BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c9966_g1_i1 len=914 path=[2571:0-166 101:167-190 125:191-913]

Length=914
                                                                      Score     E

ref|XP_009776930.1|  PREDICTED: uncharacterized protein LOC104226597    112   2e-26   
ref|XP_009601831.1|  PREDICTED: uncharacterized protein LOC104097030    106   3e-24   
ref|XP_006345450.1|  PREDICTED: uncharacterized protein LOC102591434  97.1    7e-21   
ref|XP_004229628.1|  PREDICTED: uncharacterized protein LOC101246280  97.1    1e-20   
ref|XP_011093544.1|  PREDICTED: uncharacterized protein LOC105173488  92.8    2e-19   
ref|XP_006594414.1|  PREDICTED: uncharacterized protein LOC100790...  90.9    8e-19   
ref|XP_008231285.1|  PREDICTED: uncharacterized protein LOC103330474  91.3    1e-18   
ref|XP_006592965.1|  PREDICTED: uncharacterized protein LOC100783...  89.7    2e-18   
ref|XP_010695231.1|  PREDICTED: uncharacterized protein LOC104907...  90.1    2e-18   
ref|XP_010257231.1|  PREDICTED: uncharacterized protein LOC104597...  89.4    3e-18   
ref|XP_007219773.1|  hypothetical protein PRUPE_ppa025628mg           90.1    3e-18   
gb|KCW66109.1|  hypothetical protein EUGRSUZ_G03381                   88.6    7e-18   
ref|XP_010695238.1|  PREDICTED: uncharacterized protein LOC104907...  86.7    3e-17   
ref|XP_003542850.1|  PREDICTED: uncharacterized protein LOC100790...  85.9    4e-17   
ref|XP_004510953.1|  PREDICTED: uncharacterized protein LOC101513856  85.1    6e-17   
emb|CDP07777.1|  unnamed protein product                              85.5    7e-17   
ref|XP_008375264.1|  PREDICTED: uncharacterized protein LOC103438504  85.1    3e-16   
ref|XP_003638281.1|  hypothetical protein MTR_125s0006                83.6    3e-16   
ref|XP_008461800.1|  PREDICTED: uncharacterized protein LOC103500315  83.2    5e-16   
ref|XP_003540528.1|  PREDICTED: uncharacterized protein LOC100783...  82.8    6e-16   
ref|XP_010257232.1|  PREDICTED: uncharacterized protein LOC104597...  81.6    1e-15   
ref|XP_006592968.1|  PREDICTED: uncharacterized protein LOC100783...  80.9    2e-15   
ref|XP_006592967.1|  PREDICTED: uncharacterized protein LOC100783...  80.9    2e-15   
ref|XP_004151057.1|  PREDICTED: uncharacterized protein LOC101205386  81.6    2e-15   
ref|XP_006592962.1|  PREDICTED: uncharacterized protein LOC100783...  80.9    3e-15   
ref|XP_002298433.1|  hypothetical protein POPTR_0001s27330g           80.9    3e-15   Populus trichocarpa [western balsam poplar]
ref|XP_006592966.1|  PREDICTED: uncharacterized protein LOC100783...  80.5    3e-15   
ref|XP_009364981.1|  PREDICTED: uncharacterized protein LOC103954860  81.6    4e-15   
ref|XP_010659345.1|  PREDICTED: uncharacterized protein LOC100249968  79.7    8e-15   
gb|KDP43474.1|  hypothetical protein JCGZ_16761                       79.3    9e-15   
gb|EYU29029.1|  hypothetical protein MIMGU_mgv1a020803mg              78.6    2e-14   
emb|CBI24887.3|  unnamed protein product                              78.6    4e-14   
ref|XP_007133820.1|  hypothetical protein PHAVU_011G211600g           77.4    5e-14   
gb|KDO83404.1|  hypothetical protein CISIN_1g047782mg                 77.4    6e-14   
ref|XP_006482879.1|  PREDICTED: uncharacterized protein LOC102617...  77.0    9e-14   
ref|XP_006482878.1|  PREDICTED: uncharacterized protein LOC102617...  76.6    1e-13   
gb|KHG11133.1|  hypothetical protein F383_14104                       76.3    2e-13   
ref|XP_006439116.1|  hypothetical protein CICLE_v10033658mg           76.6    2e-13   
ref|XP_011047396.1|  PREDICTED: uncharacterized protein LOC105141...  71.6    6e-12   
ref|XP_002532165.1|  conserved hypothetical protein                   70.9    1e-11   Ricinus communis
gb|KHN19453.1|  hypothetical protein glysoja_026068                   68.9    4e-11   
ref|XP_011047397.1|  PREDICTED: uncharacterized protein LOC105141...  67.0    3e-10   
ref|XP_007052525.1|  Cellulose synthase family protein isoform 1      67.8    3e-09   
gb|KFK43111.1|  hypothetical protein AALP_AA1G081600                  60.5    6e-08   
ref|XP_010088233.1|  hypothetical protein L484_012516                 58.5    2e-07   
emb|CDX95105.1|  BnaC05g05660D                                        58.5    4e-07   
ref|NP_973789.1|  uncharacterized protein                             58.2    4e-07   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010475581.1|  PREDICTED: uncharacterized protein LOC104754977  58.2    4e-07   
ref|XP_010488231.1|  PREDICTED: uncharacterized protein LOC104766108  57.8    5e-07   
ref|XP_010458018.1|  PREDICTED: uncharacterized protein LOC104739382  57.8    5e-07   
ref|XP_002889676.1|  hypothetical protein ARALYDRAFT_470850           57.4    8e-07   
ref|XP_009148048.1|  PREDICTED: uncharacterized protein LOC103871544  56.6    1e-06   
gb|AAF79824.1|AC026875_4  T6D22.8                                     59.7    2e-06   Arabidopsis thaliana [mouse-ear cress]
emb|CDX93602.1|  BnaA06g04460D                                        55.5    4e-06   
ref|XP_006305324.1|  hypothetical protein CARUB_v10009702mg           55.1    3e-05   
ref|XP_006838344.1|  hypothetical protein AMTR_s00103p00157960        52.8    3e-05   
ref|XP_009118399.1|  PREDICTED: uncharacterized protein LOC103843420  52.0    5e-05   
emb|CDY06292.1|  BnaA09g49110D                                        54.7    6e-05   
ref|XP_008804548.1|  PREDICTED: uncharacterized protein LOC103717801  48.9    6e-04   



>ref|XP_009776930.1| PREDICTED: uncharacterized protein LOC104226597 [Nicotiana sylvestris]
Length=156

 Score =   112 bits (280),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 74/156 (47%), Positives = 95/156 (61%), Gaps = 9/156 (6%)
 Frame = -2

Query  694  VVEEPILCRLQRLDNVLKQVEALRGGGGNQspaksstassstatssegqaaatSWSAEFS  515
             VEEPIL RL RLDN+LK++E +RGG  +   + +S+ + ++   +         S +FS
Sbjct  3    TVEEPILSRLDRLDNILKKLEEVRGGDHSPKTSTASSETLTSDGQA--------SSLDFS  54

Query  514  PKSLEKHCRPIDDVIMEAEAKGTLIERLVNVEERVAKLCNYLHQELEAFkttkeatmhtt  335
            P+S+EKHCRPIDDVI E E KGTLIERLVNVE RV  +C  L  ELE  K  +E  + + 
Sbjct  55   PRSMEKHCRPIDDVITETEHKGTLIERLVNVENRVLNMCLQLEAELEIMKKKREENLVSE  114

Query  334  tttiapssaaaaqks-pkKGFKSLVKSCVKGKAKGR  230
                   +     KS  KKG KS VKSCVKGK  G+
Sbjct  115  EKKEENVAVEEKNKSPYKKGLKSFVKSCVKGKGIGK  150



>ref|XP_009601831.1| PREDICTED: uncharacterized protein LOC104097030 [Nicotiana tomentosiformis]
Length=150

 Score =   106 bits (265),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 66/155 (43%), Positives = 88/155 (57%), Gaps = 13/155 (8%)
 Frame = -2

Query  694  VVEEPILCRLQRLDNVLKQVEALRGGGGNQspaksstassstatssegqaaatSWSAEFS  515
             VEEPIL RL RLDN++K++E +RGG  +   + +S+ + ++   +         S +FS
Sbjct  3    AVEEPILSRLDRLDNIVKKLEEVRGGDHSPKTSTASSETLTSDGQTS--------SLDFS  54

Query  514  PKSLEKHCRPIDDVIMEAEAKGTLIERLVNVEERVAKLCNYLHQELEAFkttkeatmhtt  335
            P+S+EKHCRPIDDVI E E KGTLIERL+NVE RV  +C  L  ELE             
Sbjct  55   PRSMEKHCRPIDDVITETEHKGTLIERLLNVENRVLNMCLQLESELEIM-----KKKKKK  109

Query  334  tttiapssaaaaqkspkKGFKSLVKSCVKGKAKGR  230
                        +   KKG K+ VK+CVKGK  G+
Sbjct  110  KREENLVIEEKNKSPYKKGLKTFVKACVKGKGIGK  144



>ref|XP_006345450.1| PREDICTED: uncharacterized protein LOC102591434 [Solanum tuberosum]
Length=149

 Score = 97.1 bits (240),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 64/149 (43%), Positives = 84/149 (56%), Gaps = 14/149 (9%)
 Frame = -2

Query  691  VEEPILCRLQRLDNVLKQVEALRGGGGNQspaksstassstatssegqaaatSWSAEFSP  512
            VEEPIL RL RLDN++K++E +RGG  +   + +S+ + ++             S +FSP
Sbjct  4    VEEPILSRLDRLDNIIKKLEEVRGGDHSPKTSTASSETLTSDGQVS--------SLDFSP  55

Query  511  KSLEKHCRPIDDVIMEAEAKGTLIERLVNVEERVAKLCNYLHQELEAFkttkeatmhttt  332
            +S+EKHCRPI+DVI E E KGTLIERLVNVE RV  +C     +LEA    +        
Sbjct  56   RSMEKHCRPIEDVISETEHKGTLIERLVNVENRVLNVC----LQLEA--ELEMMKKKKKK  109

Query  331  ttiapssaaaaqkspkKGFKSLVKSCVKG  245
                  +        K  FKS VKSCVKG
Sbjct  110  KEEENLNLKNKLAHNKGSFKSFVKSCVKG  138



>ref|XP_004229628.1| PREDICTED: uncharacterized protein LOC101246280 [Solanum lycopersicum]
Length=163

 Score = 97.1 bits (240),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 66/164 (40%), Positives = 88/164 (54%), Gaps = 23/164 (14%)
 Frame = -2

Query  691  VEEPILCRLQRLDNVLKQVEALRGGGGNQspaksstassstatssegqaaatSWSAEFSP  512
            VEEPIL R+ RLDN++K++E +RGG  +   + +S+ + ++             S +FSP
Sbjct  4    VEEPILSRIDRLDNIIKKLEEVRGGDHSPKTSTASSETLTSDGQVS--------SLDFSP  55

Query  511  KSLEKHCRPIDDVIMEAEAKGTLIERLVNVEERVAKLCNYLHQELEAFkttk--------  356
            +S+EKHCRPIDDVI E E KGTL+ERLVNVE+RV  +C     ELE  K           
Sbjct  56   RSMEKHCRPIDDVISETEHKGTLMERLVNVEKRVLNVCLQWEAELEMIKKNNNNNDVGVE  115

Query  355  -------eatmhtttttiapssaaaaqkspkKGFKSLVKSCVKG  245
                   +     +   I      A+    K  FKS VKSCVKG
Sbjct  116  ENLNLNLKKKRQVSNVVIIEEKNKASSPHKKGSFKSFVKSCVKG  159



>ref|XP_011093544.1| PREDICTED: uncharacterized protein LOC105173488 [Sesamum indicum]
Length=152

 Score = 92.8 bits (229),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 73/152 (48%), Positives = 92/152 (61%), Gaps = 18/152 (12%)
 Frame = -2

Query  706  MTTLVVEEPILCRLQRLDNVLKQVEALRGGGGNQspaksstassstatssegqaaatSWS  527
            MT L  EEPIL RL RLDN+LKQ+E +R  G +   + +ST SS T TS     +     
Sbjct  9    MTGL--EEPILSRLNRLDNILKQLEDIRSAGHSPKSSYASTTSSGTLTSDGHPFSL----  62

Query  526  AEFSPKSLEKHCRPIDDVIMEAEAKGTLIERLVNVEERVAKLCNYLHQELEAFkttkeat  347
            A+FSP+  EKHCRP+D+VIME E KGTLIERLV+ E+R+ KLC    +ELE         
Sbjct  63   ADFSPEGFEKHCRPVDEVIMEVERKGTLIERLVHAEDRILKLCLQWEEELEG--------  114

Query  346  mhtttttiapssaaaaqkspkKGFKSLVKSCV  251
                  +   S+A+  + SPKKG K  VKSCV
Sbjct  115  ----ERSKEHSTASVEKSSPKKGLKQFVKSCV  142



>ref|XP_006594414.1| PREDICTED: uncharacterized protein LOC100790797 isoform X2 [Glycine 
max]
Length=139

 Score = 90.9 bits (224),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 67/152 (44%), Positives = 85/152 (56%), Gaps = 24/152 (16%)
 Frame = -2

Query  691  VEEPILCRLQRLDNVLKQVEALRGGGGNQspaksstassstatssegqaaatSWSAEFSP  512
             EEPIL R+ RLDN+L+Q+E +RG   +   + +ST +S +             S +FSP
Sbjct  4    TEEPILSRIDRLDNMLRQLEVIRGCNPSPKSSCASTPTSGSDGHVS--------STDFSP  55

Query  511  KSLEKHCRPIDDVIMEAEAKGTLIERLVNVEERVAKLCNYLHQELEAFkttkeatmhttt  332
            KSLEKHCRPI+ V+ME E KGT+IERL  VE+R+ KLC  L +EL A             
Sbjct  56   KSLEKHCRPIEFVMMETEVKGTMIERLNQVEDRMLKLCLQLEEELVA-------------  102

Query  331  ttiapssaaaaqkspkKGFKSLVKSCVKGKAK  236
                         SPKKGFK LVK CVK + K
Sbjct  103  ---KKKEEEKKMNSPKKGFKQLVKQCVKARGK  131



>ref|XP_008231285.1| PREDICTED: uncharacterized protein LOC103330474 [Prunus mume]
Length=173

 Score = 91.3 bits (225),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 57/115 (50%), Positives = 77/115 (67%), Gaps = 5/115 (4%)
 Frame = -2

Query  706  MTTLVVEEPILCRLQRLDNVLKQVEALRGGGGNQspaksstassstatssegqaaa----  539
            MT    EEPILCR+ RLDN+L+Q+E +RG   + +   S +  SS+  S+  + +     
Sbjct  4    MTKGNAEEPILCRMDRLDNMLRQLEEIRGCNKSNNTRASHSPKSSSFASTPSRLSDGVGH  63

Query  538  tSWSAEF-SPKSLEKHCRPIDDVIMEAEAKGTLIERLVNVEERVAKLCNYLHQEL  377
             S SAE  SP+SLEKHCRP++ V+ME + KGTLIERL +VE+RV KLC  L +EL
Sbjct  64   VSSSAELISPESLEKHCRPMEHVMMETDVKGTLIERLDHVEDRVLKLCMQLEEEL  118



>ref|XP_006592965.1| PREDICTED: uncharacterized protein LOC100783695 isoform X5 [Glycine 
max]
Length=137

 Score = 89.7 bits (221),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 64/153 (42%), Positives = 84/153 (55%), Gaps = 24/153 (16%)
 Frame = -2

Query  694  VVEEPILCRLQRLDNVLKQVEALRGGGGNQspaksstassstatssegqaaatSWSAEFS  515
              EE IL R+ RLDNVL+ +E +RG   +   + +ST +S +             S +FS
Sbjct  3    ATEEKILSRIDRLDNVLRHLEEIRGCNPSPKSSCASTPTSGSDGHV--------SSTDFS  54

Query  514  PKSLEKHCRPIDDVIMEAEAKGTLIERLVNVEERVAKLCNYLHQELEAFkttkeatmhtt  335
            PKSLEKHCRPI++++ME EAKGT+IERL  VE+R+ KLC  L +EL A            
Sbjct  55   PKSLEKHCRPIENIMMETEAKGTMIERLNQVEDRMLKLCLQLEEELVA------------  102

Query  334  tttiapssaaaaqkspkKGFKSLVKSCVKGKAK  236
                          SPKKGFK LVK  +K + K
Sbjct  103  ----KKKEEGKKMNSPKKGFKQLVKQSMKPRGK  131



>ref|XP_010695231.1| PREDICTED: uncharacterized protein LOC104907900 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=148

 Score = 90.1 bits (222),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 68/159 (43%), Positives = 89/159 (56%), Gaps = 19/159 (12%)
 Frame = -2

Query  706  MTTLVVEEPILCRLQRLDNVLKQVEALRGGGGNQspaksstassstatssegqaaatSWS  527
            M  L  EEPIL RL RLDN+++ +E +RGG      +  ST+S ST ++    + A   S
Sbjct  1    MAVLTQEEPILSRLDRLDNLMRHLEMIRGGN----RSPKSTSSPSTPSTGTRTSDAHPSS  56

Query  526  AEFSPKSLEK-HCRPIDDVIMEAEAKGTLIERLVNVEERVAKLCNYLH--QELEAFkttk  356
             +FSP+S +K HCRPIDDVI+E E KGTL++R+  +E R+ K+C  L   QELEA     
Sbjct  57   LDFSPRSRDKLHCRPIDDVIVETEHKGTLLDRVSLIEHRLLKVCMQLQLEQELEA-----  111

Query  355  eatmhtttttiapssaaaaqkspkKGFKSLVKSCVKGKA  239
                              +    KKG K LVKSCVKGK 
Sbjct  112  -------ENQALSQKQEVSPHKKKKGLKQLVKSCVKGKG  143



>ref|XP_010257231.1| PREDICTED: uncharacterized protein LOC104597417 isoform X1 [Nelumbo 
nucifera]
Length=137

 Score = 89.4 bits (220),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 66/154 (43%), Positives = 85/154 (55%), Gaps = 21/154 (14%)
 Frame = -2

Query  691  VEEPILCRLQRLDNVLKQVEALRGGGGNQspaksstassstatssegqaaatSWSAEFSP  512
             EEPIL RL RLDNVL+ +E +RG         S ++  S  +S    +   + S +FSP
Sbjct  4    TEEPILSRLDRLDNVLRHLEEIRGCN-----RCSKSSYESATSSGPLTSDGGNSSVDFSP  58

Query  511  KSLEKHCRPIDDVIMEAEAKGTLIERLVNVEERVAKLCNYLHQELEAFkttkeatmhttt  332
            KSLEKHCRPI+ V+ME EAKG+LIER+ +VE+R+ KLC  L    E              
Sbjct  59   KSLEKHCRPIEHVMMETEAKGSLIERMDHVEDRLLKLCLQLEVAKEKE------------  106

Query  331  ttiapssaaaaqkspkKGFKSLVKSCVKGKAKGR  230
                     + +K  KKG K LVKSCVK K K +
Sbjct  107  ----KEDEKSEKKPHKKGLKQLVKSCVKRKPKTK  136



>ref|XP_007219773.1| hypothetical protein PRUPE_ppa025628mg [Prunus persica]
 gb|EMJ20972.1| hypothetical protein PRUPE_ppa025628mg [Prunus persica]
Length=173

 Score = 90.1 bits (222),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 57/115 (50%), Positives = 76/115 (66%), Gaps = 5/115 (4%)
 Frame = -2

Query  706  MTTLVVEEPILCRLQRLDNVLKQVEALRGGGGNQspaksstassstatssegqaaa----  539
            MTT    EPILCR+ RLDN+L+Q+E +RG   + +   S +  SS+  S+  + +     
Sbjct  4    MTTGNAAEPILCRMDRLDNMLRQLEEIRGCNNSNNTRSSHSPKSSSFASTPSRTSDGVGH  63

Query  538  tSWSAEF-SPKSLEKHCRPIDDVIMEAEAKGTLIERLVNVEERVAKLCNYLHQEL  377
             S SAE  SP+SLEKHCRP++ V+ME + KGTLIERL  VE+RV KLC  L +EL
Sbjct  64   VSSSAELISPESLEKHCRPMEHVMMETDVKGTLIERLDQVEDRVLKLCMQLEEEL  118



>gb|KCW66109.1| hypothetical protein EUGRSUZ_G03381 [Eucalyptus grandis]
Length=146

 Score = 88.6 bits (218),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 62/153 (41%), Positives = 87/153 (57%), Gaps = 16/153 (10%)
 Frame = -2

Query  694  VVEEPILCRLQRLDNVLKQVEALRGGGGNQspaksstassstatssegqaaatSWSAEFS  515
            ++EEPIL R+ RLDN+LKQ+E ++ G         S++  ST +S    +     S +FS
Sbjct  3    LMEEPILSRIDRLDNMLKQLEEIKVG---NRSFTKSSSGESTPSSGTLTSEGHVSSVDFS  59

Query  514  PKSLEKHCRPIDDVIMEAEAKGTLIERLVNVEERVAKLCNYLHQELEAFkttkeatmhtt  335
            PKSLEK+CRP+D V++E EAKG L+ERL +VE+R+ KLC  +  ELEA            
Sbjct  60   PKSLEKYCRPLDRVMVETEAKGNLVERLHHVEDRLHKLCLQVEGELEA------------  107

Query  334  tttiapssaaaaqkspkKGFKSLVKSCVKGKAK  236
                     +  +   K+G K +VKS VKG  K
Sbjct  108  -ERKMIEGKSEKKARKKRGLKQMVKSLVKGGGK  139



>ref|XP_010695238.1| PREDICTED: uncharacterized protein LOC104907900 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=142

 Score = 86.7 bits (213),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 67/157 (43%), Positives = 87/157 (55%), Gaps = 21/157 (13%)
 Frame = -2

Query  706  MTTLVVEEPILCRLQRLDNVLKQVEALRGGGGNQspaksstassstatssegqaaatSWS  527
            M  L  EEPIL RL RLDN+++ +E +RGG      +  ST+S ST ++    + A   S
Sbjct  1    MAVLTQEEPILSRLDRLDNLMRHLEMIRGGN----RSPKSTSSPSTPSTGTRTSDAHPSS  56

Query  526  AEFSPKSLEK-HCRPIDDVIMEAEAKGTLIERLVNVEERVAKLCNYLHQELEAFkttkea  350
             +FSP+S +K HCRPIDDVI+E E KGTL++R+  +E R+ K    L QELEA       
Sbjct  57   LDFSPRSRDKLHCRPIDDVIVETEHKGTLLDRVSLIEHRLLK----LEQELEA-------  105

Query  349  tmhtttttiapssaaaaqkspkKGFKSLVKSCVKGKA  239
                            +    KKG K LVKSCVKGK 
Sbjct  106  -----ENQALSQKQEVSPHKKKKGLKQLVKSCVKGKG  137



>ref|XP_003542850.1| PREDICTED: uncharacterized protein LOC100790797 isoform X1 [Glycine 
max]
 gb|KHN37621.1| hypothetical protein glysoja_007324 [Glycine soja]
Length=135

 Score = 85.9 bits (211),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 63/152 (41%), Positives = 82/152 (54%), Gaps = 28/152 (18%)
 Frame = -2

Query  691  VEEPILCRLQRLDNVLKQVEALRGGGGNQspaksstassstatssegqaaatSWSAEFSP  512
             EEPIL R+ RLDN+L+Q+E +RG   +   + +ST +S +             S +FSP
Sbjct  4    TEEPILSRIDRLDNMLRQLEVIRGCNPSPKSSCASTPTSGSDGHVS--------STDFSP  55

Query  511  KSLEKHCRPIDDVIMEAEAKGTLIERLVNVEERVAKLCNYLHQELEAFkttkeatmhttt  332
            KSLEKHCRPI+ V+ME E KGT+IERL  VE+R+ KL   L  + +              
Sbjct  56   KSLEKHCRPIEFVMMETEVKGTMIERLNQVEDRMLKLEEELVAKKKE-------------  102

Query  331  ttiapssaaaaqkspkKGFKSLVKSCVKGKAK  236
                         SPKKGFK LVK CVK + K
Sbjct  103  -------EEKKMNSPKKGFKQLVKQCVKARGK  127



>ref|XP_004510953.1| PREDICTED: uncharacterized protein LOC101513856 [Cicer arietinum]
Length=127

 Score = 85.1 bits (209),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 48/97 (49%), Positives = 64/97 (66%), Gaps = 8/97 (8%)
 Frame = -2

Query  691  VEEPILCRLQRLDNVLKQVEALRGGGGNQspaksstassstatssegqaaatSWSAEFSP  512
             EEPIL R+ RLDN+L+ +E +RG   +   + +S+ +S +   +         S +FSP
Sbjct  4    TEEPILSRIDRLDNMLRHIEVIRGYNRSPKSSCASSPTSGSDGRAS--------SVDFSP  55

Query  511  KSLEKHCRPIDDVIMEAEAKGTLIERLVNVEERVAKL  401
            KSLEKHCRPI+ VIME E KGTLIERL  VE+R+ KL
Sbjct  56   KSLEKHCRPIETVIMETEVKGTLIERLNQVEDRMLKL  92



>emb|CDP07777.1| unnamed protein product [Coffea canephora]
Length=142

 Score = 85.5 bits (210),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 67/152 (44%), Positives = 90/152 (59%), Gaps = 18/152 (12%)
 Frame = -2

Query  694  VVEEPILCRLQRLDNVLKQVEALRGGGGNQspaksstassstatssegqaaatSWSAEFS  515
             +EEP+L RL RLDN+LKQ+E +RG G +   + +++  SS              S +FS
Sbjct  3    TMEEPVLSRLDRLDNILKQLEEIRGSGYHSPKSSTASTRSSGTL----------TSEDFS  52

Query  514  PKSLEKHCRPIDDVIMEAEAKGTLIERLVNVEERVAKLCNYLHQELEAFkttkeatmhtt  335
            P+SL+KHCRPI+DVI E   KGTL ER+V+VE+R+ KLC  L +E EA            
Sbjct  53   PRSLQKHCRPIEDVISEIGIKGTLFERIVHVEDRLLKLCLQLEEEEEA--------ETEE  104

Query  334  tttiapssaaaaqkspkKGFKSLVKSCVKGKA  239
                    ++A + SP+KG K LVKSCVKGK 
Sbjct  105  KRKKKEGISSAEKSSPRKGLKQLVKSCVKGKG  136



>ref|XP_008375264.1| PREDICTED: uncharacterized protein LOC103438504 [Malus domestica]
 ref|XP_008346930.1| PREDICTED: uncharacterized protein LOC103409921 [Malus domestica]
Length=199

 Score = 85.1 bits (209),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 52/120 (43%), Positives = 71/120 (59%), Gaps = 8/120 (7%)
 Frame = -2

Query  712  AMMTTLVVEEPILCRLQRLDNVLKQVEALRGGGGNQspaksstassstatssegqaaatS  533
            AM T    EEPIL R+ RLD +L+Q+E +R    +      +  SSS  ++    +   +
Sbjct  3    AMTTANTTEEPILFRMDRLDTILRQLEEIRRSQSHSRSHTHTPKSSSLTSTPSRTSGTLT  62

Query  532  W-------SAEF-SPKSLEKHCRPIDDVIMEAEAKGTLIERLVNVEERVAKLCNYLHQEL  377
                    S E  SP+SLEKHCRPI+ V+ME +AKG+LIERL +VE+RV KLC  L +E 
Sbjct  63   SEGGKLPSSXELISPESLEKHCRPIEHVMMETDAKGSLIERLDHVEDRVLKLCVQLEEEF  122



>ref|XP_003638281.1| hypothetical protein MTR_125s0006 [Medicago truncatula]
 gb|KEH19076.1| hypothetical protein MTR_8g037205 [Medicago truncatula]
Length=135

 Score = 83.6 bits (205),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 49/99 (49%), Positives = 64/99 (65%), Gaps = 8/99 (8%)
 Frame = -2

Query  697  LVVEEPILCRLQRLDNVLKQVEALRGGGGNQspaksstassstatssegqaaatSWSAEF  518
            +  E PIL R+ RLDN+L+Q+E +RG   +   + +ST +S +             S +F
Sbjct  2    VATEVPILSRIDRLDNMLRQLEEIRGYNRSPKSSCASTPTSGSDGRIS--------SVDF  53

Query  517  SPKSLEKHCRPIDDVIMEAEAKGTLIERLVNVEERVAKL  401
            SPKSLEKHCRPI+ VIME E KGTLIERL  VE+R+ KL
Sbjct  54   SPKSLEKHCRPIETVIMETEVKGTLIERLKQVEDRMLKL  92



>ref|XP_008461800.1| PREDICTED: uncharacterized protein LOC103500315 [Cucumis melo]
Length=143

 Score = 83.2 bits (204),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 52/107 (49%), Positives = 72/107 (67%), Gaps = 5/107 (5%)
 Frame = -2

Query  694  VVEEPILCRLQRLDNVLKQVEALRGGGGNQspaksstassstatssegqaaatSWSAEFS  515
            V EEPIL RL RLDN+L+++E ++G   +   + +ST SS T TS    +     S + S
Sbjct  3    VAEEPILSRLDRLDNMLRRLEEIKGCAKSPKSSCASTPSSGTLTSDYHTS-----SVDLS  57

Query  514  PKSLEKHCRPIDDVIMEAEAKGTLIERLVNVEERVAKLCNYLHQELE  374
            PKSLEKHCRPI+ V+  AE KG+L+ER+ N+E+RV KLC  +  E+E
Sbjct  58   PKSLEKHCRPINHVVRVAELKGSLVERMDNLEDRVLKLCIQVEGEME  104



>ref|XP_003540528.1| PREDICTED: uncharacterized protein LOC100783695 isoform X1 [Glycine 
max]
Length=133

 Score = 82.8 bits (203),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 47/98 (48%), Positives = 64/98 (65%), Gaps = 8/98 (8%)
 Frame = -2

Query  694  VVEEPILCRLQRLDNVLKQVEALRGGGGNQspaksstassstatssegqaaatSWSAEFS  515
              EE IL R+ RLDNVL+ +E +RG   +   + +ST +S +             S +FS
Sbjct  3    ATEEKILSRIDRLDNVLRHLEEIRGCNPSPKSSCASTPTSGSDGHV--------SSTDFS  54

Query  514  PKSLEKHCRPIDDVIMEAEAKGTLIERLVNVEERVAKL  401
            PKSLEKHCRPI++++ME EAKGT+IERL  VE+R+ KL
Sbjct  55   PKSLEKHCRPIENIMMETEAKGTMIERLNQVEDRMLKL  92



>ref|XP_010257232.1| PREDICTED: uncharacterized protein LOC104597417 isoform X2 [Nelumbo 
nucifera]
Length=133

 Score = 81.6 bits (200),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 47/94 (50%), Positives = 63/94 (67%), Gaps = 5/94 (5%)
 Frame = -2

Query  691  VEEPILCRLQRLDNVLKQVEALRGGGGNQspaksstassstatssegqaaatSWSAEFSP  512
             EEPIL RL RLDNVL+ +E +RG         S ++  S  +S    +   + S +FSP
Sbjct  4    TEEPILSRLDRLDNVLRHLEEIRGCN-----RCSKSSYESATSSGPLTSDGGNSSVDFSP  58

Query  511  KSLEKHCRPIDDVIMEAEAKGTLIERLVNVEERV  410
            KSLEKHCRPI+ V+ME EAKG+LIER+ +VE+R+
Sbjct  59   KSLEKHCRPIEHVMMETEAKGSLIERMDHVEDRL  92



>ref|XP_006592968.1| PREDICTED: uncharacterized protein LOC100783695 isoform X8 [Glycine 
max]
Length=106

 Score = 80.9 bits (198),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 46/96 (48%), Positives = 63/96 (66%), Gaps = 8/96 (8%)
 Frame = -2

Query  691  VEEPILCRLQRLDNVLKQVEALRGGGGNQspaksstassstatssegqaaatSWSAEFSP  512
             EE IL R+ RLDNVL+ +E +RG   +   + +ST +S +             S +FSP
Sbjct  4    TEEKILSRIDRLDNVLRHLEEIRGCNPSPKSSCASTPTSGSDGHVS--------STDFSP  55

Query  511  KSLEKHCRPIDDVIMEAEAKGTLIERLVNVEERVAK  404
            KSLEKHCRPI++++ME EAKGT+IERL  VE+R+ K
Sbjct  56   KSLEKHCRPIENIMMETEAKGTMIERLNQVEDRMLK  91



>ref|XP_006592967.1| PREDICTED: uncharacterized protein LOC100783695 isoform X7 [Glycine 
max]
Length=107

 Score = 80.9 bits (198),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 46/97 (47%), Positives = 63/97 (65%), Gaps = 8/97 (8%)
 Frame = -2

Query  694  VVEEPILCRLQRLDNVLKQVEALRGGGGNQspaksstassstatssegqaaatSWSAEFS  515
              EE IL R+ RLDNVL+ +E +RG   +   + +ST +S +             S +FS
Sbjct  3    ATEEKILSRIDRLDNVLRHLEEIRGCNPSPKSSCASTPTSGSDGHVS--------STDFS  54

Query  514  PKSLEKHCRPIDDVIMEAEAKGTLIERLVNVEERVAK  404
            PKSLEKHCRPI++++ME EAKGT+IERL  VE+R+ K
Sbjct  55   PKSLEKHCRPIENIMMETEAKGTMIERLNQVEDRMLK  91



>ref|XP_004151057.1| PREDICTED: uncharacterized protein LOC101205386 [Cucumis sativus]
 ref|XP_004164155.1| PREDICTED: uncharacterized LOC101205386 [Cucumis sativus]
 gb|KGN58589.1| hypothetical protein Csa_3G695850 [Cucumis sativus]
Length=142

 Score = 81.6 bits (200),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 53/107 (50%), Positives = 72/107 (67%), Gaps = 5/107 (5%)
 Frame = -2

Query  694  VVEEPILCRLQRLDNVLKQVEALRGGGGNQspaksstassstatssegqaaatSWSAEFS  515
            V EEPIL RL RLD +L+++E +RG G +   + +ST SS T TS    +     S + S
Sbjct  3    VAEEPILSRLDRLDVMLRRLEEIRGCGKSPKSSCASTPSSGTLTSDYHTS-----SVDLS  57

Query  514  PKSLEKHCRPIDDVIMEAEAKGTLIERLVNVEERVAKLCNYLHQELE  374
            PKSLEKHCRPI+ V+  AE KG+L+ER+ N+E+RV KLC  +  +LE
Sbjct  58   PKSLEKHCRPINHVVKVAELKGSLVERMDNLEDRVLKLCIQVEGDLE  104



>ref|XP_006592962.1| PREDICTED: uncharacterized protein LOC100783695 isoform X2 [Glycine 
max]
 ref|XP_006592963.1| PREDICTED: uncharacterized protein LOC100783695 isoform X3 [Glycine 
max]
 ref|XP_006592964.1| PREDICTED: uncharacterized protein LOC100783695 isoform X4 [Glycine 
max]
Length=151

 Score = 80.9 bits (198),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 46/97 (47%), Positives = 63/97 (65%), Gaps = 8/97 (8%)
 Frame = -2

Query  694  VVEEPILCRLQRLDNVLKQVEALRGGGGNQspaksstassstatssegqaaatSWSAEFS  515
              EE IL R+ RLDNVL+ +E +RG   +   + +ST +S +             S +FS
Sbjct  3    ATEEKILSRIDRLDNVLRHLEEIRGCNPSPKSSCASTPTSGSDGHVS--------STDFS  54

Query  514  PKSLEKHCRPIDDVIMEAEAKGTLIERLVNVEERVAK  404
            PKSLEKHCRPI++++ME EAKGT+IERL  VE+R+ K
Sbjct  55   PKSLEKHCRPIENIMMETEAKGTMIERLNQVEDRMLK  91



>ref|XP_002298433.1| hypothetical protein POPTR_0001s27330g [Populus trichocarpa]
 gb|EEE83238.1| hypothetical protein POPTR_0001s27330g [Populus trichocarpa]
Length=141

 Score = 80.9 bits (198),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 53/108 (49%), Positives = 71/108 (66%), Gaps = 5/108 (5%)
 Frame = -2

Query  694  VVEEPILCRLQRLDNVLKQVEALRGGGGNQspaksstassstatssegqaaatSWSAEFS  515
            + EEPIL RL RLDN+++++  L  GG N+ P  SS  + S+ T +     +     + S
Sbjct  3    ITEEPILSRLDRLDNMMRELAEL--GGCNRPPKSSSPCTPSSGTLAGEGKVSF---VDLS  57

Query  514  PKSLEKHCRPIDDVIMEAEAKGTLIERLVNVEERVAKLCNYLHQELEA  371
            P+SLEKHCRPI +V+ME E KGTL+ERL ++EERV KLC  L   LEA
Sbjct  58   PESLEKHCRPISNVMMETEVKGTLVERLDHLEERVLKLCVQLEGGLEA  105



>ref|XP_006592966.1| PREDICTED: uncharacterized protein LOC100783695 isoform X6 [Glycine 
max]
Length=134

 Score = 80.5 bits (197),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 46/97 (47%), Positives = 63/97 (65%), Gaps = 8/97 (8%)
 Frame = -2

Query  694  VVEEPILCRLQRLDNVLKQVEALRGGGGNQspaksstassstatssegqaaatSWSAEFS  515
              EE IL R+ RLDNVL+ +E +RG   +   + +ST +S +             S +FS
Sbjct  3    ATEEKILSRIDRLDNVLRHLEEIRGCNPSPKSSCASTPTSGSDGHVS--------STDFS  54

Query  514  PKSLEKHCRPIDDVIMEAEAKGTLIERLVNVEERVAK  404
            PKSLEKHCRPI++++ME EAKGT+IERL  VE+R+ K
Sbjct  55   PKSLEKHCRPIENIMMETEAKGTMIERLNQVEDRMLK  91



>ref|XP_009364981.1| PREDICTED: uncharacterized protein LOC103954860 [Pyrus x bretschneideri]
Length=203

 Score = 81.6 bits (200),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 56/120 (47%), Positives = 72/120 (60%), Gaps = 8/120 (7%)
 Frame = -2

Query  712  AMMTTLVVEEPILCRLQRLDNVLKQVEALRGGGGNQspaksstassstatssegqaaatS  533
            AM      EEPIL R+ RLD VL+Q+E +RG   +      S  SSS  +S    +   +
Sbjct  3    AMTMANTTEEPILSRMDRLDTVLRQLEEIRGSHSHSHTHTHSPKSSSCTSSPTRTSGTLT  62

Query  532  -------WSAEF-SPKSLEKHCRPIDDVIMEAEAKGTLIERLVNVEERVAKLCNYLHQEL  377
                    SAE  SP+SLEKHCRPI+ V+ME +AKG+LIERL +VE+RV KLC  L +E 
Sbjct  63   SDGGHVPSSAELISPESLEKHCRPIEHVMMETDAKGSLIERLDHVEDRVLKLCVQLEEEF  122



>ref|XP_010659345.1| PREDICTED: uncharacterized protein LOC100249968 [Vitis vinifera]
Length=145

 Score = 79.7 bits (195),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 49/99 (49%), Positives = 65/99 (66%), Gaps = 6/99 (6%)
 Frame = -2

Query  691  VEEPILCRLQRLDNVLKQVEALRGGGGNQspaksstassstatssegqaaatSWSAEFSP  512
             EEPI+C+L RLDN+L+Q+E +RG         S ++ +ST +S    +   + S + SP
Sbjct  4    TEEPIICKLDRLDNILRQLEEIRG-----CSRSSKSSCASTPSSGALTSDGQTSSVDLSP  58

Query  511  KSLEKH-CRPIDDVIMEAEAKGTLIERLVNVEERVAKLC  398
            KSLEKH CRPI DV  E E KG+L+ERLV VE R+ KLC
Sbjct  59   KSLEKHQCRPIADVRTETEVKGSLMERLVQVEVRLLKLC  97



>gb|KDP43474.1| hypothetical protein JCGZ_16761 [Jatropha curcas]
Length=131

 Score = 79.3 bits (194),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 52/110 (47%), Positives = 71/110 (65%), Gaps = 6/110 (5%)
 Frame = -2

Query  697  LVVEEPILCRLQRLDNVLKQVEALRGGGGNQspaksstassstatssegqaaatSWSAEF  518
            ++ EEPIL RL R+DN+L+Q+E +RG       +  ++  SS   +SEGQ +    S +F
Sbjct  3    VIAEEPILSRLGRVDNMLRQLEEIRGSSNRSPKSSIASTPSSGTLTSEGQVS----SIDF  58

Query  517  SPKSLEKHCRPIDDVIMEAEAKGTLIERLVNVEERVAKLCNYLHQELEAF  368
            SPK LEKHCRPI+ V+ E E KGTLIERL   EER+ K+  ++H  L A 
Sbjct  59   SPKCLEKHCRPINRVMTETEIKGTLIERLDQAEERLLKV--HVHSYLCAV  106



>gb|EYU29029.1| hypothetical protein MIMGU_mgv1a020803mg [Erythranthe guttata]
Length=147

 Score = 78.6 bits (192),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 64/152 (42%), Positives = 90/152 (59%), Gaps = 17/152 (11%)
 Frame = -2

Query  688  EEPILCRLQRLDNVLKQVEALRG-GGGNQspaksstassstatssegqaaatSWSAEFSP  512
            +EPI+ RL RLDN +KQ++ +   GGG+    KSS AS++++ +   +A        FSP
Sbjct  5    DEPIIYRLNRLDNSMKQLQDIMSFGGGDHYSPKSSYASTTSSGTLTSEAR-----PSFSP  59

Query  511  KSLEKHCRPIDDVIMEAEAKGTLIERLVNVEERVAKLCNYLHQELEAFkttkeatmhttt  332
            +SLEK CRP+D+V+ME E KGTLI+RLV+ E+ + K+C  L +E EA            +
Sbjct  60   ESLEKRCRPVDEVLMEVEQKGTLIQRLVHAEDLIFKMCMQLEEEFEA-----------ES  108

Query  331  ttiapssaaaaqkspkKGFKSLVKSCVKGKAK  236
              +   S   +    KKG K LVKSCV GK K
Sbjct  109  KELKEISEKKSPSPSKKGLKQLVKSCVGGKTK  140



>emb|CBI24887.3| unnamed protein product [Vitis vinifera]
Length=186

 Score = 78.6 bits (192),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 51/99 (52%), Positives = 65/99 (66%), Gaps = 6/99 (6%)
 Frame = -2

Query  691  VEEPILCRLQRLDNVLKQVEALRGGGGNQspaksstassstatssegqaaatSWSAEFSP  512
             EEPI+C+L RLDN+L+Q+E +RG   +   + +ST SS   TS    +     S + SP
Sbjct  45   TEEPIICKLDRLDNILRQLEEIRGCSRSSKSSCASTPSSGALTSDGQTS-----SVDLSP  99

Query  511  KSLEKH-CRPIDDVIMEAEAKGTLIERLVNVEERVAKLC  398
            KSLEKH CRPI DV  E E KG+L+ERLV VE R+ KLC
Sbjct  100  KSLEKHQCRPIADVRTETEVKGSLMERLVQVEVRLLKLC  138



>ref|XP_007133820.1| hypothetical protein PHAVU_011G211600g [Phaseolus vulgaris]
 gb|ESW05814.1| hypothetical protein PHAVU_011G211600g [Phaseolus vulgaris]
Length=137

 Score = 77.4 bits (189),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 54/151 (36%), Positives = 80/151 (53%), Gaps = 27/151 (18%)
 Frame = -2

Query  694  VVEEPILCRLQRLDNVLKQVEALRGGGGNQspaksstassstatssegqaaatSWSAEFS  515
              +EPIL R+ RLD +L+Q+E +RG   +   + +ST +S +             S +FS
Sbjct  4    ATQEPILSRIDRLDYLLRQLEEIRGCNRSPKSSCASTPTSGSDGRVS--------SVDFS  55

Query  514  PKSLEKHCRPIDDVIMEAEAKGTLIERLVNVEERVAKLCNYLHQELEAFkttkeatmhtt  335
            P+SLEKHCRP++ V+ME EAKGT+IERL   E+R+ K+   + ++L A            
Sbjct  56   PRSLEKHCRPMESVMMETEAKGTVIERLNQAEDRLLKVFLQVEEDLLA------------  103

Query  334  tttiapssaaaaqkspkKGFKSLVKSCVKGK  242
                    +       KK FK LVK CV+ +
Sbjct  104  -------KSNKMNNGSKKSFKELVKKCVRAR  127



>gb|KDO83404.1| hypothetical protein CISIN_1g047782mg [Citrus sinensis]
Length=148

 Score = 77.4 bits (189),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 50/95 (53%), Positives = 62/95 (65%), Gaps = 5/95 (5%)
 Frame = -2

Query  694  VVEEPILCRLQRLDNVLKQVEALRGGGGNQspaksstassstatssegqaaatSWSAEFS  515
            V EEPIL RL RLDN+L+Q+E +R   G+   + +ST SS T TS    +     S EFS
Sbjct  3    VTEEPILSRLDRLDNLLRQLEEIRRCNGSPKSSCASTPSSGTFTSEGQAS-----SVEFS  57

Query  514  PKSLEKHCRPIDDVIMEAEAKGTLIERLVNVEERV  410
            P SLEKHCRPID V+ME   KGT++ERL  +E  V
Sbjct  58   PNSLEKHCRPIDRVVMETGVKGTVMERLDRIEAHV  92



>ref|XP_006482879.1| PREDICTED: uncharacterized protein LOC102617979 isoform X2 [Citrus 
sinensis]
 gb|KDO37461.1| hypothetical protein CISIN_1g038447mg [Citrus sinensis]
Length=148

 Score = 77.0 bits (188),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 49/95 (52%), Positives = 61/95 (64%), Gaps = 5/95 (5%)
 Frame = -2

Query  694  VVEEPILCRLQRLDNVLKQVEALRGGGGNQspaksstassstatssegqaaatSWSAEFS  515
            V EEPIL RL RLDN+L+Q+E +R    +   + +ST SS T TS    +     S EFS
Sbjct  3    VTEEPILSRLDRLDNLLRQLEEIRSCNRSPKSSCASTPSSGTFTSEGQAS-----SVEFS  57

Query  514  PKSLEKHCRPIDDVIMEAEAKGTLIERLVNVEERV  410
            P SLEKHCRPID V+ME   KGT++ERL  +E  V
Sbjct  58   PNSLEKHCRPIDRVVMETGVKGTVVERLDRIEAHV  92



>ref|XP_006482878.1| PREDICTED: uncharacterized protein LOC102617979 isoform X1 [Citrus 
sinensis]
Length=152

 Score = 76.6 bits (187),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 49/95 (52%), Positives = 61/95 (64%), Gaps = 5/95 (5%)
 Frame = -2

Query  694  VVEEPILCRLQRLDNVLKQVEALRGGGGNQspaksstassstatssegqaaatSWSAEFS  515
            V EEPIL RL RLDN+L+Q+E +R    +   + +ST SS T TS    +     S EFS
Sbjct  3    VTEEPILSRLDRLDNLLRQLEEIRSCNRSPKSSCASTPSSGTFTSEGQAS-----SVEFS  57

Query  514  PKSLEKHCRPIDDVIMEAEAKGTLIERLVNVEERV  410
            P SLEKHCRPID V+ME   KGT++ERL  +E  V
Sbjct  58   PNSLEKHCRPIDRVVMETGVKGTVVERLDRIEAHV  92



>gb|KHG11133.1| hypothetical protein F383_14104 [Gossypium arboreum]
 gb|KHG24239.1| hypothetical protein F383_01748 [Gossypium arboreum]
Length=175

 Score = 76.3 bits (186),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 48/108 (44%), Positives = 72/108 (67%), Gaps = 8/108 (7%)
 Frame = -2

Query  697  LVVEEPILCRLQRLDNVLKQVEALRGGGGNQspaksstassstatssegqaaatSW----  530
            +V EEP+L RL R+DN+++Q+E +RG  GN +  +S +  SS+A++       ++     
Sbjct  3    IVGEEPVLSRLDRVDNMVRQLEEMRGSHGNGNYNRSPSPRSSSASTPSTVTLGSTCTEGH  62

Query  529  --SAEFSP--KSLEKHCRPIDDVIMEAEAKGTLIERLVNVEERVAKLC  398
              S +FSP  KSLEK+CRPID V++E + KGTL+ RL  VE+R+ KLC
Sbjct  63   PSSIDFSPTAKSLEKYCRPIDHVMVETQLKGTLLHRLDQVEDRLLKLC  110



>ref|XP_006439116.1| hypothetical protein CICLE_v10033658mg, partial [Citrus clementina]
 gb|ESR52356.1| hypothetical protein CICLE_v10033658mg, partial [Citrus clementina]
Length=201

 Score = 76.6 bits (187),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 48/95 (51%), Positives = 60/95 (63%), Gaps = 5/95 (5%)
 Frame = -2

Query  694  VVEEPILCRLQRLDNVLKQVEALRGGGGNQspaksstassstatssegqaaatSWSAEFS  515
            V EEPIL RL RLDN+L+Q+E +R    +   + +ST SS T  S    +     S EFS
Sbjct  61   VTEEPILSRLDRLDNLLRQLEEIRSCNRSPKSSCASTPSSGTFRSEGQAS-----SVEFS  115

Query  514  PKSLEKHCRPIDDVIMEAEAKGTLIERLVNVEERV  410
            P SLEKHCRPID V+ME   KGT++ERL  +E  V
Sbjct  116  PNSLEKHCRPIDRVVMETGVKGTVVERLDRIEAHV  150



>ref|XP_011047396.1| PREDICTED: uncharacterized protein LOC105141753 isoform X1 [Populus 
euphratica]
Length=137

 Score = 71.6 bits (174),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 47/98 (48%), Positives = 66/98 (67%), Gaps = 5/98 (5%)
 Frame = -2

Query  694  VVEEPILCRLQRLDNVLKQVEALRGGGGNQspaksstassstatssegqaaatSWSAEFS  515
            + EEPI+ RL RLDN+++++  L  GG N+ P  SS ++ S+ T +     +     + S
Sbjct  3    ITEEPIISRLDRLDNMMRELAEL--GGCNRPPKCSSPSTPSSGTLTREGKVSF---VDLS  57

Query  514  PKSLEKHCRPIDDVIMEAEAKGTLIERLVNVEERVAKL  401
            P+SLEKHCRPI  V+ME E KGTL+ERL ++EERV KL
Sbjct  58   PESLEKHCRPISYVMMETEVKGTLVERLDHLEERVLKL  95



>ref|XP_002532165.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF30218.1| conserved hypothetical protein [Ricinus communis]
Length=141

 Score = 70.9 bits (172),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 50/106 (47%), Positives = 67/106 (63%), Gaps = 5/106 (5%)
 Frame = -2

Query  694  VVEEPILCRLQRLDNVLKQVEALRGGGGNQspaksstassstatssegqaaatSWSAEFS  515
            V EEPIL RL RLD +L+Q+E +RG           ++ +ST +S    +     S + S
Sbjct  3    VPEEPILSRLDRLDTMLRQLEDMRGSN-----RSPKSSCASTPSSGTLTSEGHVSSIDLS  57

Query  514  PKSLEKHCRPIDDVIMEAEAKGTLIERLVNVEERVAKLCNYLHQEL  377
            PKSLEKHCRPI+ V+ME E KGTL+ERL  +E+R+ KLC  L + L
Sbjct  58   PKSLEKHCRPINRVMMETEIKGTLVERLDLLEDRLLKLCMQLEEGL  103



>gb|KHN19453.1| hypothetical protein glysoja_026068 [Glycine soja]
Length=120

 Score = 68.9 bits (167),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 30/43 (70%), Positives = 38/43 (88%), Gaps = 0/43 (0%)
 Frame = -2

Query  529  SAEFSPKSLEKHCRPIDDVIMEAEAKGTLIERLVNVEERVAKL  401
            S +FSPKSLEKHCRPI++++ME EAKGT+IERL  VE+R+ KL
Sbjct  37   STDFSPKSLEKHCRPIENIMMETEAKGTMIERLNQVEDRMLKL  79



>ref|XP_011047397.1| PREDICTED: uncharacterized protein LOC105141753 isoform X2 [Populus 
euphratica]
Length=135

 Score = 67.0 bits (162),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 39/52 (75%), Gaps = 0/52 (0%)
 Frame = -2

Query  526  AEFSPKSLEKHCRPIDDVIMEAEAKGTLIERLVNVEERVAKLCNYLHQELEA  371
             + SP+SLEKHCRPI  V+ME E KGTL+ERL ++EERV KLC  L   LEA
Sbjct  48   VDLSPESLEKHCRPISYVMMETEVKGTLVERLDHLEERVLKLCVQLEGGLEA  99



>ref|XP_007052525.1| Cellulose synthase family protein isoform 1 [Theobroma cacao]
 gb|EOX96682.1| Cellulose synthase family protein isoform 1 [Theobroma cacao]
Length=1237

 Score = 67.8 bits (164),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 43/97 (44%), Positives = 62/97 (64%), Gaps = 4/97 (4%)
 Frame = -2

Query  706   MTTLVVEEPILCRLQRLDNVLKQVEALRGGGGNQspaksstassstatssegqaaatSWS  527
             M  +  EEP++ RL R+DN+L+Q+E +RG   +   + +ST SS T TS    ++     
Sbjct  1081  MAIISSEEPVISRLDRVDNMLRQLEEIRGCSKSPRSSCASTPSSGTFTSEGHPSSVDL--  1138

Query  526   AEFSPKSLEKHCRPIDDVIMEAEAKGTLIERLVNVEE  416
                SP SLEKHCRPID V++E + KGTLI+RL  +E+
Sbjct  1139  --ASPSSLEKHCRPIDHVMVETQVKGTLIQRLDQLED  1173



>gb|KFK43111.1| hypothetical protein AALP_AA1G081600 [Arabis alpina]
Length=138

 Score = 60.5 bits (145),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 38/108 (35%), Positives = 64/108 (59%), Gaps = 12/108 (11%)
 Frame = -2

Query  694  VVEEPILCRLQRLDNVLKQVEALRGGGGNQspaksstassstatssegqaaatSWSAEFS  515
            +VEEPIL RL R+D +++++E ++G     S   + ++ +  ++               S
Sbjct  3    IVEEPILSRLDRIDFMVRKIEEMKGNSPRSSSPSTPSSGTQPSSLDLS-----------S  51

Query  514  PKSLEK-HCRPIDDVIMEAEAKGTLIERLVNVEERVAKLCNYLHQELE  374
            P+S+ K  CR ++ V+ E E KGTL+ERL NVEE+V KLC+   +E++
Sbjct  52   PRSIGKVQCRSMEQVMEETERKGTLLERLNNVEEKVLKLCSQFGEEVD  99



>ref|XP_010088233.1| hypothetical protein L484_012516 [Morus notabilis]
 gb|EXB32785.1| hypothetical protein L484_012516 [Morus notabilis]
Length=128

 Score = 58.5 bits (140),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 26/37 (70%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = -2

Query  523  EFSPKSLEKHCRPIDDVIMEAEAKGTLIERLVNVEER  413
            + SPKSLEKHCRPI+ V++E E KGTLIERL  VE+R
Sbjct  48   DVSPKSLEKHCRPINHVMLETEVKGTLIERLHRVEDR  84



>emb|CDX95105.1| BnaC05g05660D [Brassica napus]
Length=140

 Score = 58.5 bits (140),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 39/100 (39%), Positives = 60/100 (60%), Gaps = 12/100 (12%)
 Frame = -2

Query  694  VVEEPILCRLQRLDNVLKQVEALRGGGGNQspaksstassstatssegqaaatSWSAEFS  515
            +VEEPIL RL R+D +++++E ++G     S   + ++ +  ++               S
Sbjct  3    MVEEPILSRLDRIDVMVRKLEEMKGSSPRSSSPSTPSSGTQPSSLDLS-----------S  51

Query  514  PKSLEK-HCRPIDDVIMEAEAKGTLIERLVNVEERVAKLC  398
            P+S+ K  CRP++ VI E E KGTL+ERL NVEE+V KLC
Sbjct  52   PRSVGKVQCRPMEQVIEETERKGTLLERLNNVEEQVLKLC  91



>ref|NP_973789.1| uncharacterized protein [Arabidopsis thaliana]
 dbj|BAF00449.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE28223.1| uncharacterized protein AT1G07985 [Arabidopsis thaliana]
Length=144

 Score = 58.2 bits (139),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 39/103 (38%), Positives = 60/103 (58%), Gaps = 12/103 (12%)
 Frame = -2

Query  694  VVEEPILCRLQRLDNVLKQVEALRGGGGNQspaksstassstatssegqaaatSWSAEFS  515
            VVEEPIL RL R+D +++++E ++G     S   + ++ +  ++               S
Sbjct  3    VVEEPILSRLDRIDFMVRKLEEMKGSSPRSSSPSTPSSGTQPSSMDLS-----------S  51

Query  514  PKSLEK-HCRPIDDVIMEAEAKGTLIERLVNVEERVAKLCNYL  389
            P+S+ K HCR ++ V  E E KGTL+ERL NVEE+V KLC+  
Sbjct  52   PRSIGKVHCRSMEQVREETERKGTLLERLNNVEEQVLKLCSQF  94



>ref|XP_010475581.1| PREDICTED: uncharacterized protein LOC104754977 [Camelina sativa]
Length=143

 Score = 58.2 bits (139),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 39/104 (38%), Positives = 63/104 (61%), Gaps = 13/104 (13%)
 Frame = -2

Query  694  VVEEPILCRLQRLDNVLKQVEALRGGGGNQspaksstassstatssegqaaatSWSAEFS  515
            +VEEPIL RL R+D +++++E ++G     S   + ++ +  ++           S +FS
Sbjct  3    IVEEPILSRLDRIDFMVRKLEEMKGSSPRSSSPSTPSSGTQPSS-----------SVDFS  51

Query  514  -PKSLEK-HCRPIDDVIMEAEAKGTLIERLVNVEERVAKLCNYL  389
             P+S+ K  CR ++ V+ E E KGTL+ERL NVEE+V KLC+  
Sbjct  52   SPRSIGKVQCRSMEQVMEETERKGTLLERLNNVEEQVLKLCSQF  95



>ref|XP_010488231.1| PREDICTED: uncharacterized protein LOC104766108 [Camelina sativa]
Length=143

 Score = 57.8 bits (138),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 39/104 (38%), Positives = 62/104 (60%), Gaps = 14/104 (13%)
 Frame = -2

Query  694  VVEEPILCRLQRLDNVLKQVEALRGGGGNQspaksstassstatssegqaaatSWSAEFS  515
            +VEEPIL RL R+D +++++E ++G     S   + ++ +  +            S +FS
Sbjct  3    IVEEPILSRLDRIDFMVRKLEEMKGSSPRSSSPSTPSSGTQPS------------SVDFS  50

Query  514  -PKSLEK-HCRPIDDVIMEAEAKGTLIERLVNVEERVAKLCNYL  389
             P+S+ K  CR ++ V+ E E KGTL+ERL NVEE+V KLC+  
Sbjct  51   SPRSIGKVQCRSMEQVMEETERKGTLLERLNNVEEQVLKLCSQF  94



>ref|XP_010458018.1| PREDICTED: uncharacterized protein LOC104739382 [Camelina sativa]
Length=142

 Score = 57.8 bits (138),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 39/104 (38%), Positives = 62/104 (60%), Gaps = 14/104 (13%)
 Frame = -2

Query  694  VVEEPILCRLQRLDNVLKQVEALRGGGGNQspaksstassstatssegqaaatSWSAEFS  515
            +VEEPIL RL R+D +++++E ++G     S   + ++ +  +            S +FS
Sbjct  3    IVEEPILSRLDRIDFMVRKLEEMKGSSPRSSSPSTPSSGTQPS------------SVDFS  50

Query  514  -PKSLEK-HCRPIDDVIMEAEAKGTLIERLVNVEERVAKLCNYL  389
             P+S+ K  CR ++ V+ E E KGTL+ERL NVEE+V KLC+  
Sbjct  51   SPRSIGKVQCRSMEQVMEETERKGTLLERLNNVEEQVLKLCSQF  94



>ref|XP_002889676.1| hypothetical protein ARALYDRAFT_470850 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65935.1| hypothetical protein ARALYDRAFT_470850 [Arabidopsis lyrata subsp. 
lyrata]
Length=144

 Score = 57.4 bits (137),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 38/103 (37%), Positives = 60/103 (58%), Gaps = 12/103 (12%)
 Frame = -2

Query  694  VVEEPILCRLQRLDNVLKQVEALRGGGGNQspaksstassstatssegqaaatSWSAEFS  515
            VVEEPIL RL R+D +++++E ++G     S   + ++ +  ++               S
Sbjct  3    VVEEPILSRLDRIDFMVRKLEEMKGSSPRSSSPSTPSSGTQPSSMDMS-----------S  51

Query  514  PKSLEK-HCRPIDDVIMEAEAKGTLIERLVNVEERVAKLCNYL  389
            P+S+ K  CR ++ V+ E E KGTL+ERL NVEE+V KLC+  
Sbjct  52   PRSIGKVQCRSMEQVMEETERKGTLLERLNNVEEQVLKLCSQF  94



>ref|XP_009148048.1| PREDICTED: uncharacterized protein LOC103871544 [Brassica rapa]
Length=141

 Score = 56.6 bits (135),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 38/101 (38%), Positives = 59/101 (58%), Gaps = 13/101 (13%)
 Frame = -2

Query  694  VVEEPILCRLQRLDNVLKQVEALRGGGGNQspaksstassstatssegqaaatSWSAEFS  515
            +VEEPIL RL R+D +++++E ++G     S   + ++ +  ++               S
Sbjct  3    MVEEPILSRLDRIDVMVRKLEEMKGSSPRSSSPSTPSSGTQPSSLDLS-----------S  51

Query  514  PKSLEKH--CRPIDDVIMEAEAKGTLIERLVNVEERVAKLC  398
            P+S  K   CRP++ V+ E E KGTL+ERL NVEE+V KLC
Sbjct  52   PRSTGKQVQCRPMEQVMEETERKGTLLERLNNVEEQVLKLC  92



>gb|AAF79824.1|AC026875_4 T6D22.8 [Arabidopsis thaliana]
Length=990

 Score = 59.7 bits (143),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 39/101 (39%), Positives = 60/101 (59%), Gaps = 12/101 (12%)
 Frame = -2

Query  694  VVEEPILCRLQRLDNVLKQVEALRGGGGNQspaksstassstatssegqaaatSWSAEFS  515
            VVEEPIL RL R+D +++++E ++G     S   + ++ +  ++               S
Sbjct  3    VVEEPILSRLDRIDFMVRKLEEMKGSSPRSSSPSTPSSGTQPSSMDLS-----------S  51

Query  514  PKSLEK-HCRPIDDVIMEAEAKGTLIERLVNVEERVAKLCN  395
            P+S+ K HCR ++ V  E E KGTL+ERL NVEE+V KLC+
Sbjct  52   PRSIGKVHCRSMEQVREETERKGTLLERLNNVEEQVLKLCS  92



>emb|CDX93602.1| BnaA06g04460D [Brassica napus]
Length=140

 Score = 55.5 bits (132),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 38/100 (38%), Positives = 59/100 (59%), Gaps = 12/100 (12%)
 Frame = -2

Query  694  VVEEPILCRLQRLDNVLKQVEALRGGGGNQspaksstassstatssegqaaatSWSAEFS  515
            +VEEPIL RL R+D +++++E ++G     S   + ++ +  ++               S
Sbjct  3    MVEEPILSRLDRIDVMVRKLEEMKGSSPRSSSPSTPSSGTQPSSLDLS-----------S  51

Query  514  PKSLEK-HCRPIDDVIMEAEAKGTLIERLVNVEERVAKLC  398
            P+S+ K  CR ++ VI E E KGTL+ERL NVEE+V KLC
Sbjct  52   PRSIGKVQCRSMEQVIEETERKGTLLERLNNVEEQVLKLC  91



>ref|XP_006305324.1| hypothetical protein CARUB_v10009702mg [Capsella rubella]
 gb|EOA38222.1| hypothetical protein CARUB_v10009702mg [Capsella rubella]
Length=330

 Score = 55.1 bits (131),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 41/133 (31%), Positives = 70/133 (53%), Gaps = 21/133 (16%)
 Frame = -2

Query  790  CILKYSTNTHQIELKKRSRTYEAAN*AMMTTLVVEEPILCRLQRLDNVLKQVEALRGGGG  611
            C+L YS  T         + ++  +  +    VVEEPIL RL R+D +++++E ++G   
Sbjct  168  CLLTYSDTT---------KAHKTLSFVLSIMAVVEEPILSRLDRIDFMVRKLEEMKGSSP  218

Query  610  NQspaksstassstatssegqaaatSWSAEFSPKSLEK-HCRPIDDVIMEAEAKGTLIER  434
              S   + ++ +  ++               SP+S+ K   R ++ V+ E E KGTL++R
Sbjct  219  RSSSPSTPSSGTQPSSMDLS-----------SPRSIGKVQIRSMEQVMEETERKGTLLDR  267

Query  433  LVNVEERVAKLCN  395
            L NVEE+V KLC+
Sbjct  268  LKNVEEQVLKLCS  280



>ref|XP_006838344.1| hypothetical protein AMTR_s00103p00157960 [Amborella trichopoda]
 gb|ERN00913.1| hypothetical protein AMTR_s00103p00157960 [Amborella trichopoda]
Length=135

 Score = 52.8 bits (125),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 37/101 (37%), Positives = 57/101 (56%), Gaps = 7/101 (7%)
 Frame = -2

Query  691  VEEPILCRLQRLDNVLKQVEALRGGGGNQspaksstassstatssegqaaatSWSAEFSP  512
             +E ++ RL RLD ++  +E L+G    +S   S++ S +T+            S   SP
Sbjct  4    TKESLVSRLDRLDILISYLEELKGSESGKSSCVSTSRSGTTSNGHST-------SVGSSP  56

Query  511  KSLEKHCRPIDDVIMEAEAKGTLIERLVNVEERVAKLCNYL  389
              LEK CRP+D V +E + KGTL++RLV VE RV +L  ++
Sbjct  57   PILEKRCRPLDTVSVETQVKGTLVDRLVLVEGRVLQLEKWI  97



>ref|XP_009118399.1| PREDICTED: uncharacterized protein LOC103843420 [Brassica rapa]
Length=135

 Score = 52.0 bits (123),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 35/101 (35%), Positives = 59/101 (58%), Gaps = 11/101 (11%)
 Frame = -2

Query  694  VVEEPILCRLQRLDNVLKQVEALRGGGGNQspaksstassstatssegqaaatSWSAEFS  515
            +VEEPIL RL R+D +++++E ++G           ++S ST +S     ++   S+   
Sbjct  3    IVEEPILSRLDRIDFMVRKLEEMKG-----------SSSPSTPSSGRTHTSSLDLSSPRR  51

Query  514  PKSLEKHCRPIDDVIMEAEAKGTLIERLVNVEERVAKLCNY  392
                +  CR ++ V+ E + KGT +ERL NVEE+V KLC++
Sbjct  52   STGKKHQCRSMEQVMEETKRKGTFLERLNNVEEQVLKLCSH  92



>emb|CDY06292.1| BnaA09g49110D [Brassica napus]
Length=880

 Score = 54.7 bits (130),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 34/107 (32%), Positives = 53/107 (50%), Gaps = 37/107 (35%)
 Frame = -2

Query  694  VVEEPILCRLQRLDNVLKQVEALRGGGGNQspaksstassstatssegqaaatSWSAEFS  515
            +VEEPIL RL R+D +++++E ++G                                   
Sbjct  3    IVEEPILSRLDRIDFMVRKLEEMKGS----------------------------------  28

Query  514  PKSLEKH-CRPIDDVIMEAEAKGTLIERLVNVEERVAKLCNYLHQEL  377
              S +KH CR ++ V+ E + KGT +ERL NVEE+V KLC++  +E 
Sbjct  29   --SRKKHQCRSMEQVMEETKRKGTFLERLNNVEEQVLKLCSHYEEEF  73



>ref|XP_008804548.1| PREDICTED: uncharacterized protein LOC103717801 [Phoenix dactylifera]
Length=143

 Score = 48.9 bits (115),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 35/99 (35%), Positives = 51/99 (52%), Gaps = 18/99 (18%)
 Frame = -2

Query  529  SAEFSPKSLEKH-CRPIDDVIMEAEAKGTLIERLVNVEERVAKLCNYLHQELEAFkttke  353
            S   SPK L +  CRP+ DV+ME +AKG+L++R+ ++E R+ K+ +   +E         
Sbjct  59   SVNSSPKCLSRRWCRPVHDVLMEVQAKGSLMDRVDHLEHRLLKIEDEKKRE---------  109

Query  352  atmhtttttiapssaaaaqkspkKGFKSLVKSCVKGKAK  236
                        S  +  +    KG KSLVKSCVKG  K
Sbjct  110  --------EAERSPRSGDKSKHGKGLKSLVKSCVKGSLK  140



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1944606558024