSLITAQYGPYWRMLRRLCTTQFFVTRRLDAMSDVRSRCVDQMLRFV  164

Query  652  EKEASSVQRGT---------------GVHVAHFVFLSTFNLLGNLFLSRDLVDPMSDKAS  786
            E+     Q GT                + V  + FL  FNL+GNL  SRDL+DP S + S
Sbjct  165  EEGG---QNGTLWNTVVFTARYSCTKTIDVGRYFFLMAFNLIGNLMFSRDLLDPDSKRGS  221

Query  787  KFFDAMTGIMQ  819
            +F      +M+
Sbjct  222  EFLYHTGKVME  232



>ref|XP_006382520.1| hypothetical protein POPTR_0005s02940g [Populus trichocarpa]
 gb|ERP60317.1| hypothetical protein POPTR_0005s02940g [Populus trichocarpa]
Length=516

 Score =   135 bits (341),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 66/168 (39%), Positives = 105/168 (63%), Gaps = 4/168 (2%)
 Frame = +1

Query  295  VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT  474
            V+GN+  LG  PH++ A +   +G ++ + +GS+  + I S++ A E+FKNHD   A R 
Sbjct  44   VVGNIFLLGWAPHESFANLARVHGPIMTIWLGSMCNVVISSSEVAREMFKNHDAVLAGRK  103

Query  475  VIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIE  654
            + + ++      GS+  A YG +WR+LRR+CT E FV  R++     R +CID ML +IE
Sbjct  104  IYEAIRGDFGNEGSIITAQYGPHWRMLRRLCTTEFFVTSRLDAMQGARTRCIDGMLQYIE  163

Query  655  KEASSVQRGT-GVHVAHFVFLSTFNLLGNLFLSRDLVDPMSDKASKFF  795
             ++++   GT  + +  + FL  FNL+GNL  S+DL+DP S+K +KFF
Sbjct  164  DDSAN---GTSAIDLGRYFFLMAFNLIGNLMFSKDLLDPKSEKGAKFF  208



>ref|XP_006482365.1| PREDICTED: cytochrome P450 76A2-like [Citrus sinensis]
Length=508

 Score =   133 bits (335),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 67/169 (40%), Positives = 105/169 (62%), Gaps = 7/169 (4%)
 Frame = +1

Query  295  VIGNMLDLGAFP---HQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFA  465
            V+GN+  LG  P   H + A + +K+G ++ L +GS+ T+ + S + A ++FKNHDV  A
Sbjct  43   VVGNIFQLGWMPMPPHASFAILAHKHGPLMTLWLGSMCTVVVSSNEVARDMFKNHDVVLA  102

Query  466  DRTVIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLL  645
             R + + MK      GS+  + YG++WR+LRR+CT E FV  R++ T  VR KCID M+ 
Sbjct  103  GRKIYEAMKGDYGTEGSIITSQYGAHWRMLRRLCTTEFFVTSRLDATRGVRSKCIDRMVQ  162

Query  646  WIEKEASSVQRGTGVHVAHFVFLSTFNLLGNLFLSRDLVDPMSDKASKF  792
            ++E+  +       + V  F+FL  FNL+GNL  S+DL+ P S++ +KF
Sbjct  163  FVEEAEACAP----IDVGRFIFLMAFNLIGNLMFSKDLLGPESERGAKF  207



>emb|CDP18467.1| unnamed protein product [Coffea canephora]
Length=444

 Score =   132 bits (333),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 69/150 (46%), Positives = 93/150 (62%), Gaps = 4/150 (3%)
 Frame = +1

Query  370  VIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPYGSYWR  549
             +WL  GS+ T+ I S + A E+FKNHDV  A R + + MK      GSL  A YG +WR
Sbjct  2    TLWL--GSMCTVVISSNEVAREMFKNHDVVLAGRKIYEAMKGDIGNEGSLITAQYGPHWR  59

Query  550  VLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEASSVQRGTGVHVAHFVFLSTFNL  729
            +LRR+CT E FV  R++ TV VR KCID M+ +I  EA+      G+ V  F FL  FNL
Sbjct  60   MLRRLCTAEFFVTSRLDATVDVRAKCIDQMVKYI--EAAGGSGANGIDVGKFFFLLAFNL  117

Query  730  LGNLFLSRDLVDPMSDKASKFFDAMTGIMQ  819
            +GNL  S+DL+DP S++ +KFF     +M+
Sbjct  118  IGNLMFSKDLLDPSSERGAKFFYHAGKVME  147



>ref|XP_006439139.1| hypothetical protein CICLE_v10033708mg [Citrus clementina]
 gb|ESR52379.1| hypothetical protein CICLE_v10033708mg [Citrus clementina]
Length=512

 Score =   132 bits (333),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 67/169 (40%), Positives = 104/169 (62%), Gaps = 7/169 (4%)
 Frame = +1

Query  295  VIGNMLDLGAFP---HQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFA  465
            V+GN+  LG  P   H + A + +K+G ++ L +GS+ T+ + S + A ++FKNHDV  A
Sbjct  47   VVGNIFQLGWMPMPPHASFAILAHKHGPLMTLWLGSMCTVVVSSNEVARDMFKNHDVVLA  106

Query  466  DRTVIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLL  645
             R + + MK      GS+  + YG++WR+LRR+CT E FV  R++ T  VR KCID M+ 
Sbjct  107  GRKIYEAMKGDYGTEGSIITSQYGAHWRMLRRLCTTEFFVTSRLDATRGVRSKCIDRMVQ  166

Query  646  WIEKEASSVQRGTGVHVAHFVFLSTFNLLGNLFLSRDLVDPMSDKASKF  792
            ++E+  +       + V  F FL  FNL+GNL  S+DL+ P S++ +KF
Sbjct  167  FVEEAGACAP----IDVGRFTFLMAFNLIGNLMFSKDLLGPESERGAKF  211



>ref|NP_001268152.1| ripening-related P-450 enzyme-like [Vitis vinifera]
 emb|CAB85635.1| putative ripening-related P-450 enzyme [Vitis vinifera]
Length=499

 Score =   132 bits (331),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 69/208 (33%), Positives = 126/208 (61%), Gaps = 7/208 (3%)
 Frame = +1

Query  196  WSAIFLIPGLVFLLARKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAEMKNKYGSVI  375
            W++I+++    F   R +  ++++LPPGP  LP+IG++L+LG  PH+++A +   YG ++
Sbjct  14   WTSIYIM----FSARRGRKHAAHKLPPGPVPLPIIGSLLNLGNRPHESLANLAKTYGPIM  69

Query  376  WLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPYGSYWRVL  555
             L++G V+T+ I SA  A E+ +  D+SF +R++ D ++   +   S+A+ P  + WR L
Sbjct  70   TLKLGYVTTIVISSAPMAKEVLQKQDLSFCNRSIPDAIRAAKHNQLSMAWIPVSTTWRAL  129

Query  556  RRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEASSVQRGTGVHVAHFVFLSTFNLLG  735
            RR C   LF  ++++    +R + + ++L  +E+   S Q G  V +    F ++ NLL 
Sbjct  130  RRTCNSHLFTSQKLDSNTHLRHQKVQELLANVEQ---SCQAGGPVDIGQEAFRTSLNLLS  186

Query  736  NLFLSRDLVDPMSDKASKFFDAMTGIMQ  819
            N   S DLVDP+S+ A +F + + G+M+
Sbjct  187  NTIFSVDLVDPISETAQEFKELVRGVME  214



>ref|XP_003631427.1| PREDICTED: geraniol 8-hydroxylase-like [Vitis vinifera]
 ref|XP_010661621.1| PREDICTED: geraniol 8-hydroxylase-like [Vitis vinifera]
 ref|XP_010661624.1| PREDICTED: geraniol 8-hydroxylase-like [Vitis vinifera]
 ref|XP_010661630.1| PREDICTED: geraniol 8-hydroxylase-like [Vitis vinifera]
 ref|XP_010661639.1| PREDICTED: geraniol 8-hydroxylase-like [Vitis vinifera]
Length=499

 Score =   132 bits (331),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 72/210 (34%), Positives = 127/210 (60%), Gaps = 7/210 (3%)
 Frame = +1

Query  190  LVWSAIFLIPGLVFLLARKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAEMKNKYGS  369
            + W++I+++    F + R    ++Y+LPPGP  LP+IGN+L+LG  PH+++AE+   YG 
Sbjct  12   VAWTSIYIM----FSVRRGSQHTAYKLPPGPVPLPIIGNLLNLGNRPHESLAELAKTYGP  67

Query  370  VIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPYGSYWR  549
            ++ L++G V+T+ I SA  A E+ +  D+SF +R V D ++   +   S+A+ P  + WR
Sbjct  68   IMTLKLGYVTTIVISSAPMAKEVLQKQDLSFCNRFVPDAIRATNHNQLSMAWMPVSTTWR  127

Query  550  VLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEASSVQRGTGVHVAHFVFLSTFNL  729
            VLR+IC   LF  ++++    +R   + ++L  +E+   S Q G  V++    F ++ NL
Sbjct  128  VLRKICNSHLFTTQKLDSNTHLRHHKVQELLAKVEE---SRQAGDAVYIGREAFRTSLNL  184

Query  730  LGNLFLSRDLVDPMSDKASKFFDAMTGIMQ  819
            L N   S DLVDP+S+   +F + +  I++
Sbjct  185  LSNTIFSVDLVDPISETVLEFQELVRCIIE  214



>ref|XP_010658029.1| PREDICTED: ripening-related P-450 enzyme-like isoform X1 [Vitis 
vinifera]
 ref|XP_010658036.1| PREDICTED: ripening-related P-450 enzyme-like isoform X1 [Vitis 
vinifera]
Length=499

 Score =   132 bits (331),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 69/208 (33%), Positives = 126/208 (61%), Gaps = 7/208 (3%)
 Frame = +1

Query  196  WSAIFLIPGLVFLLARKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAEMKNKYGSVI  375
            W++I+++    F   R +  ++++LPPGP  LP+IG++L+LG  PH+++A +   YG ++
Sbjct  14   WTSIYIM----FSARRGRKHAAHKLPPGPVPLPIIGSLLNLGNRPHESLANLAKTYGPIM  69

Query  376  WLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPYGSYWRVL  555
             L++G V+T+ I SA  A E+ +  D+SF +R++ D ++   +   S+A+ P  + WR L
Sbjct  70   TLKLGYVTTIVISSAPMAKEVLQKQDLSFCNRSIPDAIRAAKHNQLSMAWLPVSTTWRAL  129

Query  556  RRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEASSVQRGTGVHVAHFVFLSTFNLLG  735
            RR C   LF  ++++    +R + + ++L  +E+   S Q G  V +    F ++ NLL 
Sbjct  130  RRTCNSHLFTPQKLDSNTHLRHQKVQELLANVEQ---SCQAGGPVDIGQEAFRTSLNLLS  186

Query  736  NLFLSRDLVDPMSDKASKFFDAMTGIMQ  819
            N   S DLVDP+S+ A +F + + G+M+
Sbjct  187  NTIFSVDLVDPISETAQEFKELVRGVME  214



>ref|XP_012082611.1| PREDICTED: cytochrome P450 76A1 [Jatropha curcas]
 gb|KDP29244.1| hypothetical protein JCGZ_16633 [Jatropha curcas]
Length=518

 Score =   132 bits (331),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 67/176 (38%), Positives = 105/176 (60%), Gaps = 3/176 (2%)
 Frame = +1

Query  295  VIGNMLDLG-AFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADR  471
            V+GN+  LG   PH++  E+   +G ++ L +GS+ T+ + S K A E+FKNHD   A R
Sbjct  48   VVGNIFQLGHRSPHESFTELALTHGPIMTLWLGSMCTIVVSSDKMAREMFKNHDAVLAGR  107

Query  472  TVIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWI  651
             + + MK    + GS+  + YG +WR+LRR+ T E FV  R++    VR +CID+++ +I
Sbjct  108  KIYEAMKGNHGHDGSMITSQYGPHWRMLRRLATTEFFVTSRLDAMRTVRCRCIDELIKFI  167

Query  652  EKEASSVQRGTGVHVAHFVFLSTFNLLGNLFLSRDLVDPMSDKASKFFDAMTGIMQ  819
            E+   + +    V V  F FL  FNL+GNL  S+DL+DP S+  + FF     +M+
Sbjct  168  EEACGNGK--NAVDVGRFFFLMAFNLIGNLMFSKDLLDPKSETGATFFYHAGKVME  221



>ref|XP_009626046.1| PREDICTED: cytochrome P450 76A1 [Nicotiana tomentosiformis]
Length=506

 Score =   132 bits (331),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 70/175 (40%), Positives = 102/175 (58%), Gaps = 2/175 (1%)
 Frame = +1

Query  295  VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT  474
            ++ N+   G  PH + A++  KYG ++ L +GS+ST+ I S   A E+FKNHD+  A R 
Sbjct  44   LVTNIFQSGFAPHVSFAKLATKYGPIMTLWLGSMSTVVISSNDVAREMFKNHDMVLAGRK  103

Query  475  VIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIE  654
            + + MK      GSL    YG +WR+LRR+ T E FV  R++     R KCID M+ +I 
Sbjct  104  IYEAMKGDFGNEGSLITNQYGPHWRMLRRLSTKEFFVTSRLDVMRGTRTKCIDQMVKFIG  163

Query  655  KEASSVQRGTGVHVAHFVFLSTFNLLGNLFLSRDLVDPMSDKASKFFDAMTGIMQ  819
               +S    T + V  F FL  FNL+GNL  S+DL+DP S++ +KFF     +M+
Sbjct  164  DAGNSGT--TSIDVGRFFFLMAFNLIGNLMFSKDLLDPKSNRGAKFFYHAGKVME  216



>ref|XP_007034575.1| Cytochrome P450, putative [Theobroma cacao]
 gb|EOY05501.1| Cytochrome P450, putative [Theobroma cacao]
Length=551

 Score =   131 bits (329),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 74/218 (34%), Positives = 133/218 (61%), Gaps = 6/218 (3%)
 Frame = +1

Query  166  EMEWEWKYLVWSAIFLIPGLVFLLARKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIA  345
            E E    +L++  ++ I   ++LL   K+SS  +LPPGP  +P++GN+LDLG  PH+++A
Sbjct  58   EGEEREPFLLFPHLYGI--FIWLLWGSKASSG-KLPPGPRRIPILGNLLDLGDKPHKSLA  114

Query  346  EMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAF  525
            E+   +G ++ L++GS++T+ + SA  A E+ +NHD++F++RT+ D ++V  +    L +
Sbjct  115  ELAKTHGPLMSLKLGSLTTIVVSSAAMAKEVLQNHDLTFSNRTIGDALRVNQHDEVGLPW  174

Query  526  APYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEASSVQRGTGVHVAHF  705
             P    WR LR++C+   F +K+++    +RRK I+++L ++ K   +   G  +++   
Sbjct  175  MPVSPLWRTLRKVCSSHFFSNKKLDAHQYLRRKKIEELLSYVHKHCRA---GEAINIGQA  231

Query  706  VFLSTFNLLGNLFLSRDLVDPMSDKASKFFDAMTGIMQ  819
             F S+ NLL +   S+DLVDP S  A  F   +  IM+
Sbjct  232  AFNSSINLLSDTVFSKDLVDPNSKDAQAFKHTVCSIME  269



>gb|KDO63687.1| hypothetical protein CISIN_1g040285mg, partial [Citrus sinensis]
Length=298

 Score =   128 bits (321),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 69/194 (36%), Positives = 112/194 (58%), Gaps = 3/194 (2%)
 Frame = +1

Query  238  ARKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILS  417
            +R   S S RLPPGP   PVIGN+L+LG  PH+++A++   +G ++ L+ G V+T+   S
Sbjct  24   SRGFKSGSRRLPPGPTPYPVIGNLLELGDKPHKSLAKLAKIHGPIMSLKFGQVTTVVFSS  83

Query  418  AKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRI  597
            A  A E+ +N D SF +RT+ D +   G++   + + P  + WR LR+IC    F  +++
Sbjct  84   AAMAKEILQNQDTSFCNRTIPDAIYAHGHHEFGMPWLPVATLWRNLRKICNSHAFSSRQL  143

Query  598  NETVPVRRKCIDDMLLWIEKEASSVQRGTGVHVAHFVFLSTFNLLGNLFLSRDLVDPMSD  777
            +    +RRK I D+L ++++   +   GT +H+    F +T NL+ N   S DL DP S 
Sbjct  144  DANQHLRRKKIQDLLAYVQENCRA---GTAIHIGQAAFDTTLNLISNTIFSIDLADPTSK  200

Query  778  KASKFFDAMTGIMQ  819
             A +F     G+M+
Sbjct  201  TAREFKQTNWGMME  214



>ref|XP_009793679.1| PREDICTED: cytochrome P450 76A1 [Nicotiana sylvestris]
Length=506

 Score =   130 bits (327),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 69/175 (39%), Positives = 101/175 (58%), Gaps = 2/175 (1%)
 Frame = +1

Query  295  VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT  474
            ++ N+   G  PH + A++  KYG ++ L +GS+ST+ I S   A E+FKNHD+  A R 
Sbjct  44   LVTNIFQSGFAPHVSFAKLATKYGPIMTLWLGSMSTVVISSNDVAREMFKNHDMVLAGRK  103

Query  475  VIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIE  654
            + + MK      GSL    YG +WR+LRR+ T E FV  R++     R KCID M+ +I 
Sbjct  104  IYEAMKGDFGNEGSLITNQYGPHWRMLRRLSTKEFFVTSRLDAMRGTRTKCIDQMVQFIG  163

Query  655  KEASSVQRGTGVHVAHFVFLSTFNLLGNLFLSRDLVDPMSDKASKFFDAMTGIMQ  819
               +     T + V  F FL  FNL+GNL  S+DL+DP S++ +KFF     +M+
Sbjct  164  DAGNFGT--TSIDVGRFFFLMAFNLIGNLMFSKDLLDPKSNRGAKFFYHAGKVME  216



>ref|XP_010558964.1| PREDICTED: LOW QUALITY PROTEIN: cytochrome P450 76A1 [Tarenaya 
hassleriana]
Length=514

 Score =   130 bits (326),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 71/182 (39%), Positives = 111/182 (61%), Gaps = 10/182 (5%)
 Frame = +1

Query  295  VIGNMLDLGAFP---HQTIAEM-KNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSF  462
            V+GNM  L   P   HQT++++ +  +G  + LR+GS+ T+   S+ AA E+ ++ DV+ 
Sbjct  42   VVGNMFQLAISPLPPHQTLSKLARGVHGPFMTLRLGSMLTVVASSSSAAREVLRDCDVAL  101

Query  463  ADRTVIDVMKVQ--GYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDD  636
            A R + + MK +      GSL  A YG+YWR+LRR+CT + FV +R++    VR +C+D 
Sbjct  102  AGRKIYEAMKGERGKSSEGSLITAQYGAYWRMLRRLCTTQFFVTRRLDSMCNVRARCMDQ  161

Query  637  MLLWIEKEASSVQRGTG-VHVAHFVFLSTFNLLGNLFLSRDLVDPMSDKASKFFDAMTGI  813
            M+ ++E+     Q GT  V +  + FL  FNL+GNL  S+DL+DP S + SKFF     +
Sbjct  162  MVRFVEEAG---QNGTKTVDIGRYFFLMAFNLIGNLMFSKDLLDPDSKQGSKFFYHAGKV  218

Query  814  MQ  819
            M+
Sbjct  219  ME  220



>ref|XP_004138005.1| PREDICTED: cytochrome P450 76A2 [Cucumis sativus]
 gb|KGN59047.1| hypothetical protein Csa_3G748270 [Cucumis sativus]
Length=523

 Score =   130 bits (326),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 62/175 (35%), Positives = 101/175 (58%), Gaps = 0/175 (0%)
 Frame = +1

Query  295  VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT  474
            V+GN+L L    H++  ++  KYG ++ L++GS+ T+ + S+  A E+FK HDV  + R 
Sbjct  41   VVGNLLQLSFSAHESFTKLAAKYGPIMTLQLGSMKTVVVSSSTVAREMFKTHDVPLSGRM  100

Query  475  VIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIE  654
            + + MK      GSL  + YG +WR+LRR+ T E FV +++     VRR CID M+  +E
Sbjct  101  IYEAMKGNHGTQGSLITSQYGPHWRMLRRLATSEFFVARQLESMKHVRRHCIDAMIRHVE  160

Query  655  KEASSVQRGTGVHVAHFVFLSTFNLLGNLFLSRDLVDPMSDKASKFFDAMTGIMQ  819
            +          + V  FVF+  FNL+GNL  S+DL++  S +  +F+     +M+
Sbjct  161  EGCDPCGNAPALDVGKFVFVMGFNLIGNLIFSKDLLEANSKRGKEFYYHTRKVME  215



>ref|XP_008442789.1| PREDICTED: LOW QUALITY PROTEIN: cytochrome P450 76A2 [Cucumis 
melo]
Length=519

 Score =   129 bits (325),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 61/175 (35%), Positives = 102/175 (58%), Gaps = 0/175 (0%)
 Frame = +1

Query  295  VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT  474
            V+GN+L L    H++  ++  KYG ++ L++GS+ T+ I S+ AA E+FK HD   + R 
Sbjct  38   VVGNLLQLSFSAHESFTKLAAKYGPIMTLQLGSMKTVVISSSTAAREMFKTHDAPLSGRM  97

Query  475  VIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIE  654
            + + MK      GSL  + YG +WR+LRR+ T E FV +++     VRR CID M+  ++
Sbjct  98   IYEAMKGDHGTQGSLITSQYGPHWRMLRRLATSEFFVARQLESMKHVRRHCIDAMIRHVQ  157

Query  655  KEASSVQRGTGVHVAHFVFLSTFNLLGNLFLSRDLVDPMSDKASKFFDAMTGIMQ  819
            +          + V  F+F+ +FNL+GNL  S+DL++  S +  +F+     +M+
Sbjct  158  EGCDPCGNAQALDVGKFMFVMSFNLIGNLIFSKDLLEANSKRGKEFYYHTRKVME  212



>gb|KHN37270.1| Cytochrome P450 76A2 [Glycine soja]
Length=491

 Score =   129 bits (325),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 70/177 (40%), Positives = 107/177 (60%), Gaps = 5/177 (3%)
 Frame = +1

Query  295  VIGNMLDL-GAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADR  471
            V+GN+  L G  PH+++A++ +K+G ++ L +GS+ T+ I S++ A  +FKNHDV  A R
Sbjct  21   VVGNIFQLAGWLPHESLAKLAHKHGPIMTLWLGSMCTVVISSSQVARHMFKNHDVILAGR  80

Query  472  TVIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWI  651
             + + M+      GSL  + Y S+WR+L+R+CT ELFV  R++    VR KCI  ML  I
Sbjct  81   KIYEAMRGDHGSEGSLITSQYNSHWRMLKRLCTTELFVTTRLDAMQGVRAKCIHRMLHLI  140

Query  652  EKEASSVQRGT-GVHVAHFVFLSTFNLLGNLFLSRDLVDPMSDKASKFFDAMTGIMQ  819
            ++     Q GT  V V  F FL  FNL+GNL  S+DL+D   ++   F+     +M+
Sbjct  141  QQAG---QSGTCAVDVGRFFFLMDFNLIGNLIFSKDLLDSEMERGDCFYYHALKVME  194



>ref|XP_003535793.1| PREDICTED: cytochrome P450 76A2-like [Glycine max]
Length=510

 Score =   129 bits (324),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 70/177 (40%), Positives = 107/177 (60%), Gaps = 5/177 (3%)
 Frame = +1

Query  295  VIGNMLDL-GAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADR  471
            V+GN+  L G  PH+++A++ +K+G ++ L +GS+ T+ I S++ A  +FKNHDV  A R
Sbjct  40   VVGNIFQLAGWLPHESLAKLAHKHGPIMTLWLGSMCTVVISSSQVARHMFKNHDVILAGR  99

Query  472  TVIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWI  651
             + + M+      GSL  + Y S+WR+L+R+CT ELFV  R++    VR KCI  ML  I
Sbjct  100  KIYEAMRGDHGSEGSLITSQYNSHWRMLKRLCTTELFVTTRLDAMQGVRAKCIHRMLHLI  159

Query  652  EKEASSVQRGT-GVHVAHFVFLSTFNLLGNLFLSRDLVDPMSDKASKFFDAMTGIMQ  819
            ++     Q GT  V V  F FL  FNL+GNL  S+DL+D   ++   F+     +M+
Sbjct  160  QQAG---QSGTCAVDVGRFFFLMDFNLIGNLIFSKDLLDSEMERGDCFYYHALKVME  213



>ref|XP_006403743.1| hypothetical protein EUTSA_v10010318mg [Eutrema salsugineum]
 gb|ESQ45196.1| hypothetical protein EUTSA_v10010318mg [Eutrema salsugineum]
Length=496

 Score =   129 bits (323),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 66/176 (38%), Positives = 101/176 (57%), Gaps = 22/176 (13%)
 Frame = +1

Query  295  VIGNMLDL-GAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADR  471
            VIGNM  L G+ PH ++ ++  ++G ++ LR+GS+ T+ I S++ A E+FK HD + A R
Sbjct  44   VIGNMFQLAGSPPHDSLTKLSRRHGPIMTLRLGSMLTVVISSSQVAREIFKKHDAALAGR  103

Query  472  TVIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWI  651
             + + MK      GSL  A YG+YWR+LRR+CT + FV +R++    VR KC+D ML ++
Sbjct  104  KIYEAMKGGKSSEGSLITAQYGAYWRMLRRLCTTQFFVTRRLDAMSDVRSKCVDQMLRFV  163

Query  652  EKEASSVQRGTGVHVAHFVFLSTFNLLGNLFLSRDLVDPMSDKASKFFDAMTGIMQ  819
            E+   +                     GNL  SRDL+DP S + S+FF     +M+
Sbjct  164  EEGGQN---------------------GNLMFSRDLLDPDSKRGSEFFYHTGKVME  198



>ref|XP_006440464.1| hypothetical protein CICLE_v10019826mg [Citrus clementina]
 gb|ESR53704.1| hypothetical protein CICLE_v10019826mg [Citrus clementina]
Length=499

 Score =   128 bits (322),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 69/194 (36%), Positives = 112/194 (58%), Gaps = 3/194 (2%)
 Frame = +1

Query  238  ARKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILS  417
            +R   S S RLPPGP   PVIGN+L+LG  PH+++A++   +G ++ L+ G V+T+   S
Sbjct  24   SRGFKSGSRRLPPGPTPYPVIGNLLELGDKPHKSLAKLAKIHGPIMSLKFGQVTTVVFSS  83

Query  418  AKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRI  597
            A  A E+ +N D SF +RT+ D +   G++   + + P  + WR LR+IC    F  +++
Sbjct  84   AAMAKEILQNQDTSFCNRTIPDAIYAHGHHEFGMPWLPVATLWRNLRKICNSHAFSSRQL  143

Query  598  NETVPVRRKCIDDMLLWIEKEASSVQRGTGVHVAHFVFLSTFNLLGNLFLSRDLVDPMSD  777
            +    +RRK I D+L ++++   +   GT +H+    F +T NL+ N   S DL DP S 
Sbjct  144  DANQHLRRKKIQDLLAYVQENCRA---GTAIHIGQAAFDTTLNLISNTIFSIDLADPTSK  200

Query  778  KASKFFDAMTGIMQ  819
             A +F     G+M+
Sbjct  201  TAREFKQTNWGMME  214



>ref|XP_002276561.1| PREDICTED: geraniol 8-hydroxylase [Vitis vinifera]
Length=498

 Score =   127 bits (319),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 70/210 (33%), Positives = 124/210 (59%), Gaps = 8/210 (4%)
 Frame = +1

Query  190  LVWSAIFLIPGLVFLLARKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAEMKNKYGS  369
            + W++I+++     + AR+  S + +LPPGP   P+IGN+L+LG  PH+++A +   YG 
Sbjct  12   VAWTSIYIV-----VSARRSKSGAGKLPPGPVPFPIIGNLLNLGNKPHESLANLAKIYGP  66

Query  370  VIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPYGSYWR  549
            V+ L++G V+T+ I SA  A E+ +  D SF +RT+ D ++   +   S+ + P  + WR
Sbjct  67   VMSLKLGCVTTVVITSATMAKEVLQKKDQSFCNRTIPDALRALNHNQISMVWLPVSTKWR  126

Query  550  VLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEASSVQRGTGVHVAHFVFLSTFNL  729
             LR+IC   +F +++++ +  +R + + D+L  +E+   S Q G  V +    F +T NL
Sbjct  127  TLRKICNSHIFTNQKLDSSNYLRHQKVQDLLANVEQ---SCQAGDVVDIGQEAFRTTLNL  183

Query  730  LGNLFLSRDLVDPMSDKASKFFDAMTGIMQ  819
            L N   S DLV+P SD   +F + +  +M+
Sbjct  184  LSNTTFSVDLVEPSSDTVQEFKELVRHMME  213



>ref|XP_006477331.1| PREDICTED: geraniol 8-hydroxylase-like [Citrus sinensis]
Length=499

 Score =   126 bits (317),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 68/194 (35%), Positives = 111/194 (57%), Gaps = 3/194 (2%)
 Frame = +1

Query  238  ARKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILS  417
            +R   S S RLPPGP   PVIGN+L+LG  PH+++A++   +G ++ L+ G V+T+   S
Sbjct  24   SRGFKSGSRRLPPGPTPYPVIGNLLELGDKPHKSLAKLAKIHGPIMSLKFGQVTTVVFSS  83

Query  418  AKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRI  597
            A  A E+ +N D SF +RT+ D +   G++   + + P  + WR  R+IC    F  +++
Sbjct  84   AAMAKEILQNQDTSFCNRTIPDAIYAHGHHEFGMPWLPVATLWRNFRKICNSHAFSSRQL  143

Query  598  NETVPVRRKCIDDMLLWIEKEASSVQRGTGVHVAHFVFLSTFNLLGNLFLSRDLVDPMSD  777
            +    +RRK I D+L ++++   +   GT +H+    F +T NL+ N   S DL DP S 
Sbjct  144  DANQHLRRKKIQDLLAYVQENCRA---GTAIHIGQAAFDTTLNLISNTIFSIDLADPTSK  200

Query  778  KASKFFDAMTGIMQ  819
             A +F     G+M+
Sbjct  201  TAREFKQINWGMME  214



>emb|CBI33813.3| unnamed protein product [Vitis vinifera]
Length=594

 Score =   127 bits (319),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 70/210 (33%), Positives = 124/210 (59%), Gaps = 8/210 (4%)
 Frame = +1

Query  190  LVWSAIFLIPGLVFLLARKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAEMKNKYGS  369
            + W++I+++     + AR+  S + +LPPGP   P+IGN+L+LG  PH+++A +   YG 
Sbjct  12   VAWTSIYIV-----VSARRSKSGAGKLPPGPVPFPIIGNLLNLGNKPHESLANLAKIYGP  66

Query  370  VIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPYGSYWR  549
            V+ L++G V+T+ I SA  A E+ +  D SF +RT+ D ++   +   S+ + P  + WR
Sbjct  67   VMSLKLGCVTTVVITSATMAKEVLQKKDQSFCNRTIPDALRALNHNQISMVWLPVSTKWR  126

Query  550  VLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEASSVQRGTGVHVAHFVFLSTFNL  729
             LR+IC   +F +++++ +  +R + + D+L  +E+   S Q G  V +    F +T NL
Sbjct  127  TLRKICNSHIFTNQKLDSSNYLRHQKVQDLLANVEQ---SCQAGDVVDIGQEAFRTTLNL  183

Query  730  LGNLFLSRDLVDPMSDKASKFFDAMTGIMQ  819
            L N   S DLV+P SD   +F + +  +M+
Sbjct  184  LSNTTFSVDLVEPSSDTVQEFKELVRHMME  213



>ref|XP_010692297.1| PREDICTED: geraniol 8-hydroxylase-like isoform X2 [Beta vulgaris 
subsp. vulgaris]
Length=484

 Score =   125 bits (314),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 61/175 (35%), Positives = 103/175 (59%), Gaps = 3/175 (2%)
 Frame = +1

Query  295  VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT  474
            +IGN+  LG  PH+++AE+   YG ++ L++GS++T+ I S + A E+F  HD+ F+ R 
Sbjct  37   IIGNIFKLGDKPHRSVAELAKIYGPIMSLKLGSITTIVISSPEVAREMFLKHDLDFSGRA  96

Query  475  VIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIE  654
              D ++   +   S+ F P G  WR LR+I TV+LF  KR++ +  +R+K +D++   IE
Sbjct  97   NTDALRAANHDQLSMVFLPVGPKWRNLRKIATVQLFTGKRLDASQIIRQKKVDEL---IE  153

Query  655  KEASSVQRGTGVHVAHFVFLSTFNLLGNLFLSRDLVDPMSDKASKFFDAMTGIMQ  819
                  +RG  +++    F +T NLL + F S+DL    S  + +F D  + IM+
Sbjct  154  YARHCSERGLPLNIGKAAFTTTLNLLSSTFFSKDLASHDSSSSQEFKDIASNIME  208



>ref|XP_003592855.1| Cytochrome P450 [Medicago truncatula]
 gb|AES63106.1| cytochrome P450 family protein [Medicago truncatula]
Length=522

 Score =   124 bits (311),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 66/178 (37%), Positives = 108/178 (61%), Gaps = 4/178 (2%)
 Frame = +1

Query  295  VIGNMLDLG-AFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADR  471
            V+GN+  LG + PH++   +  ++G ++ L +GS+ T+ + S +AA ++FKN+D + A R
Sbjct  43   VVGNIFQLGLSPPHESFTILSRRHGPIMTLWLGSMCTVVVSSCEAARDMFKNNDAALAGR  102

Query  472  TVIDVMKVQGYY--MGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLL  645
             V + MK    +   GSL  + Y ++WR+LRR+ T E FV  R++    VR KCID M+ 
Sbjct  103  KVYEAMKGNHNHGSEGSLITSQYDAHWRMLRRLSTTEFFVTSRLDAMQGVRAKCIDRMVH  162

Query  646  WIEKEASSVQRGTGVHVAHFVFLSTFNLLGNLFLSRDLVDPMSDKASKFFDAMTGIMQ  819
             I+ EA++      V V  F FL  FNL+GNL  S+DL+DP  ++ ++F+     +M+
Sbjct  163  LID-EAAAESSNCAVDVGKFFFLMAFNLIGNLIFSKDLLDPEMERGARFYYHAIKVMK  219



>ref|XP_003536316.1| PREDICTED: geraniol 8-hydroxylase-like [Glycine max]
 gb|KHN37833.1| Cytochrome P450 76C1 [Glycine soja]
Length=497

 Score =   123 bits (309),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 77/196 (39%), Positives = 114/196 (58%), Gaps = 6/196 (3%)
 Frame = +1

Query  235  LARKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAIL  414
            LA+     ++ LPPGP  LP+IGN+L+LG  PHQ++A++   +G V+ L++G+V+T+ I 
Sbjct  21   LAKTTRKPNHNLPPGPSRLPIIGNLLELGQNPHQSMAKLAKIHGPVMSLKLGTVTTIVIS  80

Query  415  SAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKR  594
            SA  A E+   HD S ++R +   + V  +   SLAF P    WR +R+IC  +LF HK 
Sbjct  81   SADMAKEVLVTHDESLSNRPIPQSVSVLNHEHYSLAFLPVSPLWREMRKICNGQLFAHKT  140

Query  595  INETVPVRRKCIDDMLLWIEKEASSVQRGTGVHVAHFVFLSTFNLLGNLFLSRDLVDPMS  774
            ++E+  VRRK +  +L  + K   S Q G  V V    F +T NLL N   S DLV  +S
Sbjct  141  LDESQDVRRKIVQQLLSDVHK---SCQIGEAVDVGRQAFKTTLNLLSNTIFSEDLV--LS  195

Query  775  D-KASKFFDAMTGIMQ  819
               A +F D +T I +
Sbjct  196  KGTAGEFKDLVTNITK  211



>ref|XP_002303546.2| hypothetical protein POPTR_0003s11810g [Populus trichocarpa]
 gb|EEE78525.2| hypothetical protein POPTR_0003s11810g [Populus trichocarpa]
Length=505

 Score =   123 bits (309),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 70/202 (35%), Positives = 121/202 (60%), Gaps = 4/202 (2%)
 Frame = +1

Query  211  LIPGLVFLLARKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIG  390
            +I  L ++L R K  S  +LPPGP  LP++GN+LDLG  PH+++A++   +G ++ L++G
Sbjct  17   VIQSLDYILRRSKRKSG-KLPPGPSRLPIVGNLLDLGDKPHKSLAKLAKTHGQLMSLKLG  75

Query  391  SVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPYGSYWRVLRRICT  570
             V+T+ + SA  A E+ + HD++F +RTV+D ++   ++   +A+ P  + WR LR+IC 
Sbjct  76   QVTTIVVSSATMAKEVLQKHDLTFCNRTVVDAVRALDHHEAGIAWLPVATRWRNLRKICN  135

Query  571  VELFVHKRINETVPVRRKCIDDMLLWIEKEASSVQRGTGVHVAHFVFLSTFNLLGNLFLS  750
              +F  ++++    +RRK + D+L  +++       G  V +    F +T N L N  LS
Sbjct  136  SHIFTSQKLDANQDLRRKKVQDLLAEVQERCLV---GEAVDLRQAAFTATLNALSNTVLS  192

Query  751  RDLVDPMSDKASKFFDAMTGIM  816
             DL D  SD A +F + ++ IM
Sbjct  193  LDLTDLSSDIAREFKEHISCIM  214



>ref|XP_007209932.1| hypothetical protein PRUPE_ppa004606mg [Prunus persica]
 gb|EMJ11131.1| hypothetical protein PRUPE_ppa004606mg [Prunus persica]
Length=500

 Score =   123 bits (309),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 69/209 (33%), Positives = 121/209 (58%), Gaps = 6/209 (3%)
 Frame = +1

Query  190  LVWSAIFLIPGLVFLLARKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAEMKNKYGS  369
            L W+   LI  +++ ++R + SS  +LPPGP   P+IGN+L LG  PH+++AE+  K+G 
Sbjct  12   LTWT---LIQTILYSISRSQKSSRPKLPPGPKPFPLIGNLLQLGDKPHKSLAELAKKHGP  68

Query  370  VIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPYGSYWR  549
            ++ L++G V+ + + SA  A E+ + HD   ++RT+ D ++   +++  L + P  + WR
Sbjct  69   LMSLKLGKVTAIVVSSAAMAKEVLQTHDQFLSNRTIPDSIRAYDHHIVGLPWIPVSTLWR  128

Query  550  VLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEASSVQRGTGVHVAHFVFLSTFNL  729
             LR+IC  ELF +K ++    +RR  + +++  + +   S Q    V +    F +T NL
Sbjct  129  NLRKICNTELFANKMLDSNQNLRRNKVQELIGQVHR---SSQADEAVDIGRAAFTTTLNL  185

Query  730  LGNLFLSRDLVDPMSDKASKFFDAMTGIM  816
            L N   S DL +P S+ A +F + +  IM
Sbjct  186  LSNTIFSIDLANPSSEMAREFQEMVCNIM  214



>ref|XP_002276576.1| PREDICTED: geraniol 8-hydroxylase [Vitis vinifera]
Length=499

 Score =   123 bits (309),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 61/172 (35%), Positives = 99/172 (58%), Gaps = 3/172 (2%)
 Frame = +1

Query  301  GNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVI  480
            GN+L+LG  PHQ+   +   YG ++ L++GS +T+ I S K A E+    D +FA RTV+
Sbjct  48   GNLLELGDKPHQSFTTLSKTYGPLMSLKLGSTTTIVISSPKTAQEVLNKKDQAFASRTVL  107

Query  481  DVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKE  660
            + +++Q ++  S+ F P  ++WR LR+IC++++F  +R+  +  +RRK +  +L   E  
Sbjct  108  NAIQIQDHHKFSMVFLPASAHWRNLRKICSMQIFSPQRVEASQDLRRKVVQQLL---EHA  164

Query  661  ASSVQRGTGVHVAHFVFLSTFNLLGNLFLSRDLVDPMSDKASKFFDAMTGIM  816
              S   G  V V    F +T NLL N F S DL    S+ + +F D +  IM
Sbjct  165  RESCNSGRAVDVGRAAFTTTLNLLSNTFFSVDLAHYDSNLSQEFKDLIWSIM  216



>ref|XP_009362819.1| PREDICTED: geraniol 8-hydroxylase-like [Pyrus x bretschneideri]
Length=501

 Score =   123 bits (308),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 73/210 (35%), Positives = 120/210 (57%), Gaps = 7/210 (3%)
 Frame = +1

Query  190  LVWSAIFLIPGLVFLLAR-KKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAEMKNKYG  366
            L W+   L+  L + L R KKSS S +LPPGP   PVIGN+  LG  PH+++A++  K+G
Sbjct  12   LTWA---LLEALFYSLGRGKKSSRSKQLPPGPKPFPVIGNLHQLGDKPHKSLAKLAQKHG  68

Query  367  SVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPYGSYW  546
             ++ L++G V+++ I SA  A E+ + HD  F +RT+ D ++   ++   L + P  + W
Sbjct  69   PLMSLKLGQVTSIVISSAAMAKEVLQTHDHFFCNRTIPDSLRAHDHHTIGLPWLPVSTMW  128

Query  547  RVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEASSVQRGTGVHVAHFVFLSTFN  726
            R LR+IC  +LF +K ++    +RR+ + ++L  + + + S   G  + +    F +  N
Sbjct  129  RNLRKICNTQLFANKMLDSNENLRRRKLQELLEEVRQSSVS---GQALDIGKAAFTTVLN  185

Query  727  LLGNLFLSRDLVDPMSDKASKFFDAMTGIM  816
            LL N   S DL DP S+ A  F + +  IM
Sbjct  186  LLSNTIFSIDLADPNSEMARNFKEMVCNIM  215



>emb|CDP11721.1| unnamed protein product [Coffea canephora]
Length=476

 Score =   122 bits (307),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 68/187 (36%), Positives = 116/187 (62%), Gaps = 3/187 (2%)
 Frame = +1

Query  253  SSSYRlppgppglpVIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAA  432
            SSS + PPGP GLP+IG++L+LG  P+Q++A +   +G ++ L++GS++T+   S +AA 
Sbjct  24   SSSRKTPPGPKGLPIIGSLLELGPRPNQSLAALAKIHGPIMTLKLGSITTIVASSPEAAK  83

Query  433  ELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVP  612
            E+ +  +  F+DRTV  V+  Q Y+  SLA+AP    WR  RRIC  ++F ++R++   P
Sbjct  84   EILQKQEQVFSDRTVPCVVTAQPYHKTSLAWAPGDQRWRSYRRICATQMFTNQRLDLLQP  143

Query  613  VRRKCIDDMLLWIEKEASSVQRGTGVHVAHFVFLSTFNLLGNLFLSRDLVDPMSDKASKF  792
            +R K ++D++L+ +K + S      V +    F +  N++ +   S D+VD  S+ A +F
Sbjct  144  LRHKKVEDLMLYFKKHSDST---APVDIGRASFATALNVISSTMFSIDIVDLDSENAQEF  200

Query  793  FDAMTGI  813
             D + GI
Sbjct  201  KDLILGI  207



>ref|XP_011033851.1| PREDICTED: geraniol 8-hydroxylase-like isoform X2 [Populus euphratica]
Length=500

 Score =   122 bits (306),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 71/208 (34%), Positives = 123/208 (59%), Gaps = 9/208 (4%)
 Frame = +1

Query  208  FLIP-----GLVFLLARKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAEMKNKYGSV  372
            FL+P      L ++L R K  S  +LPPGP  LP++GN+ DLG  PH+++A++   +G +
Sbjct  11   FLLPFAVIQSLDYILRRSKRKSG-KLPPGPSRLPIVGNLWDLGDKPHKSLAKLAKTHGQL  69

Query  373  IWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPYGSYWRV  552
            + L++G V+T+ + SA  A E+ + HD++F +RT++D ++   ++   +A+ P  + WR 
Sbjct  70   MSLKLGQVTTIVVSSAAMAKEVLQKHDLTFCNRTIVDAVRALDHHESGIAWLPVATRWRN  129

Query  553  LRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEASSVQRGTGVHVAHFVFLSTFNLL  732
            LRRIC   +F  ++++    +RRK + D+L  +++       G  V + H  F +T N L
Sbjct  130  LRRICNSHIFTAQKLDANQDLRRKKVQDILAEVQERCLV---GEAVDLRHAAFTATLNAL  186

Query  733  GNLFLSRDLVDPMSDKASKFFDAMTGIM  816
             N  LS +L D  SD A +F + ++ IM
Sbjct  187  SNTVLSLNLTDLSSDIAREFKERISCIM  214



>ref|XP_007040049.1| Cytochrome P450, putative [Theobroma cacao]
 gb|EOY24550.1| Cytochrome P450, putative [Theobroma cacao]
Length=500

 Score =   122 bits (306),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 57/175 (33%), Positives = 102/175 (58%), Gaps = 3/175 (2%)
 Frame = +1

Query  295  VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT  474
            + GN+ DLG  PH++++E+   +G ++ L+IGS+ T+ I S   A ++ + HD++F++RT
Sbjct  44   IFGNLFDLGDKPHKSLSELAKIHGPLMSLKIGSLITVVISSENMAKQVLQKHDLTFSNRT  103

Query  475  VIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIE  654
            ++D ++   +    L + P    WR LR++C   LF  ++++    +RRK I +++  ++
Sbjct  104  IVDAVRASQHDEVGLPWIPVSPLWRTLRKVCNTHLFASQKLDANQYLRRKKIQELIAIVQ  163

Query  655  KEASSVQRGTGVHVAHFVFLSTFNLLGNLFLSRDLVDPMSDKASKFFDAMTGIMQ  819
            K   S   G  +++    F +T NLL N   S DLVDP S  A +F   + GIM+
Sbjct  164  K---SCHAGEVINIGQAAFNTTINLLSNTIFSMDLVDPNSPTAQEFKKTVWGIME  215



>ref|XP_011033850.1| PREDICTED: geraniol 8-hydroxylase-like isoform X1 [Populus euphratica]
Length=519

 Score =   122 bits (306),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 71/208 (34%), Positives = 123/208 (59%), Gaps = 9/208 (4%)
 Frame = +1

Query  208  FLIP-----GLVFLLARKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAEMKNKYGSV  372
            FL+P      L ++L R K  S  +LPPGP  LP++GN+ DLG  PH+++A++   +G +
Sbjct  30   FLLPFAVIQSLDYILRRSKRKSG-KLPPGPSRLPIVGNLWDLGDKPHKSLAKLAKTHGQL  88

Query  373  IWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPYGSYWRV  552
            + L++G V+T+ + SA  A E+ + HD++F +RT++D ++   ++   +A+ P  + WR 
Sbjct  89   MSLKLGQVTTIVVSSAAMAKEVLQKHDLTFCNRTIVDAVRALDHHESGIAWLPVATRWRN  148

Query  553  LRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEASSVQRGTGVHVAHFVFLSTFNLL  732
            LRRIC   +F  ++++    +RRK + D+L  +++       G  V + H  F +T N L
Sbjct  149  LRRICNSHIFTAQKLDANQDLRRKKVQDILAEVQERCLV---GEAVDLRHAAFTATLNAL  205

Query  733  GNLFLSRDLVDPMSDKASKFFDAMTGIM  816
             N  LS +L D  SD A +F + ++ IM
Sbjct  206  SNTVLSLNLTDLSSDIAREFKERISCIM  233



>ref|XP_002276053.1| PREDICTED: geraniol 8-hydroxylase-like [Vitis vinifera]
Length=496

 Score =   122 bits (305),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 70/209 (33%), Positives = 122/209 (58%), Gaps = 7/209 (3%)
 Frame = +1

Query  193  VWSAIFLIPGLVFLLARKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAEMKNKYGSV  372
            VW+ I L+   +  + RK S++S   PPGP   P+IGN+L LG  PHQ++  +   YG V
Sbjct  13   VWTCIHLLK--LSPIGRKPSTASL--PPGPRPFPIIGNILKLGDKPHQSLTNLSKTYGPV  68

Query  373  IWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPYGSYWRV  552
            + L++GS+ST+ + S + A E+   +D +F+ R V+  +K   ++  S+ ++P  +YWR 
Sbjct  69   MSLKLGSISTIVVSSPETAKEVLHRNDQAFSGREVLGAVKAHNHHESSVIWSPTSAYWRK  128

Query  553  LRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEASSVQRGTGVHVAHFVFLSTFNLL  732
            +R+ICT E+F  +R+N +  +R+K + ++L  +E+      RG  V +    F ++ NLL
Sbjct  129  IRKICTREMFSVQRLNASQGLRKKIVQELLDHVEE---CCGRGCAVDIGAATFTASLNLL  185

Query  733  GNLFLSRDLVDPMSDKASKFFDAMTGIMQ  819
             N   S +L    S  + +F D + G+M+
Sbjct  186  SNTIFSTNLAHHDSTFSQEFKDIVWGVME  214



>ref|XP_003600328.1| Cytochrome P450 [Medicago truncatula]
 gb|AES70579.1| cytochrome P450 family 71 protein [Medicago truncatula]
Length=498

 Score =   121 bits (304),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 71/179 (40%), Positives = 109/179 (61%), Gaps = 10/179 (6%)
 Frame = +1

Query  190  LVWSAIFLIPGLVFL----LARKKSSSSYRlppgppglpVIGNMLDL-GAFPHQTIAEMK  354
            + +++IF +   VF+    L +K  SS+  LPPGP  LP+IGN+ +L G+ PH  + ++ 
Sbjct  6    ICFTSIFSLLMFVFIANKILTKKSESSAQNLPPGPLKLPIIGNIHNLIGSLPHHRLRDLS  65

Query  355  NKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPY  534
             KYG ++ L++G VST+ + SA+ A E+ KNHD+ FA R  I   K+  Y    LAFAPY
Sbjct  66   TKYGPLMHLKLGEVSTIVVSSAEYAKEVMKNHDLVFASRPPIQASKIMSYDSLGLAFAPY  125

Query  535  GSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEASSVQRGTGVHVAHFVF  711
            G YWR LR+ICT+EL   KR+    P+R + + +++ WI     S + G+ ++    VF
Sbjct  126  GDYWRNLRKICTLELLSSKRVQSFQPIRSEEVTNLIKWI-----SSKEGSQINFTKEVF  179



>ref|XP_010053381.1| PREDICTED: geraniol 8-hydroxylase-like [Eucalyptus grandis]
 gb|KCW77659.1| hypothetical protein EUGRSUZ_D01958 [Eucalyptus grandis]
Length=499

 Score =   121 bits (304),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 79/210 (38%), Positives = 122/210 (58%), Gaps = 7/210 (3%)
 Frame = +1

Query  187  YLVWSAIFLIPGLVFLLARKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAEMKNKYG  366
            YL WS   L+  L F+  +K   S   LPPGPP LPVIGN+L+LG  PH+++A++ + YG
Sbjct  11   YLAWS---LVQALRFI-TKKTKPSPSNLPPGPPPLPVIGNLLELGNLPHKSLAKLAHTYG  66

Query  367  SVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPYGSYW  546
             +I L++G+++T+ I S   + E+ + HDVSFA+R + D +      M SL + P    W
Sbjct  67   PIIKLQLGAITTVVISSPTLSREILQTHDVSFANRMIPDAVTAFNQGMHSLPWVPVSPLW  126

Query  547  RVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEASSVQRGTGVHVAHFVFLSTFN  726
            R LRRI  V LF + +++ T  +RRK + ++L  +E   +S + G  V +    F ++ N
Sbjct  127  RNLRRIFNVHLFSNMKLDSTQHLRRKKVQELLAHVE---TSARVGGEVEIGEAAFTTSIN  183

Query  727  LLGNLFLSRDLVDPMSDKASKFFDAMTGIM  816
             L +   S DLVD  S  A +F + +  IM
Sbjct  184  FLADAMFSLDLVDRSSGSAKEFKETVWQIM  213



>gb|AHF22835.1| drimenol oxidase 1 [Persicaria hydropiper]
Length=503

 Score =   121 bits (304),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 73/210 (35%), Positives = 125/210 (60%), Gaps = 6/210 (3%)
 Frame = +1

Query  187  YLVWSAIFLIPGLVFLLARKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAEMKNKYG  366
            YL+     ++ GL+   +R   +S  +LPPGPPGLP++GN+ DLG+ PH+++A++   +G
Sbjct  3    YLILMICIVVSGLLLYSSR---TSKMKLPPGPPGLPIVGNLFDLGSLPHRSLAKLAKLHG  59

Query  367  SVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPYGSYW  546
             V+ LR+G +  + I S  AA E+ +  D  F +R V D +    ++  S+A  P  + W
Sbjct  60   PVMCLRMGRLRVVVISSDSAAKEVLQTSDTLFCNRFVYDSLTASQHHTFSMALLPPTALW  119

Query  547  RVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEASSVQRGTGVHVAHFVFLSTFN  726
            + LR+I   +LF + R+N +  +RRK ++D+L ++E   S  + GT +++A   F ++ N
Sbjct  120  KSLRKISASQLFTNARMNASQHLRRKQLEDLLSYVE---SCSRSGTAINIAQAAFNTSVN  176

Query  727  LLGNLFLSRDLVDPMSDKASKFFDAMTGIM  816
            LL   F S DL+DP S  + +F + +  IM
Sbjct  177  LLSKTFFSVDLIDPSSSNSVEFKEMVWQIM  206



>ref|XP_010692296.1| PREDICTED: geraniol 8-hydroxylase-like isoform X1 [Beta vulgaris 
subsp. vulgaris]
Length=487

 Score =   121 bits (303),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 60/174 (34%), Positives = 102/174 (59%), Gaps = 3/174 (2%)
 Frame = +1

Query  295  VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT  474
            +IGN+  LG  PH+++AE+   YG ++ L++GS++T+ I S + A E+F  HD+ F+ R 
Sbjct  37   IIGNIFKLGDKPHRSVAELAKIYGPIMSLKLGSITTIVISSPEVAREMFLKHDLDFSGRA  96

Query  475  VIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIE  654
              D ++   +   S+ F P G  WR LR+I TV+LF  KR++ +  +R+K +D++   IE
Sbjct  97   NTDALRAANHDQLSMVFLPVGPKWRNLRKIATVQLFTGKRLDASQIIRQKKVDEL---IE  153

Query  655  KEASSVQRGTGVHVAHFVFLSTFNLLGNLFLSRDLVDPMSDKASKFFDAMTGIM  816
                  +RG  +++    F +T NLL + F S DL   +S  + +F D +  +M
Sbjct  154  YARHCSERGLPLNIGKAAFTTTLNLLSSTFFSMDLASHVSSDSQEFKDLVWQMM  207



>gb|ACU20890.1| unknown [Glycine max]
Length=516

 Score =   121 bits (303),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 55/175 (31%), Positives = 106/175 (61%), Gaps = 3/175 (2%)
 Frame = +1

Query  295  VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT  474
            +IGN+L+LG  PHQ +A++   YG ++ L++G ++T+ I S + A E+ + HD  FA+RT
Sbjct  42   IIGNILELGNQPHQALAKLSQIYGPIMSLKLGKITTIVISSPQVAKEVLQKHDQIFANRT  101

Query  475  VIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIE  654
            V D ++   +++ S+ + P  + WR LRR+C  ++F  ++++ T   R++ + D++ +++
Sbjct  102  VPDTLRALDHHILSVVWMPPLAQWRTLRRVCATKVFSSQQLDSTQVFRQRKVQDLMDYVK  161

Query  655  KEASSVQRGTGVHVAHFVFLSTFNLLGNLFLSRDLVDPMSDKASKFFDAMTGIMQ  819
            +     ++G  + +    F +  N + N F S DL    SDK+ +F D + GIM+
Sbjct  162  ERC---EKGEALDIGEASFTTVLNSISNTFFSMDLAYYTSDKSQEFKDIVWGIME  213



>ref|XP_004497404.1| PREDICTED: cytochrome P450 76A2-like [Cicer arietinum]
Length=516

 Score =   120 bits (302),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 68/166 (41%), Positives = 103/166 (62%), Gaps = 10/166 (6%)
 Frame = +1

Query  295  VIGNMLDLGAF----PHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSF  462
            ++GN+L L       PH++ A +  K+G ++ L +GS+ T+ + S++ A ++FKN+DV  
Sbjct  39   IVGNILQLARLSSSPPHESFAILARKHGPIMTLWLGSMCTVVVSSSEVARQMFKNNDVVL  98

Query  463  ADRTVIDVMK---VQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCID  633
            A R V + MK     G   GSL  + Y S+WR+L+R+ T E FV  R++    VR KC+D
Sbjct  99   AGRKVYEAMKGNYENGIIEGSLITSQYNSHWRMLKRLATHEFFVTSRLDAMRDVRAKCVD  158

Query  634  DMLLWIEKEA-SSVQRGTGVHVAHFVFLSTFNLLGNLFLSRDLVDP  768
             ML  IE E+ +SV  G GV V +F+F  +FNL+GNL  S+DL+ P
Sbjct  159  RMLNLIEHESVNSV--GVGVDVGNFLFTMSFNLIGNLIFSKDLLGP  202



>ref|XP_003521519.1| PREDICTED: geraniol 8-hydroxylase-like [Glycine max]
 gb|KHN04086.1| Cytochrome P450 76C4 [Glycine soja]
Length=516

 Score =   120 bits (301),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 55/175 (31%), Positives = 105/175 (60%), Gaps = 3/175 (2%)
 Frame = +1

Query  295  VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT  474
            +IGN+L+LG  PHQ +A++   YG ++ L++G  +T+ I S + A E+ + HD  FA+RT
Sbjct  42   IIGNILELGNQPHQALAKLSQIYGPIMSLKLGKTTTIVISSPQVAKEVLQKHDQIFANRT  101

Query  475  VIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIE  654
            V D ++   +++ S+ + P  + WR LRR+C  ++F  ++++ T   R++ + D++ +++
Sbjct  102  VPDTLRALDHHILSVVWMPPLAQWRTLRRVCATKVFSSQQLDSTQVFRQRKVQDLMDYVK  161

Query  655  KEASSVQRGTGVHVAHFVFLSTFNLLGNLFLSRDLVDPMSDKASKFFDAMTGIMQ  819
            +     ++G  + +    F +  N + N F S DL    SDK+ +F D + GIM+
Sbjct  162  ERC---EKGEALDIGEASFTTVLNSISNTFFSMDLAYYTSDKSQEFKDIVWGIME  213



>emb|CBI38806.3| unnamed protein product [Vitis vinifera]
Length=1183

 Score =   123 bits (308),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 61/172 (35%), Positives = 99/172 (58%), Gaps = 3/172 (2%)
 Frame = +1

Query  301  GNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVI  480
            GN+L+LG  PHQ+   +   YG ++ L++GS +T+ I S K A E+    D +FA RTV+
Sbjct  671  GNLLELGDKPHQSFTTLSKTYGPLMSLKLGSTTTIVISSPKTAQEVLNKKDQAFASRTVL  730

Query  481  DVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKE  660
            + +++Q ++  S+ F P  ++WR LR+IC++++F  +R+  +  +RRK +  +L   E  
Sbjct  731  NAIQIQDHHKFSMVFLPASAHWRNLRKICSMQIFSPQRVEASQDLRRKVVQQLL---EHA  787

Query  661  ASSVQRGTGVHVAHFVFLSTFNLLGNLFLSRDLVDPMSDKASKFFDAMTGIM  816
              S   G  V V    F +T NLL N F S DL    S+ + +F D +  IM
Sbjct  788  RESCNSGRAVDVGRAAFTTTLNLLSNTFFSVDLAHYDSNLSQEFKDLIWSIM  839


 Score =   101 bits (251),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 52/172 (30%), Positives = 96/172 (56%), Gaps = 3/172 (2%)
 Frame = +1

Query  301  GNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVI  480
            GN+L+LG  PH +   +  KYG ++ L++GS++T+ I S + A ++    D +F+ RTV 
Sbjct  48   GNLLELGDKPHHSFTTLSKKYGPLMSLKLGSITTIVISSPETAQQVLNKKDQTFSGRTVP  107

Query  481  DVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKE  660
            + ++V  ++  S+ F P  ++WR LR+IC++++F  +R++    +R+K +  +L    + 
Sbjct  108  NAIQVASHHHFSIGFLPASAHWRNLRKICSMQIFSLQRVDAFHGLRQKVVQQLLDHAHES  167

Query  661  ASSVQRGTGVHVAHFVFLSTFNLLGNLFLSRDLVDPMSDKASKFFDAMTGIM  816
             SS   G  V +    F    NLL N   S DL    S+ + +F + +  I+
Sbjct  168  CSS---GRAVDIGRAAFTIALNLLSNTVFSVDLAHYDSNLSQEFKELIWSIL  216



>ref|XP_010093536.1| Cytochrome P450 76C4 [Morus notabilis]
 gb|EXB54226.1| Cytochrome P450 76C4 [Morus notabilis]
Length=498

 Score =   119 bits (299),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 76/208 (37%), Positives = 116/208 (56%), Gaps = 7/208 (3%)
 Frame = +1

Query  205  IFLIPGLVFLLARK---KSSSSYRlppgppglpVIGNMLDLGAFPHQTIAEMKNKYGSVI  375
            +F IP + FL  R    + S + RLPPGP G+P++GN+L LG  PH+++ EM   YG ++
Sbjct  9    LFSIP-IFFLFIRPFILRKSDTKRLPPGPRGIPILGNLLQLGPRPHESLHEMAKLYGPLM  67

Query  376  WLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPYGSYWRVL  555
             LR+GSV+T+   S   A EL  NHD  FA+R + D +  Q  + G+LA+ P    WR  
Sbjct  68   TLRLGSVTTVVASSPDMARELLHNHDQVFANRPIPDSVTAQPNHQGTLAWVPGDHRWRNR  127

Query  556  RRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEASSVQRGTGVHVAHFVFLSTFNLLG  735
            RRIC+ +LF  +R++     R + ++ +L  I K   +    T V +    F +T NL+ 
Sbjct  128  RRICSSQLFTAQRLDILQHFRHRKVEQVLGHIRKHCDA---ATPVDIGSLSFAATLNLMS  184

Query  736  NLFLSRDLVDPMSDKASKFFDAMTGIMQ  819
            N   S D++D     A +F D +  IM+
Sbjct  185  NTIFSVDIIDAEFGTAQEFKDVVWSIME  212



>ref|XP_006423671.1| hypothetical protein CICLE_v10028269mg [Citrus clementina]
 gb|ESR36911.1| hypothetical protein CICLE_v10028269mg [Citrus clementina]
Length=495

 Score =   119 bits (299),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 63/177 (36%), Positives = 101/177 (57%), Gaps = 8/177 (5%)
 Frame = +1

Query  295  VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT  474
            VIGN+L+LG  PH+++A++   +G ++ LR+G V+T+ I S   A  + K HD  F DR 
Sbjct  41   VIGNLLELGGKPHKSLAKLAKIHGPIMSLRLGQVTTVVISSPSMAKAILKEHDSLFCDRK  100

Query  475  VIDVMKVQGY--YMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLW  648
            V + +  Q Y  +  SL + P    WR LR+IC + +F +++++    +RRK I D+L +
Sbjct  101  VPESILSQPYQHHEFSLVWLPVSPLWRSLRKICNMHIFSNQKLDANQDLRRKKIKDLLAY  160

Query  649  IEKEASSVQRGTGVHVAHFVFLSTFNLLGNLFLSRDLVDPMSDKASKFFDAMTGIMQ  819
            +E+  S+   G  +      F ++ NLL N   S DLVDP      +F D + GIM+
Sbjct  161  VEENCSA---GKAIDFGQAAFNTSLNLLSNTIFSMDLVDP---NEREFKDTVWGIME  211



>gb|KEH34024.1| cytochrome P450 family 71 protein [Medicago truncatula]
Length=507

 Score =   119 bits (298),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 72/195 (37%), Positives = 112/195 (57%), Gaps = 7/195 (4%)
 Frame = +1

Query  187  YLVWSAIFLIPGLVFLLARKKSS-SSYRlppgppglpVIGNMLDL-GAFPHQTIAEMKNK  360
            YL +   F++  L+    RKK S S+Y +PPGP  LP+IGN+ +L  + PHQ + ++  K
Sbjct  7    YLPYIFFFILLTLIVQKIRKKKSYSAYNIPPGPRKLPIIGNIHNLLSSQPHQKLRDLAKK  66

Query  361  YGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPYGS  540
            YG V+ L++G VS M I S + A+E+ K HD+ F+ R  I   ++  Y   S+AFAPYG+
Sbjct  67   YGPVMHLQLGEVSAMVISSPECASEVMKTHDIHFSSRPQILATEIMSYNSTSIAFAPYGN  126

Query  541  YWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEASSVQRGTGVHVAHFVFLST  720
            YWR LR+ICT+EL   KR+N   P+R +   ++  WI     + Q G  +++   V  S 
Sbjct  127  YWRQLRKICTLELLSLKRVNSYQPIREEVFFNLAKWI-----ASQVGIPINITEAVRSSI  181

Query  721  FNLLGNLFLSRDLVD  765
            + ++       +  D
Sbjct  182  YTIVSRAAFGNECKD  196



>emb|CDP11720.1| unnamed protein product [Coffea canephora]
Length=499

 Score =   119 bits (298),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 70/207 (34%), Positives = 122/207 (59%), Gaps = 5/207 (2%)
 Frame = +1

Query  205  IFLIPGLVFLLAR--KKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAEMKNKYGSVIW  378
            +F IP  V +L      SS+    PPGP GLP+IG++L+LG+ P+Q++A +   +G ++ 
Sbjct  7    LFCIPLFVIILKPFLHGSSAPKNTPPGPKGLPIIGSLLELGSRPNQSLAVLAKIHGPIMT  66

Query  379  LRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPYGSYWRVLR  558
            L++GS++ +   S +AA E+ +  +  F+DR+V DV+  Q     +LA+ P    WR  R
Sbjct  67   LKLGSITAIVASSPEAAKEILQKQEQIFSDRSVPDVITAQPNPQATLAWVPGDQRWRNRR  126

Query  559  RICTVELFVHKRINETVPVRRKCIDDMLLWIEKEASSVQRGTGVHVAHFVFLSTFNLLGN  738
            RIC+ ++F  +R++    +R K +++++L  +K ++   RG  V +    F +T NL+ N
Sbjct  127  RICSTQMFTTQRLDSLQHLRHKKVEELVLHFKKHSA---RGAPVDIGRAAFATTLNLMSN  183

Query  739  LFLSRDLVDPMSDKASKFFDAMTGIMQ  819
               S D+VDP  + A +F D +  IM+
Sbjct  184  TIFSIDMVDPEFETAQEFKDLVWRIME  210



>gb|KEH34016.1| cytochrome P450 family 71 protein [Medicago truncatula]
Length=473

 Score =   119 bits (297),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 54/147 (37%), Positives = 94/147 (64%), Gaps = 6/147 (4%)
 Frame = +1

Query  295  VIGNMLDL-GAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADR  471
            +IGN+ +L  + PH+ + ++  KYG V+ L++G VS M I S + A+E+ K HD+ F+ R
Sbjct  10   IIGNIHNLLSSQPHRKLRDLAKKYGPVMHLQLGEVSNMVISSPECASEVMKTHDIHFSSR  69

Query  472  TVIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWI  651
              I V ++  Y   S+AFAPYG+YWR +R+ICT+EL   KR+N   P+R + + +++ WI
Sbjct  70   PQILVTEIISYNSTSIAFAPYGNYWRQIRKICTLELLSLKRVNSYQPIREEVLSNLVKWI  129

Query  652  EKEASSVQRGTGVHVAHFVFLSTFNLL  732
                 + Q+GT ++++  V  + + ++
Sbjct  130  -----ASQKGTPINISEAVLSTMYTIV  151



>ref|XP_002276121.1| PREDICTED: geraniol 8-hydroxylase-like isoform X2 [Vitis vinifera]
Length=465

 Score =   118 bits (296),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 70/209 (33%), Positives = 125/209 (60%), Gaps = 7/209 (3%)
 Frame = +1

Query  193  VWSAIFLIPGLVFLLARKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAEMKNKYGSV  372
            VW+ I L+   +  + RK  ++S   PPGP  LP+IGN+L LG  PH+++A +   YG V
Sbjct  13   VWTCIHLL--KLSPIGRKPGTASL--PPGPRPLPIIGNILKLGDKPHRSLANLSKTYGPV  68

Query  373  IWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPYGSYWRV  552
            + L++GS++T+ I S++ A E+   +D +F+ RTV D ++   ++  S+ + P   +WR 
Sbjct  69   MSLKLGSIATIVISSSETAKEVLHRNDQAFSSRTVPDAVRAHNHHESSVVWVPASVHWRK  128

Query  553  LRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEASSVQRGTGVHVAHFVFLSTFNLL  732
            +R+ICT E+F  ++++ +  +RRK + ++L  +E+  S   RG  V +   VF ++ NLL
Sbjct  129  IRKICTREIFSVQQLDASQGLRRKIVQELLDHVEECCS---RGCAVDINGAVFTASLNLL  185

Query  733  GNLFLSRDLVDPMSDKASKFFDAMTGIMQ  819
             N   S +L    S+ + +F +   G+M+
Sbjct  186  SNTIFSINLAHHGSNFSQEFKNIARGVME  214



>emb|CBI38803.3| unnamed protein product [Vitis vinifera]
Length=1702

 Score =   122 bits (305),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 70/209 (33%), Positives = 122/209 (58%), Gaps = 7/209 (3%)
 Frame = +1

Query  193  VWSAIFLIPGLVFLLARKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAEMKNKYGSV  372
            VW+ I L+   +  + RK S++S   PPGP   P+IGN+L LG  PHQ++  +   YG V
Sbjct  43   VWTCIHLLK--LSPIGRKPSTASL--PPGPRPFPIIGNILKLGDKPHQSLTNLSKTYGPV  98

Query  373  IWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPYGSYWRV  552
            + L++GS+ST+ + S + A E+   +D +F+ R V+  +K   ++  S+ ++P  +YWR 
Sbjct  99   MSLKLGSISTIVVSSPETAKEVLHRNDQAFSGREVLGAVKAHNHHESSVIWSPTSAYWRK  158

Query  553  LRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEASSVQRGTGVHVAHFVFLSTFNLL  732
            +R+ICT E+F  +R+N +  +R+K + ++L  +E+      RG  V +    F ++ NLL
Sbjct  159  IRKICTREMFSVQRLNASQGLRKKIVQELLDHVEE---CCGRGCAVDIGAATFTASLNLL  215

Query  733  GNLFLSRDLVDPMSDKASKFFDAMTGIMQ  819
             N   S +L    S  + +F D + G+M+
Sbjct  216  SNTIFSTNLAHHDSTFSQEFKDIVWGVME  244


 Score =   106 bits (264),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 58/175 (33%), Positives = 102/175 (58%), Gaps = 3/175 (2%)
 Frame = +1

Query  295  VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT  474
            +IGN+L LG  PHQ++  +   YG V+ L++GSVST+ I S++ A E+   ++ +F+ R 
Sbjct  490  IIGNILKLGDKPHQSLTNLSKTYGPVMSLKLGSVSTIVISSSETAKEVLHRNNQAFSGRV  549

Query  475  VIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIE  654
            V+D +K   ++  S+ ++P  +YWR +R+ICT E+F  +R+  +  +RRK + ++L   +
Sbjct  550  VLDAVKAHNHHESSVVWSPASAYWRKIRKICTREMFSVQRLEASQGLRRKIVQELL---D  606

Query  655  KEASSVQRGTGVHVAHFVFLSTFNLLGNLFLSRDLVDPMSDKASKFFDAMTGIMQ  819
                   RG  V +    F ++ NLL N   S +LV   S  + +F D +  +M+
Sbjct  607  HAEECCGRGCAVDIGAATFTASLNLLSNTIFSINLVHHASTFSQEFKDIVWRVME  661


 Score = 86.7 bits (213),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 62/209 (30%), Positives = 111/209 (53%), Gaps = 26/209 (12%)
 Frame = +1

Query  193   VWSAIFLIPGLVFLLARKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAEMKNKYGSV  372
             VW+ I L+   +  + RK  ++S   PPGP  LP+IGN+L LG  PH+++A +   YG V
Sbjct  925   VWTCIHLLK--LSPIGRKPGTASL--PPGPRPLPIIGNILKLGDKPHRSLANLSKTYGPV  980

Query  373   IWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPYGSYWRV  552
             + L++GS++T+ I S++ A E+   +D +F+ RTV D ++   ++  S+ + P       
Sbjct  981   MSLKLGSIATIVISSSETAKEVLHRNDQAFSSRTVPDAVRAHNHHESSVVWVPAS-----  1035

Query  553   LRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEASSVQRGTGVHVAHFVFLSTFNLL  732
                           ++ +  +RRK + ++L  +E+  S   RG  V +   VF ++ NLL
Sbjct  1036  --------------LDASQGLRRKIVQELLDHVEECCS---RGCAVDINGAVFTASLNLL  1078

Query  733   GNLFLSRDLVDPMSDKASKFFDAMTGIMQ  819
              N   S +L    S+ + +F +   G+M+
Sbjct  1079  SNTIFSINLAHHGSNFSQEFKNIARGVME  1107



>ref|XP_010661587.1| PREDICTED: geraniol 8-hydroxylase-like isoform X1 [Vitis vinifera]
Length=496

 Score =   118 bits (295),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 70/209 (33%), Positives = 125/209 (60%), Gaps = 7/209 (3%)
 Frame = +1

Query  193  VWSAIFLIPGLVFLLARKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAEMKNKYGSV  372
            VW+ I L+   +  + RK  ++S   PPGP  LP+IGN+L LG  PH+++A +   YG V
Sbjct  13   VWTCIHLLK--LSPIGRKPGTASL--PPGPRPLPIIGNILKLGDKPHRSLANLSKTYGPV  68

Query  373  IWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPYGSYWRV  552
            + L++GS++T+ I S++ A E+   +D +F+ RTV D ++   ++  S+ + P   +WR 
Sbjct  69   MSLKLGSIATIVISSSETAKEVLHRNDQAFSSRTVPDAVRAHNHHESSVVWVPASVHWRK  128

Query  553  LRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEASSVQRGTGVHVAHFVFLSTFNLL  732
            +R+ICT E+F  ++++ +  +RRK + ++L  +E+  S   RG  V +   VF ++ NLL
Sbjct  129  IRKICTREIFSVQQLDASQGLRRKIVQELLDHVEECCS---RGCAVDINGAVFTASLNLL  185

Query  733  GNLFLSRDLVDPMSDKASKFFDAMTGIMQ  819
             N   S +L    S+ + +F +   G+M+
Sbjct  186  SNTIFSINLAHHGSNFSQEFKNIARGVME  214



>ref|XP_004248582.1| PREDICTED: premnaspirodiene oxygenase-like isoform X1 [Solanum 
lycopersicum]
Length=513

 Score =   118 bits (296),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 59/156 (38%), Positives = 92/156 (59%), Gaps = 5/156 (3%)
 Frame = +1

Query  295  VIGNMLDL-GAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADR  471
            +IGN+  L G+ PH T+ +M N+YG ++ LR G V T+ + SA+AA E+ K HD+ FADR
Sbjct  45   LIGNLHQLMGSLPHHTLRDMANEYGPIMHLRFGEVPTVIVSSAEAAKEVMKTHDLVFADR  104

Query  472  TVIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWI  651
              I V  + GY    + F+PYG +WR LR+IC  EL   KR+     +R++ ++D++   
Sbjct  105  PKILVADIIGYNSTQITFSPYGDHWRQLRKICVAELLNVKRVQSFESIRQEEVEDLI---  161

Query  652  EKEASSVQRGTGVHVAHFVFLSTFNLLGNLFLSRDL  759
             K  SS   GT ++++  +F  T N++      R L
Sbjct  162  -KTISSNPSGTTINLSQMIFTLTNNIIARAAFGRKL  196



>gb|KJB37572.1| hypothetical protein B456_006G211100 [Gossypium raimondii]
Length=500

 Score =   118 bits (295),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 64/190 (34%), Positives = 107/190 (56%), Gaps = 3/190 (2%)
 Frame = +1

Query  247  KSSSSYRlppgppglpVIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKA  426
            + SS  +LPPGP   P+IGN+ DLG  PH+++A+    +G V+ L++GS+ T+ + S   
Sbjct  28   RKSSQSKLPPGPWPKPIIGNLFDLGDKPHRSLAKFAQIHGPVMSLKLGSILTIVVSSETT  87

Query  427  AAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINET  606
            A E+ +  D++F +RT++D ++   +Y   L + P    WR LR++C   +F   +++  
Sbjct  88   AKEILQKQDLTFCNRTIVDAVRASQHYEVGLPWIPVSPLWRTLRKVCNTHIFASIKLDAN  147

Query  607  VPVRRKCIDDMLLWIEKEASSVQRGTGVHVAHFVFLSTFNLLGNLFLSRDLVDPMSDKAS  786
              +RR  I ++   I   + S  +G  V++    F +T NLL N   S DLVDP S  A 
Sbjct  148  EYLRRNKIQEL---IANVSESCLKGEAVNIGQAAFDTTVNLLSNTVFSMDLVDPNSSIAR  204

Query  787  KFFDAMTGIM  816
            +F   + G+M
Sbjct  205  EFKKTVRGMM  214



>gb|AJG35804.1| CYP76G10 [Santalum spicatum]
Length=509

 Score =   118 bits (295),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 70/208 (34%), Positives = 122/208 (59%), Gaps = 7/208 (3%)
 Frame = +1

Query  196  WSAIFLIPGLVFLLARKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAEMKNKYGSVI  375
            W+ +  +P     L+R   ++S RLPPGP   PV+GN+L LG  PH+++AE+   YG ++
Sbjct  14   WALVRALP----TLSRGSKAASGRLPPGPVPWPVVGNLLKLGNKPHKSLAELAKSYGPIM  69

Query  376  WLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPYGSYWRVL  555
             L++G ++T+ I +   A E+ +  DV+F++RT  D ++  G+ + S+A+ P  + WR L
Sbjct  70   CLKLGHMTTIVISTPTVAKEVLQKQDVAFSNRTTPDAVRAHGHDLYSMAWLPVSTRWRTL  129

Query  556  RRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEASSVQRGTGVHVAHFVFLSTFNLLG  735
            R+I    +F  +R++E   +RR+ +D++L  +   A S   G  V +    FL++ NLL 
Sbjct  130  RKISNSHIFTSQRLDENHHLRRRKLDELLARV---AESSLVGAVVDMGAVAFLTSLNLLS  186

Query  736  NLFLSRDLVDPMSDKASKFFDAMTGIMQ  819
            N   S+DLV+P      +  + + GIM+
Sbjct  187  NTVFSKDLVEPGLGAVQETKEVVWGIME  214



>ref|XP_006423653.1| hypothetical protein CICLE_v10028270mg [Citrus clementina]
 gb|ESR36893.1| hypothetical protein CICLE_v10028270mg [Citrus clementina]
Length=495

 Score =   117 bits (294),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 59/177 (33%), Positives = 102/177 (58%), Gaps = 8/177 (5%)
 Frame = +1

Query  295  VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT  474
            VIGN+L+LG  PH+++A++   YG ++ LR+G V+T+ + S   A  + +NHD+SF DR 
Sbjct  41   VIGNLLELGGKPHESLAKLAQIYGPIMSLRLGQVTTIVVSSPSMAKAILQNHDLSFCDRK  100

Query  475  VIDVMKVQGYYMG--SLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLW  648
            V + +  + Y     SL + P  + W+ LR+IC   +F +++++    +RR  I D+L +
Sbjct  101  VPEAIMSKTYRRNEFSLVWMPVSALWKNLRKICNTHIFTNQKLDANQDLRRNKIKDLLAY  160

Query  649  IEKEASSVQRGTGVHVAHFVFLSTFNLLGNLFLSRDLVDPMSDKASKFFDAMTGIMQ  819
            +E+   +   G  + V    F ++ NLL N   S DLV+P   K  +F + +  IM+
Sbjct  161  VEENCRA---GKAIDVGQAAFNTSLNLLSNTIFSIDLVNP---KEREFKNIVCRIME  211



>ref|XP_006487694.1| PREDICTED: geraniol 8-hydroxylase-like [Citrus sinensis]
Length=495

 Score =   117 bits (294),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 59/177 (33%), Positives = 102/177 (58%), Gaps = 8/177 (5%)
 Frame = +1

Query  295  VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT  474
            VIGN+L+LG  PH+++A++   YG ++ LR+G V+T+ + S   A  + +NHD+SF DR 
Sbjct  41   VIGNLLELGGKPHESLAKLAQIYGPIMSLRLGQVTTIVVSSPSMAKAILQNHDLSFCDRK  100

Query  475  VIDVMKVQGYYMG--SLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLW  648
            V + +  + Y     SL + P  + W+ LR+IC   +F +++++    +RR  I D+L +
Sbjct  101  VPEAVMSKTYRRNEFSLVWMPVSALWKNLRKICNTHIFTNQKLDANQDLRRNKIKDLLAY  160

Query  649  IEKEASSVQRGTGVHVAHFVFLSTFNLLGNLFLSRDLVDPMSDKASKFFDAMTGIMQ  819
            +E+   +   G  + V    F ++ NLL N   S DLV+P   K  +F + +  IM+
Sbjct  161  VEENCRA---GKAIDVGQAAFNTSLNLLSNTIFSIDLVNP---KEREFKNIVCRIME  211



>gb|KDO36667.1| hypothetical protein CISIN_1g011040mg [Citrus sinensis]
Length=495

 Score =   117 bits (293),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 59/177 (33%), Positives = 102/177 (58%), Gaps = 8/177 (5%)
 Frame = +1

Query  295  VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT  474
            VIGN+L+LG  PH+++A++   YG ++ LR+G V+T+ + S   A  + +NHD+SF DR 
Sbjct  41   VIGNLLELGGKPHESLAKLAQIYGPIMSLRLGQVTTIVVSSPSMAKAILQNHDLSFCDRK  100

Query  475  VIDVMKVQGYYMG--SLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLW  648
            V + +  + Y     SL + P  + W+ LR+IC   +F +++++    +RR  I D+L +
Sbjct  101  VPEAVMSKTYRRNEFSLVWMPVSALWKNLRKICNTHIFTNQKLDANQDLRRNKIKDLLAY  160

Query  649  IEKEASSVQRGTGVHVAHFVFLSTFNLLGNLFLSRDLVDPMSDKASKFFDAMTGIMQ  819
            +E+   +   G  + V    F ++ NLL N   S DLV+P   K  +F + +  IM+
Sbjct  161  VEENCRA---GKAIDVGQAAFNTSLNLLSNTIFSIDLVNP---KEREFKNIVCRIME  211



>ref|XP_011626659.1| PREDICTED: geraniol 8-hydroxylase [Amborella trichopoda]
Length=500

 Score =   117 bits (294),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 57/175 (33%), Positives = 107/175 (61%), Gaps = 6/175 (3%)
 Frame = +1

Query  295  VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT  474
            ++G++  LG+ PH+ +A +   +GS++ L++G ++T+ + S++ A E+ + +D+ F  RT
Sbjct  46   MVGSLHRLGSRPHEALAALAETHGSLMTLQLGFMTTVVVSSSEMAKEVLQKNDLVFGGRT  105

Query  475  VIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIE  654
            VI+V+K++ Y  GSL +A  G  WR LRRICT +LF  +R++    +R + + +M+  I 
Sbjct  106  VIEVLKMRSYPEGSLVWAQTGPRWRALRRICTTQLFTPQRLDSLQALRCQKVHEMVELIR  165

Query  655  KEASSVQRGTGVHVAHFVFLSTFNLLGNLFLSRDLVDPMSDKASKFFDAMTGIMQ  819
            +   +V  G         F+++ N++ N+  S D+V+P S  A +F D +  IM+
Sbjct  166  QAEPAVDIGRA------AFVTSMNIISNMIFSADMVNPNSGSAQEFRDVVWAIME  214



>ref|XP_006440463.1| hypothetical protein CICLE_v10019651mg [Citrus clementina]
 gb|ESR53703.1| hypothetical protein CICLE_v10019651mg [Citrus clementina]
Length=536

 Score =   117 bits (294),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 61/173 (35%), Positives = 99/173 (57%), Gaps = 3/173 (2%)
 Frame = +1

Query  295  VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT  474
            VIGN+L+LGA PH+++A++   YG V+ L+ G V+T+ I SA  A E+ +N D SF +RT
Sbjct  80   VIGNLLELGAKPHRSLAKLSKIYGPVMSLKFGQVTTVVISSATTAREILQNQDTSFCNRT  139

Query  475  VIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIE  654
            V D ++   +   S+A+ P  +    LR+IC   +F  ++++    +RRK I  +L + +
Sbjct  140  VPDALRAHQHDEFSMAWLPLSTPRTNLRKICNSHIFTTQKLDANQHLRRKRIQQLLAYAQ  199

Query  655  KEASSVQRGTGVHVAHFVFLSTFNLLGNLFLSRDLVDPMSDKASKFFDAMTGI  813
            +   +   G  + +    F +T N L N   S DL D  SD A +F D ++GI
Sbjct  200  ENCRA---GKAIDIGQAAFNTTLNFLWNTIFSVDLADHSSDTAREFRDMISGI  249



>gb|KHG25715.1| 7-ethoxycoumarin O-deethylase [Gossypium arboreum]
Length=437

 Score =   117 bits (292),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 62/190 (33%), Positives = 107/190 (56%), Gaps = 3/190 (2%)
 Frame = +1

Query  247  KSSSSYRlppgppglpVIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKA  426
            + SS  +LPPGP   P++GN+ DLG  PH+++A++   +G V+ L++GS+ T+ + S   
Sbjct  28   RKSSQRKLPPGPWPKPIVGNLFDLGDKPHRSLAKLAQIHGPVMSLKLGSILTIVVSSETT  87

Query  427  AAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINET  606
            A E+ +  D++F +RT++D ++   +Y   L + P    WR LR++C   +F   +++  
Sbjct  88   AKEILQKQDLTFCNRTIVDAVRASQHYEVGLPWIPVSPLWRTLRKVCKTHIFASIKLDAN  147

Query  607  VPVRRKCIDDMLLWIEKEASSVQRGTGVHVAHFVFLSTFNLLGNLFLSRDLVDPMSDKAS  786
              +R+  I ++   I     S  +G  V++    F +T NLL N   S DLVDP S  A 
Sbjct  148  EYLRQNKIQEL---IANVGESCLKGEAVNIGQVAFDTTINLLSNTVFSMDLVDPNSSIAR  204

Query  787  KFFDAMTGIM  816
            +F   + G+M
Sbjct  205  EFKKTVRGMM  214



>ref|XP_006829362.2| PREDICTED: geraniol 8-hydroxylase [Amborella trichopoda]
Length=285

 Score =   115 bits (288),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 54/175 (31%), Positives = 105/175 (60%), Gaps = 6/175 (3%)
 Frame = +1

Query  295  VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT  474
            ++G++  LG+ PH+ +A +   +G ++ L++G V+T+ + S++ A E+ + ++++FA  T
Sbjct  20   MVGSLHRLGSRPHEALAALAETHGCLMTLQLGFVTTIVVSSSEMATEVLQKNNLAFAGCT  79

Query  475  VIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIE  654
            VI+VMK++ +Y GSL +A  G  W+ LRR+C  +LF  +R++    +R + + +M+  I 
Sbjct  80   VIEVMKIKSHYNGSLVWAQMGPRWQALRRLCNTQLFTPQRLDTLQALRYQKVHEMVELIR  139

Query  655  KEASSVQRGTGVHVAHFVFLSTFNLLGNLFLSRDLVDPMSDKASKFFDAMTGIMQ  819
            +    V       +    F++  NL+ N+  S ++VDP S  A +F D +  IM+
Sbjct  140  QTEQVVD------IGRVAFVTALNLVSNMIFSTEMVDPKSGSAQEFEDVVWSIME  188



>sp|O23976.1|C76B1_HELTU RecName: Full=7-ethoxycoumarin O-deethylase; Short=ECOD; AltName: 
Full=Cytochrome P450 76B1; AltName: Full=Phenylurea dealkylase 
[Helianthus tuberosus]
 emb|CAA71054.1| 7-ethoxycoumarin O-deethylase [Helianthus tuberosus]
Length=490

 Score =   117 bits (293),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 57/174 (33%), Positives = 100/174 (57%), Gaps = 3/174 (2%)
 Frame = +1

Query  295  VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT  474
            +IGN+  LGA PHQ++A++   +G ++ L++G ++T+ I SA AA E+ K  D++F+ R 
Sbjct  37   IIGNLHLLGALPHQSLAKLAKIHGPIMSLQLGQITTLVISSATAAEEVLKKQDLAFSTRN  96

Query  475  VIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIE  654
            V D ++   +   S++F    + WR LRRI +  +F +  +     +R K +++++ +  
Sbjct  97   VPDAVRAYNHERHSISFLHVCTEWRTLRRIVSSNIFSNSSLEAKQHLRSKKVEELIAYCR  156

Query  655  KEASSVQRGTGVHVAHFVFLSTFNLLGNLFLSRDLVDPMSDKASKFFDAMTGIM  816
            K A S +    VH+    F ++ NLL N   S+DL DP  D   +F + +T IM
Sbjct  157  KAALSNE---NVHIGRAAFRTSLNLLSNTIFSKDLTDPYEDSGKEFREVITNIM  207



>ref|XP_006494410.1| PREDICTED: geraniol 8-hydroxylase-like [Citrus sinensis]
Length=488

 Score =   117 bits (293),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 61/177 (34%), Positives = 101/177 (57%), Gaps = 8/177 (5%)
 Frame = +1

Query  295  VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT  474
            VIGN+L+LG  PH+++A++   +G ++ LR+G V+T+ + S   A  + K HD  F DR 
Sbjct  34   VIGNLLELGGKPHKSLAKLAKIHGPIMSLRLGQVTTVVVSSPSMAKTILKEHDSLFCDRK  93

Query  475  VIDVMKVQGY--YMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLW  648
            V + +  Q Y  +  SL + P    WR LR+IC + +F +++++    +RRK I D+L +
Sbjct  94   VPESILSQPYQHHEFSLVWLPVSPLWRSLRKICNMHIFTNQKLDANQDLRRKKIKDLLAY  153

Query  649  IEKEASSVQRGTGVHVAHFVFLSTFNLLGNLFLSRDLVDPMSDKASKFFDAMTGIMQ  819
            +E+  S+   G  +      F ++ NLL N   S DLVDP      +F + + GIM+
Sbjct  154  VEENCSA---GKALDFGQAAFNTSLNLLSNTIFSMDLVDP---NEREFKETVWGIME  204



>gb|ERN14964.1| hypothetical protein AMTR_s00032p00215290 [Amborella trichopoda]
Length=512

 Score =   117 bits (294),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 57/175 (33%), Positives = 107/175 (61%), Gaps = 6/175 (3%)
 Frame = +1

Query  295  VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT  474
            ++G++  LG+ PH+ +A +   +GS++ L++G ++T+ + S++ A E+ + +D+ F  RT
Sbjct  44   MVGSLHRLGSRPHEALAALAETHGSLMTLQLGFMTTVVVSSSEMAKEVLQKNDLVFGGRT  103

Query  475  VIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIE  654
            VI+V+K++ Y  GSL +A  G  WR LRRICT +LF  +R++    +R + + +M+  I 
Sbjct  104  VIEVLKMRSYPEGSLVWAQTGPRWRALRRICTTQLFTPQRLDSLQALRCQKVHEMVELIR  163

Query  655  KEASSVQRGTGVHVAHFVFLSTFNLLGNLFLSRDLVDPMSDKASKFFDAMTGIMQ  819
            +   +V  G         F+++ N++ N+  S D+V+P S  A +F D +  IM+
Sbjct  164  QAEPAVDIGRA------AFVTSMNIISNMIFSADMVNPNSGSAQEFRDVVWAIME  212



>ref|XP_010667620.1| PREDICTED: geraniol 8-hydroxylase-like [Beta vulgaris subsp. 
vulgaris]
Length=265

 Score =   115 bits (287),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 71/211 (34%), Positives = 117/211 (55%), Gaps = 8/211 (4%)
 Frame = +1

Query  190  LVWSAIFLIPGLVFLLARKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAEMKNKYGS  369
            L W  I L+   V     KK S     PPGP  LP+ GN+  LG  PH ++ E+  +YG 
Sbjct  12   LTWVTIHLLLSTV-----KKLSKPRNFPPGPYPLPIFGNLFCLGNKPHISLTELAKRYGP  66

Query  370  VIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAP-YGSYW  546
            ++ L++G V T+ I SA  A E  + +D S A+R V+D ++   ++  S+ + P   S W
Sbjct  67   LMMLQLGQVPTVVISSAAVAKEAHQKNDQSLANRYVVDAIRALNHHQYSIGWLPATSSEW  126

Query  547  RVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEASSVQRGTGVHVAHFVFLSTFN  726
            R LR++C   +F   +++ET  +RR  I+D+L ++E+  SS + G  V +    F ++ N
Sbjct  127  RNLRKVCNSLVFSPSKLDETQSLRRDKINDLLTFVER--SSSKGGKAVDIGQVAFTTSLN  184

Query  727  LLGNLFLSRDLVDPMSDKASKFFDAMTGIMQ  819
            LL + F S DL DP S+ A +  + +  +++
Sbjct  185  LLSSAFFSMDLGDPSSEYACQLRETIRSLLE  215



>ref|XP_003557080.2| PREDICTED: geraniol 8-hydroxylase-like [Glycine max]
Length=483

 Score =   117 bits (293),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 61/175 (35%), Positives = 101/175 (58%), Gaps = 4/175 (2%)
 Frame = +1

Query  295  VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT  474
            +IGN+L+LG  PH+++A++   +G +I L++G ++T+ + SA+ A E+   +D   ++RT
Sbjct  29   IIGNLLELGEKPHKSLAKLAKIHGPIISLKLGQITTVVVSSAQMAKEVLLTNDQFLSNRT  88

Query  475  VIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIE  654
            +   + V  +   SLAF P    WR LR+IC  +LF HK ++ +  VRRK +  ++  I 
Sbjct  89   IPQSVSVLNHEQYSLAFMPISPLWRELRKICNTQLFAHKSLDASQDVRRKIVQQLVTDIH  148

Query  655  KEASSVQRGTGVHVAHFVFLSTFNLLGNLFLSRDLVDPMSDKASKFFDAMTGIMQ  819
            +   S Q G  V +    F +T NLL N   S DL+   + KA +F D +T I +
Sbjct  149  E---SSQMGEAVDIGTAAFKTTINLLSNTIFSVDLIH-STGKAEEFKDLVTNITK  199



>gb|AGX93052.1| geraniol 10-hydroxylase-like protein [Amsonia hubrichtii]
Length=493

 Score =   117 bits (293),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 57/174 (33%), Positives = 99/174 (57%), Gaps = 3/174 (2%)
 Frame = +1

Query  295  VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT  474
            +IGN+  LG  PH+++A++  KYG ++ L++G V+T+ I S+  A E+ +  D++F+ R+
Sbjct  39   IIGNLHLLGEQPHKSLAKLSKKYGPIMGLQLGRVTTVVISSSGVAKEVLQKQDLAFSSRS  98

Query  475  VIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIE  654
            V D +     +  S+ + P  S WR LR+I    +F   R++    +R + +++++ +  
Sbjct  99   VPDALHAHNQFQFSVVWLPVASQWRSLRKILNSNIFSGNRLDANQHLRSRKVEELIAYCR  158

Query  655  KEASSVQRGTGVHVAHFVFLSTFNLLGNLFLSRDLVDPMSDKASKFFDAMTGIM  816
            K +   Q G  V V    F ++ NLL N   S+DL DP SD A +F D +  IM
Sbjct  159  KNS---QTGEAVDVGRAAFRTSLNLLSNTIFSKDLTDPYSDSAKEFKDLVWNIM  209



>gb|ERM96778.1| hypothetical protein AMTR_s01143p00010430 [Amborella trichopoda]
Length=309

 Score =   115 bits (289),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 54/175 (31%), Positives = 105/175 (60%), Gaps = 6/175 (3%)
 Frame = +1

Query  295  VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT  474
            ++G++  LG+ PH+ +A +   +G ++ L++G V+T+ + S++ A E+ + ++++FA  T
Sbjct  44   MVGSLHRLGSRPHEALAALAETHGCLMTLQLGFVTTIVVSSSEMATEVLQKNNLAFAGCT  103

Query  475  VIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIE  654
            VI+VMK++ +Y GSL +A  G  W+ LRR+C  +LF  +R++    +R + + +M+  I 
Sbjct  104  VIEVMKIKSHYNGSLVWAQMGPRWQALRRLCNTQLFTPQRLDTLQALRYQKVHEMVELIR  163

Query  655  KEASSVQRGTGVHVAHFVFLSTFNLLGNLFLSRDLVDPMSDKASKFFDAMTGIMQ  819
            +    V       +    F++  NL+ N+  S ++VDP S  A +F D +  IM+
Sbjct  164  QTEQVVD------IGRVAFVTALNLVSNMIFSTEMVDPKSGSAQEFEDVVWSIME  212



>ref|XP_009757342.1| PREDICTED: geraniol 8-hydroxylase-like [Nicotiana sylvestris]
Length=494

 Score =   117 bits (292),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 59/176 (34%), Positives = 100/176 (57%), Gaps = 4/176 (2%)
 Frame = +1

Query  295  VIGNMLD-LGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADR  471
            +IGN+ + LG  PHQ++A +  KYG +I LR+G + T+ I S+  A ++ KN D++F+ R
Sbjct  42   LIGNLHNILGDQPHQSLARLAEKYGPIISLRMGQIRTVVISSSAVAKQVLKNQDLAFSSR  101

Query  472  TVIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWI  651
            T+ D +    +Y  S+ F P  + WR LR+I    +F   R++E   +R + I D + + 
Sbjct  102  TIPDALHSHNHYQFSVVFLPVTTRWRSLRKILNSNIFSGNRLDEYQHLRSQKIQDFIAYC  161

Query  652  EKEASSVQRGTGVHVAHFVFLSTFNLLGNLFLSRDLVDPMSDKASKFFDAMTGIMQ  819
                   Q G  V++    F ++ NLL +   S+D+VDP ++   +F DA+  IM+
Sbjct  162  ---CQCSQTGKAVNIGQAAFETSMNLLSSTIFSKDVVDPYANSGKEFKDAVWKIME  214



>ref|XP_006494407.1| PREDICTED: geraniol 8-hydroxylase-like [Citrus sinensis]
Length=495

 Score =   117 bits (292),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 61/177 (34%), Positives = 101/177 (57%), Gaps = 8/177 (5%)
 Frame = +1

Query  295  VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT  474
            VIGN+L+LG  PH+++A++   +G ++ LR+G V+T+ + S   A  + K HD  F DR 
Sbjct  41   VIGNLLELGGKPHKSLAKLAKIHGPIMSLRLGQVTTVVVSSPSMAKTILKEHDSLFCDRK  100

Query  475  VIDVMKVQGY--YMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLW  648
            V + +  Q Y  +  SL + P    WR LR+IC + +F +++++    +RRK I D+L +
Sbjct  101  VPESILSQPYQHHEFSLVWLPVSPLWRSLRKICNMHIFTNQKLDANQDLRRKKIKDLLAY  160

Query  649  IEKEASSVQRGTGVHVAHFVFLSTFNLLGNLFLSRDLVDPMSDKASKFFDAMTGIMQ  819
            +E+  S+   G  +      F ++ NLL N   S DLVDP      +F + + GIM+
Sbjct  161  VEENCSA---GKALDFGQAAFNTSLNLLSNTIFSMDLVDP---NEREFKETVWGIME  211



>ref|XP_006477329.1| PREDICTED: geraniol 8-hydroxylase-like [Citrus sinensis]
Length=499

 Score =   117 bits (292),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 60/175 (34%), Positives = 99/175 (57%), Gaps = 3/175 (2%)
 Frame = +1

Query  295  VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT  474
            VIGN+L+LGA PH+++A++   YG V+ L+ G V+T+ I SA  A E+ +N D SF +RT
Sbjct  43   VIGNLLELGAKPHRSLAKLSKIYGPVMSLKFGQVTTVVISSATTAREILQNQDTSFCNRT  102

Query  475  VIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIE  654
            V D ++   +   S+ + P  +    LR+IC   +F  ++++    +RRK I  +L + +
Sbjct  103  VPDALRAHQHDEFSMGWLPLSTPRTNLRKICNSHIFTTQKLDANQHLRRKRIQQLLAYAQ  162

Query  655  KEASSVQRGTGVHVAHFVFLSTFNLLGNLFLSRDLVDPMSDKASKFFDAMTGIMQ  819
            +   +   G  + +    F +T N L N   S DL D  SD A +F D ++GI +
Sbjct  163  ENCRA---GKAIDIGQAAFNTTLNFLWNTIFSVDLADHSSDTAREFRDIISGITE  214



>ref|XP_006606065.1| PREDICTED: geraniol 8-hydroxylase-like [Glycine max]
Length=498

 Score =   117 bits (292),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 60/175 (34%), Positives = 102/175 (58%), Gaps = 4/175 (2%)
 Frame = +1

Query  295  VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT  474
            +IGN+L+LG  PH+++A++   +G ++ L++G ++T+ + SA+ A E+   +D   ++RT
Sbjct  44   IIGNLLELGEKPHKSLAKLAKIHGPIMSLKLGQITTVVVSSAQMAKEVLLTNDQFLSNRT  103

Query  475  VIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIE  654
            +   + V  +   SLAF P   +WR LR+IC  +LF HK ++ +  VRRK +  ++  I 
Sbjct  104  IPQSVSVLNHEQYSLAFMPISPFWRELRKICNTQLFAHKSLDASQDVRRKIVQQLVSDIH  163

Query  655  KEASSVQRGTGVHVAHFVFLSTFNLLGNLFLSRDLVDPMSDKASKFFDAMTGIMQ  819
            +   S Q G  V +    F +T NLL N   S DL+   + KA +F D +T I +
Sbjct  164  Q---SSQIGEAVDIGTAAFKTTINLLSNTIFSMDLIH-STGKAEEFKDLVTNITK  214



>gb|AGX93053.1| geraniol 10-hydroxylase-like protein [Rauvolfia serpentina]
Length=493

 Score =   117 bits (292),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 54/174 (31%), Positives = 100/174 (57%), Gaps = 3/174 (2%)
 Frame = +1

Query  295  VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT  474
            +IGN+  LG  PH+++A++  K+G ++ L++G ++T+ + S+  A E+ + HD++F+ R+
Sbjct  39   IIGNLHMLGDQPHKSLAKLSKKHGPIMSLKLGQITTVVVSSSGMAKEVLQKHDLAFSSRS  98

Query  475  VIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIE  654
            + + +     Y  S+ + P  S WR LR+     +F   R++    +R + +++++ +  
Sbjct  99   IPNALHAHNQYQFSVVWLPVASRWRSLRKTLNSNIFSGNRLDANQHLRSRKVEELIAYCR  158

Query  655  KEASSVQRGTGVHVAHFVFLSTFNLLGNLFLSRDLVDPMSDKASKFFDAMTGIM  816
            K   + Q G  V V    F ++ NLL NL  S+DL DP SD A +F D +  IM
Sbjct  159  K---NCQTGEAVDVGRAAFRTSLNLLSNLIFSKDLTDPYSDSAKEFKDLVWNIM  209



>gb|KGN58318.1| Cytochrome P450 [Cucumis sativus]
Length=302

 Score =   115 bits (287),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 71/211 (34%), Positives = 117/211 (55%), Gaps = 6/211 (3%)
 Frame = +1

Query  196  WSAIFLIPGLVFLLARKK---SSSSYRlppgppglpVIGNMLDLGAFPHQTIAEMKNKYG  366
            W+ I  +  L F+ + K    +S+S +LPPGP  LP+IGN+LDLG  PH+++A M   +G
Sbjct  4    WTCILFLSLLFFISSLKSKWSTSTSKKLPPGPNPLPLIGNLLDLGDKPHKSLATMAKLHG  63

Query  367  SVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPYGSYW  546
             +I L++G V+ + + S+  A E+ + +D    +R V D +    ++     + P  S W
Sbjct  64   PIISLKLGRVTAVVVSSSAMAKEVLQTNDQFLCNRVVPDALTAHSHHEVGFPWIPVSSLW  123

Query  547  RVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEASSVQRGTGVHVAHFVFLSTFN  726
            R  R+IC   LF  K ++    +RRK +++++  + K A    +G  V +   VF +T N
Sbjct  124  RNYRKICNNTLFAGKILDMNENLRRKKVEELVEIVRKSA---LKGEAVDLGRLVFATTLN  180

Query  727  LLGNLFLSRDLVDPMSDKASKFFDAMTGIMQ  819
            LL N   S DL DP S+ A +F   + GI++
Sbjct  181  LLSNTIFSVDLADPSSELAKEFKKYVRGILE  211



>ref|XP_008447652.1| PREDICTED: geraniol 8-hydroxylase-like [Cucumis melo]
Length=297

 Score =   114 bits (286),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 61/174 (35%), Positives = 97/174 (56%), Gaps = 3/174 (2%)
 Frame = +1

Query  298  IGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTV  477
            IGN+LDLG  PH+++A M   +G +I L++G V+ + I S+  A E+ + +D    +RTV
Sbjct  40   IGNLLDLGDKPHKSLATMAKVHGQIISLKLGRVTAVVISSSAMAKEVLQTNDQFLCNRTV  99

Query  478  IDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEK  657
             D +    ++     + P  S WR  R+IC   LF  K ++    +RRK +++++  + K
Sbjct  100  PDALTAHSHHELGFPWIPVSSLWRNYRKICNNMLFAGKILDMNENLRRKKVEELVEIVRK  159

Query  658  EASSVQRGTGVHVAHFVFLSTFNLLGNLFLSRDLVDPMSDKASKFFDAMTGIMQ  819
             A    +G  V +   VF +T NLL N  LS DL DP S+ A +F   + GIM+
Sbjct  160  SA---LKGEAVDLGRLVFTTTLNLLSNTILSVDLADPSSELAKEFKKYVWGIME  210



>ref|XP_003530792.1| PREDICTED: cytochrome P450 71D9-like [Glycine max]
Length=512

 Score =   116 bits (291),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 58/165 (35%), Positives = 104/165 (63%), Gaps = 6/165 (4%)
 Frame = +1

Query  238  ARKKSSSSYRlppgppglpVIGNMLDL-GAFPHQTIAEMKNKYGSVIWLRIGSVSTMAIL  414
             +K   +++++P GP  LP+IGN+ +L  + PH+ + +M  KYG +++L++G VST+ I 
Sbjct  28   PKKTDDTTFKIPDGPRKLPIIGNIYNLLSSQPHRKLRDMALKYGPLMYLQLGEVSTIVIS  87

Query  415  SAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKR  594
            S + A E+ K HD++FA R  +  + +  Y   ++AFAPYG+YWR LR+ICT+EL   KR
Sbjct  88   SPECAKEVMKTHDINFATRPKVLAIDIMSYNSTNIAFAPYGNYWRQLRKICTLELLSLKR  147

Query  595  INETVPVRRKCIDDMLLWIEKEASSVQRGTGVHVAHFVFLSTFNL  729
            +N   P+R + + +++ WI+       +G+ +++   V  S + +
Sbjct  148  VNSYQPIREEELSNLVKWIDS-----HKGSSINLTQAVLSSIYTI  187



>ref|XP_006419188.1| hypothetical protein CICLE_v10030448mg [Citrus clementina]
 gb|ESR32428.1| hypothetical protein CICLE_v10030448mg [Citrus clementina]
Length=499

 Score =   116 bits (291),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 60/173 (35%), Positives = 98/173 (57%), Gaps = 3/173 (2%)
 Frame = +1

Query  295  VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT  474
            VIGN+L+LGA PH+++A++   YG V+ L+ G V+T+ I SA  A E+ +N D SF +RT
Sbjct  43   VIGNLLELGAKPHRSLAKLSKIYGPVMSLKFGQVTTVVISSATTAREILQNQDTSFCNRT  102

Query  475  VIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIE  654
            V D ++   +   S+ + P  +    LR+IC   +F  ++++    +RRK I  +L + +
Sbjct  103  VPDALRAHQHDEFSMGWLPLSTPRTNLRKICNSHIFTTQKLDANQHLRRKRIQQLLAYAQ  162

Query  655  KEASSVQRGTGVHVAHFVFLSTFNLLGNLFLSRDLVDPMSDKASKFFDAMTGI  813
            +   +   G  + +    F +T N L N   S DL D  SD A +F D ++GI
Sbjct  163  ENCRA---GKAIDIGQAAFNTTLNFLWNTIFSVDLADHSSDTAREFRDMISGI  212



>ref|XP_006477330.1| PREDICTED: geraniol 8-hydroxylase-like [Citrus sinensis]
Length=499

 Score =   116 bits (291),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 61/174 (35%), Positives = 98/174 (56%), Gaps = 3/174 (2%)
 Frame = +1

Query  295  VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT  474
            VIGN+L+LGA PH+++A++   YG V+ L+ G V+T+ I SA  A E+ +N D SF +RT
Sbjct  43   VIGNLLELGAKPHRSLAKLSKIYGPVMSLKFGQVTTVVISSATTAREILQNQDTSFCNRT  102

Query  475  VIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIE  654
            V D ++   +   S+ + P  +    LR+IC   +F  ++++    +RRK I  +L + +
Sbjct  103  VPDALRAHQHDEFSMGWLPLSTPRTNLRKICNSHIFTTQKLDANQHLRRKRIQQLLAYAQ  162

Query  655  KEASSVQRGTGVHVAHFVFLSTFNLLGNLFLSRDLVDPMSDKASKFFDAMTGIM  816
            +   +   G  + +    F +T N L N   S DL D  SD A +F D + GIM
Sbjct  163  ENCRA---GKAIDIGQAAFNTTLNFLWNTIFSVDLADHSSDTAREFRDMVWGIM  213



>gb|KJB51557.1| hypothetical protein B456_008G222600 [Gossypium raimondii]
Length=501

 Score =   116 bits (291),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 70/205 (34%), Positives = 119/205 (58%), Gaps = 3/205 (1%)
 Frame = +1

Query  205  IFLIPGLVFLLARKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAEMKNKYGSVIWLR  384
            IFL+  + F L  ++ SS++ LPPGP   P+ G++  LG+ P+Q++ E+   YG ++ LR
Sbjct  5    IFLLFCISFFLLFRRRSSAHSLPPGPINFPIFGSLHRLGSHPNQSLYELAKTYGPLMTLR  64

Query  385  IGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPYGSYWRVLRRI  564
            +G ++T+ + SA+ A ++F+ H+ SF+DRTV D +  Q     +LA+A     WR  RR+
Sbjct  65   LGYITTVIVSSAEFAKQVFQTHEHSFSDRTVPDCVASQPNPESTLAWALGDGRWRNRRRL  124

Query  565  CTVELFVHKRINETVPVRRKCIDDMLLWIEKEASSVQRGTGVHVAHFVFLSTFNLLGNLF  744
            C+ +LF  +R+N    +R +    ++  I K+ +S   G+ V +    F +T NL+    
Sbjct  125  CSTQLFTVQRLNSLQHLRHQKAQQLIQHINKQRAS---GSQVKIGEVAFATTLNLISTTI  181

Query  745  LSRDLVDPMSDKASKFFDAMTGIMQ  819
             S D+VDP    A +F D +  IM+
Sbjct  182  FSSDIVDPEFSTAQEFKDLVWRIME  206



>gb|KHM99472.1| Cytochrome P450 71D11 [Glycine soja]
Length=508

 Score =   116 bits (291),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 58/165 (35%), Positives = 104/165 (63%), Gaps = 6/165 (4%)
 Frame = +1

Query  238  ARKKSSSSYRlppgppglpVIGNMLDL-GAFPHQTIAEMKNKYGSVIWLRIGSVSTMAIL  414
             +K   +++++P GP  LP+IGN+ +L  + PH+ + +M  KYG +++L++G VST+ I 
Sbjct  28   PKKTDDTTFKIPDGPRKLPIIGNIYNLLSSQPHRKLRDMALKYGPLMYLQLGEVSTIVIS  87

Query  415  SAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKR  594
            S + A E+ K HD++FA R  +  + +  Y   ++AFAPYG+YWR LR+ICT+EL   KR
Sbjct  88   SPECAKEVMKTHDINFATRPKVLAIDIMSYNSTNIAFAPYGNYWRQLRKICTLELLSLKR  147

Query  595  INETVPVRRKCIDDMLLWIEKEASSVQRGTGVHVAHFVFLSTFNL  729
            +N   P+R + + +++ WI+       +G+ +++   V  S + +
Sbjct  148  VNSYQPIREEELSNLVKWIDS-----HKGSSINLTQAVLSSIYTI  187



>gb|AHB33940.1| santalene/bergamotene oxidase [Santalum album]
Length=509

 Score =   116 bits (291),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 69/208 (33%), Positives = 122/208 (59%), Gaps = 7/208 (3%)
 Frame = +1

Query  196  WSAIFLIPGLVFLLARKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAEMKNKYGSVI  375
            W+ +  +P     L+R   ++S RLPPGP   PV+GN+L LG  PH+++AE+   YG ++
Sbjct  14   WALVRALP----TLSRGSKAASGRLPPGPVPWPVVGNLLKLGNKPHKSLAELAKSYGPIM  69

Query  376  WLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPYGSYWRVL  555
             L++G ++T+ I +   A E+ +  DV+F++RT  D ++  G+ + S+A+ P  + WR L
Sbjct  70   CLKLGHMTTIVISTPTVAKEVLQKQDVAFSNRTTPDAVRAHGHDLYSMAWLPVSTRWRTL  129

Query  556  RRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEASSVQRGTGVHVAHFVFLSTFNLLG  735
            R+I    +F  +R++E   +RR+ +D++L  +   A S   G  V +    FL++ NLL 
Sbjct  130  RKISNSHIFTSQRLDENHHLRRRKLDELLARV---AESSLVGAVVDMGAVAFLTSLNLLS  186

Query  736  NLFLSRDLVDPMSDKASKFFDAMTGIMQ  819
            N   S+DLV+P      +  + + G+M+
Sbjct  187  NTVFSKDLVEPGLGAVQETKEVVWGMME  214



>gb|AAS92624.1| cytochrome P450 [Hypericum androsaemum]
Length=498

 Score =   116 bits (290),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 67/210 (32%), Positives = 119/210 (57%), Gaps = 3/210 (1%)
 Frame = +1

Query  190  LVWSAIFLIPGLVFLLARKKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAEMKNKYGS  369
            L++ A +L+   V L  R K++ S +LPPGP  LP+IGN+L L   PH+++A++   +G 
Sbjct  11   LLFVATYLLVNHVILRGRSKNNGSTKLPPGPRPLPIIGNLLALRDKPHKSLAKLARVHGP  70

Query  370  VIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPYGSYWR  549
            ++ L++G V+T+ + S   A E+ + HD + ++R +ID ++ QG++   LA+ P G  WR
Sbjct  71   LVTLKLGQVTTVVVSSPATAREILQKHDATLSNRYIIDAIRAQGHHEAGLAWVPVGPTWR  130

Query  550  VLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEASSVQRGTGVHVAHFVFLSTFNL  729
              R++C   +F ++++N +  VR++ I  +L    +   S + G  + V    F +  + 
Sbjct  131  KFRKVCYSHIFTNQKLNSSQHVRQRTIQQLL---AEARESCRVGEAMDVGKAAFRAALSS  187

Query  730  LGNLFLSRDLVDPMSDKASKFFDAMTGIMQ  819
            L    +S DL D  SD A +F +    IM 
Sbjct  188  LSISVMSLDLADAASDTAREFKELARCIMN  217



>ref|XP_003636948.1| Cytochrome P450 [Medicago truncatula]
Length=333

 Score =   114 bits (286),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 69/182 (38%), Positives = 109/182 (60%), Gaps = 6/182 (3%)
 Frame = +1

Query  190  LVWSAIFLIPGLVFLL----ARKKSSSSYRlppgppglpVIGNMLDL-GAFPHQTIAEMK  354
            L +++IF +   VF++     +K +SS+  LPPGP  LP+IGN+ +L G+ PH  + ++ 
Sbjct  6    LYFTSIFSLLFFVFIVNKIVTKKSNSSTPNLPPGPLMLPIIGNIHNLIGSLPHHRLRDLS  65

Query  355  NKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPY  534
             KYG ++ L++G VST+ + SA+ A E+ K HD+ FA R  I   K+  Y    L+F+PY
Sbjct  66   TKYGPLMHLKLGEVSTIVVSSAEYAKEVLKTHDLVFASRPPIQASKIMSYNSIGLSFSPY  125

Query  535  GSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWI-EKEASSVQRGTGVHVAHFVF  711
            G YWR LR+IC +EL   KR+    P+R + + +++ WI  KE S +     V+   F+ 
Sbjct  126  GDYWRQLRKICALELLSSKRVQSFQPIRSEEMTNLIKWIASKEGSEINLTKEVNSRIFLI  185

Query  712  LS  717
             S
Sbjct  186  TS  187



>ref|XP_004511453.1| PREDICTED: geraniol 8-hydroxylase-like [Cicer arietinum]
Length=499

 Score =   115 bits (289),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 72/192 (38%), Positives = 115/192 (60%), Gaps = 4/192 (2%)
 Frame = +1

Query  244  KKSSSSYRlppgppglpVIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAK  423
            K   ++Y+LPPGP  LP+IGN+L+LG  PH+++A++   +G ++ L++G ++T+ + SA+
Sbjct  26   KTRKTNYKLPPGPSPLPIIGNLLELGDKPHKSLAKLAKLHGPIMSLKLGQITTVVVSSAE  85

Query  424  AAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINE  603
             A E+   HD   ++RT+   + V  +   SLAF P    WR LR+IC  +LF HK ++ 
Sbjct  86   MAKEVLLTHDHFLSNRTIPQSVSVLNHENYSLAFMPVTPLWRDLRKICNGQLFAHKTLDA  145

Query  604  TVPVRRKCIDDMLLWIEKEASSVQRGTGVHVAHFVFLSTFNLLGNLFLSRDLVDPMSDKA  783
            +  VRR  +  ++  I KE+S  Q+G  V +   VF +T NLL N   S DLV   +  A
Sbjct  146  SQDVRRNKVQHLIAEI-KESS--QKGEAVDIGTAVFKTTINLLSNTIFSVDLVQ-SAGIA  201

Query  784  SKFFDAMTGIMQ  819
             +F D +T I +
Sbjct  202  GEFKDLVTNITK  213



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1738401790104