BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c99647_g1_i1 len=357 path=[1:0-356]

Length=357
                                                                      Score     E

gb|ABG00000.1|  retrotransposon protein, putative, Ty1-copia subc...  46.2    5e-09   Oryza sativa Japonica Group [Japonica rice]
gb|AAU10682.1|  putative polyprotein                                  43.9    6e-09   Oryza sativa Japonica Group [Japonica rice]
emb|CCH50966.1|  T4.5                                                 47.0    1e-08   
gb|AAD21687.1|  Strong similarity to gi|3600044 T12H20.12 proteas...  42.7    2e-08   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004513130.1|  PREDICTED: uncharacterized protein LOC101488260  45.4    3e-08   
gb|AAC67200.1|  putative retroelement pol polyprotein                 41.2    2e-07   Arabidopsis thaliana [mouse-ear cress]
emb|CAN77680.1|  hypothetical protein VITISV_040762                   44.3    2e-07   Vitis vinifera
dbj|BAG98101.1|  unnamed protein product                              45.1    2e-07   Oryza sativa Japonica Group [Japonica rice]
gb|EEE57553.1|  hypothetical protein OsJ_07890                        44.7    3e-07   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008390627.1|  PREDICTED: uncharacterized protein LOC103452871  43.5    3e-07   
emb|CAN64418.1|  hypothetical protein VITISV_030041                   43.5    4e-07   Vitis vinifera
ref|XP_008349809.1|  PREDICTED: uncharacterized protein LOC103413096  44.3    7e-07   
emb|CAN76078.1|  hypothetical protein VITISV_008973                   40.8    9e-07   Vitis vinifera
emb|CAN82380.1|  hypothetical protein VITISV_021579                   43.9    9e-07   Vitis vinifera
gb|AAK51235.1|AF287471_1  polyprotein                                 40.4    1e-06   Arabidopsis thaliana [mouse-ear cress]
emb|CAN73924.1|  hypothetical protein VITISV_041509                   43.5    1e-06   Vitis vinifera
emb|CAN79148.1|  hypothetical protein VITISV_004343                   43.1    1e-06   Vitis vinifera
emb|CAN69607.1|  hypothetical protein VITISV_009561                   48.5    1e-06   Vitis vinifera
ref|XP_008376319.1|  PREDICTED: uncharacterized protein LOC103439538  43.1    2e-06   
gb|AAN04167.1|  Putative copia-like retrotransposon polyprotein       40.4    2e-06   Oryza sativa Japonica Group [Japonica rice]
emb|CAH67225.1|  OSIGBa0145M07.7                                      43.9    3e-06   Oryza sativa [red rice]
ref|XP_008385055.1|  PREDICTED: uncharacterized protein LOC103447646  44.7    3e-06   
emb|CAE05450.3|  OSJNBa0073E02.10                                     43.9    4e-06   Oryza sativa [red rice]
gb|ACP30598.1|  disease resistance protein                            40.4    4e-06   Brassica rapa subsp. pekinensis [bai cai]
gb|AAT07563.1|  putative polyprotein                                  41.2    8e-06   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008356535.1|  PREDICTED: uncharacterized protein LOC103420252  37.7    8e-06   
gb|AAB82754.1|  retrofit                                              38.9    8e-06   Oryza longistaminata [long-staminate rice]
gb|ABA97008.1|  retrotransposon protein, putative, Ty1-copia subc...  41.2    8e-06   Oryza sativa Japonica Group [Japonica rice]
dbj|BAB90546.1|  putative rice retrotransposon retrofit gag/pol p...  38.9    8e-06   Oryza sativa Japonica Group [Japonica rice]
gb|ACV42639.1|  gag/pol                                               38.9    9e-06   
emb|CAN82221.1|  hypothetical protein VITISV_015226                   38.1    9e-06   Vitis vinifera
emb|CAN68489.1|  hypothetical protein VITISV_037543                   39.7    9e-06   Vitis vinifera
ref|XP_008779347.1|  PREDICTED: uncharacterized protein LOC103699078  52.8    1e-05   
gb|AAC35532.1|  contains similarity to proteases                      37.7    1e-05   Arabidopsis thaliana [mouse-ear cress]
emb|CAB40035.1|  retrotransposon like protein                         37.4    1e-05   Arabidopsis thaliana [mouse-ear cress]
emb|CAN78022.1|  hypothetical protein VITISV_015518                   46.6    2e-05   Vitis vinifera
gb|ABF95616.1|  retrotransposon protein, putative, Ty1-copia subc...  43.5    2e-05   Oryza sativa Japonica Group [Japonica rice]
emb|CAN73071.1|  hypothetical protein VITISV_032383                   45.8    2e-05   Vitis vinifera
emb|CAN66496.1|  hypothetical protein VITISV_036886                   38.5    2e-05   Vitis vinifera
emb|CAC37623.1|  copia-like polyprotein                               37.4    2e-05   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010430968.1|  PREDICTED: uncharacterized protein LOC104715244  37.7    2e-05   
emb|CAN77868.1|  hypothetical protein VITISV_001383                   43.5    2e-05   Vitis vinifera
gb|AAD43604.1|AC005698_3  T3P18.3                                     37.4    2e-05   Arabidopsis thaliana [mouse-ear cress]
emb|CAN83290.1|  hypothetical protein VITISV_018945                   43.9    3e-05   Vitis vinifera
ref|XP_008342970.1|  PREDICTED: uncharacterized protein LOC103405720  45.1    3e-05   
emb|CAN71267.1|  hypothetical protein VITISV_017889                   43.5    3e-05   Vitis vinifera
gb|AAT39281.2|  Integrase core domain containing protein              37.7    3e-05   Solanum demissum
emb|CAN74794.1|  hypothetical protein VITISV_041689                   43.9    3e-05   Vitis vinifera
ref|XP_007014689.1|  Uncharacterized protein TCM_040047               39.7    3e-05   
gb|AAC61290.1|  putative retroelement pol polyprotein                 37.7    3e-05   Arabidopsis thaliana [mouse-ear cress]
gb|AAR88589.1|  putative copia-like retrotransposon protein           41.6    4e-05   Oryza sativa Japonica Group [Japonica rice]
emb|CAN67970.1|  hypothetical protein VITISV_025093                   43.1    4e-05   Vitis vinifera
emb|CAN66898.1|  hypothetical protein VITISV_037436                   42.0    5e-05   Vitis vinifera
emb|CAN80650.1|  hypothetical protein VITISV_022906                   41.6    6e-05   Vitis vinifera
emb|CAN68388.1|  hypothetical protein VITISV_038864                   41.6    6e-05   Vitis vinifera
emb|CAN79492.1|  hypothetical protein VITISV_033373                   42.4    6e-05   Vitis vinifera
gb|AEJ72555.1|  putative retroelement polyprotein                     43.9    6e-05   
ref|XP_008387250.1|  PREDICTED: uncharacterized protein LOC103449699  37.0    6e-05   
emb|CAN75855.1|  hypothetical protein VITISV_025389                   39.7    7e-05   Vitis vinifera
emb|CAN60145.1|  hypothetical protein VITISV_019412                   41.2    8e-05   Vitis vinifera
emb|CAN69340.1|  hypothetical protein VITISV_032634                   41.2    8e-05   Vitis vinifera
emb|CAN74341.1|  hypothetical protein VITISV_043997                   41.2    8e-05   Vitis vinifera
emb|CAN62181.1|  hypothetical protein VITISV_044399                   41.2    8e-05   Vitis vinifera
emb|CAN74624.1|  hypothetical protein VITISV_024822                   41.2    8e-05   Vitis vinifera
emb|CAN71109.1|  hypothetical protein VITISV_001479                   41.2    8e-05   Vitis vinifera
emb|CAN73240.1|  hypothetical protein VITISV_035336                   41.2    8e-05   Vitis vinifera
emb|CAN81130.1|  hypothetical protein VITISV_003944                   41.2    8e-05   Vitis vinifera
emb|CAN65728.1|  hypothetical protein VITISV_015033                   41.2    8e-05   Vitis vinifera
emb|CAN61435.1|  hypothetical protein VITISV_033767                   41.2    8e-05   Vitis vinifera
ref|XP_008367623.1|  PREDICTED: uncharacterized protein LOC103431265  36.6    8e-05   
ref|XP_008344799.1|  PREDICTED: uncharacterized protein LOC103407689  43.5    9e-05   
emb|CAN61548.1|  hypothetical protein VITISV_043524                   40.8    1e-04   Vitis vinifera
emb|CAN65867.1|  hypothetical protein VITISV_034935                   40.8    1e-04   Vitis vinifera
emb|CAN67605.1|  hypothetical protein VITISV_030993                   40.0    1e-04   Vitis vinifera
emb|CAN78464.1|  hypothetical protein VITISV_025101                   41.2    1e-04   Vitis vinifera
emb|CAN60331.1|  hypothetical protein VITISV_024553                   40.4    1e-04   Vitis vinifera
ref|XP_008342448.1|  PREDICTED: uncharacterized protein LOC103405249  38.1    1e-04   
emb|CBI36090.3|  unnamed protein product                              40.4    1e-04   
emb|CAN82859.1|  hypothetical protein VITISV_025377                   47.8    1e-04   Vitis vinifera
emb|CAN60277.1|  hypothetical protein VITISV_028254                   43.5    1e-04   Vitis vinifera
emb|CAN82960.1|  hypothetical protein VITISV_004472                   39.7    2e-04   Vitis vinifera
emb|CAN72410.1|  hypothetical protein VITISV_014973                   42.0    2e-04   Vitis vinifera
emb|CAN62116.1|  hypothetical protein VITISV_011012                   44.3    2e-04   Vitis vinifera
ref|XP_008369089.1|  PREDICTED: uncharacterized protein LOC103432662  37.4    2e-04   
gb|ABA98049.1|  retrotransposon protein, putative, Ty1-copia subc...  38.1    2e-04   Oryza sativa Japonica Group [Japonica rice]
emb|CAN63196.1|  hypothetical protein VITISV_035792                   43.1    2e-04   Vitis vinifera
emb|CAN65849.1|  hypothetical protein VITISV_038148                   41.2    2e-04   Vitis vinifera
emb|CAN80991.1|  hypothetical protein VITISV_021529                   40.0    2e-04   Vitis vinifera
emb|CAB43904.1|  putative protein                                     38.1    2e-04   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008675247.1|  PREDICTED: uncharacterized protein LOC103651...  35.4    2e-04   
emb|CAN76274.1|  hypothetical protein VITISV_008497                   39.3    3e-04   Vitis vinifera
emb|CAN71164.1|  hypothetical protein VITISV_031057                   43.5    3e-04   Vitis vinifera
gb|ACY72569.1|  unknown                                               38.9    3e-04   Oryza sativa Japonica Group [Japonica rice]
emb|CAN81016.1|  hypothetical protein VITISV_025518                   40.4    3e-04   Vitis vinifera
gb|ABW81031.1|  LTRGag-pol-polymerase 3                               38.9    3e-04   Arabidopsis lyrata subsp. lyrata
emb|CAN62863.1|  hypothetical protein VITISV_030334                   38.1    4e-04   Vitis vinifera
ref|XP_008364216.1|  PREDICTED: uncharacterized protein LOC103427909  37.0    4e-04   
gb|ABI34342.1|  Polyprotein, putative                                 37.4    4e-04   Solanum demissum
emb|CAN66507.1|  hypothetical protein VITISV_034008                   38.9    4e-04   Vitis vinifera
emb|CAN69431.1|  hypothetical protein VITISV_024659                   38.9    4e-04   Vitis vinifera
emb|CAN79518.1|  hypothetical protein VITISV_026066                   48.1    4e-04   Vitis vinifera
emb|CAN67247.1|  hypothetical protein VITISV_008682                   35.8    4e-04   Vitis vinifera
emb|CAN71595.1|  hypothetical protein VITISV_010143                   38.9    4e-04   Vitis vinifera
ref|XP_008384570.1|  PREDICTED: uncharacterized protein LOC103447138  35.8    5e-04   
emb|CAN76896.1|  hypothetical protein VITISV_010605                   38.5    5e-04   Vitis vinifera
emb|CDH30699.1|  putative Ty1-copia-like retrotransposon              37.0    6e-04   
emb|CAN81099.1|  hypothetical protein VITISV_017741                   35.4    6e-04   Vitis vinifera
ref|XP_008375724.1|  PREDICTED: uncharacterized protein LOC103438960  36.6    6e-04   
emb|CAN81355.1|  hypothetical protein VITISV_039158                   40.4    6e-04   Vitis vinifera
gb|AAU43956.1|  unknown protein                                       36.6    7e-04   Oryza sativa Japonica Group [Japonica rice]
emb|CAN76151.1|  hypothetical protein VITISV_012673                   40.4    7e-04   Vitis vinifera
ref|XP_008385371.1|  PREDICTED: uncharacterized protein LOC103447922  35.4    7e-04   
ref|XP_008387175.1|  PREDICTED: uncharacterized protein LOC103449620  47.8    7e-04   
ref|XP_008351324.1|  PREDICTED: uncharacterized protein LOC103414737  35.8    7e-04   
emb|CAN76321.1|  hypothetical protein VITISV_044445                   37.7    7e-04   Vitis vinifera
emb|CAN60396.1|  hypothetical protein VITISV_018063                   37.7    8e-04   Vitis vinifera
emb|CAN72268.1|  hypothetical protein VITISV_017854                   38.5    8e-04   Vitis vinifera
gb|AAF02855.1|AC009324_4  Similar to retrotransposon proteins         35.0    9e-04   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009344802.1|  PREDICTED: uncharacterized protein LOC103936680  40.8    9e-04   



>gb|ABG00000.1| retrotransposon protein, putative, Ty1-copia subclass [Oryza 
sativa Japonica Group]
Length=2074

 Score = 46.2 bits (108),  Expect(2) = 5e-09, Method: Composition-based stats.
 Identities = 17/34 (50%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = +1

Query  241   CQFGKSSRFPLDRVYSRSNNILDLLYTDIWGPAP  342
             CQ  KS + P  + +S SNN L+L+++D+WGPAP
Sbjct  1452  CQQAKSHQLPYPKSFSVSNNPLELVFSDVWGPAP  1485


 Score = 40.4 bits (93),  Expect(2) = 5e-09, Method: Composition-based stats.
 Identities = 23/50 (46%), Positives = 28/50 (56%), Gaps = 3/50 (6%)
 Frame = +3

Query  21    KDCRTRAVLLRGPTTSGLYRL---SQSRSPVALIIARATPDIWHRRLGHP  161
             KD  T+ +LLRGP  +GLY L   S + S   L   + T   WH RLGHP
Sbjct  1374  KDQVTKNLLLRGPCRNGLYPLPTSSLATSKQVLGAIKPTMSRWHSRLGHP  1423



>gb|AAU10682.1| putative polyprotein [Oryza sativa Japonica Group]
Length=1210

 Score = 43.9 bits (102),  Expect(2) = 6e-09, Method: Compositional matrix adjust.
 Identities = 25/49 (51%), Positives = 28/49 (57%), Gaps = 2/49 (4%)
 Frame = +3

Query  21   KDCRTRAVLLRGPTTSGLYRL--SQSRSPVALIIARATPDIWHRRLGHP  161
            KD  T+  LLRGP  +GLY L  S S S   L   + T  IWH RLGHP
Sbjct  408  KDQITKNTLLRGPCCNGLYPLPASTSSSKQVLGAIKPTVSIWHSRLGHP  456


 Score = 42.4 bits (98),  Expect(2) = 6e-09, Method: Composition-based stats.
 Identities = 17/34 (50%), Positives = 24/34 (71%), Gaps = 0/34 (0%)
 Frame = +1

Query  241  CQFGKSSRFPLDRVYSRSNNILDLLYTDIWGPAP  342
            CQ GKS + P  +  S SN  L+L+++D+WGPAP
Sbjct  485  CQKGKSHQLPFLKSTSASNFPLELVFSDVWGPAP  518



>emb|CCH50966.1| T4.5 [Malus x robusta]
Length=1670

 Score = 47.0 bits (110),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 26/65 (40%), Positives = 33/65 (51%), Gaps = 9/65 (14%)
 Frame = +3

Query  21   KDCRTRAVLLRGPTTSGLYRLSQSRS---------PVALIIARATPDIWHRRLGHPHERA  173
            KD  T  +L +GP+  GLY    + S         P AL+IA+A    WHRRLGHP    
Sbjct  684  KDLSTGKMLFQGPSEGGLYPFYWNASNGVSGIAISPTALMIAKADIHTWHRRLGHPSGGT  743

Query  174  QHHVL  188
             H V+
Sbjct  744  LHSVV  748


 Score = 38.9 bits (89),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 17/37 (46%), Positives = 22/37 (59%), Gaps = 0/37 (0%)
 Frame = +1

Query  241  CQFGKSSRFPLDRVYSRSNNILDLLYTDIWGPAPVVS  351
            CQ GKS R     +   S+  L LL+TD+WGP+P  S
Sbjct  768  CQLGKSYRLSFSTLPCTSSRPLQLLHTDVWGPSPTSS  804



>gb|AAD21687.1| Strong similarity to gi|3600044 T12H20.12 protease homolog from 
Arabidopsis thaliana BAC gb|AF080119 and is a member of the 
reverse transcriptase family PF|00078 [Arabidopsis thaliana]
Length=1415

 Score = 42.7 bits (99),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 20/39 (51%), Positives = 26/39 (67%), Gaps = 0/39 (0%)
 Frame = +1

Query  241  CQFGKSSRFPLDRVYSRSNNILDLLYTDIWGPAPVVSAE  357
            CQ GKSSR P     SR  + LD ++ D+WGP+PVVS +
Sbjct  491  CQMGKSSRLPFLISDSRVLHPLDRIHCDLWGPSPVVSNQ  529


 Score = 41.6 bits (96),  Expect(2) = 2e-08, Method: Composition-based stats.
 Identities = 23/57 (40%), Positives = 35/57 (61%), Gaps = 4/57 (7%)
 Frame = +3

Query  24   DCRTRAVLLRGPTTSGLYRLSQSRSPVALIIAR---ATPDIWHRRLGHPHERAQHHV  185
            D +T+ V+  GP  +GLY L +++  VAL   R   AT ++WH RLGH + +A  H+
Sbjct  416  DLQTQKVVTTGPRRNGLYVL-ENQEFVALYSNRQCAATEEVWHHRLGHANSKALQHL  471



>ref|XP_004513130.1| PREDICTED: uncharacterized protein LOC101488260 [Cicer arietinum]
Length=752

 Score = 45.4 bits (106),  Expect(2) = 3e-08, Method: Composition-based stats.
 Identities = 24/61 (39%), Positives = 35/61 (57%), Gaps = 0/61 (0%)
 Frame = +1

Query  169  VLNIMFFSCPVTPsrsssaklcssCQFGKSSRFPLDRVYSRSNNILDLLYTDIWGPAPVV  348
            VL  +  +C V  S +    LC +CQFGK    P    YS +   LDL+++ +WGPAP++
Sbjct  432  VLEKVLKNCNVKTSSNDHFLLCEACQFGKLHLLPFTSSYSHAKEPLDLIHSGVWGPAPIL  491

Query  349  S  351
            S
Sbjct  492  S  492


 Score = 38.5 bits (88),  Expect(2) = 3e-08, Method: Composition-based stats.
 Identities = 20/50 (40%), Positives = 28/50 (56%), Gaps = 2/50 (4%)
 Frame = +3

Query  45   LLRGPTTSGLYRLSQSRSPVA--LIIARATPDIWHRRLGHPHERAQHHVL  188
            LL+G    GLY+LS + S V     I  +  + WHR+LGHP+ +    VL
Sbjct  388  LLKGKVKDGLYQLSSANSQVNKDSCIYMSVKENWHRKLGHPNNKVLEKVL  437



>gb|AAC67200.1| putative retroelement pol polyprotein [Arabidopsis thaliana]
Length=1402

 Score = 41.2 bits (95),  Expect(2) = 2e-07, Method: Composition-based stats.
 Identities = 21/50 (42%), Positives = 27/50 (54%), Gaps = 3/50 (6%)
 Frame = +3

Query  24   DCRTRAVLLRGPTTSGLYRLSQSRSPVALIIAR---ATPDIWHRRLGHPH  164
            D  T+ +L+ G T  GLY L       A    R   A+ ++WHRRLGHPH
Sbjct  426  DKATKKLLIMGSTCDGLYCLKDDSQFKAFFSTRQQSASDEVWHRRLGHPH  475


 Score = 40.0 bits (92),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 24/39 (62%), Gaps = 0/39 (0%)
 Frame = +1

Query  241  CQFGKSSRFPLDRVYSRSNNILDLLYTDIWGPAPVVSAE  357
            CQ GKS+R P       SN  L+ ++ D+WGP+P+ S +
Sbjct  501  CQLGKSTRLPFVSSSFTSNRPLERVHCDLWGPSPITSVQ  539



>emb|CAN77680.1| hypothetical protein VITISV_040762 [Vitis vinifera]
Length=590

 Score = 44.3 bits (103),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 21/49 (43%), Positives = 32/49 (65%), Gaps = 2/49 (4%)
 Frame = +3

Query  21   KDCRTRAVLLRGPTTSGLYRL--SQSRSPVALIIARATPDIWHRRLGHP  161
            KD RT  +LL+GP  +G+Y +  S + +P+A +  R +   WH+RLGHP
Sbjct  390  KDRRTGEILLQGPCENGVYPMPSSPAATPIAFVHERTSVTGWHQRLGHP  438


 Score = 36.6 bits (83),  Expect(2) = 2e-07, Method: Composition-based stats.
 Identities = 15/37 (41%), Positives = 20/37 (54%), Gaps = 0/37 (0%)
 Frame = +1

Query  241  CQFGKSSRFPLDRVYSRSNNILDLLYTDIWGPAPVVS  351
            C   K+ + P  +    S    DLLYTD+WGP+P  S
Sbjct  467  CSINKAHQLPFHKHGLTSTTPFDLLYTDVWGPSPTPS  503



>dbj|BAG98101.1| unnamed protein product [Oryza sativa Japonica Group]
Length=572

 Score = 45.1 bits (105),  Expect(2) = 2e-07, Method: Composition-based stats.
 Identities = 17/34 (50%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = +1

Query  241  CQFGKSSRFPLDRVYSRSNNILDLLYTDIWGPAP  342
            CQ GKS + P  +  SRS+  L+L+++D+WGPAP
Sbjct  436  CQKGKSHQLPYSKSLSRSSAPLELIHSDVWGPAP  469


 Score = 35.8 bits (81),  Expect(2) = 2e-07, Method: Composition-based stats.
 Identities = 20/56 (36%), Positives = 25/56 (45%), Gaps = 0/56 (0%)
 Frame = +3

Query  21   KDCRTRAVLLRGPTTSGLYRLSQSRSPVALIIARATPDIWHRRLGHPHERAQHHVL  188
            KD  TR +L +G    GLY L    +       + +P  WH RLGHP       VL
Sbjct  361  KDQVTRKLLHQGRCERGLYPLKSFPNKQVFAAIKLSPSQWHCRLGHPSSVIVQQVL  416



>gb|EEE57553.1| hypothetical protein OsJ_07890 [Oryza sativa Japonica Group]
Length=499

 Score = 44.7 bits (104),  Expect(2) = 3e-07, Method: Composition-based stats.
 Identities = 17/34 (50%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = +1

Query  241  CQFGKSSRFPLDRVYSRSNNILDLLYTDIWGPAP  342
            CQ GKS + P  +  SRS+  L+L+++D+WGPAP
Sbjct  363  CQKGKSHQLPYSKSLSRSSAPLELIHSDVWGPAP  396


 Score = 35.8 bits (81),  Expect(2) = 3e-07, Method: Composition-based stats.
 Identities = 20/56 (36%), Positives = 25/56 (45%), Gaps = 0/56 (0%)
 Frame = +3

Query  21   KDCRTRAVLLRGPTTSGLYRLSQSRSPVALIIARATPDIWHRRLGHPHERAQHHVL  188
            KD  TR +L +G    GLY L    +       + +P  WH RLGHP       VL
Sbjct  288  KDQVTRKLLHQGRCERGLYPLKSFPNKQVFAAIKLSPSQWHCRLGHPSSVIVQQVL  343



>ref|XP_008390627.1| PREDICTED: uncharacterized protein LOC103452871 [Malus domestica]
Length=1159

 Score = 43.5 bits (101),  Expect(2) = 3e-07, Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 29/50 (58%), Gaps = 3/50 (6%)
 Frame = +3

Query  21   KDCRTRAVLLRGPTTSGLYRLS---QSRSPVALIIARATPDIWHRRLGHP  161
            KD  TR +L +GP ++G Y L     + +P   +  +A+   WHRRLGHP
Sbjct  426  KDRSTRRMLFQGPVSAGFYPLQGIPSTSAPSTFLSTKASLQTWHRRLGHP  475


 Score = 37.0 bits (84),  Expect(2) = 3e-07, Method: Compositional matrix adjust.
 Identities = 15/36 (42%), Positives = 23/36 (64%), Gaps = 0/36 (0%)
 Frame = +1

Query  241  CQFGKSSRFPLDRVYSRSNNILDLLYTDIWGPAPVV  348
            C  GK+ + P     S ++  L+L++ D+WGPAPVV
Sbjct  504  CAIGKNHKLPFSSSTSSASASLELIHCDVWGPAPVV  539



>emb|CAN64418.1| hypothetical protein VITISV_030041 [Vitis vinifera]
Length=1429

 Score = 43.5 bits (101),  Expect(2) = 4e-07, Method: Composition-based stats.
 Identities = 21/48 (44%), Positives = 30/48 (63%), Gaps = 2/48 (4%)
 Frame = +3

Query  21   KDCRTRAVLLRGPTTSGLYRLSQS--RSPVALIIARATPDIWHRRLGH  158
            KD RT  +LL+GP  +G+Y L+ S   +P+A +  R +   WH RLGH
Sbjct  282  KDWRTGEILLQGPCENGVYPLASSPAATPIAFVHERTSAXGWHXRLGH  329


 Score = 36.6 bits (83),  Expect(2) = 4e-07, Method: Composition-based stats.
 Identities = 15/37 (41%), Positives = 20/37 (54%), Gaps = 0/37 (0%)
 Frame = +1

Query  241  CQFGKSSRFPLDRVYSRSNNILDLLYTDIWGPAPVVS  351
            C   K+ + P  +    S    DLLYTD+WGP+P  S
Sbjct  359  CSXNKAHQLPFHKHGLTSTTPFDLLYTDVWGPSPTPS  395



>ref|XP_008349809.1| PREDICTED: uncharacterized protein LOC103413096 [Malus domestica]
Length=954

 Score = 44.3 bits (103),  Expect(2) = 7e-07, Method: Compositional matrix adjust.
 Identities = 24/52 (46%), Positives = 29/52 (56%), Gaps = 5/52 (10%)
 Frame = +3

Query  21   KDCRTRAVLLRGPTTSGLYRLSQSR-----SPVALIIARATPDIWHRRLGHP  161
            KD  +  +LLRGP   G Y L  S      SP AL+  +A   IWH+RLGHP
Sbjct  469  KDRISGKMLLRGPVRDGFYPLQSSSNLHPLSPTALLSIKAPVTIWHKRLGHP  520


 Score = 35.4 bits (80),  Expect(2) = 7e-07, Method: Compositional matrix adjust.
 Identities = 13/38 (34%), Positives = 21/38 (55%), Gaps = 0/38 (0%)
 Frame = +1

Query  241  CQFGKSSRFPLDRVYSRSNNILDLLYTDIWGPAPVVSA  354
            C   K+ + P     S + + L LL+ D+WGPA + S+
Sbjct  549  CALAKNHKLPFKAATSSTTHSLQLLHCDLWGPASITSS  586



>emb|CAN76078.1| hypothetical protein VITISV_008973 [Vitis vinifera]
Length=1146

 Score = 40.8 bits (94),  Expect(2) = 9e-07, Method: Compositional matrix adjust.
 Identities = 20/45 (44%), Positives = 25/45 (56%), Gaps = 2/45 (4%)
 Frame = +3

Query  33   TRAVLLRGPTTSGLYRLSQSRSPVALIIARATPD--IWHRRLGHP  161
            T+ +LL+G    GLY  S S  P A +   +  D  IWH RLGHP
Sbjct  303  TKKILLKGWLRDGLYEFSSSSPPRAFVTPSSFSDGAIWHSRLGHP  347


 Score = 38.1 bits (87),  Expect(2) = 9e-07, Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 22/37 (59%), Gaps = 0/37 (0%)
 Frame = +1

Query  241  CQFGKSSRFPLDRVYSRSNNILDLLYTDIWGPAPVVS  351
            CQ  KS   P     S  ++ L L++TD+WGPAP +S
Sbjct  376  CQLAKSHSLPYSLSSSHVSHPLALIHTDLWGPAPSIS  412



>emb|CAN82380.1| hypothetical protein VITISV_021579 [Vitis vinifera]
Length=828

 Score = 43.9 bits (102),  Expect(2) = 9e-07, Method: Compositional matrix adjust.
 Identities = 22/49 (45%), Positives = 27/49 (55%), Gaps = 2/49 (4%)
 Frame = +3

Query  21   KDCRTRAVLLRGPTTSGLYRLSQSRSPVALIIARATPD--IWHRRLGHP  161
            KD  T+ +LL+G    GLY  S S  P A +   +  D  IWH RLGHP
Sbjct  342  KDQVTKKILLKGWLRDGLYEFSSSSPPRAFVTTSSFSDGAIWHSRLGHP  390


 Score = 35.0 bits (79),  Expect(2) = 9e-07, Method: Compositional matrix adjust.
 Identities = 15/37 (41%), Positives = 21/37 (57%), Gaps = 0/37 (0%)
 Frame = +1

Query  241  CQFGKSSRFPLDRVYSRSNNILDLLYTDIWGPAPVVS  351
            C   KS   P     S  ++ L L++TD+WGPAP +S
Sbjct  419  CPLAKSHSLPYSLSSSHVSHPLALIHTDLWGPAPSIS  455



>gb|AAK51235.1|AF287471_1 polyprotein [Arabidopsis thaliana]
Length=1453

 Score = 40.4 bits (93),  Expect(2) = 1e-06, Method: Compositional matrix adjust.
 Identities = 17/39 (44%), Positives = 25/39 (64%), Gaps = 0/39 (0%)
 Frame = +1

Query  241  CQFGKSSRFPLDRVYSRSNNILDLLYTDIWGPAPVVSAE  357
            CQ GKSS+       SR  ++L  ++ D+WGP+PVVS +
Sbjct  494  CQMGKSSKLQFFSSNSRELDLLGRIHCDLWGPSPVVSKQ  532


 Score = 38.1 bits (87),  Expect(2) = 1e-06, Method: Composition-based stats.
 Identities = 21/52 (40%), Positives = 32/52 (62%), Gaps = 4/52 (8%)
 Frame = +3

Query  24   DCRTRAVLLRGPTTSGLYRLSQSRSPVALIIAR---ATPDIWHRRLGHPHER  170
            D  T+ V+ +GP ++GLY L +++  VA    R   A+ +IWH RLGH + R
Sbjct  419  DINTQKVVSKGPRSNGLYVL-ENQEFVAFYSNRQCAASEEIWHHRLGHSNSR  469



>emb|CAN73924.1| hypothetical protein VITISV_041509 [Vitis vinifera]
Length=1434

 Score = 43.5 bits (101),  Expect(2) = 1e-06, Method: Compositional matrix adjust.
 Identities = 22/49 (45%), Positives = 27/49 (55%), Gaps = 2/49 (4%)
 Frame = +3

Query  21   KDCRTRAVLLRGPTTSGLYRLSQSRSPVALIIARATPD--IWHRRLGHP  161
            KD  T+ +LL+G    GLY  S S  P A +   +  D  IWH RLGHP
Sbjct  439  KDQVTKKILLKGWLRDGLYEFSSSSPPRAFVTTGSFSDGAIWHSRLGHP  487


 Score = 35.0 bits (79),  Expect(2) = 1e-06, Method: Compositional matrix adjust.
 Identities = 15/37 (41%), Positives = 21/37 (57%), Gaps = 0/37 (0%)
 Frame = +1

Query  241  CQFGKSSRFPLDRVYSRSNNILDLLYTDIWGPAPVVS  351
            C   KS   P     S +++ L L++TD+WGPAP  S
Sbjct  516  CPLAKSHSLPYSLSSSHASHPLALIHTDLWGPAPSTS  552



>emb|CAN79148.1| hypothetical protein VITISV_004343 [Vitis vinifera]
Length=1334

 Score = 43.1 bits (100),  Expect(2) = 1e-06, Method: Compositional matrix adjust.
 Identities = 22/49 (45%), Positives = 27/49 (55%), Gaps = 2/49 (4%)
 Frame = +3

Query  21   KDCRTRAVLLRGPTTSGLYRLSQSRSPVALIIARATPD--IWHRRLGHP  161
            KD  T+ +LL+G    GLY  S S  P A +   +  D  IWH RLGHP
Sbjct  439  KDQVTKKILLKGWLRDGLYEFSSSSPPRAFVTTGSFSDGAIWHSRLGHP  487


 Score = 35.0 bits (79),  Expect(2) = 1e-06, Method: Compositional matrix adjust.
 Identities = 15/37 (41%), Positives = 21/37 (57%), Gaps = 0/37 (0%)
 Frame = +1

Query  241  CQFGKSSRFPLDRVYSRSNNILDLLYTDIWGPAPVVS  351
            C   KS   P     S +++ L L++TD+WGPAP  S
Sbjct  516  CPLAKSHSLPYSLSSSHASHPLALIHTDLWGPAPSTS  552



>emb|CAN69607.1| hypothetical protein VITISV_009561 [Vitis vinifera]
Length=1207

 Score = 48.5 bits (114),  Expect(2) = 1e-06, Method: Compositional matrix adjust.
 Identities = 18/37 (49%), Positives = 27/37 (73%), Gaps = 0/37 (0%)
 Frame = +1

Query  241  CQFGKSSRFPLDRVYSRSNNILDLLYTDIWGPAPVVS  351
            CQF K+ R P  R   RS+++LDL++ D+WGP+P+ S
Sbjct  428  CQFAKNHRLPYSRNEHRSSHVLDLIHCDLWGPSPIKS  464


 Score = 29.6 bits (65),  Expect(2) = 1e-06, Method: Compositional matrix adjust.
 Identities = 16/43 (37%), Positives = 22/43 (51%), Gaps = 4/43 (9%)
 Frame = +3

Query  42   VLLRGPTTSGLYRLSQSRSPVALIIA----RATPDIWHRRLGH  158
            V+  G    GLY L +  S    ++     RA+ D+WH RLGH
Sbjct  356  VVATGKRDGGLYVLERDNSAFISVLKNKSLRASYDLWHARLGH  398



>ref|XP_008376319.1| PREDICTED: uncharacterized protein LOC103439538 [Malus domestica]
Length=1217

 Score = 43.1 bits (100),  Expect(2) = 2e-06, Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 22/37 (59%), Gaps = 0/37 (0%)
 Frame = +1

Query  241  CQFGKSSRFPLDRVYSRSNNILDLLYTDIWGPAPVVS  351
            C   KS + P    +S +  IL LL+ D+WGPAP+ S
Sbjct  506  CALAKSHKLPFGSAHSTTTQILQLLHCDLWGPAPITS  542


 Score = 35.0 bits (79),  Expect(2) = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/61 (43%), Positives = 28/61 (46%), Gaps = 5/61 (8%)
 Frame = +3

Query  21   KDCRTRAVLLRGPTTSGLYRLS-----QSRSPVALIIARATPDIWHRRLGHPHERAQHHV  185
            KD  +   LLRG    G Y L       S SP A I  +A   IWHRRLGHP       V
Sbjct  426  KDRVSGKTLLRGQVKEGFYPLQGSSHPPSSSPSAFISVKAHVQIWHRRLGHPSSSIFRKV  485

Query  186  L  188
            L
Sbjct  486  L  486



>gb|AAN04167.1| Putative copia-like retrotransposon polyprotein [Oryza sativa 
Japonica Group]
 gb|AAP53032.1| retrotransposon protein, putative, Ty1-copia subclass [Oryza 
sativa Japonica Group]
Length=1042

 Score = 40.4 bits (93),  Expect(2) = 2e-06, Method: Composition-based stats.
 Identities = 16/33 (48%), Positives = 21/33 (64%), Gaps = 0/33 (0%)
 Frame = +1

Query  241  CQFGKSSRFPLDRVYSRSNNILDLLYTDIWGPA  339
            CQ  KS + P     S SN  L+L+Y+D+WGPA
Sbjct  387  CQKAKSHQLPYSNSMSVSNKPLELIYSDVWGPA  419


 Score = 37.4 bits (85),  Expect(2) = 2e-06, Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 25/47 (53%), Gaps = 0/47 (0%)
 Frame = +3

Query  21   KDCRTRAVLLRGPTTSGLYRLSQSRSPVALIIARATPDIWHRRLGHP  161
            KD  TR+ +L+GP   GLY L  + S         + + WH RLGHP
Sbjct  312  KDRTTRSTVLKGPRRHGLYPLPSTSSTKQAFAVAPSLERWHSRLGHP  358



>emb|CAH67225.1| OSIGBa0145M07.7 [Oryza sativa Indica Group]
Length=1087

 Score = 43.9 bits (102),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 17/34 (50%), Positives = 24/34 (71%), Gaps = 0/34 (0%)
 Frame = +1

Query  241  CQFGKSSRFPLDRVYSRSNNILDLLYTDIWGPAP  342
            CQ  KS + P  R  SRS+  L+L+++D+WGPAP
Sbjct  481  CQQAKSHQLPYSRSVSRSSAPLELVFSDVWGPAP  514


 Score = 33.1 bits (74),  Expect(2) = 3e-06, Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 29/51 (57%), Gaps = 4/51 (8%)
 Frame = +3

Query  21   KDCRTRAVLLRGPTTSGLYRLS-QSRSPV---ALIIARATPDIWHRRLGHP  161
            KD  T++ LL+G +  GLY +  +S +P    AL+   +    WH RLGHP
Sbjct  403  KDQTTKSTLLQGRSRGGLYPIPLKSTTPQGRQALVSTSSAESRWHSRLGHP  453



>ref|XP_008385055.1| PREDICTED: uncharacterized protein LOC103447646 [Malus domestica]
Length=727

 Score = 44.7 bits (104),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 22/51 (43%), Positives = 27/51 (53%), Gaps = 4/51 (8%)
 Frame = +3

Query  21   KDCRTRAVLLRGPTTSGLYRLS----QSRSPVALIIARATPDIWHRRLGHP  161
            KDC +  +L R P   G Y        S SP AL+ ++A   IWH RLGHP
Sbjct  476  KDCISGMMLFRRPIKDGFYPFQGITPASTSPSALVCSKAPLQIWHNRLGHP  526


 Score = 32.3 bits (72),  Expect(2) = 3e-06, Method: Compositional matrix adjust.
 Identities = 13/37 (35%), Positives = 21/37 (57%), Gaps = 0/37 (0%)
 Frame = +1

Query  241  CQFGKSSRFPLDRVYSRSNNILDLLYTDIWGPAPVVS  351
            C  GK+ + P     S  +  L+L++ D+WGP P +S
Sbjct  555  CAIGKNHKLPFTTSISFVSVPLELVHCDVWGPTPTLS  591



>emb|CAE05450.3| OSJNBa0073E02.10 [Oryza sativa Japonica Group]
Length=1131

 Score = 43.9 bits (102),  Expect(2) = 4e-06, Method: Composition-based stats.
 Identities = 17/34 (50%), Positives = 24/34 (71%), Gaps = 0/34 (0%)
 Frame = +1

Query  241  CQFGKSSRFPLDRVYSRSNNILDLLYTDIWGPAP  342
            CQ  KS + P  R  SRS+  L+L+++D+WGPAP
Sbjct  481  CQQAKSHQLPYSRSVSRSSAPLELVFSDVWGPAP  514


 Score = 32.7 bits (73),  Expect(2) = 4e-06, Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 29/51 (57%), Gaps = 4/51 (8%)
 Frame = +3

Query  21   KDCRTRAVLLRGPTTSGLYRLS-QSRSPV---ALIIARATPDIWHRRLGHP  161
            KD  T++ LL+G +  GLY +  +S +P    AL+   +    WH RLGHP
Sbjct  403  KDQTTKSTLLQGRSRGGLYPIPLKSTTPQGRQALVSTSSAESRWHSRLGHP  453



>gb|ACP30598.1| disease resistance protein [Brassica rapa subsp. pekinensis]
Length=2301

 Score = 40.4 bits (93),  Expect(2) = 4e-06, Method: Composition-based stats.
 Identities = 16/39 (41%), Positives = 23/39 (59%), Gaps = 0/39 (0%)
 Frame = +1

Query  241  CQFGKSSRFPLDRVYSRSNNILDLLYTDIWGPAPVVSAE  357
            CQ  KSSR P       +   L+ ++ D+WGP+PVVS +
Sbjct  499  CQMAKSSRLPFSASQFVATRPLERIHCDVWGPSPVVSVQ  537


 Score = 36.6 bits (83),  Expect(2) = 4e-06, Method: Composition-based stats.
 Identities = 20/50 (40%), Positives = 30/50 (60%), Gaps = 4/50 (8%)
 Frame = +3

Query  24   DCRTRAVLLRGPTTSGLYRLSQSRSPVALIIAR---ATPDIWHRRLGHPH  164
            D  T+ VLL+G  T GLY + +  +  A    R   A+ ++WH+RLGHP+
Sbjct  425  DKATKKVLLQGRNTKGLYSIKEP-AFHAFFSTRQVAASDEVWHQRLGHPN  473



>gb|AAT07563.1| putative polyprotein [Oryza sativa Japonica Group]
 gb|AAT07631.1| putative polyprotein [Oryza sativa Japonica Group]
Length=1431

 Score = 41.2 bits (95),  Expect(2) = 8e-06, Method: Composition-based stats.
 Identities = 16/33 (48%), Positives = 22/33 (67%), Gaps = 0/33 (0%)
 Frame = +1

Query  241  CQFGKSSRFPLDRVYSRSNNILDLLYTDIWGPA  339
            CQ  K  + P  R  S SNN L+L+++D+WGPA
Sbjct  481  CQQAKCHQLPFPRSTSVSNNPLELIHSDVWGPA  513


 Score = 34.7 bits (78),  Expect(2) = 8e-06, Method: Compositional matrix adjust.
 Identities = 20/47 (43%), Positives = 23/47 (49%), Gaps = 0/47 (0%)
 Frame = +3

Query  21   KDCRTRAVLLRGPTTSGLYRLSQSRSPVALIIARATPDIWHRRLGHP  161
            KD  TR  +L GP   GLY L    S     +A  +   WH RLGHP
Sbjct  406  KDKATRRTILEGPCRRGLYPLPARSSLRQAFVATPSFVRWHGRLGHP  452



>ref|XP_008356535.1| PREDICTED: uncharacterized protein LOC103420252 [Malus domestica]
Length=1312

 Score = 37.7 bits (86),  Expect(2) = 8e-06, Method: Compositional matrix adjust.
 Identities = 25/63 (40%), Positives = 28/63 (44%), Gaps = 7/63 (11%)
 Frame = +3

Query  21   KDCRTRAVLLRGPTTSGLYRL-------SQSRSPVALIIARATPDIWHRRLGHPHERAQH  179
            KD  T   LLRG    G + L       + S SP AL+   A   IWH RLGHP      
Sbjct  472  KDRFTGRTLLRGQVKDGFFPLHGSPALSTVSHSPTALVSTAANVRIWHSRLGHPSSAIFR  531

Query  180  HVL  188
             VL
Sbjct  532  KVL  534


 Score = 37.7 bits (86),  Expect(2) = 8e-06, Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 22/37 (59%), Gaps = 0/37 (0%)
 Frame = +1

Query  241  CQFGKSSRFPLDRVYSRSNNILDLLYTDIWGPAPVVS  351
            C   K+ + P     S S   L+LL+ D+WGP+PVVS
Sbjct  554  CALAKNHKLPFGSPQSVSTASLELLHCDVWGPSPVVS  590



>gb|AAB82754.1| retrofit [Oryza longistaminata]
Length=1445

 Score = 38.9 bits (89),  Expect(2) = 8e-06, Method: Composition-based stats.
 Identities = 16/34 (47%), Positives = 22/34 (65%), Gaps = 0/34 (0%)
 Frame = +1

Query  241  CQFGKSSRFPLDRVYSRSNNILDLLYTDIWGPAP  342
            CQ  KS + P  R  S S   L+L+++D+WGPAP
Sbjct  493  CQEAKSHQLPYIRSTSVSQFPLELVFSDVWGPAP  526


 Score = 36.6 bits (83),  Expect(2) = 8e-06, Method: Composition-based stats.
 Identities = 22/51 (43%), Positives = 27/51 (53%), Gaps = 4/51 (8%)
 Frame = +3

Query  21   KDCRTRAVLLRGPTTSGLYRL----SQSRSPVALIIARATPDIWHRRLGHP  161
            KD  TR VLL G    GLY +     +S +  AL  A+ +   WH RLGHP
Sbjct  414  KDQVTRDVLLEGKCRHGLYPIPKFFGRSTNKQALGAAKLSLSRWHSRLGHP  464



>gb|ABA97008.1| retrotransposon protein, putative, Ty1-copia subclass [Oryza 
sativa Japonica Group]
Length=1202

 Score = 41.2 bits (95),  Expect(2) = 8e-06, Method: Composition-based stats.
 Identities = 16/33 (48%), Positives = 22/33 (67%), Gaps = 0/33 (0%)
 Frame = +1

Query  241  CQFGKSSRFPLDRVYSRSNNILDLLYTDIWGPA  339
            CQ  K  + P  R  S SNN L+L+++D+WGPA
Sbjct  490  CQQAKCHQLPFPRSTSVSNNPLELIHSDVWGPA  522


 Score = 34.7 bits (78),  Expect(2) = 8e-06, Method: Compositional matrix adjust.
 Identities = 20/47 (43%), Positives = 23/47 (49%), Gaps = 0/47 (0%)
 Frame = +3

Query  21   KDCRTRAVLLRGPTTSGLYRLSQSRSPVALIIARATPDIWHRRLGHP  161
            KD  TR  +L GP   GLY L    S     +A  +   WH RLGHP
Sbjct  415  KDKATRRTILEGPCRRGLYPLPARSSLRQAFVATPSFVRWHGRLGHP  461



>dbj|BAB90546.1| putative rice retrotransposon retrofit gag/pol polyprotein [Oryza 
sativa Japonica Group]
Length=1448

 Score = 38.9 bits (89),  Expect(2) = 8e-06, Method: Composition-based stats.
 Identities = 16/34 (47%), Positives = 22/34 (65%), Gaps = 0/34 (0%)
 Frame = +1

Query  241  CQFGKSSRFPLDRVYSRSNNILDLLYTDIWGPAP  342
            CQ  KS + P  R  S S   L+L+++D+WGPAP
Sbjct  497  CQEAKSHQLPYIRSTSVSQFPLELVFSDVWGPAP  530


 Score = 36.6 bits (83),  Expect(2) = 8e-06, Method: Composition-based stats.
 Identities = 22/51 (43%), Positives = 26/51 (51%), Gaps = 4/51 (8%)
 Frame = +3

Query  21   KDCRTRAVLLRGPTTSGLY----RLSQSRSPVALIIARATPDIWHRRLGHP  161
            KD  TR VLL G    GLY       +S +  AL  A+ +   WH RLGHP
Sbjct  418  KDQVTRDVLLEGKCRHGLYPIPKSFGRSTNKQALGAAKLSLSRWHSRLGHP  468



>gb|ACV42639.1| gag/pol [Oryza sativa Japonica Group]
Length=1448

 Score = 38.9 bits (89),  Expect(2) = 9e-06, Method: Composition-based stats.
 Identities = 16/34 (47%), Positives = 22/34 (65%), Gaps = 0/34 (0%)
 Frame = +1

Query  241  CQFGKSSRFPLDRVYSRSNNILDLLYTDIWGPAP  342
            CQ  KS + P  R  S S   L+L+++D+WGPAP
Sbjct  497  CQEAKSHQLPYIRSTSVSQFPLELVFSDVWGPAP  530


 Score = 36.6 bits (83),  Expect(2) = 9e-06, Method: Composition-based stats.
 Identities = 22/51 (43%), Positives = 26/51 (51%), Gaps = 4/51 (8%)
 Frame = +3

Query  21   KDCRTRAVLLRGPTTSGLY----RLSQSRSPVALIIARATPDIWHRRLGHP  161
            KD  TR VLL G    GLY       +S +  AL  A+ +   WH RLGHP
Sbjct  418  KDQVTRDVLLEGKCRHGLYPIPKSFGRSTNKQALGAAKLSLSRWHSRLGHP  468



>emb|CAN82221.1| hypothetical protein VITISV_015226 [Vitis vinifera]
Length=1007

 Score = 38.1 bits (87),  Expect(2) = 9e-06, Method: Compositional matrix adjust.
 Identities = 14/35 (40%), Positives = 22/35 (63%), Gaps = 0/35 (0%)
 Frame = +1

Query  241  CQFGKSSRFPLDRVYSRSNNILDLLYTDIWGPAPV  345
            CQF KS + P +   SR+++   LL+ D+WGP  +
Sbjct  208  CQFAKSHKLPFNVSVSRASHPFALLHADLWGPTSI  242


 Score = 37.4 bits (85),  Expect(2) = 9e-06, Method: Compositional matrix adjust.
 Identities = 21/68 (31%), Positives = 29/68 (43%), Gaps = 12/68 (18%)
 Frame = +3

Query  21   KDCRTRAVLLRGPTTSGLYRLSQSRSPVALIIARATPD------------IWHRRLGHPH  164
            KD  T+ +LL+G    GLYR      P       ++ D            +WH RLGHP 
Sbjct  123  KDQVTKKILLQGSLEHGLYRFPARFVPSPTAFVSSSYDRSSNISLTTITTLWHSRLGHPA  182

Query  165  ERAQHHVL  188
            +    H+L
Sbjct  183  DNILKHIL  190



>emb|CAN68489.1| hypothetical protein VITISV_037543 [Vitis vinifera]
Length=1449

 Score = 39.7 bits (91),  Expect(2) = 9e-06, Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 24/37 (65%), Gaps = 0/37 (0%)
 Frame = +1

Query  241  CQFGKSSRFPLDRVYSRSNNILDLLYTDIWGPAPVVS  351
            CQF KS + P +   SR+++ L LL+ D+WGP  + S
Sbjct  556  CQFAKSHKLPFNVXVSRASHPLALLHADLWGPXSIPS  592


 Score = 35.8 bits (81),  Expect(2) = 9e-06, Method: Compositional matrix adjust.
 Identities = 21/68 (31%), Positives = 29/68 (43%), Gaps = 12/68 (18%)
 Frame = +3

Query  21   KDCRTRAVLLRGPTTSGLYRLSQSRSPVALIIARATPD------------IWHRRLGHPH  164
            KD  T+ +LL+G    GLYR      P       ++ D            +WH RLGHP 
Sbjct  471  KDQVTKKILLQGSLEHGLYRFPARFVPSPAAFVSSSYDRSSNLSLTTTTTLWHSRLGHPA  530

Query  165  ERAQHHVL  188
            +    H+L
Sbjct  531  DNILKHIL  538



>ref|XP_008779347.1| PREDICTED: uncharacterized protein LOC103699078, partial [Phoenix 
dactylifera]
Length=419

 Score = 52.8 bits (125),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 31/69 (45%), Positives = 38/69 (55%), Gaps = 8/69 (12%)
 Frame = +3

Query  21   KDCRTRAVLLRGPTTSGLYR---LSQSRSPVALIIARATPDIWHRRLGHPHERA-----Q  176
            KDC +   L RGP    LY    LSQ  SP+ALI  RA+ + WH+RLGHP  +       
Sbjct  219  KDCNSGKTLHRGPLRKSLYSMLSLSQPSSPLALIGVRASIEDWHKRLGHPAFQTVSKVIS  278

Query  177  HHVLLVSGH  203
            HH L VS +
Sbjct  279  HHQLPVSSN  287



>gb|AAC35532.1| contains similarity to proteases [Arabidopsis thaliana]
Length=1392

 Score = 37.7 bits (86),  Expect(2) = 1e-05, Method: Composition-based stats.
 Identities = 19/58 (33%), Positives = 30/58 (52%), Gaps = 2/58 (3%)
 Frame = +3

Query  21   KDCRTRAVLLRGPTTSGLYRLSQSRSPVALIIARATPD--IWHRRLGHPHERAQHHVL  188
            KD RT+ +L +G    GLY L            + + D  +WH+RLGHP++    H++
Sbjct  420  KDKRTQQLLTQGNKHKGLYVLKDVPFQTYYSTRQQSSDDEVWHQRLGHPNKEVLQHLI  477


 Score = 37.4 bits (85),  Expect(2) = 1e-05, Method: Compositional matrix adjust.
 Identities = 17/39 (44%), Positives = 23/39 (59%), Gaps = 0/39 (0%)
 Frame = +1

Query  241  CQFGKSSRFPLDRVYSRSNNILDLLYTDIWGPAPVVSAE  357
            CQ GK  R P       S+  L+ ++ D+WGPAPV SA+
Sbjct  495  CQMGKVCRLPFVASEFVSSRPLERIHCDLWGPAPVTSAQ  533



>emb|CAB40035.1| retrotransposon like protein [Arabidopsis thaliana]
 emb|CAB81170.1| retrotransposon like protein [Arabidopsis thaliana]
Length=1515

 Score = 37.4 bits (85),  Expect(2) = 1e-05, Method: Composition-based stats.
 Identities = 19/58 (33%), Positives = 30/58 (52%), Gaps = 2/58 (3%)
 Frame = +3

Query  21   KDCRTRAVLLRGPTTSGLYRLSQSRSPVALIIARATPD--IWHRRLGHPHERAQHHVL  188
            KD RT+ +L +G    GLY L            + + D  +WH+RLGHP++    H++
Sbjct  417  KDKRTQQLLTQGNKHKGLYVLKDVPFQTYYSTRQQSSDDEVWHQRLGHPNKEVLQHLI  474


 Score = 37.4 bits (85),  Expect(2) = 1e-05, Method: Compositional matrix adjust.
 Identities = 17/39 (44%), Positives = 23/39 (59%), Gaps = 0/39 (0%)
 Frame = +1

Query  241  CQFGKSSRFPLDRVYSRSNNILDLLYTDIWGPAPVVSAE  357
            CQ GK  R P       S+  L+ ++ D+WGPAPV SA+
Sbjct  492  CQMGKVCRLPFVASEFVSSRPLERIHCDLWGPAPVTSAQ  530



>emb|CAN78022.1| hypothetical protein VITISV_015518 [Vitis vinifera]
Length=1501

 Score = 46.6 bits (109),  Expect(2) = 2e-05, Method: Compositional matrix adjust.
 Identities = 17/37 (46%), Positives = 26/37 (70%), Gaps = 0/37 (0%)
 Frame = +1

Query  241  CQFGKSSRFPLDRVYSRSNNILDLLYTDIWGPAPVVS  351
            CQ  K+ R P  R   RS+++LDL++ D+WGP+P+ S
Sbjct  444  CQLAKNHRLPYSRNEHRSSHVLDLIHCDLWGPSPIKS  480


 Score = 28.1 bits (61),  Expect(2) = 2e-05, Method: Compositional matrix adjust.
 Identities = 15/39 (38%), Positives = 20/39 (51%), Gaps = 4/39 (10%)
 Frame = +3

Query  54   GPTTSGLYRLSQSRSPVALIIA----RATPDIWHRRLGH  158
            G    GLY L +  S    ++     RA+ D+WH RLGH
Sbjct  390  GKRDGGLYVLERGNSAFISVLKNKSLRASYDLWHARLGH  428



>gb|ABF95616.1| retrotransposon protein, putative, Ty1-copia subclass [Oryza 
sativa Japonica Group]
Length=1241

 Score = 43.5 bits (101),  Expect(2) = 2e-05, Method: Composition-based stats.
 Identities = 16/35 (46%), Positives = 25/35 (71%), Gaps = 0/35 (0%)
 Frame = +1

Query  241  CQFGKSSRFPLDRVYSRSNNILDLLYTDIWGPAPV  345
            CQ GKS + P  +  S S+  L+L+++D+WGPAP+
Sbjct  478  CQKGKSHQLPYPKSSSVSSQPLELIFSDVWGPAPI  512


 Score = 31.2 bits (69),  Expect(2) = 2e-05, Method: Compositional matrix adjust.
 Identities = 21/49 (43%), Positives = 24/49 (49%), Gaps = 4/49 (8%)
 Frame = +3

Query  21   KDCRTRAVLLRGPTTSGLYRLSQSRSPVALIIARATPDI--WHRRLGHP  161
            KD  TR  +L+G     LY L  S  P   + A  TP    WH RLGHP
Sbjct  403  KDRVTRNTILKGRCRRRLYSLPTS--PAKQVHAATTPSFSRWHSRLGHP  449



>emb|CAN73071.1| hypothetical protein VITISV_032383 [Vitis vinifera]
Length=1239

 Score = 45.8 bits (107),  Expect(2) = 2e-05, Method: Composition-based stats.
 Identities = 17/37 (46%), Positives = 26/37 (70%), Gaps = 0/37 (0%)
 Frame = +1

Query  241  CQFGKSSRFPLDRVYSRSNNILDLLYTDIWGPAPVVS  351
            CQ  K+ R P  R   RS+++LDL++ D+WGP+P+ S
Sbjct  466  CQLAKNHRLPYSRNEHRSSHVLDLIHCDLWGPSPIKS  502


 Score = 28.9 bits (63),  Expect(2) = 2e-05, Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 23/47 (49%), Gaps = 4/47 (9%)
 Frame = +3

Query  30   RTRAVLLRGPTTSGLYRLSQSRSPVALIIA----RATPDIWHRRLGH  158
            +T  V+  G    GLY L    S    ++     RA+ D+WH RLGH
Sbjct  390  QTGRVVATGKRDGGLYVLECGNSAFISVLKNKSLRASYDLWHARLGH  436



>emb|CAN66496.1| hypothetical protein VITISV_036886 [Vitis vinifera]
Length=1092

 Score = 38.5 bits (88),  Expect(2) = 2e-05, Method: Composition-based stats.
 Identities = 15/39 (38%), Positives = 22/39 (56%), Gaps = 0/39 (0%)
 Frame = +1

Query  241  CQFGKSSRFPLDRVYSRSNNILDLLYTDIWGPAPVVSAE  357
            CQ  KS + P      ++   L+ LY D+WGP+PV S +
Sbjct  372  CQCNKSHKLPFSSTSLKNXVXLEFLYDDVWGPSPVSSID  410


 Score = 35.8 bits (81),  Expect(2) = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 29/51 (57%), Gaps = 5/51 (10%)
 Frame = +3

Query  21   KDCRTRAVLLRGPTTSGLYRLS-QSRSP----VALIIARATPDIWHRRLGH  158
            KD  T A L+RG   +G+Y ++ QS SP    + L   R T D WH RLGH
Sbjct  293  KDRMTGAXLMRGRCENGVYPVALQSSSPQXNQIHLAGTRVTFDCWHHRLGH  343



>emb|CAC37623.1| copia-like polyprotein [Arabidopsis thaliana]
Length=1466

 Score = 37.4 bits (85),  Expect(2) = 2e-05, Method: Compositional matrix adjust.
 Identities = 17/39 (44%), Positives = 24/39 (62%), Gaps = 0/39 (0%)
 Frame = +1

Query  241  CQFGKSSRFPLDRVYSRSNNILDLLYTDIWGPAPVVSAE  357
            CQ GKS+R        R+   LD ++ D+WGP+PVVS +
Sbjct  493  CQMGKSTRLQFFSSDFRALKPLDRVHCDLWGPSPVVSNQ  531


 Score = 36.6 bits (83),  Expect(2) = 2e-05, Method: Composition-based stats.
 Identities = 22/58 (38%), Positives = 31/58 (53%), Gaps = 4/58 (7%)
 Frame = +3

Query  24   DCRTRAVLLRGPTTSGLYRLSQSRSPVALIIAR---ATPDIWHRRLGHPHERAQHHVL  188
            D  T+ V+ +GP  +GLY L  S   VAL   R   A+ + WH RLGH + +    +L
Sbjct  418  DLTTQKVVSKGPRNNGLYMLENSEF-VALYSNRQCAASMETWHHRLGHSNSKILQQLL  474



>ref|XP_010430968.1| PREDICTED: uncharacterized protein LOC104715244 [Camelina sativa]
Length=618

 Score = 37.7 bits (86),  Expect(2) = 2e-05, Method: Composition-based stats.
 Identities = 21/57 (37%), Positives = 33/57 (58%), Gaps = 4/57 (7%)
 Frame = +3

Query  24   DCRTRAVLLRGPTTSGLYRLSQSRSPVALIIAR---ATPDIWHRRLGHPHERAQHHV  185
            D +T+ V+ +GP    LY L +++  VAL   R   A+  IWH+RLGH + +   H+
Sbjct  443  DLQTQKVVTKGPRRKSLYML-ENKEFVALFSNRQCDASDMIWHQRLGHANLQVLQHL  498


 Score = 36.2 bits (82),  Expect(2) = 2e-05, Method: Compositional matrix adjust.
 Identities = 15/39 (38%), Positives = 23/39 (59%), Gaps = 0/39 (0%)
 Frame = +1

Query  241  CQFGKSSRFPLDRVYSRSNNILDLLYTDIWGPAPVVSAE  357
            CQ GKS + P       +   +D ++ D+WGP+PVVS +
Sbjct  518  CQMGKSCQLPFFSSDFSAKEPIDRIHCDLWGPSPVVSVQ  556



>emb|CAN77868.1| hypothetical protein VITISV_001383 [Vitis vinifera]
Length=662

 Score = 43.5 bits (101),  Expect(2) = 2e-05, Method: Compositional matrix adjust.
 Identities = 17/39 (44%), Positives = 26/39 (67%), Gaps = 0/39 (0%)
 Frame = +1

Query  241  CQFGKSSRFPLDRVYSRSNNILDLLYTDIWGPAPVVSAE  357
            C+ GKS   P     SR+++  DL+++D+WGP+PV S E
Sbjct  111  CKLGKSKTLPFPLHASRASHCFDLIHSDVWGPSPVSSHE  149


 Score = 30.4 bits (67),  Expect(2) = 2e-05, Method: Composition-based stats.
 Identities = 11/18 (61%), Positives = 14/18 (78%), Gaps = 0/18 (0%)
 Frame = +3

Query  135  IWHRRLGHPHERAQHHVL  188
            +WHRRLGHP+ +   HVL
Sbjct  74   VWHRRLGHPNTQILSHVL  91



>gb|AAD43604.1|AC005698_3 T3P18.3 [Arabidopsis thaliana]
Length=1309

 Score = 37.4 bits (85),  Expect(2) = 2e-05, Method: Compositional matrix adjust.
 Identities = 17/39 (44%), Positives = 24/39 (62%), Gaps = 0/39 (0%)
 Frame = +1

Query  241  CQFGKSSRFPLDRVYSRSNNILDLLYTDIWGPAPVVSAE  357
            CQ GKS+R        R+   LD ++ D+WGP+PVVS +
Sbjct  371  CQMGKSTRLQFFSSDFRALKPLDRVHCDLWGPSPVVSNQ  409


 Score = 36.6 bits (83),  Expect(2) = 2e-05, Method: Composition-based stats.
 Identities = 22/58 (38%), Positives = 31/58 (53%), Gaps = 4/58 (7%)
 Frame = +3

Query  24   DCRTRAVLLRGPTTSGLYRLSQSRSPVALIIAR---ATPDIWHRRLGHPHERAQHHVL  188
            D  T+ V+ +GP  +GLY L  S   VAL   R   A+ + WH RLGH + +    +L
Sbjct  296  DLTTQKVVSKGPRNNGLYMLENSEF-VALYSNRQCAASMETWHHRLGHSNSKILQQLL  352



>emb|CAN83290.1| hypothetical protein VITISV_018945 [Vitis vinifera]
Length=723

 Score = 43.9 bits (102),  Expect(2) = 3e-05, Method: Compositional matrix adjust.
 Identities = 17/39 (44%), Positives = 26/39 (67%), Gaps = 0/39 (0%)
 Frame = +1

Query  241  CQFGKSSRFPLDRVYSRSNNILDLLYTDIWGPAPVVSAE  357
            C+ GKS   P     SR+++  DL+++D+WGP+PV S E
Sbjct  411  CKLGKSKTLPFPLHASRASHCFDLIHSDVWGPSPVSSHE  449


 Score = 30.0 bits (66),  Expect(2) = 3e-05, Method: Compositional matrix adjust.
 Identities = 19/55 (35%), Positives = 27/55 (49%), Gaps = 9/55 (16%)
 Frame = +3

Query  51   RGPTTSGLYRLS---QSRSPVALIIARATPDI------WHRRLGHPHERAQHHVL  188
            +GP    L+ L       SP++ I + A   +      WHRRLGHP+ +   HVL
Sbjct  337  KGPKVGXLFPLFLPIPDFSPLSSIKSFACNSVSDLSMXWHRRLGHPNTQFLSHVL  391



>ref|XP_008342970.1| PREDICTED: uncharacterized protein LOC103405720 [Malus domestica]
Length=887

 Score = 45.1 bits (105),  Expect(2) = 3e-05, Method: Composition-based stats.
 Identities = 28/64 (44%), Positives = 33/64 (52%), Gaps = 8/64 (13%)
 Frame = +3

Query  21   KDCRTRAVLLRGPTTSGLYRLS---QSRSPV-----ALIIARATPDIWHRRLGHPHERAQ  176
            KD  T  +LLRGP T G Y L     S SP      AL+  +A+ +IWH RLGHP     
Sbjct  380  KDRSTGKMLLRGPXTXGFYLLQGTPXSFSPTXLSSHALVCTKASVNIWHSRLGHPSSSII  439

Query  177  HHVL  188
              VL
Sbjct  440  KKVL  443


 Score = 28.9 bits (63),  Expect(2) = 3e-05, Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 21/37 (57%), Gaps = 0/37 (0%)
 Frame = +1

Query  241  CQFGKSSRFPLDRVYSRSNNILDLLYTDIWGPAPVVS  351
            C   K+ + P  +  S S   L LL+ D+WGP PVVS
Sbjct  463  CAIAKTHKLPFPQSSSFSTTSLSLLHCDVWGPXPVVS  499



>emb|CAN71267.1| hypothetical protein VITISV_017889 [Vitis vinifera]
Length=1576

 Score = 43.5 bits (101),  Expect(2) = 3e-05, Method: Compositional matrix adjust.
 Identities = 17/39 (44%), Positives = 26/39 (67%), Gaps = 0/39 (0%)
 Frame = +1

Query  241  CQFGKSSRFPLDRVYSRSNNILDLLYTDIWGPAPVVSAE  357
            C+ GKS   P     SR+++  DL+++D+WGP+PV S E
Sbjct  673  CKLGKSKTLPFPLHASRASHCFDLIHSDVWGPSPVSSHE  711


 Score = 30.0 bits (66),  Expect(2) = 3e-05, Method: Compositional matrix adjust.
 Identities = 11/18 (61%), Positives = 14/18 (78%), Gaps = 0/18 (0%)
 Frame = +3

Query  135  IWHRRLGHPHERAQHHVL  188
            +WHRRLGHP+ +   HVL
Sbjct  636  VWHRRLGHPNTQILSHVL  653



>gb|AAT39281.2| Integrase core domain containing protein [Solanum demissum]
Length=1760

 Score = 37.7 bits (86),  Expect(2) = 3e-05, Method: Compositional matrix adjust.
 Identities = 26/65 (40%), Positives = 39/65 (60%), Gaps = 4/65 (6%)
 Frame = +1

Query  169  VLNIMF--FSCPVTPsrsssaklcssCQFGKSSRFPLDRVYSRSNNILDLLYTDIWGPAP  342
             LN++F  FS PV+   S +A +C+SC   K  R P      +S   L ++YTD+WGP+P
Sbjct  453  TLNMIFHQFSLPVS--HSRTASICNSCYSNKMHRLPFSENSLQSQRPLQIIYTDLWGPSP  510

Query  343  VVSAE  357
            V+S +
Sbjct  511  VLSID  515


 Score = 36.2 bits (82),  Expect(2) = 3e-05, Method: Composition-based stats.
 Identities = 21/53 (40%), Positives = 26/53 (49%), Gaps = 5/53 (9%)
 Frame = +3

Query  21   KDCRTRAVLLRGPTTSGLYRL---SQSRSPVALIIARATPDIWHRRLGHPHER  170
            KD  T A L RG    GLY     S   +P   ++      +WHRRLGHP+ R
Sbjct  402  KDLSTGAPLFRGQNRDGLYEWPLGSAHHTPQCNVVVPL--HLWHRRLGHPNHR  452



>emb|CAN74794.1| hypothetical protein VITISV_041689 [Vitis vinifera]
Length=845

 Score = 43.9 bits (102),  Expect(2) = 3e-05, Method: Compositional matrix adjust.
 Identities = 17/39 (44%), Positives = 26/39 (67%), Gaps = 0/39 (0%)
 Frame = +1

Query  241  CQFGKSSRFPLDRVYSRSNNILDLLYTDIWGPAPVVSAE  357
            C+ GKS   P     SR+++  DL+++D+WGP+PV S E
Sbjct  508  CKLGKSKTLPFPLHASRASHCFDLIHSDVWGPSPVSSHE  546


 Score = 30.0 bits (66),  Expect(2) = 3e-05, Method: Compositional matrix adjust.
 Identities = 11/18 (61%), Positives = 14/18 (78%), Gaps = 0/18 (0%)
 Frame = +3

Query  135  IWHRRLGHPHERAQHHVL  188
            +WHRRLGHP+ +   HVL
Sbjct  471  VWHRRLGHPNTQILSHVL  488



>ref|XP_007014689.1| Uncharacterized protein TCM_040047 [Theobroma cacao]
 gb|EOY32308.1| Uncharacterized protein TCM_040047 [Theobroma cacao]
Length=678

 Score = 39.7 bits (91),  Expect(2) = 3e-05, Method: Composition-based stats.
 Identities = 20/52 (38%), Positives = 29/52 (56%), Gaps = 5/52 (10%)
 Frame = +3

Query  21   KDCRTRAVLLRGPTTSGLYRLSQSRSPVALIIA-----RATPDIWHRRLGHP  161
            KD    A L+R    +GLY L +  S +++I       + + D+WHRRLGHP
Sbjct  134  KDSSMGAPLVRSLNRNGLYELPRCMSHLSMITTTFLSVKTSFDVWHRRLGHP  185


 Score = 33.9 bits (76),  Expect(2) = 3e-05, Method: Composition-based stats.
 Identities = 15/39 (38%), Positives = 20/39 (51%), Gaps = 0/39 (0%)
 Frame = +1

Query  241  CQFGKSSRFPLDRVYSRSNNILDLLYTDIWGPAPVVSAE  357
            C   +S + P  +    S   L LLYTD+WGPA +   E
Sbjct  213  CACNESHKLPFGQSTLSSTKHLQLLYTDVWGPAQISFVE  251



>gb|AAC61290.1| putative retroelement pol polyprotein [Arabidopsis thaliana]
Length=1149

 Score = 37.7 bits (86),  Expect(2) = 3e-05, Method: Composition-based stats.
 Identities = 21/51 (41%), Positives = 31/51 (61%), Gaps = 3/51 (6%)
 Frame = +3

Query  21   KDCRTRAVLLRGPTTS-GLYRLSQSRSPV--ALIIARATPDIWHRRLGHPH  164
            KD  T  VL +G +TS GLY+L   +  +  +    +AT ++WH RLGHP+
Sbjct  407  KDKATCKVLTKGSSTSEGLYKLENPKFQMFYSTRQVKATDEVWHMRLGHPN  457


 Score = 35.8 bits (81),  Expect(2) = 3e-05, Method: Compositional matrix adjust.
 Identities = 19/42 (45%), Positives = 26/42 (62%), Gaps = 6/42 (14%)
 Frame = +1

Query  241  CQFGKSSRFPL---DRVYSRSNNILDLLYTDIWGPAPVVSAE  357
            C+ GKSSR P    D + SR    L+ ++ D+WGPAPV S +
Sbjct  483  CRLGKSSRLPFIASDFIASRP---LERVHCDLWGPAPVSSIQ  521



>gb|AAR88589.1| putative copia-like retrotransposon protein [Oryza sativa Japonica 
Group]
Length=1399

 Score = 41.6 bits (96),  Expect(2) = 4e-05, Method: Composition-based stats.
 Identities = 15/35 (43%), Positives = 25/35 (71%), Gaps = 0/35 (0%)
 Frame = +1

Query  241  CQFGKSSRFPLDRVYSRSNNILDLLYTDIWGPAPV  345
            CQ GKS + P  +  S S+  L+L+++++WGPAP+
Sbjct  456  CQKGKSHQLPYPKSSSVSSQPLELIFSNVWGPAPI  490


 Score = 31.6 bits (70),  Expect(2) = 4e-05, Method: Compositional matrix adjust.
 Identities = 21/49 (43%), Positives = 24/49 (49%), Gaps = 4/49 (8%)
 Frame = +3

Query  21   KDCRTRAVLLRGPTTSGLYRLSQSRSPVALIIARATPDI--WHRRLGHP  161
            KD  TR  +L+G     LY L  S  P   + A  TP    WH RLGHP
Sbjct  381  KDRATRNTILKGRCRRRLYSLPTS--PAKQVHAATTPSFSRWHSRLGHP  427



>emb|CAN67970.1| hypothetical protein VITISV_025093 [Vitis vinifera]
Length=1023

 Score = 43.1 bits (100),  Expect(2) = 4e-05, Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 26/39 (67%), Gaps = 0/39 (0%)
 Frame = +1

Query  241  CQFGKSSRFPLDRVYSRSNNILDLLYTDIWGPAPVVSAE  357
            C+ GKS   P     SR+++  DL+++D+WGP+P+ S E
Sbjct  427  CKLGKSKTLPFPLHASRASHCFDLIHSDVWGPSPISSHE  465


 Score = 30.0 bits (66),  Expect(2) = 4e-05, Method: Compositional matrix adjust.
 Identities = 11/18 (61%), Positives = 14/18 (78%), Gaps = 0/18 (0%)
 Frame = +3

Query  135  IWHRRLGHPHERAQHHVL  188
            +WHRRLGHP+ +   HVL
Sbjct  390  VWHRRLGHPNTQILSHVL  407



>emb|CAN66898.1| hypothetical protein VITISV_037436 [Vitis vinifera]
Length=1183

 Score = 42.0 bits (97),  Expect(2) = 5e-05, Method: Composition-based stats.
 Identities = 20/49 (41%), Positives = 26/49 (53%), Gaps = 0/49 (0%)
 Frame = +3

Query  42   VLLRGPTTSGLYRLSQSRSPVALIIARATPDIWHRRLGHPHERAQHHVL  188
            VL RG  T  LY  S  R  +A+  A    ++WHRRLGH  E+    +L
Sbjct  346  VLARGKKTGTLYMTSCPRDTIAVADASTDTNLWHRRLGHMSEKGMKMLL  394


 Score = 31.2 bits (69),  Expect(2) = 5e-05, Method: Composition-based stats.
 Identities = 10/16 (63%), Positives = 15/16 (94%), Gaps = 0/16 (0%)
 Frame = +1

Query  304  LDLLYTDIWGPAPVVS  351
            L+L++TD+WGP+PV S
Sbjct  435  LELVHTDLWGPSPVAS  450



>emb|CAN80650.1| hypothetical protein VITISV_022906 [Vitis vinifera]
Length=1091

 Score = 41.6 bits (96),  Expect(2) = 6e-05, Method: Composition-based stats.
 Identities = 21/49 (43%), Positives = 25/49 (51%), Gaps = 0/49 (0%)
 Frame = +3

Query  42   VLLRGPTTSGLYRLSQSRSPVALIIARATPDIWHRRLGHPHERAQHHVL  188
            VL RG  T  LY  S  R  +A+  A     IWHRRLGH  E+    +L
Sbjct  279  VLARGKKTGTLYMTSCPRDTIAVADASIDTSIWHRRLGHMSEKGMKMLL  327


 Score = 31.2 bits (69),  Expect(2) = 6e-05, Method: Composition-based stats.
 Identities = 10/16 (63%), Positives = 15/16 (94%), Gaps = 0/16 (0%)
 Frame = +1

Query  304  LDLLYTDIWGPAPVVS  351
            L+L++TD+WGP+PV S
Sbjct  368  LELVHTDLWGPSPVAS  383



>emb|CAN68388.1| hypothetical protein VITISV_038864 [Vitis vinifera]
Length=1172

 Score = 41.6 bits (96),  Expect(2) = 6e-05, Method: Composition-based stats.
 Identities = 20/49 (41%), Positives = 25/49 (51%), Gaps = 0/49 (0%)
 Frame = +3

Query  42   VLLRGPTTSGLYRLSQSRSPVALIIARATPDIWHRRLGHPHERAQHHVL  188
            VL RG  T  LY  S  R  +A+  A     +WHRRLGH  E+    +L
Sbjct  315  VLARGKKTGTLYMTSCPRDTIAVADASTNTSLWHRRLGHMSEKGMKMLL  363


 Score = 31.2 bits (69),  Expect(2) = 6e-05, Method: Composition-based stats.
 Identities = 10/16 (63%), Positives = 15/16 (94%), Gaps = 0/16 (0%)
 Frame = +1

Query  304  LDLLYTDIWGPAPVVS  351
            L+L++TD+WGP+PV S
Sbjct  404  LELVHTDLWGPSPVAS  419



>emb|CAN79492.1| hypothetical protein VITISV_033373 [Vitis vinifera]
Length=2116

 Score = 42.4 bits (98),  Expect(2) = 6e-05, Method: Composition-based stats.
 Identities = 16/39 (41%), Positives = 25/39 (64%), Gaps = 0/39 (0%)
 Frame = +1

Query  241   CQFGKSSRFPLDRVYSRSNNILDLLYTDIWGPAPVVSAE  357
             C+ GKS   P     SR+++  DL+++D WGP+P+ S E
Sbjct  1293  CKLGKSKTLPFPLHASRASHCFDLIHSDFWGPSPISSYE  1331


 Score = 30.0 bits (66),  Expect(2) = 6e-05, Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 30/57 (53%), Gaps = 9/57 (16%)
 Frame = +3

Query  45    LLRGPTTSGLYRLS---QSRSPVALIIARATPDI------WHRRLGHPHERAQHHVL  188
             + +GP    L+ L     + SP++ I + A  ++      WHRRLGHP+ +   HVL
Sbjct  1217  IAKGPKVGRLFPLFLPVPNFSPLSSIKSFACNNVSDLSMVWHRRLGHPNTQILSHVL  1273



>gb|AEJ72555.1| putative retroelement polyprotein [Malus domestica]
Length=1249

 Score = 43.9 bits (102),  Expect(2) = 6e-05, Method: Composition-based stats.
 Identities = 15/37 (41%), Positives = 25/37 (68%), Gaps = 0/37 (0%)
 Frame = +1

Query  241  CQFGKSSRFPLDRVYSRSNNILDLLYTDIWGPAPVVS  351
            C F K +R P D   ++S    +++++D+WGPAP+VS
Sbjct  473  CHFSKQTRLPFDVSSTKSCKPFEIVHSDVWGPAPLVS  509


 Score = 28.9 bits (63),  Expect(2) = 6e-05, Method: Composition-based stats.
 Identities = 10/21 (48%), Positives = 12/21 (57%), Gaps = 0/21 (0%)
 Frame = +3

Query  135  IWHRRLGHPHERAQHHVLLVS  197
            +WHRRL HP    Q H+   S
Sbjct  442  LWHRRLRHPSNLVQSHLFKTS  462



>ref|XP_008387250.1| PREDICTED: uncharacterized protein LOC103449699 [Malus domestica]
Length=1313

 Score = 37.0 bits (84),  Expect(2) = 6e-05, Method: Composition-based stats.
 Identities = 23/60 (38%), Positives = 31/60 (52%), Gaps = 13/60 (22%)
 Frame = +3

Query  21   KDCRTRAVLLRGPTTSGLY------RLS-------QSRSPVALIIARATPDIWHRRLGHP  161
            +D  T  +L +G  ++GLY      RLS       Q+  PVAL+    T  +WH RLGHP
Sbjct  552  QDKTTGRILYKGXCSNGLYPIPSFPRLSSGSSSHLQAHPPVALLGHXVTSTLWHCRLGHP  611


 Score = 35.8 bits (81),  Expect(2) = 6e-05, Method: Compositional matrix adjust.
 Identities = 22/72 (31%), Positives = 36/72 (50%), Gaps = 9/72 (13%)
 Frame = +1

Query  142  IVGLVIRMSVLNIMFFSCPVTPsrsssaklcssCQFGKSSRFPLDRVYSRSNNILDLLYT  321
            IV L++R S + +     P           C SC  GK S+ P     ++S    +++++
Sbjct  615  IVSLILRKSKVAVKTDVSPTV---------CQSCLEGKFSKLPFSHTSTKSVIPFEIVHS  665

Query  322  DIWGPAPVVSAE  357
            D+WGPAP VS +
Sbjct  666  DLWGPAPSVSXD  677



>emb|CAN75855.1| hypothetical protein VITISV_025389 [Vitis vinifera]
Length=1230

 Score = 39.7 bits (91),  Expect(2) = 7e-05, Method: Composition-based stats.
 Identities = 20/49 (41%), Positives = 25/49 (51%), Gaps = 0/49 (0%)
 Frame = +3

Query  42   VLLRGPTTSGLYRLSQSRSPVALIIARATPDIWHRRLGHPHERAQHHVL  188
            VL RG  T  LY  S  R  +A+  A     +WHRRLGH  E+    +L
Sbjct  433  VLARGKKTGTLYMTSCPRDTIAVADASTDTILWHRRLGHMSEKGMKMLL  481


 Score = 32.7 bits (73),  Expect(2) = 7e-05, Method: Composition-based stats.
 Identities = 11/16 (69%), Positives = 16/16 (100%), Gaps = 0/16 (0%)
 Frame = +1

Query  304  LDLLYTDIWGPAPVVS  351
            L+L++TD+WGP+PVVS
Sbjct  511  LELVHTDLWGPSPVVS  526



>emb|CAN60145.1| hypothetical protein VITISV_019412 [Vitis vinifera]
Length=1227

 Score = 41.2 bits (95),  Expect(2) = 8e-05, Method: Composition-based stats.
 Identities = 20/50 (40%), Positives = 25/50 (50%), Gaps = 0/50 (0%)
 Frame = +3

Query  42   VLLRGPTTSGLYRLSQSRSPVALIIARATPDIWHRRLGHPHERAQHHVLL  191
            VL RG  T  LY  S  R  +A+  A     +WHRRLGH  E+    +L 
Sbjct  365  VLARGKKTGTLYMTSCPRDTIAVADASTDTSLWHRRLGHISEKGMKMLLF  414


 Score = 31.2 bits (69),  Expect(2) = 8e-05, Method: Composition-based stats.
 Identities = 10/16 (63%), Positives = 15/16 (94%), Gaps = 0/16 (0%)
 Frame = +1

Query  304  LDLLYTDIWGPAPVVS  351
            L+L++TD+WGP+PV S
Sbjct  440  LELVHTDLWGPSPVAS  455



>emb|CAN69340.1| hypothetical protein VITISV_032634 [Vitis vinifera]
Length=1298

 Score = 41.2 bits (95),  Expect(2) = 8e-05, Method: Composition-based stats.
 Identities = 20/49 (41%), Positives = 25/49 (51%), Gaps = 0/49 (0%)
 Frame = +3

Query  42   VLLRGPTTSGLYRLSQSRSPVALIIARATPDIWHRRLGHPHERAQHHVL  188
            VL RG  T  LY  S  R  +A+  A     +WHRRLGH  E+    +L
Sbjct  383  VLARGKKTGTLYMTSCPRDTIAVADASTDTSLWHRRLGHMSEKGMKMLL  431


 Score = 31.2 bits (69),  Expect(2) = 8e-05, Method: Composition-based stats.
 Identities = 10/16 (63%), Positives = 15/16 (94%), Gaps = 0/16 (0%)
 Frame = +1

Query  304  LDLLYTDIWGPAPVVS  351
            L+L++TD+WGP+PV S
Sbjct  472  LELVHTDLWGPSPVAS  487



>emb|CAN74341.1| hypothetical protein VITISV_043997 [Vitis vinifera]
Length=1269

 Score = 41.2 bits (95),  Expect(2) = 8e-05, Method: Composition-based stats.
 Identities = 20/49 (41%), Positives = 25/49 (51%), Gaps = 0/49 (0%)
 Frame = +3

Query  42   VLLRGPTTSGLYRLSQSRSPVALIIARATPDIWHRRLGHPHERAQHHVL  188
            VL RG  T  LY  S  R  +A+  A     +WHRRLGH  E+    +L
Sbjct  383  VLARGKKTGTLYMTSCPRDTIAVADASTDTSLWHRRLGHMSEKGMKMLL  431


 Score = 31.2 bits (69),  Expect(2) = 8e-05, Method: Composition-based stats.
 Identities = 10/16 (63%), Positives = 15/16 (94%), Gaps = 0/16 (0%)
 Frame = +1

Query  304  LDLLYTDIWGPAPVVS  351
            L+L++TD+WGP+PV S
Sbjct  472  LELVHTDLWGPSPVAS  487



>emb|CAN62181.1| hypothetical protein VITISV_044399 [Vitis vinifera]
Length=1264

 Score = 41.2 bits (95),  Expect(2) = 8e-05, Method: Composition-based stats.
 Identities = 20/49 (41%), Positives = 25/49 (51%), Gaps = 0/49 (0%)
 Frame = +3

Query  42   VLLRGPTTSGLYRLSQSRSPVALIIARATPDIWHRRLGHPHERAQHHVL  188
            VL RG  T  LY  S  R  +A+  A     +WHRRLGH  E+    +L
Sbjct  383  VLARGKKTGTLYMTSCPRDTIAVADASTDTSLWHRRLGHMSEKGMKMLL  431


 Score = 31.2 bits (69),  Expect(2) = 8e-05, Method: Composition-based stats.
 Identities = 10/16 (63%), Positives = 15/16 (94%), Gaps = 0/16 (0%)
 Frame = +1

Query  304  LDLLYTDIWGPAPVVS  351
            L+L++TD+WGP+PV S
Sbjct  472  LELVHTDLWGPSPVAS  487



>emb|CAN74624.1| hypothetical protein VITISV_024822 [Vitis vinifera]
Length=1250

 Score = 41.2 bits (95),  Expect(2) = 8e-05, Method: Composition-based stats.
 Identities = 20/49 (41%), Positives = 25/49 (51%), Gaps = 0/49 (0%)
 Frame = +3

Query  42   VLLRGPTTSGLYRLSQSRSPVALIIARATPDIWHRRLGHPHERAQHHVL  188
            VL RG  T  LY  S  R  +A+  A     +WHRRLGH  E+    +L
Sbjct  383  VLARGKKTGTLYMTSCPRDTIAVADASTDTSLWHRRLGHMSEKGMKMLL  431


 Score = 31.2 bits (69),  Expect(2) = 8e-05, Method: Composition-based stats.
 Identities = 10/16 (63%), Positives = 15/16 (94%), Gaps = 0/16 (0%)
 Frame = +1

Query  304  LDLLYTDIWGPAPVVS  351
            L+L++TD+WGP+PV S
Sbjct  472  LELVHTDLWGPSPVAS  487



>emb|CAN71109.1| hypothetical protein VITISV_001479 [Vitis vinifera]
Length=1246

 Score = 41.2 bits (95),  Expect(2) = 8e-05, Method: Composition-based stats.
 Identities = 20/49 (41%), Positives = 25/49 (51%), Gaps = 0/49 (0%)
 Frame = +3

Query  42   VLLRGPTTSGLYRLSQSRSPVALIIARATPDIWHRRLGHPHERAQHHVL  188
            VL RG  T  LY  S  R  +A+  A     +WHRRLGH  E+    +L
Sbjct  355  VLARGKKTGTLYMTSCPRDTIAVADASTDTSLWHRRLGHMSEKGMKMLL  403


 Score = 31.2 bits (69),  Expect(2) = 8e-05, Method: Composition-based stats.
 Identities = 10/16 (63%), Positives = 15/16 (94%), Gaps = 0/16 (0%)
 Frame = +1

Query  304  LDLLYTDIWGPAPVVS  351
            L+L++TD+WGP+PV S
Sbjct  444  LELVHTDLWGPSPVAS  459



>emb|CAN73240.1| hypothetical protein VITISV_035336 [Vitis vinifera]
Length=1244

 Score = 41.2 bits (95),  Expect(2) = 8e-05, Method: Composition-based stats.
 Identities = 20/49 (41%), Positives = 25/49 (51%), Gaps = 0/49 (0%)
 Frame = +3

Query  42   VLLRGPTTSGLYRLSQSRSPVALIIARATPDIWHRRLGHPHERAQHHVL  188
            VL RG  T  LY  S  R  +A+  A     +WHRRLGH  E+    +L
Sbjct  383  VLARGKKTGTLYMTSCPRDTIAVADASTDTSLWHRRLGHMSEKGMKMLL  431


 Score = 31.2 bits (69),  Expect(2) = 8e-05, Method: Composition-based stats.
 Identities = 10/16 (63%), Positives = 15/16 (94%), Gaps = 0/16 (0%)
 Frame = +1

Query  304  LDLLYTDIWGPAPVVS  351
            L+L++TD+WGP+PV S
Sbjct  472  LELVHTDLWGPSPVAS  487



>emb|CAN81130.1| hypothetical protein VITISV_003944 [Vitis vinifera]
Length=1236

 Score = 41.2 bits (95),  Expect(2) = 8e-05, Method: Composition-based stats.
 Identities = 20/49 (41%), Positives = 25/49 (51%), Gaps = 0/49 (0%)
 Frame = +3

Query  42   VLLRGPTTSGLYRLSQSRSPVALIIARATPDIWHRRLGHPHERAQHHVL  188
            VL RG  T  LY  S  R  +A+  A     +WHRRLGH  E+    +L
Sbjct  383  VLARGKKTGTLYMTSCPRDTIAVADASTDTSLWHRRLGHMSEKGMKMLL  431


 Score = 31.2 bits (69),  Expect(2) = 8e-05, Method: Composition-based stats.
 Identities = 10/16 (63%), Positives = 15/16 (94%), Gaps = 0/16 (0%)
 Frame = +1

Query  304  LDLLYTDIWGPAPVVS  351
            L+L++TD+WGP+PV S
Sbjct  472  LELVHTDLWGPSPVAS  487



>emb|CAN65728.1| hypothetical protein VITISV_015033 [Vitis vinifera]
Length=841

 Score = 41.2 bits (95),  Expect(2) = 8e-05, Method: Composition-based stats.
 Identities = 20/49 (41%), Positives = 25/49 (51%), Gaps = 0/49 (0%)
 Frame = +3

Query  42   VLLRGPTTSGLYRLSQSRSPVALIIARATPDIWHRRLGHPHERAQHHVL  188
            VL RG  T  LY  S  R  +A+  A     +WHRRLGH  E+    +L
Sbjct  346  VLARGKKTGTLYMTSCPRDTIAVADASTDTSLWHRRLGHMSEKGMKMLL  394


 Score = 31.2 bits (69),  Expect(2) = 8e-05, Method: Composition-based stats.
 Identities = 10/16 (63%), Positives = 15/16 (94%), Gaps = 0/16 (0%)
 Frame = +1

Query  304  LDLLYTDIWGPAPVVS  351
            L+L++TD+WGP+PV S
Sbjct  435  LELVHTDLWGPSPVAS  450



>emb|CAN61435.1| hypothetical protein VITISV_033767 [Vitis vinifera]
Length=1298

 Score = 41.2 bits (95),  Expect(2) = 8e-05, Method: Composition-based stats.
 Identities = 20/49 (41%), Positives = 25/49 (51%), Gaps = 0/49 (0%)
 Frame = +3

Query  42   VLLRGPTTSGLYRLSQSRSPVALIIARATPDIWHRRLGHPHERAQHHVL  188
            VL RG  T  LY  S  R  +A+  A     +WHRRLGH  E+    +L
Sbjct  383  VLARGKKTXTLYMTSCPRDTIAVADASTDTSLWHRRLGHMSEKGMKMLL  431


 Score = 31.2 bits (69),  Expect(2) = 8e-05, Method: Composition-based stats.
 Identities = 10/16 (63%), Positives = 15/16 (94%), Gaps = 0/16 (0%)
 Frame = +1

Query  304  LDLLYTDIWGPAPVVS  351
            L+L++TD+WGP+PV S
Sbjct  472  LELVHTDLWGPSPVAS  487



>ref|XP_008367623.1| PREDICTED: uncharacterized protein LOC103431265 [Malus domestica]
Length=1110

 Score = 36.6 bits (83),  Expect(2) = 8e-05, Method: Compositional matrix adjust.
 Identities = 19/60 (32%), Positives = 27/60 (45%), Gaps = 5/60 (8%)
 Frame = +3

Query  21   KDCRTRAVLLRGPTTSGLYRLSQSRSPVA-----LIIARATPDIWHRRLGHPHERAQHHV  185
            KD  +     +GP   G Y    S S           A+A+ D+WH+RLGHP  +  H +
Sbjct  660  KDLSSGRXRFKGPVQQGFYPFHFSSSATGNHKALTATAKASTDVWHQRLGHPSVKILHKL  719


 Score = 35.8 bits (81),  Expect(2) = 8e-05, Method: Composition-based stats.
 Identities = 14/39 (36%), Positives = 24/39 (62%), Gaps = 0/39 (0%)
 Frame = +1

Query  241  CQFGKSSRFPLDRVYSRSNNILDLLYTDIWGPAPVVSAE  357
            C   KSS+ P       ++  L+L++TD+WGP+P  S++
Sbjct  739  CALAKSSKLPFVFSSCTTSKPLELVHTDVWGPSPQXSSQ  777



>ref|XP_008344799.1| PREDICTED: uncharacterized protein LOC103407689 [Malus domestica]
Length=1107

 Score = 43.5 bits (101),  Expect(2) = 9e-05, Method: Compositional matrix adjust.
 Identities = 18/39 (46%), Positives = 26/39 (67%), Gaps = 0/39 (0%)
 Frame = +1

Query  241  CQFGKSSRFPLDRVYSRSNNILDLLYTDIWGPAPVVSAE  357
            C  GK SRFP     +RS+ + + +++D+WGPAPV S E
Sbjct  601  CIHGKLSRFPFPVKQTRSHVVFEKIHSDVWGPAPVKSVE  639


 Score = 28.9 bits (63),  Expect(2) = 9e-05, Method: Composition-based stats.
 Identities = 20/70 (29%), Positives = 32/70 (46%), Gaps = 11/70 (16%)
 Frame = +3

Query  21   KDCRTRAVLLRGPT---------TSGLYRLSQSR--SPVALIIARATPDIWHRRLGHPHE  167
            +D  TR VL  G +          +   RLS ++    +A +  +    IWH+ LG P E
Sbjct  516  QDKATRRVLYXGKSDDXELFQIXVNXFSRLSAAQLGRSIAFVGKKIKSSIWHKXLGXPSE  575

Query  168  RAQHHVLLVS  197
               H++L V+
Sbjct  576  EILHNMLNVA  585



>emb|CAN61548.1| hypothetical protein VITISV_043524 [Vitis vinifera]
Length=1535

 Score = 40.8 bits (94),  Expect(2) = 1e-04, Method: Composition-based stats.
 Identities = 20/49 (41%), Positives = 25/49 (51%), Gaps = 0/49 (0%)
 Frame = +3

Query  42   VLLRGPTTSGLYRLSQSRSPVALIIARATPDIWHRRLGHPHERAQHHVL  188
            VL RG  T  LY  S  R  +A+  A     +WHRRLGH  E+    +L
Sbjct  650  VLARGKKTGTLYMTSCPRDTIAVADASTDTSLWHRRLGHMSEKGMKMLL  698


 Score = 31.2 bits (69),  Expect(2) = 1e-04, Method: Composition-based stats.
 Identities = 10/16 (63%), Positives = 15/16 (94%), Gaps = 0/16 (0%)
 Frame = +1

Query  304  LDLLYTDIWGPAPVVS  351
            L+L++TD+WGP+PV S
Sbjct  739  LELVHTDLWGPSPVAS  754



>emb|CAN65867.1| hypothetical protein VITISV_034935 [Vitis vinifera]
Length=1137

 Score = 40.8 bits (94),  Expect(2) = 1e-04, Method: Composition-based stats.
 Identities = 20/49 (41%), Positives = 25/49 (51%), Gaps = 0/49 (0%)
 Frame = +3

Query  42   VLLRGPTTSGLYRLSQSRSPVALIIARATPDIWHRRLGHPHERAQHHVL  188
            VL RG  T  LY  S  R  +A+  A     +WHRRLGH  E+    +L
Sbjct  337  VLARGKKTGTLYMTSCPRDTIAVADASTDTSLWHRRLGHMSEKGMKMLL  385


 Score = 31.2 bits (69),  Expect(2) = 1e-04, Method: Composition-based stats.
 Identities = 10/16 (63%), Positives = 15/16 (94%), Gaps = 0/16 (0%)
 Frame = +1

Query  304  LDLLYTDIWGPAPVVS  351
            L+L++TD+WGP+PV S
Sbjct  426  LELVHTDLWGPSPVAS  441



>emb|CAN67605.1| hypothetical protein VITISV_030993 [Vitis vinifera]
Length=1290

 Score = 40.0 bits (92),  Expect(2) = 1e-04, Method: Composition-based stats.
 Identities = 19/49 (39%), Positives = 26/49 (53%), Gaps = 0/49 (0%)
 Frame = +3

Query  42   VLLRGPTTSGLYRLSQSRSPVALIIARATPDIWHRRLGHPHERAQHHVL  188
            VL RG  T  LY  S  R+ +A+  A     +WHRRLGH  ++    +L
Sbjct  154  VLARGKKTDTLYMTSCPRNTIAVADASTDTSLWHRRLGHMSDKGMKMLL  202


 Score = 31.6 bits (70),  Expect(2) = 1e-04, Method: Composition-based stats.
 Identities = 15/35 (43%), Positives = 21/35 (60%), Gaps = 7/35 (20%)
 Frame = +1

Query  247  FGKSSRFPLDRVYSRSNNILDLLYTDIWGPAPVVS  351
            F K+SR P           L+L++TD+WGP+PV S
Sbjct  231  FLKTSRTP-------KAEKLELVHTDLWGPSPVTS  258



>emb|CAN78464.1| hypothetical protein VITISV_025101 [Vitis vinifera]
Length=997

 Score = 41.2 bits (95),  Expect(2) = 1e-04, Method: Composition-based stats.
 Identities = 20/49 (41%), Positives = 25/49 (51%), Gaps = 0/49 (0%)
 Frame = +3

Query  42   VLLRGPTTSGLYRLSQSRSPVALIIARATPDIWHRRLGHPHERAQHHVL  188
            VL RG  T  LY  S  R  +A+  A     +WHRRLGH  E+    +L
Sbjct  260  VLARGKKTGTLYMTSCPRDTIAVADASTDTSLWHRRLGHMSEKGMKMLL  308


 Score = 30.4 bits (67),  Expect(2) = 1e-04, Method: Composition-based stats.
 Identities = 10/16 (63%), Positives = 15/16 (94%), Gaps = 0/16 (0%)
 Frame = +1

Query  304  LDLLYTDIWGPAPVVS  351
            L+L++TD+WGP+PV S
Sbjct  349  LELVHTDLWGPSPVSS  364



>emb|CAN60331.1| hypothetical protein VITISV_024553 [Vitis vinifera]
Length=1134

 Score = 40.4 bits (93),  Expect(2) = 1e-04, Method: Composition-based stats.
 Identities = 20/49 (41%), Positives = 25/49 (51%), Gaps = 0/49 (0%)
 Frame = +3

Query  42   VLLRGPTTSGLYRLSQSRSPVALIIARATPDIWHRRLGHPHERAQHHVL  188
            VL RG  T  LY  S  R  +A+  A     +WHRRLGH  E+    +L
Sbjct  329  VLARGKKTGTLYMTSCPRDIIAVADASTDTSLWHRRLGHMSEKGMKMLL  377


 Score = 31.2 bits (69),  Expect(2) = 1e-04, Method: Composition-based stats.
 Identities = 10/15 (67%), Positives = 15/15 (100%), Gaps = 0/15 (0%)
 Frame = +1

Query  304  LDLLYTDIWGPAPVV  348
            L+L++TD+WGP+PVV
Sbjct  418  LELVHTDLWGPSPVV  432



>ref|XP_008342448.1| PREDICTED: uncharacterized protein LOC103405249 [Malus domestica]
Length=1097

 Score = 38.1 bits (87),  Expect(2) = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 30/67 (45%), Gaps = 8/67 (12%)
 Frame = +3

Query  24   DCRTRAVLLRGPTTSGLYRLSQSRSPVA-------LIIARATP-DIWHRRLGHPHERAQH  179
            D  T  +L +G   +GLY +  S SP A         + +  P  IWH+RLGHP      
Sbjct  378  DKXTGXILYKGLCNNGLYPIISSTSPAASFXGHPAAFLGKQVPHSIWHKRLGHPSNSIVS  437

Query  180  HVLLVSG  200
             VL  S 
Sbjct  438  QVLTSSN  444


 Score = 33.1 bits (74),  Expect(2) = 1e-04, Method: Composition-based stats.
 Identities = 12/31 (39%), Positives = 19/31 (61%), Gaps = 0/31 (0%)
 Frame = +1

Query  250  GKSSRFPLDRVYSRSNNILDLLYTDIWGPAP  342
            GK S+ P      +S    D++++D+WGPAP
Sbjct  462  GKFSKLPFSSSLVKSVKPFDIVHSDVWGPAP  492



>emb|CBI36090.3| unnamed protein product [Vitis vinifera]
Length=1273

 Score = 40.4 bits (93),  Expect(2) = 1e-04, Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 25/37 (68%), Gaps = 0/37 (0%)
 Frame = +1

Query  241   CQFGKSSRFPLDRVYSRSNNILDLLYTDIWGPAPVVS  351
             CQ  K+ R P  R   RS+++LDL++ D+ GP+P+ S
Sbjct  1042  CQLAKNHRLPYSRNEHRSSHVLDLIHCDLPGPSPIKS  1078


 Score = 31.2 bits (69),  Expect(2) = 1e-04, Method: Composition-based stats.
 Identities = 17/47 (36%), Positives = 24/47 (51%), Gaps = 4/47 (9%)
 Frame = +3

Query  30    RTRAVLLRGPTTSGLYRLSQSRSPVALIIA----RATPDIWHRRLGH  158
             +T  V+  G    GLY L +  S    ++     RA+ D+WH RLGH
Sbjct  966   QTGRVVATGKRDGGLYVLERGNSAFISVLKNKSLRASYDLWHARLGH  1012



>emb|CAN82859.1| hypothetical protein VITISV_025377 [Vitis vinifera]
Length=1578

 Score = 47.8 bits (112),  Expect(2) = 1e-04, Method: Composition-based stats.
 Identities = 25/63 (40%), Positives = 37/63 (59%), Gaps = 5/63 (8%)
 Frame = +3

Query  21   KDCRTRAVLLRGPTTSGLYRLSQ-----SRSPVALIIARATPDIWHRRLGHPHERAQHHV  185
            KD  T A+LL+G    G+Y   +     S++ VA +  R TPD WH+RLGHP  +  +H+
Sbjct  354  KDQITGAILLKGKCEDGVYPFPKHLPPNSKNVVAYVHERTTPDGWHKRLGHPSSKLVNHL  413

Query  186  LLV  194
            + V
Sbjct  414  IHV  416


 Score = 23.5 bits (49),  Expect(2) = 1e-04, Method: Composition-based stats.
 Identities = 6/12 (50%), Positives = 11/12 (92%), Gaps = 0/12 (0%)
 Frame = +1

Query  304  LDLLYTDIWGPA  339
            ++L+Y D+WGP+
Sbjct  454  MELIYKDVWGPS  465



>emb|CAN60277.1| hypothetical protein VITISV_028254 [Vitis vinifera]
Length=372

 Score = 43.5 bits (101),  Expect(2) = 1e-04, Method: Compositional matrix adjust.
 Identities = 18/38 (47%), Positives = 25/38 (66%), Gaps = 0/38 (0%)
 Frame = +1

Query  241  CQFGKSSRFPLDRVYSRSNNILDLLYTDIWGPAPVVSA  354
            CQ  K+ R P  R   RS+++LDL++ DIWG +PV S 
Sbjct  324  CQITKNHRLPYSRNERRSSHVLDLIHCDIWGXSPVKST  361


 Score = 27.7 bits (60),  Expect(2) = 1e-04, Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 22/47 (47%), Gaps = 4/47 (9%)
 Frame = +3

Query  30   RTRAVLLRGPTTSGLYRLSQSRSPVALIIAR----ATPDIWHRRLGH  158
            +T  V+  G   SGLY L    S    ++      A+ D+WH  LGH
Sbjct  248  QTGRVVETGKRDSGLYVLECGNSXFIFVLKNKALHASYDLWHAHLGH  294



>emb|CAN82960.1| hypothetical protein VITISV_004472 [Vitis vinifera]
Length=437

 Score = 39.7 bits (91),  Expect(2) = 2e-04, Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 25/39 (64%), Gaps = 0/39 (0%)
 Frame = +1

Query  241  CQFGKSSRFPLDRVYSRSNNILDLLYTDIWGPAPVVSAE  357
            C+ GKS   P     SR+++  DL+++D+WGP+ V S E
Sbjct  365  CKLGKSKTLPFPLHASRASHCFDLIHSDVWGPSLVSSHE  403


 Score = 31.6 bits (70),  Expect(2) = 2e-04, Method: Composition-based stats.
 Identities = 11/18 (61%), Positives = 14/18 (78%), Gaps = 0/18 (0%)
 Frame = +3

Query  135  IWHRRLGHPHERAQHHVL  188
            +WHRRLGHP+ +   HVL
Sbjct  328  VWHRRLGHPNTQILSHVL  345



>emb|CAN72410.1| hypothetical protein VITISV_014973 [Vitis vinifera]
Length=1201

 Score = 42.0 bits (97),  Expect(2) = 2e-04, Method: Compositional matrix adjust.
 Identities = 16/35 (46%), Positives = 24/35 (69%), Gaps = 0/35 (0%)
 Frame = +1

Query  241  CQFGKSSRFPLDRVYSRSNNILDLLYTDIWGPAPV  345
            C+ GKS  FP     SR+++  DL+++D WGP+PV
Sbjct  470  CKLGKSKTFPFPLHASRASHCFDLIHSDAWGPSPV  504


 Score = 29.3 bits (64),  Expect(2) = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/64 (33%), Positives = 31/64 (48%), Gaps = 9/64 (14%)
 Frame = +3

Query  24   DCRTRAVLLRGPTTSGLYRLS---QSRSPVALIIARATPDI------WHRRLGHPHERAQ  176
            D  TR  + +GP    L+ L       SP++ I + A  ++      WHRRL HP+ +  
Sbjct  387  DQVTREPITKGPKVGRLFPLFLPVPDFSPLSSIQSFACNNVSDLSMVWHRRLVHPNTQIL  446

Query  177  HHVL  188
             HVL
Sbjct  447  SHVL  450



>emb|CAN62116.1| hypothetical protein VITISV_011012 [Vitis vinifera]
Length=566

 Score = 44.3 bits (103),  Expect(2) = 2e-04, Method: Composition-based stats.
 Identities = 21/49 (43%), Positives = 27/49 (55%), Gaps = 0/49 (0%)
 Frame = +3

Query  42   VLLRGPTTSGLYRLSQSRSPVALIIARATPDIWHRRLGHPHERAQHHVL  188
            VL RG  TS LY  S  R  +A++ A     +WHRRLGH  E+    +L
Sbjct  132  VLARGKKTSTLYMTSCPRDTIAVVDASTDTSLWHRRLGHKSEKGMKMLL  180


 Score = 26.9 bits (58),  Expect(2) = 2e-04, Method: Composition-based stats.
 Identities = 9/16 (56%), Positives = 14/16 (88%), Gaps = 0/16 (0%)
 Frame = +1

Query  304  LDLLYTDIWGPAPVVS  351
            L+L++TD+WGP+ V S
Sbjct  221  LELVHTDLWGPSLVAS  236



>ref|XP_008369089.1| PREDICTED: uncharacterized protein LOC103432662 [Malus domestica]
Length=1318

 Score = 37.4 bits (85),  Expect(2) = 2e-04, Method: Composition-based stats.
 Identities = 22/72 (31%), Positives = 34/72 (47%), Gaps = 9/72 (13%)
 Frame = +1

Query  142  IVGLVIRMSVLNIMFFSCPVTPsrsssaklcssCQFGKSSRFPLDRVYSRSNNILDLLYT  321
            IV + +R S +    FSC  +P           C  GK +  P     S+S    ++++T
Sbjct  609  IVQIALRKSSIP---FSCXSSPQVCKP------CLQGKFTHLPFPSPASKSVTXFEVIHT  659

Query  322  DIWGPAPVVSAE  357
            D+WGP+P  S E
Sbjct  660  DVWGPSPTKSIE  671


 Score = 33.5 bits (75),  Expect(2) = 2e-04, Method: Composition-based stats.
 Identities = 18/51 (35%), Positives = 27/51 (53%), Gaps = 4/51 (8%)
 Frame = +3

Query  21   KDCRTRAVLLRGPTTSGLYRL----SQSRSPVALIIARATPDIWHRRLGHP  161
            +D  T+  L +G + + +Y L    S S  P A I  + +  +WH RLGHP
Sbjct  555  QDKVTQQTLFQGLSNNAVYPLPVLKSSSHRPAAYIGQKXSSALWHCRLGHP  605



>gb|ABA98049.1| retrotransposon protein, putative, Ty1-copia subclass [Oryza 
sativa Japonica Group]
Length=1460

 Score = 38.1 bits (87),  Expect(2) = 2e-04, Method: Composition-based stats.
 Identities = 15/34 (44%), Positives = 22/34 (65%), Gaps = 0/34 (0%)
 Frame = +1

Query  241  CQFGKSSRFPLDRVYSRSNNILDLLYTDIWGPAP  342
            CQ  KS + P     S S + L+L+++D+WGPAP
Sbjct  488  CQQAKSHQLPFPISSSVSKHPLELVFSDVWGPAP  521


 Score = 32.7 bits (73),  Expect(2) = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/47 (43%), Positives = 24/47 (51%), Gaps = 0/47 (0%)
 Frame = +3

Query  21   KDCRTRAVLLRGPTTSGLYRLSQSRSPVALIIARATPDIWHRRLGHP  161
            KD  TR  LL+G +   LY L  S    A    + + D WH RLGHP
Sbjct  414  KDQITRKTLLKGRSWRRLYPLPHSSLKQAYSAIKLSLDRWHHRLGHP  460



>emb|CAN63196.1| hypothetical protein VITISV_035792 [Vitis vinifera]
Length=1179

 Score = 43.1 bits (100),  Expect(2) = 2e-04, Method: Composition-based stats.
 Identities = 21/49 (43%), Positives = 26/49 (53%), Gaps = 0/49 (0%)
 Frame = +3

Query  42   VLLRGPTTSGLYRLSQSRSPVALIIARATPDIWHRRLGHPHERAQHHVL  188
            VL RG  T  LY  S SR  +A+  A     +WHRRLGH  E+    +L
Sbjct  383  VLARGKKTGTLYMTSCSRDTIAVADASTDTSLWHRRLGHMSEKGMKMLL  431


 Score = 27.7 bits (60),  Expect(2) = 2e-04, Method: Composition-based stats.
 Identities = 9/16 (56%), Positives = 14/16 (88%), Gaps = 0/16 (0%)
 Frame = +1

Query  304  LDLLYTDIWGPAPVVS  351
            L+L++TD+W P+PV S
Sbjct  472  LELVHTDLWRPSPVAS  487



>emb|CAN65849.1| hypothetical protein VITISV_038148 [Vitis vinifera]
Length=541

 Score = 41.2 bits (95),  Expect(2) = 2e-04, Method: Composition-based stats.
 Identities = 20/49 (41%), Positives = 25/49 (51%), Gaps = 0/49 (0%)
 Frame = +3

Query  42   VLLRGPTTSGLYRLSQSRSPVALIIARATPDIWHRRLGHPHERAQHHVL  188
            VL RG  T  LY  S  R  +A+  A     +WHRRLGH  E+    +L
Sbjct  244  VLARGKKTGTLYMTSCPRDTIAVADASTDTSLWHRRLGHMSEKGMKMLL  292


 Score = 29.6 bits (65),  Expect(2) = 2e-04, Method: Composition-based stats.
 Identities = 10/16 (63%), Positives = 14/16 (88%), Gaps = 0/16 (0%)
 Frame = +1

Query  304  LDLLYTDIWGPAPVVS  351
            L+L+ TD+WGP+PV S
Sbjct  321  LELVXTDLWGPSPVAS  336



>emb|CAN80991.1| hypothetical protein VITISV_021529 [Vitis vinifera]
Length=1033

 Score = 40.0 bits (92),  Expect(2) = 2e-04, Method: Composition-based stats.
 Identities = 19/49 (39%), Positives = 25/49 (51%), Gaps = 0/49 (0%)
 Frame = +3

Query  42   VLLRGPTTSGLYRLSQSRSPVALIIARATPDIWHRRLGHPHERAQHHVL  188
            +L RG  T  LY  S  R  +A+  A     +WHRRLGH  E+    +L
Sbjct  383  ILARGKKTGTLYMTSCPRDTIAVADASTDTSLWHRRLGHMSEKEMKMLL  431


 Score = 30.4 bits (67),  Expect(2) = 2e-04, Method: Composition-based stats.
 Identities = 9/16 (56%), Positives = 15/16 (94%), Gaps = 0/16 (0%)
 Frame = +1

Query  304  LDLLYTDIWGPAPVVS  351
            L+L++TD+WGP+P+ S
Sbjct  472  LELVHTDLWGPSPIAS  487



>emb|CAB43904.1| putative protein [Arabidopsis thaliana]
 emb|CAB81478.1| putative protein [Arabidopsis thaliana]
Length=1415

 Score = 38.1 bits (87),  Expect(2) = 2e-04, Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 25/39 (64%), Gaps = 0/39 (0%)
 Frame = +1

Query  241  CQFGKSSRFPLDRVYSRSNNILDLLYTDIWGPAPVVSAE  357
            CQ GK  + P       S+ +L+ ++ D+WGPAPVVS++
Sbjct  461  CQMGKICKLPFASSDFVSSRLLERVHCDLWGPAPVVSSQ  499


 Score = 32.3 bits (72),  Expect(2) = 2e-04, Method: Composition-based stats.
 Identities = 21/59 (36%), Positives = 32/59 (54%), Gaps = 4/59 (7%)
 Frame = +3

Query  21   KDCRTRAVLLRGPTTSGLYRLSQSRSPVALIIAR--ATPD-IWHRRLGHPHERAQHHVL  188
            KD  T+ +L +G   + LY L   +  +A   +R  AT D +WH RLGHP++     +L
Sbjct  386  KDKLTKQLLTKGTRHNDLYLLENPKF-MACYSSRQQATSDEVWHMRLGHPNQDVLQQLL  443



>ref|XP_008675247.1| PREDICTED: uncharacterized protein LOC103651388 isoform X1 [Zea 
mays]
Length=1371

 Score = 35.4 bits (80),  Expect(2) = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 32/53 (60%), Gaps = 5/53 (9%)
 Frame = +3

Query  21   KDCRTRAVLLRGPTTSGLYRLSQSRSPVA-LIIARATPD-IWHRRLGHPHERA  173
            KD  +R V++R  ++  LY L   + PVA  ++A A P  +WHRRLGHP   A
Sbjct  564  KDLLSRNVIIRCNSSGPLYPL---QLPVAHSLVASAAPSHLWHRRLGHPGREA  613


 Score = 35.0 bits (79),  Expect(2) = 2e-04, Method: Compositional matrix adjust.
 Identities = 15/39 (38%), Positives = 22/39 (56%), Gaps = 1/39 (3%)
 Frame = +1

Query  241  CQFGKSSRFPLDRVYSRSNNILDLLYTDIW-GPAPVVSA  354
            CQ G+  R P     SR++N  DL++ D+W  P P +S 
Sbjct  635  CQLGRHVRLPFGTSVSRASNNFDLIHCDLWTSPIPSISG  673



>emb|CAN76274.1| hypothetical protein VITISV_008497 [Vitis vinifera]
Length=1149

 Score = 39.3 bits (90),  Expect(2) = 3e-04, Method: Composition-based stats.
 Identities = 19/49 (39%), Positives = 25/49 (51%), Gaps = 0/49 (0%)
 Frame = +3

Query  42   VLLRGPTTSGLYRLSQSRSPVALIIARATPDIWHRRLGHPHERAQHHVL  188
            VL RG  T  LY  S  R+ +A+        +WHRRLGH  E+    +L
Sbjct  346  VLARGKKTGTLYMTSCPRNTIAVADVSTDTSLWHRRLGHMSEKGMKMLL  394


 Score = 31.2 bits (69),  Expect(2) = 3e-04, Method: Composition-based stats.
 Identities = 10/16 (63%), Positives = 15/16 (94%), Gaps = 0/16 (0%)
 Frame = +1

Query  304  LDLLYTDIWGPAPVVS  351
            L+L++TD+WGP+PV S
Sbjct  435  LELVHTDLWGPSPVAS  450



>emb|CAN71164.1| hypothetical protein VITISV_031057 [Vitis vinifera]
Length=1303

 Score = 43.5 bits (101),  Expect(2) = 3e-04, Method: Compositional matrix adjust.
 Identities = 17/39 (44%), Positives = 26/39 (67%), Gaps = 0/39 (0%)
 Frame = +1

Query  241  CQFGKSSRFPLDRVYSRSNNILDLLYTDIWGPAPVVSAE  357
            C+ GKS   P     SR+++  DL+++D+WGP+PV S E
Sbjct  651  CKLGKSKTLPFPLHASRASHCFDLIHSDVWGPSPVSSHE  689


 Score = 26.9 bits (58),  Expect(2) = 3e-04, Method: Compositional matrix adjust.
 Identities = 10/18 (56%), Positives = 12/18 (67%), Gaps = 0/18 (0%)
 Frame = +3

Query  135  IWHRRLGHPHERAQHHVL  188
            +WHR LGHP+     HVL
Sbjct  614  VWHRXLGHPNTXILSHVL  631



>gb|ACY72569.1| unknown [Oryza sativa Japonica Group]
Length=1436

 Score = 38.9 bits (89),  Expect(2) = 3e-04, Method: Composition-based stats.
 Identities = 16/34 (47%), Positives = 22/34 (65%), Gaps = 0/34 (0%)
 Frame = +1

Query  241  CQFGKSSRFPLDRVYSRSNNILDLLYTDIWGPAP  342
            CQ  KS + P  R  S S   L+L+++D+WGPAP
Sbjct  494  CQEAKSRQLPYVRSTSVSQFPLELVFSDVWGPAP  527


 Score = 31.2 bits (69),  Expect(2) = 3e-04, Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 26/51 (51%), Gaps = 4/51 (8%)
 Frame = +3

Query  21   KDCRTRAVLLRGPTTSGLYRLSQS----RSPVALIIARATPDIWHRRLGHP  161
            KD  T+ +LL G    GLY + +S     S  AL   + +   WH RLGHP
Sbjct  415  KDQVTKDILLEGRCRHGLYPIPKSFGRTTSKQALGTTKLSLSRWHSRLGHP  465



>emb|CAN81016.1| hypothetical protein VITISV_025518 [Vitis vinifera]
Length=1461

 Score = 40.4 bits (93),  Expect(2) = 3e-04, Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 26/47 (55%), Gaps = 0/47 (0%)
 Frame = +3

Query  21   KDCRTRAVLLRGPTTSGLYRLSQSRSPVALIIARATPDIWHRRLGHP  161
            +D  TR  +  G   +GLY L+Q ++P          D+WH+RLGHP
Sbjct  500  QDATTRKTIGLGKQHNGLYYLAQDQNPALAYAIHKHSDLWHQRLGHP  546


 Score = 29.6 bits (65),  Expect(2) = 3e-04, Method: Composition-based stats.
 Identities = 11/32 (34%), Positives = 16/32 (50%), Gaps = 0/32 (0%)
 Frame = +1

Query  241  CQFGKSSRFPLDRVYSRSNNILDLLYTDIWGP  336
            C   K +R      +  S+   DL++ DIWGP
Sbjct  572  CPLAKQTRLSFPSSFISSHAPFDLIHCDIWGP  603



>gb|ABW81031.1| LTRGag-pol-polymerase 3 [Arabidopsis lyrata subsp. lyrata]
Length=1296

 Score = 38.9 bits (89),  Expect(2) = 3e-04, Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 28/50 (56%), Gaps = 3/50 (6%)
 Frame = +3

Query  21   KDCRTRAVLLRGPTTSGLYRLSQSRSPV---ALIIARATPDIWHRRLGHP  161
            KD +TR  LLR  ++  LY ++ S  P    AL    +   IWHRRLGHP
Sbjct  455  KDLKTRNKLLRCDSSGPLYSVTPSSYPSSHHALAATTSDSFIWHRRLGHP  504


 Score = 31.6 bits (70),  Expect(2) = 3e-04, Method: Compositional matrix adjust.
 Identities = 12/39 (31%), Positives = 24/39 (62%), Gaps = 1/39 (3%)
 Frame = +1

Query  241  CQFGKSSRFPLDRVYSRSNNILDLLYTDIW-GPAPVVSA  354
            CQ GK +R P     + ++++ +++++DIW  P P +S 
Sbjct  532  CQLGKHTRLPFFNSNTIASSLFEIVHSDIWTSPVPSISG  570



>emb|CAN62863.1| hypothetical protein VITISV_030334 [Vitis vinifera]
Length=1442

 Score = 38.1 bits (87),  Expect(2) = 4e-04, Method: Compositional matrix adjust.
 Identities = 21/48 (44%), Positives = 27/48 (56%), Gaps = 5/48 (10%)
 Frame = +3

Query  33   TRAVLLRGPTTSGLYRLSQS-----RSPVALIIARATPDIWHRRLGHP  161
            T A+LLRG   +G+Y  S+S        VA +  R   D WH+RLGHP
Sbjct  481  TGAILLRGSCENGIYIFSESLVGNFSQKVANVHERMLLDGWHKRLGHP  528


 Score = 32.0 bits (71),  Expect(2) = 4e-04, Method: Composition-based stats.
 Identities = 13/33 (39%), Positives = 17/33 (52%), Gaps = 0/33 (0%)
 Frame = +1

Query  241  CQFGKSSRFPLDRVYSRSNNILDLLYTDIWGPA  339
            C   KS + P       S   L ++YTD+WGPA
Sbjct  556  CSINKSHQQPFRTTSLSSTGPLKIIYTDVWGPA  588



>ref|XP_008364216.1| PREDICTED: uncharacterized protein LOC103427909 [Malus domestica]
Length=917

 Score = 37.0 bits (84),  Expect(2) = 4e-04, Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 22/37 (59%), Gaps = 0/37 (0%)
 Frame = +1

Query  241  CQFGKSSRFPLDRVYSRSNNILDLLYTDIWGPAPVVS  351
            C  GK S+ P      +S    DL+++D+WGPAP VS
Sbjct  488  CLEGKFSKLPFPSSVDKSVKPFDLVHSDVWGPAPCVS  524


 Score = 33.1 bits (74),  Expect(2) = 4e-04, Method: Composition-based stats.
 Identities = 19/54 (35%), Positives = 26/54 (48%), Gaps = 8/54 (15%)
 Frame = +3

Query  24   DCRTRAVLLRGPTTSGLYRLS--------QSRSPVALIIARATPDIWHRRLGHP  161
            D  T  VL +G   +GLY +           R+  A +  + T  IWH+RLGHP
Sbjct  407  DKATGRVLYKGLCNNGLYXIIXPSSHAVINKRNLAAFLGQQVTTSIWHKRLGHP  460



>gb|ABI34342.1| Polyprotein, putative [Solanum demissum]
Length=1054

 Score = 37.4 bits (85),  Expect(2) = 4e-04, Method: Compositional matrix adjust.
 Identities = 17/39 (44%), Positives = 23/39 (59%), Gaps = 1/39 (3%)
 Frame = +1

Query  241  CQFGKSSRFPLDR-VYSRSNNILDLLYTDIWGPAPVVSA  354
            CQ GK +R    R    RS +I  L+++DIWGP+ V S 
Sbjct  279  CQLGKHTRATFSRSTEGRSESIFSLVHSDIWGPSRVSST  317


 Score = 32.7 bits (73),  Expect(2) = 4e-04, Method: Compositional matrix adjust.
 Identities = 19/46 (41%), Positives = 26/46 (57%), Gaps = 1/46 (2%)
 Frame = +3

Query  24   DCRTRAVLLRGPTTSGLYRLSQSRSPVALIIARATPDIWHRRLGHP  161
            D  T  ++  G  + GLY L+ S S  A  I  + PD+ H+RLGHP
Sbjct  212  DRNTGQMIGTGHESQGLYYLTSSNSLTACSITDS-PDLIHKRLGHP  256



>emb|CAN66507.1| hypothetical protein VITISV_034008 [Vitis vinifera]
Length=1260

 Score = 38.9 bits (89),  Expect(2) = 4e-04, Method: Compositional matrix adjust.
 Identities = 15/35 (43%), Positives = 22/35 (63%), Gaps = 0/35 (0%)
 Frame = +1

Query  241  CQFGKSSRFPLDRVYSRSNNILDLLYTDIWGPAPV  345
            C+ GKS   P     SR+++  DL++ D+WGP PV
Sbjct  511  CKLGKSKTLPFPLHASRASHCFDLIHCDVWGPFPV  545


 Score = 31.2 bits (69),  Expect(2) = 4e-04, Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 32/65 (49%), Gaps = 9/65 (14%)
 Frame = +3

Query  21   KDCRTRAVLLRGPTTSGLYRLS---QSRSPVALIIARATPDI------WHRRLGHPHERA  173
            +D  T   + +GP    L+ L       SP++ I + A  ++      WHRRLGHP+ + 
Sbjct  427  QDQVTGEPIAKGPKVGCLFLLFLPVPDFSPLSSIKSFACNNVSDLSMVWHRRLGHPNTQI  486

Query  174  QHHVL  188
              HVL
Sbjct  487  LSHVL  491



>emb|CAN69431.1| hypothetical protein VITISV_024659 [Vitis vinifera]
Length=1287

 Score = 38.9 bits (89),  Expect(2) = 4e-04, Method: Composition-based stats.
 Identities = 19/49 (39%), Positives = 24/49 (49%), Gaps = 0/49 (0%)
 Frame = +3

Query  42   VLLRGPTTSGLYRLSQSRSPVALIIARATPDIWHRRLGHPHERAQHHVL  188
            VL  G  T  LY  S  R  +A+  A     +WHRRLGH  E+    +L
Sbjct  383  VLAHGKKTGTLYMTSCPRDTIAVADASTDTSLWHRRLGHMSEKGMKMLL  431


 Score = 31.2 bits (69),  Expect(2) = 4e-04, Method: Composition-based stats.
 Identities = 10/16 (63%), Positives = 15/16 (94%), Gaps = 0/16 (0%)
 Frame = +1

Query  304  LDLLYTDIWGPAPVVS  351
            L+L++TD+WGP+PV S
Sbjct  472  LELVHTDLWGPSPVAS  487



>emb|CAN79518.1| hypothetical protein VITISV_026066 [Vitis vinifera]
Length=532

 Score = 48.1 bits (113),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 25/59 (42%), Positives = 35/59 (59%), Gaps = 5/59 (8%)
 Frame = +3

Query  33   TRAVLLRGPTTSGLYR-----LSQSRSPVALIIARATPDIWHRRLGHPHERAQHHVLLV  194
            T A+LL+G    G+Y      L  S++ VA +  R TPD WHRRLGHP  +  +H++ V
Sbjct  430  TEAILLKGECEDGVYPFPEHLLPNSKNIVAYVHERTTPDGWHRRLGHPSSKLVNHLIHV  488



>emb|CAN67247.1| hypothetical protein VITISV_008682 [Vitis vinifera]
Length=1270

 Score = 35.8 bits (81),  Expect(2) = 4e-04, Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 24/51 (47%), Gaps = 5/51 (10%)
 Frame = +3

Query  24   DCRTRAVLLRGPTTSGLYRLSQSRSPVALIIARATPD-----IWHRRLGHP  161
            D  T+  LL+G    GLY    S S  A +   + P      IWH RLGHP
Sbjct  329  DQVTKQTLLKGWLKDGLYEFPSSSSTHAFVSTSSIPALTPGAIWHSRLGHP  379


 Score = 33.9 bits (76),  Expect(2) = 4e-04, Method: Composition-based stats.
 Identities = 14/34 (41%), Positives = 19/34 (56%), Gaps = 0/34 (0%)
 Frame = +1

Query  241  CQFGKSSRFPLDRVYSRSNNILDLLYTDIWGPAP  342
            C   KS   P     S ++  L L++TD+WGPAP
Sbjct  408  CPLAKSHSLPYSLSSSHASQPLALIHTDLWGPAP  441



>emb|CAN71595.1| hypothetical protein VITISV_010143 [Vitis vinifera]
Length=1523

 Score = 38.9 bits (89),  Expect(2) = 4e-04, Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 28/50 (56%), Gaps = 0/50 (0%)
 Frame = +3

Query  21   KDCRTRAVLLRGPTTSGLYRLSQSRSPVALIIARATPDIWHRRLGHPHER  170
            +D ++  ++  G  + GLY L+  R     ++   T D+WH+RLGHP  +
Sbjct  494  QDLQSGKMIGMGTESEGLYCLNLPRKGTCNVVNTKTQDLWHQRLGHPSSK  543


 Score = 30.8 bits (68),  Expect(2) = 4e-04, Method: Composition-based stats.
 Identities = 12/31 (39%), Positives = 17/31 (55%), Gaps = 0/31 (0%)
 Frame = +1

Query  241  CQFGKSSRFPLDRVYSRSNNILDLLYTDIWG  333
            C   K +R P     S S++  DL++ DIWG
Sbjct  564  CPLAKHTRTPFPLSVSSSDSCFDLIHVDIWG  594



>ref|XP_008384570.1| PREDICTED: uncharacterized protein LOC103447138 [Malus domestica]
Length=808

 Score = 35.8 bits (81),  Expect(2) = 5e-04, Method: Compositional matrix adjust.
 Identities = 15/39 (38%), Positives = 22/39 (56%), Gaps = 0/39 (0%)
 Frame = +1

Query  241  CQFGKSSRFPLDRVYSRSNNILDLLYTDIWGPAPVVSAE  357
            C   KSS+ P       ++  L+LL+ D+WGPAP+ S  
Sbjct  464  CAVRKSSKLPFVSSSCTTSKPLELLHMDVWGPAPISSVH  502


 Score = 33.9 bits (76),  Expect(2) = 5e-04, Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 28/55 (51%), Gaps = 5/55 (9%)
 Frame = +3

Query  21   KDCRTRAVLLRGPTTSGLYRLSQSR-SPVALIIARATP----DIWHRRLGHPHER  170
            KD  +  +L  GP   GLY    S  +P +  +  AT     D+WH+RLGHP  +
Sbjct  385  KDISSGKMLFSGPVRDGLYPFHTSYPAPGSPHLFGATTIAYQDLWHKRLGHPSTK  439



>emb|CAN76896.1| hypothetical protein VITISV_010605 [Vitis vinifera]
Length=1146

 Score = 38.5 bits (88),  Expect(2) = 5e-04, Method: Composition-based stats.
 Identities = 19/49 (39%), Positives = 24/49 (49%), Gaps = 0/49 (0%)
 Frame = +3

Query  42   VLLRGPTTSGLYRLSQSRSPVALIIARATPDIWHRRLGHPHERAQHHVL  188
            VL RG  T  LY  S  R  +A+  A     +WH RLGH  E+    +L
Sbjct  352  VLARGKKTGTLYMTSCPRDTIAVADASTDTSLWHXRLGHMSEKGMKMLL  400


 Score = 31.2 bits (69),  Expect(2) = 5e-04, Method: Composition-based stats.
 Identities = 10/16 (63%), Positives = 15/16 (94%), Gaps = 0/16 (0%)
 Frame = +1

Query  304  LDLLYTDIWGPAPVVS  351
            L+L++TD+WGP+PV S
Sbjct  441  LELVHTDLWGPSPVAS  456



>emb|CDH30699.1| putative Ty1-copia-like retrotransposon [Cercis chinensis]
Length=646

 Score = 37.0 bits (84),  Expect(2) = 6e-04, Method: Composition-based stats.
 Identities = 14/37 (38%), Positives = 21/37 (57%), Gaps = 0/37 (0%)
 Frame = +1

Query  241  CQFGKSSRFPLDRVYSRSNNILDLLYTDIWGPAPVVS  351
            CQ  KS + P  R YS++    DL++ D+WG    +S
Sbjct  546  CQLAKSHKLPFVRNYSKAMKPFDLVHADLWGSPSCLS  582


 Score = 32.3 bits (72),  Expect(2) = 6e-04, Method: Composition-based stats.
 Identities = 20/59 (34%), Positives = 30/59 (51%), Gaps = 12/59 (20%)
 Frame = +3

Query  21   KDCRTRAVLLRGPTTSGLYRLS---QSRSPVALII---------ARATPDIWHRRLGHP  161
            KD +T+A+LL+G    GLY +     S +P A +          +  +  +WH RLGHP
Sbjct  460  KDQKTQAILLKGGLDKGLYSVPSAYSSHAPQARVFQIFSTSSSTSIDSMRLWHNRLGHP  518



>emb|CAN81099.1| hypothetical protein VITISV_017741 [Vitis vinifera]
Length=1455

 Score = 35.4 bits (80),  Expect(2) = 6e-04, Method: Composition-based stats.
 Identities = 26/77 (34%), Positives = 35/77 (45%), Gaps = 21/77 (27%)
 Frame = +3

Query  21   KDCRTRAVLLRGPTTSGLY---------RLSQSRSPVALIIARA------------TPDI  137
            KD  T+AVL+ G    GLY         R +QS S    ++A +            T D+
Sbjct  464  KDQVTQAVLMVGKVRDGLYAFDSSHLALRPTQSLSKSPSVVASSFSSKVCTTSLSSTFDL  523

Query  138  WHRRLGHPHERAQHHVL  188
            WH+RLGHP      +VL
Sbjct  524  WHKRLGHPSAATIKNVL  540


 Score = 33.9 bits (76),  Expect(2) = 6e-04, Method: Compositional matrix adjust.
 Identities = 14/37 (38%), Positives = 21/37 (57%), Gaps = 0/37 (0%)
 Frame = +1

Query  241  CQFGKSSRFPLDRVYSRSNNILDLLYTDIWGPAPVVS  351
            C  GK  RFP    ++     L+L++ D+WGP  V+S
Sbjct  559  CCLGKIHRFPFSLSHTTYTKPLELIHLDLWGPTLVLS  595



>ref|XP_008375724.1| PREDICTED: uncharacterized protein LOC103438960 [Malus domestica]
Length=657

 Score = 36.6 bits (83),  Expect(2) = 6e-04, Method: Composition-based stats.
 Identities = 20/63 (32%), Positives = 35/63 (56%), Gaps = 0/63 (0%)
 Frame = +1

Query  169  VLNIMFFSCPVTPsrsssaklcssCQFGKSSRFPLDRVYSRSNNILDLLYTDIWGPAPVV  348
            VL+IM  +  V+  +   + +CS+C  GK  R P      R+ +  + +++D+WGP+P  
Sbjct  536  VLSIMLKTAXVSVHKDPXSTMCSACISGKMCRLPFSVKXVRTTHXFEKIHSDVWGPSPQK  595

Query  349  SAE  357
            S E
Sbjct  596  SIE  598


 Score = 32.3 bits (72),  Expect(2) = 6e-04, Method: Composition-based stats.
 Identities = 19/59 (32%), Positives = 29/59 (49%), Gaps = 11/59 (19%)
 Frame = +3

Query  24   DCRTRAVLLRGPTTSG-LYRLSQS--RSPVA--------LIIARATPDIWHRRLGHPHE  167
            D  TR +L +G +  G L+++  S  RS  A         +  +    +WH+RLGHP E
Sbjct  476  DKATRVILYQGKSDDGELFKIPASVFRSSFAAKLEKCSAFLXKKVRSSVWHKRLGHPSE  534



>emb|CAN81355.1| hypothetical protein VITISV_039158 [Vitis vinifera]
Length=1402

 Score = 40.4 bits (93),  Expect(2) = 6e-04, Method: Compositional matrix adjust.
 Identities = 18/37 (49%), Positives = 22/37 (59%), Gaps = 0/37 (0%)
 Frame = +1

Query  241  CQFGKSSRFPLDRVYSRSNNILDLLYTDIWGPAPVVS  351
            CQ  KS R P       ++  L+L+YTDIWGPA V S
Sbjct  520  CQLAKSHRLPTHLSSFHASKPLELVYTDIWGPASVTS  556


 Score = 28.5 bits (62),  Expect(2) = 6e-04, Method: Composition-based stats.
 Identities = 18/58 (31%), Positives = 28/58 (48%), Gaps = 12/58 (21%)
 Frame = +3

Query  21   KDCRTRAVLLRGPTTSGLYR---LSQSRSPVALIIARAT---------PDIWHRRLGH  158
            KD  T+ VL +G   +GLY+   +S  ++    I   +T          ++WH RLGH
Sbjct  435  KDLHTKRVLAQGKLENGLYKFPVISNKKTAYVGITNDSTFQCSNIENKRELWHHRLGH  492



>gb|AAU43956.1| unknown protein [Oryza sativa Japonica Group]
 gb|AAU44069.1| putative polyprotein [Oryza sativa Japonica Group]
Length=1447

 Score = 36.6 bits (83),  Expect(2) = 7e-04, Method: Composition-based stats.
 Identities = 17/33 (52%), Positives = 24/33 (73%), Gaps = 0/33 (0%)
 Frame = +1

Query  241  CQFGKSSRFPLDRVYSRSNNILDLLYTDIWGPA  339
            CQ GKS + P  R  S S++ L+L+Y+D+WGPA
Sbjct  494  CQQGKSHQLPYSRSSSMSSHPLELIYSDVWGPA  526


 Score = 32.7 bits (73),  Expect(2) = 7e-04, Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 23/54 (43%), Gaps = 7/54 (13%)
 Frame = +3

Query  21   KDCRTRAVLLRGPTTSGLYRLSQSRS-----PVALIIARATPDI--WHRRLGHP  161
            KD  T+ +L RGP    LY L  S       P+        P    WH RLGHP
Sbjct  412  KDLATKKLLFRGPCRGRLYALPSSSPHERPRPLKEAFGAIKPSFERWHSRLGHP  465



>emb|CAN76151.1| hypothetical protein VITISV_012673 [Vitis vinifera]
Length=979

 Score = 40.4 bits (93),  Expect(2) = 7e-04, Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 20/36 (56%), Gaps = 0/36 (0%)
 Frame = +1

Query  241  CQFGKSSRFPLDRVYSRSNNILDLLYTDIWGPAPVV  348
            CQ  KS R P  R  SR+     L+Y D+WG  P+V
Sbjct  290  CQLAKSHRLPFQRSTSRAIKPFGLIYVDLWGATPIV  325


 Score = 28.9 bits (63),  Expect(2) = 7e-04, Method: Composition-based stats.
 Identities = 17/55 (31%), Positives = 25/55 (45%), Gaps = 9/55 (16%)
 Frame = +3

Query  21   KDCRTRAVLLRGPTTSGLYRLSQSRS----PVALIIARATPD-----IWHRRLGH  158
            KD +TR V L+G    G Y++  +      P+A     +  D     + H RLGH
Sbjct  207  KDQKTRLVFLQGKNEKGFYKIPAATRVVGHPLAFYATSSISDAGSLRLLHNRLGH  261



>ref|XP_008385371.1| PREDICTED: uncharacterized protein LOC103447922 [Malus domestica]
Length=441

 Score = 35.4 bits (80),  Expect(2) = 7e-04, Method: Composition-based stats.
 Identities = 17/51 (33%), Positives = 24/51 (47%), Gaps = 4/51 (8%)
 Frame = +3

Query  21   KDCRTRAVLLRGPTTSGLYRLSQS----RSPVALIIARATPDIWHRRLGHP  161
            KD  +R +   GP   G Y    +     S  AL+  +A+  +WH RL HP
Sbjct  107  KDXISRMMFFXGPVKHGFYPFQDTSTAFNSHSALMSTKASLQVWHNRLSHP  157


 Score = 33.5 bits (75),  Expect(2) = 7e-04, Method: Composition-based stats.
 Identities = 13/37 (35%), Positives = 20/37 (54%), Gaps = 0/37 (0%)
 Frame = +1

Query  241  CQFGKSSRFPLDRVYSRSNNILDLLYTDIWGPAPVVS  351
            C  GK+ + P        +  L+L++ D+WGPAP  S
Sbjct  186  CAIGKNHKLPFTTSVGSVSVALELVHYDVWGPAPTSS  222



>ref|XP_008387175.1| PREDICTED: uncharacterized protein LOC103449620 [Malus domestica]
Length=647

 Score = 47.8 bits (112),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 24/56 (43%), Positives = 32/56 (57%), Gaps = 9/56 (16%)
 Frame = +3

Query  21   KDCRTRAVLLRGPTTSGLYRLSQSRS---------PVALIIARATPDIWHRRLGHP  161
            KD RT  +L +GP+  GLY    + S         P AL+IA+A   IWH+R+GHP
Sbjct  106  KDLRTGEMLFQGPSEXGLYPXYWNASNXVSGIAISPTALMIAKADFQIWHQRIGHP  161



>ref|XP_008351324.1| PREDICTED: uncharacterized protein LOC103414737 [Malus domestica]
Length=1269

 Score = 35.8 bits (81),  Expect(2) = 7e-04, Method: Composition-based stats.
 Identities = 21/51 (41%), Positives = 27/51 (53%), Gaps = 4/51 (8%)
 Frame = +3

Query  21   KDCRTRAVLLRGPTTSGLYRL----SQSRSPVALIIARATPDIWHRRLGHP  161
            +D  T+ VL RG + + +Y L    S   SP A I  R    +WH RLGHP
Sbjct  625  QDKVTQEVLYRGLSNNAVYPLPVMKSSHVSPAAYIGRRINSALWHCRLGHP  675


 Score = 33.1 bits (74),  Expect(2) = 7e-04, Method: Compositional matrix adjust.
 Identities = 14/39 (36%), Positives = 24/39 (62%), Gaps = 0/39 (0%)
 Frame = +1

Query  241  CQFGKSSRFPLDRVYSRSNNILDLLYTDIWGPAPVVSAE  357
            C  GK +  P   + S+S    ++++TD+WGP+P +S E
Sbjct  703  CLQGKFANLPFPYLASKSVIPFEVIHTDVWGPSPSLSIE  741



>emb|CAN76321.1| hypothetical protein VITISV_044445 [Vitis vinifera]
Length=1279

 Score = 37.7 bits (86),  Expect(2) = 7e-04, Method: Composition-based stats.
 Identities = 19/49 (39%), Positives = 24/49 (49%), Gaps = 0/49 (0%)
 Frame = +3

Query  42   VLLRGPTTSGLYRLSQSRSPVALIIARATPDIWHRRLGHPHERAQHHVL  188
            VL RG  T  L   S  R  +A+  A     +WHRRLGH  E+    +L
Sbjct  383  VLARGKKTXTLXMTSCPRDTIAVADASTDTSLWHRRLGHMSEKGMKMLL  431


 Score = 31.2 bits (69),  Expect(2) = 7e-04, Method: Composition-based stats.
 Identities = 10/16 (63%), Positives = 15/16 (94%), Gaps = 0/16 (0%)
 Frame = +1

Query  304  LDLLYTDIWGPAPVVS  351
            L+L++TD+WGP+PV S
Sbjct  453  LELVHTDLWGPSPVAS  468



>emb|CAN60396.1| hypothetical protein VITISV_018063 [Vitis vinifera]
Length=1294

 Score = 37.7 bits (86),  Expect(2) = 8e-04, Method: Composition-based stats.
 Identities = 19/49 (39%), Positives = 24/49 (49%), Gaps = 0/49 (0%)
 Frame = +3

Query  42   VLLRGPTTSGLYRLSQSRSPVALIIARATPDIWHRRLGHPHERAQHHVL  188
            VL R   T  LY  S  R  +A+  A     +WHRRLGH  E+    +L
Sbjct  345  VLARRKKTDTLYMTSCPRDTIAVADASTDTSLWHRRLGHMSEKGMKMML  393


 Score = 31.2 bits (69),  Expect(2) = 8e-04, Method: Composition-based stats.
 Identities = 10/16 (63%), Positives = 15/16 (94%), Gaps = 0/16 (0%)
 Frame = +1

Query  304  LDLLYTDIWGPAPVVS  351
            L+L++TD+WGP+PV S
Sbjct  434  LELVHTDLWGPSPVAS  449



>emb|CAN72268.1| hypothetical protein VITISV_017854 [Vitis vinifera]
Length=972

 Score = 38.5 bits (88),  Expect(2) = 8e-04, Method: Compositional matrix adjust.
 Identities = 15/39 (38%), Positives = 25/39 (64%), Gaps = 0/39 (0%)
 Frame = +1

Query  241  CQFGKSSRFPLDRVYSRSNNILDLLYTDIWGPAPVVSAE  357
            C+ GKS   P     SR+++  DL+++++WGP+ V S E
Sbjct  382  CKLGKSKTLPFPLHASRASHCFDLIHSNVWGPSSVSSLE  420


 Score = 30.0 bits (66),  Expect(2) = 8e-04, Method: Compositional matrix adjust.
 Identities = 11/18 (61%), Positives = 14/18 (78%), Gaps = 0/18 (0%)
 Frame = +3

Query  135  IWHRRLGHPHERAQHHVL  188
            +WHRRLGHP+ +   HVL
Sbjct  345  VWHRRLGHPNTQILSHVL  362



>gb|AAF02855.1|AC009324_4 Similar to retrotransposon proteins [Arabidopsis thaliana]
Length=1522

 Score = 35.0 bits (79),  Expect(2) = 9e-04, Method: Composition-based stats.
 Identities = 18/56 (32%), Positives = 29/56 (52%), Gaps = 2/56 (4%)
 Frame = +3

Query  24   DCRTRAVLLRGPTTSGLYRLSQSRSPVALIIAR--ATPDIWHRRLGHPHERAQHHV  185
            D  T+ +L+ G    GLY L + +  V     +  A+ ++WHRRLGH +    H +
Sbjct  420  DKATKKLLVMGRNRDGLYSLEEPKLQVLYSTRQNSASSEVWHRRLGHANAEVLHQL  475


 Score = 33.5 bits (75),  Expect(2) = 9e-04, Method: Compositional matrix adjust.
 Identities = 13/39 (33%), Positives = 22/39 (56%), Gaps = 0/39 (0%)
 Frame = +1

Query  241  CQFGKSSRFPLDRVYSRSNNILDLLYTDIWGPAPVVSAE  357
            C  GKS+R P       ++  L+ ++ D+WGP+P  S +
Sbjct  495  CHLGKSTRLPFMLSTFNASRPLERIHCDLWGPSPTSSVQ  533



>ref|XP_009344802.1| PREDICTED: uncharacterized protein LOC103936680 [Pyrus x bretschneideri]
Length=613

 Score = 40.8 bits (94),  Expect(2) = 9e-04, Method: Composition-based stats.
 Identities = 24/64 (38%), Positives = 31/64 (48%), Gaps = 9/64 (14%)
 Frame = +3

Query  24   DCRTRAVLLRGPTTSGLYRLSQSRS---------PVALIIARATPDIWHRRLGHPHERAQ  176
            D RT  +L +GP   GL+    + S         P AL+IA+     WHRRL HP   A 
Sbjct  476  DLRTGKMLFQGPCEGGLHPFYWNASNGISGIAISPHALMIAKVDITTWHRRLRHPFSLAL  535

Query  177  HHVL  188
            H V+
Sbjct  536  HKVV  539


 Score = 28.1 bits (61),  Expect(2) = 9e-04, Method: Compositional matrix adjust.
 Identities = 12/37 (32%), Positives = 19/37 (51%), Gaps = 0/37 (0%)
 Frame = +1

Query  241  CQFGKSSRFPLDRVYSRSNNILDLLYTDIWGPAPVVS  351
            CQ GK+S+     +   S     L++TD+W  +P  S
Sbjct  559  CQMGKTSKLSFSTLPCTSTRPFHLVHTDVWCSSPTPS  595



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 520238967072