BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c9951_g2_i1 len=774 path=[443:0-773]

Length=774
                                                                      Score     E

ref|XP_009779067.1|  PREDICTED: probable UDP-arabinopyranose muta...    335   5e-111   
ref|XP_004237490.1|  PREDICTED: probable UDP-arabinopyranose muta...    335   1e-110   
ref|XP_006340504.1|  PREDICTED: probable UDP-arabinopyranose muta...    335   1e-110   
ref|XP_009604203.1|  PREDICTED: probable UDP-arabinopyranose muta...    333   7e-110   
emb|CDP04238.1|  unnamed protein product                                324   1e-106   
ref|XP_007205460.1|  hypothetical protein PRUPE_ppa007906mg             322   1e-105   
ref|XP_011084720.1|  PREDICTED: probable UDP-arabinopyranose muta...    320   7e-105   
ref|XP_008366889.1|  PREDICTED: probable UDP-arabinopyranose muta...    320   9e-105   
ref|XP_009337977.1|  PREDICTED: probable UDP-arabinopyranose muta...    320   9e-105   
ref|XP_008355840.1|  PREDICTED: probable UDP-arabinopyranose muta...    320   1e-104   
ref|XP_010111044.1|  putative UDP-arabinopyranose mutase 5              319   1e-104   
ref|XP_009337978.1|  PREDICTED: probable UDP-arabinopyranose muta...    321   2e-104   
ref|XP_011084721.1|  PREDICTED: probable UDP-arabinopyranose muta...    321   2e-104   
gb|KDP23306.1|  hypothetical protein JCGZ_23139                         318   3e-104   
ref|XP_008370793.1|  PREDICTED: probable UDP-arabinopyranose muta...    318   4e-104   
ref|XP_002325896.1|  hypothetical protein POPTR_0019s07860g             317   8e-104   Populus trichocarpa [western balsam poplar]
ref|XP_009346829.1|  PREDICTED: probable UDP-arabinopyranose muta...    317   8e-104   
ref|XP_008370794.1|  PREDICTED: probable UDP-arabinopyranose muta...    320   1e-103   
ref|XP_011009922.1|  PREDICTED: probable UDP-arabinopyranose muta...    315   5e-103   
ref|XP_007029449.1|  Alpha-1,4-glucan-protein synthase family pro...    315   6e-103   
ref|XP_002512611.1|  Alpha-1,4-glucan-protein synthase [UDP-formi...    315   7e-103   Ricinus communis
ref|XP_007029448.1|  Alpha-1,4-glucan-protein synthase family pro...    316   1e-102   
ref|XP_006371261.1|  hypothetical protein POPTR_0019s07850g             314   1e-102   
gb|KHN40454.1|  Putative UDP-arabinopyranose mutase 5                   312   9e-102   
gb|KHG19854.1|  putative UDP-arabinopyranose mutase 5 -like protein     310   4e-101   
ref|XP_003624124.1|  Alpha-1,4-glucan-protein synthase                  310   5e-101   
ref|XP_006602836.1|  PREDICTED: probable UDP-arabinopyranose muta...    310   5e-101   
ref|XP_010038096.1|  PREDICTED: probable UDP-arabinopyranose muta...    310   6e-101   
ref|XP_004492819.1|  PREDICTED: probable UDP-arabinopyranose muta...    310   8e-101   
ref|XP_003624123.1|  Alpha-1,4-glucan-protein synthase                  312   8e-101   
ref|XP_004302139.1|  PREDICTED: probable UDP-arabinopyranose muta...    310   9e-101   
ref|XP_007139747.1|  hypothetical protein PHAVU_008G056100g             309   1e-100   
ref|XP_004492818.1|  PREDICTED: probable UDP-arabinopyranose muta...    311   1e-100   
ref|XP_004302138.1|  PREDICTED: probable UDP-arabinopyranose muta...    311   2e-100   
ref|XP_002279911.1|  PREDICTED: probable UDP-arabinopyranose muta...    309   2e-100   Vitis vinifera
gb|EYU39764.1|  hypothetical protein MIMGU_mgv1a009196mg                308   2e-100   
ref|XP_010649270.1|  PREDICTED: probable UDP-arabinopyranose muta...    311   3e-100   
gb|KHN29291.1|  Putative UDP-arabinopyranose mutase 5                   306   2e-99    
ref|XP_006587817.1|  PREDICTED: probable UDP-arabinopyranose muta...    306   2e-99    
ref|XP_008446352.1|  PREDICTED: probable UDP-arabinopyranose muta...    299   1e-96    
ref|XP_004135177.1|  PREDICTED: probable UDP-arabinopyranose muta...    299   1e-96    
ref|XP_004155310.1|  PREDICTED: LOW QUALITY PROTEIN: probable UDP...    301   3e-96    
ref|XP_004135176.1|  PREDICTED: probable UDP-arabinopyranose muta...    301   3e-96    
ref|XP_010244804.1|  PREDICTED: probable UDP-arabinopyranose muta...    300   5e-96    
ref|XP_010244805.1|  PREDICTED: probable UDP-arabinopyranose muta...    300   1e-95    
gb|KHG02400.1|  putative UDP-arabinopyranose mutase 5 -like protein     296   2e-95    
ref|XP_006428551.1|  hypothetical protein CICLE_v10013540mg             293   2e-94    
ref|XP_006491773.1|  PREDICTED: probable UDP-arabinopyranose muta...    293   2e-94    
ref|XP_006491774.1|  PREDICTED: probable UDP-arabinopyranose muta...    295   5e-94    
gb|KDO54891.1|  hypothetical protein CISIN_1g039651mg                   290   3e-93    
ref|XP_002871721.1|  hypothetical protein ARALYDRAFT_488506             290   5e-93    
ref|XP_010492563.1|  PREDICTED: probable UDP-arabinopyranose muta...    287   4e-92    
ref|XP_010420346.1|  PREDICTED: probable UDP-arabinopyranose muta...    287   5e-92    
emb|CDY55583.1|  BnaC09g41420D                                          287   6e-92    
ref|NP_197155.1|  reversably-glycosylated protein 5                     287   6e-92    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006400191.1|  hypothetical protein EUTSA_v10013999mg             287   6e-92    
ref|XP_010558589.1|  PREDICTED: probable UDP-arabinopyranose muta...    287   6e-92    
ref|XP_006289145.1|  hypothetical protein CARUB_v10002568mg             286   1e-91    
ref|XP_009121479.1|  PREDICTED: probable UDP-arabinopyranose muta...    286   1e-91    
ref|XP_010453815.1|  PREDICTED: probable UDP-arabinopyranose muta...    286   1e-91    
emb|CDX69446.1|  BnaA10g17950D                                          286   1e-91    
ref|XP_010674690.1|  PREDICTED: probable UDP-arabinopyranose muta...    280   3e-89    
ref|XP_008218418.1|  PREDICTED: LOW QUALITY PROTEIN: probable UDP...    273   6e-87    
ref|XP_010927619.1|  PREDICTED: probable UDP-arabinopyranose muta...    271   7e-86    
ref|XP_010927622.1|  PREDICTED: probable UDP-arabinopyranose muta...    273   1e-85    
ref|XP_008800968.1|  PREDICTED: probable UDP-arabinopyranose muta...    269   6e-85    
ref|XP_009402728.1|  PREDICTED: probable UDP-arabinopyranose muta...    266   4e-84    
ref|XP_004516238.1|  PREDICTED: probable UDP-arabinopyranose muta...    264   4e-82    
ref|XP_004960161.1|  PREDICTED: probable UDP-arabinopyranose muta...    248   8e-77    
ref|XP_008668126.1|  PREDICTED: alpha-1,4-glucan-protein synthase...    243   5e-75    
ref|XP_002447267.1|  hypothetical protein SORBIDRAFT_06g031590          243   6e-75    Sorghum bicolor [broomcorn]
ref|XP_008668128.1|  PREDICTED: alpha-1,4-glucan-protein synthase...    244   2e-74    
ref|NP_001054143.1|  Os04g0660400                                       240   7e-74    Oryza sativa Japonica Group [Japonica rice]
ref|XP_003580737.1|  PREDICTED: probable UDP-arabinopyranose muta...    240   1e-73    
emb|CAA09470.1|  RGP2 protein                                           240   1e-73    Oryza sativa [red rice]
ref|NP_001151577.1|  alpha-1,4-glucan-protein synthase                  240   1e-73    Zea mays [maize]
gb|EEC78175.1|  hypothetical protein OsI_17769                          241   1e-73    Oryza sativa Indica Group [Indian rice]
ref|XP_006652954.1|  PREDICTED: probable UDP-arabinopyranose muta...    238   4e-73    
ref|XP_010240553.1|  PREDICTED: probable UDP-arabinopyranose muta...    241   5e-73    
gb|AAL87194.1|AF480497_22  putative amylogenin                          240   1e-72    Oryza sativa Japonica Group [Japonica rice]
gb|AFK36248.1|  unknown                                                 229   3e-72    
emb|CAA77236.1|  amylogenin                                             236   3e-72    Triticum aestivum [Canadian hard winter wheat]
dbj|BAJ88947.1|  predicted protein                                      238   3e-72    
gb|AGV54358.1|  alpha-1,4-glucan-protein synthase [UDP-forming]-l...    216   2e-64    
ref|XP_009398248.1|  PREDICTED: UDP-arabinopyranose mutase 1-like       216   3e-64    
ref|XP_007153489.1|  hypothetical protein PHAVU_003G040000g             218   5e-64    
gb|EYU44230.1|  hypothetical protein MIMGU_mgv1a009275mg                214   1e-63    
emb|CDY26446.1|  BnaC09g42220D                                          213   2e-63    
ref|XP_006408433.1|  hypothetical protein EUTSA_v10021014mg             214   2e-63    
emb|CDX69510.1|  BnaA10g18590D                                          213   2e-63    
gb|AAB61672.1|  type IIIa membrane protein cp-wap13                     213   2e-63    Vigna unguiculata
ref|XP_008811806.1|  PREDICTED: UDP-arabinopyranose mutase 1            214   2e-63    
emb|CDX78646.1|  BnaA03g05580D                                          213   3e-63    
gb|KDO64420.1|  hypothetical protein CISIN_1g048449mg                   211   3e-63    
ref|XP_010937949.1|  PREDICTED: UDP-arabinopyranose mutase 1            213   3e-63    
emb|CDP00457.1|  unnamed protein product                                210   3e-63    
gb|ABK21236.1|  unknown                                                 213   3e-63    Picea sitchensis
emb|CDX90981.1|  BnaC02g06160D                                          213   4e-63    
emb|CDX85541.1|  BnaA02g02720D                                          213   4e-63    
ref|XP_009134656.1|  PREDICTED: UDP-arabinopyranose mutase 1-like       213   4e-63    
ref|XP_006298006.1|  hypothetical protein CARUB_v10014051mg             213   4e-63    
emb|CBI16940.3|  unnamed protein product                                210   5e-63    
ref|XP_009121556.1|  PREDICTED: UDP-arabinopyranose mutase 2            213   5e-63    
emb|CDP19977.1|  unnamed protein product                                213   6e-63    
ref|XP_010923637.1|  PREDICTED: UDP-arabinopyranose mutase 1-like       213   6e-63    
ref|XP_010463620.1|  PREDICTED: UDP-arabinopyranose mutase 1-like       212   7e-63    
ref|XP_010463051.1|  PREDICTED: UDP-arabinopyranose mutase 1            212   7e-63    
emb|CDY34712.1|  BnaA01g33130D                                          212   8e-63    
gb|AFK42305.1|  unknown                                                 209   1e-62    
emb|CDX70629.1|  BnaC03g07130D                                          211   1e-62    
ref|XP_009407384.1|  PREDICTED: UDP-arabinopyranose mutase 1            212   1e-62    
emb|CDX74267.1|  BnaA03g27800D                                          212   1e-62    
ref|XP_009117866.1|  PREDICTED: UDP-arabinopyranose mutase 1-like       212   1e-62    
ref|XP_002525910.1|  Alpha-1,4-glucan-protein synthase [UDP-formi...    209   1e-62    Ricinus communis
ref|XP_010091605.1|  UDP-arabinopyranose mutase 3                       212   1e-62    
ref|XP_006400087.1|  hypothetical protein EUTSA_v10013907mg             212   1e-62    
gb|KFK37680.1|  hypothetical protein AALP_AA3G014800                    211   1e-62    
emb|CDY43248.1|  BnaC05g48410D                                          211   1e-62    
ref|NP_186872.1|  UDP-arabinose mutase 1                                211   1e-62    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009147367.1|  PREDICTED: UDP-arabinopyranose mutase 1            211   2e-62    
ref|XP_003516432.1|  PREDICTED: alpha-1,4-glucan-protein synthase...    211   2e-62    
ref|XP_010462164.1|  PREDICTED: UDP-arabinopyranose mutase 1-like       211   2e-62    
gb|KFK25794.1|  hypothetical protein AALP_AA8G161500                    211   2e-62    
ref|XP_007210189.1|  hypothetical protein PRUPE_ppa017775mg             211   3e-62    
ref|NP_001242893.1|  uncharacterized protein LOC100809983               211   3e-62    
ref|XP_009131489.1|  PREDICTED: UDP-arabinopyranose mutase 2-like       211   3e-62    
ref|XP_006436872.1|  hypothetical protein CICLE_v10033661mg             211   4e-62    
gb|KHN29964.1|  Alpha-1,4-glucan-protein synthase [UDP-forming]         211   4e-62    
ref|XP_003614188.1|  Alpha-1 4-glucan-protein synthase                  210   4e-62    
ref|XP_010420237.1|  PREDICTED: UDP-arabinopyranose mutase 2            210   5e-62    
ref|XP_006338340.1|  PREDICTED: UDP-arabinopyranose mutase 1-like       210   5e-62    
ref|XP_010453704.1|  PREDICTED: UDP-arabinopyranose mutase 2-like       210   5e-62    
ref|XP_010492407.1|  PREDICTED: UDP-arabinopyranose mutase 2-like       210   5e-62    
ref|XP_009396438.1|  PREDICTED: UDP-arabinopyranose mutase 1-like       210   5e-62    
gb|AAC50000.1|  reversibly glycosylated polypeptide-1                   210   6e-62    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010319476.1|  PREDICTED: alpha-1,4-glucan-protein synthase...    210   6e-62    
ref|XP_002281356.1|  PREDICTED: UDP-arabinopyranose mutase 3            210   6e-62    Vitis vinifera
ref|NP_001275274.1|  alpha-1,4-glucan-protein synthase [UDP-formi...    210   6e-62    
ref|XP_009762274.1|  PREDICTED: alpha-1,4-glucan-protein synthase...    210   7e-62    
ref|XP_010029403.1|  PREDICTED: UDP-arabinopyranose mutase 1            210   7e-62    
ref|XP_009791765.1|  PREDICTED: alpha-1,4-glucan-protein synthase...    210   7e-62    
ref|XP_009596987.1|  PREDICTED: alpha-1,4-glucan-protein synthase...    209   8e-62    
gb|EMT01764.1|  Alpha-1,4-glucan-protein synthase (UDP-forming)         209   8e-62    
emb|CAN65977.1|  hypothetical protein VITISV_036160                     210   9e-62    Vitis vinifera
emb|CDM84286.1|  unnamed protein product                                209   9e-62    
ref|XP_006288007.1|  hypothetical protein CARUB_v10001241mg             209   9e-62    
ref|XP_004298551.1|  PREDICTED: UDP-arabinopyranose mutase 1-like       209   1e-61    
ref|NP_197069.1|  reversibly glycosylated polypeptide 2                 209   1e-61    Arabidopsis thaliana [mouse-ear cress]
gb|AAM65020.1|  reversibly glycosylated polypeptide-3                   209   1e-61    Arabidopsis thaliana [mouse-ear cress]
gb|AFK40119.1|  unknown                                                 209   1e-61    
gb|KEH21751.1|  alpha-1,4-glucan-protein synthase [UDP-forming]-l...    209   1e-61    
ref|XP_004232138.1|  PREDICTED: alpha-1,4-glucan-protein synthase...    209   1e-61    
ref|XP_004490223.1|  PREDICTED: alpha-1,4-glucan-protein synthase...    209   1e-61    
ref|XP_006856400.1|  hypothetical protein AMTR_s00047p00209120          209   1e-61    
ref|XP_002964765.1|  UDP-L-arabinose mutase-like protein                209   2e-61    
gb|KEH25141.1|  alpha-1,4-glucan-protein synthase [UDP-forming]-l...    208   2e-61    
ref|XP_008239501.1|  PREDICTED: UDP-arabinopyranose mutase 1-like       209   2e-61    
ref|XP_010543954.1|  PREDICTED: UDP-arabinopyranose mutase 3            204   2e-61    
ref|XP_011073091.1|  PREDICTED: UDP-arabinopyranose mutase 1-like       209   2e-61    
ref|XP_008786030.1|  PREDICTED: UDP-arabinopyranose mutase 1            209   2e-61    
ref|XP_002961235.1|  UDP-arabinose mutase                               208   2e-61    
ref|XP_006345104.1|  PREDICTED: alpha-1,4-glucan-protein synthase...    208   3e-61    
ref|XP_011021068.1|  PREDICTED: UDP-arabinopyranose mutase 1            208   3e-61    
sp|O04300.1|UPTG_PEA  RecName: Full=Alpha-1,4-glucan-protein synt...    208   3e-61    Pisum sativum [garden pea]
ref|XP_006373391.1|  type IIIa membrane protein cp-wap13                208   3e-61    
ref|XP_002961697.1|  UDP-L-arabinose mutase-like protein                209   3e-61    
ref|XP_009135081.1|  PREDICTED: UDP-arabinopyranose mutase 3            208   3e-61    
ref|XP_002871677.1|  reversibly glycosylated polypeptide-3              208   3e-61    
ref|XP_004491891.1|  PREDICTED: UDP-arabinopyranose mutase 2-like       207   4e-61    
ref|XP_009625283.1|  PREDICTED: alpha-1,4-glucan-protein synthase...    208   4e-61    
ref|NP_001234554.1|  UDP-glucose:protein transglucosylase-like pr...    208   4e-61    
gb|EMT30339.1|  Alpha-1,4-glucan-protein synthase (UDP-forming)         208   5e-61    
ref|XP_009397227.1|  PREDICTED: UDP-arabinopyranose mutase 3            207   5e-61    
emb|CAA77237.1|  reversibly glycosylated polypeptide                    207   5e-61    Triticum aestivum [Canadian hard winter wheat]
gb|KHG08185.1|  UDP-arabinopyranose mutase 1                            207   5e-61    
ref|XP_008445443.1|  PREDICTED: alpha-1,4-glucan-protein synthase...    207   6e-61    
gb|EPS67258.1|  hypothetical protein M569_07517                         207   6e-61    
ref|XP_010099313.1|  Alpha-1,4-glucan-protein synthase [UDP-formi...    207   6e-61    
gb|ABR26070.1|  alpha-1,4-glucan-protein synthase                       202   6e-61    Oryza sativa Indica Group [Indian rice]
ref|XP_011099037.1|  PREDICTED: alpha-1,4-glucan-protein synthase...    207   7e-61    
ref|XP_002947267.1|  hypothetical protein VOLCADRAFT_108916             206   9e-61    
ref|XP_010525126.1|  PREDICTED: UDP-arabinopyranose mutase 2-like       207   9e-61    
ref|XP_010260639.1|  PREDICTED: alpha-1,4-glucan-protein synthase...    207   9e-61    
ref|XP_008775857.1|  PREDICTED: alpha-1,4-glucan-protein synthase...    206   1e-60    
ref|XP_009803551.1|  PREDICTED: alpha-1,4-glucan-protein synthase...    207   1e-60    
ref|XP_007032852.1|  Reversibly glycosylated polypeptide 1              207   1e-60    
gb|AAC50001.1|  reversibly glycosylated polypeptide-2                   207   1e-60    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009590755.1|  PREDICTED: alpha-1,4-glucan-protein synthase...    207   1e-60    
gb|ABF97477.1|  Alpha-1,4-glucan-protein synthase, putative, expr...    204   1e-60    Oryza sativa Japonica Group [Japonica rice]
ref|XP_006365656.1|  PREDICTED: alpha-1,4-glucan-protein synthase...    206   1e-60    
ref|XP_006850293.1|  hypothetical protein AMTR_s00020p00173350          206   1e-60    
ref|XP_004982467.1|  PREDICTED: alpha-1,4-glucan-protein synthase...    206   2e-60    
sp|Q8RU27.1|UPTG2_SOLTU  RecName: Full=Alpha-1,4-glucan-protein s...    206   2e-60    Solanum tuberosum [potatoes]
ref|XP_011011707.1|  PREDICTED: alpha-1,4-glucan-protein synthase...    206   2e-60    
ref|XP_002316078.1|  REVERSIBLY GLYCOSYLATED POLYPEPTIDE 3 family...    206   2e-60    Populus trichocarpa [western balsam poplar]
ref|XP_006437885.1|  hypothetical protein CICLE_v10031914mg             206   2e-60    
ref|XP_004144170.1|  PREDICTED: alpha-1,4-glucan-protein synthase...    206   2e-60    
gb|KDO70314.1|  hypothetical protein CISIN_1g018080mg                   206   2e-60    
gb|EYU23070.1|  hypothetical protein MIMGU_mgv1a008625mg                206   2e-60    
gb|ABK94330.1|  unknown                                                 206   2e-60    Populus trichocarpa [western balsam poplar]
ref|XP_002458535.1|  hypothetical protein SORBIDRAFT_03g035320          206   2e-60    Sorghum bicolor [broomcorn]
ref|XP_004304212.1|  PREDICTED: alpha-1,4-glucan-protein synthase...    206   3e-60    
ref|XP_004233392.1|  PREDICTED: UDP-arabinopyranose mutase 1-like       206   3e-60    
ref|XP_003562308.1|  PREDICTED: UDP-arabinopyranose mutase 1            206   3e-60    
ref|XP_009599670.1|  PREDICTED: alpha-1,4-glucan-protein synthase...    206   3e-60    
ref|XP_008346784.1|  PREDICTED: alpha-1,4-glucan-protein synthase...    202   3e-60    
ref|XP_011078650.1|  PREDICTED: alpha-1,4-glucan-protein synthase...    205   3e-60    
gb|EMT17982.1|  Alpha-1,4-glucan-protein synthase (UDP-forming) 1       206   3e-60    
gb|EYU23625.1|  hypothetical protein MIMGU_mgv1a008906mg                205   4e-60    
dbj|BAC43271.1|  putative reversibly glycosylated polypeptide-3 RGP     200   4e-60    Arabidopsis thaliana [mouse-ear cress]
ref|XP_008464578.1|  PREDICTED: alpha-1,4-glucan-protein synthase...    205   4e-60    
ref|XP_002511153.1|  Alpha-1,4-glucan-protein synthase [UDP-formi...    205   4e-60    Ricinus communis
ref|XP_009772308.1|  PREDICTED: alpha-1,4-glucan-protein synthase...    205   4e-60    
ref|XP_010455418.1|  PREDICTED: UDP-arabinopyranose mutase 3-like       205   4e-60    
emb|CBI27314.3|  unnamed protein product                                202   5e-60    
ref|XP_004958247.1|  PREDICTED: UDP-arabinopyranose mutase 3-like       205   5e-60    
ref|XP_011008611.1|  PREDICTED: UDP-arabinopyranose mutase 1-like       205   5e-60    
ref|XP_002305394.1|  type IIIa membrane protein cp-wap13                205   5e-60    Populus trichocarpa [western balsam poplar]
ref|XP_010549987.1|  PREDICTED: UDP-arabinopyranose mutase 2-like       205   5e-60    
ref|XP_010558513.1|  PREDICTED: UDP-arabinopyranose mutase 2            205   5e-60    
ref|XP_009780946.1|  PREDICTED: alpha-1,4-glucan-protein synthase...    205   5e-60    
ref|XP_011085597.1|  PREDICTED: alpha-1,4-glucan-protein synthase...    205   6e-60    
gb|KHG14483.1|  Alpha-1,4-glucan-protein synthase [UDP-forming] 2       205   6e-60    
ref|NP_199888.1|  reversibly glycosylated polypeptide 4                 205   6e-60    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009758723.1|  PREDICTED: UDP-arabinopyranose mutase 3            205   6e-60    
ref|XP_011072963.1|  PREDICTED: UDP-arabinopyranose mutase 3-like       204   6e-60    
ref|XP_011086921.1|  PREDICTED: UDP-arabinopyranose mutase 3-like       204   7e-60    
ref|XP_007139431.1|  hypothetical protein PHAVU_008G028900g             204   8e-60    
ref|XP_010232375.1|  PREDICTED: UDP-arabinopyranose mutase 1-like       204   8e-60    
ref|XP_003531873.1|  PREDICTED: alpha-1,4-glucan-protein synthase...    204   8e-60    
gb|KHG05154.1|  UDP-arabinopyranose mutase 1                            204   8e-60    
ref|XP_008785739.1|  PREDICTED: UDP-arabinopyranose mutase 3-like       204   9e-60    
ref|XP_004234907.1|  PREDICTED: alpha-1,4-glucan-protein synthase...    204   9e-60    
ref|NP_001142134.1|  hypothetical protein                               204   9e-60    Zea mays [maize]
ref|XP_010464509.1|  PREDICTED: UDP-arabinopyranose mutase 3-like...    204   1e-59    
gb|EYU42116.1|  hypothetical protein MIMGU_mgv1a008980mg                204   1e-59    
ref|XP_006657933.1|  PREDICTED: UDP-arabinopyranose mutase 3-like       204   1e-59    
ref|XP_002460988.1|  hypothetical protein SORBIDRAFT_02g038770          204   1e-59    Sorghum bicolor [broomcorn]
ref|NP_001148994.1|  LOC100282614                                       204   1e-59    Zea mays [maize]
ref|XP_007045810.1|  Reversibly glycosylated polypeptide 3              204   1e-59    
ref|XP_009609413.1|  PREDICTED: alpha-1,4-glucan-protein synthase...    204   1e-59    
ref|XP_010694098.1|  PREDICTED: alpha-1,4-glucan-protein synthase...    204   1e-59    
ref|XP_003552602.1|  PREDICTED: UDP-arabinopyranose mutase 1-like       204   1e-59    
gb|ACN27755.1|  unknown                                                 204   1e-59    Zea mays [maize]
ref|XP_009146975.1|  PREDICTED: UDP-arabinopyranose mutase 3-like       204   1e-59    
gb|KDP24292.1|  hypothetical protein JCGZ_25588                         204   1e-59    
gb|KDP41329.1|  hypothetical protein JCGZ_15736                         204   1e-59    
ref|XP_007222173.1|  hypothetical protein PRUPE_ppa007760mg             204   1e-59    
emb|CAA77235.1|  reversibly glycosylated polypeptide                    204   2e-59    Oryza sativa [red rice]
ref|XP_010249072.1|  PREDICTED: UDP-arabinopyranose mutase 1-like       204   2e-59    
gb|KHF98767.1|  Alpha-1,4-glucan-protein synthase [UDP-forming] 2       204   2e-59    
ref|NP_001050617.1|  Os03g0599800                                       204   2e-59    Oryza sativa Japonica Group [Japonica rice]
ref|XP_008243821.1|  PREDICTED: alpha-1,4-glucan-protein synthase...    203   2e-59    
emb|CDP20181.1|  unnamed protein product                                202   2e-59    
ref|XP_007029902.1|  Alpha-1,4-glucan-protein synthase family pro...    197   2e-59    
ref|XP_011018877.1|  PREDICTED: UDP-arabinopyranose mutase 3            204   2e-59    
ref|XP_007215599.1|  hypothetical protein PRUPE_ppa007756mg             203   2e-59    
emb|CAC83750.1|  reversibly glycosylated polypeptide                    203   2e-59    Gossypium hirsutum [American cotton]
ref|XP_002318748.1|  type IIIa membrane protein cp-wap13                203   2e-59    Populus trichocarpa [western balsam poplar]
ref|XP_006650286.1|  PREDICTED: UDP-arabinopyranose mutase 1-like       204   2e-59    
gb|KDP22595.1|  hypothetical protein JCGZ_26426                         203   2e-59    
emb|CBI15334.3|  unnamed protein product                                202   2e-59    
gb|EPS71623.1|  hypothetical protein M569_03136                         203   2e-59    
ref|XP_010421937.1|  PREDICTED: UDP-arabinopyranose mutase 3-like       203   2e-59    
ref|XP_003562725.1|  PREDICTED: UDP-arabinopyranose mutase 3            203   2e-59    
gb|KHG20395.1|  Alpha-1,4-glucan-protein synthase [UDP-forming] 2       203   2e-59    
gb|ABG76000.1|  GRP-like protein 2                                      203   2e-59    Gossypium hirsutum [American cotton]
ref|XP_006430944.1|  hypothetical protein CICLE_v10011996mg             203   2e-59    
ref|XP_009393063.1|  PREDICTED: UDP-arabinopyranose mutase 1-like       203   3e-59    
ref|XP_009415135.1|  PREDICTED: UDP-arabinopyranose mutase 1-like       203   3e-59    
ref|XP_007209279.1|  hypothetical protein PRUPE_ppa007588mg             203   3e-59    
ref|XP_008240085.1|  PREDICTED: alpha-1,4-glucan-protein synthase...    203   4e-59    
ref|XP_010939210.1|  PREDICTED: UDP-arabinopyranose mutase 1-like       203   4e-59    
ref|XP_010486438.1|  PREDICTED: UDP-arabinopyranose mutase 3 isof...    202   4e-59    
ref|XP_009346197.1|  PREDICTED: alpha-1,4-glucan-protein synthase...    202   4e-59    
ref|XP_008360881.1|  PREDICTED: alpha-1,4-glucan-protein synthase...    202   4e-59    
gb|KHG19485.1|  Alpha-1,4-glucan-protein synthase [UDP-forming] 2       201   5e-59    
ref|XP_009338011.1|  PREDICTED: alpha-1,4-glucan-protein synthase...    202   5e-59    
gb|KHG07278.1|  UDP-arabinopyranose mutase 1 -like protein              202   5e-59    
ref|XP_008374655.1|  PREDICTED: alpha-1,4-glucan-protein synthase...    202   5e-59    
ref|XP_004236070.1|  PREDICTED: alpha-1,4-glucan-protein synthase...    202   5e-59    
ref|XP_004488432.1|  PREDICTED: UDP-arabinopyranose mutase 3-like       202   5e-59    
ref|XP_002311350.1|  REVERSIBLY GLYCOSYLATED POLYPEPTIDE 3 family...    202   5e-59    
ref|XP_002263926.1|  PREDICTED: alpha-1,4-glucan-protein synthase...    202   5e-59    
ref|XP_010037256.1|  PREDICTED: alpha-1,4-glucan-protein synthase...    202   6e-59    
ref|XP_004507294.1|  PREDICTED: alpha-1,4-glucan-protein synthase...    202   6e-59    
ref|XP_008230285.1|  PREDICTED: alpha-1,4-glucan-protein synthase...    202   6e-59    
ref|XP_007151376.1|  hypothetical protein PHAVU_004G041600g             202   6e-59    
ref|XP_008339787.1|  PREDICTED: alpha-1,4-glucan-protein synthase...    202   6e-59    
ref|XP_010257974.1|  PREDICTED: UDP-arabinopyranose mutase 3            202   6e-59    
ref|NP_001275026.1|  alpha-1,4-glucan-protein synthase [UDP-formi...    202   7e-59    
ref|XP_010695260.1|  PREDICTED: alpha-1,4-glucan-protein synthase...    202   7e-59    
emb|CBI15676.3|  unnamed protein product                                201   8e-59    
sp|Q9SC19.2|UPTG1_SOLTU  RecName: Full=Alpha-1,4-glucan-protein s...    202   8e-59    
ref|XP_002263490.1|  PREDICTED: UDP-arabinopyranose mutase 1            202   8e-59    
ref|XP_010442554.1|  PREDICTED: probable UDP-arabinopyranose muta...    202   8e-59    
ref|XP_011044108.1|  PREDICTED: UDP-arabinopyranose mutase 1-like...    202   9e-59    
emb|CAN69560.1|  hypothetical protein VITISV_040027                     202   9e-59    
ref|XP_008453028.1|  PREDICTED: alpha-1,4-glucan-protein synthase...    202   1e-58    
ref|XP_004299283.1|  PREDICTED: alpha-1,4-glucan-protein synthase...    202   1e-58    
gb|ACF84514.1|  unknown                                                 201   1e-58    
ref|XP_009420914.1|  PREDICTED: UDP-arabinopyranose mutase 1-like       202   1e-58    
ref|NP_001105598.1|  alpha-1,4-glucan-protein synthase [UDP-forming]    201   1e-58    
ref|XP_007037627.1|  Reversibly glycosylated polypeptide 3              201   1e-58    
ref|XP_009627053.1|  PREDICTED: alpha-1,4-glucan-protein synthase...    201   1e-58    
emb|CAH59419.1|  hypothetical protein                                   197   1e-58    
ref|XP_003544006.1|  PREDICTED: UDP-arabinopyranose mutase 1            201   1e-58    
ref|XP_004157438.1|  PREDICTED: alpha-1,4-glucan-protein synthase...    201   1e-58    
gb|KFK26700.1|  hypothetical protein AALP_AA8G282200                    201   1e-58    
gb|KHG01197.1|  UDP-arabinopyranose mutase 1                            201   1e-58    
ref|XP_002512057.1|  Alpha-1,4-glucan-protein synthase [UDP-formi...    201   1e-58    
gb|KEH38142.1|  alpha-1,4-glucan-protein synthase [UDP-forming]-l...    201   2e-58    
ref|XP_002283867.1|  PREDICTED: UDP-arabinopyranose mutase 1 isof...    201   2e-58    
gb|ACU24537.1|  unknown                                                 201   2e-58    
ref|XP_003527118.1|  PREDICTED: UDP-arabinopyranose mutase 3-like       201   2e-58    
ref|XP_011070916.1|  PREDICTED: alpha-1,4-glucan-protein synthase...    201   2e-58    
gb|KHN19595.1|  UDP-arabinopyranose mutase 3                            201   2e-58    
ref|XP_003522279.1|  PREDICTED: UDP-arabinopyranose mutase 3-like       201   2e-58    
ref|NP_187502.2|  UDP-arabinopyranose mutase 3                          201   2e-58    
gb|KFM22622.1|  Alpha-1,4-glucan-protein synthase [UDP-forming] 1       200   3e-58    
ref|XP_006402067.1|  hypothetical protein EUTSA_v10013945mg             200   3e-58    
ref|XP_004137605.1|  PREDICTED: alpha-1,4-glucan-protein synthase...    202   3e-58    
ref|XP_006440801.1|  hypothetical protein CICLE_v10020723mg             201   3e-58    
ref|XP_010092082.1|  Reversibly glycosylated polypeptide                201   3e-58    
ref|XP_004137137.1|  PREDICTED: alpha-1,4-glucan-protein synthase...    200   4e-58    
ref|XP_001693685.1|  UDP-Glucose:protein transglucosylase               200   4e-58    
gb|EMS53325.1|  Alpha-1,4-glucan-protein synthase [UDP-forming] 1       205   4e-58    
ref|XP_002464260.1|  hypothetical protein SORBIDRAFT_01g015090          200   4e-58    
ref|XP_006477708.1|  PREDICTED: UDP-arabinopyranose mutase 3-like       200   4e-58    
ref|XP_006848327.1|  hypothetical protein AMTR_s00013p00162620          200   4e-58    
ref|NP_001241418.1|  uncharacterized protein LOC100803287               200   5e-58    
ref|XP_009333665.1|  PREDICTED: alpha-1,4-glucan-protein synthase...    200   5e-58    
ref|XP_010442299.1|  PREDICTED: probable UDP-arabinopyranose muta...    200   5e-58    
ref|XP_006281448.1|  hypothetical protein CARUB_v10027526mg             200   5e-58    
ref|XP_009373784.1|  PREDICTED: alpha-1,4-glucan-protein synthase...    199   5e-58    
ref|XP_002957802.1|  hypothetical protein VOLCADRAFT_107818             199   5e-58    
ref|XP_008379448.1|  PREDICTED: UDP-arabinopyranose mutase 3            199   6e-58    
ref|XP_009134067.1|  PREDICTED: probable UDP-arabinopyranose muta...    199   6e-58    
gb|EEC82411.1|  hypothetical protein OsI_26792                          199   6e-58    
ref|NP_001060224.1|  Os07g0604800                                       199   7e-58    
emb|CDY34025.1|  BnaC03g27900D                                          199   7e-58    
ref|XP_006407735.1|  hypothetical protein EUTSA_v10022220mg             199   9e-58    
emb|CDX83155.1|  BnaA03g23510D                                          199   9e-58    
ref|XP_002514626.1|  Alpha-1,4-glucan-protein synthase [UDP-formi...    199   1e-57    
ref|XP_009359403.1|  PREDICTED: UDP-arabinopyranose mutase 1-like       199   1e-57    
ref|XP_010535275.1|  PREDICTED: probable UDP-arabinopyranose muta...    198   2e-57    
gb|KDP31375.1|  hypothetical protein JCGZ_11751                         198   2e-57    
ref|XP_002862986.1|  hypothetical protein ARALYDRAFT_333145             198   3e-57    
gb|KCW48931.1|  hypothetical protein EUGRSUZ_K02544                     198   3e-57    
ref|XP_005843564.1|  reversibly glycosylated protein                    197   4e-57    
emb|CDY00647.1|  BnaC03g36310D                                          195   4e-57    
ref|XP_011016638.1|  PREDICTED: UDP-arabinopyranose mutase 1-like       197   5e-57    
ref|XP_009344295.1|  PREDICTED: UDP-arabinopyranose mutase 1-like       197   6e-57    
ref|XP_010464508.1|  PREDICTED: UDP-arabinopyranose mutase 3-like...    197   6e-57    
ref|XP_008341803.1|  PREDICTED: alpha-1,4-glucan-protein synthase...    197   6e-57    
ref|XP_002864073.1|  hypothetical protein ARALYDRAFT_918103             197   8e-57    
ref|XP_004138333.1|  PREDICTED: UDP-arabinopyranose mutase 1-like       196   9e-57    
ref|XP_011044106.1|  PREDICTED: UDP-arabinopyranose mutase 1-like...    196   1e-56    
ref|XP_006299317.1|  hypothetical protein CARUB_v10015472mg             197   1e-56    
ref|XP_008453303.1|  PREDICTED: UDP-arabinopyranose mutase 1            196   1e-56    
ref|XP_011006288.1|  PREDICTED: alpha-1,4-glucan-protein synthase...    196   2e-56    
ref|XP_010663750.1|  PREDICTED: UDP-arabinopyranose mutase 1 isof...    196   2e-56    
ref|XP_006374431.1|  REVERSIBLY GLYCOSYLATED POLYPEPTIDE 3 family...    195   3e-56    
ref|XP_010486437.1|  PREDICTED: UDP-arabinopyranose mutase 3 isof...    196   3e-56    
ref|XP_009781345.1|  PREDICTED: alpha-1,4-glucan-protein synthase...    194   4e-56    
ref|XP_009602147.1|  PREDICTED: alpha-1,4-glucan-protein synthase...    194   5e-56    
ref|XP_009134066.1|  PREDICTED: probable UDP-arabinopyranose muta...    194   6e-56    
gb|KFK38277.1|  hypothetical protein AALP_AA3G093300                    194   6e-56    
ref|XP_010442289.1|  PREDICTED: probable UDP-arabinopyranose muta...    195   6e-56    
ref|XP_002884703.1|  hypothetical protein ARALYDRAFT_317692             194   1e-55    
ref|XP_009408634.1|  PREDICTED: alpha-1,4-glucan-protein synthase...    192   2e-55    
ref|XP_009408633.1|  PREDICTED: alpha-1,4-glucan-protein synthase...    193   2e-55    
ref|XP_006351518.1|  PREDICTED: alpha-1,4-glucan-protein synthase...    192   3e-55    
ref|XP_001770932.1|  predicted protein                                  192   3e-55    
emb|CDY64941.1|  BnaA05g37110D                                          192   3e-55    
ref|XP_006482427.1|  PREDICTED: LOW QUALITY PROTEIN: UDP-arabinop...    192   3e-55    
ref|XP_001770887.1|  predicted protein                                  192   4e-55    
ref|XP_001764207.1|  predicted protein                                  192   4e-55    
ref|XP_005646903.1|  UDP-forming alpha-1,4-glucan-protein synthase      192   4e-55    
ref|XP_004234337.1|  PREDICTED: alpha-1,4-glucan-protein synthase...    192   4e-55    
ref|XP_001764137.1|  predicted protein                                  192   4e-55    
gb|AAF07834.1|AC010871_10  putative reversibly glycosylatable pol...    192   5e-55    
ref|XP_007138376.1|  hypothetical protein PHAVU_009G203300g             192   7e-55    
ref|XP_001764208.1|  predicted protein                                  191   8e-55    
emb|CDP14996.1|  unnamed protein product                                191   2e-54    
gb|KDD75206.1|  reversibly glycosylated polypeptide                     188   1e-53    
gb|EPS68143.1|  hypothetical protein M569_06629                         187   3e-53    
gb|AAB61671.1|  type IIIa membrane protein cp-wap11                     186   5e-53    
ref|XP_002958792.1|  hypothetical protein VOLCADRAFT_108319             187   5e-53    
ref|XP_011006287.1|  PREDICTED: alpha-1,4-glucan-protein synthase...    187   8e-53    
ref|XP_010317538.1|  PREDICTED: alpha-1,4-glucan-protein synthase...    186   1e-52    
gb|AEQ94119.1|  putative reversibly glycosylatable polypeptide          178   5e-52    
ref|XP_002993064.1|  UDP-arabinose mutase-like protein                  179   2e-50    
ref|XP_002971912.1|  UDP-arabinose mutase-like protein                  179   2e-50    
gb|KDO65674.1|  hypothetical protein CISIN_1g0178621mg                  177   1e-49    
gb|ACU19796.1|  unknown                                                 173   3e-48    
emb|CDX73947.1|  BnaA03g31000D                                          167   9e-48    
ref|XP_006391052.1|  hypothetical protein EUTSA_v100196160mg            167   2e-47    
emb|CAA09469.1|  RGP1 protein                                           166   2e-45    
ref|XP_002322275.1|  type IIIa membrane protein cp-wap13                166   3e-45    
gb|KDO72286.1|  hypothetical protein CISIN_1g038078mg                   160   7e-45    
gb|EEC75700.1|  hypothetical protein OsI_12519                          162   3e-44    
ref|XP_010417228.1|  PREDICTED: UDP-arabinopyranose mutase 1-like       157   8e-44    
gb|AFW90628.1|  UDP-glucose protein transglucosylase                    156   1e-43    
emb|CAN80500.1|  hypothetical protein VITISV_031831                     164   3e-43    
ref|XP_010265047.1|  PREDICTED: UDP-arabinopyranose mutase 3-like       160   7e-43    
tpg|DAA41390.1|  TPA: hypothetical protein ZEAMMB73_184776              158   5e-42    
gb|KCW83759.1|  hypothetical protein EUGRSUZ_B00630                     156   6e-42    
emb|CDY27964.1|  BnaC05g43660D                                          155   7e-42    
gb|AFK48049.1|  unknown                                                 150   4e-41    
emb|CDX85502.1|  BnaA02g03110D                                          145   7e-40    
dbj|BAD93611.1|  hypothetical protein                                   144   2e-39    
emb|CDX78695.1|  BnaA03g06070D                                          136   2e-36    
ref|XP_007224860.1|  hypothetical protein PRUPE_ppa022800mg             142   2e-35    
ref|XP_008657957.1|  PREDICTED: alpha-1,4-glucan-protein synthase...    132   3e-33    
gb|AFK39536.1|  unknown                                                 127   1e-32    
emb|CDY38107.1|  BnaC02g06660D                                          127   2e-32    
gb|AFW85005.1|  hypothetical protein ZEAMMB73_417932                    126   2e-30    
gb|KDO64418.1|  hypothetical protein CISIN_1g0451452mg                  119   4e-30    
gb|AFK37490.1|  unknown                                                 118   3e-29    
ref|XP_010456545.1|  PREDICTED: UDP-arabinopyranose mutase 2-like       112   2e-27    
ref|XP_004173666.1|  PREDICTED: alpha-1,4-glucan-protein synthase...    110   2e-26    
ref|XP_001774689.1|  predicted protein                                  115   3e-26    
ref|XP_008657956.1|  PREDICTED: alpha-1,4-glucan-protein synthase...    107   7e-25    
gb|AAT08665.1|  reversibly glycosylated polypeptide                     104   2e-23    
gb|EYU28881.1|  hypothetical protein MIMGU_mgv11b024632mg               104   5e-23    
gb|KDO70315.1|  hypothetical protein CISIN_1g018080mg                   103   1e-22    
gb|KDO70316.1|  hypothetical protein CISIN_1g018080mg                   103   1e-22    
gb|EAY90896.1|  hypothetical protein OsI_12510                        89.4    1e-18    
ref|XP_008666193.1|  PREDICTED: UDP-arabinopyranose mutase 3-like     90.1    1e-18    
tpg|DAA56857.1|  TPA: hypothetical protein ZEAMMB73_581550            91.7    2e-18    
ref|XP_008675851.1|  PREDICTED: UDP-arabinopyranose mutase 3-like     89.7    3e-18    
tpg|DAA54446.1|  TPA: putative RING zinc finger domain superfamil...  90.1    1e-17    
ref|XP_002960478.1|  UDP-arabinopyranose mutase-like protein          88.2    5e-17    
ref|XP_002967246.1|  UDP-arabinopyranose mutase-like protein          87.0    1e-16    
emb|CBI17670.3|  unnamed protein product                              84.0    2e-16    
gb|KCW84538.1|  hypothetical protein EUGRSUZ_B01380                   84.0    7e-16    
gb|AAF91484.1|  putative Golgi-associated protein                     64.7    3e-10    
gb|AFW73897.1|  hypothetical protein ZEAMMB73_294153                  64.7    1e-08    
emb|CDM82620.1|  unnamed protein product                              60.5    2e-08    
tpg|DAA38808.1|  TPA: hypothetical protein ZEAMMB73_533077            58.5    6e-08    
ref|WP_021072896.1|  hypothetical protein                             55.5    1e-05    
sp|P85413.1|UPTG_PHODC  RecName: Full=Alpha-1,4-glucan-protein sy...  49.7    8e-05    
gb|AEW08575.1|  hypothetical protein CL580Contig1_03                  49.7    1e-04    
ref|WP_008420341.1|  alpha-1,4-glucan-protein synthase                52.8    1e-04    
ref|WP_015410404.1|  homolog to arabinopyranose mutase                51.6    3e-04    
ref|WP_021054225.1|  putative glucan-protein synthase, RGP family...  51.2    4e-04    
ref|WP_023501381.1|  putative glucan-protein synthase, RGP family...  50.8    5e-04    
ref|WP_009375065.1|  hypothetical protein                             50.4    6e-04    
gb|ERG88183.1|  putative glucan-protein synthase, RGP family protein  50.4    6e-04    
ref|WP_008011326.1|  Alpha-1,4-glucan-protein synthase, UDP-forming   50.1    9e-04    
ref|XP_008661254.1|  PREDICTED: heat shock 70 kDa protein 14-like     49.7    9e-04    



>ref|XP_009779067.1| PREDICTED: probable UDP-arabinopyranose mutase 5 [Nicotiana sylvestris]
Length=348

 Score =   335 bits (860),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 157/189 (83%), Positives = 173/189 (92%), Gaps = 0/189 (0%)
 Frame = +2

Query  2    SCALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGP  181
            SCALSCGL LN+AD DAPTQALKP  RN+RYVDAVLTVPARA+MP+SGINIAFDRELVGP
Sbjct  159  SCALSCGLCLNLADLDAPTQALKPALRNTRYVDAVLTVPARAMMPLSGINIAFDRELVGP  218

Query  182  ALSPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRKERGNAIESLKK  361
            AL P+FRLAKEG  RWETVED+W+GMCVKVVCDHLG GVK+GLPYVWRKERG+A+ESLKK
Sbjct  219  ALLPSFRLAKEGKFRWETVEDIWTGMCVKVVCDHLGYGVKTGLPYVWRKERGDAVESLKK  278

Query  362  EWEGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEWV  541
            EWEGVKLMEE+VPFFQS+RLSP A T EDCV EIAAAVKEQLG+  PVF+RAAD+MVEWV
Sbjct  279  EWEGVKLMEEVVPFFQSMRLSPAANTAEDCVVEIAAAVKEQLGQIDPVFTRAADSMVEWV  338

Query  542  ELWNDVKTQ  568
            +LW  VKTQ
Sbjct  339  KLWKTVKTQ  347



>ref|XP_004237490.1| PREDICTED: probable UDP-arabinopyranose mutase 5 [Solanum lycopersicum]
Length=348

 Score =   335 bits (858),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 156/189 (83%), Positives = 174/189 (92%), Gaps = 0/189 (0%)
 Frame = +2

Query  2    SCALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGP  181
            SCALSCGLWLN+AD DAPTQALKP+ RN+RYVDAVLTVPARA+MP+SGINIAFDRELVGP
Sbjct  159  SCALSCGLWLNLADLDAPTQALKPELRNTRYVDAVLTVPARAMMPMSGINIAFDRELVGP  218

Query  182  ALSPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRKERGNAIESLKK  361
            AL P+F+LAKEG  RWETVEDVW+GMCVKVVCDHLG GVK+GLPYVWRKERGNAI SLKK
Sbjct  219  ALLPSFKLAKEGKFRWETVEDVWTGMCVKVVCDHLGYGVKTGLPYVWRKERGNAIGSLKK  278

Query  362  EWEGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEWV  541
            EWEGVKLMEE+VPFFQS++L+P A T EDCV EIAAAVKEQLG+  PVF+RAAD+MVEWV
Sbjct  279  EWEGVKLMEEVVPFFQSMKLTPAAKTAEDCVIEIAAAVKEQLGRIDPVFTRAADSMVEWV  338

Query  542  ELWNDVKTQ  568
            +LW  VKT+
Sbjct  339  QLWKAVKTR  347



>ref|XP_006340504.1| PREDICTED: probable UDP-arabinopyranose mutase 5-like [Solanum 
tuberosum]
Length=348

 Score =   335 bits (858),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 155/189 (82%), Positives = 175/189 (93%), Gaps = 0/189 (0%)
 Frame = +2

Query  2    SCALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGP  181
            SCALSCGLWLN+AD DAPTQALKP+ RN+RYVDAVLTVPARA+MP+SGINIAFDRELVGP
Sbjct  159  SCALSCGLWLNLADLDAPTQALKPELRNTRYVDAVLTVPARAMMPLSGINIAFDRELVGP  218

Query  182  ALSPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRKERGNAIESLKK  361
            AL P+F+LAKEG  RWETVEDVW+GMCVKVVCDHLG G+K+GLPYVWRKERG+AIESLKK
Sbjct  219  ALLPSFKLAKEGKFRWETVEDVWTGMCVKVVCDHLGYGLKTGLPYVWRKERGDAIESLKK  278

Query  362  EWEGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEWV  541
            EWEGVKLMEE+VPFFQS++L+P A T EDCV EIAAAVKEQLG+  PVF+RAAD+MVEWV
Sbjct  279  EWEGVKLMEEVVPFFQSMKLTPAAKTAEDCVIEIAAAVKEQLGRIDPVFTRAADSMVEWV  338

Query  542  ELWNDVKTQ  568
            +LW  VKT+
Sbjct  339  QLWKTVKTR  347



>ref|XP_009604203.1| PREDICTED: probable UDP-arabinopyranose mutase 5 [Nicotiana tomentosiformis]
Length=348

 Score =   333 bits (853),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 154/189 (81%), Positives = 172/189 (91%), Gaps = 0/189 (0%)
 Frame = +2

Query  2    SCALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGP  181
            SCALSCGL LN+AD DAPTQALKP  RN+RYVDAVLTVPARA+MP+SGIN+AFDRELVGP
Sbjct  159  SCALSCGLCLNLADLDAPTQALKPALRNTRYVDAVLTVPARAMMPLSGINVAFDRELVGP  218

Query  182  ALSPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRKERGNAIESLKK  361
            AL P+FRLAKEG  RWETVED+W+GMCVKVVCDH+G GVK+GLPYVWRKERG+A+ESLKK
Sbjct  219  ALLPSFRLAKEGKFRWETVEDIWTGMCVKVVCDHMGYGVKTGLPYVWRKERGDAVESLKK  278

Query  362  EWEGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEWV  541
            EWEGVKLMEE+VPFFQS+RLSP A T EDCV EIAAAVKEQLG+  PVF+RAAD+MVEWV
Sbjct  279  EWEGVKLMEEVVPFFQSMRLSPAANTAEDCVVEIAAAVKEQLGRIDPVFTRAADSMVEWV  338

Query  542  ELWNDVKTQ  568
            +LW  V TQ
Sbjct  339  KLWKTVTTQ  347



>emb|CDP04238.1| unnamed protein product [Coffea canephora]
Length=354

 Score =   324 bits (831),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 151/191 (79%), Positives = 170/191 (89%), Gaps = 0/191 (0%)
 Frame = +2

Query  5    CALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGPA  184
            C LSCGLWLN+ADYDAPTQALKP QRNSR+VDAVLTVPARA++PVSGINI FDRELVGPA
Sbjct  161  CGLSCGLWLNLADYDAPTQALKPGQRNSRFVDAVLTVPARAMLPVSGINIGFDRELVGPA  220

Query  185  LSPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRKERGNAIESLKKE  364
            + PAFRLAKEG  RWETVED+WSGMCVKV+CDHLG GVKSGLPYVWR ERGNA+ESLKKE
Sbjct  221  MVPAFRLAKEGKFRWETVEDIWSGMCVKVICDHLGYGVKSGLPYVWRNERGNAVESLKKE  280

Query  365  WEGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEWVE  544
            WEGVKLMEE+VPFFQS+RLS  A T EDCV E+AAAVKE+L    PVF+RA++AMVEWV+
Sbjct  281  WEGVKLMEEVVPFFQSMRLSQGAVTAEDCVIEMAAAVKERLEPLDPVFARASEAMVEWVK  340

Query  545  LWNDVKTQ*TN  577
            LW  V ++ +N
Sbjct  341  LWKVVTSRLSN  351



>ref|XP_007205460.1| hypothetical protein PRUPE_ppa007906mg [Prunus persica]
 ref|XP_007205461.1| hypothetical protein PRUPE_ppa007906mg [Prunus persica]
 gb|EMJ06659.1| hypothetical protein PRUPE_ppa007906mg [Prunus persica]
 gb|EMJ06660.1| hypothetical protein PRUPE_ppa007906mg [Prunus persica]
Length=351

 Score =   322 bits (825),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 149/189 (79%), Positives = 170/189 (90%), Gaps = 0/189 (0%)
 Frame = +2

Query  2    SCALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGP  181
            +CALSCGLWLN+ADYDAPTQALKP+QRNSRYVDAV+TVP R+LMPVSGINIAF+RE+VGP
Sbjct  159  TCALSCGLWLNLADYDAPTQALKPEQRNSRYVDAVMTVPVRSLMPVSGINIAFNREVVGP  218

Query  182  ALSPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRKERGNAIESLKK  361
            AL PA RLA EG LRWETVED+WSGMCVKV+CDHLGLGVKSG+PYVWR+ERG+AIESLKK
Sbjct  219  ALFPALRLAGEGKLRWETVEDIWSGMCVKVICDHLGLGVKSGIPYVWRRERGDAIESLKK  278

Query  362  EWEGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEWV  541
            EWEGVKLMEE+VPFFQS+RL   A T EDCV E+A +VKEQLGK  P+F+RAADAM +WV
Sbjct  279  EWEGVKLMEEVVPFFQSVRLPQTAVTAEDCVVEMAKSVKEQLGKVDPMFARAADAMGDWV  338

Query  542  ELWNDVKTQ  568
            +LW  V + 
Sbjct  339  KLWKSVGSS  347



>ref|XP_011084720.1| PREDICTED: probable UDP-arabinopyranose mutase 5 isoform X1 [Sesamum 
indicum]
Length=348

 Score =   320 bits (819),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 145/187 (78%), Positives = 167/187 (89%), Gaps = 0/187 (0%)
 Frame = +2

Query  5    CALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGPA  184
            C LSCGLWLN+ADYDAPTQALKP  RNSRYVDAVLTVPAR ++P+SGINIAF+ ELVGP 
Sbjct  161  CGLSCGLWLNLADYDAPTQALKPSARNSRYVDAVLTVPARTMLPLSGINIAFNNELVGPT  220

Query  185  LSPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRKERGNAIESLKKE  364
            L PAFRLAKEG  RWETVED+W+GMC KVVCDHL LGVKSGLPYVWR+ERGNA+ESLKKE
Sbjct  221  LLPAFRLAKEGKFRWETVEDIWTGMCAKVVCDHLRLGVKSGLPYVWRQERGNAVESLKKE  280

Query  365  WEGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEWVE  544
            WEGV+LMEE+VPFFQS+RLS  A T EDC+ EIAA+VKEQLG+S P+F+RAA+ MVEW++
Sbjct  281  WEGVQLMEEVVPFFQSVRLSEAAVTAEDCIAEIAASVKEQLGRSNPMFARAAENMVEWIK  340

Query  545  LWNDVKT  565
            LW  V++
Sbjct  341  LWKQVRS  347



>ref|XP_008366889.1| PREDICTED: probable UDP-arabinopyranose mutase 5 [Malus domestica]
Length=351

 Score =   320 bits (819),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 145/189 (77%), Positives = 168/189 (89%), Gaps = 0/189 (0%)
 Frame = +2

Query  2    SCALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGP  181
            +CALSCGLWLN+ADYDAPTQALKP+QRNSRYVDAV+TVP R+LMPVSGINIAFDRE+VGP
Sbjct  159  TCALSCGLWLNLADYDAPTQALKPEQRNSRYVDAVMTVPVRSLMPVSGINIAFDREVVGP  218

Query  182  ALSPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRKERGNAIESLKK  361
            AL PA RL+ EG +RWETVED+WSGMCVKV+CDHLG+GVK+G+PYVWRKERG+AIESLKK
Sbjct  219  ALFPALRLSAEGKIRWETVEDIWSGMCVKVICDHLGIGVKTGIPYVWRKERGDAIESLKK  278

Query  362  EWEGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEWV  541
            EW+GVKLMEE+VPFFQS+RL   A T EDCV ++A AVKEQLGK  P+F RA DAM +WV
Sbjct  279  EWZGVKLMEEVVPFFQSVRLPRSAVTAEDCVVDMAKAVKEQLGKVDPMFVRAGDAMADWV  338

Query  542  ELWNDVKTQ  568
            +LW  V + 
Sbjct  339  KLWKSVGSS  347



>ref|XP_009337977.1| PREDICTED: probable UDP-arabinopyranose mutase 5 isoform X1 [Pyrus 
x bretschneideri]
Length=351

 Score =   320 bits (819),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 145/189 (77%), Positives = 168/189 (89%), Gaps = 0/189 (0%)
 Frame = +2

Query  2    SCALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGP  181
            +CALSCGLWLN+ADYDAPTQALKP+QRNSRYVDAV+TVP R+LMPVSGINIAFDRE+VGP
Sbjct  159  TCALSCGLWLNLADYDAPTQALKPEQRNSRYVDAVMTVPVRSLMPVSGINIAFDREVVGP  218

Query  182  ALSPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRKERGNAIESLKK  361
            AL PA RL+ EG +RWETVED+WSGMCVKV+CDH+G+GVK+G+PYVWRKERG+AIESLKK
Sbjct  219  ALFPALRLSAEGKIRWETVEDIWSGMCVKVICDHMGIGVKTGIPYVWRKERGDAIESLKK  278

Query  362  EWEGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEWV  541
            EWEGVKLMEE+VPFFQS+RL   A T EDCV ++A AVKEQLGK  P+F+RA DAM +WV
Sbjct  279  EWEGVKLMEEVVPFFQSVRLPRSAVTAEDCVVDMARAVKEQLGKVDPMFARAGDAMADWV  338

Query  542  ELWNDVKTQ  568
             LW  V + 
Sbjct  339  RLWKSVGSS  347



>ref|XP_008355840.1| PREDICTED: probable UDP-arabinopyranose mutase 5 [Malus domestica]
Length=351

 Score =   320 bits (819),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 145/189 (77%), Positives = 169/189 (89%), Gaps = 0/189 (0%)
 Frame = +2

Query  2    SCALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGP  181
            +CALSCGLWLN+ADYDAPTQALKP+QRNSRYVDAV+TVP R+LMPVSGINIAFDRE+VGP
Sbjct  159  TCALSCGLWLNLADYDAPTQALKPEQRNSRYVDAVMTVPVRSLMPVSGINIAFDREVVGP  218

Query  182  ALSPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRKERGNAIESLKK  361
            AL PA RL+ EG +RWETVED+WSGMCVKV+CDHLG+G+K+G+PYVWRKERG+AIESLKK
Sbjct  219  ALFPALRLSAEGKIRWETVEDLWSGMCVKVICDHLGIGIKTGIPYVWRKERGDAIESLKK  278

Query  362  EWEGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEWV  541
            EWEGVKLMEE+VPFFQS+RL   A T EDCV ++A AVKEQLGK  P+F+RA DAM +WV
Sbjct  279  EWEGVKLMEEVVPFFQSVRLPRSAVTAEDCVVDMAKAVKEQLGKVDPMFARAGDAMADWV  338

Query  542  ELWNDVKTQ  568
            +LW  V + 
Sbjct  339  KLWKSVGSS  347



>ref|XP_010111044.1| putative UDP-arabinopyranose mutase 5 [Morus notabilis]
 gb|EXC29906.1| putative UDP-arabinopyranose mutase 5 [Morus notabilis]
Length=350

 Score =   319 bits (818),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 150/188 (80%), Positives = 163/188 (87%), Gaps = 0/188 (0%)
 Frame = +2

Query  5    CALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGPA  184
            CALSCGLWLN+ADYDAPTQALKP+QRNSRYVDAVLTVPARALMP+SGINIAFDRELVGPA
Sbjct  161  CALSCGLWLNLADYDAPTQALKPEQRNSRYVDAVLTVPARALMPMSGINIAFDRELVGPA  220

Query  185  LSPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRKERGNAIESLKKE  364
            L PA RLA EG LRWET+ED+WSGMC KVVCDHLG GVKSGLPYVWR ERGNAI+SL+KE
Sbjct  221  LFPALRLAGEGKLRWETMEDIWSGMCAKVVCDHLGFGVKSGLPYVWRTERGNAIDSLRKE  280

Query  365  WEGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEWVE  544
            WEGVKLMEE+VPFFQ+LRL       EDCV E+A  VKEQLGK  PVF RAA+AMV+WV 
Sbjct  281  WEGVKLMEEVVPFFQALRLKRTTVKAEDCVIEVAKEVKEQLGKVDPVFGRAAEAMVDWVR  340

Query  545  LWNDVKTQ  568
            LW  V + 
Sbjct  341  LWRAVGSS  348



>ref|XP_009337978.1| PREDICTED: probable UDP-arabinopyranose mutase 5 isoform X2 [Pyrus 
x bretschneideri]
Length=429

 Score =   321 bits (823),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 145/189 (77%), Positives = 168/189 (89%), Gaps = 0/189 (0%)
 Frame = +2

Query  2    SCALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGP  181
            +CALSCGLWLN+ADYDAPTQALKP+QRNSRYVDAV+TVP R+LMPVSGINIAFDRE+VGP
Sbjct  237  TCALSCGLWLNLADYDAPTQALKPEQRNSRYVDAVMTVPVRSLMPVSGINIAFDREVVGP  296

Query  182  ALSPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRKERGNAIESLKK  361
            AL PA RL+ EG +RWETVED+WSGMCVKV+CDH+G+GVK+G+PYVWRKERG+AIESLKK
Sbjct  297  ALFPALRLSAEGKIRWETVEDIWSGMCVKVICDHMGIGVKTGIPYVWRKERGDAIESLKK  356

Query  362  EWEGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEWV  541
            EWEGVKLMEE+VPFFQS+RL   A T EDCV ++A AVKEQLGK  P+F+RA DAM +WV
Sbjct  357  EWEGVKLMEEVVPFFQSVRLPRSAVTAEDCVVDMARAVKEQLGKVDPMFARAGDAMADWV  416

Query  542  ELWNDVKTQ  568
             LW  V + 
Sbjct  417  RLWKSVGSS  425



>ref|XP_011084721.1| PREDICTED: probable UDP-arabinopyranose mutase 5 isoform X2 [Sesamum 
indicum]
Length=426

 Score =   321 bits (823),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 145/187 (78%), Positives = 167/187 (89%), Gaps = 0/187 (0%)
 Frame = +2

Query  5    CALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGPA  184
            C LSCGLWLN+ADYDAPTQALKP  RNSRYVDAVLTVPAR ++P+SGINIAF+ ELVGP 
Sbjct  239  CGLSCGLWLNLADYDAPTQALKPSARNSRYVDAVLTVPARTMLPLSGINIAFNNELVGPT  298

Query  185  LSPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRKERGNAIESLKKE  364
            L PAFRLAKEG  RWETVED+W+GMC KVVCDHL LGVKSGLPYVWR+ERGNA+ESLKKE
Sbjct  299  LLPAFRLAKEGKFRWETVEDIWTGMCAKVVCDHLRLGVKSGLPYVWRQERGNAVESLKKE  358

Query  365  WEGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEWVE  544
            WEGV+LMEE+VPFFQS+RLS  A T EDC+ EIAA+VKEQLG+S P+F+RAA+ MVEW++
Sbjct  359  WEGVQLMEEVVPFFQSVRLSEAAVTAEDCIAEIAASVKEQLGRSNPMFARAAENMVEWIK  418

Query  545  LWNDVKT  565
            LW  V++
Sbjct  419  LWKQVRS  425



>gb|KDP23306.1| hypothetical protein JCGZ_23139 [Jatropha curcas]
Length=348

 Score =   318 bits (815),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 146/183 (80%), Positives = 166/183 (91%), Gaps = 0/183 (0%)
 Frame = +2

Query  2    SCALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGP  181
            +CALSCGLWLN+AD+DAPTQALKP QRNSRYVDAV+TVPARA+MP+SGINIAFDRELVGP
Sbjct  159  ACALSCGLWLNLADFDAPTQALKPGQRNSRYVDAVMTVPARAMMPISGINIAFDRELVGP  218

Query  182  ALSPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRKERGNAIESLKK  361
            AL PA +LA EG LRWET+ED+WSGMCVKVVCDHLGLGVKSGLPYVWRK+RGNAI+SLKK
Sbjct  219  ALLPALKLAGEGKLRWETMEDIWSGMCVKVVCDHLGLGVKSGLPYVWRKDRGNAIDSLKK  278

Query  362  EWEGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEWV  541
            EWEG+KLMEE+VPFFQS+RL   A T EDCV EIA AVK+QLG   PVF+RA +AM EW+
Sbjct  279  EWEGMKLMEEVVPFFQSVRLPRTAATAEDCVIEIATAVKQQLGPLDPVFTRAGEAMFEWI  338

Query  542  ELW  550
            ++W
Sbjct  339  KIW  341



>ref|XP_008370793.1| PREDICTED: probable UDP-arabinopyranose mutase 5 isoform X1 [Malus 
domestica]
Length=351

 Score =   318 bits (815),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 145/189 (77%), Positives = 168/189 (89%), Gaps = 0/189 (0%)
 Frame = +2

Query  2    SCALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGP  181
            +CALSCGLWLN+ADYDAPTQALKP+QRNSRYVDAV+TVP R+LMPVSGINIAFDRE+VGP
Sbjct  159  TCALSCGLWLNLADYDAPTQALKPEQRNSRYVDAVMTVPVRSLMPVSGINIAFDREVVGP  218

Query  182  ALSPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRKERGNAIESLKK  361
            AL PA RL+ EG +RWETVED+WSGMCVKV+CDHLG+G K+G+PYVWRKERG+AIESLKK
Sbjct  219  ALFPALRLSAEGKIRWETVEDLWSGMCVKVICDHLGIGXKTGIPYVWRKERGDAIESLKK  278

Query  362  EWEGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEWV  541
            EWEGVKLMEE+VPFFQS+RL   A T EDCV ++A AVKEQLGK  P+F+RA DAM +WV
Sbjct  279  EWEGVKLMEEVVPFFQSVRLPRSAVTAEDCVVDMAKAVKEQLGKVDPMFARAGDAMADWV  338

Query  542  ELWNDVKTQ  568
            +LW  V + 
Sbjct  339  KLWKSVGSS  347



>ref|XP_002325896.1| hypothetical protein POPTR_0019s07860g [Populus trichocarpa]
 gb|EEF00278.1| hypothetical protein POPTR_0019s07860g [Populus trichocarpa]
Length=351

 Score =   317 bits (813),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 147/188 (78%), Positives = 167/188 (89%), Gaps = 0/188 (0%)
 Frame = +2

Query  2    SCALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGP  181
            +CALSCGLWLN+AD DAPTQALKP QRNSRYVDAV+T+P+RA+MP+SGINIAFDRE VGP
Sbjct  159  TCALSCGLWLNLADLDAPTQALKPGQRNSRYVDAVMTIPSRAMMPISGINIAFDREAVGP  218

Query  182  ALSPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRKERGNAIESLKK  361
            AL PA +LA EGNLRWET+ED+WSGMCVKVVCDHLGLGVKSGLPYVWRK+RG+AIESLKK
Sbjct  219  ALLPALKLAGEGNLRWETMEDIWSGMCVKVVCDHLGLGVKSGLPYVWRKDRGSAIESLKK  278

Query  362  EWEGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEWV  541
            EWEGVKL EEIVPFFQ +RL   A T EDC+ E+A  VK+QLG S PVF+RAA+AMVEWV
Sbjct  279  EWEGVKLTEEIVPFFQLVRLPQTAATTEDCILEMATTVKQQLGPSNPVFTRAAEAMVEWV  338

Query  542  ELWNDVKT  565
            +LW  V +
Sbjct  339  KLWKAVGS  346



>ref|XP_009346829.1| PREDICTED: probable UDP-arabinopyranose mutase 5 [Pyrus x bretschneideri]
Length=351

 Score =   317 bits (813),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 144/189 (76%), Positives = 167/189 (88%), Gaps = 0/189 (0%)
 Frame = +2

Query  2    SCALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGP  181
            +CALSCGLWLN+ADYDAPTQALKP+QRNSRYVDAV+TVP R+LMPVSGINIAFDRE+VGP
Sbjct  159  TCALSCGLWLNLADYDAPTQALKPEQRNSRYVDAVMTVPVRSLMPVSGINIAFDREVVGP  218

Query  182  ALSPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRKERGNAIESLKK  361
             L PA RL+ EG +RWETVED+WSGMC+KV+CDHLG+GVK+G+PYVWRKERG+AIESLKK
Sbjct  219  TLFPALRLSAEGKIRWETVEDIWSGMCMKVICDHLGIGVKTGIPYVWRKERGDAIESLKK  278

Query  362  EWEGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEWV  541
            EWEGVKLMEE+VPFFQS+RL   A T EDCV ++A AVKEQLGK  P+F RA DAM +WV
Sbjct  279  EWEGVKLMEEVVPFFQSVRLPRSAVTAEDCVVDMAKAVKEQLGKVDPMFIRAGDAMADWV  338

Query  542  ELWNDVKTQ  568
            +LW  V + 
Sbjct  339  KLWKSVGSS  347



>ref|XP_008370794.1| PREDICTED: probable UDP-arabinopyranose mutase 5 isoform X2 [Malus 
domestica]
Length=429

 Score =   320 bits (819),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 145/189 (77%), Positives = 168/189 (89%), Gaps = 0/189 (0%)
 Frame = +2

Query  2    SCALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGP  181
            +CALSCGLWLN+ADYDAPTQALKP+QRNSRYVDAV+TVP R+LMPVSGINIAFDRE+VGP
Sbjct  237  TCALSCGLWLNLADYDAPTQALKPEQRNSRYVDAVMTVPVRSLMPVSGINIAFDREVVGP  296

Query  182  ALSPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRKERGNAIESLKK  361
            AL PA RL+ EG +RWETVED+WSGMCVKV+CDHLG+G K+G+PYVWRKERG+AIESLKK
Sbjct  297  ALFPALRLSAEGKIRWETVEDLWSGMCVKVICDHLGIGXKTGIPYVWRKERGDAIESLKK  356

Query  362  EWEGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEWV  541
            EWEGVKLMEE+VPFFQS+RL   A T EDCV ++A AVKEQLGK  P+F+RA DAM +WV
Sbjct  357  EWEGVKLMEEVVPFFQSVRLPRSAVTAEDCVVDMAKAVKEQLGKVDPMFARAGDAMADWV  416

Query  542  ELWNDVKTQ  568
            +LW  V + 
Sbjct  417  KLWKSVGSS  425



>ref|XP_011009922.1| PREDICTED: probable UDP-arabinopyranose mutase 5 [Populus euphratica]
 ref|XP_011009923.1| PREDICTED: probable UDP-arabinopyranose mutase 5 [Populus euphratica]
Length=351

 Score =   315 bits (808),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 146/188 (78%), Positives = 166/188 (88%), Gaps = 0/188 (0%)
 Frame = +2

Query  2    SCALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGP  181
            +CALSCGLWLN+AD DAPTQALKP QRNSRYVDAV+T+P+RA+MP+SGINIAFDRE VGP
Sbjct  159  TCALSCGLWLNLADLDAPTQALKPGQRNSRYVDAVMTIPSRAMMPISGINIAFDREAVGP  218

Query  182  ALSPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRKERGNAIESLKK  361
            AL PA +LA EGNLRWET+ED+WSGMCVKVVCDHLGLGVKSGLPYVWRK+RG+ IESLKK
Sbjct  219  ALLPALKLAGEGNLRWETMEDIWSGMCVKVVCDHLGLGVKSGLPYVWRKDRGSPIESLKK  278

Query  362  EWEGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEWV  541
            EWEGVKL EEIVPFFQ +RL   A T EDC+ E+A  VK+QLG S PVF+RAA+AMVEWV
Sbjct  279  EWEGVKLTEEIVPFFQLVRLPQTAATTEDCILEMATTVKQQLGPSNPVFTRAAEAMVEWV  338

Query  542  ELWNDVKT  565
            +LW  V +
Sbjct  339  KLWKAVGS  346



>ref|XP_007029449.1| Alpha-1,4-glucan-protein synthase family protein isoform 2 [Theobroma 
cacao]
 ref|XP_007029450.1| Alpha-1,4-glucan-protein synthase family protein isoform 3, partial 
[Theobroma cacao]
 ref|XP_007029451.1| Alpha-1,4-glucan-protein synthase family protein isoform 2 [Theobroma 
cacao]
 gb|EOY09951.1| Alpha-1,4-glucan-protein synthase family protein isoform 2 [Theobroma 
cacao]
 gb|EOY09952.1| Alpha-1,4-glucan-protein synthase family protein isoform 3, partial 
[Theobroma cacao]
 gb|EOY09953.1| Alpha-1,4-glucan-protein synthase family protein isoform 2 [Theobroma 
cacao]
Length=352

 Score =   315 bits (807),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 146/183 (80%), Positives = 164/183 (90%), Gaps = 0/183 (0%)
 Frame = +2

Query  5    CALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGPA  184
            CALSCGLWLN+AD+DAPTQALK +QRNSRYVDAV+TVPARAL P+SGINIAFDRE+VGPA
Sbjct  159  CALSCGLWLNLADHDAPTQALKTRQRNSRYVDAVITVPARALAPISGINIAFDREVVGPA  218

Query  185  LSPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRKERGNAIESLKKE  364
            L PA RLA EG  RWET+ED+WSGMCVKVVCDHLGLGVKSGLPYVWR +RG+AI SLKKE
Sbjct  219  LVPALRLAGEGKFRWETMEDIWSGMCVKVVCDHLGLGVKSGLPYVWRTDRGDAISSLKKE  278

Query  365  WEGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEWVE  544
            WEGVKLMEE+VPFFQS+RL   ATT EDCV E+A AVKEQLG + PVF+RAA AM++WV+
Sbjct  279  WEGVKLMEEVVPFFQSVRLPRTATTAEDCVVEVAKAVKEQLGSTDPVFARAAGAMLDWVK  338

Query  545  LWN  553
            LW 
Sbjct  339  LWK  341



>ref|XP_002512611.1| Alpha-1,4-glucan-protein synthase [UDP-forming], putative [Ricinus 
communis]
 gb|EEF50063.1| Alpha-1,4-glucan-protein synthase [UDP-forming], putative [Ricinus 
communis]
Length=351

 Score =   315 bits (807),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 143/183 (78%), Positives = 167/183 (91%), Gaps = 0/183 (0%)
 Frame = +2

Query  2    SCALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGP  181
            +CALSCGLWLN+AD+DAPTQALKP +RNSRYVDAVLTVPARA+MP+SGINIAFDRE+VGP
Sbjct  159  TCALSCGLWLNLADFDAPTQALKPAERNSRYVDAVLTVPARAMMPISGINIAFDREVVGP  218

Query  182  ALSPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRKERGNAIESLKK  361
             + PA RLA EG LRWET+ED+W+GMCVKV+CDHLGLGVK+GLPYVWRK+RGNAIESLKK
Sbjct  219  CVLPALRLAGEGKLRWETMEDIWNGMCVKVICDHLGLGVKTGLPYVWRKDRGNAIESLKK  278

Query  362  EWEGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEWV  541
            EWEGVKLMEE+VPFFQS+RL   A T EDCV E+A +VK++LG   PVFSRA++AM+EWV
Sbjct  279  EWEGVKLMEEVVPFFQSIRLPQTAATAEDCVAELATSVKQKLGPLDPVFSRASEAMLEWV  338

Query  542  ELW  550
            +LW
Sbjct  339  KLW  341



>ref|XP_007029448.1| Alpha-1,4-glucan-protein synthase family protein isoform 1 [Theobroma 
cacao]
 gb|EOY09950.1| Alpha-1,4-glucan-protein synthase family protein isoform 1 [Theobroma 
cacao]
Length=402

 Score =   316 bits (810),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 146/182 (80%), Positives = 164/182 (90%), Gaps = 0/182 (0%)
 Frame = +2

Query  5    CALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGPA  184
            CALSCGLWLN+AD+DAPTQALK +QRNSRYVDAV+TVPARAL P+SGINIAFDRE+VGPA
Sbjct  209  CALSCGLWLNLADHDAPTQALKTRQRNSRYVDAVITVPARALAPISGINIAFDREVVGPA  268

Query  185  LSPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRKERGNAIESLKKE  364
            L PA RLA EG  RWET+ED+WSGMCVKVVCDHLGLGVKSGLPYVWR +RG+AI SLKKE
Sbjct  269  LVPALRLAGEGKFRWETMEDIWSGMCVKVVCDHLGLGVKSGLPYVWRTDRGDAISSLKKE  328

Query  365  WEGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEWVE  544
            WEGVKLMEE+VPFFQS+RL   ATT EDCV E+A AVKEQLG + PVF+RAA AM++WV+
Sbjct  329  WEGVKLMEEVVPFFQSVRLPRTATTAEDCVVEVAKAVKEQLGSTDPVFARAAGAMLDWVK  388

Query  545  LW  550
            LW
Sbjct  389  LW  390



>ref|XP_006371261.1| hypothetical protein POPTR_0019s07850g [Populus trichocarpa]
 ref|XP_006371262.1| hypothetical protein POPTR_0019s07850g [Populus trichocarpa]
 gb|ERP49058.1| hypothetical protein POPTR_0019s07850g [Populus trichocarpa]
 gb|ERP49059.1| hypothetical protein POPTR_0019s07850g [Populus trichocarpa]
Length=351

 Score =   314 bits (805),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 146/188 (78%), Positives = 166/188 (88%), Gaps = 0/188 (0%)
 Frame = +2

Query  2    SCALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGP  181
            +CALSCGLWLN+AD DAPTQALK  QRNSRYVDAV+T+P+RA+MP+SGINIAFDRE VGP
Sbjct  159  TCALSCGLWLNLADLDAPTQALKAGQRNSRYVDAVMTIPSRAMMPISGINIAFDREAVGP  218

Query  182  ALSPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRKERGNAIESLKK  361
            AL PA +LA EGNLRWET+ED+WSGMCVKVVCDHLGLGVKSGLPYVWRK+RG+AIESLKK
Sbjct  219  ALLPALKLAGEGNLRWETMEDIWSGMCVKVVCDHLGLGVKSGLPYVWRKDRGSAIESLKK  278

Query  362  EWEGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEWV  541
            EWEGVKL EEIVPFFQ +RL   A T EDC+ E+A  VK+QLG S PVF+RAA+AMVEWV
Sbjct  279  EWEGVKLTEEIVPFFQLVRLPQTAATTEDCILEMATTVKQQLGPSNPVFTRAAEAMVEWV  338

Query  542  ELWNDVKT  565
            +LW  V +
Sbjct  339  KLWKAVGS  346



>gb|KHN40454.1| Putative UDP-arabinopyranose mutase 5 [Glycine soja]
Length=347

 Score =   312 bits (799),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 146/187 (78%), Positives = 166/187 (89%), Gaps = 0/187 (0%)
 Frame = +2

Query  5    CALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGPA  184
            CALSCGLWLN+AD DAPTQALKP QRN RYVDAV+TVP+RA++PVSGINIAF+RE+VGPA
Sbjct  160  CALSCGLWLNLADLDAPTQALKPGQRNLRYVDAVVTVPSRAMVPVSGINIAFNREVVGPA  219

Query  185  LSPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRKERGNAIESLKKE  364
            L PA RLA EG LRWET+ED+WSGMCVKV+CDHLGLGVKSGLPYVWR ERG+AI+SLKKE
Sbjct  220  LVPALRLAGEGKLRWETMEDIWSGMCVKVICDHLGLGVKSGLPYVWRTERGDAIQSLKKE  279

Query  365  WEGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEWVE  544
            WEGVKLME++VPFFQSLRL   ATT EDCV E+A  VKEQLGK  P+FS AA+AM EWV+
Sbjct  280  WEGVKLMEDVVPFFQSLRLPQSATTAEDCVVEMAKTVKEQLGKVDPMFSAAAEAMEEWVK  339

Query  545  LWNDVKT  565
            LW  V++
Sbjct  340  LWKSVRS  346



>gb|KHG19854.1| putative UDP-arabinopyranose mutase 5 -like protein [Gossypium 
arboreum]
Length=352

 Score =   310 bits (795),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 141/188 (75%), Positives = 163/188 (87%), Gaps = 0/188 (0%)
 Frame = +2

Query  5    CALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGPA  184
            CALSCGLWLN+ADYDAPTQALKP++RNSRYVDAVLTVPAR LMP+SGINIAF+RE++GPA
Sbjct  159  CALSCGLWLNLADYDAPTQALKPEERNSRYVDAVLTVPARTLMPISGINIAFNREVIGPA  218

Query  185  LSPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRKERGNAIESLKKE  364
            L P+ RL  EG  RWET+ED+WSGMCVKV CDHLGLGVKSG+PYVWR +RG+AI SL+KE
Sbjct  219  LLPSLRLGGEGKFRWETMEDIWSGMCVKVACDHLGLGVKSGMPYVWRNDRGDAIASLRKE  278

Query  365  WEGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEWVE  544
            WEGVKLMEE+VPFFQS+RL  +ATT EDCV E+A  VKEQLG   P+F+RAA AMV+WV 
Sbjct  279  WEGVKLMEEVVPFFQSVRLPREATTTEDCVAEVANVVKEQLGSKDPIFARAAKAMVDWVM  338

Query  545  LWNDVKTQ  568
            LW  V + 
Sbjct  339  LWKSVGSS  346



>ref|XP_003624124.1| Alpha-1,4-glucan-protein synthase [Medicago truncatula]
 gb|ABD28560.1| Alpha-1,4-glucan-protein synthase (UDP-forming) [Medicago truncatula]
 gb|AES80342.1| alpha-1,4-glucan-protein synthase [UDP-forming]-like protein 
[Medicago truncatula]
Length=347

 Score =   310 bits (794),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 145/187 (78%), Positives = 163/187 (87%), Gaps = 0/187 (0%)
 Frame = +2

Query  5    CALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGPA  184
            CALSCGLWLN+AD DAPTQALKP QRNSRYVDAVLTVP RA++PVSGINIAF+RELVGPA
Sbjct  160  CALSCGLWLNLADLDAPTQALKPTQRNSRYVDAVLTVPTRAMLPVSGINIAFNRELVGPA  219

Query  185  LSPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRKERGNAIESLKKE  364
            L PA  LA EG LRWETVED+W G+CVK+VCDHL LGVKSGLPYVWR ERGNAI+SLKKE
Sbjct  220  LVPALVLAGEGKLRWETVEDIWCGLCVKIVCDHLSLGVKSGLPYVWRNERGNAIDSLKKE  279

Query  365  WEGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEWVE  544
            WEGVKLME++VPFFQS++L   ATT EDCV E+A +VKEQLGK  P+F +AADAM EWV+
Sbjct  280  WEGVKLMEDVVPFFQSVKLPQSATTAEDCVIEMAKSVKEQLGKVDPMFLKAADAMAEWVK  339

Query  545  LWNDVKT  565
            LW  V +
Sbjct  340  LWKSVGS  346



>ref|XP_006602836.1| PREDICTED: probable UDP-arabinopyranose mutase 5-like isoform 
X1 [Glycine max]
 ref|XP_006602837.1| PREDICTED: probable UDP-arabinopyranose mutase 5-like isoform 
X2 [Glycine max]
Length=347

 Score =   310 bits (794),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 145/187 (78%), Positives = 165/187 (88%), Gaps = 0/187 (0%)
 Frame = +2

Query  5    CALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGPA  184
            CALSCGLWLN+AD DAPTQALKP QRN RYVDAV+TVP+RA++PVSGINIAF+RE+VGPA
Sbjct  160  CALSCGLWLNLADLDAPTQALKPGQRNLRYVDAVVTVPSRAMVPVSGINIAFNREVVGPA  219

Query  185  LSPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRKERGNAIESLKKE  364
            L PA RLA EG LRWET+ED+W GMCVKV+CDHLGLGVKSGLPYVWR ERG+AI+SLKKE
Sbjct  220  LVPALRLAGEGKLRWETMEDIWCGMCVKVICDHLGLGVKSGLPYVWRTERGDAIQSLKKE  279

Query  365  WEGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEWVE  544
            WEGVKLME++VPFFQSLRL   ATT EDCV E+A  VKEQLGK  P+FS AA+AM EWV+
Sbjct  280  WEGVKLMEDVVPFFQSLRLPQSATTAEDCVVEMAKTVKEQLGKVDPMFSAAAEAMEEWVK  339

Query  545  LWNDVKT  565
            LW  V++
Sbjct  340  LWKSVRS  346



>ref|XP_010038096.1| PREDICTED: probable UDP-arabinopyranose mutase 5 [Eucalyptus 
grandis]
Length=350

 Score =   310 bits (794),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 141/188 (75%), Positives = 163/188 (87%), Gaps = 0/188 (0%)
 Frame = +2

Query  2    SCALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGP  181
            +CALSCGLWLN+ADYDAPTQALKP +RN+RYVDAVLT+P   LMPVSGINIAFDRE VGP
Sbjct  158  ACALSCGLWLNLADYDAPTQALKPGERNARYVDAVLTIPTGTLMPVSGINIAFDREAVGP  217

Query  182  ALSPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRKERGNAIESLKK  361
            AL PA RLA EG  RWET+ED+WSGMCVKV CDHL LGVKSGLPYVWRK+RG+A+ESLKK
Sbjct  218  ALFPALRLAAEGKFRWETIEDIWSGMCVKVACDHLSLGVKSGLPYVWRKDRGDAVESLKK  277

Query  362  EWEGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEWV  541
            EW+GVKLME +VPFFQS+RL   ATT EDCV E+A A+K+QLG + PVF+RAA+AMVEW+
Sbjct  278  EWQGVKLMEHVVPFFQSVRLPRTATTAEDCVVEMAGAIKQQLGATDPVFARAAEAMVEWI  337

Query  542  ELWNDVKT  565
             +W  V +
Sbjct  338  RIWKAVGS  345



>ref|XP_004492819.1| PREDICTED: probable UDP-arabinopyranose mutase 5-like isoform 
X2 [Cicer arietinum]
Length=347

 Score =   310 bits (793),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 144/187 (77%), Positives = 164/187 (88%), Gaps = 0/187 (0%)
 Frame = +2

Query  5    CALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGPA  184
            CALSCGLWLN+AD DAPTQALKP QRNSRYVDAVLTVP RA++PVSGINIAF+REL+GPA
Sbjct  160  CALSCGLWLNLADLDAPTQALKPAQRNSRYVDAVLTVPVRAMLPVSGINIAFNRELIGPA  219

Query  185  LSPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRKERGNAIESLKKE  364
            L PA  LA EG +RWETVED+W G+CVKV+CDHLGLGVKSGLPYV R ERGNAI+SLKKE
Sbjct  220  LVPALVLAGEGKIRWETVEDIWCGLCVKVICDHLGLGVKSGLPYVSRTERGNAIDSLKKE  279

Query  365  WEGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEWVE  544
            WEGVK+MEE+VPFFQS+RL   ATT EDCV E+A +VKEQLGK  P+FS+AADAM EW++
Sbjct  280  WEGVKMMEEVVPFFQSVRLPQSATTAEDCVVEMAKSVKEQLGKVDPMFSQAADAMEEWIK  339

Query  545  LWNDVKT  565
            LW  V +
Sbjct  340  LWKSVGS  346



>ref|XP_003624123.1| Alpha-1,4-glucan-protein synthase [Medicago truncatula]
Length=425

 Score =   312 bits (799),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 145/185 (78%), Positives = 162/185 (88%), Gaps = 0/185 (0%)
 Frame = +2

Query  5    CALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGPA  184
            CALSCGLWLN+AD DAPTQALKP QRNSRYVDAVLTVP RA++PVSGINIAF+RELVGPA
Sbjct  238  CALSCGLWLNLADLDAPTQALKPTQRNSRYVDAVLTVPTRAMLPVSGINIAFNRELVGPA  297

Query  185  LSPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRKERGNAIESLKKE  364
            L PA  LA EG LRWETVED+W G+CVK+VCDHL LGVKSGLPYVWR ERGNAI+SLKKE
Sbjct  298  LVPALVLAGEGKLRWETVEDIWCGLCVKIVCDHLSLGVKSGLPYVWRNERGNAIDSLKKE  357

Query  365  WEGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEWVE  544
            WEGVKLME++VPFFQS++L   ATT EDCV E+A +VKEQLGK  P+F +AADAM EWV+
Sbjct  358  WEGVKLMEDVVPFFQSVKLPQSATTAEDCVIEMAKSVKEQLGKVDPMFLKAADAMAEWVK  417

Query  545  LWNDV  559
            LW  V
Sbjct  418  LWKSV  422



>ref|XP_004302139.1| PREDICTED: probable UDP-arabinopyranose mutase 5-like isoform 
2 [Fragaria vesca subsp. vesca]
 ref|XP_004302140.1| PREDICTED: probable UDP-arabinopyranose mutase 5-like isoform 
3 [Fragaria vesca subsp. vesca]
 ref|XP_004302141.1| PREDICTED: probable UDP-arabinopyranose mutase 5-like isoform 
4 [Fragaria vesca subsp. vesca]
Length=351

 Score =   310 bits (793),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 142/189 (75%), Positives = 164/189 (87%), Gaps = 0/189 (0%)
 Frame = +2

Query  2    SCALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGP  181
            +CALSCGLWLN+AD DAPTQALKP+QRNSRYVDAVLTVP RAL+PVSGINIAFDRE+VGP
Sbjct  159  TCALSCGLWLNLADLDAPTQALKPEQRNSRYVDAVLTVPVRALLPVSGINIAFDREVVGP  218

Query  182  ALSPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRKERGNAIESLKK  361
            AL PA RLA EG  RWET+ED+W GMCVKV+CDHLGLGVK+G+PYVWRKERG+A++SLKK
Sbjct  219  ALFPALRLAGEGKFRWETMEDIWCGMCVKVICDHLGLGVKTGMPYVWRKERGDAVQSLKK  278

Query  362  EWEGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEWV  541
            EWEGVKLMEE+VPFFQS+RL   A T EDCV  +A  VKE+LGK  P+F+RA+DAM  WV
Sbjct  279  EWEGVKLMEEVVPFFQSVRLPRSAVTAEDCVVSMAKTVKEELGKVDPMFARASDAMEAWV  338

Query  542  ELWNDVKTQ  568
            +LW  V + 
Sbjct  339  KLWKSVGSS  347



>ref|XP_007139747.1| hypothetical protein PHAVU_008G056100g [Phaseolus vulgaris]
 ref|XP_007139748.1| hypothetical protein PHAVU_008G056100g [Phaseolus vulgaris]
 gb|ESW11741.1| hypothetical protein PHAVU_008G056100g [Phaseolus vulgaris]
 gb|ESW11742.1| hypothetical protein PHAVU_008G056100g [Phaseolus vulgaris]
Length=350

 Score =   309 bits (792),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 143/188 (76%), Positives = 163/188 (87%), Gaps = 0/188 (0%)
 Frame = +2

Query  2    SCALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGP  181
            +CALSCGLWLN+AD DAPTQALKP QRN RYVDAVLTVPARAL+PVSGINIAF+RE +GP
Sbjct  159  TCALSCGLWLNLADLDAPTQALKPAQRNLRYVDAVLTVPARALVPVSGINIAFNREAIGP  218

Query  182  ALSPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRKERGNAIESLKK  361
            A+ PA RL+ EG  RWET ED+W GMCVKV+CDHLGLGVKSGLPYVWR ERG+A+ESLKK
Sbjct  219  AIGPALRLSGEGKFRWETAEDIWCGMCVKVICDHLGLGVKSGLPYVWRTERGDAVESLKK  278

Query  362  EWEGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEWV  541
            EWEGVKLME++VPFFQSL+L   ATT EDCV E+A  VKEQLGK  P+FS+AA+AMV+WV
Sbjct  279  EWEGVKLMEDVVPFFQSLKLPQSATTAEDCVVEMAKTVKEQLGKVDPMFSQAAEAMVDWV  338

Query  542  ELWNDVKT  565
             LW  V +
Sbjct  339  TLWKTVAS  346



>ref|XP_004492818.1| PREDICTED: probable UDP-arabinopyranose mutase 5-like isoform 
X1 [Cicer arietinum]
Length=425

 Score =   311 bits (798),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 144/185 (78%), Positives = 163/185 (88%), Gaps = 0/185 (0%)
 Frame = +2

Query  5    CALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGPA  184
            CALSCGLWLN+AD DAPTQALKP QRNSRYVDAVLTVP RA++PVSGINIAF+REL+GPA
Sbjct  238  CALSCGLWLNLADLDAPTQALKPAQRNSRYVDAVLTVPVRAMLPVSGINIAFNRELIGPA  297

Query  185  LSPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRKERGNAIESLKKE  364
            L PA  LA EG +RWETVED+W G+CVKV+CDHLGLGVKSGLPYV R ERGNAI+SLKKE
Sbjct  298  LVPALVLAGEGKIRWETVEDIWCGLCVKVICDHLGLGVKSGLPYVSRTERGNAIDSLKKE  357

Query  365  WEGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEWVE  544
            WEGVK+MEE+VPFFQS+RL   ATT EDCV E+A +VKEQLGK  P+FS+AADAM EW++
Sbjct  358  WEGVKMMEEVVPFFQSVRLPQSATTAEDCVVEMAKSVKEQLGKVDPMFSQAADAMEEWIK  417

Query  545  LWNDV  559
            LW  V
Sbjct  418  LWKSV  422



>ref|XP_004302138.1| PREDICTED: probable UDP-arabinopyranose mutase 5-like isoform 
1 [Fragaria vesca subsp. vesca]
Length=436

 Score =   311 bits (798),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 142/186 (76%), Positives = 163/186 (88%), Gaps = 0/186 (0%)
 Frame = +2

Query  2    SCALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGP  181
            +CALSCGLWLN+AD DAPTQALKP+QRNSRYVDAVLTVP RAL+PVSGINIAFDRE+VGP
Sbjct  244  TCALSCGLWLNLADLDAPTQALKPEQRNSRYVDAVLTVPVRALLPVSGINIAFDREVVGP  303

Query  182  ALSPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRKERGNAIESLKK  361
            AL PA RLA EG  RWET+ED+W GMCVKV+CDHLGLGVK+G+PYVWRKERG+A++SLKK
Sbjct  304  ALFPALRLAGEGKFRWETMEDIWCGMCVKVICDHLGLGVKTGMPYVWRKERGDAVQSLKK  363

Query  362  EWEGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEWV  541
            EWEGVKLMEE+VPFFQS+RL   A T EDCV  +A  VKE+LGK  P+F+RA+DAM  WV
Sbjct  364  EWEGVKLMEEVVPFFQSVRLPRSAVTAEDCVVSMAKTVKEELGKVDPMFARASDAMEAWV  423

Query  542  ELWNDV  559
            +LW  V
Sbjct  424  KLWKSV  429



>ref|XP_002279911.1| PREDICTED: probable UDP-arabinopyranose mutase 5 isoform X1 [Vitis 
vinifera]
Length=357

 Score =   309 bits (791),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 144/186 (77%), Positives = 161/186 (87%), Gaps = 0/186 (0%)
 Frame = +2

Query  2    SCALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGP  181
            +CALSCGLWLN+AD+DAPTQALKP  RNSRYVDAVLTVPARALMPVSG+NIAF+REL GP
Sbjct  160  TCALSCGLWLNLADHDAPTQALKPGHRNSRYVDAVLTVPARALMPVSGVNIAFNRELAGP  219

Query  182  ALSPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRKERGNAIESLKK  361
            AL P  RLA EG LRWETVED+W G+CVKVVCDHLGLGVK+GLPYVWR +RGNAIESLKK
Sbjct  220  ALFPGLRLAAEGKLRWETVEDIWCGLCVKVVCDHLGLGVKTGLPYVWRNDRGNAIESLKK  279

Query  362  EWEGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEWV  541
            EWEGVKLMEE+VPFFQS+RLS  A T EDC+ EI A VKE+L    PVF+RAA AM +W+
Sbjct  280  EWEGVKLMEEVVPFFQSVRLSQAAVTTEDCMLEIVALVKERLATLDPVFARAAQAMADWI  339

Query  542  ELWNDV  559
            +LW  V
Sbjct  340  KLWKAV  345



>gb|EYU39764.1| hypothetical protein MIMGU_mgv1a009196mg [Erythranthe guttata]
Length=349

 Score =   308 bits (790),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 143/186 (77%), Positives = 163/186 (88%), Gaps = 0/186 (0%)
 Frame = +2

Query  5    CALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGPA  184
            C LSCGLWLN+AD DAPTQALKP+ RNSRYVD VLTVPAR ++PVSGINI F+ ELVGPA
Sbjct  161  CGLSCGLWLNLADLDAPTQALKPELRNSRYVDMVLTVPARTMLPVSGINIGFNSELVGPA  220

Query  185  LSPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRKERGNAIESLKKE  364
            L PAFRLAKEG LRWETVED+WSGMCVKVVCDHL +GVKSG+PYVWR+ERGNA+ESLKKE
Sbjct  221  LMPAFRLAKEGKLRWETVEDIWSGMCVKVVCDHLKIGVKSGVPYVWRQERGNAVESLKKE  280

Query  365  WEGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEWVE  544
            WEGVKLME++VPFFQ LRLS  A T EDCV EIA+ VKE LG + P+F+RAA+ MVEW++
Sbjct  281  WEGVKLMEDVVPFFQGLRLSEGAVTAEDCVGEIASKVKEVLGGNDPMFARAAETMVEWIK  340

Query  545  LWNDVK  562
            LW  V+
Sbjct  341  LWKRVR  346



>ref|XP_010649270.1| PREDICTED: probable UDP-arabinopyranose mutase 5 isoform X2 [Vitis 
vinifera]
Length=440

 Score =   311 bits (797),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 144/186 (77%), Positives = 161/186 (87%), Gaps = 0/186 (0%)
 Frame = +2

Query  2    SCALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGP  181
            +CALSCGLWLN+AD+DAPTQALKP  RNSRYVDAVLTVPARALMPVSG+NIAF+REL GP
Sbjct  243  TCALSCGLWLNLADHDAPTQALKPGHRNSRYVDAVLTVPARALMPVSGVNIAFNRELAGP  302

Query  182  ALSPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRKERGNAIESLKK  361
            AL P  RLA EG LRWETVED+W G+CVKVVCDHLGLGVK+GLPYVWR +RGNAIESLKK
Sbjct  303  ALFPGLRLAAEGKLRWETVEDIWCGLCVKVVCDHLGLGVKTGLPYVWRNDRGNAIESLKK  362

Query  362  EWEGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEWV  541
            EWEGVKLMEE+VPFFQS+RLS  A T EDC+ EI A VKE+L    PVF+RAA AM +W+
Sbjct  363  EWEGVKLMEEVVPFFQSVRLSQAAVTTEDCMLEIVALVKERLATLDPVFARAAQAMADWI  422

Query  542  ELWNDV  559
            +LW  V
Sbjct  423  KLWKAV  428



>gb|KHN29291.1| Putative UDP-arabinopyranose mutase 5 [Glycine soja]
Length=347

 Score =   306 bits (784),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 144/187 (77%), Positives = 161/187 (86%), Gaps = 0/187 (0%)
 Frame = +2

Query  5    CALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGPA  184
            CALSCGLWLN+AD DAPTQALKP QRN RYVDAVLTVP+RA++PVSGIN+AF+RE VGPA
Sbjct  160  CALSCGLWLNLADLDAPTQALKPGQRNLRYVDAVLTVPSRAMVPVSGINVAFNREAVGPA  219

Query  185  LSPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRKERGNAIESLKKE  364
            L PA RLA EG LRWET+ED+W GMCVKV+CDHLGLGVKSGLPYVWR ERG+AI+SLKKE
Sbjct  220  LVPALRLAGEGKLRWETMEDIWCGMCVKVICDHLGLGVKSGLPYVWRTERGDAIQSLKKE  279

Query  365  WEGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEWVE  544
            WEGVKLME+IVPFFQSLRL   ATT E CV E+A  VKE LGK  P+FS AA AM EWV+
Sbjct  280  WEGVKLMEDIVPFFQSLRLPQSATTAEACVVEVAKTVKEHLGKVDPMFSEAAQAMEEWVK  339

Query  545  LWNDVKT  565
            LW  V++
Sbjct  340  LWKSVRS  346



>ref|XP_006587817.1| PREDICTED: probable UDP-arabinopyranose mutase 5-like [Glycine 
max]
Length=347

 Score =   306 bits (784),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 144/187 (77%), Positives = 161/187 (86%), Gaps = 0/187 (0%)
 Frame = +2

Query  5    CALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGPA  184
            CALSCGLWLN+AD DAPTQALKP QRN RYVDAVLTVP+RA++PVSGINIAF+RE VGPA
Sbjct  160  CALSCGLWLNLADLDAPTQALKPGQRNLRYVDAVLTVPSRAMVPVSGINIAFNREAVGPA  219

Query  185  LSPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRKERGNAIESLKKE  364
            L PA RLA EG LRWET+ED+W GMCVKV+CDHLGLGVKSGLPYVWR ERG+AI+SLKKE
Sbjct  220  LVPALRLAGEGKLRWETMEDIWCGMCVKVICDHLGLGVKSGLPYVWRTERGDAIQSLKKE  279

Query  365  WEGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEWVE  544
            WEGVKLME++VPFFQSLRL   ATT E CV E+A  VKE LGK  P+FS AA AM EWV+
Sbjct  280  WEGVKLMEDVVPFFQSLRLPQSATTAEACVVEVAKTVKEHLGKVDPMFSEAAQAMEEWVK  339

Query  545  LWNDVKT  565
            LW  V++
Sbjct  340  LWKSVRS  346



>ref|XP_008446352.1| PREDICTED: probable UDP-arabinopyranose mutase 5 [Cucumis melo]
Length=353

 Score =   299 bits (766),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 139/188 (74%), Positives = 159/188 (85%), Gaps = 0/188 (0%)
 Frame = +2

Query  2    SCALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGP  181
            +C+LSCGLWLN+ADYDAPTQALKP  RN+R VDAVLT+P  A++PVSGINIAFDRE+VGP
Sbjct  159  ACSLSCGLWLNLADYDAPTQALKPSLRNTRIVDAVLTIPVGAMLPVSGINIAFDREVVGP  218

Query  182  ALSPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRKERGNAIESLKK  361
            AL PA RLA EG  RWET+ED+W G+CVKV CDHL LGVKSG PYVWR ERGNAIESLKK
Sbjct  219  ALCPALRLAGEGKFRWETMEDIWCGLCVKVTCDHLKLGVKSGQPYVWRNERGNAIESLKK  278

Query  362  EWEGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEWV  541
            EWEGVKLMEE+VPFFQ+LRL   A T E C  EIA AV++QLG+S P+FSR A+AMVEWV
Sbjct  279  EWEGVKLMEEVVPFFQTLRLPEAAVTAEACFLEIAKAVRDQLGRSNPMFSRVAEAMVEWV  338

Query  542  ELWNDVKT  565
            E+W  V +
Sbjct  339  EIWKKVGS  346



>ref|XP_004135177.1| PREDICTED: probable UDP-arabinopyranose mutase 5-like isoform 
2 [Cucumis sativus]
 gb|KGN51917.1| hypothetical protein Csa_5G605110 [Cucumis sativus]
Length=353

 Score =   299 bits (765),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 138/188 (73%), Positives = 159/188 (85%), Gaps = 0/188 (0%)
 Frame = +2

Query  2    SCALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGP  181
            +C+LSCGLWLN+ADYDAPTQALKP  RN+R VDAVLT+P  A++PVSGINIAFDRE+VGP
Sbjct  159  ACSLSCGLWLNLADYDAPTQALKPSLRNTRIVDAVLTIPVGAMLPVSGINIAFDREVVGP  218

Query  182  ALSPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRKERGNAIESLKK  361
            AL PA RLA EG  RWET+ED+W G+CVKV CDHL LGVKSGLPYVWR ERGNAIESLKK
Sbjct  219  ALCPALRLAGEGKFRWETMEDIWCGLCVKVTCDHLKLGVKSGLPYVWRNERGNAIESLKK  278

Query  362  EWEGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEWV  541
            EWEGVKLMEE+VPFFQ+LRL   A T + C  EIA  V+EQLG+S P+F+R A+AMVEWV
Sbjct  279  EWEGVKLMEEVVPFFQTLRLPEAAVTADACFLEIAKVVREQLGRSNPMFARVAEAMVEWV  338

Query  542  ELWNDVKT  565
            E+W  V +
Sbjct  339  EIWKKVGS  346



>ref|XP_004155310.1| PREDICTED: LOW QUALITY PROTEIN: probable UDP-arabinopyranose 
mutase 5-like [Cucumis sativus]
Length=431

 Score =   301 bits (770),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 138/186 (74%), Positives = 158/186 (85%), Gaps = 0/186 (0%)
 Frame = +2

Query  2    SCALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGP  181
            +C+LSCGLWLN+ADYDAPTQALKP  RN+R VDAVLT+P  A++PVSGINIAFDRE+VGP
Sbjct  237  ACSLSCGLWLNLADYDAPTQALKPSLRNTRIVDAVLTIPVGAMLPVSGINIAFDREVVGP  296

Query  182  ALSPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRKERGNAIESLKK  361
            AL PA RLA EG  RWET+ED+W G+CVKV CDHL LGVKSGLPYVWR ERGNAIESLKK
Sbjct  297  ALCPALRLAGEGKFRWETMEDIWCGLCVKVTCDHLKLGVKSGLPYVWRNERGNAIESLKK  356

Query  362  EWEGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEWV  541
            EWEGVKLMEE+VPFFQ+LRL   A T + C  EIA  V+EQLG+S P+F+R A+AMVEWV
Sbjct  357  EWEGVKLMEEVVPFFQTLRLPEAAVTADACFLEIAKVVREQLGRSNPMFARVAEAMVEWV  416

Query  542  ELWNDV  559
            E+W  V
Sbjct  417  EIWKKV  422



>ref|XP_004135176.1| PREDICTED: probable UDP-arabinopyranose mutase 5-like isoform 
1 [Cucumis sativus]
Length=431

 Score =   301 bits (770),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 138/186 (74%), Positives = 158/186 (85%), Gaps = 0/186 (0%)
 Frame = +2

Query  2    SCALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGP  181
            +C+LSCGLWLN+ADYDAPTQALKP  RN+R VDAVLT+P  A++PVSGINIAFDRE+VGP
Sbjct  237  ACSLSCGLWLNLADYDAPTQALKPSLRNTRIVDAVLTIPVGAMLPVSGINIAFDREVVGP  296

Query  182  ALSPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRKERGNAIESLKK  361
            AL PA RLA EG  RWET+ED+W G+CVKV CDHL LGVKSGLPYVWR ERGNAIESLKK
Sbjct  297  ALCPALRLAGEGKFRWETMEDIWCGLCVKVTCDHLKLGVKSGLPYVWRNERGNAIESLKK  356

Query  362  EWEGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEWV  541
            EWEGVKLMEE+VPFFQ+LRL   A T + C  EIA  V+EQLG+S P+F+R A+AMVEWV
Sbjct  357  EWEGVKLMEEVVPFFQTLRLPEAAVTADACFLEIAKVVREQLGRSNPMFARVAEAMVEWV  416

Query  542  ELWNDV  559
            E+W  V
Sbjct  417  EIWKKV  422



>ref|XP_010244804.1| PREDICTED: probable UDP-arabinopyranose mutase 5 isoform X1 [Nelumbo 
nucifera]
Length=430

 Score =   300 bits (768),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 139/187 (74%), Positives = 159/187 (85%), Gaps = 0/187 (0%)
 Frame = +2

Query  5    CALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGPA  184
            C LSCGLWLN+ADYDAPTQALKP++RNSRYVDAVLTVP +ALMP+SGIN+AFDRE+VGPA
Sbjct  239  CVLSCGLWLNLADYDAPTQALKPERRNSRYVDAVLTVPKQALMPLSGINVAFDREVVGPA  298

Query  185  LSPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRKERGNAIESLKKE  364
            L P  RL  EG +RWET+ED+W GMC KVVCDHLGLGVKSGLPYVWRKERG+AIESLKKE
Sbjct  299  LFPGLRLEGEGKMRWETMEDIWCGMCAKVVCDHLGLGVKSGLPYVWRKERGDAIESLKKE  358

Query  365  WEGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEWVE  544
            WEG+KLME++VPFFQS+RL   A   EDCV E+A  VK++LG   P+  RAADAMVEWV 
Sbjct  359  WEGMKLMEDVVPFFQSVRLPRTAVVAEDCVLELAEMVKKKLGVVDPLVGRAADAMVEWVR  418

Query  545  LWNDVKT  565
            LW  V +
Sbjct  419  LWKAVGS  425



>ref|XP_010244805.1| PREDICTED: probable UDP-arabinopyranose mutase 5 isoform X2 [Nelumbo 
nucifera]
Length=441

 Score =   300 bits (767),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 139/187 (74%), Positives = 159/187 (85%), Gaps = 0/187 (0%)
 Frame = +2

Query  5    CALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGPA  184
            C LSCGLWLN+ADYDAPTQALKP++RNSRYVDAVLTVP +ALMP+SGIN+AFDRE+VGPA
Sbjct  250  CVLSCGLWLNLADYDAPTQALKPERRNSRYVDAVLTVPKQALMPLSGINVAFDREVVGPA  309

Query  185  LSPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRKERGNAIESLKKE  364
            L P  RL  EG +RWET+ED+W GMC KVVCDHLGLGVKSGLPYVWRKERG+AIESLKKE
Sbjct  310  LFPGLRLEGEGKMRWETMEDIWCGMCAKVVCDHLGLGVKSGLPYVWRKERGDAIESLKKE  369

Query  365  WEGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEWVE  544
            WEG+KLME++VPFFQS+RL   A   EDCV E+A  VK++LG   P+  RAADAMVEWV 
Sbjct  370  WEGMKLMEDVVPFFQSVRLPRTAVVAEDCVLELAEMVKKKLGVVDPLVGRAADAMVEWVR  429

Query  545  LWNDVKT  565
            LW  V +
Sbjct  430  LWKAVGS  436



>gb|KHG02400.1| putative UDP-arabinopyranose mutase 5 -like protein [Gossypium 
arboreum]
Length=353

 Score =   296 bits (757),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 133/183 (73%), Positives = 163/183 (89%), Gaps = 0/183 (0%)
 Frame = +2

Query  5    CALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGPA  184
            CALSCGLWLN+AD+DAPTQALK +QRNSRYVDAV+TVPA +L+P+SGINIAF+RE VGPA
Sbjct  159  CALSCGLWLNLADHDAPTQALKARQRNSRYVDAVMTVPAGSLIPISGINIAFEREAVGPA  218

Query  185  LSPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRKERGNAIESLKKE  364
            L PA +LA EG  RWET+ED+WSG+CVKVVCDHLGLGVK+GLPY+WR +RG+ I SLKKE
Sbjct  219  LVPALKLAGEGKCRWETMEDIWSGLCVKVVCDHLGLGVKTGLPYIWRTDRGDPIASLKKE  278

Query  365  WEGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEWVE  544
            WEGVKLMEE++PFFQS+RL  +ATTVE+C+ E+A AVKE+LG   PVF+RA+ AM++W++
Sbjct  279  WEGVKLMEEVIPFFQSVRLPREATTVEECIVEVANAVKERLGSMDPVFARASKAMLDWIK  338

Query  545  LWN  553
            LW 
Sbjct  339  LWQ  341



>ref|XP_006428551.1| hypothetical protein CICLE_v10013540mg [Citrus clementina]
 gb|ESR41791.1| hypothetical protein CICLE_v10013540mg [Citrus clementina]
Length=353

 Score =   293 bits (750),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 131/182 (72%), Positives = 158/182 (87%), Gaps = 0/182 (0%)
 Frame = +2

Query  5    CALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGPA  184
            CALSCGLWLN+ADYDAPTQALKP+ RNS YVDAV+TVPA  LMP+SGINIAF+R LVGPA
Sbjct  160  CALSCGLWLNLADYDAPTQALKPEHRNSHYVDAVMTVPAGTLMPISGINIAFNRALVGPA  219

Query  185  LSPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRKERGNAIESLKKE  364
            L P  +L  EG LRWET+ED+W GMCVKV+CDHL +GVK+GLPYV+R ++GN IESLKKE
Sbjct  220  LFPGLKLTGEGKLRWETIEDIWCGMCVKVICDHLSIGVKTGLPYVFRSDKGNPIESLKKE  279

Query  365  WEGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEWVE  544
            WEGVK MEEI+PFFQS+RL   ATT EDC+ E+A +VK++LG + P+F+RAA+AMVEWV+
Sbjct  280  WEGVKKMEEIIPFFQSVRLPRTATTAEDCLLEMAKSVKDRLGGTDPLFARAAEAMVEWVK  339

Query  545  LW  550
            +W
Sbjct  340  IW  341



>ref|XP_006491773.1| PREDICTED: probable UDP-arabinopyranose mutase 5-like isoform 
X1 [Citrus sinensis]
Length=353

 Score =   293 bits (750),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 131/182 (72%), Positives = 158/182 (87%), Gaps = 0/182 (0%)
 Frame = +2

Query  5    CALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGPA  184
            CALSCGLWLN+ADYDAPTQALKP+ RNS YVDAV+TVPA  LMP+SGINIAF+R LVGPA
Sbjct  160  CALSCGLWLNLADYDAPTQALKPEHRNSHYVDAVMTVPAGTLMPISGINIAFNRALVGPA  219

Query  185  LSPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRKERGNAIESLKKE  364
            L P  +L  EG LRWET+ED+W GMCVKV+CDHL +GVK+GLPYV+R ++GN IESLKKE
Sbjct  220  LFPGLKLTGEGKLRWETIEDIWCGMCVKVICDHLSIGVKTGLPYVFRSDKGNPIESLKKE  279

Query  365  WEGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEWVE  544
            WEGVK MEEI+PFFQS+RL   ATT EDC+ E+A +VK++LG + P+F+RAA+AMVEWV+
Sbjct  280  WEGVKKMEEIIPFFQSVRLPRTATTAEDCLLEMAKSVKDRLGGTDPLFARAAEAMVEWVK  339

Query  545  LW  550
            +W
Sbjct  340  IW  341



>ref|XP_006491774.1| PREDICTED: probable UDP-arabinopyranose mutase 5-like isoform 
X2 [Citrus sinensis]
Length=431

 Score =   295 bits (755),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 131/182 (72%), Positives = 158/182 (87%), Gaps = 0/182 (0%)
 Frame = +2

Query  5    CALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGPA  184
            CALSCGLWLN+ADYDAPTQALKP+ RNS YVDAV+TVPA  LMP+SGINIAF+R LVGPA
Sbjct  238  CALSCGLWLNLADYDAPTQALKPEHRNSHYVDAVMTVPAGTLMPISGINIAFNRALVGPA  297

Query  185  LSPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRKERGNAIESLKKE  364
            L P  +L  EG LRWET+ED+W GMCVKV+CDHL +GVK+GLPYV+R ++GN IESLKKE
Sbjct  298  LFPGLKLTGEGKLRWETIEDIWCGMCVKVICDHLSIGVKTGLPYVFRSDKGNPIESLKKE  357

Query  365  WEGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEWVE  544
            WEGVK MEEI+PFFQS+RL   ATT EDC+ E+A +VK++LG + P+F+RAA+AMVEWV+
Sbjct  358  WEGVKKMEEIIPFFQSVRLPRTATTAEDCLLEMAKSVKDRLGGTDPLFARAAEAMVEWVK  417

Query  545  LW  550
            +W
Sbjct  418  IW  419



>gb|KDO54891.1| hypothetical protein CISIN_1g039651mg [Citrus sinensis]
Length=353

 Score =   290 bits (743),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 130/182 (71%), Positives = 157/182 (86%), Gaps = 0/182 (0%)
 Frame = +2

Query  5    CALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGPA  184
            CALSCGLWLN+ADYDAPTQALKP+ RN  YVDAV+TVPA  LMP+SGINIAF+R LVGPA
Sbjct  160  CALSCGLWLNLADYDAPTQALKPEHRNLHYVDAVMTVPAGTLMPISGINIAFNRALVGPA  219

Query  185  LSPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRKERGNAIESLKKE  364
            L P  +L  EG LRWET+ED+W GMCVKV+CDHL +GVK+GLPYV+R ++GN IESLKKE
Sbjct  220  LFPGLKLTGEGKLRWETIEDIWCGMCVKVICDHLSIGVKTGLPYVFRSDKGNPIESLKKE  279

Query  365  WEGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEWVE  544
            WEGVK MEEI+PFFQS+RL   ATT EDC+ E+A +VK++LG + P+F+RAA+AMVEWV+
Sbjct  280  WEGVKKMEEIIPFFQSVRLPRTATTAEDCLLEMAKSVKDRLGGTDPLFARAAEAMVEWVK  339

Query  545  LW  550
            +W
Sbjct  340  IW  341



>ref|XP_002871721.1| hypothetical protein ARALYDRAFT_488506 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47980.1| hypothetical protein ARALYDRAFT_488506 [Arabidopsis lyrata subsp. 
lyrata]
Length=348

 Score =   290 bits (741),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 131/188 (70%), Positives = 160/188 (85%), Gaps = 0/188 (0%)
 Frame = +2

Query  5    CALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGPA  184
            CA SCGLWLN+AD DAPTQALK +QRN+ YVDAV+TVPA+A++P+SGINIAF+RELVGPA
Sbjct  160  CAASCGLWLNLADLDAPTQALKTEQRNTSYVDAVMTVPAKAMLPISGINIAFNRELVGPA  219

Query  185  LSPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRKERGNAIESLKKE  364
            L PA RLA EG +RWET+EDVW GMC+K + DHLG GVK+GLPYVWR ERG+A+ESL+K+
Sbjct  220  LVPALRLAGEGKVRWETLEDVWCGMCLKHISDHLGYGVKTGLPYVWRNERGDAVESLRKK  279

Query  365  WEGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEWVE  544
            WEG+KLME+ VPFF+SL+L   A  VEDCV E+A AVKEQLG   P F++AADAMV+W++
Sbjct  280  WEGMKLMEKSVPFFESLKLPETALKVEDCVIELAKAVKEQLGSDDPAFTQAADAMVKWIQ  339

Query  545  LWNDVKTQ  568
            LWN V + 
Sbjct  340  LWNSVNSS  347



>ref|XP_010492563.1| PREDICTED: probable UDP-arabinopyranose mutase 5 [Camelina sativa]
Length=348

 Score =   287 bits (735),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 130/188 (69%), Positives = 160/188 (85%), Gaps = 0/188 (0%)
 Frame = +2

Query  5    CALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGPA  184
            CA SCGLWLN+AD DAPTQALK +QRN+ YVDAV+TVPA+A++P+SGINIAF+RELVGPA
Sbjct  160  CAASCGLWLNLADLDAPTQALKTEQRNTAYVDAVMTVPAKAMLPISGINIAFNRELVGPA  219

Query  185  LSPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRKERGNAIESLKKE  364
            L PA R+A EG +RWET+EDVW GMC+K + DHLG GVK+GLPYVWR ERG+A+ESL+K+
Sbjct  220  LVPALRIAGEGKVRWETLEDVWCGMCLKHISDHLGYGVKTGLPYVWRNERGDAVESLRKK  279

Query  365  WEGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEWVE  544
            WEG+KLME+ VPFF+SL+L   A  VEDCV E+A AV+EQLG   P F++AADAMV+WV+
Sbjct  280  WEGMKLMEKSVPFFESLKLPETALKVEDCVIELAKAVREQLGSDDPAFTQAADAMVKWVQ  339

Query  545  LWNDVKTQ  568
            LWN V + 
Sbjct  340  LWNSVNSS  347



>ref|XP_010420346.1| PREDICTED: probable UDP-arabinopyranose mutase 5 [Camelina sativa]
 ref|XP_010420347.1| PREDICTED: probable UDP-arabinopyranose mutase 5 [Camelina sativa]
Length=348

 Score =   287 bits (735),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 129/188 (69%), Positives = 160/188 (85%), Gaps = 0/188 (0%)
 Frame = +2

Query  5    CALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGPA  184
            CA SCGLWLN+AD DAPTQALK +QRN+ YVDAV+TVPA+A++P+SGINIAF+RELVGPA
Sbjct  160  CAASCGLWLNLADLDAPTQALKTEQRNTAYVDAVMTVPAKAMLPISGINIAFNRELVGPA  219

Query  185  LSPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRKERGNAIESLKKE  364
            L PA R+A EG +RWET+EDVW GMC+K + DHLG GVK+GLPYVWR ERG+A+ESL+K+
Sbjct  220  LVPALRIAGEGKVRWETLEDVWCGMCLKHISDHLGYGVKTGLPYVWRNERGDAVESLRKK  279

Query  365  WEGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEWVE  544
            WEG+KLME+ VPFF+SL+L   A  VEDCV E+A AV+EQLG   P F++AADAMV+W++
Sbjct  280  WEGMKLMEKSVPFFESLKLPETALKVEDCVIELAKAVREQLGSDDPAFTQAADAMVKWIQ  339

Query  545  LWNDVKTQ  568
            LWN V + 
Sbjct  340  LWNSVNSS  347



>emb|CDY55583.1| BnaC09g41420D [Brassica napus]
Length=348

 Score =   287 bits (734),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 129/188 (69%), Positives = 160/188 (85%), Gaps = 0/188 (0%)
 Frame = +2

Query  5    CALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGPA  184
            CA SCGLWLN+AD DAPTQALK +QRN+ YVDAV+TVP +A++P+SGINIAF+RELVGPA
Sbjct  160  CAASCGLWLNLADLDAPTQALKTEQRNTSYVDAVMTVPLKAMLPISGINIAFNRELVGPA  219

Query  185  LSPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRKERGNAIESLKKE  364
            L PA R+A EG +RWET+EDVW GMC+K + DHLG GVK+GLPYVWR ERG+A+ESL+K+
Sbjct  220  LVPALRIAGEGKVRWETLEDVWCGMCLKHISDHLGYGVKTGLPYVWRNERGDAVESLRKK  279

Query  365  WEGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEWVE  544
            WEG+KLME+ VPFF++L+L   A +VEDCV E+A AVKEQLG   P F++AADAMV+WV+
Sbjct  280  WEGMKLMEKSVPFFEALKLPESAVSVEDCVVELAKAVKEQLGSDDPAFTQAADAMVKWVQ  339

Query  545  LWNDVKTQ  568
            LWN V + 
Sbjct  340  LWNSVNSS  347



>ref|NP_197155.1| reversably-glycosylated protein 5 [Arabidopsis thaliana]
 ref|NP_850831.1| reversably-glycosylated protein 5 [Arabidopsis thaliana]
 sp|Q9FFD2.1|RGP5_ARATH RecName: Full=Probable UDP-arabinopyranose mutase 5; AltName: 
Full=Reversibly glycosylated polypeptide 5; Short=AtRGP5; AltName: 
Full=UDP-L-arabinose mutase 5 [Arabidopsis thaliana]
 dbj|BAB09620.1| amylogenin; reversibly glycosylatable polypeptide [Arabidopsis 
thaliana]
 gb|AAM14090.1| putative amylogenin; reversibly glycosylatable polypeptide [Arabidopsis 
thaliana]
 gb|AAM45135.1| putative amylogenin; reversibly glycosylatable polypeptide [Arabidopsis 
thaliana]
 gb|AAM66046.1| amylogenin [Arabidopsis thaliana]
 gb|AED92302.1| reversably-glycosylated protein 5 [Arabidopsis thaliana]
 gb|AED92303.1| reversably-glycosylated protein 5 [Arabidopsis thaliana]
 gb|AHL38625.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=348

 Score =   287 bits (734),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 131/188 (70%), Positives = 159/188 (85%), Gaps = 0/188 (0%)
 Frame = +2

Query  5    CALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGPA  184
            CA SCGLWLN+AD DAPTQALK ++RN+ YVDAV+TVPA+A++P+SGINIAF+RELVGPA
Sbjct  160  CAASCGLWLNLADLDAPTQALKTEKRNTAYVDAVMTVPAKAMLPISGINIAFNRELVGPA  219

Query  185  LSPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRKERGNAIESLKKE  364
            L PA RLA EG +RWET+EDVW GMC+K + DHLG GVK+GLPYVWR ERG+A+ESL+K+
Sbjct  220  LVPALRLAGEGKVRWETLEDVWCGMCLKHISDHLGYGVKTGLPYVWRNERGDAVESLRKK  279

Query  365  WEGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEWVE  544
            WEG+KLME+ VPFF SL+L   A  VEDCV E+A AVKEQLG   P F++AADAMV+WV+
Sbjct  280  WEGMKLMEKSVPFFDSLKLPETALKVEDCVIELAKAVKEQLGSDDPAFTQAADAMVKWVQ  339

Query  545  LWNDVKTQ  568
            LWN V + 
Sbjct  340  LWNSVNSS  347



>ref|XP_006400191.1| hypothetical protein EUTSA_v10013999mg [Eutrema salsugineum]
 gb|ESQ41644.1| hypothetical protein EUTSA_v10013999mg [Eutrema salsugineum]
Length=346

 Score =   287 bits (734),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 130/187 (70%), Positives = 159/187 (85%), Gaps = 0/187 (0%)
 Frame = +2

Query  5    CALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGPA  184
            CA SCGLWLN+AD DAPTQALK +QRN+ YVDAV+TVP +A++P+SGINIAF+RELVGPA
Sbjct  158  CAASCGLWLNLADLDAPTQALKTEQRNTSYVDAVMTVPLKAMLPISGINIAFNRELVGPA  217

Query  185  LSPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRKERGNAIESLKKE  364
            L PA RLA EG +RWET+EDVW GMC+K + DHLG GVK+GLPYVWR ERG+A+ESL+K+
Sbjct  218  LVPALRLAGEGKVRWETLEDVWCGMCLKHISDHLGYGVKTGLPYVWRNERGDAVESLRKK  277

Query  365  WEGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEWVE  544
            WEG+KLME+ VPFF+SL+L   A  VEDCV E+A AVKEQLG   P F++AADAMV+W++
Sbjct  278  WEGMKLMEKSVPFFESLKLPETALKVEDCVIELAKAVKEQLGSEDPAFTQAADAMVKWIQ  337

Query  545  LWNDVKT  565
            LWN V +
Sbjct  338  LWNSVNS  344



>ref|XP_010558589.1| PREDICTED: probable UDP-arabinopyranose mutase 5 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010558590.1| PREDICTED: probable UDP-arabinopyranose mutase 5 isoform X2 [Tarenaya 
hassleriana]
Length=348

 Score =   287 bits (734),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 130/184 (71%), Positives = 159/184 (86%), Gaps = 0/184 (0%)
 Frame = +2

Query  5    CALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGPA  184
            CA+SCGLWLN+AD DAPTQALK + RNS YVDAV+TVPA+A+MP+SGINIAF+RELVGPA
Sbjct  160  CAVSCGLWLNLADLDAPTQALKTELRNSTYVDAVMTVPAKAMMPISGINIAFNRELVGPA  219

Query  185  LSPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRKERGNAIESLKKE  364
            L P+ RLA EG +RWET+EDVW GMC+KVVCDHLG GVK+GLPYVWR ERG+A+ SL+KE
Sbjct  220  LVPSLRLAGEGKVRWETMEDVWCGMCIKVVCDHLGYGVKTGLPYVWRNERGDAVNSLRKE  279

Query  365  WEGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEWVE  544
            WEG+KLME+ V FF+ LRL   A TV+DCV E+A A+K+QLG S PVF++AADAM +W++
Sbjct  280  WEGMKLMEKSVSFFEFLRLPETALTVQDCVLELAKALKDQLGSSDPVFAQAADAMAKWIK  339

Query  545  LWND  556
            LW +
Sbjct  340  LWTE  343



>ref|XP_006289145.1| hypothetical protein CARUB_v10002568mg [Capsella rubella]
 gb|EOA22043.1| hypothetical protein CARUB_v10002568mg [Capsella rubella]
Length=348

 Score =   286 bits (732),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 129/188 (69%), Positives = 159/188 (85%), Gaps = 0/188 (0%)
 Frame = +2

Query  5    CALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGPA  184
            CA SCGLWLN+AD DAPTQALK +QRN+ YVDAV+TVPA+A++P+SGINIAF+RELVGPA
Sbjct  160  CAASCGLWLNLADLDAPTQALKTEQRNTSYVDAVMTVPAKAMLPISGINIAFNRELVGPA  219

Query  185  LSPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRKERGNAIESLKKE  364
            + PA R+A EG +RWET+EDVW GMC+K + DHLG GVK+G+PYVWR ERG+A+ESL+K+
Sbjct  220  MVPALRIAGEGKVRWETLEDVWCGMCLKHISDHLGYGVKTGMPYVWRNERGDAVESLRKK  279

Query  365  WEGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEWVE  544
            WEG+KLME+ VPFF SL+L   A  VEDCV E+A AVKEQLG   P F++AADAMV+WV+
Sbjct  280  WEGMKLMEKSVPFFDSLKLPETALKVEDCVIELAKAVKEQLGSDDPAFTQAADAMVKWVQ  339

Query  545  LWNDVKTQ  568
            LWN V + 
Sbjct  340  LWNSVNSS  347



>ref|XP_009121479.1| PREDICTED: probable UDP-arabinopyranose mutase 5 [Brassica rapa]
 ref|XP_009121480.1| PREDICTED: probable UDP-arabinopyranose mutase 5 [Brassica rapa]
Length=348

 Score =   286 bits (732),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 129/188 (69%), Positives = 159/188 (85%), Gaps = 0/188 (0%)
 Frame = +2

Query  5    CALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGPA  184
            CA SCGLWLN+AD DAPTQALK +QRN+ YVDAV+TVP +A++P+SGINIAF+RELVGPA
Sbjct  160  CAASCGLWLNLADLDAPTQALKTEQRNTSYVDAVMTVPLKAMLPISGINIAFNRELVGPA  219

Query  185  LSPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRKERGNAIESLKKE  364
            L PA R+A EG +RWET+EDVW GMC+K + DHLG GVK+GLPYVWR ERG+A+ESL+K+
Sbjct  220  LVPALRIAGEGKVRWETLEDVWCGMCLKHISDHLGYGVKTGLPYVWRNERGDAVESLRKK  279

Query  365  WEGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEWVE  544
            WEG+KLME+ VPFF++L+L   A  VEDCV E+A AVKEQLG   P F++AADAMV+WV+
Sbjct  280  WEGMKLMEKSVPFFEALKLPESAVNVEDCVVELAKAVKEQLGSDDPAFTQAADAMVKWVQ  339

Query  545  LWNDVKTQ  568
            LWN V + 
Sbjct  340  LWNSVNSS  347



>ref|XP_010453815.1| PREDICTED: probable UDP-arabinopyranose mutase 5 [Camelina sativa]
Length=348

 Score =   286 bits (732),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 129/188 (69%), Positives = 160/188 (85%), Gaps = 0/188 (0%)
 Frame = +2

Query  5    CALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGPA  184
            CA SCGLWLN+AD DAPTQALK +QRN+ YVDAV+TVPA+A++P+SGINIAF+RELVGPA
Sbjct  160  CAASCGLWLNLADLDAPTQALKTEQRNTAYVDAVMTVPAKAMLPISGINIAFNRELVGPA  219

Query  185  LSPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRKERGNAIESLKKE  364
            L PA R+A EG +RWET+EDVW GMC+K + DHLG GVK+GLPYVWR ERG+A++SL+K+
Sbjct  220  LVPALRIAGEGKVRWETLEDVWCGMCLKHISDHLGYGVKTGLPYVWRNERGDAVKSLRKK  279

Query  365  WEGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEWVE  544
            WEG+KLME+ VPFF+SL+L   A  VEDCV E+A AV+EQLG   P F++AADAMV+WV+
Sbjct  280  WEGMKLMEKSVPFFESLKLPETALKVEDCVIELAKAVREQLGSDDPAFTQAADAMVKWVQ  339

Query  545  LWNDVKTQ  568
            LWN V + 
Sbjct  340  LWNSVNSS  347



>emb|CDX69446.1| BnaA10g17950D [Brassica napus]
Length=348

 Score =   286 bits (732),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 129/188 (69%), Positives = 159/188 (85%), Gaps = 0/188 (0%)
 Frame = +2

Query  5    CALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGPA  184
            CA SCGLWLN+AD DAPTQALK +QRN+ YVDAV+TVP +A++P+SGINIAF+RELVGPA
Sbjct  160  CAASCGLWLNLADLDAPTQALKTEQRNTSYVDAVMTVPLKAMLPISGINIAFNRELVGPA  219

Query  185  LSPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRKERGNAIESLKKE  364
            L PA R+A EG +RWET+EDVW GMC+K + DHLG GVK+GLPYVWR ERG+A+ESL+K+
Sbjct  220  LVPALRIAGEGKVRWETLEDVWCGMCLKHISDHLGYGVKTGLPYVWRNERGDAVESLRKK  279

Query  365  WEGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEWVE  544
            WEG+KLME+ VPFF++L+L   A  VEDCV E+A AVKEQLG   P F++AADAMV+WV+
Sbjct  280  WEGMKLMEKSVPFFEALKLPESAVNVEDCVVELAKAVKEQLGSDDPAFTQAADAMVKWVQ  339

Query  545  LWNDVKTQ  568
            LWN V + 
Sbjct  340  LWNSVNSS  347



>ref|XP_010674690.1| PREDICTED: probable UDP-arabinopyranose mutase 5 [Beta vulgaris 
subsp. vulgaris]
Length=351

 Score =   280 bits (716),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 126/183 (69%), Positives = 158/183 (86%), Gaps = 1/183 (1%)
 Frame = +2

Query  5    CALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGPA  184
            CA+SCGLWLN+AD DAPTQALKP+QRN+RYVDAVLTVPA+A+MP+SG+NI F+REL+GPA
Sbjct  161  CAISCGLWLNLADLDAPTQALKPEQRNTRYVDAVLTVPAKAMMPLSGVNIGFNRELLGPA  220

Query  185  LSPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRKERGNAIESLKKE  364
            L P  +L KEG LRWET+EDV+SGMC KVVCDHL LG+K+GLPYVWR+ERG+A++SLKK+
Sbjct  221  LFPGLKLTKEGKLRWETMEDVFSGMCAKVVCDHLKLGMKTGLPYVWREERGDAVQSLKKD  280

Query  365  WEGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLG-KSAPVFSRAADAMVEWV  541
            WEG+KLME+ VPFF+S++L P+A   E+C+ EIA  VKE+   +   VF  AADAM+EWV
Sbjct  281  WEGMKLMEDAVPFFESIKLPPEAVKAEECMLEIAKLVKEKFAHEKNSVFINAADAMIEWV  340

Query  542  ELW  550
            +LW
Sbjct  341  KLW  343



>ref|XP_008218418.1| PREDICTED: LOW QUALITY PROTEIN: probable UDP-arabinopyranose 
mutase 5 [Prunus mume]
Length=333

 Score =   273 bits (699),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 131/189 (69%), Positives = 151/189 (80%), Gaps = 18/189 (10%)
 Frame = +2

Query  2    SCALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGP  181
            +CALSCGLWLN+ADYDAPTQALKP+QRNSRYVDAV+TVP R+LMPVSGINIAF+RE+ GP
Sbjct  159  TCALSCGLWLNLADYDAPTQALKPEQRNSRYVDAVMTVPVRSLMPVSGINIAFNREVAGP  218

Query  182  ALSPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRKERGNAIESLKK  361
            AL PA RLA EG LRWETVED+WSGMCVKV+CDHLGLGVKSG+PYV              
Sbjct  219  ALFPALRLAGEGKLRWETVEDIWSGMCVKVICDHLGLGVKSGIPYV--------------  264

Query  362  EWEGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEWV  541
                VKLMEE+VPFFQS+RL   A T EDCV ++A +VKEQLGK  P+F+RAADAM +WV
Sbjct  265  ----VKLMEEVVPFFQSVRLPQTAVTAEDCVVDMAKSVKEQLGKVDPMFARAADAMGDWV  320

Query  542  ELWNDVKTQ  568
            +LW  V + 
Sbjct  321  KLWKSVGSS  329



>ref|XP_010927619.1| PREDICTED: probable UDP-arabinopyranose mutase 2 isoform X1 [Elaeis 
guineensis]
 ref|XP_010927620.1| PREDICTED: probable UDP-arabinopyranose mutase 2 isoform X1 [Elaeis 
guineensis]
 ref|XP_010927621.1| PREDICTED: probable UDP-arabinopyranose mutase 2 isoform X1 [Elaeis 
guineensis]
Length=350

 Score =   271 bits (694),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 139/192 (72%), Positives = 156/192 (81%), Gaps = 5/192 (3%)
 Frame = +2

Query  5    CALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGPA  184
            C LSCGLWLN+ADYDAPTQ +KP  RN RYVDAV+TVP RALMPVSGIN  F+REL+GPA
Sbjct  158  CVLSCGLWLNIADYDAPTQVVKPNDRNVRYVDAVMTVPVRALMPVSGINFGFNRELLGPA  217

Query  185  LSPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRKE----RGNAIES  352
            L P  RLA EG  RWET+ED+W G+C KVVCDHLGLGVKSGLPYVWR +    RG A++S
Sbjct  218  LLPGLRLAGEGKERWETMEDIWCGLCTKVVCDHLGLGVKSGLPYVWRGDGVDVRG-AMDS  276

Query  353  LKKEWEGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMV  532
            LK+EWEGVKLMEEIVPFFQS+RL   A T EDCV E+AA VKEQLG   PVF+ AADAMV
Sbjct  277  LKREWEGVKLMEEIVPFFQSVRLPSTAVTAEDCVIEMAAMVKEQLGPLNPVFASAADAMV  336

Query  533  EWVELWNDVKTQ  568
            EWV+LW  V +Q
Sbjct  337  EWVKLWKAVGSQ  348



>ref|XP_010927622.1| PREDICTED: probable UDP-arabinopyranose mutase 2 isoform X2 [Elaeis 
guineensis]
Length=433

 Score =   273 bits (698),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 139/192 (72%), Positives = 156/192 (81%), Gaps = 5/192 (3%)
 Frame = +2

Query  5    CALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGPA  184
            C LSCGLWLN+ADYDAPTQ +KP  RN RYVDAV+TVP RALMPVSGIN  F+REL+GPA
Sbjct  241  CVLSCGLWLNIADYDAPTQVVKPNDRNVRYVDAVMTVPVRALMPVSGINFGFNRELLGPA  300

Query  185  LSPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRKE----RGNAIES  352
            L P  RLA EG  RWET+ED+W G+C KVVCDHLGLGVKSGLPYVWR +    RG A++S
Sbjct  301  LLPGLRLAGEGKERWETMEDIWCGLCTKVVCDHLGLGVKSGLPYVWRGDGVDVRG-AMDS  359

Query  353  LKKEWEGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMV  532
            LK+EWEGVKLMEEIVPFFQS+RL   A T EDCV E+AA VKEQLG   PVF+ AADAMV
Sbjct  360  LKREWEGVKLMEEIVPFFQSVRLPSTAVTAEDCVIEMAAMVKEQLGPLNPVFASAADAMV  419

Query  533  EWVELWNDVKTQ  568
            EWV+LW  V +Q
Sbjct  420  EWVKLWKAVGSQ  431



>ref|XP_008800968.1| PREDICTED: probable UDP-arabinopyranose mutase 2 [Phoenix dactylifera]
Length=350

 Score =   269 bits (687),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 135/191 (71%), Positives = 155/191 (81%), Gaps = 3/191 (2%)
 Frame = +2

Query  5    CALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGPA  184
            CALSCGLWLN+ADYDAPTQ +KP +RN RYVDAV+TVP RA+MP+SGINI F+REL+GPA
Sbjct  158  CALSCGLWLNIADYDAPTQVVKPNERNVRYVDAVMTVPVRAMMPMSGINIGFNRELLGPA  217

Query  185  LSPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRKER---GNAIESL  355
            L P  RLA EG  RWET+ED+W GMC KVVCDHLGLGVKSGLPYVWR +      A+ESL
Sbjct  218  LLPGLRLAGEGKQRWETMEDIWCGMCAKVVCDHLGLGVKSGLPYVWRGDGVDVKGAMESL  277

Query  356  KKEWEGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVE  535
            K+EWEGVKLMEE+ PFFQS+RL   A T EDCV E+AA VKEQLG   PVF+ AADAM+E
Sbjct  278  KREWEGVKLMEEVAPFFQSVRLPRTAVTAEDCVIEMAAMVKEQLGPLNPVFAGAADAMLE  337

Query  536  WVELWNDVKTQ  568
            WV+LW    +Q
Sbjct  338  WVKLWKAAGSQ  348



>ref|XP_009402728.1| PREDICTED: probable UDP-arabinopyranose mutase 2 [Musa acuminata 
subsp. malaccensis]
Length=347

 Score =   266 bits (681),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 121/185 (65%), Positives = 146/185 (79%), Gaps = 3/185 (2%)
 Frame = +2

Query  5    CALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGPA  184
            C LSCGLWLN+ADYDAPTQ +KP +RN+RYVDAV+TVP RA+MP+SGINI F+RE++GPA
Sbjct  158  CLLSCGLWLNIADYDAPTQIVKPHERNTRYVDAVMTVPLRAMMPLSGINIGFNREVLGPA  217

Query  185  LSPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWR---KERGNAIESL  355
            L P  RL  EG  RWET+ED+WSGMC KV+CDHLG GVKSGLPYVWR    +  NA++SL
Sbjct  218  LVPGLRLDGEGKRRWETIEDIWSGMCAKVICDHLGCGVKSGLPYVWRGVGSDADNAMDSL  277

Query  356  KKEWEGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVE  535
            KKEWEGVKLMEE+VPFFQS++    A T  DCV EI+   +E L    PV+++AAD M  
Sbjct  278  KKEWEGVKLMEEVVPFFQSVKFPKTAVTAADCVIEISRMARENLASLNPVYAQAADTMEA  337

Query  536  WVELW  550
            WV+LW
Sbjct  338  WVDLW  342



>ref|XP_004516238.1| PREDICTED: probable UDP-arabinopyranose mutase 5-like [Cicer 
arietinum]
Length=416

 Score =   264 bits (674),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 123/163 (75%), Positives = 140/163 (86%), Gaps = 0/163 (0%)
 Frame = +2

Query  5    CALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGPA  184
            CALSC LWLN+AD DAP QALKP QR SRYVDAVLTVP RA++PVSGINIAF+RELVGP 
Sbjct  160  CALSCELWLNLADLDAPIQALKPAQRKSRYVDAVLTVPVRAMLPVSGINIAFNRELVGPT  219

Query  185  LSPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRKERGNAIESLKKE  364
            L PA  LA EG +RWETVED+W G+CVKV+CDHLGLGVKSGLPYV R ERGN I+ LKKE
Sbjct  220  LVPALVLAGEGKIRWETVEDIWCGLCVKVICDHLGLGVKSGLPYVSRTERGNVIDKLKKE  279

Query  365  WEGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGK  493
            WEGVK++EE+VPFF+S+RL   ATT EDCV E+A +VKEQLG+
Sbjct  280  WEGVKMIEEVVPFFRSVRLPQSATTAEDCVVEMAKSVKEQLGR  322



>ref|XP_004960161.1| PREDICTED: probable UDP-arabinopyranose mutase 2-like isoform 
X1 [Setaria italica]
 ref|XP_004960162.1| PREDICTED: probable UDP-arabinopyranose mutase 2-like isoform 
X2 [Setaria italica]
Length=348

 Score =   248 bits (633),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 116/184 (63%), Positives = 146/184 (79%), Gaps = 3/184 (2%)
 Frame = +2

Query  5    CALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGPA  184
            C LSCGLWL+ ADYD  T  +K  QRN+ YVDAV+TVP  A+MPVSGIN+AF+RE++GPA
Sbjct  158  CMLSCGLWLHNADYDPMTHVVKRNQRNTTYVDAVMTVPLGAMMPVSGINVAFNREVLGPA  217

Query  185  LSPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRK--ERGNAIESLK  358
            + PA RL  EG  RW+T+EDVW+G+C KVVCD LG G+K+GLPYV R   E G A+ESL 
Sbjct  218  MFPALRLRNEGKHRWDTLEDVWNGLCAKVVCDSLGYGMKTGLPYVMRSDAEAGKALESL-  276

Query  359  KEWEGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEW  538
            KEWEGVK+M++++PFFQSL+LS  A TVEDCV E+A+ V+E+LG    +F++AADAMVEW
Sbjct  277  KEWEGVKVMDDVLPFFQSLKLSRTAVTVEDCVKELASIVREKLGPKNAIFTKAADAMVEW  336

Query  539  VELW  550
              LW
Sbjct  337  NNLW  340



>ref|XP_008668126.1| PREDICTED: alpha-1,4-glucan-protein synthase isoform X1 [Zea 
mays]
 ref|XP_008668127.1| PREDICTED: alpha-1,4-glucan-protein synthase isoform X1 [Zea 
mays]
 gb|ACF86668.1| unknown [Zea mays]
 gb|ACN27940.1| unknown [Zea mays]
 gb|ACN34042.1| unknown [Zea mays]
 tpg|DAA35558.1| TPA: alpha-1,4-glucan-protein synthase isoform 1 [Zea mays]
 tpg|DAA35559.1| TPA: alpha-1,4-glucan-protein synthase isoform 2 [Zea mays]
 tpg|DAA35560.1| TPA: alpha-1,4-glucan-protein synthase isoform 3 [Zea mays]
Length=349

 Score =   243 bits (621),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 112/184 (61%), Positives = 144/184 (78%), Gaps = 3/184 (2%)
 Frame = +2

Query  5    CALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGPA  184
            C LSCGLWL+ ADYD  T  +K  QRN+ YVDAV+TVP  A++PVSGIN+AF+R+++GPA
Sbjct  159  CMLSCGLWLHNADYDPMTHVVKRNQRNTTYVDAVMTVPLGAMLPVSGINVAFNRDVLGPA  218

Query  185  LSPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRK--ERGNAIESLK  358
            + P  RL  EG  RW+T+ED+W+G+C KVVCD LG GVK+GLPYV R   E G A+ESL 
Sbjct  219  MFPGLRLRNEGKHRWDTLEDIWNGLCAKVVCDSLGYGVKTGLPYVMRSDAEAGKALESL-  277

Query  359  KEWEGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEW  538
            KEWEGVK+M++++PFFQSL+LS  A TV+DCV E+A  V+E+LG    +F++AADAMVEW
Sbjct  278  KEWEGVKVMDDVLPFFQSLKLSRTAVTVDDCVKELAGVVREKLGPKNAIFTKAADAMVEW  337

Query  539  VELW  550
              LW
Sbjct  338  NNLW  341



>ref|XP_002447267.1| hypothetical protein SORBIDRAFT_06g031590 [Sorghum bicolor]
 gb|EES11595.1| hypothetical protein SORBIDRAFT_06g031590 [Sorghum bicolor]
Length=348

 Score =   243 bits (621),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 111/184 (60%), Positives = 145/184 (79%), Gaps = 3/184 (2%)
 Frame = +2

Query  5    CALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGPA  184
            C LSCGLW++ ADYD  T  +K  QRN+ YVDAV+TVP  A++PVSGIN+AF+R+++GPA
Sbjct  158  CMLSCGLWMHNADYDPMTHVVKRNQRNTTYVDAVMTVPLGAMLPVSGINVAFNRDVLGPA  217

Query  185  LSPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRK--ERGNAIESLK  358
            + P  RL KEG  RW+T+ED+W+G+C KVVCD LG GVK+GLPYV R   E G A+ESL 
Sbjct  218  MFPGLRLRKEGKHRWDTLEDIWNGLCAKVVCDSLGYGVKTGLPYVMRSDAEAGKALESL-  276

Query  359  KEWEGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEW  538
            K+WEGVK+M++++PFFQSL+LS  A TV+DCV E+A  V+E+LG    +F++AADAMVEW
Sbjct  277  KDWEGVKIMDDVLPFFQSLKLSRTAVTVDDCVKELAGIVREKLGPKNAIFTKAADAMVEW  336

Query  539  VELW  550
              LW
Sbjct  337  NNLW  340



>ref|XP_008668128.1| PREDICTED: alpha-1,4-glucan-protein synthase isoform X2 [Zea 
mays]
Length=427

 Score =   244 bits (623),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 112/184 (61%), Positives = 144/184 (78%), Gaps = 3/184 (2%)
 Frame = +2

Query  5    CALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGPA  184
            C LSCGLWL+ ADYD  T  +K  QRN+ YVDAV+TVP  A++PVSGIN+AF+R+++GPA
Sbjct  237  CMLSCGLWLHNADYDPMTHVVKRNQRNTTYVDAVMTVPLGAMLPVSGINVAFNRDVLGPA  296

Query  185  LSPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRK--ERGNAIESLK  358
            + P  RL  EG  RW+T+ED+W+G+C KVVCD LG GVK+GLPYV R   E G A+ESL 
Sbjct  297  MFPGLRLRNEGKHRWDTLEDIWNGLCAKVVCDSLGYGVKTGLPYVMRSDAEAGKALESL-  355

Query  359  KEWEGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEW  538
            KEWEGVK+M++++PFFQSL+LS  A TV+DCV E+A  V+E+LG    +F++AADAMVEW
Sbjct  356  KEWEGVKVMDDVLPFFQSLKLSRTAVTVDDCVKELAGVVREKLGPKNAIFTKAADAMVEW  415

Query  539  VELW  550
              LW
Sbjct  416  NNLW  419



>ref|NP_001054143.1| Os04g0660400 [Oryza sativa Japonica Group]
 sp|Q7FAY6.1|RGP2_ORYSJ RecName: Full=Probable UDP-arabinopyranose mutase 2; Short=OsUAM2; 
AltName: Full=Reversibly glycosylated polypeptide 2; AltName: 
Full=UDP-L-arabinose mutase 2 [Oryza sativa Japonica 
Group]
 emb|CAA77234.1| amylogenin [Oryza sativa Indica Group]
 emb|CAE02896.1| OSJNBa0015K02.13 [Oryza sativa Japonica Group]
 dbj|BAF16057.1| Os04g0660400 [Oryza sativa Japonica Group]
 emb|CAH67058.1| H0112G12.3 [Oryza sativa Indica Group]
 dbj|BAG92258.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96594.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG86762.1| unnamed protein product [Oryza sativa Japonica Group]
Length=347

 Score =   240 bits (613),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 114/190 (60%), Positives = 144/190 (76%), Gaps = 3/190 (2%)
 Frame = +2

Query  5    CALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGPA  184
            C LSCGLWL+ ADYD  T  +K  QRN+ YVDAV+TVP  A+MPVSGIN+AF+RE++GP 
Sbjct  157  CMLSCGLWLHNADYDPMTHVVKRNQRNTTYVDAVMTVPLGAMMPVSGINVAFNREVLGPV  216

Query  185  LSPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRK--ERGNAIESLK  358
            + PA RL KEG  RW+T+EDVW+G+C KVVCD L  GVK+GLPYV R   E G A+ESL 
Sbjct  217  MFPALRLRKEGKHRWDTLEDVWNGLCAKVVCDRLRYGVKTGLPYVMRSDAEAGKALESL-  275

Query  359  KEWEGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEW  538
            KEWEGVK+M+ ++PFF+SL+LS  + TVEDCV E+ + VKE+LG    +F++AADAM EW
Sbjct  276  KEWEGVKVMDVVLPFFESLKLSSTSVTVEDCVKELTSIVKEKLGPQNAIFAKAADAMEEW  335

Query  539  VELWNDVKTQ  568
             +LW     Q
Sbjct  336  TKLWKSHGAQ  345



>ref|XP_003580737.1| PREDICTED: probable UDP-arabinopyranose mutase 2 isoform X1 [Brachypodium 
distachyon]
Length=348

 Score =   240 bits (612),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 111/190 (58%), Positives = 144/190 (76%), Gaps = 3/190 (2%)
 Frame = +2

Query  5    CALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGPA  184
            C LS GLWL+ ADYD  T  +K  QRN+ YVDAV+TVP  A+MPVSGIN+AF+RE++GP 
Sbjct  158  CMLSSGLWLHNADYDPMTHVVKRNQRNTNYVDAVMTVPLGAMMPVSGINVAFNREVLGPV  217

Query  185  LSPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRK--ERGNAIESLK  358
            + P  R+ KEG  RW+T+ED+W+G+C KVVCD LG GVK+GLPYV R   E G A+ESL 
Sbjct  218  MFPGLRIRKEGKHRWDTLEDIWNGLCAKVVCDSLGYGVKTGLPYVMRSDAEAGKALESL-  276

Query  359  KEWEGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEW  538
            K+WEGVK+M+ ++PFFQSL+LS  A TV+DCV E+A+ V+E+L    P+F++AADAM EW
Sbjct  277  KDWEGVKVMDNVLPFFQSLKLSRTAVTVDDCVKELASIVREKLAPKNPIFAKAADAMEEW  336

Query  539  VELWNDVKTQ  568
             +LW     Q
Sbjct  337  TKLWKSHGAQ  346



>emb|CAA09470.1| RGP2 protein [Oryza sativa Japonica Group]
Length=348

 Score =   240 bits (612),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 114/190 (60%), Positives = 144/190 (76%), Gaps = 3/190 (2%)
 Frame = +2

Query  5    CALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGPA  184
            C LSCGLWL+ ADYD  T  +K  QRN+ YVDAV+TVP  A+MPVSGIN+AF+RE++GP 
Sbjct  158  CMLSCGLWLHNADYDPMTHVVKRNQRNTTYVDAVMTVPLGAMMPVSGINVAFNREVLGPV  217

Query  185  LSPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRK--ERGNAIESLK  358
            + PA RL KEG  RW+T+EDVW+G+C KVVCD L  GVK+GLPYV R   E G A+ESL 
Sbjct  218  MFPALRLRKEGKHRWDTLEDVWNGLCAKVVCDRLRYGVKTGLPYVIRSDAEAGKALESL-  276

Query  359  KEWEGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEW  538
            KEWEGVK+M+ ++PFF+SL+LS  + TVEDCV E+ + VKE+LG    +F++AADAM EW
Sbjct  277  KEWEGVKVMDVVLPFFESLKLSSTSVTVEDCVKELTSIVKEKLGPQNAIFAKAADAMEEW  336

Query  539  VELWNDVKTQ  568
             +LW     Q
Sbjct  337  TKLWKSHGAQ  346



>ref|NP_001151577.1| alpha-1,4-glucan-protein synthase [Zea mays]
 gb|ACG43402.1| alpha-1,4-glucan-protein synthase [Zea mays]
 gb|ACG47191.1| alpha-1,4-glucan-protein synthase [Zea mays]
Length=349

 Score =   240 bits (612),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 111/184 (60%), Positives = 143/184 (78%), Gaps = 3/184 (2%)
 Frame = +2

Query  5    CALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGPA  184
            C LSCGLWL+ ADYD  T  +K  QRN+ YVDAV+TVP  A++PVSGIN+AF+R+++GPA
Sbjct  159  CMLSCGLWLHNADYDPMTHVVKRNQRNTTYVDAVMTVPLGAMLPVSGINVAFNRDVLGPA  218

Query  185  LSPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRK--ERGNAIESLK  358
            + P  RL  EG  RW+T+ED+W+G+C KVVCD LG GVK+ LPYV R   E G A+ESL 
Sbjct  219  MFPGLRLRNEGKHRWDTLEDIWNGLCAKVVCDSLGYGVKTRLPYVMRSDAEAGKALESL-  277

Query  359  KEWEGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEW  538
            KEWEGVK+M++++PFFQSL+LS  A TV+DCV E+A  V+E+LG    +F++AADAMVEW
Sbjct  278  KEWEGVKVMDDVLPFFQSLKLSRTAVTVDDCVKELAGIVREKLGPKNAIFTKAADAMVEW  337

Query  539  VELW  550
              LW
Sbjct  338  NNLW  341



>gb|EEC78175.1| hypothetical protein OsI_17769 [Oryza sativa Indica Group]
 gb|EEE61839.1| hypothetical protein OsJ_16492 [Oryza sativa Japonica Group]
Length=378

 Score =   241 bits (614),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 114/190 (60%), Positives = 144/190 (76%), Gaps = 3/190 (2%)
 Frame = +2

Query  5    CALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGPA  184
            C LSCGLWL+ ADYD  T  +K  QRN+ YVDAV+TVP  A+MPVSGIN+AF+RE++GP 
Sbjct  188  CMLSCGLWLHNADYDPMTHVVKRNQRNTTYVDAVMTVPLGAMMPVSGINVAFNREVLGPV  247

Query  185  LSPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRK--ERGNAIESLK  358
            + PA RL KEG  RW+T+EDVW+G+C KVVCD L  GVK+GLPYV R   E G A+ESL 
Sbjct  248  MFPALRLRKEGKHRWDTLEDVWNGLCAKVVCDRLRYGVKTGLPYVMRSDAEAGKALESL-  306

Query  359  KEWEGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEW  538
            KEWEGVK+M+ ++PFF+SL+LS  + TVEDCV E+ + VKE+LG    +F++AADAM EW
Sbjct  307  KEWEGVKVMDVVLPFFESLKLSSTSVTVEDCVKELTSIVKEKLGPQNAIFAKAADAMEEW  366

Query  539  VELWNDVKTQ  568
             +LW     Q
Sbjct  367  TKLWKSHGAQ  376



>ref|XP_006652954.1| PREDICTED: probable UDP-arabinopyranose mutase 2-like isoform 
X1 [Oryza brachyantha]
 ref|XP_006652955.1| PREDICTED: probable UDP-arabinopyranose mutase 2-like isoform 
X2 [Oryza brachyantha]
Length=347

 Score =   238 bits (608),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 112/184 (61%), Positives = 141/184 (77%), Gaps = 3/184 (2%)
 Frame = +2

Query  5    CALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGPA  184
            C LSCGLWL+ ADYD  T  +K  Q N++YVDAV+TVP  A+MPVSGIN+AF+RE++GP 
Sbjct  157  CMLSCGLWLHNADYDPMTHVVKRSQHNTKYVDAVMTVPLGAMMPVSGINVAFNREVLGPV  216

Query  185  LSPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRK--ERGNAIESLK  358
            + PA RL KEG  RW+T+EDVW+G+C KVVCD LG G+K+GLPYV R   E G A+ESL 
Sbjct  217  MFPALRLRKEGKHRWDTLEDVWNGLCAKVVCDRLGYGMKTGLPYVIRSDAEAGKALESL-  275

Query  359  KEWEGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEW  538
            KEWEGVK+M+ ++ FF+SL+LS  A TVEDCV E+ + VKE LG    +F++AADAM EW
Sbjct  276  KEWEGVKVMDVVLSFFESLKLSSTAVTVEDCVKELTSIVKENLGPQNAIFAKAADAMEEW  335

Query  539  VELW  550
              LW
Sbjct  336  TNLW  339



>ref|XP_010240553.1| PREDICTED: probable UDP-arabinopyranose mutase 2 isoform X2 [Brachypodium 
distachyon]
Length=430

 Score =   241 bits (614),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 111/190 (58%), Positives = 144/190 (76%), Gaps = 3/190 (2%)
 Frame = +2

Query  5    CALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGPA  184
            C LS GLWL+ ADYD  T  +K  QRN+ YVDAV+TVP  A+MPVSGIN+AF+RE++GP 
Sbjct  240  CMLSSGLWLHNADYDPMTHVVKRNQRNTNYVDAVMTVPLGAMMPVSGINVAFNREVLGPV  299

Query  185  LSPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRK--ERGNAIESLK  358
            + P  R+ KEG  RW+T+ED+W+G+C KVVCD LG GVK+GLPYV R   E G A+ESL 
Sbjct  300  MFPGLRIRKEGKHRWDTLEDIWNGLCAKVVCDSLGYGVKTGLPYVMRSDAEAGKALESL-  358

Query  359  KEWEGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEW  538
            K+WEGVK+M+ ++PFFQSL+LS  A TV+DCV E+A+ V+E+L    P+F++AADAM EW
Sbjct  359  KDWEGVKVMDNVLPFFQSLKLSRTAVTVDDCVKELASIVREKLAPKNPIFAKAADAMEEW  418

Query  539  VELWNDVKTQ  568
             +LW     Q
Sbjct  419  TKLWKSHGAQ  428



>gb|AAL87194.1|AF480497_22 putative amylogenin [Oryza sativa Japonica Group]
Length=433

 Score =   240 bits (612),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 114/190 (60%), Positives = 144/190 (76%), Gaps = 3/190 (2%)
 Frame = +2

Query  5    CALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGPA  184
            C LSCGLWL+ ADYD  T  +K  QRN+ YVDAV+TVP  A+MPVSGIN+AF+RE++GP 
Sbjct  243  CMLSCGLWLHNADYDPMTHVVKRNQRNTTYVDAVMTVPLGAMMPVSGINVAFNREVLGPV  302

Query  185  LSPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRK--ERGNAIESLK  358
            + PA RL KEG  RW+T+EDVW+G+C KVVCD L  GVK+GLPYV R   E G A+ESL 
Sbjct  303  MFPALRLRKEGKHRWDTLEDVWNGLCAKVVCDRLRYGVKTGLPYVMRSDAEAGKALESL-  361

Query  359  KEWEGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEW  538
            KEWEGVK+M+ ++PFF+SL+LS  + TVEDCV E+ + VKE+LG    +F++AADAM EW
Sbjct  362  KEWEGVKVMDVVLPFFESLKLSSTSVTVEDCVKELTSIVKEKLGPQNAIFAKAADAMEEW  421

Query  539  VELWNDVKTQ  568
             +LW     Q
Sbjct  422  TKLWKSHGAQ  431



>gb|AFK36248.1| unknown [Lotus japonicus]
Length=147

 Score =   229 bits (585),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 108/146 (74%), Positives = 122/146 (84%), Gaps = 0/146 (0%)
 Frame = +2

Query  128  LMPVSGINIAFDRELVGPALSPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSG  307
            +MPVSGINIAF+RE VGPAL PA +LA EG  RWETVED+W GMCVKV+CDHLGLGVKSG
Sbjct  1    MMPVSGINIAFNREAVGPALIPALKLAGEGKFRWETVEDIWCGMCVKVICDHLGLGVKSG  60

Query  308  LPYVWRKERGNAIESLKKEWEGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQL  487
            LPYVWR ERG+AIESLKKEWEGVKLME++VPFFQS+RL   ATT EDCV E+A  VKE L
Sbjct  61   LPYVWRTERGDAIESLKKEWEGVKLMEDVVPFFQSVRLPQSATTAEDCVVEMAKTVKENL  120

Query  488  GKSAPVFSRAADAMVEWVELWNDVKT  565
            GK  P+FS AA+ M EWV+LW  V +
Sbjct  121  GKVDPMFSHAAETMEEWVKLWESVGS  146



>emb|CAA77236.1| amylogenin [Triticum aestivum]
 gb|ADK56175.1| glycosyltransferase 75 [Triticum aestivum]
 gb|EMT18389.1| Alpha-1,4-glucan-protein synthase (UDP-forming) [Aegilops tauschii]
Length=348

 Score =   236 bits (602),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 109/190 (57%), Positives = 142/190 (75%), Gaps = 3/190 (2%)
 Frame = +2

Query  5    CALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGPA  184
            C LSCGLWL+ ADYD  T  +K  QRN+ YVDAV+TVP  A+ PVSGIN+AF+RE++GP 
Sbjct  158  CMLSCGLWLHNADYDPMTHVVKRNQRNTNYVDAVMTVPLGAMFPVSGINVAFNREVLGPV  217

Query  185  LSPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRK--ERGNAIESLK  358
            + P  R+ KEG  RW+T+ED+W+G+C KVVCD LG GVK+GLPYV R   E G A+ESL 
Sbjct  218  MFPGLRIRKEGKHRWDTLEDIWNGLCAKVVCDSLGYGVKTGLPYVMRSDAEAGKALESL-  276

Query  359  KEWEGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEW  538
            KEWEGVK+M++++PFF+SL+LS  A TV+DCV E+A  VK++L     +F++AAD M EW
Sbjct  277  KEWEGVKVMDDVLPFFESLKLSRTAVTVDDCVKELAGIVKQKLAPKNAIFAKAADVMEEW  336

Query  539  VELWNDVKTQ  568
             +LW     Q
Sbjct  337  TKLWKSHGAQ  346



>dbj|BAJ88947.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=394

 Score =   238 bits (606),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 108/190 (57%), Positives = 143/190 (75%), Gaps = 3/190 (2%)
 Frame = +2

Query  5    CALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGPA  184
            C LSCGLWL+ ADYD  T  +K  QRN+ YVDAV+TVP  A+ PVSGIN+AF+RE++GP 
Sbjct  158  CVLSCGLWLHNADYDPMTHVVKRNQRNTNYVDAVMTVPLGAMFPVSGINVAFNREVLGPV  217

Query  185  LSPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRK--ERGNAIESLK  358
            + P  R+ KEG  RW+T+ED+W+G+C KV+CD LG GVK+GLPYV R   E G A+ESL 
Sbjct  218  MFPGLRIRKEGKHRWDTLEDIWNGLCAKVICDSLGYGVKTGLPYVMRSDAEAGKALESL-  276

Query  359  KEWEGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEW  538
            KEWEGVK+M++++PFF+SL+LS  A TV+DC+ E+A  V+++L     +FS+AADAM EW
Sbjct  277  KEWEGVKVMDDVLPFFESLKLSRTAVTVDDCIKELAGIVRQKLAPKNAIFSKAADAMEEW  336

Query  539  VELWNDVKTQ  568
             +LW     Q
Sbjct  337  TKLWKSHGAQ  346



>gb|AGV54358.1| alpha-1,4-glucan-protein synthase [UDP-forming]-like protein 
[Phaseolus vulgaris]
Length=363

 Score =   216 bits (551),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 99/187 (53%), Positives = 137/187 (73%), Gaps = 3/187 (2%)
 Frame = +2

Query  8    ALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGPAL  187
            A+S GLWLN+ DYDAPTQ +KP++RN+RYVDAVLT+P   L P+ G+N+AFDREL+GPA+
Sbjct  165  AVSHGLWLNIPDYDAPTQLVKPRERNTRYVDAVLTIPKGTLFPMCGMNLAFDRELIGPAM  224

Query  188  SPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRKERGNAIESLKKEW  367
               F L  +G       +D+W+G CVKV+CDHLGLGVK+GLPY+W  +  N   +LKKE+
Sbjct  225  --YFGLMGDGQ-PIGRYDDMWAGWCVKVICDHLGLGVKTGLPYIWHSKASNPFVNLKKEY  281

Query  368  EGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEWVEL  547
            +G+   EEI+PFFQS  LS ++T+V+ C  E++  VKE+LG   P F++ ADAMV W+E 
Sbjct  282  KGIFWQEEIIPFFQSATLSKESTSVQQCYIELSKQVKEKLGAVDPYFNKLADAMVTWIEA  341

Query  548  WNDVKTQ  568
            W+++   
Sbjct  342  WDELNNN  348



>ref|XP_009398248.1| PREDICTED: UDP-arabinopyranose mutase 1-like [Musa acuminata 
subsp. malaccensis]
Length=364

 Score =   216 bits (550),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 98/184 (53%), Positives = 136/184 (74%), Gaps = 3/184 (2%)
 Frame = +2

Query  8    ALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGPAL  187
            A+S GLWLN+ DYDAPTQ +KP++RN+RYVDAVLT+P   L P+ G+N+AFDREL+GPA+
Sbjct  167  AVSHGLWLNIPDYDAPTQLVKPRERNTRYVDAVLTIPKGTLFPMCGMNLAFDRELIGPAM  226

Query  188  SPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRKERGNAIESLKKEW  367
               F L  +G       +D+W+G C KV+CDHLGLG+K+GLPY+W  +  N   +LKKE+
Sbjct  227  Y--FGLMGDGQ-PIGRYDDMWAGWCTKVICDHLGLGIKTGLPYIWHSKASNPFVNLKKEY  283

Query  368  EGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEWVEL  547
            +G+   EE++PFFQS  LS + TTV+ C  E++  V+E+LGK  P F++ ADAMV W+E 
Sbjct  284  KGIFWQEELIPFFQSAVLSKECTTVQKCYIELSKQVREKLGKIDPYFTKLADAMVTWIEA  343

Query  548  WNDV  559
            W+D+
Sbjct  344  WDDL  347



>ref|XP_007153489.1| hypothetical protein PHAVU_003G040000g [Phaseolus vulgaris]
 gb|ESW25483.1| hypothetical protein PHAVU_003G040000g [Phaseolus vulgaris]
Length=435

 Score =   218 bits (554),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 99/187 (53%), Positives = 137/187 (73%), Gaps = 3/187 (2%)
 Frame = +2

Query  8    ALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGPAL  187
            A+S GLWLN+ DYDAPTQ +KP++RN+RYVDAVLT+P   L P+ G+N+AFDREL+GPA+
Sbjct  237  AVSHGLWLNIPDYDAPTQLVKPRERNTRYVDAVLTIPKGTLFPMCGMNLAFDRELIGPAM  296

Query  188  SPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRKERGNAIESLKKEW  367
               F L  +G       +D+W+G CVKV+CDHLGLGVK+GLPY+W  +  N   +LKKE+
Sbjct  297  --YFGLMGDGQ-PIGRYDDMWAGWCVKVICDHLGLGVKTGLPYIWHSKASNPFVNLKKEY  353

Query  368  EGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEWVEL  547
            +G+   EEI+PFFQS  LS ++T+V+ C  E++  VKE+LG   P F++ ADAMV W+E 
Sbjct  354  KGIFWQEEIIPFFQSATLSKESTSVQQCYIELSKQVKEKLGAVDPYFNKLADAMVTWIEA  413

Query  548  WNDVKTQ  568
            W+++   
Sbjct  414  WDELNNN  420



>gb|EYU44230.1| hypothetical protein MIMGU_mgv1a009275mg [Erythranthe guttata]
Length=347

 Score =   214 bits (544),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 97/185 (52%), Positives = 135/185 (73%), Gaps = 3/185 (2%)
 Frame = +2

Query  8    ALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGPAL  187
            A+S GLW+N+ DYDAPTQ +KP++RN+RYVDAVLT+P   L P+ G+N+AFDR+L+GPA+
Sbjct  161  AVSHGLWMNIPDYDAPTQLVKPRERNTRYVDAVLTIPKGTLFPMCGMNLAFDRDLIGPAM  220

Query  188  SPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRKERGNAIESLKKEW  367
               F L  +G       +D+W+G C+KV+CDHLGLGVK+GLPY+W  +  N   +LKKE+
Sbjct  221  Y--FGLMGDGQ-PIGRYDDMWAGWCIKVICDHLGLGVKTGLPYIWHSKASNPFVNLKKEY  277

Query  368  EGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEWVEL  547
            +G+   EEI+PFFQS  LS ++TTV+ C  E++  VKE LGK  P F + ADAM  W++ 
Sbjct  278  KGIFWQEEIIPFFQSATLSKESTTVQKCYVELSKQVKETLGKVDPYFVKLADAMETWIQA  337

Query  548  WNDVK  562
            W+D+ 
Sbjct  338  WDDLN  342



>emb|CDY26446.1| BnaC09g42220D [Brassica napus]
Length=335

 Score =   213 bits (543),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 96/187 (51%), Positives = 138/187 (74%), Gaps = 3/187 (2%)
 Frame = +2

Query  2    SCALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGP  181
            S A+S GLWLN+ DYDAPTQ +KPK+RN+RYVDAV+T+P   L P+ G+N+AFDR+L+GP
Sbjct  147  STAVSHGLWLNIPDYDAPTQLVKPKERNTRYVDAVMTIPKGTLFPMCGMNLAFDRDLIGP  206

Query  182  ALSPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRKERGNAIESLKK  361
            A+   F L  +G       +D+W+G C+KV+CDHLGLGVK+GLPY++  +  N   +LKK
Sbjct  207  AMY--FGLMGDGQ-PIGRYDDMWAGWCIKVICDHLGLGVKTGLPYIYHSKASNPFVNLKK  263

Query  362  EWEGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEWV  541
            E++G+   E+I+PFFQ+++LS +ATTV+ C  E++  VKE+L    P F + ADAMV W+
Sbjct  264  EYKGIFWQEDIIPFFQNVKLSKEATTVQQCYIELSKMVKEKLSSLDPYFDKLADAMVTWI  323

Query  542  ELWNDVK  562
            E W+++ 
Sbjct  324  EAWDELN  330



>ref|XP_006408433.1| hypothetical protein EUTSA_v10021014mg [Eutrema salsugineum]
 gb|ESQ49886.1| hypothetical protein EUTSA_v10021014mg [Eutrema salsugineum]
Length=357

 Score =   214 bits (544),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 99/187 (53%), Positives = 136/187 (73%), Gaps = 3/187 (2%)
 Frame = +2

Query  2    SCALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGP  181
            S A+S GLWLN+ DYDAPTQ +KPK+RN+RYVDAVLT+P   L P+ G+N+AFDREL+GP
Sbjct  169  STAVSHGLWLNIPDYDAPTQLVKPKERNTRYVDAVLTIPKGTLFPMCGMNLAFDRELIGP  228

Query  182  ALSPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRKERGNAIESLKK  361
            A+   F L  +G       +D+W+G CVKV+CDHLGLGVK+GLPY++  +  N   +LKK
Sbjct  229  AMY--FGLMGDGQ-PIGRYDDMWAGWCVKVICDHLGLGVKTGLPYIYHSKASNPFVNLKK  285

Query  362  EWEGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEWV  541
            E++G+   E+I+PFFQS +LS +A TV+ C  E++  VKE+L    P F + ADAMV W+
Sbjct  286  EYKGIFWQEDIIPFFQSAKLSKEAVTVQQCYIELSKMVKEKLSPIDPYFDKLADAMVTWI  345

Query  542  ELWNDVK  562
            E W+++ 
Sbjct  346  EAWDELN  352



>emb|CDX69510.1| BnaA10g18590D [Brassica napus]
Length=335

 Score =   213 bits (542),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 96/187 (51%), Positives = 138/187 (74%), Gaps = 3/187 (2%)
 Frame = +2

Query  2    SCALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGP  181
            S A+S GLWLN+ DYDAPTQ +KPK+RN+RYVDAV+T+P   L P+ G+N+AFDR+L+GP
Sbjct  147  STAVSHGLWLNIPDYDAPTQLVKPKERNARYVDAVMTIPKGTLFPMCGMNLAFDRDLIGP  206

Query  182  ALSPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRKERGNAIESLKK  361
            A+   F L  +G       +D+W+G C+KV+CDHLGLGVK+GLPY++  +  N   +LKK
Sbjct  207  AMY--FGLMGDGQ-PIGRYDDMWAGWCIKVICDHLGLGVKTGLPYIYHSKASNPFVNLKK  263

Query  362  EWEGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEWV  541
            E++G+   E+I+PFFQ+++LS +ATTV+ C  E++  VKE+L    P F + ADAMV W+
Sbjct  264  EYKGIFWQEDIIPFFQNVKLSKEATTVQQCYIELSKMVKEKLSSLDPYFDKLADAMVTWI  323

Query  542  ELWNDVK  562
            E W+++ 
Sbjct  324  EAWDELN  330



>gb|AAB61672.1| type IIIa membrane protein cp-wap13 [Vigna unguiculata]
Length=346

 Score =   213 bits (543),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 98/186 (53%), Positives = 135/186 (73%), Gaps = 3/186 (2%)
 Frame = +2

Query  8    ALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGPAL  187
            A+S GLWLN+ DYDAPTQ +KP++RN+RYVDAVLT+P   L P+ G+N+AFDREL+GPA+
Sbjct  135  AVSHGLWLNIPDYDAPTQLVKPRERNTRYVDAVLTIPKGTLFPMCGMNLAFDRELIGPAM  194

Query  188  SPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRKERGNAIESLKKEW  367
               F L  +G       +D+W+G CVKV+CDHLGLGVK+GLPY+W  +  N   +LKKE+
Sbjct  195  --YFGLMGDGQ-PIGRYDDMWAGWCVKVICDHLGLGVKTGLPYIWHSKASNPFVNLKKEY  251

Query  368  EGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEWVEL  547
            +G+   EEI+PFFQS  L  + T+V+ C  E++  VKE+LG   P F++ ADAMV W+E 
Sbjct  252  KGIFWQEEIIPFFQSATLPKECTSVQKCYIELSKQVKEKLGAVDPYFNKLADAMVTWIEA  311

Query  548  WNDVKT  565
            W+++  
Sbjct  312  WDELNN  317



>ref|XP_008811806.1| PREDICTED: UDP-arabinopyranose mutase 1 [Phoenix dactylifera]
Length=361

 Score =   214 bits (544),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 98/187 (52%), Positives = 135/187 (72%), Gaps = 3/187 (2%)
 Frame = +2

Query  2    SCALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGP  181
            + A+S GLWLN+ DYDAPTQ +KP++RN+RYVDAVLT+P   L P+ G+N+AFDREL+GP
Sbjct  164  ATAVSHGLWLNIPDYDAPTQLVKPRERNTRYVDAVLTIPKGTLFPMCGMNLAFDRELIGP  223

Query  182  ALSPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRKERGNAIESLKK  361
            A+   F L  +G       +D+W+G C KV+CDHLGLGVK+GLPY+W  +  N   +LKK
Sbjct  224  AMY--FGLMGDGQ-PIGRYDDMWAGWCTKVICDHLGLGVKTGLPYIWHSKASNPFVNLKK  280

Query  362  EWEGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEWV  541
            E+ G+   EE++PFFQS  LS   TTV+ C  E++  V+E+LGK  P F++ ADAMV W+
Sbjct  281  EYNGIFWQEELIPFFQSAVLSKDCTTVQKCYIELSKQVREKLGKIDPYFNKLADAMVTWI  340

Query  542  ELWNDVK  562
            E W+++ 
Sbjct  341  EAWDELN  347



>emb|CDX78646.1| BnaA03g05580D [Brassica napus]
Length=341

 Score =   213 bits (542),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 96/186 (52%), Positives = 138/186 (74%), Gaps = 3/186 (2%)
 Frame = +2

Query  2    SCALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGP  181
            S A+S GLWLN+ DYDAPTQ +KPK+RN+RYVDAV+T+P   L P+ G+N+AFDR+L+GP
Sbjct  147  STAVSHGLWLNIPDYDAPTQLVKPKERNTRYVDAVMTIPKGTLFPMCGMNLAFDRDLIGP  206

Query  182  ALSPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRKERGNAIESLKK  361
            A+   F L  +G       +D+W+G C+KV+CDHLGLGVK+GLPY++  +  N   +LKK
Sbjct  207  AMY--FGLMGDGQ-PIGRYDDMWAGWCIKVICDHLGLGVKTGLPYIYHSKASNPFVNLKK  263

Query  362  EWEGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEWV  541
            E++G+   E+I+PFFQ+++LS +ATTV+ C  E++  VKE+L    P F + ADAMV W+
Sbjct  264  EYKGIFWQEDIIPFFQNVKLSKEATTVQQCYIELSKMVKEKLSPLDPYFDKLADAMVTWI  323

Query  542  ELWNDV  559
            E W+++
Sbjct  324  EAWDEL  329



>gb|KDO64420.1| hypothetical protein CISIN_1g048449mg [Citrus sinensis]
Length=288

 Score =   211 bits (537),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 96/186 (52%), Positives = 133/186 (72%), Gaps = 3/186 (2%)
 Frame = +2

Query  8    ALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGPAL  187
            A+S GLWLN+ DYDAPTQ +KP++RNSRYVDAV+T+P  +L P+ G+N+AFDREL+GPA+
Sbjct  79   AISHGLWLNIPDYDAPTQLVKPRERNSRYVDAVMTIPKGSLFPMCGMNLAFDRELIGPAM  138

Query  188  SPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRKERGNAIESLKKEW  367
               F L  +G       +D+W+G C KV+CDHL LGVK+GLPY+W  +  N   +LKKE+
Sbjct  139  --YFGLMGDGQ-PIGRYDDMWAGWCAKVICDHLSLGVKTGLPYIWHSKASNPFVNLKKEY  195

Query  368  EGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEWVEL  547
            +G+   EEI+PFFQS+ L  + TTV+ C  E++  VKE+LG   P F +  DAMV W+E 
Sbjct  196  KGIYWQEEIIPFFQSVLLPKECTTVQKCYIELSRQVKEKLGPLDPYFQKLGDAMVTWIEA  255

Query  548  WNDVKT  565
            W+ + +
Sbjct  256  WDQLNS  261



>ref|XP_010937949.1| PREDICTED: UDP-arabinopyranose mutase 1 [Elaeis guineensis]
 gb|AGE46030.1| alpha-1,4-glucan-protein synthase [Elaeis guineensis]
Length=361

 Score =   213 bits (543),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 99/187 (53%), Positives = 134/187 (72%), Gaps = 3/187 (2%)
 Frame = +2

Query  2    SCALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGP  181
            S A+S GLWLN+ DYDAPTQ +KP++RN+RYVDAVLTVP   L P+ G+N+AFDREL+GP
Sbjct  164  STAVSHGLWLNIPDYDAPTQLVKPRERNTRYVDAVLTVPKGTLFPMCGMNLAFDRELIGP  223

Query  182  ALSPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRKERGNAIESLKK  361
            A+   F L  +G       +D+W+G C KV+CDHLGLGVK+GLPY+W  +  N   +LKK
Sbjct  224  AM--YFGLMGDGQ-PIGRYDDMWAGWCTKVICDHLGLGVKTGLPYIWHSKASNPFVNLKK  280

Query  362  EWEGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEWV  541
            E++G+   EE++PFFQS  L    TTV+ C  E++  V+E+LGK  P F + ADAMV W+
Sbjct  281  EYKGIFWQEELIPFFQSAVLPKDCTTVQKCYIELSKQVREKLGKIDPYFDKLADAMVTWI  340

Query  542  ELWNDVK  562
            E W+++ 
Sbjct  341  EAWDELN  347



>emb|CDP00457.1| unnamed protein product [Coffea canephora]
Length=269

 Score =   210 bits (535),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 94/185 (51%), Positives = 134/185 (72%), Gaps = 3/185 (2%)
 Frame = +2

Query  8    ALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGPAL  187
            A+S GLWLN+ DYDAPTQ +KP++RN+RYVDAV+T+P   L P+ G+N+AF+REL+GPA+
Sbjct  73   AVSHGLWLNIPDYDAPTQLVKPRERNTRYVDAVMTIPKGTLFPMCGMNLAFNRELIGPAM  132

Query  188  SPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRKERGNAIESLKKEW  367
               F L  +G       +D+W+G C KV+CDHLGLG+K+GLPY+W  +  N   +LKKE+
Sbjct  133  Y--FGLMGDGQ-PIGRYDDMWAGWCTKVICDHLGLGIKTGLPYIWHSKASNPFVNLKKEY  189

Query  368  EGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEWVEL  547
            +G+   EEI+PFFQ++ L  + TTV+ C TE+A  VK +L    P F++ ADAMV W+E 
Sbjct  190  KGIYWQEEIIPFFQAVSLPKECTTVQQCYTELAKQVKAKLANVDPYFTKLADAMVTWIEA  249

Query  548  WNDVK  562
            W+++ 
Sbjct  250  WDELN  254



>gb|ABK21236.1| unknown [Picea sitchensis]
Length=363

 Score =   213 bits (543),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 98/190 (52%), Positives = 135/190 (71%), Gaps = 3/190 (2%)
 Frame = +2

Query  8    ALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGPAL  187
            A+S GLW+N+ DYDAPTQ +KP +RN+RYVDAVLT+P   L P+ G+N+AFDREL+GPA+
Sbjct  163  AVSHGLWMNIPDYDAPTQLVKPLERNTRYVDAVLTIPKGTLFPMCGMNLAFDRELIGPAM  222

Query  188  SPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRKERGNAIESLKKEW  367
               F L  +G       +D+W+G C+KV+CDHLGLGVK+GLPY+W  +  N   +LKKE+
Sbjct  223  --YFGLMGDGQ-PIGRYDDMWAGWCIKVICDHLGLGVKTGLPYIWHSKASNPFVNLKKEY  279

Query  368  EGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEWVEL  547
            +G+   EEI+PFFQS  L  + T+V+ C  E++  VKE LGK  P F + ADAMV W+E 
Sbjct  280  KGIFWQEEIIPFFQSATLPKECTSVQQCYIELSKQVKESLGKVDPYFQKLADAMVTWIEA  339

Query  548  WNDVKTQ*TN  577
            W+++    +N
Sbjct  340  WDELNPTASN  349



>emb|CDX90981.1| BnaC02g06160D [Brassica napus]
Length=341

 Score =   213 bits (541),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 96/186 (52%), Positives = 137/186 (74%), Gaps = 3/186 (2%)
 Frame = +2

Query  2    SCALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGP  181
            + A+S GLWLN+ DYDAPTQ +KPK+RN+RYVDAV+T+P   L P+ G+N+AFDR+L+GP
Sbjct  147  TTAVSHGLWLNIPDYDAPTQLVKPKERNTRYVDAVMTIPKGTLFPMCGMNLAFDRDLIGP  206

Query  182  ALSPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRKERGNAIESLKK  361
            A+   F L  +G       +D+W+G C+KV+CDHLGLGVK+GLPY++  +  N   +LKK
Sbjct  207  AMY--FGLMGDGQ-PIGRYDDMWAGWCIKVICDHLGLGVKTGLPYIYHSKASNPFVNLKK  263

Query  362  EWEGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEWV  541
            E++G+   EEI+PFFQ+ +LS +ATTV+ C  E++  VKE+L    P F + ADAMV W+
Sbjct  264  EYKGIFWQEEIIPFFQNAKLSKEATTVQQCYIELSKMVKEKLSSLDPYFDKLADAMVTWI  323

Query  542  ELWNDV  559
            E W+++
Sbjct  324  EAWDEL  329



>emb|CDX85541.1| BnaA02g02720D [Brassica napus]
Length=341

 Score =   213 bits (541),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 96/187 (51%), Positives = 137/187 (73%), Gaps = 3/187 (2%)
 Frame = +2

Query  2    SCALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGP  181
            + A+S GLWLN+ DYDAPTQ +KPK+RN+RYVDAV+T+P   L P+ G+N+AFDR+L+GP
Sbjct  147  TTAVSHGLWLNIPDYDAPTQLVKPKERNTRYVDAVMTIPKGTLFPMCGMNLAFDRDLIGP  206

Query  182  ALSPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRKERGNAIESLKK  361
            A+   F L  +G       +D+W+G C+KV+CDHLGLGVK+GLPY++  +  N   +LKK
Sbjct  207  AMY--FGLMGDGQ-PIGRYDDMWAGWCIKVICDHLGLGVKTGLPYIYHSKASNPFVNLKK  263

Query  362  EWEGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEWV  541
            E++G+   EEI+PFFQ+ +LS +ATTV+ C  E++  VKE+L    P F + ADAMV W+
Sbjct  264  EYKGIFWQEEIIPFFQNAKLSKEATTVQQCYIELSKMVKEKLSSLDPYFDKLADAMVTWI  323

Query  542  ELWNDVK  562
            E W+++ 
Sbjct  324  EAWDELN  330



>ref|XP_009134656.1| PREDICTED: UDP-arabinopyranose mutase 1-like [Brassica rapa]
 emb|CDX91983.1| BnaC03g32850D [Brassica napus]
Length=357

 Score =   213 bits (542),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 98/187 (52%), Positives = 136/187 (73%), Gaps = 3/187 (2%)
 Frame = +2

Query  2    SCALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGP  181
            S A+S GLWLN+ DYDAPTQ +KPK+RN+RYVDAV+T+P   L P+ G+N+AFDREL+GP
Sbjct  169  STAVSHGLWLNIPDYDAPTQLVKPKERNTRYVDAVMTIPKGTLFPMCGMNLAFDRELIGP  228

Query  182  ALSPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRKERGNAIESLKK  361
            A+   F L  +G       +D+W+G CVKV+CDHLGLGVK+GLPY++  +  N   +LKK
Sbjct  229  AMY--FGLMGDGQ-PIGRYDDMWAGWCVKVICDHLGLGVKTGLPYIYHSKASNPFVNLKK  285

Query  362  EWEGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEWV  541
            E++G+   E+I+PFFQS +LS +A TV+ C  E++  VKE+L    P F + ADAMV W+
Sbjct  286  EYKGIFWQEDIIPFFQSAKLSKEAVTVQQCYIELSKMVKEKLSAIDPYFDKLADAMVTWI  345

Query  542  ELWNDVK  562
            E W+++ 
Sbjct  346  EAWDELN  352



>ref|XP_006298006.1| hypothetical protein CARUB_v10014051mg [Capsella rubella]
 gb|EOA30904.1| hypothetical protein CARUB_v10014051mg [Capsella rubella]
Length=357

 Score =   213 bits (542),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 98/187 (52%), Positives = 136/187 (73%), Gaps = 3/187 (2%)
 Frame = +2

Query  2    SCALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGP  181
            S A+S GLWLN+ DYDAPTQ +KPK+RN+RYVDAV+T+P   L P+ G+N+AFDREL+GP
Sbjct  169  STAVSHGLWLNIPDYDAPTQLVKPKERNTRYVDAVMTIPKGTLFPMCGMNLAFDRELIGP  228

Query  182  ALSPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRKERGNAIESLKK  361
            A+   F L  +G       +D+W+G CVKV+CDHLGLGVK+GLPY++  +  N   +LKK
Sbjct  229  AMY--FGLMGDGQ-PIGRYDDMWAGWCVKVICDHLGLGVKTGLPYIYHSKASNPFVNLKK  285

Query  362  EWEGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEWV  541
            E++G+   E+I+PFFQS +LS +A TV+ C  E++  VKE+L    P F + ADAMV W+
Sbjct  286  EYKGIFWQEDIIPFFQSAKLSKEAVTVQQCYMELSKMVKEKLSAIDPYFDKLADAMVTWI  345

Query  542  ELWNDVK  562
            E W+++ 
Sbjct  346  EAWDELN  352



>emb|CBI16940.3| unnamed protein product [Vitis vinifera]
Length=267

 Score =   210 bits (534),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 98/185 (53%), Positives = 131/185 (71%), Gaps = 3/185 (2%)
 Frame = +2

Query  8    ALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGPAL  187
            A+S GLWLN+ DYDAPTQ +KP +RN+R+VDAVLT+P   L P+ G+N+AFDR+L+GPA+
Sbjct  73   AVSHGLWLNIPDYDAPTQLVKPLERNTRFVDAVLTIPKGTLFPMCGMNLAFDRDLIGPAM  132

Query  188  SPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRKERGNAIESLKKEW  367
               F L  +G       +D+W+G CVKV CDHLGLGVK+GLPY+W  +  N   +LKKE+
Sbjct  133  Y--FGLMGDGQ-PIGRYDDMWAGWCVKVTCDHLGLGVKTGLPYIWHSKASNPFVNLKKEY  189

Query  368  EGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEWVEL  547
             G+   EEI+PFFQS+ L    TTV+ C  E+A  VKE+LGK  P F +  DAMV W+E 
Sbjct  190  NGIFWQEEIIPFFQSVSLPKDCTTVQKCYVELAKLVKEKLGKVDPYFVKLGDAMVTWIEA  249

Query  548  WNDVK  562
            W+++ 
Sbjct  250  WDELN  254



>ref|XP_009121556.1| PREDICTED: UDP-arabinopyranose mutase 2 [Brassica rapa]
Length=357

 Score =   213 bits (541),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 96/187 (51%), Positives = 138/187 (74%), Gaps = 3/187 (2%)
 Frame = +2

Query  2    SCALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGP  181
            S A+S GLWLN+ DYDAPTQ +KPK+RN+RYVDAV+T+P   L P+ G+N+AFDR+L+GP
Sbjct  169  STAVSHGLWLNIPDYDAPTQLVKPKERNARYVDAVMTIPKGTLFPMCGMNLAFDRDLIGP  228

Query  182  ALSPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRKERGNAIESLKK  361
            A+   F L  +G       +D+W+G C+KV+CDHLGLGVK+GLPY++  +  N   +LKK
Sbjct  229  AMY--FGLMGDGQ-PIGRYDDMWAGWCIKVICDHLGLGVKTGLPYIYHSKASNPFVNLKK  285

Query  362  EWEGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEWV  541
            E++G+   E+I+PFFQ+++LS +ATTV+ C  E++  VKE+L    P F + ADAMV W+
Sbjct  286  EYKGIFWQEDIIPFFQNVKLSKEATTVQQCYIELSKMVKEKLSSLDPYFDKLADAMVTWI  345

Query  542  ELWNDVK  562
            E W+++ 
Sbjct  346  EAWDELN  352



>emb|CDP19977.1| unnamed protein product [Coffea canephora]
Length=356

 Score =   213 bits (541),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 96/185 (52%), Positives = 133/185 (72%), Gaps = 3/185 (2%)
 Frame = +2

Query  8    ALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGPAL  187
            A+S GLWLN+ DYDAPTQ +KP +RN+RYV+ V+T+P   L P+ G+N+AFDR+L+GPA+
Sbjct  161  AVSHGLWLNIPDYDAPTQLVKPLERNTRYVNTVMTIPKGTLFPMCGMNLAFDRDLIGPAM  220

Query  188  SPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRKERGNAIESLKKEW  367
               F L  EG       +D+W+G C KV+CDHLGLG+K+GLPY+W  +  N   +LKKE+
Sbjct  221  --YFGLMGEGQ-PIGRYDDMWAGWCTKVICDHLGLGIKTGLPYIWHSKASNPFVNLKKEY  277

Query  368  EGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEWVEL  547
             G+   EEI+PFFQS  LS  +TTV+ C  E++  VKE+LGK  P F++ ADAMV W+E 
Sbjct  278  NGIYWQEEIIPFFQSATLSKDSTTVQKCYVELSKQVKEKLGKIDPYFTKLADAMVTWIEA  337

Query  548  WNDVK  562
            W+++ 
Sbjct  338  WDELN  342



>ref|XP_010923637.1| PREDICTED: UDP-arabinopyranose mutase 1-like [Elaeis guineensis]
Length=362

 Score =   213 bits (541),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 98/187 (52%), Positives = 134/187 (72%), Gaps = 3/187 (2%)
 Frame = +2

Query  2    SCALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGP  181
            + A+S GLWLN+ DYDAPTQ +KP +RN+RYVDAVLTVP   L P+ G+N+AF+REL+GP
Sbjct  165  TTAVSHGLWLNIPDYDAPTQLVKPHERNTRYVDAVLTVPKGTLFPMCGMNLAFNRELIGP  224

Query  182  ALSPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRKERGNAIESLKK  361
            A+   F L  +G       +D+W+G C KV+CDHLGLGVK+GLPY+W  +  N   +LKK
Sbjct  225  AM--YFGLMGDGQ-PIGRYDDMWAGWCTKVICDHLGLGVKTGLPYIWHSKASNPFANLKK  281

Query  362  EWEGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEWV  541
            E+ G+   EE++PFFQS  LS   TTV+ C  E++  V+E+LGK  P F++ ADAMV W+
Sbjct  282  EYNGIFWQEELIPFFQSAVLSKDCTTVQKCYIELSKQVREKLGKIDPYFNKLADAMVTWI  341

Query  542  ELWNDVK  562
            E W+++ 
Sbjct  342  EAWDELN  348



>ref|XP_010463620.1| PREDICTED: UDP-arabinopyranose mutase 1-like [Camelina sativa]
Length=357

 Score =   212 bits (540),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 98/187 (52%), Positives = 136/187 (73%), Gaps = 3/187 (2%)
 Frame = +2

Query  2    SCALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGP  181
            S A+S GLWLN+ DYDAPTQ +KPK+RN+RYVDAV+T+P   L P+ G+N+AFDREL+GP
Sbjct  169  STAVSHGLWLNIPDYDAPTQLVKPKERNTRYVDAVMTIPKGTLFPMCGMNLAFDRELIGP  228

Query  182  ALSPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRKERGNAIESLKK  361
            A+   F L  +G       +D+W+G CVKV+CDHLGLGVK+GLPY++  +  N   +LKK
Sbjct  229  AM--YFGLMGDGQ-PIGRYDDMWAGWCVKVICDHLGLGVKTGLPYIYHSKASNPFVNLKK  285

Query  362  EWEGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEWV  541
            E++G+   E+I+PFFQS +LS +A TV+ C  E++  VKE+L    P F + ADAMV W+
Sbjct  286  EYKGIFWQEDIIPFFQSAKLSKEAVTVQQCYIELSKMVKEKLSVIDPYFDKLADAMVTWI  345

Query  542  ELWNDVK  562
            E W+++ 
Sbjct  346  EAWDELN  352



>ref|XP_010463051.1| PREDICTED: UDP-arabinopyranose mutase 1 [Camelina sativa]
 ref|XP_010485464.1| PREDICTED: UDP-arabinopyranose mutase 1 [Camelina sativa]
Length=357

 Score =   212 bits (540),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 98/187 (52%), Positives = 136/187 (73%), Gaps = 3/187 (2%)
 Frame = +2

Query  2    SCALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGP  181
            S A+S GLWLN+ DYDAPTQ +KPK+RN+RYVDAV+T+P   L P+ G+N+AFDREL+GP
Sbjct  169  STAVSHGLWLNIPDYDAPTQLVKPKERNTRYVDAVMTIPKGTLFPMCGMNLAFDRELIGP  228

Query  182  ALSPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRKERGNAIESLKK  361
            A+   F L  +G       +D+W+G CVKV+CDHLGLGVK+GLPY++  +  N   +LKK
Sbjct  229  AM--YFGLMGDGQ-PIGRYDDMWAGWCVKVICDHLGLGVKTGLPYIYHSKASNPFVNLKK  285

Query  362  EWEGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEWV  541
            E++G+   E+I+PFFQS +LS +A TV+ C  E++  VKE+L    P F + ADAMV W+
Sbjct  286  EYKGIFWQEDIIPFFQSAKLSKEAVTVQQCYMELSKMVKEKLSVIDPYFDKLADAMVTWI  345

Query  542  ELWNDVK  562
            E W+++ 
Sbjct  346  EAWDELN  352



>emb|CDY34712.1| BnaA01g33130D [Brassica napus]
Length=357

 Score =   212 bits (540),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 97/187 (52%), Positives = 137/187 (73%), Gaps = 3/187 (2%)
 Frame = +2

Query  2    SCALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGP  181
            S A+S GLWLN+ DYDAPTQ +KPK+RN+RYVDAV+T+P   L P+ G+N+AFDR+L+GP
Sbjct  169  STAVSHGLWLNIPDYDAPTQLVKPKERNTRYVDAVMTIPKGTLFPMCGMNLAFDRDLIGP  228

Query  182  ALSPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRKERGNAIESLKK  361
            A+   F L  +G       +D+W+G CVKV+CDHLGLGVK+GLPY++  +  N   +LKK
Sbjct  229  AMY--FGLMGDGQ-PIGRYDDMWAGWCVKVICDHLGLGVKTGLPYIYHSKASNPFVNLKK  285

Query  362  EWEGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEWV  541
            E++G+   E+I+PFFQS +LS +A TV+ C  E++  VKE+L    P F++ ADAMV W+
Sbjct  286  EYKGIFWQEDIIPFFQSAKLSKEAVTVQQCYIELSKMVKEKLSAIDPYFAKLADAMVTWI  345

Query  542  ELWNDVK  562
            E W+++ 
Sbjct  346  EAWDELN  352



>gb|AFK42305.1| unknown [Lotus japonicus]
Length=270

 Score =   209 bits (532),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 94/186 (51%), Positives = 133/186 (72%), Gaps = 3/186 (2%)
 Frame = +2

Query  8    ALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGPAL  187
            A+S GLWLN+ DYDAPTQ +KP++RN+RYVDAV+T+P   L P+ G+N+AFDR+L+GPA+
Sbjct  73   AVSHGLWLNIPDYDAPTQLVKPRERNTRYVDAVMTIPKGTLFPMCGMNLAFDRQLIGPAM  132

Query  188  SPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRKERGNAIESLKKEW  367
               F L  +G       +D+W+G C+KV+CDHLGLGVK+GLPY+W  +  N   +LKKE+
Sbjct  133  --YFGLMGDGQ-PIGRYDDMWAGWCIKVICDHLGLGVKTGLPYIWHSKASNPFVNLKKEY  189

Query  368  EGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEWVEL  547
            +G+   EEI+PFFQS  L    T+V+ C  E++  VKE+LG   P F++  DAMV W+E 
Sbjct  190  KGIFWQEEIIPFFQSATLPKDCTSVQKCYIELSKQVKEKLGPVDPYFNKLGDAMVTWIEA  249

Query  548  WNDVKT  565
            W+++  
Sbjct  250  WDELNN  255



>emb|CDX70629.1| BnaC03g07130D [Brassica napus]
Length=341

 Score =   211 bits (538),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 95/187 (51%), Positives = 138/187 (74%), Gaps = 3/187 (2%)
 Frame = +2

Query  2    SCALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGP  181
            S A+S GLWLN+ DYDAPTQ +KPK+RN+RYVDAV+T+P   L P+ G+N+AFDR+L+GP
Sbjct  147  STAVSHGLWLNIPDYDAPTQLVKPKERNTRYVDAVMTIPKGTLFPMCGMNLAFDRDLIGP  206

Query  182  ALSPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRKERGNAIESLKK  361
            A+   F L  +G       +D+W+G C+KV+CDHLGLGVK+GLPY++  +  N   +LKK
Sbjct  207  AMY--FGLMGDGQ-PIGRYDDMWAGWCIKVICDHLGLGVKTGLPYIYHSKASNPFVNLKK  263

Query  362  EWEGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEWV  541
            E++G+   E+I+PFFQ+++LS +AT+V+ C  E++  VKE+L    P F + ADAMV W+
Sbjct  264  EYKGIFWQEDIIPFFQNVKLSKEATSVQQCYIELSKMVKEKLSPLDPYFDKLADAMVTWI  323

Query  542  ELWNDVK  562
            E W+++ 
Sbjct  324  EAWDELN  330



>ref|XP_009407384.1| PREDICTED: UDP-arabinopyranose mutase 1 [Musa acuminata subsp. 
malaccensis]
Length=363

 Score =   212 bits (540),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 96/185 (52%), Positives = 135/185 (73%), Gaps = 3/185 (2%)
 Frame = +2

Query  8    ALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGPAL  187
            A+S GLWLN+ DYDAPTQ +KP++RNSRYVDAVLT+P   L P+ G+N+AFDR+L+GPA+
Sbjct  168  AVSHGLWLNIPDYDAPTQLVKPRERNSRYVDAVLTIPKGTLFPMCGMNLAFDRDLIGPAM  227

Query  188  SPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRKERGNAIESLKKEW  367
               F L  +G       +D+W+G C KV+CDHLGLGVK+GLPY+W  +  N   +LKKE+
Sbjct  228  --YFGLMGDGQ-PIGRYDDMWAGWCTKVICDHLGLGVKTGLPYIWHSKASNPFVNLKKEY  284

Query  368  EGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEWVEL  547
            +G+   EE++PFFQS+ L    T+V+ C  E++  V+E+LGK  P F++ ADAMV W+E 
Sbjct  285  KGIFWQEELIPFFQSVALPKDCTSVQKCYIELSKQVREKLGKIDPYFTKLADAMVTWIEA  344

Query  548  WNDVK  562
            W+++ 
Sbjct  345  WDELN  349



>emb|CDX74267.1| BnaA03g27800D [Brassica napus]
Length=357

 Score =   212 bits (539),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 97/187 (52%), Positives = 136/187 (73%), Gaps = 3/187 (2%)
 Frame = +2

Query  2    SCALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGP  181
            S A+S GLWLN+ DYDAPTQ +KPK+RN+RYVDAV+T+P   L P+ G+N+AFDR+L+GP
Sbjct  169  STAVSHGLWLNIPDYDAPTQLVKPKERNTRYVDAVMTIPKGTLFPMCGMNLAFDRDLIGP  228

Query  182  ALSPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRKERGNAIESLKK  361
            A+   F L  +G       +D+W+G CVKV+CDHLGLGVK+GLPY++  +  N   +LKK
Sbjct  229  AMY--FGLMGDGQ-PIGRYDDMWAGWCVKVICDHLGLGVKTGLPYIYHSKASNPFVNLKK  285

Query  362  EWEGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEWV  541
            E++G+   E+I+PFFQS +LS +A TV+ C  E++  VKE+L    P F + ADAMV W+
Sbjct  286  EYKGIFWQEDIIPFFQSAKLSKEAVTVQQCYIELSKMVKEKLSAIDPYFDKLADAMVTWI  345

Query  542  ELWNDVK  562
            E W+++ 
Sbjct  346  EAWDELN  352



>ref|XP_009117866.1| PREDICTED: UDP-arabinopyranose mutase 1-like [Brassica rapa]
Length=357

 Score =   212 bits (539),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 97/187 (52%), Positives = 136/187 (73%), Gaps = 3/187 (2%)
 Frame = +2

Query  2    SCALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGP  181
            S A+S GLWLN+ DYDAPTQ +KPK+RN+RYVDAV+T+P   L P+ G+N+AFDR+L+GP
Sbjct  169  STAVSHGLWLNIPDYDAPTQLVKPKERNTRYVDAVMTIPKGTLFPMCGMNLAFDRDLIGP  228

Query  182  ALSPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRKERGNAIESLKK  361
            A+   F L  +G       +D+W+G CVKV+CDHLGLGVK+GLPY++  +  N   +LKK
Sbjct  229  AMY--FGLMGDGQ-PIGRYDDMWAGWCVKVICDHLGLGVKTGLPYIYHSKASNPFVNLKK  285

Query  362  EWEGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEWV  541
            E++G+   E+I+PFFQS +LS +A TV+ C  E++  VKE+L    P F + ADAMV W+
Sbjct  286  EYKGIFWQEDIIPFFQSAKLSKEAVTVQQCYIELSKMVKEKLSAIDPYFDKLADAMVTWI  345

Query  542  ELWNDVK  562
            E W+++ 
Sbjct  346  EAWDELN  352



>ref|XP_002525910.1| Alpha-1,4-glucan-protein synthase [UDP-forming], putative [Ricinus 
communis]
 gb|EEF36430.1| Alpha-1,4-glucan-protein synthase [UDP-forming], putative [Ricinus 
communis]
Length=260

 Score =   209 bits (531),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 96/185 (52%), Positives = 133/185 (72%), Gaps = 3/185 (2%)
 Frame = +2

Query  8    ALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGPAL  187
            A+S GLWLN+ DYDAPTQ +KP++RN+RYVDAVLT+P   L P+ G+N+AFDR+L+GPA+
Sbjct  66   AVSHGLWLNIPDYDAPTQLVKPRERNTRYVDAVLTIPKGTLFPMCGMNLAFDRDLIGPAM  125

Query  188  SPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRKERGNAIESLKKEW  367
               F L  +G       +D+W+G CVKV+CDHLGLGVK+GLPY++  +  N   +LKKE+
Sbjct  126  Y--FGLMGDGQ-PIGRYDDMWAGWCVKVICDHLGLGVKTGLPYIYHSKASNPFVNLKKEY  182

Query  368  EGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEWVEL  547
            +G+   EEI+PFFQ+  L    TTV+ C  E+A  VK++L K  P F + ADAMV W+E 
Sbjct  183  KGIFWQEEIIPFFQAATLPKDCTTVQKCYIELAKQVKDKLSKVDPYFDKLADAMVTWIEA  242

Query  548  WNDVK  562
            W+++ 
Sbjct  243  WDELN  247



>ref|XP_010091605.1| UDP-arabinopyranose mutase 3 [Morus notabilis]
 gb|EXB44871.1| UDP-arabinopyranose mutase 3 [Morus notabilis]
Length=362

 Score =   212 bits (539),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 98/186 (53%), Positives = 134/186 (72%), Gaps = 3/186 (2%)
 Frame = +2

Query  8    ALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGPAL  187
            A+S GLWLN+ DYDAPTQ +KP +RNSRYVDAVLT+P   L P+ G+N+AFDREL+GPA+
Sbjct  165  AVSHGLWLNIPDYDAPTQLVKPLERNSRYVDAVLTIPKGTLFPMCGMNLAFDRELIGPAM  224

Query  188  SPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRKERGNAIESLKKEW  367
               F L  +G       +D+W+G CVKV+CDHLG GVK+GLPY+W  +  N   +LKKE+
Sbjct  225  --YFGLMGDGQ-PIGRYDDMWAGWCVKVICDHLGYGVKTGLPYIWHSKASNPFVNLKKEY  281

Query  368  EGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEWVEL  547
             G+   EE +PFFQS+ L  + TTV+ C  E++  VKE+LGK  P F++ A+AMV W+E 
Sbjct  282  NGIFWQEEAIPFFQSVMLPKECTTVQQCYIELSKQVKEKLGKVDPYFNKLAEAMVTWIEA  341

Query  548  WNDVKT  565
            W+++ +
Sbjct  342  WDELNS  347



>ref|XP_006400087.1| hypothetical protein EUTSA_v10013907mg [Eutrema salsugineum]
 gb|ESQ41540.1| hypothetical protein EUTSA_v10013907mg [Eutrema salsugineum]
Length=363

 Score =   212 bits (539),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 96/187 (51%), Positives = 136/187 (73%), Gaps = 3/187 (2%)
 Frame = +2

Query  2    SCALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGP  181
            S A+S GLWLN+ DYDAPTQ +KPK+RN+RYVDAV+T+P   L P+ G+N+AFDR+L+GP
Sbjct  169  STAVSHGLWLNIPDYDAPTQLVKPKERNTRYVDAVMTIPKGTLFPMCGMNLAFDRDLIGP  228

Query  182  ALSPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRKERGNAIESLKK  361
            A+   F L  +G       +D+W+G C+KV+CDHLGLGVK+GLPY++  +  N   +LKK
Sbjct  229  AMY--FGLMGDGQ-PIGRYDDMWAGWCIKVICDHLGLGVKTGLPYIYHSKASNPFVNLKK  285

Query  362  EWEGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEWV  541
            E++G+   EEI+PFFQ+ +LS +A TV+ C  E++  VKE+L    P F + ADAMV W+
Sbjct  286  EYKGIFWQEEIIPFFQNAKLSKEAVTVQQCYIELSKMVKEKLSSLDPYFDKLADAMVTWI  345

Query  542  ELWNDVK  562
            E W+++ 
Sbjct  346  EAWDELN  352



>gb|KFK37680.1| hypothetical protein AALP_AA3G014800 [Arabis alpina]
Length=357

 Score =   211 bits (538),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 95/187 (51%), Positives = 137/187 (73%), Gaps = 3/187 (2%)
 Frame = +2

Query  2    SCALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGP  181
            S A+S GLWLN+ DYDAPTQ +KPK+RN+RYVDAV+T+P   L P+ G+N+AFDREL+GP
Sbjct  169  STAVSHGLWLNIPDYDAPTQLVKPKERNTRYVDAVMTIPKGTLFPMCGMNLAFDRELIGP  228

Query  182  ALSPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRKERGNAIESLKK  361
            A+   F L  +G       +D+W+G C+KV+CDHLGLGVK+GLPY++  +  N   +L+K
Sbjct  229  AMY--FGLMGDGQ-PIGRYDDMWAGWCIKVICDHLGLGVKTGLPYIYHSKASNPFVNLRK  285

Query  362  EWEGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEWV  541
            E++G+   E+I+PFFQ+++LS +A TV+ C  E++  VKE+L    P F + ADAMV W+
Sbjct  286  EYKGIFWQEDIIPFFQNVKLSKEAVTVQQCYIELSKMVKEKLSAIDPYFDKLADAMVTWI  345

Query  542  ELWNDVK  562
            E W+++ 
Sbjct  346  EAWDELN  352



>emb|CDY43248.1| BnaC05g48410D [Brassica napus]
Length=357

 Score =   211 bits (538),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 97/187 (52%), Positives = 136/187 (73%), Gaps = 3/187 (2%)
 Frame = +2

Query  2    SCALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGP  181
            S A+S GLWLN+ DYDAPTQ +KPK+RN+RYVDAV+T+P   L P+ G+N+AFDR+L+GP
Sbjct  169  STAVSHGLWLNIPDYDAPTQLVKPKERNTRYVDAVMTIPKGTLFPMCGMNLAFDRDLIGP  228

Query  182  ALSPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRKERGNAIESLKK  361
            A+   F L  +G       +D+W+G CVKV+CDHLGLGVK+GLPY++  +  N   +LKK
Sbjct  229  AMY--FGLMGDGQ-PIGRYDDMWAGWCVKVICDHLGLGVKTGLPYIYHSKASNPFVNLKK  285

Query  362  EWEGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEWV  541
            E++G+   E+I+PFFQS +LS +A TV+ C  E++  VKE+L    P F + ADAMV W+
Sbjct  286  EYKGIFWQEDIIPFFQSAKLSKEAVTVQQCYLELSKLVKEKLSPIDPYFDKLADAMVTWI  345

Query  542  ELWNDVK  562
            E W+++ 
Sbjct  346  EAWDELN  352



>ref|NP_186872.1| UDP-arabinose mutase 1 [Arabidopsis thaliana]
 ref|XP_002882214.1| hypothetical protein ARALYDRAFT_477458 [Arabidopsis lyrata subsp. 
lyrata]
 sp|Q9SRT9.1|RGP1_ARATH RecName: Full=UDP-arabinopyranose mutase 1; AltName: Full=Reversibly 
glycosylated polypeptide 1; Short=AtRGP1; AltName: Full=UDP-L-arabinose 
mutase 1 [Arabidopsis thaliana]
 gb|AAF02115.1|AC009755_8 reversibly glycosylated polypeptide-1 [Arabidopsis thaliana]
 gb|AAO00769.1| reversibly glycosylated polypeptide-1 [Arabidopsis thaliana]
 gb|AAP68280.1| At3g02230 [Arabidopsis thaliana]
 gb|EFH58473.1| hypothetical protein ARALYDRAFT_477458 [Arabidopsis lyrata subsp. 
lyrata]
 gb|AEE73781.1| reversibly glycosylated polypeptide 1 [Arabidopsis thaliana]
 gb|AHL38786.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=357

 Score =   211 bits (538),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 96/187 (51%), Positives = 136/187 (73%), Gaps = 3/187 (2%)
 Frame = +2

Query  2    SCALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGP  181
            S A+S GLWLN+ DYDAPTQ +KPK+RN+RYVDAV+T+P   L P+ G+N+AFDREL+GP
Sbjct  169  STAVSHGLWLNIPDYDAPTQLVKPKERNTRYVDAVMTIPKGTLFPMCGMNLAFDRELIGP  228

Query  182  ALSPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRKERGNAIESLKK  361
            A+   F L  +G       +D+W+G C+KV+CDHLGLGVK+GLPY++  +  N   +LKK
Sbjct  229  AMY--FGLMGDGQ-PIGRYDDMWAGWCIKVICDHLGLGVKTGLPYIYHSKASNPFVNLKK  285

Query  362  EWEGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEWV  541
            E++G+   E+I+PFFQS +L+ +A TV+ C  E++  VKE+L    P F + ADAMV W+
Sbjct  286  EYKGIFWQEDIIPFFQSAKLTKEAVTVQQCYMELSKLVKEKLSPIDPYFDKLADAMVTWI  345

Query  542  ELWNDVK  562
            E W+++ 
Sbjct  346  EAWDELN  352



>ref|XP_009147367.1| PREDICTED: UDP-arabinopyranose mutase 1 [Brassica rapa]
 emb|CDY60468.1| BnaAnng16810D [Brassica napus]
Length=357

 Score =   211 bits (538),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 97/187 (52%), Positives = 136/187 (73%), Gaps = 3/187 (2%)
 Frame = +2

Query  2    SCALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGP  181
            S A+S GLWLN+ DYDAPTQ +KPK+RN+RYVDAV+T+P   L P+ G+N+AFDR+L+GP
Sbjct  169  STAVSHGLWLNIPDYDAPTQLVKPKERNTRYVDAVMTIPKGTLFPMCGMNLAFDRDLIGP  228

Query  182  ALSPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRKERGNAIESLKK  361
            A+   F L  +G       +D+W+G CVKV+CDHLGLGVK+GLPY++  +  N   +LKK
Sbjct  229  AMY--FGLMGDGQ-PIGRYDDMWAGWCVKVICDHLGLGVKTGLPYIYHSKASNPFVNLKK  285

Query  362  EWEGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEWV  541
            E++G+   E+I+PFFQS +LS +A TV+ C  E++  VKE+L    P F + ADAMV W+
Sbjct  286  EYKGIFWQEDIIPFFQSAKLSKEAVTVQQCYLELSKLVKEKLSPIDPYFDKLADAMVTWI  345

Query  542  ELWNDVK  562
            E W+++ 
Sbjct  346  EAWDELN  352



>ref|XP_003516432.1| PREDICTED: alpha-1,4-glucan-protein synthase [UDP-forming]-like 
[Glycine max]
 gb|KHN05625.1| Alpha-1,4-glucan-protein synthase [UDP-forming] [Glycine soja]
Length=368

 Score =   211 bits (538),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 98/187 (52%), Positives = 134/187 (72%), Gaps = 3/187 (2%)
 Frame = +2

Query  8    ALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGPAL  187
            A+S GLWLN+ DYDAPTQ +KP +RN+RYVDAVLT+P   L P+ G+N+AFDR+L+GPA+
Sbjct  168  AVSHGLWLNIPDYDAPTQLVKPLERNTRYVDAVLTIPKGTLFPMCGMNLAFDRQLIGPAM  227

Query  188  SPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRKERGNAIESLKKEW  367
               F L  +G       +D+W+G CVKV+CDHLGLGVK+GLPY+W  +  N   +LKKE+
Sbjct  228  --YFGLMGDGQ-PIGRYDDMWAGWCVKVICDHLGLGVKTGLPYIWHSKASNPFVNLKKEY  284

Query  368  EGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEWVEL  547
            +G+   EEI+PFFQS  LS + T+V+ C  E++  VKE+LG   P F + ADAMV W+E 
Sbjct  285  KGIFWQEEIIPFFQSATLSKECTSVQKCYIELSKQVKEKLGAVDPYFIKLADAMVTWIEA  344

Query  548  WNDVKTQ  568
            W+++   
Sbjct  345  WDELNNN  351



>ref|XP_010462164.1| PREDICTED: UDP-arabinopyranose mutase 1-like [Camelina sativa]
Length=362

 Score =   211 bits (538),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 96/187 (51%), Positives = 136/187 (73%), Gaps = 3/187 (2%)
 Frame = +2

Query  2    SCALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGP  181
            S A+S GLWLN+ DYDAPTQ +KPK+RN+RYVDAV+T+P   L P+ G+N+AFDREL+GP
Sbjct  169  STAVSHGLWLNIPDYDAPTQLVKPKERNTRYVDAVMTIPKGTLFPMCGMNLAFDRELIGP  228

Query  182  ALSPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRKERGNAIESLKK  361
            A+   F L  +G       +D+W+G C+KV+CDHL LGVK+GLPY++  +  N   +LKK
Sbjct  229  AM--YFGLMGDGQ-PIGRYDDMWAGWCIKVICDHLSLGVKTGLPYIYHSKASNPFVNLKK  285

Query  362  EWEGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEWV  541
            E++G+   EEI+PFFQ+++LS +A TV+ C  E++  VKE+L    P F + ADAMV W+
Sbjct  286  EYKGIFWQEEIIPFFQNVKLSKEAVTVQQCYIELSKMVKEKLSSLDPYFDKLADAMVTWI  345

Query  542  ELWNDVK  562
            E W+++ 
Sbjct  346  EAWDELN  352



>gb|KFK25794.1| hypothetical protein AALP_AA8G161500 [Arabis alpina]
Length=361

 Score =   211 bits (537),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 96/187 (51%), Positives = 136/187 (73%), Gaps = 3/187 (2%)
 Frame = +2

Query  2    SCALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGP  181
            S A+S GLWLN+ DYDAPTQ +KPK+RN+RYVDAV+T+P   L P+ G+N+AFDR+L+GP
Sbjct  169  STAVSHGLWLNIPDYDAPTQLVKPKERNTRYVDAVMTIPKGTLFPMCGMNLAFDRDLIGP  228

Query  182  ALSPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRKERGNAIESLKK  361
            A+   F L  +G       +D+W+G C+KV+CDHL LGVK+GLPY++  +  N   +LKK
Sbjct  229  AMY--FGLMGDGQ-PIGRYDDMWAGWCIKVICDHLSLGVKTGLPYIYHSKASNPFVNLKK  285

Query  362  EWEGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEWV  541
            E++G+   EEI+PFFQ+ +LS +ATTV+ C  E++  VKE+L    P F + ADAMV W+
Sbjct  286  EYKGIFWQEEIIPFFQNAKLSKEATTVQQCYIELSKMVKEKLSSLDPYFDKLADAMVTWI  345

Query  542  ELWNDVK  562
            E W+++ 
Sbjct  346  EAWDELN  352



>ref|XP_007210189.1| hypothetical protein PRUPE_ppa017775mg [Prunus persica]
 gb|EMJ11388.1| hypothetical protein PRUPE_ppa017775mg [Prunus persica]
Length=361

 Score =   211 bits (537),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 96/185 (52%), Positives = 133/185 (72%), Gaps = 3/185 (2%)
 Frame = +2

Query  8    ALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGPAL  187
            A+S GLWLN+ DYDAPTQ +KP++RN+RYVDAV+T+P   L P+ G+N+AFDREL+GPA+
Sbjct  160  AISHGLWLNIPDYDAPTQLVKPRERNTRYVDAVMTIPKGTLFPMCGMNLAFDRELIGPAM  219

Query  188  SPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRKERGNAIESLKKEW  367
               F L  +G       +D+W+G C KV+CDHL LGVK+GLPY+W  +  N   +LKKE+
Sbjct  220  Y--FGLMGDGQ-PIGRYDDMWAGWCAKVICDHLLLGVKTGLPYIWHSKASNPFVNLKKEY  276

Query  368  EGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEWVEL  547
            +G+   E+I+PFFQS+ L  + T+V+DC  E+A  VKE+LG   P F +  DAMV W+E 
Sbjct  277  KGIYWQEDIIPFFQSIALREECTSVQDCYIELANKVKERLGPIDPYFEKLGDAMVTWIEA  336

Query  548  WNDVK  562
            WN++ 
Sbjct  337  WNELN  341



>ref|NP_001242893.1| uncharacterized protein LOC100809983 [Glycine max]
 gb|ACU23018.1| unknown [Glycine max]
Length=368

 Score =   211 bits (537),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 97/186 (52%), Positives = 135/186 (73%), Gaps = 3/186 (2%)
 Frame = +2

Query  8    ALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGPAL  187
            A+S GLWLN+ DYDAPTQ +KP +RN+RYVDAVLT+P   L P+ G+N+AFDR+L+GPA+
Sbjct  167  AVSHGLWLNIPDYDAPTQLVKPLERNTRYVDAVLTIPKGTLFPMCGMNLAFDRQLIGPAM  226

Query  188  SPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRKERGNAIESLKKEW  367
               F L  +G       +D+W+G CVKVVCDHLGLGVK+GLPY+W  +  N   +LKKE+
Sbjct  227  --YFGLMGDGQ-PIGRYDDMWAGWCVKVVCDHLGLGVKTGLPYIWHSKASNPFVNLKKEY  283

Query  368  EGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEWVEL  547
            +G+   EEI+PFFQS  +  + T+V+ C  E++  VKE+LG   P F++ ADAMV W+E 
Sbjct  284  KGIFWQEEIIPFFQSATIPKECTSVQKCYIELSKQVKEKLGAVDPYFTKLADAMVTWIEA  343

Query  548  WNDVKT  565
            W+++ +
Sbjct  344  WDELNS  349



>ref|XP_009131489.1| PREDICTED: UDP-arabinopyranose mutase 2-like [Brassica rapa]
Length=363

 Score =   211 bits (536),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 95/186 (51%), Positives = 137/186 (74%), Gaps = 3/186 (2%)
 Frame = +2

Query  2    SCALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGP  181
            S A+S GLWLN+ DYDAPTQ +KPK+RN+RYVDAV+T+P   L P+ G+N+AFDR+L+GP
Sbjct  169  STAVSHGLWLNIPDYDAPTQLVKPKERNTRYVDAVMTIPKGTLFPMCGMNLAFDRDLIGP  228

Query  182  ALSPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRKERGNAIESLKK  361
            A+   F L  +G       +D+W+G C+KV+CDHLGLGVK+GLPY++  +      +LKK
Sbjct  229  AM--YFGLMGDGQ-PIGRYDDMWAGWCIKVICDHLGLGVKTGLPYIYHSKASTPFVNLKK  285

Query  362  EWEGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEWV  541
            E++G+   E+I+PFFQ+++LS +ATTV+ C  E++  VKE+L    P F + ADAMV W+
Sbjct  286  EYKGIFWQEDIIPFFQNVKLSKEATTVQQCYIELSKMVKEKLSPLDPYFDKLADAMVTWI  345

Query  542  ELWNDV  559
            E W+++
Sbjct  346  EAWDEL  351



>ref|XP_006436872.1| hypothetical protein CICLE_v10033661mg [Citrus clementina]
 ref|XP_006493259.1| PREDICTED: alpha-1,4-glucan-protein synthase [UDP-forming]-like 
[Citrus sinensis]
 gb|ESR50112.1| hypothetical protein CICLE_v10033661mg [Citrus clementina]
Length=366

 Score =   211 bits (536),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 96/186 (52%), Positives = 133/186 (72%), Gaps = 3/186 (2%)
 Frame = +2

Query  8    ALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGPAL  187
            A+S GLWLN+ DYDAPTQ +KP++RNSRYVDAV+T+P  +L P+ G+N+AFDREL+GPA+
Sbjct  165  AISHGLWLNIPDYDAPTQLVKPRERNSRYVDAVMTIPKGSLFPMCGMNLAFDRELIGPAM  224

Query  188  SPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRKERGNAIESLKKEW  367
               F L  +G       +D+W+G C KV+CDHL LGVK+GLPY+W  +  N   +LKKE+
Sbjct  225  --YFGLMGDGQ-PIGRYDDMWAGWCAKVICDHLSLGVKTGLPYIWHSKASNPFVNLKKEY  281

Query  368  EGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEWVEL  547
            +G+   EEI+PFFQS+ L  + TTV+ C  E++  VKE+LG   P F +  DAMV W+E 
Sbjct  282  KGIYWQEEIIPFFQSVLLPKECTTVQKCYIELSRQVKEKLGPLDPYFQKLGDAMVTWIEA  341

Query  548  WNDVKT  565
            W+ + +
Sbjct  342  WDQLNS  347



>gb|KHN29964.1| Alpha-1,4-glucan-protein synthase [UDP-forming] [Glycine soja]
Length=368

 Score =   211 bits (536),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 96/186 (52%), Positives = 135/186 (73%), Gaps = 3/186 (2%)
 Frame = +2

Query  8    ALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGPAL  187
            A+S GLWLN+ DYDAPTQ +KP +RN+RYVDAVLT+P   L P+ G+N+AFDR+L+GPA+
Sbjct  167  AVSHGLWLNIPDYDAPTQLVKPLERNTRYVDAVLTIPKGTLFPMCGMNLAFDRQLIGPAM  226

Query  188  SPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRKERGNAIESLKKEW  367
               F L  +G       +D+W+G CVKV+CDHLGLGVK+GLPY+W  +  N   +LKKE+
Sbjct  227  --YFGLMGDGQ-PIGRYDDMWAGWCVKVICDHLGLGVKTGLPYIWHSKASNPFVNLKKEY  283

Query  368  EGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEWVEL  547
            +G+   EEI+PFFQS  +  + T+V+ C  E++  VKE+LG   P F++ ADAMV W+E 
Sbjct  284  KGIFWQEEIIPFFQSATIPKECTSVQKCYIELSKQVKEKLGAVDPYFTKLADAMVTWIEA  343

Query  548  WNDVKT  565
            W+++ +
Sbjct  344  WDELNS  349



>ref|XP_003614188.1| Alpha-1 4-glucan-protein synthase [Medicago truncatula]
 gb|AES97146.1| alpha-1,4-glucan-protein synthase [UDP-forming]-like protein 
[Medicago truncatula]
 gb|AFK49282.1| unknown [Medicago truncatula]
Length=362

 Score =   210 bits (535),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 95/186 (51%), Positives = 133/186 (72%), Gaps = 3/186 (2%)
 Frame = +2

Query  8    ALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGPAL  187
            A+S GLWLN+ DYDAPTQ +KP +RN+R+VDAV+T+P   L P+ G+N+AFDREL+GPA+
Sbjct  164  AVSHGLWLNIPDYDAPTQLVKPHERNTRFVDAVMTIPKGTLFPMCGMNLAFDRELIGPAM  223

Query  188  SPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRKERGNAIESLKKEW  367
               F L  +G       +D+W+G C+KV+CDHLGLGVK+GLPY+W  +  N   +LKKE+
Sbjct  224  --YFGLMGDGQ-PIGRYDDMWAGWCIKVICDHLGLGVKTGLPYIWHSKASNPFVNLKKEY  280

Query  368  EGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEWVEL  547
            +G+   EEI+PFFQ+  LS   T+V+ C  E++  VKE+LG   P F + ADAMV W+E 
Sbjct  281  KGIFWQEEIIPFFQAATLSKDCTSVQKCYIELSKQVKEKLGTIDPYFVKLADAMVTWIEA  340

Query  548  WNDVKT  565
            W+++  
Sbjct  341  WDEINN  346



>ref|XP_010420237.1| PREDICTED: UDP-arabinopyranose mutase 2 [Camelina sativa]
Length=363

 Score =   210 bits (535),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 95/187 (51%), Positives = 136/187 (73%), Gaps = 3/187 (2%)
 Frame = +2

Query  2    SCALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGP  181
            S A+S GLWLN+ DYDAPTQ +KPK+RN+RYVDAV+T+P   L P+ G+N+AFDR+L+GP
Sbjct  169  STAVSHGLWLNIPDYDAPTQLVKPKERNTRYVDAVMTIPKGTLFPMCGMNLAFDRDLIGP  228

Query  182  ALSPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRKERGNAIESLKK  361
            A+   F L  +G       +D+W+G C+KV+CDHL LGVK+GLPY++  +  N   +LKK
Sbjct  229  AMY--FGLMGDGQ-PIGRYDDMWAGWCIKVICDHLSLGVKTGLPYIYHSKASNPFVNLKK  285

Query  362  EWEGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEWV  541
            E++G+   EEI+PFFQ+++LS +A TV+ C  E++  VKE+L    P F + ADAMV W+
Sbjct  286  EYKGIFWQEEIIPFFQNVKLSKEAVTVQQCYIELSKMVKEKLSSLDPYFDKLADAMVTWI  345

Query  542  ELWNDVK  562
            E W+++ 
Sbjct  346  EAWDELN  352



>ref|XP_006338340.1| PREDICTED: UDP-arabinopyranose mutase 1-like [Solanum tuberosum]
Length=355

 Score =   210 bits (535),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 96/187 (51%), Positives = 133/187 (71%), Gaps = 3/187 (2%)
 Frame = +2

Query  2    SCALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGP  181
            S A+S GLWLN+ DYDAPTQ +KP +RN+RYVD VLT+P   L P+ G+N+AFDR+L+GP
Sbjct  157  STAVSHGLWLNIPDYDAPTQLVKPLERNTRYVDTVLTIPKGTLFPMCGMNLAFDRDLIGP  216

Query  182  ALSPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRKERGNAIESLKK  361
            A+   F L  +G       +D+W+G C KV+CDHLGLG+K+GLPY++  +  N   +LKK
Sbjct  217  AM--YFGLMGDGQ-PIGRYDDMWAGWCCKVICDHLGLGIKTGLPYIYHSKASNPFVNLKK  273

Query  362  EWEGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEWV  541
            E+ G+   EEI+PFFQ + LS ++TTV+ C  E+A  V E+LGK  P F + ADAMV W+
Sbjct  274  EYNGIFWQEEIIPFFQQMNLSKESTTVQKCYVEMAKQVNEKLGKIDPYFVKLADAMVTWI  333

Query  542  ELWNDVK  562
            E W+++ 
Sbjct  334  EAWDELN  340



>ref|XP_010453704.1| PREDICTED: UDP-arabinopyranose mutase 2-like [Camelina sativa]
Length=362

 Score =   210 bits (535),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 95/187 (51%), Positives = 136/187 (73%), Gaps = 3/187 (2%)
 Frame = +2

Query  2    SCALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGP  181
            S A+S GLWLN+ DYDAPTQ +KPK+RN+RYVDAV+T+P   L P+ G+N+AFDR+L+GP
Sbjct  169  STAVSHGLWLNIPDYDAPTQLVKPKERNTRYVDAVMTIPKGTLFPMCGMNLAFDRDLIGP  228

Query  182  ALSPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRKERGNAIESLKK  361
            A+   F L  +G       +D+W+G C+KV+CDHL LGVK+GLPY++  +  N   +LKK
Sbjct  229  AM--YFGLMGDGQ-PIGRYDDMWAGWCIKVICDHLSLGVKTGLPYIYHSKASNPFVNLKK  285

Query  362  EWEGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEWV  541
            E++G+   EEI+PFFQ+++LS +A TV+ C  E++  VKE+L    P F + ADAMV W+
Sbjct  286  EYKGIFWQEEIIPFFQNVKLSKEAVTVQQCYIELSKMVKEKLSSLDPYFDKLADAMVTWI  345

Query  542  ELWNDVK  562
            E W+++ 
Sbjct  346  EAWDELN  352



>ref|XP_010492407.1| PREDICTED: UDP-arabinopyranose mutase 2-like [Camelina sativa]
Length=362

 Score =   210 bits (535),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 95/187 (51%), Positives = 136/187 (73%), Gaps = 3/187 (2%)
 Frame = +2

Query  2    SCALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGP  181
            S A+S GLWLN+ DYDAPTQ +KPK+RN+RYVDAV+T+P   L P+ G+N+AFDR+L+GP
Sbjct  169  STAVSHGLWLNIPDYDAPTQLVKPKERNTRYVDAVMTIPKGTLFPMCGMNLAFDRDLIGP  228

Query  182  ALSPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRKERGNAIESLKK  361
            A+   F L  +G       +D+W+G C+KV+CDHL LGVK+GLPY++  +  N   +LKK
Sbjct  229  AM--YFGLMGDGQ-PIGRYDDMWAGWCIKVICDHLSLGVKTGLPYIYHSKASNPFVNLKK  285

Query  362  EWEGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEWV  541
            E++G+   EEI+PFFQ+++LS +A TV+ C  E++  VKE+L    P F + ADAMV W+
Sbjct  286  EYKGIFWQEEIIPFFQNVKLSKEAVTVQQCYIELSKMVKEKLSSLDPYFDKLADAMVTWI  345

Query  542  ELWNDVK  562
            E W+++ 
Sbjct  346  EAWDELN  352



>ref|XP_009396438.1| PREDICTED: UDP-arabinopyranose mutase 1-like [Musa acuminata 
subsp. malaccensis]
Length=360

 Score =   210 bits (535),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 95/185 (51%), Positives = 136/185 (74%), Gaps = 3/185 (2%)
 Frame = +2

Query  8    ALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGPAL  187
            A+S GLWLN+ DYDAPTQ +KP +RN+RYVDAV+TVP  AL P+ G+N+AF+REL+GPA+
Sbjct  168  AVSHGLWLNIPDYDAPTQLVKPHERNARYVDAVITVPKGALFPMCGMNLAFNRELIGPAM  227

Query  188  SPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRKERGNAIESLKKEW  367
               F L  +G       +D+W+G CVKV+CDHLGLGVK+GLPY+W  +  N + +LKKE+
Sbjct  228  --YFGLMGDGQ-PIRRYDDMWAGWCVKVICDHLGLGVKTGLPYIWHSKASNPLVNLKKEY  284

Query  368  EGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEWVEL  547
             G+   EE++PFFQ++ +  + TT ++C  E++  VKE+LGK    F++ ADAMV W+E 
Sbjct  285  HGIHWQEEVIPFFQAVSIPKKCTTPQECYIELSKQVKEKLGKVDEYFNKLADAMVTWIEA  344

Query  548  WNDVK  562
            W+++ 
Sbjct  345  WDELN  349



>gb|AAC50000.1| reversibly glycosylated polypeptide-1 [Arabidopsis thaliana]
Length=357

 Score =   210 bits (534),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 95/187 (51%), Positives = 136/187 (73%), Gaps = 3/187 (2%)
 Frame = +2

Query  2    SCALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGP  181
            S A+S GLWLN+ DYDAPTQ +KPK+RN+RYVDAV+T+P   L P+ G+N+A+DREL+GP
Sbjct  169  STAVSHGLWLNIPDYDAPTQLVKPKERNTRYVDAVMTIPKGTLFPMCGMNLAYDRELIGP  228

Query  182  ALSPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRKERGNAIESLKK  361
            A+   F L  +G       +D+W+G C+KV+CDHLGLGVK+GLPY++  +  N   +LKK
Sbjct  229  AMY--FGLMGDGQ-PIGRYDDMWAGWCIKVICDHLGLGVKTGLPYIYHSKASNPFVNLKK  285

Query  362  EWEGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEWV  541
            E++G+   E+I+PFFQS +L+ +A TV+ C  E++  VKE+L    P F + ADAMV W+
Sbjct  286  EYKGIFWQEDIIPFFQSPKLTKEAVTVQQCYMELSKLVKEKLSPIDPYFDKLADAMVTWI  345

Query  542  ELWNDVK  562
            E W+++ 
Sbjct  346  EAWDELN  352



>ref|XP_010319476.1| PREDICTED: alpha-1,4-glucan-protein synthase [UDP-forming] 2 
[Solanum lycopersicum]
Length=357

 Score =   210 bits (534),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 95/189 (50%), Positives = 135/189 (71%), Gaps = 3/189 (2%)
 Frame = +2

Query  2    SCALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGP  181
            + A+S GLWLN+ DYDAPTQ +KP++RN+RYVDAV+T+P   L P+ G+N+AFDREL+GP
Sbjct  163  ATAVSHGLWLNIPDYDAPTQLVKPRERNTRYVDAVMTIPKGTLFPMCGMNLAFDRELIGP  222

Query  182  ALSPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRKERGNAIESLKK  361
            A+   F L  +G       +D+W+G C+KV+CDHLGLGVK+GLPY+W  +  N   +LKK
Sbjct  223  AM--YFGLMGDGQ-PIGRYDDMWAGWCIKVICDHLGLGVKTGLPYIWHSKASNPFVNLKK  279

Query  362  EWEGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEWV  541
            E++G+   EEI+PFFQS  L    T+V+ C  E++  VKE+L    P F++ ADAMV W+
Sbjct  280  EYKGIYWQEEIIPFFQSATLPKDCTSVQQCYLELSKQVKEKLSAIDPYFTKLADAMVTWI  339

Query  542  ELWNDVKTQ  568
            E W+++  +
Sbjct  340  EAWDELNPK  348



>ref|XP_002281356.1| PREDICTED: UDP-arabinopyranose mutase 3 [Vitis vinifera]
Length=359

 Score =   210 bits (534),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 98/185 (53%), Positives = 131/185 (71%), Gaps = 3/185 (2%)
 Frame = +2

Query  8    ALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGPAL  187
            A+S GLWLN+ DYDAPTQ +KP +RN+R+VDAVLT+P   L P+ G+N+AFDR+L+GPA+
Sbjct  165  AVSHGLWLNIPDYDAPTQLVKPLERNTRFVDAVLTIPKGTLFPMCGMNLAFDRDLIGPAM  224

Query  188  SPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRKERGNAIESLKKEW  367
               F L  +G       +D+W+G CVKV CDHLGLGVK+GLPY+W  +  N   +LKKE+
Sbjct  225  --YFGLMGDGQ-PIGRYDDMWAGWCVKVTCDHLGLGVKTGLPYIWHSKASNPFVNLKKEY  281

Query  368  EGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEWVEL  547
             G+   EEI+PFFQS+ L    TTV+ C  E+A  VKE+LGK  P F +  DAMV W+E 
Sbjct  282  NGIFWQEEIIPFFQSVSLPKDCTTVQKCYVELAKLVKEKLGKVDPYFVKLGDAMVTWIEA  341

Query  548  WNDVK  562
            W+++ 
Sbjct  342  WDELN  346



>ref|NP_001275274.1| alpha-1,4-glucan-protein synthase [UDP-forming] 2 [Solanum tuberosum]
 gb|ABA81861.1| UDP-glucose:protein transglucosylase-like [Solanum tuberosum]
Length=363

 Score =   210 bits (534),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 95/187 (51%), Positives = 134/187 (72%), Gaps = 3/187 (2%)
 Frame = +2

Query  2    SCALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGP  181
            + A+S GLWLN+ DYDAPTQ +KP++RN+RYVDAV+T+P   L P+ G+N+AFDREL+GP
Sbjct  163  ATAVSHGLWLNIPDYDAPTQLVKPRERNTRYVDAVMTIPKGTLFPMCGMNLAFDRELIGP  222

Query  182  ALSPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRKERGNAIESLKK  361
            A+   F L  +G       +D+W+G C+KV+CDHLGLGVK+GLPY+W  +  N   +LKK
Sbjct  223  AM--YFGLMGDGQ-PIGRYDDMWAGWCIKVICDHLGLGVKTGLPYIWHSKASNPFVNLKK  279

Query  362  EWEGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEWV  541
            E++G+   EEI+PFFQS  L    T+V+ C  E++  VKE+L    P F++ ADAMV W+
Sbjct  280  EYKGIYWQEEIIPFFQSATLPKDCTSVQQCYLELSKQVKEKLSTIDPYFTKLADAMVTWI  339

Query  542  ELWNDVK  562
            E W+++ 
Sbjct  340  EAWDELN  346



>ref|XP_009762274.1| PREDICTED: alpha-1,4-glucan-protein synthase [UDP-forming] 1-like 
[Nicotiana sylvestris]
Length=357

 Score =   210 bits (534),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 96/185 (52%), Positives = 133/185 (72%), Gaps = 3/185 (2%)
 Frame = +2

Query  8    ALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGPAL  187
            A+S GLWLN+ DYDAPTQ +KP +RN+RYVD VLT+P   L P+ G+N+AFDR+L+GPA+
Sbjct  161  AVSHGLWLNIPDYDAPTQLVKPLERNTRYVDMVLTIPKGTLFPMCGMNLAFDRDLIGPAM  220

Query  188  SPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRKERGNAIESLKKEW  367
               F L  +G       +D+W+G C KV+CDHLGLG+K+GLPY++  +  N   +LKKE+
Sbjct  221  --YFGLMGDGQ-PIGRYDDMWAGWCCKVICDHLGLGIKTGLPYIYHSKASNPFVNLKKEY  277

Query  368  EGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEWVEL  547
             G+   EEI+PFFQ+L LS ++TTV+ C  E+A  V E+LGK  P F + ADAMV W+E 
Sbjct  278  NGIFWQEEIIPFFQNLNLSKESTTVQKCYVEMAKQVNEKLGKIDPYFVKLADAMVTWIEA  337

Query  548  WNDVK  562
            W+++ 
Sbjct  338  WDELN  342



>ref|XP_010029403.1| PREDICTED: UDP-arabinopyranose mutase 1 [Eucalyptus grandis]
 gb|KCW56314.1| hypothetical protein EUGRSUZ_I02055 [Eucalyptus grandis]
Length=367

 Score =   210 bits (534),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 97/186 (52%), Positives = 132/186 (71%), Gaps = 3/186 (2%)
 Frame = +2

Query  8    ALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGPAL  187
            A+S GLWLN+ DYDAPTQ +KP +RN RYVDAVLT+P   L P+ G+N+AFDREL+GPA+
Sbjct  171  AVSHGLWLNIPDYDAPTQLVKPLERNQRYVDAVLTIPKGTLFPMCGMNLAFDRELIGPAM  230

Query  188  SPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRKERGNAIESLKKEW  367
               F L  +G       +D+W+G CVKV+CDHLGLGVK+GLPY+W  +  N   +L+KE+
Sbjct  231  Y--FGLMGDGQ-PIGRYDDMWAGWCVKVICDHLGLGVKTGLPYIWHSKASNPFVNLRKEY  287

Query  368  EGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEWVEL  547
            +G+   EEI+PFFQS  L    TTV+ C  E++  VK++L K  P F + ADAM+ W+E 
Sbjct  288  KGIFWQEEIIPFFQSAALPKDCTTVQKCYIELSKQVKDKLSKVDPYFDKLADAMITWIEA  347

Query  548  WNDVKT  565
            W+++ T
Sbjct  348  WDELNT  353



>ref|XP_009791765.1| PREDICTED: alpha-1,4-glucan-protein synthase [UDP-forming] 2 
[Nicotiana sylvestris]
Length=363

 Score =   210 bits (534),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 94/185 (51%), Positives = 133/185 (72%), Gaps = 3/185 (2%)
 Frame = +2

Query  8    ALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGPAL  187
            A+S GLWLN+ DYDAPTQ +KP++RN+RYVDAV+T+P   L P+ G+N+AFDREL+GPA+
Sbjct  165  AVSHGLWLNIPDYDAPTQLVKPRERNTRYVDAVMTIPKGTLFPMCGMNLAFDRELIGPAM  224

Query  188  SPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRKERGNAIESLKKEW  367
               F L  +G       +D+W+G C KV+CDHLGLG+K+GLPY+W  +  N   +LKKE+
Sbjct  225  --YFGLMGDGQ-PIGRYDDMWAGWCTKVICDHLGLGIKTGLPYIWHSKASNPFVNLKKEY  281

Query  368  EGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEWVEL  547
            +G+   EEI+PFFQS  L    T+V+ C  E++  VK++L K  P F++ ADAMV W+E 
Sbjct  282  KGIYWQEEIIPFFQSATLPKDCTSVQQCYIELSKQVKDKLSKVDPYFTKLADAMVTWIEA  341

Query  548  WNDVK  562
            W+++ 
Sbjct  342  WDELN  346



>ref|XP_009596987.1| PREDICTED: alpha-1,4-glucan-protein synthase [UDP-forming] 1-like 
[Nicotiana tomentosiformis]
Length=357

 Score =   209 bits (533),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 96/185 (52%), Positives = 133/185 (72%), Gaps = 3/185 (2%)
 Frame = +2

Query  8    ALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGPAL  187
            A+S GLWLN+ DYDAPTQ +KP +RN+RYVD VLT+P   L P+ G+N+AFDR+L+GPA+
Sbjct  161  AVSHGLWLNIPDYDAPTQLVKPLERNTRYVDMVLTIPKGTLFPMCGMNLAFDRDLIGPAM  220

Query  188  SPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRKERGNAIESLKKEW  367
               F L  +G       +D+W+G C KV+CDHLGLG+K+GLPY++  +  N   +LKKE+
Sbjct  221  --YFGLMGDGQ-PIGRYDDMWAGWCCKVICDHLGLGIKTGLPYIYHSKASNPFVNLKKEY  277

Query  368  EGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEWVEL  547
             G+   EEI+PFFQ+L LS ++TTV+ C  E+A  V E+LGK  P F + ADAMV W+E 
Sbjct  278  NGIFWQEEIIPFFQNLNLSKESTTVQKCYVEMAKQVNEKLGKIDPYFVKLADAMVTWIEA  337

Query  548  WNDVK  562
            W+++ 
Sbjct  338  WDELN  342



>gb|EMT01764.1| Alpha-1,4-glucan-protein synthase (UDP-forming) [Aegilops tauschii]
Length=355

 Score =   209 bits (533),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 95/187 (51%), Positives = 136/187 (73%), Gaps = 3/187 (2%)
 Frame = +2

Query  8    ALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGPAL  187
            A+S GLWLN+ DYDAPTQ +KP++RN RYVDAV+T+P  +L P+ G+N+AFDREL+GPA+
Sbjct  158  AVSHGLWLNIPDYDAPTQLVKPRERNGRYVDAVMTIPKGSLFPMCGMNLAFDRELIGPAM  217

Query  188  SPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRKERGNAIESLKKEW  367
               F L  +G       +D+W+G CVKV+CDHLGLGVK+GLPY+W  +  N   +LKKE+
Sbjct  218  Y--FGLMGDGQ-PIGRYDDMWAGWCVKVICDHLGLGVKTGLPYIWHSKASNPFVNLKKEY  274

Query  368  EGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEWVEL  547
            +G+   E+I+PFFQ+ +L+ +  TV+ C   ++  VKE+LGK  P F + ADAMV W+E 
Sbjct  275  KGIFWQEDIIPFFQAAKLTKECDTVQKCYISLSQQVKEKLGKIDPYFVKLADAMVTWIEA  334

Query  548  WNDVKTQ  568
            W+ + ++
Sbjct  335  WDMLNSK  341



>emb|CAN65977.1| hypothetical protein VITISV_036160 [Vitis vinifera]
Length=386

 Score =   210 bits (535),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 98/185 (53%), Positives = 131/185 (71%), Gaps = 3/185 (2%)
 Frame = +2

Query  8    ALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGPAL  187
            A+S GLWLN+ DYDAPTQ +KP +RN+R+VDAVLT+P   L P+ G+N+AFDR+L+GPA+
Sbjct  165  AVSHGLWLNIPDYDAPTQLVKPLERNTRFVDAVLTIPKGTLFPMCGMNLAFDRDLIGPAM  224

Query  188  SPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRKERGNAIESLKKEW  367
               F L  +G       +D+W+G CVKV CDHLGLGVK+GLPY+W  +  N   +LKKE+
Sbjct  225  --YFGLMGDGQ-PIGRYDDMWAGWCVKVTCDHLGLGVKTGLPYIWHSKASNPFVNLKKEY  281

Query  368  EGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEWVEL  547
             G+   EEI+PFFQS+ L    TTV+ C  E+A  VKE+LGK  P F +  DAMV W+E 
Sbjct  282  NGIFWQEEIIPFFQSVSLPKDCTTVQKCYVELAKLVKEKLGKVDPYFVKLGDAMVTWIEA  341

Query  548  WNDVK  562
            W+++ 
Sbjct  342  WDELN  346



>emb|CDM84286.1| unnamed protein product [Triticum aestivum]
Length=356

 Score =   209 bits (533),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 95/187 (51%), Positives = 136/187 (73%), Gaps = 3/187 (2%)
 Frame = +2

Query  8    ALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGPAL  187
            A+S GLWLN+ DYDAPTQ +KP++RN RYVDAV+T+P  +L P+ G+N+AFDREL+GPA+
Sbjct  158  AVSHGLWLNIPDYDAPTQLVKPRERNGRYVDAVMTIPKGSLFPMCGMNLAFDRELIGPAM  217

Query  188  SPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRKERGNAIESLKKEW  367
               F L  +G       +D+W+G CVKV+CDHLGLGVK+GLPY+W  +  N   +LKKE+
Sbjct  218  Y--FGLMGDGQ-PIGRYDDMWAGWCVKVICDHLGLGVKTGLPYIWHSKASNPFVNLKKEY  274

Query  368  EGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEWVEL  547
            +G+   E+I+PFFQ+ +L+ +  TV+ C   ++  VKE+LGK  P F + ADAMV W+E 
Sbjct  275  KGIFWQEDIIPFFQAAKLTKECDTVQKCYISLSQQVKEKLGKIDPYFVKLADAMVTWIEA  334

Query  548  WNDVKTQ  568
            W+ + ++
Sbjct  335  WDMLNSK  341



>ref|XP_006288007.1| hypothetical protein CARUB_v10001241mg [Capsella rubella]
 gb|EOA20905.1| hypothetical protein CARUB_v10001241mg [Capsella rubella]
Length=363

 Score =   209 bits (533),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 96/187 (51%), Positives = 135/187 (72%), Gaps = 3/187 (2%)
 Frame = +2

Query  2    SCALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGP  181
            S A+S GLWLN+ DYDAPTQ +KPK+RN RYVDAV+T+P   L P+ G+N+AFDR+L+GP
Sbjct  169  STAVSHGLWLNIPDYDAPTQLVKPKERNIRYVDAVMTIPKGTLFPMCGMNLAFDRDLIGP  228

Query  182  ALSPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRKERGNAIESLKK  361
            A+   F L  +G       +D+W+G C+KV+CDHL LGVK+GLPY++  +  N   +LKK
Sbjct  229  AMY--FGLMGDGQ-PIGRYDDMWAGWCIKVICDHLSLGVKTGLPYIYHSKASNPFVNLKK  285

Query  362  EWEGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEWV  541
            E++G+   EEI+PFFQ+ +LS +ATTV+ C  E++  VKE+L    P F + ADAMV W+
Sbjct  286  EYKGIFWQEEIIPFFQNAKLSKEATTVQQCYIELSKMVKEKLSSLDPYFDKLADAMVTWI  345

Query  542  ELWNDVK  562
            E W+++ 
Sbjct  346  EAWDELN  352



>ref|XP_004298551.1| PREDICTED: UDP-arabinopyranose mutase 1-like [Fragaria vesca 
subsp. vesca]
Length=356

 Score =   209 bits (532),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 94/185 (51%), Positives = 133/185 (72%), Gaps = 3/185 (2%)
 Frame = +2

Query  8    ALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGPAL  187
            A+S GLWLN+ DYDAPTQ +KP++RN+RYVDAV+T+P   L P+ G+N+AFDREL+GPA+
Sbjct  158  AISHGLWLNIPDYDAPTQLVKPRERNTRYVDAVMTIPKGTLFPMCGMNLAFDRELIGPAM  217

Query  188  SPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRKERGNAIESLKKEW  367
               F L  +G       +D+W+G C KV+CDHLG+GVK+GLPY+W  +  N   +LKKE+
Sbjct  218  Y--FGLMGDGQ-PIGRYDDMWAGWCAKVICDHLGIGVKTGLPYIWHSKASNPFVNLKKEY  274

Query  368  EGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEWVEL  547
            +G+   E+I+PFFQS+ L  +  TV++C   +A +VKE+LG   P F +  DAMV W+E 
Sbjct  275  KGIYWQEDIIPFFQSIVLPKECKTVQECYIVLAKSVKEKLGPIDPYFQKLGDAMVTWIEA  334

Query  548  WNDVK  562
            WN++ 
Sbjct  335  WNELN  339



>ref|NP_197069.1| reversibly glycosylated polypeptide 2 [Arabidopsis thaliana]
 sp|Q9LFW1.1|RGP2_ARATH RecName: Full=UDP-arabinopyranose mutase 2; AltName: Full=Reversibly 
glycosylated polypeptide 2; Short=AtRGP2; AltName: Full=UDP-L-arabinose 
mutase 2 [Arabidopsis thaliana]
 emb|CAC01764.1| reversibly glycosylated polypeptide-2 (AtRGB) [Arabidopsis thaliana]
 gb|AAK63950.1| AT5g15650/F14F8_30 [Arabidopsis thaliana]
 gb|AAM52234.1| AT5g15650/F14F8_30 [Arabidopsis thaliana]
 gb|AED92188.1| reversibly glycosylated polypeptide 2 [Arabidopsis thaliana]
 gb|AHL38628.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=360

 Score =   209 bits (532),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 95/187 (51%), Positives = 135/187 (72%), Gaps = 3/187 (2%)
 Frame = +2

Query  2    SCALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGP  181
            S A+S GLWLN+ DYDAPTQ +KPK+RN+RYVDAV+T+P   L P+ G+N+AFDR+L+GP
Sbjct  169  STAVSHGLWLNIPDYDAPTQLVKPKERNTRYVDAVMTIPKGTLFPMCGMNLAFDRDLIGP  228

Query  182  ALSPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRKERGNAIESLKK  361
            A+   F L  +G       +D+W+G C+KV+CDHL LGVK+GLPY++  +  N   +LKK
Sbjct  229  AM--YFGLMGDGQ-PIGRYDDMWAGWCIKVICDHLSLGVKTGLPYIYHSKASNPFVNLKK  285

Query  362  EWEGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEWV  541
            E++G+   EEI+PFFQ+ +LS +A TV+ C  E++  VKE+L    P F + ADAMV W+
Sbjct  286  EYKGIFWQEEIIPFFQNAKLSKEAVTVQQCYIELSKMVKEKLSSLDPYFDKLADAMVTWI  345

Query  542  ELWNDVK  562
            E W+++ 
Sbjct  346  EAWDELN  352



>gb|AAM65020.1| reversibly glycosylated polypeptide-3 [Arabidopsis thaliana]
Length=360

 Score =   209 bits (532),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 95/187 (51%), Positives = 135/187 (72%), Gaps = 3/187 (2%)
 Frame = +2

Query  2    SCALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGP  181
            S A+S GLWLN+ DYDAPTQ +KPK+RN+RYVDAV+T+P   L P+ G+N+AFDR+L+GP
Sbjct  169  STAVSHGLWLNIPDYDAPTQLVKPKERNTRYVDAVMTIPKGTLFPMCGMNLAFDRDLIGP  228

Query  182  ALSPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRKERGNAIESLKK  361
            A+   F L  +G       +D+W+G C+KV+CDHL LGVK+GLPY++  +  N   +LKK
Sbjct  229  AM--YFGLMGDGQ-PIGRYDDMWAGWCIKVICDHLSLGVKTGLPYIYHSKASNPFVNLKK  285

Query  362  EWEGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEWV  541
            E++G+   EEI+PFFQ+ +LS +A TV+ C  E++  VKE+L    P F + ADAMV W+
Sbjct  286  EYKGIFWQEEIIPFFQNAKLSKEAVTVQQCYIELSKMVKEKLSSLDPYFDKLADAMVTWI  345

Query  542  ELWNDVK  562
            E W+++ 
Sbjct  346  EAWDELN  352



>gb|AFK40119.1| unknown [Lotus japonicus]
Length=360

 Score =   209 bits (532),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 94/186 (51%), Positives = 133/186 (72%), Gaps = 3/186 (2%)
 Frame = +2

Query  8    ALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGPAL  187
            A+S GLWLN+ DYDAPTQ +KP++RN+RYVDAV+T+P   L P+ G+N+AFDR+L+GPA+
Sbjct  163  AVSHGLWLNIPDYDAPTQLVKPRERNTRYVDAVMTIPKGTLFPMCGMNLAFDRQLIGPAM  222

Query  188  SPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRKERGNAIESLKKEW  367
               F L  +G       +D+W+G C+KV+CDHLGLGVK+GLPY+W  +  N   +LKKE+
Sbjct  223  --YFGLMGDGQ-PIGRYDDMWAGWCIKVICDHLGLGVKTGLPYIWHSKASNPFVNLKKEY  279

Query  368  EGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEWVEL  547
            +G+   EEI+PFFQS  L    T+V+ C  E++  VKE+LG   P F++  DAMV W+E 
Sbjct  280  KGIFWQEEIIPFFQSATLPKDCTSVQKCYIELSKQVKEKLGPVDPYFNKLGDAMVTWIEA  339

Query  548  WNDVKT  565
            W+++  
Sbjct  340  WDELNN  345



>gb|KEH21751.1| alpha-1,4-glucan-protein synthase [UDP-forming]-like protein 
[Medicago truncatula]
Length=360

 Score =   209 bits (532),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 95/185 (51%), Positives = 136/185 (74%), Gaps = 3/185 (2%)
 Frame = +2

Query  8    ALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGPAL  187
            A+S GLWLN+ DYDAPTQ +KP +RN+RYVDA+LT+P   L P+ G+N+AFDREL+GPA+
Sbjct  161  AVSHGLWLNIPDYDAPTQLVKPLERNTRYVDAILTIPKGTLFPMCGMNLAFDRELIGPAM  220

Query  188  SPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRKERGNAIESLKKEW  367
               F L  +G       +D+W+G C+KV+CDHLGLGVK+GLPY++  +  N   +L+KE+
Sbjct  221  --YFGLMGDGQ-PIGRYDDMWAGWCIKVICDHLGLGVKTGLPYIYHSKASNPFVNLRKEY  277

Query  368  EGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEWVEL  547
            +G+   E+I+PFFQ++ LS +ATTV+ C  E+A  VK++L K  P F + ADAMV W+E 
Sbjct  278  KGIFWQEDIIPFFQNVVLSKEATTVQKCYIELAKEVKDKLSKIDPYFDKLADAMVTWIES  337

Query  548  WNDVK  562
            W+++ 
Sbjct  338  WDELN  342



>ref|XP_004232138.1| PREDICTED: alpha-1,4-glucan-protein synthase [UDP-forming] 1-like 
[Solanum lycopersicum]
Length=352

 Score =   209 bits (531),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 94/187 (50%), Positives = 133/187 (71%), Gaps = 3/187 (2%)
 Frame = +2

Query  2    SCALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGP  181
            S A+S GLWLN+ DYDAPTQ +KP +RN+RYVD VLT+P   L P+ G+N+AFDR+L+GP
Sbjct  157  STAVSHGLWLNIPDYDAPTQLVKPLERNTRYVDTVLTIPKGTLFPMCGMNLAFDRDLIGP  216

Query  182  ALSPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRKERGNAIESLKK  361
            A+   F L  +G       +D+W+G C KV+CDHLGLG+K+GLPY++  +  N   +LKK
Sbjct  217  AM--YFGLMGDGQ-PIGRYDDMWAGWCCKVICDHLGLGIKTGLPYIYHSKASNPFVNLKK  273

Query  362  EWEGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEWV  541
            E+ G+   EEI+PFFQ + LS ++TTV+ C  E+A  V E+LGK  P F + +DAM+ W+
Sbjct  274  EYNGIFWQEEIIPFFQQMNLSKESTTVQKCYVEMAKQVNEKLGKIDPYFVKLSDAMITWI  333

Query  542  ELWNDVK  562
            E W+++ 
Sbjct  334  EAWDELN  340



>ref|XP_004490223.1| PREDICTED: alpha-1,4-glucan-protein synthase [UDP-forming]-like 
[Cicer arietinum]
Length=360

 Score =   209 bits (532),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 94/186 (51%), Positives = 132/186 (71%), Gaps = 3/186 (2%)
 Frame = +2

Query  8    ALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGPAL  187
            A+S GLWLN+ DYDAPTQ +KP +RN+RYVDAV+T+P   L P+ G+N+AF+REL+GPA+
Sbjct  163  AVSHGLWLNIPDYDAPTQLVKPHERNTRYVDAVMTIPKGTLFPMCGMNLAFNRELIGPAM  222

Query  188  SPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRKERGNAIESLKKEW  367
               F L  +G       +D+W+G C+KV+CDHLG GVK+GLPY+W  +  N   +LKKE+
Sbjct  223  --YFGLMGDGQ-PIGRYDDMWAGWCIKVICDHLGFGVKTGLPYIWHSKASNPFVNLKKEY  279

Query  368  EGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEWVEL  547
            +G+   EEI+PFFQ+  LS   T+V+ C  E++  VKE+LG   P F + ADAMV W+E 
Sbjct  280  KGIFWQEEIIPFFQAATLSKDCTSVQKCYIELSKQVKEKLGTIDPYFVKLADAMVTWIEA  339

Query  548  WNDVKT  565
            W+++  
Sbjct  340  WDEINN  345



>ref|XP_006856400.1| hypothetical protein AMTR_s00047p00209120 [Amborella trichopoda]
 gb|ERN17867.1| hypothetical protein AMTR_s00047p00209120 [Amborella trichopoda]
Length=360

 Score =   209 bits (532),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 94/184 (51%), Positives = 134/184 (73%), Gaps = 3/184 (2%)
 Frame = +2

Query  8    ALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGPAL  187
            A+S GLWLN+ DYDAPTQ +KP++RN+RYVDAVLT+P   L P+ G+N+AF+REL+GPA+
Sbjct  162  AVSHGLWLNIPDYDAPTQLVKPRERNTRYVDAVLTIPKGTLFPMCGMNLAFNRELIGPAM  221

Query  188  SPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRKERGNAIESLKKEW  367
               F L  +G       +D+W+G C KV+CDHLGLG+K+GLPY+W  +  N   +LKKE+
Sbjct  222  --YFGLMGDGQ-PIGRYDDMWAGWCTKVICDHLGLGLKTGLPYIWHSKASNPFVNLKKEY  278

Query  368  EGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEWVEL  547
            +G+   EE++PFFQS  L  + TTV+ C  E++  VKE+LGK  P F + ++AMV W+E 
Sbjct  279  KGIYWQEELIPFFQSATLPKECTTVQKCYIELSKQVKEKLGKVDPYFQKLSEAMVTWIEA  338

Query  548  WNDV  559
            W+++
Sbjct  339  WDEL  342



>ref|XP_002964765.1| UDP-L-arabinose mutase-like protein [Selaginella moellendorffii]
 gb|EFJ33603.1| UDP-L-arabinose mutase-like protein [Selaginella moellendorffii]
Length=387

 Score =   209 bits (533),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 97/187 (52%), Positives = 133/187 (71%), Gaps = 3/187 (2%)
 Frame = +2

Query  8    ALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGPAL  187
            A+S GLWLN+ DYDAPTQ +KP +RN+RYVDAV+T+P   L P+ G+N+AF+REL+GPA+
Sbjct  161  AISHGLWLNIPDYDAPTQLVKPSERNTRYVDAVMTIPKGTLFPMCGMNLAFNRELIGPAM  220

Query  188  SPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRKERGNAIESLKKEW  367
               F L  +G       +D+W+G C KV+CDHLG GVK+GLPY+W  +  N   +LKKE+
Sbjct  221  --YFGLMGDGQ-PIGRYDDMWAGWCCKVICDHLGYGVKTGLPYIWHSKASNPFVNLKKEY  277

Query  368  EGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEWVEL  547
            +G+   EEI+PFFQS  LS +AT+VE C  E+A  V+E+L    P FS+ ADAMV W+E 
Sbjct  278  KGIFWQEEIIPFFQSAVLSKEATSVEQCYRELAKQVREKLSNVDPYFSKLADAMVTWIES  337

Query  548  WNDVKTQ  568
            W ++ + 
Sbjct  338  WEELTSN  344



>gb|KEH25141.1| alpha-1,4-glucan-protein synthase [UDP-forming]-like protein 
[Medicago truncatula]
Length=347

 Score =   208 bits (530),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 95/185 (51%), Positives = 133/185 (72%), Gaps = 3/185 (2%)
 Frame = +2

Query  8    ALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGPAL  187
            A+S GLWLN+ DYDAPTQ +KP +RN+RYVD VLT+P   L P+ G+N+AFDR+L+GPA+
Sbjct  161  AISHGLWLNIPDYDAPTQLVKPLERNTRYVDTVLTIPKGTLFPMCGMNLAFDRDLIGPAM  220

Query  188  SPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRKERGNAIESLKKEW  367
               F L  +G       +D+W+G C KV+CDHLGLG+K+GLPY++  +  N   +L+KE+
Sbjct  221  --YFGLMGDGQ-PIGRYDDMWAGWCCKVICDHLGLGIKTGLPYIFHSKASNPFVNLRKEY  277

Query  368  EGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEWVEL  547
            +G+   E+I+PFFQSL L  +ATTV+ C  E++  VKE+LGK  P F + ADAMV W+E 
Sbjct  278  KGIFWQEDIIPFFQSLALPKEATTVQKCYIEMSKQVKEKLGKIDPYFDKLADAMVTWIEA  337

Query  548  WNDVK  562
            W+ + 
Sbjct  338  WDQLN  342



>ref|XP_008239501.1| PREDICTED: UDP-arabinopyranose mutase 1-like [Prunus mume]
Length=360

 Score =   209 bits (531),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 95/185 (51%), Positives = 133/185 (72%), Gaps = 3/185 (2%)
 Frame = +2

Query  8    ALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGPAL  187
            A+S GLWLN+ DYDAPTQ +KP++RN+RYV+AV+T+P   L P+ G+N+AFDREL+GPA+
Sbjct  160  AISHGLWLNIPDYDAPTQLVKPRERNTRYVNAVMTIPKGTLFPMCGMNLAFDRELIGPAM  219

Query  188  SPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRKERGNAIESLKKEW  367
               F L  +G       +D+W+G C KV+CDHL LGVK+GLPY+W  +  N   +LKKE+
Sbjct  220  Y--FGLMGDGQ-PIGRYDDMWAGWCAKVICDHLLLGVKTGLPYIWHSKASNPFVNLKKEY  276

Query  368  EGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEWVEL  547
            +G+   E+I+PFFQS+ L  + T+V+DC  E+A  VKE+LG   P F +  DAMV W+E 
Sbjct  277  KGIYWQEDIIPFFQSIALREECTSVQDCYIELANKVKERLGLIDPYFEKLGDAMVTWIEA  336

Query  548  WNDVK  562
            WN++ 
Sbjct  337  WNELN  341



>ref|XP_010543954.1| PREDICTED: UDP-arabinopyranose mutase 3 [Tarenaya hassleriana]
Length=200

 Score =   204 bits (518),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 93/189 (49%), Positives = 131/189 (69%), Gaps = 3/189 (2%)
 Frame = +2

Query  2    SCALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGP  181
            + A+S GLWLN+ DYDAPTQ +KP +RN+RYVDAV+T+P   L P+ G+N+AFDREL+GP
Sbjct  6    TTAVSHGLWLNIPDYDAPTQLVKPLERNTRYVDAVMTIPKGTLFPMCGMNLAFDRELIGP  65

Query  182  ALSPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRKERGNAIESLKK  361
            A+   F L  +G       +D+W+G CVKV+CDH+G GVK+GLPY+W  +  N   +LKK
Sbjct  66   AMY--FGLMGDGQPI-GRYDDMWAGWCVKVICDHMGWGVKTGLPYIWHSKASNPFVNLKK  122

Query  362  EWEGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEWV  541
            E+ G+   EE +PFFQS  L  +  TV++C  E+   VKE+LGK  P F + AD M  W+
Sbjct  123  EYNGIFWQEEAIPFFQSAALPEECKTVQECYIELGKMVKEKLGKVDPYFVKLADGMFTWI  182

Query  542  ELWNDVKTQ  568
            E W+++ ++
Sbjct  183  EAWDELNSE  191



>ref|XP_011073091.1| PREDICTED: UDP-arabinopyranose mutase 1-like [Sesamum indicum]
Length=368

 Score =   209 bits (531),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 96/185 (52%), Positives = 133/185 (72%), Gaps = 3/185 (2%)
 Frame = +2

Query  8    ALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGPAL  187
            A+S GLWLN+ DYDAPTQ +KP +RN+RYVDAVLT+P   L P+ G+N+AFDREL+GPA+
Sbjct  165  AVSHGLWLNIPDYDAPTQLVKPLERNTRYVDAVLTIPKGTLFPMCGMNLAFDRELIGPAM  224

Query  188  SPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRKERGNAIESLKKEW  367
               F L  +G       +D+W+G C KV+ DHLGLGVK+GLPY+W  +  N   +LKKE+
Sbjct  225  --YFGLMGDGQ-PIGRYDDMWAGWCTKVITDHLGLGVKTGLPYIWHSKASNPFVNLKKEY  281

Query  368  EGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEWVEL  547
            +G+   E+I+PFFQS+ L  + TTV+ C TE++  VKE+LG   P F + ADAMV W++ 
Sbjct  282  KGIYWQEDIIPFFQSVTLPKECTTVQKCYTELSKLVKEKLGPIDPYFQKLADAMVTWIDA  341

Query  548  WNDVK  562
            W+++ 
Sbjct  342  WDELN  346



>ref|XP_008786030.1| PREDICTED: UDP-arabinopyranose mutase 1 [Phoenix dactylifera]
Length=362

 Score =   209 bits (531),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 96/187 (51%), Positives = 133/187 (71%), Gaps = 3/187 (2%)
 Frame = +2

Query  2    SCALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGP  181
            + A+S GLWLN+ DYDAPTQ +KP +RN+R+VDAVLTVP   L P+ G+N+AF+REL+GP
Sbjct  165  TTAVSHGLWLNIPDYDAPTQLVKPHERNTRFVDAVLTVPKGTLFPMCGMNLAFNRELIGP  224

Query  182  ALSPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRKERGNAIESLKK  361
            A+   F L  +G       +D+W+G C KV+CDHLGLGVK+GLPY+W  +  N   +LKK
Sbjct  225  AM--YFGLMGDGQ-PIGRYDDMWAGWCTKVICDHLGLGVKTGLPYIWHSKASNPFVNLKK  281

Query  362  EWEGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEWV  541
            E+ G+   EE++PFFQS  LS   TTV+ C  E++  V+ +LGK  P F++ ADAMV W+
Sbjct  282  EYNGIFWQEELIPFFQSAALSKDCTTVQKCYIELSKQVRAKLGKIDPYFNKLADAMVTWI  341

Query  542  ELWNDVK  562
            E W+++ 
Sbjct  342  EAWDELN  348



>ref|XP_002961235.1| UDP-arabinose mutase [Selaginella moellendorffii]
 ref|XP_002969466.1| UDP-arabinose mutase [Selaginella moellendorffii]
 gb|EFJ29554.1| UDP-arabinose mutase [Selaginella moellendorffii]
 gb|EFJ38774.1| UDP-arabinose mutase [Selaginella moellendorffii]
Length=362

 Score =   208 bits (530),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 93/188 (49%), Positives = 133/188 (71%), Gaps = 3/188 (2%)
 Frame = +2

Query  2    SCALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGP  181
            + A+S GLWLN+ DYDAPTQ +KP +RN+RYVDAV+T+P   L P+ G+N+ F+REL+GP
Sbjct  154  TTAISHGLWLNIPDYDAPTQLVKPAERNTRYVDAVMTIPKGTLFPMCGMNLGFNRELIGP  213

Query  182  ALSPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRKERGNAIESLKK  361
            A+   F L  +G       +D+W+G C KV+CDHLG GVK+GLPY+W  +  N   +LKK
Sbjct  214  AM--YFGLMGDGQ-PIGRYDDMWAGWCAKVICDHLGYGVKTGLPYIWHSKASNPFVNLKK  270

Query  362  EWEGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEWV  541
            E++G+   EEI+PFFQ + L  + TTVE C  E+A  VK++L    P F++ ADAMV+W+
Sbjct  271  EYKGIFWQEEIIPFFQKVSLPKECTTVEHCYIELAKQVKDKLNGVDPYFAKLADAMVQWI  330

Query  542  ELWNDVKT  565
            + W+D+ +
Sbjct  331  DAWSDINS  338



>ref|XP_006345104.1| PREDICTED: alpha-1,4-glucan-protein synthase [UDP-forming] 2-like 
[Solanum tuberosum]
Length=365

 Score =   208 bits (530),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 94/185 (51%), Positives = 134/185 (72%), Gaps = 3/185 (2%)
 Frame = +2

Query  8    ALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGPAL  187
            A+S GLWLN+ DYDAPTQ +KP +RN+RYVDAV+T+P   L P+ G+N+AFDREL+GPA+
Sbjct  169  AVSHGLWLNIPDYDAPTQLVKPLERNTRYVDAVMTIPKGTLFPMCGMNLAFDRELIGPAM  228

Query  188  SPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRKERGNAIESLKKEW  367
               F L  +G       +D+W+G C+KV+CDHLGLGVK+GLPY+W  +  N   +LKKE+
Sbjct  229  --YFGLMGDGQ-PIGRYDDMWAGWCIKVICDHLGLGVKTGLPYIWHSKASNPFVNLKKEY  285

Query  368  EGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEWVEL  547
            +G+   EE++PFFQS+ L  + T+V+ C  E++  VK +LGK    F++ ADAM+ W+E 
Sbjct  286  KGIYWQEELIPFFQSVALPKECTSVQKCYLELSKQVKAKLGKVDDYFNKLADAMITWIEA  345

Query  548  WNDVK  562
            W+D+ 
Sbjct  346  WDDLN  350



>ref|XP_011021068.1| PREDICTED: UDP-arabinopyranose mutase 1 [Populus euphratica]
Length=366

 Score =   208 bits (530),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 96/184 (52%), Positives = 132/184 (72%), Gaps = 3/184 (2%)
 Frame = +2

Query  8    ALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGPAL  187
            A+S GLWLN+ DYDAPTQ +KP +RN+RYVDAVLT+P   L P+ G+N+ FDR+L+GPA+
Sbjct  171  AVSHGLWLNIPDYDAPTQLVKPLERNTRYVDAVLTIPKGTLFPMCGMNLCFDRDLIGPAM  230

Query  188  SPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRKERGNAIESLKKEW  367
               F L  +G       +D+W+G C KV+CDHLGLGVK+GLPY++  +  N   +LKKE+
Sbjct  231  Y--FGLMGDGQ-PIGRYDDMWAGWCTKVICDHLGLGVKTGLPYIYHSKASNPFVNLKKEY  287

Query  368  EGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEWVEL  547
            +G+   EEI+PFFQ+  LS   TTV+ C  E++  VKE+LGK  P F + ADAMV W+E 
Sbjct  288  KGIFWQEEIIPFFQAATLSKDCTTVQKCYIELSKQVKEKLGKVDPYFDKLADAMVTWIEA  347

Query  548  WNDV  559
            W+++
Sbjct  348  WDEL  351



>sp|O04300.1|UPTG_PEA RecName: Full=Alpha-1,4-glucan-protein synthase [UDP-forming]; 
AltName: Full=Reversibly glycosylated polypeptide 1; AltName: 
Full=UDP-glucose:protein transglucosylase; Short=UPTG [Pisum 
sativum]
 gb|AAB88408.1| reversibly glycosylatable polypeptide [Pisum sativum]
Length=364

 Score =   208 bits (530),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 95/187 (51%), Positives = 133/187 (71%), Gaps = 3/187 (2%)
 Frame = +2

Query  8    ALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGPAL  187
            A+S GLWLN+ DYDAPTQ +KP +RN+R+VDAVLT+P  +L P+ G+N+AF+REL+GPA+
Sbjct  164  AVSHGLWLNIPDYDAPTQLVKPHERNTRFVDAVLTIPKGSLFPMCGMNLAFNRELIGPAM  223

Query  188  SPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRKERGNAIESLKKEW  367
               F L  +G       +D+W+G C+KV+CDHLG GVK+GLPY+W  +  N   +LKKE+
Sbjct  224  --YFGLMGDGQ-PIGRYDDMWAGWCIKVICDHLGYGVKTGLPYIWHSKASNPFVNLKKEY  280

Query  368  EGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEWVEL  547
            +G+   EEI+PFFQ+  LS   T+V+ C  E++  VKE+LG   P F + ADAMV WVE 
Sbjct  281  KGIFWQEEIIPFFQAATLSKDCTSVQKCYIELSKQVKEKLGTIDPYFIKLADAMVTWVEA  340

Query  548  WNDVKTQ  568
            W+++   
Sbjct  341  WDEINNN  347



>ref|XP_006373391.1| type IIIa membrane protein cp-wap13 [Populus trichocarpa]
 gb|ERP51188.1| type IIIa membrane protein cp-wap13 [Populus trichocarpa]
Length=365

 Score =   208 bits (530),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 96/184 (52%), Positives = 132/184 (72%), Gaps = 3/184 (2%)
 Frame = +2

Query  8    ALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGPAL  187
            A+S GLWLN+ DYDAPTQ +KP +RN+RYVDAVLT+P   L P+ G+N+ FDR+L+GPA+
Sbjct  171  AVSHGLWLNIPDYDAPTQLVKPLERNTRYVDAVLTIPKGTLFPMCGMNLCFDRDLIGPAM  230

Query  188  SPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRKERGNAIESLKKEW  367
               F L  +G       +D+W+G C KV+CDHLGLGVK+GLPY++  +  N   +LKKE+
Sbjct  231  Y--FGLMGDGQ-PIGRYDDMWAGWCTKVICDHLGLGVKTGLPYIYHSKASNPFVNLKKEY  287

Query  368  EGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEWVEL  547
            +G+   EEI+PFFQ+  LS   TTV+ C  E++  VKE+LGK  P F + ADAMV W+E 
Sbjct  288  KGIFWQEEIIPFFQAATLSKDCTTVQKCYIELSKQVKEKLGKVDPYFDKLADAMVTWIEA  347

Query  548  WNDV  559
            W+++
Sbjct  348  WDEL  351



>ref|XP_002961697.1| UDP-L-arabinose mutase-like protein, partial [Selaginella moellendorffii]
 gb|EFJ36957.1| UDP-L-arabinose mutase-like protein, partial [Selaginella moellendorffii]
Length=390

 Score =   209 bits (532),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 97/187 (52%), Positives = 132/187 (71%), Gaps = 3/187 (2%)
 Frame = +2

Query  8    ALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGPAL  187
            A+S GLWLN+ DYDAPTQ +KP +RN+RYVDAV+T+P   L P+ G+N+AF+REL+GPA+
Sbjct  162  AISHGLWLNIPDYDAPTQLVKPSERNTRYVDAVMTIPKGTLFPMCGMNLAFNRELIGPAM  221

Query  188  SPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRKERGNAIESLKKEW  367
               F L  +G       +D+W+G C KV+CDHLG GVK+GLPY+W  +  N   +LKKE+
Sbjct  222  --YFGLMGDGQ-PIGRYDDMWAGWCCKVICDHLGYGVKTGLPYIWHSKASNPFVNLKKEY  278

Query  368  EGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEWVEL  547
            +G+   EEI+PFFQS  LS +AT+VE C  E+A  V+E+L    P FS+ ADAMV W E 
Sbjct  279  KGIFWQEEIIPFFQSAVLSKEATSVEQCYRELAKQVREKLSNVDPYFSKLADAMVTWTES  338

Query  548  WNDVKTQ  568
            W ++ + 
Sbjct  339  WEELTSN  345



>ref|XP_009135081.1| PREDICTED: UDP-arabinopyranose mutase 3 [Brassica rapa]
Length=363

 Score =   208 bits (530),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 96/186 (52%), Positives = 132/186 (71%), Gaps = 3/186 (2%)
 Frame = +2

Query  8    ALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGPAL  187
            A+S GLWLN+ DYDAPTQ +KP +RNSRYVDAV+T+P   L P+ G+N+AFDREL+GPA+
Sbjct  167  AVSHGLWLNIPDYDAPTQLVKPLERNSRYVDAVMTIPKGTLFPMCGMNLAFDRELIGPAM  226

Query  188  SPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRKERGNAIESLKKEW  367
               F L  +G       +D+W+G CVKV+CDH+G GVK+GLPY+W  +  N   +L+KE+
Sbjct  227  --YFGLMGDGQ-PIGRYDDMWAGWCVKVICDHMGWGVKTGLPYIWHSKASNPFVNLRKEY  283

Query  368  EGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEWVEL  547
             G+   EE +PFFQSL L  + T+V+ C  E+A  VKE+LGK  P F++ AD MV W+E 
Sbjct  284  NGIFWQEEAIPFFQSLALPKECTSVQQCYMEMAKLVKEKLGKVDPYFNKLADGMVTWIEA  343

Query  548  WNDVKT  565
            W ++ +
Sbjct  344  WEELNS  349



>ref|XP_002871677.1| reversibly glycosylated polypeptide-3 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47936.1| reversibly glycosylated polypeptide-3 [Arabidopsis lyrata subsp. 
lyrata]
Length=360

 Score =   208 bits (529),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 94/187 (50%), Positives = 135/187 (72%), Gaps = 3/187 (2%)
 Frame = +2

Query  2    SCALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGP  181
            S A+S GLWLN+ DYDAPTQ +KPK+RN+RYVDAV+T+P   L P+ G+N+AFDR+L+GP
Sbjct  169  STAVSHGLWLNIPDYDAPTQLVKPKERNTRYVDAVMTIPKGTLFPMCGMNLAFDRDLIGP  228

Query  182  ALSPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRKERGNAIESLKK  361
            A+   F L  +G       +D+W+G C+KV+CDHL LGVK+GLPY++  +  N   +L+K
Sbjct  229  AM--YFGLMGDGQ-PIGRYDDMWAGWCIKVICDHLSLGVKTGLPYIYHSKASNPFVNLRK  285

Query  362  EWEGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEWV  541
            E++G+   EEI+PFFQ+ +LS +A TV+ C  E++  VKE+L    P F + ADAMV W+
Sbjct  286  EYKGIFWQEEIIPFFQNAKLSKEAVTVQQCYIELSKMVKEKLSSLDPYFDKLADAMVTWI  345

Query  542  ELWNDVK  562
            E W+++ 
Sbjct  346  EAWDELN  352



>ref|XP_004491891.1| PREDICTED: UDP-arabinopyranose mutase 2-like [Cicer arietinum]
Length=351

 Score =   207 bits (528),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 95/185 (51%), Positives = 135/185 (73%), Gaps = 3/185 (2%)
 Frame = +2

Query  8    ALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGPAL  187
            A+S GLWLN+ DYDAPTQ +KP +RN+RYVDA+LT+P   L P+ G+N+AFDREL+GPA+
Sbjct  161  AVSHGLWLNIPDYDAPTQLVKPLERNTRYVDAILTIPKGTLFPMCGMNLAFDRELIGPAM  220

Query  188  SPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRKERGNAIESLKKEW  367
               F L  +G       +D+W+G CVKV+CDHLGLGVK+GLPY++  +  N   +L+KE+
Sbjct  221  --YFGLMGDGQ-PIGRYDDMWAGWCVKVICDHLGLGVKTGLPYIYHSKASNPFVNLRKEY  277

Query  368  EGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEWVEL  547
            +G+   E+I+PFFQ++ L  +ATTV+ C  E+A  VK++L K  P F + ADAMV W+E 
Sbjct  278  KGIFWQEDIIPFFQNVVLPKEATTVQKCYIELAKEVKDKLSKIDPYFDKLADAMVTWIES  337

Query  548  WNDVK  562
            W+++ 
Sbjct  338  WDELN  342



>ref|XP_009625283.1| PREDICTED: alpha-1,4-glucan-protein synthase [UDP-forming] 2 
[Nicotiana tomentosiformis]
Length=363

 Score =   208 bits (529),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 93/185 (50%), Positives = 133/185 (72%), Gaps = 3/185 (2%)
 Frame = +2

Query  8    ALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGPAL  187
            A+S GLWLN+ DYDAPTQ +KP++RN+RYVDAV+T+P   L P+ G+N+AF+REL+GPA+
Sbjct  165  AVSHGLWLNIPDYDAPTQLVKPRERNTRYVDAVMTIPKGTLFPMCGMNLAFNRELIGPAM  224

Query  188  SPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRKERGNAIESLKKEW  367
               F L  +G       +D+W+G C KV+CDHLGLG+K+GLPY+W  +  N   +LKKE+
Sbjct  225  --YFGLMGDGQ-PIGRYDDMWAGWCTKVICDHLGLGIKTGLPYIWHSKASNPFVNLKKEY  281

Query  368  EGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEWVEL  547
            +G+   EEI+PFFQS  L    T+V+ C  E++  VK++L K  P F++ ADAMV W+E 
Sbjct  282  KGIYWQEEIIPFFQSATLPKDCTSVQQCYIELSKQVKDKLSKVDPYFTKLADAMVTWIEA  341

Query  548  WNDVK  562
            W+++ 
Sbjct  342  WDELN  346



>ref|NP_001234554.1| UDP-glucose:protein transglucosylase-like protein SlUPTG1 [Solanum 
lycopersicum]
 gb|AAT44738.1| UDP-glucose:protein transglucosylase-like protein SlUPTG1 [Solanum 
lycopersicum]
Length=362

 Score =   208 bits (529),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 93/185 (50%), Positives = 131/185 (71%), Gaps = 3/185 (2%)
 Frame = +2

Query  8    ALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGPAL  187
            A+S GLWLN+ DYDAPTQ +KP +RN+RYVDAV+T+P   L P+ G+N+AFDR+L+GPA+
Sbjct  161  AVSHGLWLNIPDYDAPTQLVKPHERNTRYVDAVMTIPKGTLFPMCGMNLAFDRDLIGPAM  220

Query  188  SPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRKERGNAIESLKKEW  367
               F L  +G       +D+W+G C KV+CDHLGLG+K+GLPY+W  +  N   +LKKE+
Sbjct  221  Y--FGLMGDGQ-PIGRYDDMWAGWCTKVICDHLGLGIKTGLPYIWHSKASNPFVNLKKEY  277

Query  368  EGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEWVEL  547
             G+   EEI+PFFQ+  L  + TTV+ C  E++  VKE+L K  P F++  DAMV W+E 
Sbjct  278  NGIFWQEEIIPFFQTATLPKECTTVQQCYLELSKQVKEKLSKIDPYFTKLGDAMVTWIEA  337

Query  548  WNDVK  562
            W+++ 
Sbjct  338  WDELN  342



>gb|EMT30339.1| Alpha-1,4-glucan-protein synthase (UDP-forming) [Aegilops tauschii]
Length=368

 Score =   208 bits (529),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 96/185 (52%), Positives = 133/185 (72%), Gaps = 3/185 (2%)
 Frame = +2

Query  8    ALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGPAL  187
            A+S GLWLN+ DYDAPTQ +KP++RNSRYVDAVLT+P   L P+ G+N+AFDR+L+GPA+
Sbjct  171  AVSHGLWLNIPDYDAPTQMVKPRERNSRYVDAVLTIPKGTLFPMCGMNLAFDRQLIGPAM  230

Query  188  SPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRKERGNAIESLKKEW  367
               F L  +G       +D+W+G CVKV+CDHL LGVK+GLPY+W  +  N   +LKKE+
Sbjct  231  --YFGLMGDGQ-PIGRYDDMWAGWCVKVICDHLSLGVKTGLPYLWHSKASNPFVNLKKEY  287

Query  368  EGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEWVEL  547
            +G+   E+I+PFFQ+  LS +  TV+ C   ++  VKE+LGK  P F + ADAMV W+E 
Sbjct  288  KGIFWQEDIIPFFQNATLSKECDTVQKCYISLSEQVKEKLGKIDPYFVKLADAMVTWIEA  347

Query  548  WNDVK  562
            W+++ 
Sbjct  348  WDELN  352



>ref|XP_009397227.1| PREDICTED: UDP-arabinopyranose mutase 3 [Musa acuminata subsp. 
malaccensis]
Length=366

 Score =   207 bits (528),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 96/185 (52%), Positives = 131/185 (71%), Gaps = 3/185 (2%)
 Frame = +2

Query  8    ALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGPAL  187
            A+S GLWLN+ DYDAPTQ +KP +RN RYVDAVLT+P   L P+ G+N+AFDREL+GPA+
Sbjct  169  AVSHGLWLNIPDYDAPTQLVKPLERNQRYVDAVLTIPKGTLFPMCGMNLAFDRELIGPAM  228

Query  188  SPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRKERGNAIESLKKEW  367
               F L  +G       +D+W+G C KV+CDHL LGVK+GLPY+W  +  N   +LKKE+
Sbjct  229  --YFGLMGDGQ-PIGRYDDMWAGWCTKVICDHLRLGVKTGLPYIWHSKASNPFVNLKKEY  285

Query  368  EGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEWVEL  547
             G+   EE++PFFQS  LS   TT++ C  E++  V+E+LGK  P F++ ADAMV W+E 
Sbjct  286  NGIFWQEEVIPFFQSAVLSKDCTTIQKCYIELSKQVREKLGKIDPYFNKLADAMVTWIEA  345

Query  548  WNDVK  562
            W+++ 
Sbjct  346  WDELN  350



>emb|CAA77237.1| reversibly glycosylated polypeptide [Triticum aestivum]
 gb|ADK56176.1| glycosyltransferase 75 [Triticum aestivum]
Length=368

 Score =   207 bits (528),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 96/185 (52%), Positives = 133/185 (72%), Gaps = 3/185 (2%)
 Frame = +2

Query  8    ALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGPAL  187
            A+S GLWLN+ DYDAPTQ +KP++RNSRYVDAVLT+P   L P+ G+N+AFDR+L+GPA+
Sbjct  171  AVSHGLWLNIPDYDAPTQMVKPRERNSRYVDAVLTIPKGTLFPMCGMNLAFDRQLIGPAM  230

Query  188  SPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRKERGNAIESLKKEW  367
               F L  +G       +D+W+G CVKV+CDHL LGVK+GLPY+W  +  N   +LKKE+
Sbjct  231  --YFGLMGDGQ-PIGRYDDMWAGWCVKVICDHLSLGVKTGLPYLWHSKASNPFLNLKKEY  287

Query  368  EGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEWVEL  547
            +G+   E+I+PFFQ+  LS +  TV+ C   ++  VKE+LGK  P F + ADAMV W+E 
Sbjct  288  KGIFWQEDIIPFFQNASLSKECDTVQKCYISLSEQVKEKLGKIDPYFVKLADAMVTWIEA  347

Query  548  WNDVK  562
            W+++ 
Sbjct  348  WDELN  352



>gb|KHG08185.1| UDP-arabinopyranose mutase 1 [Gossypium arboreum]
Length=366

 Score =   207 bits (528),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 97/194 (50%), Positives = 137/194 (71%), Gaps = 5/194 (3%)
 Frame = +2

Query  8    ALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGPAL  187
            A+S GLWLN+ DYDAPTQ +KP +RN+R+VDAVLT+P   L P+ G+N+AFDR+L+GPA+
Sbjct  173  AVSHGLWLNIPDYDAPTQLVKPLERNTRFVDAVLTIPKGTLFPMCGMNLAFDRQLIGPAM  232

Query  188  SPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRKERGNAIESLKKEW  367
               F L  EG       +D+W+G C+KV+CDHLGLGVK+GLPY++  +  N   +L+KE+
Sbjct  233  --YFGLMGEGQ-PIGRYDDMWAGWCIKVICDHLGLGVKTGLPYIYHSKASNPFVNLRKEY  289

Query  368  EGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEWVEL  547
            +G+   E+I+PFFQ + L   +TTV+ C  E+A  VKE+LGK  P F + ADAMV W++ 
Sbjct  290  KGIYWQEDIIPFFQQVVLPKDSTTVQKCYIELAKQVKEKLGKIDPYFDKLADAMVTWIQA  349

Query  548  WNDVKTQ*TNCCFS  589
            W+ +    T+  FS
Sbjct  350  WDGLNP--TSASFS  361



>ref|XP_008445443.1| PREDICTED: alpha-1,4-glucan-protein synthase [UDP-forming] [Cucumis 
melo]
Length=358

 Score =   207 bits (528),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 96/186 (52%), Positives = 135/186 (73%), Gaps = 3/186 (2%)
 Frame = +2

Query  8    ALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGPAL  187
            A+S GLWLN+ DYDAPTQ +KP++RNSRYVDAVLT+P   L P+ G+N+AF+REL+GPA+
Sbjct  165  AVSHGLWLNIPDYDAPTQLVKPRERNSRYVDAVLTIPKGTLFPMCGMNLAFNRELIGPAM  224

Query  188  SPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRKERGNAIESLKKEW  367
               F L  +G       +D+W+G CVKV+CDHLG GVK+GLPY+W  +  N   +LKKE+
Sbjct  225  --YFGLMGDGQ-PIGRYDDMWAGWCVKVICDHLGWGVKTGLPYIWHSKASNPFVNLKKEY  281

Query  368  EGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEWVEL  547
            +G+   EEI+PFFQS+ L  + TTV+ C  E++  VKE+LG   P F + ++AMV W+E 
Sbjct  282  KGIFWQEEIIPFFQSVVLPKECTTVQKCYIELSKLVKEKLGPVDPYFLKLSEAMVTWIEA  341

Query  548  WNDVKT  565
            W+++ +
Sbjct  342  WDELNS  347



>gb|EPS67258.1| hypothetical protein M569_07517, partial [Genlisea aurea]
Length=365

 Score =   207 bits (528),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 94/186 (51%), Positives = 133/186 (72%), Gaps = 3/186 (2%)
 Frame = +2

Query  8    ALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGPAL  187
            A+S GLWLN+ DYDAPTQ +KP++RN+RYVDAVLT+P   L P+ G+N+AF+R+L+GPA+
Sbjct  165  AISHGLWLNIPDYDAPTQLVKPRERNTRYVDAVLTIPKGTLFPLCGMNLAFNRDLIGPAM  224

Query  188  SPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRKERGNAIESLKKEW  367
               F L  +G       +D+W+G C KV+ DHLGLGVK+GLPY+W  +  N   +LKKE+
Sbjct  225  --YFGLMGDGQ-PIGRYDDMWAGWCTKVIADHLGLGVKTGLPYIWHSKASNPFNNLKKEY  281

Query  368  EGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEWVEL  547
            +G+   E+I+PFFQS+ L  + TTV+ C  E++  VKE+LG   P F R +DAMV W+E 
Sbjct  282  KGIYWQEDIIPFFQSVLLPKECTTVQKCYVELSKLVKEKLGPLDPYFERLSDAMVTWIEA  341

Query  548  WNDVKT  565
            W ++ +
Sbjct  342  WEELNS  347



>ref|XP_010099313.1| Alpha-1,4-glucan-protein synthase [UDP-forming] 2 [Morus notabilis]
 gb|EXB77659.1| Alpha-1,4-glucan-protein synthase [UDP-forming] 2 [Morus notabilis]
Length=357

 Score =   207 bits (527),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 97/185 (52%), Positives = 131/185 (71%), Gaps = 3/185 (2%)
 Frame = +2

Query  8    ALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGPAL  187
            A+S GLWLN+ DYDAPTQ +KP +RN+RYVDAVLT+P   L P+ G+N+AFDREL+GPA+
Sbjct  163  AVSHGLWLNIPDYDAPTQLVKPLERNARYVDAVLTIPKGTLFPMCGMNLAFDRELIGPAM  222

Query  188  SPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRKERGNAIESLKKEW  367
               F L  +G       +D+W+G CVKV+CDHLGLGVK+GLPY+W  +  N   +LKKE+
Sbjct  223  --YFGLMGDGQ-PIGRYDDMWAGWCVKVICDHLGLGVKTGLPYIWHSKASNPFVNLKKEY  279

Query  368  EGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEWVEL  547
            +G+   EEI+PFFQS  L  + T V+ C  E++  VK +L K  P F + ADAMV W+E 
Sbjct  280  KGIFWQEEIIPFFQSAVLPKECTNVQKCYIELSKQVKAKLSKVDPYFDKLADAMVTWIEA  339

Query  548  WNDVK  562
            W+++ 
Sbjct  340  WDELN  344



>gb|ABR26070.1| alpha-1,4-glucan-protein synthase [Oryza sativa Indica Group]
Length=215

 Score =   202 bits (515),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 93/185 (50%), Positives = 132/185 (71%), Gaps = 3/185 (2%)
 Frame = +2

Query  8    ALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGPAL  187
            A+S GLWLN+ DYDAPTQ +KP++RNSRYVDAV+TVP   L P+ G+N+AFDR+L+GPA+
Sbjct  22   AVSHGLWLNIPDYDAPTQMVKPRERNSRYVDAVMTVPKGTLFPMCGMNLAFDRDLIGPAM  81

Query  188  SPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRKERGNAIESLKKEW  367
               F L  +G       +D+W+G C+KV+CDHL LGVK+GLPY+W  +  N   +LKKE+
Sbjct  82   Y--FGLMGDGQ-PIGRYDDMWAGWCMKVICDHLSLGVKTGLPYIWHSKASNPFVNLKKEY  138

Query  368  EGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEWVEL  547
            +G+   E+I+PFFQ+  +  +  TV+ C   +A  V+E+LGK  P F + ADAMV W+E 
Sbjct  139  KGIFWQEDIIPFFQNATIPKECDTVQKCYLSLAEQVREKLGKIDPYFVKLADAMVTWIEA  198

Query  548  WNDVK  562
            W+++ 
Sbjct  199  WDELN  203



>ref|XP_011099037.1| PREDICTED: alpha-1,4-glucan-protein synthase [UDP-forming] 1 
[Sesamum indicum]
Length=348

 Score =   207 bits (526),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 95/185 (51%), Positives = 132/185 (71%), Gaps = 3/185 (2%)
 Frame = +2

Query  8    ALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGPAL  187
            A+S GLWLN+ DYDAPTQ +KP +RN++YVDAVLT+P   L P+ G+N+AFDR+L+GPA+
Sbjct  161  AVSHGLWLNIPDYDAPTQLVKPLERNTKYVDAVLTIPKGTLFPMCGMNLAFDRDLIGPAM  220

Query  188  SPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRKERGNAIESLKKEW  367
               F L  +G       +D+W+G C KV+CDHLGLGVK+GLPY+W  +  N   +LKKE+
Sbjct  221  --YFGLMGDGQ-PIGRYDDMWAGWCTKVICDHLGLGVKTGLPYIWHSKASNPFVNLKKEY  277

Query  368  EGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEWVEL  547
             G+   EEI+PFFQ+  LS  +TTV+ C  E++  VKE+LGK  P F + ADAM  W++ 
Sbjct  278  NGIFWQEEIIPFFQAATLSKDSTTVQKCYIELSKQVKEKLGKVDPYFVKLADAMETWIQA  337

Query  548  WNDVK  562
            W+++ 
Sbjct  338  WDELN  342



>ref|XP_002947267.1| hypothetical protein VOLCADRAFT_108916 [Volvox carteri f. nagariensis]
 gb|EFJ51857.1| hypothetical protein VOLCADRAFT_108916 [Volvox carteri f. nagariensis]
Length=345

 Score =   206 bits (525),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 98/181 (54%), Positives = 127/181 (70%), Gaps = 3/181 (2%)
 Frame = +2

Query  8    ALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGPAL  187
            A S GLWLN+ DYDAPTQ +KPK+RN RYVDAV+TVP   L P+ G+N+AFDREL+G A+
Sbjct  158  ATSHGLWLNIPDYDAPTQMVKPKERNQRYVDAVMTVPKGTLYPMCGMNLAFDRELIGAAM  217

Query  188  SPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRKERGNAIESLKKEW  367
               F L  EG       +D+W+G C KV+CDHLG+G K+GLPYVW  +  N   +L+KE+
Sbjct  218  Y--FGLMGEGQ-PIGRYDDMWAGWCTKVICDHLGVGCKTGLPYVWHSKASNPFTNLRKEY  274

Query  368  EGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEWVEL  547
            +G+   EEI+PFFQ+L LS  +T VEDC  E+A  V++ LG   P FS+ AD MV W+E 
Sbjct  275  KGIFWQEEIIPFFQNLTLSKASTNVEDCYLELADKVRKGLGHIDPYFSKLADGMVAWIEG  334

Query  548  W  550
            W
Sbjct  335  W  335



>ref|XP_010525126.1| PREDICTED: UDP-arabinopyranose mutase 2-like [Tarenaya hassleriana]
 gb|ABD96930.1| hypothetical protein [Cleome spinosa]
Length=359

 Score =   207 bits (526),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 93/185 (50%), Positives = 135/185 (73%), Gaps = 3/185 (2%)
 Frame = +2

Query  8    ALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGPAL  187
            A+S GLWLN+ DYDAPTQ +KP +RN+RYVDAVLT+P   L P+ G+N+AFDREL+GPA+
Sbjct  171  AVSHGLWLNIPDYDAPTQLVKPMERNTRYVDAVLTIPKGTLFPMCGMNLAFDRELIGPAM  230

Query  188  SPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRKERGNAIESLKKEW  367
               F L  +G       +D+W+G CVKV+CDHLG+GVK+GLPY++  +  N   +LKKE+
Sbjct  231  --YFGLMGDGQ-PIGRYDDMWAGWCVKVICDHLGMGVKTGLPYIYHSKASNPFVNLKKEY  287

Query  368  EGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEWVEL  547
            +G+   EEI+PFFQ+++LS + TTV+ C  E++  VK++L    P F + ++AMV W+E 
Sbjct  288  KGIFWQEEIIPFFQNVKLSKECTTVQQCYIELSKMVKDKLSSIDPYFDKLSEAMVTWIEA  347

Query  548  WNDVK  562
            W+++ 
Sbjct  348  WDELN  352



>ref|XP_010260639.1| PREDICTED: alpha-1,4-glucan-protein synthase [UDP-forming] [Nelumbo 
nucifera]
Length=351

 Score =   207 bits (526),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 94/184 (51%), Positives = 131/184 (71%), Gaps = 3/184 (2%)
 Frame = +2

Query  11   LSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGPALS  190
            +S GLWLN+ DYDAPTQ +KP +RN+RYVDAV+T+P   L P+ G+N+AF+REL+GPA+ 
Sbjct  165  VSHGLWLNIPDYDAPTQLVKPLERNTRYVDAVMTIPKGTLFPMCGMNLAFNRELIGPAM-  223

Query  191  PAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRKERGNAIESLKKEWE  370
              F L  +G       +D+W+G C KV+CDHLG G+K+GLPY+W  +  N   +LKKE+ 
Sbjct  224  -YFGLMGDGQ-PIGRYDDMWAGWCTKVICDHLGWGIKTGLPYIWHSKASNPFVNLKKEYN  281

Query  371  GVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEWVELW  550
            G+   EEI+PFFQSL +  + TTV+ C  E++  VKE+LGK  P F + ADAMV W+E W
Sbjct  282  GIYWQEEIIPFFQSLTIPMECTTVQKCYIELSKQVKEKLGKVDPYFVKLADAMVTWIEAW  341

Query  551  NDVK  562
            +++ 
Sbjct  342  DELN  345



>ref|XP_008775857.1| PREDICTED: alpha-1,4-glucan-protein synthase [UDP-forming] 2-like 
[Phoenix dactylifera]
Length=340

 Score =   206 bits (525),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 95/183 (52%), Positives = 132/183 (72%), Gaps = 3/183 (2%)
 Frame = +2

Query  8    ALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGPAL  187
            A+S GLWLN+ DYDAPTQ +KP++RN+RYVDAVLT+P   L P+ G+N+AF+REL+GPA+
Sbjct  139  AVSHGLWLNIPDYDAPTQLVKPRERNTRYVDAVLTIPKGTLFPMCGMNLAFNRELIGPAI  198

Query  188  SPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRKERGNAIESLKKEW  367
               F L  +G       +D+W+G CVKVVCDHLGLGVK+GLPY+W  +  N  E+LKKE+
Sbjct  199  --YFGLMGDGQ-PISRYDDMWAGWCVKVVCDHLGLGVKTGLPYLWHSKASNPFENLKKEY  255

Query  368  EGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEWVEL  547
            +G+   EE++PFFQS     + TT  +C  E++  V+ +L K  P F++ ADAMV W+E 
Sbjct  256  KGLFWQEELIPFFQSTTFPKECTTARECYIELSKQVRARLVKLDPYFNKLADAMVTWIEA  315

Query  548  WND  556
            W++
Sbjct  316  WDE  318



>ref|XP_009803551.1| PREDICTED: alpha-1,4-glucan-protein synthase [UDP-forming] 2-like 
[Nicotiana sylvestris]
Length=359

 Score =   207 bits (526),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 92/187 (49%), Positives = 134/187 (72%), Gaps = 3/187 (2%)
 Frame = +2

Query  2    SCALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGP  181
            + A+S GLWLN+ DYDAPTQ +KP++RN+RYVDAV+T+P   L P+ G+N+AF+REL+GP
Sbjct  159  ATAVSHGLWLNIPDYDAPTQLVKPRERNTRYVDAVMTIPKGTLFPMCGMNLAFNRELIGP  218

Query  182  ALSPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRKERGNAIESLKK  361
            A+   F L  +G       +D+W+G C KV+CDHLGLG+K+GLPY+W  +  N   +LKK
Sbjct  219  AMY--FGLMGDGQ-PIGRYDDMWAGWCTKVICDHLGLGIKTGLPYIWHSKASNPFVNLKK  275

Query  362  EWEGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEWV  541
            E++G+   EEI+PFFQ++ L  + TTV+ C  E+A  VKE+L    P F++ A+AM  W+
Sbjct  276  EYKGIYWQEEIIPFFQAVTLPKECTTVQQCYIELAKQVKEKLSNIDPYFTKLAEAMATWI  335

Query  542  ELWNDVK  562
            E W+++ 
Sbjct  336  EAWDELN  342



>ref|XP_007032852.1| Reversibly glycosylated polypeptide 1 [Theobroma cacao]
 gb|EOY03778.1| Reversibly glycosylated polypeptide 1 [Theobroma cacao]
Length=364

 Score =   207 bits (526),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 97/185 (52%), Positives = 131/185 (71%), Gaps = 3/185 (2%)
 Frame = +2

Query  8    ALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGPAL  187
            A+S GLWLN+ DYDAPTQ +KP +RN+RYVDAVLT+P   L P+ G+N+AFDREL+GPA+
Sbjct  171  AVSHGLWLNIPDYDAPTQLVKPLERNTRYVDAVLTIPKGTLFPMCGMNLAFDRELIGPAM  230

Query  188  SPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRKERGNAIESLKKEW  367
               F L  +G       +D+W+G CVKV+CDHLGLGVK+GLPY++  +  N   +L+KE+
Sbjct  231  Y--FGLMGDGQ-PIGRYDDMWAGWCVKVICDHLGLGVKTGLPYIYHSKASNPFVNLRKEY  287

Query  368  EGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEWVEL  547
            +G+   EEI+PFFQ   L    TTV+ C  E+A  VKE+L K  P F + ADAMV W+E 
Sbjct  288  KGIFWQEEIIPFFQQSVLPKDCTTVQKCYIELAKQVKEKLSKVDPYFDKLADAMVTWIEA  347

Query  548  WNDVK  562
            W+++ 
Sbjct  348  WDELN  352



>gb|AAC50001.1| reversibly glycosylated polypeptide-2 [Arabidopsis thaliana]
Length=364

 Score =   207 bits (526),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 95/187 (51%), Positives = 134/187 (72%), Gaps = 3/187 (2%)
 Frame = +2

Query  2    SCALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGP  181
            S A+S GLWLN+ DYDAPTQ +KPK+RN+RYVDAV+T P   L P+ G+N+AFDR+L+GP
Sbjct  169  STAVSHGLWLNIPDYDAPTQLVKPKERNTRYVDAVMTNPKGTLFPMCGMNLAFDRDLIGP  228

Query  182  ALSPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRKERGNAIESLKK  361
            A+   F L  +G       +D+W+G C+KV+CDHL LGVK+GLPY++  +  N   +LKK
Sbjct  229  AM--YFVLMGDGQ-PIGRYDDMWAGWCIKVICDHLSLGVKTGLPYIYHSKASNPFVNLKK  285

Query  362  EWEGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEWV  541
            E++G+   EEI+PFFQ+ +LS +A TV+ C  E++  VKE+L    P F + ADAMV W+
Sbjct  286  EYKGIFWQEEIIPFFQNAKLSKEAVTVQQCYIELSKMVKEKLSSLDPYFDKLADAMVTWI  345

Query  542  ELWNDVK  562
            E W+++ 
Sbjct  346  EAWDELN  352



>ref|XP_009590755.1| PREDICTED: alpha-1,4-glucan-protein synthase [UDP-forming] 2-like 
[Nicotiana tomentosiformis]
Length=364

 Score =   207 bits (526),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 94/185 (51%), Positives = 132/185 (71%), Gaps = 3/185 (2%)
 Frame = +2

Query  8    ALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGPAL  187
            A+S GLWLN+ DYDAPTQ +KP +RN+RYVDAV+T+P   L P+ G+N+AFDREL+GPA+
Sbjct  167  AVSHGLWLNIPDYDAPTQLVKPLERNTRYVDAVMTIPKGTLFPMCGMNLAFDRELIGPAM  226

Query  188  SPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRKERGNAIESLKKEW  367
               F L  +G       +D+W+G C KV+CDHLGLGVK+GLPY+W  +  N   +LKKE+
Sbjct  227  Y--FGLMGDGQ-PIGRYDDMWAGWCTKVICDHLGLGVKTGLPYIWHSKASNPFVNLKKEY  283

Query  368  EGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEWVEL  547
            +G+   EE++PFFQS+ L    T+V+ C  E++  VK +LGK    F++ ADAM+ W+E 
Sbjct  284  KGIYWQEELIPFFQSVALPKDCTSVQKCYLELSKQVKAKLGKVDDYFNKLADAMITWIEA  343

Query  548  WNDVK  562
            WN++ 
Sbjct  344  WNELN  348



>gb|ABF97477.1| Alpha-1,4-glucan-protein synthase, putative, expressed [Oryza 
sativa Japonica Group]
Length=266

 Score =   204 bits (518),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 93/185 (50%), Positives = 132/185 (71%), Gaps = 3/185 (2%)
 Frame = +2

Query  8    ALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGPAL  187
            A+S GLWLN+ DYDAPTQ +KP++RNSRYVDAV+TVP   L P+ G+N+AFDR+L+GPA+
Sbjct  73   AVSHGLWLNIPDYDAPTQMVKPRERNSRYVDAVMTVPKGTLFPMCGMNLAFDRDLIGPAM  132

Query  188  SPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRKERGNAIESLKKEW  367
               F L  +G       +D+W+G C+KV+CDHL LGVK+GLPY+W  +  N   +LKKE+
Sbjct  133  Y--FGLMGDGQ-PIGRYDDMWAGWCMKVICDHLSLGVKTGLPYIWHSKASNPFVNLKKEY  189

Query  368  EGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEWVEL  547
            +G+   E+I+PFFQ+  +  +  TV+ C   +A  V+E+LGK  P F + ADAMV W+E 
Sbjct  190  KGIFWQEDIIPFFQNATIPKECDTVQKCYLSLAEQVREKLGKIDPYFVKLADAMVTWIEA  249

Query  548  WNDVK  562
            W+++ 
Sbjct  250  WDELN  254



>ref|XP_006365656.1| PREDICTED: alpha-1,4-glucan-protein synthase [UDP-forming] 2-like 
[Solanum tuberosum]
Length=352

 Score =   206 bits (525),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 96/182 (53%), Positives = 128/182 (70%), Gaps = 3/182 (2%)
 Frame = +2

Query  8    ALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGPAL  187
            A+S GLWLN+ DYDAPTQ +KP +RN+RYVD VLT+P   L P+ G+N+AFDREL+GPA+
Sbjct  159  AVSHGLWLNIPDYDAPTQLVKPLERNTRYVDMVLTIPKGTLFPMCGMNLAFDRELIGPAM  218

Query  188  SPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRKERGNAIESLKKEW  367
               F L  +G       +D+W+G C KV+CDHLGLG+K+GLPY++  +  N   +LKKE+
Sbjct  219  --YFGLMGDGQ-PIGRYDDMWAGWCCKVICDHLGLGIKTGLPYIYHSKASNPFVNLKKEY  275

Query  368  EGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEWVEL  547
             G+   EEI+PFFQS   S   TTV+ C  E++  VKE+LGK  P F + ADAMV W+E 
Sbjct  276  LGIFWQEEIIPFFQSHNFSKDCTTVQKCYVELSKQVKEKLGKVDPYFLKLADAMVTWIEA  335

Query  548  WN  553
            W+
Sbjct  336  WD  337



>ref|XP_006850293.1| hypothetical protein AMTR_s00020p00173350 [Amborella trichopoda]
 gb|ERN11874.1| hypothetical protein AMTR_s00020p00173350 [Amborella trichopoda]
Length=357

 Score =   206 bits (525),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 103/188 (55%), Positives = 129/188 (69%), Gaps = 4/188 (2%)
 Frame = +2

Query  2    SCALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGP  181
            S ALSCGLW+ + DYDAPT  +K    NSR V+AV+TVP  A  PVSG+N+AFD+ L+G 
Sbjct  164  STALSCGLWVGLPDYDAPTALVKAGLTNSRCVNAVMTVPRGAFFPVSGVNLAFDKSLIGV  223

Query  182  ALSPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRKERGN--AIESL  355
            A+     L  +G  R+ET+ED+W+G+C K +CDHLG G KSGLPYV R++ G   A+E+L
Sbjct  224  AMFSG--LLMQGKTRYETLEDIWAGLCAKAICDHLGYGAKSGLPYVVRRKGGGSEALEAL  281

Query  356  KKEWEGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVE  535
            KKEW+GVK MEE++PFFQSL L   A T EDC+ EIA  VK  LG     F  AA AM +
Sbjct  282  KKEWKGVKWMEEVLPFFQSLTLPRTAVTAEDCILEIAKNVKVGLGGVDAAFVHAAVAMED  341

Query  536  WVELWNDV  559
            WV  W  V
Sbjct  342  WVRAWKSV  349



>ref|XP_004982467.1| PREDICTED: alpha-1,4-glucan-protein synthase [UDP-forming]-like 
[Setaria italica]
Length=364

 Score =   206 bits (525),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 93/185 (50%), Positives = 133/185 (72%), Gaps = 3/185 (2%)
 Frame = +2

Query  8    ALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGPAL  187
            A+S GLWLN+ DYDAPTQ +KPK+RN RYVDAV+T+P   L P+ G+N+AFDR+L+GPA+
Sbjct  171  AVSHGLWLNIPDYDAPTQLVKPKERNERYVDAVMTIPKGTLFPMCGMNLAFDRDLIGPAM  230

Query  188  SPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRKERGNAIESLKKEW  367
               F L  +G       +D+W+G CVKV+CDHL LGVK+GLPY+W  +  N   +LKKE+
Sbjct  231  Y--FGLMGDGQ-PIGRYDDMWAGWCVKVICDHLSLGVKTGLPYIWHSKASNPFVNLKKEY  287

Query  368  EGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEWVEL  547
            +G+   E+I+PFFQ++ +  +  TV+ C   ++  VKE+LGK  P F++ ADAMV W+E 
Sbjct  288  KGIFWQEDIIPFFQNVTIPKECDTVQKCYIYLSGQVKEKLGKIDPYFAKLADAMVTWIEA  347

Query  548  WNDVK  562
            W+++ 
Sbjct  348  WDELN  352



>sp|Q8RU27.1|UPTG2_SOLTU RecName: Full=Alpha-1,4-glucan-protein synthase [UDP-forming] 
2; AltName: Full=Reversibly glycosylated polypeptide 2; Short=RGP2; 
AltName: Full=UDP-glucose:protein transglucosylase 
2; Short=UPTG 2 [Solanum tuberosum]
 emb|CAC84517.1| UDP-Glucose:protein transglucosylase [Solanum tuberosum]
Length=366

 Score =   206 bits (525),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 94/187 (50%), Positives = 133/187 (71%), Gaps = 3/187 (2%)
 Frame = +2

Query  2    SCALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGP  181
            + A+S GLWLN+ DYDAPTQ +KP++RN+RYVDAV+T+P   L P+ G+N+AFDREL+GP
Sbjct  163  ATAVSHGLWLNIPDYDAPTQLVKPRERNTRYVDAVMTIPKGTLFPMCGMNLAFDRELIGP  222

Query  182  ALSPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRKERGNAIESLKK  361
            A+   F L  +G       +D+W+G C+KV+CDHLGLGVK+GLPY+W  +  N   +LKK
Sbjct  223  AM--YFGLMGDGQ-PIGRYDDMWAGWCIKVICDHLGLGVKTGLPYIWHSKASNPFVNLKK  279

Query  362  EWEGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEWV  541
            E++G+   EEI+PF QS  L    T+V+ C  E++  VKE+L    P F++ ADAMV W+
Sbjct  280  EYKGIYWQEEIIPFSQSATLPKDCTSVQQCYLELSKQVKEKLSTIDPYFTKLADAMVTWI  339

Query  542  ELWNDVK  562
            E W+++ 
Sbjct  340  EAWDELN  346



>ref|XP_011011707.1| PREDICTED: alpha-1,4-glucan-protein synthase [UDP-forming] 2 
[Populus euphratica]
Length=358

 Score =   206 bits (524),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 94/186 (51%), Positives = 133/186 (72%), Gaps = 3/186 (2%)
 Frame = +2

Query  8    ALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGPAL  187
            A+S GLWLN+ DYDAPTQ +KP++RN+RYVDAVLTVP   L P+ G+N+ F+REL+GPA+
Sbjct  165  AVSHGLWLNIPDYDAPTQLVKPRERNTRYVDAVLTVPKGTLFPMCGMNLGFNRELIGPAM  224

Query  188  SPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRKERGNAIESLKKEW  367
               F L  +G       +D+W+G C+KV+CDH+G GVK+GLPY+W  +  N   +LKKE+
Sbjct  225  --YFGLMGDGQ-PIGRYDDMWAGWCMKVICDHMGWGVKTGLPYIWHSKASNPFVNLKKEY  281

Query  368  EGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEWVEL  547
            +G+   E+++PFFQS  L  +  TV+ C  E+A  VKE+LGK  P F + ADAMV W+E 
Sbjct  282  KGIYWQEDLIPFFQSAVLPKECVTVQQCYIELAKQVKEKLGKVDPYFIKLADAMVTWIEA  341

Query  548  WNDVKT  565
            W+++ +
Sbjct  342  WDELNS  347



>ref|XP_002316078.1| REVERSIBLY GLYCOSYLATED POLYPEPTIDE 3 family protein [Populus 
trichocarpa]
 gb|EEF02249.1| REVERSIBLY GLYCOSYLATED POLYPEPTIDE 3 family protein [Populus 
trichocarpa]
Length=358

 Score =   206 bits (524),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 94/186 (51%), Positives = 133/186 (72%), Gaps = 3/186 (2%)
 Frame = +2

Query  8    ALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGPAL  187
            A+S GLWLN+ DYDAPTQ +KP++RN+RYVDAVLTVP   L P+ G+N+ F+REL+GPA+
Sbjct  165  AVSHGLWLNIPDYDAPTQLVKPRERNTRYVDAVLTVPKGTLFPMCGMNLGFNRELIGPAM  224

Query  188  SPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRKERGNAIESLKKEW  367
               F L  +G       +D+W+G C+KV+CDH+G GVK+GLPY+W  +  N   +LKKE+
Sbjct  225  --YFGLMGDGQ-PIGRYDDMWAGWCMKVICDHMGWGVKTGLPYIWHSKASNPFVNLKKEY  281

Query  368  EGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEWVEL  547
            +G+   E+++PFFQS  L  +  TV+ C  E+A  VKE+LGK  P F + ADAMV W+E 
Sbjct  282  KGIYWQEDLIPFFQSAVLPKECVTVQQCYIELAKQVKEKLGKVDPYFIKLADAMVTWIEA  341

Query  548  WNDVKT  565
            W+++ +
Sbjct  342  WDELNS  347



>ref|XP_006437885.1| hypothetical protein CICLE_v10031914mg [Citrus clementina]
 ref|XP_006484235.1| PREDICTED: alpha-1,4-glucan-protein synthase [UDP-forming] 2-like 
[Citrus sinensis]
 gb|ESR51125.1| hypothetical protein CICLE_v10031914mg [Citrus clementina]
Length=361

 Score =   206 bits (524),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 96/190 (51%), Positives = 134/190 (71%), Gaps = 3/190 (2%)
 Frame = +2

Query  8    ALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGPAL  187
            A+S GLWLN+ DYDAPTQ +KP++RN+RYVDAVLTVP   L P+ G+N+AFDREL+GPA+
Sbjct  165  AVSHGLWLNIPDYDAPTQLVKPRERNTRYVDAVLTVPKGTLFPMCGMNLAFDRELIGPAM  224

Query  188  SPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRKERGNAIESLKKEW  367
               F L  +G       +D+W+G C+KV+CDH+G GVK+GLPY+W  +  N   +LKKE+
Sbjct  225  --YFGLMGDGQ-PIGRYDDMWAGWCMKVICDHMGWGVKTGLPYIWHSKASNPFVNLKKEY  281

Query  368  EGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEWVEL  547
            +G+   EE++PFFQS  L  + TTV+ C  E+A  VK +L K  P F + A+AMV W+E 
Sbjct  282  KGIYWQEELIPFFQSCVLPKECTTVQQCYLELAKQVKAKLSKVDPYFDKLAEAMVTWIEA  341

Query  548  WNDVKTQ*TN  577
            W+++ +   N
Sbjct  342  WDELNSAGQN  351



>ref|XP_004144170.1| PREDICTED: alpha-1,4-glucan-protein synthase [UDP-forming]-like 
[Cucumis sativus]
 ref|XP_004168668.1| PREDICTED: alpha-1,4-glucan-protein synthase [UDP-forming]-like 
[Cucumis sativus]
 gb|KGN47655.1| hypothetical protein Csa_6G366530 [Cucumis sativus]
Length=358

 Score =   206 bits (524),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 95/186 (51%), Positives = 135/186 (73%), Gaps = 3/186 (2%)
 Frame = +2

Query  8    ALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGPAL  187
            A+S GLWLN+ DYDAPTQ +KP++RNSRYVDAVLT+P   L P+ G+N+AF+REL+GPA+
Sbjct  165  AVSHGLWLNIPDYDAPTQLVKPRERNSRYVDAVLTIPKGTLFPMCGMNLAFNRELIGPAM  224

Query  188  SPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRKERGNAIESLKKEW  367
               F L  +G       +D+W+G CVKV+CDHLG GVK+GLPY+W  +  N   +LKKE+
Sbjct  225  --YFGLMGDGQ-PIGRYDDMWAGWCVKVICDHLGWGVKTGLPYIWHSKASNPFVNLKKEY  281

Query  368  EGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEWVEL  547
            +G+   E+I+PFFQS+ L  + TTV+ C  E++  VKE+LG   P F + ++AMV W+E 
Sbjct  282  KGIFWQEDIIPFFQSVVLPKECTTVQKCYIELSKLVKEKLGPIDPYFLKLSEAMVTWIEA  341

Query  548  WNDVKT  565
            W+++ +
Sbjct  342  WDELNS  347



>gb|KDO70314.1| hypothetical protein CISIN_1g018080mg [Citrus sinensis]
Length=361

 Score =   206 bits (524),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 96/190 (51%), Positives = 134/190 (71%), Gaps = 3/190 (2%)
 Frame = +2

Query  8    ALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGPAL  187
            A+S GLWLN+ DYDAPTQ +KP++RN+RYVDAVLTVP   L P+ G+N+AFDREL+GPA+
Sbjct  165  AVSHGLWLNIPDYDAPTQLVKPRERNTRYVDAVLTVPKGTLFPMCGMNLAFDRELIGPAM  224

Query  188  SPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRKERGNAIESLKKEW  367
               F L  +G       +D+W+G C+KV+CDH+G GVK+GLPY+W  +  N   +LKKE+
Sbjct  225  --YFGLMGDGQ-PIGRYDDMWAGWCMKVICDHMGWGVKTGLPYIWHSKASNPFVNLKKEY  281

Query  368  EGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEWVEL  547
            +G+   EE++PFFQS  L  + TTV+ C  E+A  VK +L K  P F + A+AMV W+E 
Sbjct  282  KGIYWQEELIPFFQSCVLPKECTTVQQCYLELAKQVKAKLSKVDPYFDKLAEAMVTWIEA  341

Query  548  WNDVKTQ*TN  577
            W+++ +   N
Sbjct  342  WDELNSAGQN  351



>gb|EYU23070.1| hypothetical protein MIMGU_mgv1a008625mg [Erythranthe guttata]
Length=367

 Score =   206 bits (524),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 94/186 (51%), Positives = 134/186 (72%), Gaps = 3/186 (2%)
 Frame = +2

Query  8    ALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGPAL  187
            A+S GLWLN+ DYDAPTQ +KP +RN+RYVDAVLT+P   L P+ G+N+ F+REL+GPA+
Sbjct  165  AVSHGLWLNIPDYDAPTQLVKPLERNTRYVDAVLTIPKGTLFPMCGMNLGFNRELIGPAM  224

Query  188  SPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRKERGNAIESLKKEW  367
               F L  +G       +D+W+G C KV+ DHLGLGVK+GLPY+W  +  N   +LKKE+
Sbjct  225  --YFGLMGDGQ-PIGRYDDMWAGWCTKVITDHLGLGVKTGLPYIWHSKASNPFVNLKKEY  281

Query  368  EGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEWVEL  547
            +G+   EEI+PFFQS+ LS ++TTV+ C  E++  VKE+LG   P F + ++AMV W+E 
Sbjct  282  KGIYWQEEIIPFFQSVVLSKESTTVQKCYIELSKMVKEKLGPIDPYFVKLSEAMVTWIEA  341

Query  548  WNDVKT  565
            W+++ +
Sbjct  342  WDEINS  347



>gb|ABK94330.1| unknown [Populus trichocarpa]
Length=358

 Score =   206 bits (523),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 94/186 (51%), Positives = 133/186 (72%), Gaps = 3/186 (2%)
 Frame = +2

Query  8    ALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGPAL  187
            A+S GLWLN+ DYDAPTQ +KP++RN+RYVDAVLTVP   L P+ G+N+ F+REL+GPA+
Sbjct  165  AVSHGLWLNIPDYDAPTQLVKPRERNTRYVDAVLTVPKGTLFPMCGMNLGFNRELIGPAM  224

Query  188  SPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRKERGNAIESLKKEW  367
               F L  +G       +D+W+G C+KV+CDH+G GVK+GLPY+W  +  N   +LKKE+
Sbjct  225  --YFGLMGDGQ-PIGRYDDMWAGWCMKVICDHMGWGVKTGLPYIWNSKASNPFVNLKKEY  281

Query  368  EGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEWVEL  547
            +G+   E+++PFFQS  L  +  TV+ C  E+A  VKE+LGK  P F + ADAMV W+E 
Sbjct  282  KGIYWQEDLIPFFQSAVLPKECVTVQQCYIELAKQVKEKLGKVDPYFIKLADAMVTWIEA  341

Query  548  WNDVKT  565
            W+++ +
Sbjct  342  WDELNS  347



>ref|XP_002458535.1| hypothetical protein SORBIDRAFT_03g035320 [Sorghum bicolor]
 gb|EES03655.1| hypothetical protein SORBIDRAFT_03g035320 [Sorghum bicolor]
Length=353

 Score =   206 bits (523),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 93/186 (50%), Positives = 133/186 (72%), Gaps = 3/186 (2%)
 Frame = +2

Query  8    ALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGPAL  187
            A+S GLWLN+ DYDAPTQ +KP++RN RYV+AV+T+P   L P+ G+N+AFDR+L+GPA+
Sbjct  158  AVSHGLWLNIPDYDAPTQLVKPRERNERYVNAVMTIPKGTLFPMCGMNLAFDRDLIGPAM  217

Query  188  SPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRKERGNAIESLKKEW  367
               F L  +G       +D+W+G CVKV+CDHLGLGVK+GLPY+W  +  N   +LKKE+
Sbjct  218  Y--FGLMGDGQ-PIGRYDDMWAGWCVKVICDHLGLGVKTGLPYIWHSKASNPFVNLKKEY  274

Query  368  EGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEWVEL  547
            +G+   E+I+PFFQ++ L     TV+ C   ++  VKE+LGK  P F++ ADAMV W+E 
Sbjct  275  KGIFWQEDIIPFFQAVVLPKDCDTVQKCYIALSQQVKEKLGKVDPYFTKLADAMVTWIEA  334

Query  548  WNDVKT  565
            W+ + +
Sbjct  335  WDSLNS  340



>ref|XP_004304212.1| PREDICTED: alpha-1,4-glucan-protein synthase [UDP-forming] 2-like 
[Fragaria vesca subsp. vesca]
Length=356

 Score =   206 bits (523),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 94/185 (51%), Positives = 133/185 (72%), Gaps = 3/185 (2%)
 Frame = +2

Query  8    ALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGPAL  187
            A+S GLWLN+ DYDAPTQ +KP +RN+RYVDAVLT+P   L P+ G+N+AFDR+L+GPA+
Sbjct  161  AVSHGLWLNIPDYDAPTQLVKPLERNTRYVDAVLTIPKGTLFPMCGMNLAFDRDLIGPAM  220

Query  188  SPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRKERGNAIESLKKEW  367
               F L  +G       +D+W+G C+KV+CDHLGLGVK+GLPY++  +  N   +L+KE+
Sbjct  221  Y--FGLMGDGQ-PIGRYDDMWAGWCIKVICDHLGLGVKTGLPYIYHSKASNPFVNLRKEY  277

Query  368  EGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEWVEL  547
            +G+   EEI+PFFQ+  L    TTV+ C  E++  VK++LGK  P F + ADAMV W+E 
Sbjct  278  KGIFWQEEIIPFFQAAVLPKDCTTVQACYVELSKQVKDKLGKVDPYFDKLADAMVTWIEA  337

Query  548  WNDVK  562
            W+++ 
Sbjct  338  WDELN  342



>ref|XP_004233392.1| PREDICTED: UDP-arabinopyranose mutase 1-like [Solanum lycopersicum]
Length=359

 Score =   206 bits (523),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 96/182 (53%), Positives = 128/182 (70%), Gaps = 3/182 (2%)
 Frame = +2

Query  8    ALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGPAL  187
            A+S GLWLN+ DYDAPTQ +KP +RN+RYVD VLT+P   L P+ G+N+AFDREL+GPA+
Sbjct  159  AVSHGLWLNIPDYDAPTQLVKPLERNTRYVDMVLTIPKGTLFPMCGMNLAFDRELIGPAM  218

Query  188  SPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRKERGNAIESLKKEW  367
               F L  +G       +D+W+G C KV+CDHLGLG+K+GLPY++  +  N   +LKKE+
Sbjct  219  --YFGLMGDGQ-PIGRYDDMWAGWCCKVICDHLGLGIKTGLPYIYHSKASNPFVNLKKEY  275

Query  368  EGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEWVEL  547
             G+   EEI+PFFQS   S   TTV+ C  E++  VKE+LGK  P F + ADAMV W+E 
Sbjct  276  LGIFWQEEIIPFFQSHIFSKDCTTVQKCYVELSKHVKEKLGKVDPYFVKLADAMVTWIEA  335

Query  548  WN  553
            W+
Sbjct  336  WD  337



>ref|XP_003562308.1| PREDICTED: UDP-arabinopyranose mutase 1 [Brachypodium distachyon]
Length=369

 Score =   206 bits (523),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 95/185 (51%), Positives = 132/185 (71%), Gaps = 3/185 (2%)
 Frame = +2

Query  8    ALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGPAL  187
            A+S GLWLN+ DYDAPTQ +KP++RNSRYVDAVLT+P   L P+ G+N+AFDR L+GPA+
Sbjct  171  AVSHGLWLNIPDYDAPTQMVKPRERNSRYVDAVLTIPKGTLFPMCGMNLAFDRTLIGPAM  230

Query  188  SPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRKERGNAIESLKKEW  367
               F L  +G       +D+W+G CVKV+CDHL LGVK+GLPY+W  +  N   +LKKE+
Sbjct  231  --YFGLMGDGQ-PIGRYDDMWAGWCVKVICDHLSLGVKTGLPYLWHSKASNPFVNLKKEY  287

Query  368  EGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEWVEL  547
            +G+   E+I+PFFQ+  LS +  TV+ C   ++  V+E+LGK  P F + ADAMV W+E 
Sbjct  288  KGIFWQEDIIPFFQNATLSKECDTVQKCYISLSEQVREKLGKIDPYFVKLADAMVTWIEA  347

Query  548  WNDVK  562
            W+++ 
Sbjct  348  WDELN  352



>ref|XP_009599670.1| PREDICTED: alpha-1,4-glucan-protein synthase [UDP-forming] 2-like 
[Nicotiana tomentosiformis]
Length=359

 Score =   206 bits (523),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 90/187 (48%), Positives = 134/187 (72%), Gaps = 3/187 (2%)
 Frame = +2

Query  2    SCALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGP  181
            + A+S GLWLN+ DYDAPTQ +KP++RN+RYVDAV+T+P   L P+ G+N+AF+REL+GP
Sbjct  159  ATAVSHGLWLNIPDYDAPTQLVKPRERNTRYVDAVMTIPKGTLFPMCGMNLAFNRELIGP  218

Query  182  ALSPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRKERGNAIESLKK  361
            A+   F L  +G       +D+W+G C KV+CDH GLG+K+GLPY+W  +  N   +LKK
Sbjct  219  AM--YFGLMGDGQ-PIGRYDDMWAGWCTKVICDHFGLGIKTGLPYIWHSKASNPFVNLKK  275

Query  362  EWEGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEWV  541
            E++G+   EEI+PFFQ++ L  + TTV++C  E+A  VK++L    P F++ A+AM  W+
Sbjct  276  EYKGIYWQEEIIPFFQTVTLPKECTTVQECYIELAKQVKDKLSNIDPYFTKLAEAMTTWI  335

Query  542  ELWNDVK  562
            E W+++ 
Sbjct  336  EAWDELN  342



>ref|XP_008346784.1| PREDICTED: alpha-1,4-glucan-protein synthase [UDP-forming] 2-like 
[Malus domestica]
Length=261

 Score =   202 bits (515),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 95/184 (52%), Positives = 131/184 (71%), Gaps = 3/184 (2%)
 Frame = +2

Query  8    ALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGPAL  187
            A+S GLWLN+ DYDAPTQ +KP++RN+R+VDAVLT+P   L P+ G+N+AFDREL+G A+
Sbjct  65   AVSHGLWLNIPDYDAPTQLVKPRERNTRFVDAVLTIPKGTLFPMCGMNLAFDRELIGXAM  124

Query  188  SPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRKERGNAIESLKKEW  367
               F L  +G       +D+W+G C+KV+CDHLGLGVK+GLPY+W  +  N   +LKKE+
Sbjct  125  Y--FGLMGDGQ-PIGRYDDMWAGWCMKVICDHLGLGVKTGLPYIWHSKASNPFVNLKKEY  181

Query  368  EGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEWVEL  547
            +G+   EE++PFFQS  L    TTV+ C  E++  VK +LGK    F + ADAMV WVE 
Sbjct  182  KGIYWQEELIPFFQSATLPKDCTTVQGCYLELSKQVKAKLGKVDEYFVKLADAMVTWVEA  241

Query  548  WNDV  559
            W+++
Sbjct  242  WDEL  245



>ref|XP_011078650.1| PREDICTED: alpha-1,4-glucan-protein synthase [UDP-forming] 1-like 
[Sesamum indicum]
Length=356

 Score =   205 bits (522),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 93/185 (50%), Positives = 132/185 (71%), Gaps = 3/185 (2%)
 Frame = +2

Query  8    ALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGPAL  187
            A+S GLWLN+ DYDAPTQ +KP++RN+RYVDAVLT+P   + P+ G+N+AF+R+L+GPA+
Sbjct  163  AVSHGLWLNIPDYDAPTQLVKPRERNTRYVDAVLTIPKGTIFPMCGMNLAFNRDLIGPAM  222

Query  188  SPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRKERGNAIESLKKEW  367
               F L  +G       +D+W+G C KV+CDHL LGVK+GLPY+W  +  N   +LKKE+
Sbjct  223  --YFGLMGDGQ-PIGRYDDMWAGWCTKVICDHLNLGVKTGLPYIWHSKASNPFVNLKKEY  279

Query  368  EGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEWVEL  547
            +G+   EEI+PFFQS+ L  + TTV+ C  E+A  VK +L    P F++ ADAMV W+E 
Sbjct  280  KGIYWQEEIIPFFQSVTLPKECTTVQQCYIELAKLVKAKLSSVDPYFTKLADAMVTWIEA  339

Query  548  WNDVK  562
            W+++ 
Sbjct  340  WDELN  344



>gb|EMT17982.1| Alpha-1,4-glucan-protein synthase (UDP-forming) 1 [Aegilops tauschii]
Length=385

 Score =   206 bits (524),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 95/185 (51%), Positives = 133/185 (72%), Gaps = 3/185 (2%)
 Frame = +2

Query  8    ALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGPAL  187
            A+S GLWLN+ DYDAPTQ +KP++RN+RYVDAVLT+P   L P+ G+N+AFDREL+GPA+
Sbjct  135  AVSHGLWLNIPDYDAPTQLVKPRERNNRYVDAVLTIPKGTLFPMCGMNLAFDRELIGPAM  194

Query  188  SPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRKERGNAIESLKKEW  367
               F L  +G       +D+W+G C KV+ DHL LG+K+GLPY+W  +  N   +LKKE+
Sbjct  195  --YFGLMGDGQ-PIGRYDDMWAGWCTKVITDHLSLGIKTGLPYIWHSKASNPFVNLKKEY  251

Query  368  EGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEWVEL  547
             G+   EE++PFFQS+ LS +ATTV+ C  E+A  V+ +LGK    F++ ADAMV W+E 
Sbjct  252  NGIFWQEELIPFFQSVTLSKEATTVQKCYLELAKQVRAKLGKVDGYFNKLADAMVTWIEA  311

Query  548  WNDVK  562
            W+++ 
Sbjct  312  WDELN  316



>gb|EYU23625.1| hypothetical protein MIMGU_mgv1a008906mg [Erythranthe guttata]
Length=359

 Score =   205 bits (522),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 95/185 (51%), Positives = 130/185 (70%), Gaps = 3/185 (2%)
 Frame = +2

Query  8    ALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGPAL  187
            A+S GLWLN+ DYDAPTQ +KP +RN+RYVD VLT+P   L P+ G+N+AF+REL+GPA+
Sbjct  164  AISHGLWLNIPDYDAPTQLVKPLERNTRYVDTVLTIPKGTLFPMCGMNLAFNRELIGPAM  223

Query  188  SPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRKERGNAIESLKKEW  367
               F L  +G       +D+W+G C KV+CDHLGLGVK+GLPY+W  +  N   +LKKE+
Sbjct  224  --YFGLMGDGQ-PIGRYDDMWAGWCTKVICDHLGLGVKTGLPYIWHSKASNPFVNLKKEY  280

Query  368  EGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEWVEL  547
            +G+   EE++PFFQS+ L    TTV+ C  EI+  VK +LGK    F++ ADAMV W+E 
Sbjct  281  KGIYWQEELIPFFQSVALPKDCTTVQKCYIEISKQVKAKLGKVDDYFNKLADAMVTWIEA  340

Query  548  WNDVK  562
            W+ + 
Sbjct  341  WDQLN  345



>dbj|BAC43271.1| putative reversibly glycosylated polypeptide-3 RGP [Arabidopsis 
thaliana]
Length=203

 Score =   200 bits (509),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 93/186 (50%), Positives = 129/186 (69%), Gaps = 3/186 (2%)
 Frame = +2

Query  8    ALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGPAL  187
            A+S GLWLN+ DYDAPTQ +KP ++NSRYVDAV+T+P   L P+ G+N+AFDREL+GPA+
Sbjct  8    AVSHGLWLNIPDYDAPTQLVKPLEKNSRYVDAVMTIPKGTLFPMCGMNLAFDRELIGPAM  67

Query  188  SPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRKERGNAIESLKKEW  367
               F L  +G       +D+W+G CVKV+CDH+G GVK+GLPY+W  +  N   +LKKE+
Sbjct  68   Y--FGLMGDGQPI-GRYDDMWAGWCVKVICDHMGWGVKTGLPYIWHSKASNPFVNLKKEY  124

Query  368  EGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEWVEL  547
             G+   EE +PFFQS+ L  + T+V+ C  E+A  V+E+LGK  P F   A  MV W+E 
Sbjct  125  NGIFWQEEAIPFFQSVTLPKECTSVQQCYLELAKLVREKLGKVDPYFITLATGMVTWIEA  184

Query  548  WNDVKT  565
            W ++ +
Sbjct  185  WEELNS  190



>ref|XP_008464578.1| PREDICTED: alpha-1,4-glucan-protein synthase [UDP-forming] 2-like 
[Cucumis melo]
Length=359

 Score =   205 bits (522),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 94/185 (51%), Positives = 132/185 (71%), Gaps = 3/185 (2%)
 Frame = +2

Query  8    ALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGPAL  187
            A+S GLWLN+ DYDAPTQ +KP +RN+R+VDAVLT+P   L P+ G+N+AFDR+L+GPA+
Sbjct  165  AVSHGLWLNIPDYDAPTQLVKPLERNTRFVDAVLTIPKGTLFPMCGMNLAFDRDLIGPAM  224

Query  188  SPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRKERGNAIESLKKEW  367
               F L  +G       +D+W+G CVKV+CDHLGLGVK+GLPY++  +  N   +L+KE+
Sbjct  225  Y--FGLMGDGQ-PIGRYDDMWAGWCVKVICDHLGLGVKTGLPYIYHSKASNPFVNLRKEY  281

Query  368  EGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEWVEL  547
            +G+   E+I+PFFQ + L    TTV+ C  E+A  VK++L K  P F + ADAMV W+E 
Sbjct  282  KGIFWQEDIIPFFQQVVLPKDCTTVQKCYIELAKQVKDKLSKVDPYFDKLADAMVTWIEA  341

Query  548  WNDVK  562
            W+D+ 
Sbjct  342  WDDLN  346



>ref|XP_002511153.1| Alpha-1,4-glucan-protein synthase [UDP-forming], putative [Ricinus 
communis]
 gb|EEF51755.1| Alpha-1,4-glucan-protein synthase [UDP-forming], putative [Ricinus 
communis]
Length=362

 Score =   205 bits (522),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 93/188 (49%), Positives = 133/188 (71%), Gaps = 3/188 (2%)
 Frame = +2

Query  2    SCALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGP  181
            + A+S GLWLN+ DYDAPTQ +KP +RN+RYVDAVLT+P   L P+ G+N+AF+REL+GP
Sbjct  163  ATAISHGLWLNIPDYDAPTQLVKPLERNTRYVDAVLTIPKGTLFPMCGMNLAFNRELIGP  222

Query  182  ALSPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRKERGNAIESLKK  361
            A+   F L  +G       +D+W+G C KV+CDHL LGVK+GLPY+W  +  N   +LKK
Sbjct  223  AMY--FGLMGDGQ-PIGRYDDMWAGWCAKVICDHLDLGVKTGLPYIWHSKASNPFVNLKK  279

Query  362  EWEGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEWV  541
            E++G+   E+I+PFFQS+ L  +  TV+ C  E++  VKE+LG   P F++  DAMV W+
Sbjct  280  EYKGIYWQEDIIPFFQSVALPKECNTVQKCYIELSKLVKEKLGHIDPYFTKLGDAMVTWI  339

Query  542  ELWNDVKT  565
            E W+++ +
Sbjct  340  EAWDELNS  347



>ref|XP_009772308.1| PREDICTED: alpha-1,4-glucan-protein synthase [UDP-forming] 1 
[Nicotiana sylvestris]
Length=362

 Score =   205 bits (522),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 92/185 (50%), Positives = 130/185 (70%), Gaps = 3/185 (2%)
 Frame = +2

Query  8    ALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGPAL  187
            A+S GLWLN+ DYDAPTQ +KP +RN+RYVDAV+T+P   L P+ G+N+AFDREL+GPA+
Sbjct  161  AVSHGLWLNIPDYDAPTQLVKPHERNTRYVDAVMTIPKGTLFPMCGMNLAFDRELIGPAM  220

Query  188  SPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRKERGNAIESLKKEW  367
               F L  +G       +D+W+G C KV+CDHLGLG+K+GLPY+W  +  N   +LKKE+
Sbjct  221  Y--FGLMGDGQ-PIGRYDDMWAGWCTKVICDHLGLGIKTGLPYIWHSKASNPFVNLKKEY  277

Query  368  EGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEWVEL  547
             G+   EEI+PFFQ+  L  +  TV+ C  E++  VK++L K  P F++  DAMV W+E 
Sbjct  278  NGIFWQEEIIPFFQAATLPKECKTVQQCYLELSKQVKDKLSKIDPYFTKLGDAMVTWIEA  337

Query  548  WNDVK  562
            W+++ 
Sbjct  338  WDELN  342



>ref|XP_010455418.1| PREDICTED: UDP-arabinopyranose mutase 3-like [Camelina sativa]
Length=356

 Score =   205 bits (521),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 99/186 (53%), Positives = 130/186 (70%), Gaps = 4/186 (2%)
 Frame = +2

Query  11   LSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGPALS  190
            +S GLWLNM DYDAPTQ +KP +RNSRYVDAV+T+P   L P+ G+N+AFDREL+GPA+ 
Sbjct  168  VSHGLWLNMPDYDAPTQLVKPLERNSRYVDAVMTIPKGTLFPMCGMNLAFDRELIGPAM-  226

Query  191  PAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWR-KERGNAIESLKKEW  367
              F L   G       +D+W+G CVKV+CDH+G GVK+GLPYVW  K   N +E+L+KE+
Sbjct  227  -YFGLMGHGQ-PIGGYDDMWAGWCVKVICDHMGWGVKTGLPYVWHSKASCNRLENLEKEY  284

Query  368  EGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEWVEL  547
             G+   EE +PFFQS+ L  + T+V+ C  E+A  VKE+LGK  P F + AD MV W E 
Sbjct  285  NGIFWQEEAIPFFQSVALPNECTSVQQCYLELAKQVKEKLGKVDPYFIKLADGMVTWTEA  344

Query  548  WNDVKT  565
            W ++ T
Sbjct  345  WEELNT  350



>emb|CBI27314.3| unnamed protein product [Vitis vinifera]
Length=269

 Score =   202 bits (514),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 93/185 (50%), Positives = 131/185 (71%), Gaps = 3/185 (2%)
 Frame = +2

Query  8    ALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGPAL  187
            A+S GLWLN+ DYDAPTQ +KP++RN+RYVDAVLTVP   L P+ G+N+AF+REL+GPA+
Sbjct  73   AVSHGLWLNIPDYDAPTQLVKPRERNTRYVDAVLTVPKGTLFPMCGMNLAFNRELIGPAM  132

Query  188  SPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRKERGNAIESLKKEW  367
               F L  +G       +D+W+G C+KV+CDHLG GVK+GLPY+W  +  N   +LKKE+
Sbjct  133  Y--FGLMGDGQ-PIGRYDDMWAGWCMKVICDHLGWGVKTGLPYIWHSKASNPFVNLKKEY  189

Query  368  EGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEWVEL  547
             G+   EE++PFFQ+  L  + TTV+ C  E++  VK +L K  P F + ADAM+ W+E 
Sbjct  190  SGIYWQEELIPFFQAATLPKECTTVQQCYLELSKQVKAKLEKVDPYFVKLADAMITWIEA  249

Query  548  WNDVK  562
            W+++ 
Sbjct  250  WDELN  254



>ref|XP_004958247.1| PREDICTED: UDP-arabinopyranose mutase 3-like [Setaria italica]
Length=361

 Score =   205 bits (521),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 95/185 (51%), Positives = 132/185 (71%), Gaps = 3/185 (2%)
 Frame = +2

Query  8    ALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGPAL  187
            A+S GLWLN+ DYDAPTQ +KP +RN+RYVDA+LT+P   L P+ G+N+AFDREL+GPA+
Sbjct  165  AVSHGLWLNIPDYDAPTQLVKPLERNTRYVDAILTIPKGTLFPMCGMNLAFDRELIGPAM  224

Query  188  SPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRKERGNAIESLKKEW  367
               F L  +G       +D+W+G C KV+ DHLGLGVK+GLPY+W  +  N   +LKKE+
Sbjct  225  Y--FGLMGDGQ-PIGRYDDMWAGWCTKVITDHLGLGVKTGLPYIWHSKASNPFVNLKKEY  281

Query  368  EGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEWVEL  547
             G+   EE++PFFQS+ L  +ATTV+ C  E+A  V+ +LGK    F++ ADAMV W+E 
Sbjct  282  NGIFWQEELIPFFQSVSLPKEATTVQKCYLELAKQVRAKLGKVDGYFNKLADAMVTWIEA  341

Query  548  WNDVK  562
            W+++ 
Sbjct  342  WDELN  346



>ref|XP_011008611.1| PREDICTED: UDP-arabinopyranose mutase 1-like [Populus euphratica]
Length=365

 Score =   205 bits (522),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 94/185 (51%), Positives = 131/185 (71%), Gaps = 3/185 (2%)
 Frame = +2

Query  8    ALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGPAL  187
            A+S GLWLN+ DYDAPTQ +KP +RN+RYVDAVLT+P   L P+ G+N+ FDR+L+GPA+
Sbjct  171  AVSHGLWLNIPDYDAPTQLVKPLERNTRYVDAVLTIPKGTLFPMCGMNLCFDRDLIGPAM  230

Query  188  SPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRKERGNAIESLKKEW  367
               F L  +G       +D+W+G C KV+CDHLGLGVK+GLPY++  +  N   +LKKE+
Sbjct  231  Y--FGLMGDGQ-PIGRYDDMWAGWCTKVICDHLGLGVKTGLPYIYHSKASNPFVNLKKEY  287

Query  368  EGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEWVEL  547
            +G+   EEI+PFFQ+  L    T+V+ C  E++  VKE+LGK  P F + ADAMV W+E 
Sbjct  288  KGIFWQEEIIPFFQAATLPKDCTSVQKCYIELSKQVKEKLGKVDPYFDKLADAMVTWIEA  347

Query  548  WNDVK  562
            W+++ 
Sbjct  348  WDELN  352



>ref|XP_002305394.1| type IIIa membrane protein cp-wap13 [Populus trichocarpa]
 gb|EEE85905.1| type IIIa membrane protein cp-wap13 [Populus trichocarpa]
Length=365

 Score =   205 bits (521),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 94/185 (51%), Positives = 131/185 (71%), Gaps = 3/185 (2%)
 Frame = +2

Query  8    ALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGPAL  187
            A+S GLWLN+ DYDAPTQ +KP +RN+RYVDAVLT+P   L P+ G+N+ FDR+L+GPA+
Sbjct  171  AVSHGLWLNIPDYDAPTQLVKPLERNTRYVDAVLTIPKGTLFPMCGMNLCFDRDLIGPAM  230

Query  188  SPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRKERGNAIESLKKEW  367
               F L  +G       +D+W+G C KV+CDHLGLGVK+GLPY++  +  N   +LKKE+
Sbjct  231  Y--FGLMGDGQ-PIGRYDDMWAGWCTKVICDHLGLGVKTGLPYIYHSKASNPFVNLKKEY  287

Query  368  EGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEWVEL  547
            +G+   EEI+PFFQ+  L    T+V+ C  E++  VKE+LGK  P F + ADAMV W+E 
Sbjct  288  KGIFWQEEIIPFFQAATLPKDCTSVQKCYIELSKQVKEKLGKVDPYFDKLADAMVTWIEA  347

Query  548  WNDVK  562
            W+++ 
Sbjct  348  WDELN  352



>ref|XP_010549987.1| PREDICTED: UDP-arabinopyranose mutase 2-like [Tarenaya hassleriana]
 gb|ABD96835.1| hypothetical protein [Cleome spinosa]
Length=363

 Score =   205 bits (521),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 93/185 (50%), Positives = 133/185 (72%), Gaps = 3/185 (2%)
 Frame = +2

Query  8    ALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGPAL  187
            A+S GLWLN+ DYDAPTQ +KP +RN+RYVDAVLT+P   L P+ G+N+ FDREL+GPA+
Sbjct  171  AVSHGLWLNIPDYDAPTQLVKPMERNTRYVDAVLTIPKGTLFPMCGMNLCFDRELIGPAM  230

Query  188  SPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRKERGNAIESLKKEW  367
               F L  +G       +D+W+G CVKV+CDHLGLGVK+GLPY++  +  N   +LKKE+
Sbjct  231  --YFGLMGDGQ-PIGRYDDMWAGWCVKVICDHLGLGVKTGLPYIYHSKASNPFVNLKKEY  287

Query  368  EGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEWVEL  547
            +G+   EEI+PFFQ+++L  + TTV+ C  E++  VKE+L    P F + ++AMV W+E 
Sbjct  288  KGIFWQEEIIPFFQNVKLPKECTTVQQCYIELSKLVKEKLSTIDPYFDKLSEAMVTWIEA  347

Query  548  WNDVK  562
            W+++ 
Sbjct  348  WDELN  352



>ref|XP_010558513.1| PREDICTED: UDP-arabinopyranose mutase 2 [Tarenaya hassleriana]
 gb|ABD96890.1| hypothetical protein [Cleome spinosa]
Length=364

 Score =   205 bits (521),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 92/184 (50%), Positives = 134/184 (73%), Gaps = 3/184 (2%)
 Frame = +2

Query  8    ALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGPAL  187
            A+S GLWLN+ DYDAPTQ +KPK+RN+RYVDAVLT+P   L P+ G+N+ FDR+L+GPA+
Sbjct  171  AVSHGLWLNIPDYDAPTQLVKPKERNTRYVDAVLTIPKGTLFPMCGMNLCFDRDLIGPAM  230

Query  188  SPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRKERGNAIESLKKEW  367
               F L  +G       +D+W+G CVKV+CDHLGLGVK+GLPY++  +  N   +LKKE+
Sbjct  231  --YFGLMGDGQ-PIGRYDDMWAGWCVKVICDHLGLGVKTGLPYIYHSKASNPFVNLKKEY  287

Query  368  EGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEWVEL  547
            +G+   EEI+PFFQ+++L  + TTV+ C  E++  VKE+L    P F + ++AMV W++ 
Sbjct  288  KGIFWQEEIIPFFQNVKLPKECTTVQQCYMELSKMVKEKLSSIDPYFDKLSEAMVTWIQA  347

Query  548  WNDV  559
            W+++
Sbjct  348  WDEL  351



>ref|XP_009780946.1| PREDICTED: alpha-1,4-glucan-protein synthase [UDP-forming] 2-like 
[Nicotiana sylvestris]
Length=357

 Score =   205 bits (521),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 95/182 (52%), Positives = 128/182 (70%), Gaps = 3/182 (2%)
 Frame = +2

Query  8    ALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGPAL  187
            A+S GLWLN+ DYDAPTQ +KP +RN+RYVD VLT+P   L P+ G+N+AFDREL+GPA+
Sbjct  161  AVSHGLWLNIPDYDAPTQLVKPLERNTRYVDMVLTIPKGTLFPMCGMNLAFDRELIGPAM  220

Query  188  SPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRKERGNAIESLKKEW  367
               F L  +G       +D+W+G C KV+CDHLGLG+K+GLPY++  +  N   +LKKE+
Sbjct  221  --YFGLMGDGQ-PIGRYDDMWAGWCCKVICDHLGLGIKTGLPYIYHSKASNPFVNLKKEY  277

Query  368  EGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEWVEL  547
             G+   EEI+PFFQS   S   T+V+ C  E++  VKE+LGK  P F + ADAMV W+E 
Sbjct  278  LGIFWQEEIIPFFQSHTFSKDCTSVQKCYVELSKQVKEKLGKVDPYFVKLADAMVTWIEA  337

Query  548  WN  553
            W+
Sbjct  338  WD  339



>ref|XP_011085597.1| PREDICTED: alpha-1,4-glucan-protein synthase [UDP-forming] 1-like 
[Sesamum indicum]
Length=357

 Score =   205 bits (521),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 91/182 (50%), Positives = 134/182 (74%), Gaps = 3/182 (2%)
 Frame = +2

Query  8    ALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGPAL  187
            A+S GLWLN+ DYDAPTQ +KP++RN++YVDAV+++P   L P+ G+N+AFDR+L+GPA+
Sbjct  161  AVSHGLWLNIPDYDAPTQLVKPRERNTKYVDAVISIPKGTLFPMCGMNLAFDRDLIGPAM  220

Query  188  SPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRKERGNAIESLKKEW  367
               F L  +G       +D+W+G C KV+CDHLGLGVK+GLPY+W  +  N   +L+KE+
Sbjct  221  --YFGLMGDGQ-PIGRYDDMWAGWCTKVICDHLGLGVKTGLPYIWHSKASNPFVNLRKEY  277

Query  368  EGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEWVEL  547
            +G+   EEI+PFFQ++ LS +ATTV+ C  E++  V+++LGK  P F + ADAM  W++ 
Sbjct  278  KGIFWQEEIIPFFQAVTLSKEATTVQKCYLELSKQVEDKLGKVDPYFVKLADAMETWIQA  337

Query  548  WN  553
            W+
Sbjct  338  WD  339



>gb|KHG14483.1| Alpha-1,4-glucan-protein synthase [UDP-forming] 2 [Gossypium 
arboreum]
Length=362

 Score =   205 bits (521),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 93/185 (50%), Positives = 132/185 (71%), Gaps = 3/185 (2%)
 Frame = +2

Query  8    ALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGPAL  187
            A+S GLWLN+ DYDAPTQ +KP +RN+RYVDA++T+P   L P+ G+N+AF+REL+GPA+
Sbjct  166  AVSHGLWLNIPDYDAPTQLVKPLERNTRYVDAIMTIPKGTLFPMCGMNLAFNRELIGPAM  225

Query  188  SPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRKERGNAIESLKKEW  367
               F L  +G       +D+W+G C KV+CDHLGLGVK+GLPY+W  +  N   +LKKE+
Sbjct  226  --YFGLMGDGQ-PIGRYDDMWAGWCTKVICDHLGLGVKTGLPYIWHSKASNPFVNLKKEY  282

Query  368  EGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEWVEL  547
            +G+   EE++PFFQS+ L    T+V+ C  EI+  VK +LGK    F++ ADAMV W+E 
Sbjct  283  KGIYWQEELIPFFQSVTLPKDCTSVQKCYIEISKQVKAKLGKVDDYFNKLADAMVTWIEA  342

Query  548  WNDVK  562
            W+++ 
Sbjct  343  WDELN  347



>ref|NP_199888.1| reversibly glycosylated polypeptide 4 [Arabidopsis thaliana]
 sp|Q9LUE6.1|RGP4_ARATH RecName: Full=Probable UDP-arabinopyranose mutase 4; AltName: 
Full=Reversibly glycosylated polypeptide 4; Short=AtRGP4; AltName: 
Full=UDP-L-arabinose mutase 4 [Arabidopsis thaliana]
 gb|AAK60126.1|AF329280_1 reversibly glycosylated polypeptide RGP-4 [Arabidopsis thaliana]
 dbj|BAA96988.1| UDP-glucose:protein transglucosylase; reversibly glycosylated 
polypeptide [Arabidopsis thaliana]
 gb|AAO42061.1| putative UDP-glucose:protein transglucosylase [Arabidopsis thaliana]
 gb|AAO50727.1| putative UDP-glucose [Arabidopsis thaliana]
 gb|AED95988.1| reversibly glycosylated polypeptide 4 [Arabidopsis thaliana]
 gb|AHL38583.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=364

 Score =   205 bits (521),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 97/184 (53%), Positives = 130/184 (71%), Gaps = 3/184 (2%)
 Frame = +2

Query  8    ALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGPAL  187
            A+S GLWLN+ DYDAPTQ +KP++RN+RYVDAV+T+P R L P+ G+N+AF+RELVGPA+
Sbjct  167  AISHGLWLNIPDYDAPTQLVKPRERNTRYVDAVMTIPKRVLYPMCGMNLAFNRELVGPAM  226

Query  188  SPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRKERGNAIESLKKEW  367
               F L  EG       +D+W+G   KVVCDHLG GVK+GLPY+W  +  N   +LKKE 
Sbjct  227  --YFGLMGEGQ-PISRYDDMWAGWAAKVVCDHLGFGVKTGLPYLWHSKASNPFVNLKKEH  283

Query  368  EGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEWVEL  547
            +G+   E++VPFFQ+LRLS ++ T   C  EI+   KE+L K  P F + ADAMV W+E 
Sbjct  284  KGLHWQEDMVPFFQNLRLSKESDTAAKCYMEISNMTKEKLTKVDPYFEKLADAMVVWIEA  343

Query  548  WNDV  559
            W ++
Sbjct  344  WEEL  347



>ref|XP_009758723.1| PREDICTED: UDP-arabinopyranose mutase 3 [Nicotiana sylvestris]
Length=366

 Score =   205 bits (521),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 93/185 (50%), Positives = 132/185 (71%), Gaps = 3/185 (2%)
 Frame = +2

Query  8    ALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGPAL  187
            A+S GLWLN+ DYDAPTQ +KP +RN+RYVDAV+T+P   L P+ G+N+AFDREL+GPA+
Sbjct  169  AVSHGLWLNIPDYDAPTQLVKPLERNTRYVDAVMTIPKGTLFPMCGMNLAFDRELIGPAM  228

Query  188  SPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRKERGNAIESLKKEW  367
               F L  +G       +D+W+G C KV+CDHLGLGVK+GLPY+W  +  N   +LKKE+
Sbjct  229  --YFGLMGDGQ-PIGRYDDMWAGWCTKVICDHLGLGVKTGLPYIWHSKASNPFVNLKKEY  285

Query  368  EGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEWVEL  547
            +G+   EE++PFFQS+ L    T+V+ C  E++  VK +LGK    F++ ADAM+ W+E 
Sbjct  286  KGIYWQEELIPFFQSVALPKDCTSVQKCYLELSKQVKAKLGKVDDYFNKLADAMITWIEA  345

Query  548  WNDVK  562
            W+++ 
Sbjct  346  WDELN  350



>ref|XP_011072963.1| PREDICTED: UDP-arabinopyranose mutase 3-like [Sesamum indicum]
Length=359

 Score =   204 bits (520),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 94/185 (51%), Positives = 132/185 (71%), Gaps = 3/185 (2%)
 Frame = +2

Query  8    ALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGPAL  187
            A+S GLWLN+ DYDAPTQ +KP +RN+RYVDAV+TVP   L P+ G+N+AF+REL+GPA+
Sbjct  164  AVSHGLWLNIPDYDAPTQLVKPLERNTRYVDAVMTVPKGTLFPMCGMNLAFNRELIGPAM  223

Query  188  SPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRKERGNAIESLKKEW  367
               F L  +G       +D+W+G C KV+CDHLGLGVK+GLPY+W  +  N   +LKKE+
Sbjct  224  --YFGLMGDGQ-PIGRYDDMWAGWCTKVICDHLGLGVKTGLPYIWHSKASNPFVNLKKEY  280

Query  368  EGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEWVEL  547
            +G+   EE++PFFQS+ L    TTV+ C  E++  VK +LGK    F++ ADAMV W++ 
Sbjct  281  KGIYWQEELIPFFQSVTLPKDCTTVQKCYVELSKQVKAKLGKVDDYFNKLADAMVTWIDA  340

Query  548  WNDVK  562
            W+++ 
Sbjct  341  WDELN  345



>ref|XP_011086921.1| PREDICTED: UDP-arabinopyranose mutase 3-like [Sesamum indicum]
Length=359

 Score =   204 bits (520),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 93/185 (50%), Positives = 133/185 (72%), Gaps = 3/185 (2%)
 Frame = +2

Query  8    ALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGPAL  187
            A+S GLWLN+ DYDAPTQ +KP +RN+R+VDAV+T+P   L P+ G+N+AF+REL+GPA+
Sbjct  164  AVSHGLWLNIPDYDAPTQLVKPLERNTRFVDAVMTIPKGTLFPMCGMNLAFNRELIGPAM  223

Query  188  SPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRKERGNAIESLKKEW  367
               F L  +G       +D+W+G C+KV+CDHLGLGVK+GLPY+W  +  N   +LKKE+
Sbjct  224  Y--FGLMGDGQ-PIGRYDDMWAGWCIKVICDHLGLGVKTGLPYIWHSKASNPFVNLKKEY  280

Query  368  EGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEWVEL  547
            +G+   EE++PFFQS+ L    TTV+ C  E++  VK +LGK    F++ ADAMV W+E 
Sbjct  281  KGIYWQEELIPFFQSVALPKDCTTVQKCYMELSKQVKAKLGKVDDYFNKLADAMVTWIEA  340

Query  548  WNDVK  562
            W+++ 
Sbjct  341  WDELN  345



>ref|XP_007139431.1| hypothetical protein PHAVU_008G028900g [Phaseolus vulgaris]
 gb|AAR13306.1| reversibly glycosylated protein [Phaseolus vulgaris]
 gb|ESW11425.1| hypothetical protein PHAVU_008G028900g [Phaseolus vulgaris]
Length=353

 Score =   204 bits (519),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 93/185 (50%), Positives = 133/185 (72%), Gaps = 3/185 (2%)
 Frame = +2

Query  8    ALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGPAL  187
            A+S GLWLN+ DYDAPTQ +KP +RN+RYVDA+LT+P   L P+ G+N+AFDR+L+GPA+
Sbjct  161  AVSHGLWLNIPDYDAPTQLVKPLERNTRYVDAILTIPKGTLFPMCGMNLAFDRDLIGPAM  220

Query  188  SPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRKERGNAIESLKKEW  367
               F L  +G       +D+W+G C KV+CDHLGLG+K+GLPY++  +  N   +L+KE+
Sbjct  221  Y--FGLMGDGQ-PIGRYDDMWAGWCCKVICDHLGLGIKTGLPYIYHSKASNPFVNLRKEY  277

Query  368  EGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEWVEL  547
            +G+   E+I+PFFQ+L L  +ATTV+ C   +A  VKE+L K  P F + ADAMV W+E 
Sbjct  278  KGIFWQEDIIPFFQNLVLPKEATTVQKCYIVLAKQVKEKLSKIDPYFDKLADAMVTWIEA  337

Query  548  WNDVK  562
            W+++ 
Sbjct  338  WDELN  342



>ref|XP_010232375.1| PREDICTED: UDP-arabinopyranose mutase 1-like [Brachypodium distachyon]
Length=354

 Score =   204 bits (520),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 93/182 (51%), Positives = 130/182 (71%), Gaps = 3/182 (2%)
 Frame = +2

Query  8    ALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGPAL  187
            A+S GLWLN+ DYDAPTQ +KP++RN RYVDAV+T+P   L P+ G+N+AF R+L+GPA+
Sbjct  158  AVSHGLWLNIPDYDAPTQLVKPRERNGRYVDAVMTIPKGTLFPMCGMNLAFRRDLIGPAM  217

Query  188  SPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRKERGNAIESLKKEW  367
               F L  +G       +D+W+G CVKV+CDHLGLGVK+GLPY+W  +  N   +LKKE+
Sbjct  218  Y--FGLMGDGQ-PIGRYDDMWAGWCVKVICDHLGLGVKTGLPYIWHSKASNPFVNLKKEY  274

Query  368  EGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEWVEL  547
            +G+   E+I+PFFQ++ LS    TV+ C   ++  V+E+LGK  P F + ADAMV W+E 
Sbjct  275  KGIFWQEDIIPFFQAVTLSKDCDTVQKCYIALSQQVREKLGKIDPYFGKLADAMVTWIEA  334

Query  548  WN  553
            W+
Sbjct  335  WD  336



>ref|XP_003531873.1| PREDICTED: alpha-1,4-glucan-protein synthase [UDP-forming] 1-like 
[Glycine max]
 gb|KHN30322.1| Alpha-1,4-glucan-protein synthase [UDP-forming] 1 [Glycine soja]
Length=353

 Score =   204 bits (519),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 93/185 (50%), Positives = 133/185 (72%), Gaps = 3/185 (2%)
 Frame = +2

Query  8    ALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGPAL  187
            A+S GLWLN+ DYDAPTQ +KP +RN+RYVDA+LT+P   L P+ G+N+AFDR+L+G A+
Sbjct  161  AVSHGLWLNIPDYDAPTQLVKPLERNTRYVDAILTIPKGTLFPMCGMNLAFDRDLIGAAM  220

Query  188  SPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRKERGNAIESLKKEW  367
               F L  +G       +D+W+G C KV+CDHLGLG+K+GLPY++  +  N   +L+KE+
Sbjct  221  Y--FGLMGDGQ-PIGRYDDMWAGWCCKVICDHLGLGIKTGLPYIYHSKASNPFVNLRKEY  277

Query  368  EGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEWVEL  547
            +G+   E+I+PFFQS+ L  +ATTV+ C  E+A  VKE+L K  P F + ADAMV W+E 
Sbjct  278  KGIFWQEDIIPFFQSIVLPKEATTVQKCYIELAKQVKEKLSKVDPYFDKLADAMVTWIEA  337

Query  548  WNDVK  562
            W+++ 
Sbjct  338  WDELN  342



>gb|KHG05154.1| UDP-arabinopyranose mutase 1 [Gossypium arboreum]
Length=365

 Score =   204 bits (520),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 96/186 (52%), Positives = 131/186 (70%), Gaps = 3/186 (2%)
 Frame = +2

Query  8    ALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGPAL  187
            A+S GLWLN+ DYDAPTQ +KP +RN+RYVDAV+TVP   L P+ G+N+AFDREL+GPA+
Sbjct  166  AVSHGLWLNIPDYDAPTQLVKPLERNTRYVDAVMTVPKGTLFPMCGMNLAFDRELIGPAM  225

Query  188  SPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRKERGNAIESLKKEW  367
               F L  +G       +D+W+G C+KV+CDHLGLGVK+GLPY+W  +  N   +LKKE+
Sbjct  226  --YFGLMGDGQ-PIGRYDDMWAGWCMKVICDHLGLGVKTGLPYIWHSKASNPFVNLKKEY  282

Query  368  EGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEWVEL  547
            +G+   E+ +PFFQS+ L  + ++VE C   +A  VK +LG+  P F   ADAMV W+E 
Sbjct  283  KGIFWQEKAIPFFQSVSLPKECSSVEKCYLALAGEVKSKLGEVDPYFINLADAMVTWIEA  342

Query  548  WNDVKT  565
            WN V +
Sbjct  343  WNMVNS  348



>ref|XP_008785739.1| PREDICTED: UDP-arabinopyranose mutase 3-like [Phoenix dactylifera]
Length=337

 Score =   204 bits (518),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 94/184 (51%), Positives = 130/184 (71%), Gaps = 3/184 (2%)
 Frame = +2

Query  8    ALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGPAL  187
            A+S GLWLN+ DYDAPTQ +KP +RN+RYVDAVLT+P   L P+ G+N+AF+REL+GPA+
Sbjct  136  AVSHGLWLNIPDYDAPTQLVKPLERNTRYVDAVLTIPKGTLFPMCGMNLAFNRELIGPAM  195

Query  188  SPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRKERGNAIESLKKEW  367
               F L  +G       +D+W+G C KV+CD+LGLGVK+GLPY+W  +  N   +LKKE+
Sbjct  196  Y--FGLMGDGQ-PIGRYDDMWAGWCSKVICDYLGLGVKTGLPYIWHSKASNPFANLKKEY  252

Query  368  EGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEWVEL  547
             G+   EEI+PFFQS+    + TTV+ C  E++  VK +LGK    F++ AD+MV W+E 
Sbjct  253  NGIYWQEEIIPFFQSVTFPKECTTVQKCYIELSKQVKAKLGKLDSYFNKLADSMVAWIEA  312

Query  548  WNDV  559
            WN+ 
Sbjct  313  WNEF  316



>ref|XP_004234907.1| PREDICTED: alpha-1,4-glucan-protein synthase [UDP-forming] 1-like 
[Solanum lycopersicum]
Length=350

 Score =   204 bits (519),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 93/185 (50%), Positives = 133/185 (72%), Gaps = 3/185 (2%)
 Frame = +2

Query  8    ALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGPAL  187
            A S GLWLN+ DYDAPTQ +KP +RN+RYVD VLT+P   L P+ G+N+AFDR+L+GPA+
Sbjct  161  AASHGLWLNIPDYDAPTQLVKPLERNTRYVDTVLTIPKGTLFPMCGMNLAFDRDLIGPAM  220

Query  188  SPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRKERGNAIESLKKEW  367
               F L  +G       +D+W+G C KV+CDHLGLG+K+GLPY++  +  N   +LKKE+
Sbjct  221  --YFGLMGDGQ-PIGRYDDMWAGWCCKVICDHLGLGIKTGLPYIYHSKASNPFVNLKKEY  277

Query  368  EGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEWVEL  547
            +G+   EEI+PFFQ+L LS ++T+V+ C  E+A  VKE+LG   P F + ++AMV W+E 
Sbjct  278  KGIFWQEEIIPFFQTLTLSKESTSVQKCYIELARLVKEKLGTIDPYFLKLSEAMVTWIEA  337

Query  548  WNDVK  562
            W+++ 
Sbjct  338  WDELN  342



>ref|NP_001142134.1| hypothetical protein [Zea mays]
 gb|ACF87732.1| unknown [Zea mays]
 gb|AFW68242.1| hypothetical protein ZEAMMB73_550146 [Zea mays]
Length=364

 Score =   204 bits (520),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 92/185 (50%), Positives = 131/185 (71%), Gaps = 3/185 (2%)
 Frame = +2

Query  8    ALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGPAL  187
            A+S GLWLN+ DYDAPTQ +KPK+RN RYVDAV+T+P   L P+ G+N+AFDR+L+GPA+
Sbjct  171  AVSHGLWLNIPDYDAPTQLVKPKERNERYVDAVMTIPKGTLFPMCGMNLAFDRDLIGPAM  230

Query  188  SPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRKERGNAIESLKKEW  367
               F L  +G       +D+W+G CVKV+CDHL LGVK+GLPY+W  +  N   +LKKE+
Sbjct  231  --YFGLMGDGQ-PIGRYDDMWAGWCVKVICDHLSLGVKTGLPYIWHSKASNPFVNLKKEY  287

Query  368  EGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEWVEL  547
            +G+   E+I+PFFQ++ +     TV+ C   ++  VKE+LGK  P F++  DAMV W+E 
Sbjct  288  KGIFWQEDIIPFFQNVTIPKDCDTVQKCYIYLSGQVKEKLGKIDPYFAKLGDAMVTWIEA  347

Query  548  WNDVK  562
            W+++ 
Sbjct  348  WDELN  352



>ref|XP_010464509.1| PREDICTED: UDP-arabinopyranose mutase 3-like isoform X2 [Camelina 
sativa]
Length=365

 Score =   204 bits (520),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 95/188 (51%), Positives = 131/188 (70%), Gaps = 3/188 (2%)
 Frame = +2

Query  2    SCALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGP  181
            + A+S GLWLN+ DYDAPTQ +KP +RNSRYVDAV+T+P   L P+ G+N+AFDREL+GP
Sbjct  165  TTAVSHGLWLNIPDYDAPTQLVKPLERNSRYVDAVMTIPKGTLFPMCGMNLAFDRELIGP  224

Query  182  ALSPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRKERGNAIESLKK  361
            A+   F L  +G       +D+W+G CVKV+CDH+G GVK+GLPY+W  +  N   +LKK
Sbjct  225  AM--YFGLMGDGQ-PIGRYDDMWAGWCVKVICDHMGWGVKTGLPYIWHSKASNPFMNLKK  281

Query  362  EWEGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEWV  541
            E+ G+   EE +PFFQS+ L  + T+V+ C  E+A  VKE+LGK  P F + A  MV W+
Sbjct  282  EYNGIFWQEEAIPFFQSVTLPKECTSVQQCYLELANLVKEKLGKLDPYFIKLATGMVTWI  341

Query  542  ELWNDVKT  565
            E W ++ +
Sbjct  342  EAWEELNS  349



>gb|EYU42116.1| hypothetical protein MIMGU_mgv1a008980mg [Erythranthe guttata]
Length=356

 Score =   204 bits (519),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 91/185 (49%), Positives = 132/185 (71%), Gaps = 3/185 (2%)
 Frame = +2

Query  8    ALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGPAL  187
            A+S GLWLN+ DYDAPTQ +KP++RN+RYVDAVLT+P   + P+ G+N+ F+R+L+GPA+
Sbjct  164  AVSHGLWLNIPDYDAPTQLVKPRERNTRYVDAVLTIPKGTIFPMCGMNLGFNRDLIGPAM  223

Query  188  SPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRKERGNAIESLKKEW  367
               F L  +G       +D+W+G C KV+CDHL LGVK+GLPY+W  +  N   +LKKE+
Sbjct  224  Y--FGLMGDGQ-PIGRYDDMWAGWCTKVICDHLNLGVKTGLPYIWHSKASNPFVNLKKEY  280

Query  368  EGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEWVEL  547
            +G+   E+I+PFFQ+L +  + TTV+ C  E+A  VKE+L    P F++ ADAMV W+E 
Sbjct  281  KGIYWQEDIIPFFQNLTIPKECTTVQQCYLELAKLVKEKLSTIDPYFTKLADAMVTWIEA  340

Query  548  WNDVK  562
            W+++ 
Sbjct  341  WDELN  345



>ref|XP_006657933.1| PREDICTED: UDP-arabinopyranose mutase 3-like [Oryza brachyantha]
Length=361

 Score =   204 bits (519),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 96/185 (52%), Positives = 131/185 (71%), Gaps = 3/185 (2%)
 Frame = +2

Query  8    ALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGPAL  187
            A+S GLWLN+ DYDAPTQ +KP +RNSRYVDAVLT+P   L P+ G+N+AFDREL+GPA+
Sbjct  164  AVSHGLWLNIPDYDAPTQLVKPLERNSRYVDAVLTIPKGTLFPMCGMNLAFDRELIGPAM  223

Query  188  SPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRKERGNAIESLKKEW  367
               F L  +G       +D+W+G C KV+ DHLGLGVK+GLPY+W  +  N   +LKKE+
Sbjct  224  Y--FGLMGDGQ-PIGRYDDMWAGWCTKVITDHLGLGVKTGLPYIWHSKASNPFVNLKKEY  280

Query  368  EGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEWVEL  547
             G+   EE++PFFQS  L  +ATTV+ C  E+A  V+ +LGK    F++ AD+MV W+E 
Sbjct  281  NGIFWQEELIPFFQSAALPKEATTVQKCYLELAKQVRAKLGKVDGYFNKLADSMVTWIEA  340

Query  548  WNDVK  562
            W+++ 
Sbjct  341  WDELN  345



>ref|XP_002460988.1| hypothetical protein SORBIDRAFT_02g038770 [Sorghum bicolor]
 gb|EER97509.1| hypothetical protein SORBIDRAFT_02g038770 [Sorghum bicolor]
Length=361

 Score =   204 bits (519),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 94/185 (51%), Positives = 132/185 (71%), Gaps = 3/185 (2%)
 Frame = +2

Query  8    ALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGPAL  187
            A+S GLWLN+ DYDAPTQ +KP +RN+RYVDA+LT+P   L P+ G+N+AFDREL+GPA+
Sbjct  165  AVSHGLWLNIPDYDAPTQLVKPLERNTRYVDAILTIPKGTLFPMCGMNLAFDRELIGPAM  224

Query  188  SPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRKERGNAIESLKKEW  367
               F L  +G       +D+W+G C KV+ DHLGLGVK+GLPY+W  +  N   +LKKE+
Sbjct  225  --YFGLMGDGQ-PIGRYDDMWAGWCTKVITDHLGLGVKTGLPYIWHSKASNPFVNLKKEY  281

Query  368  EGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEWVEL  547
             G+   EE++PFFQS+ L  +ATTV+ C  E+A  V+ +LGK    F++ AD+MV W+E 
Sbjct  282  NGIFWQEELIPFFQSVSLPKEATTVQKCYLELAKQVRAKLGKVDGYFNKLADSMVTWIEA  341

Query  548  WNDVK  562
            W+++ 
Sbjct  342  WDELN  346



>ref|NP_001148994.1| LOC100282614 [Zea mays]
 gb|ACG33746.1| alpha-1,4-glucan-protein synthase 1 [Zea mays]
Length=361

 Score =   204 bits (519),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 94/185 (51%), Positives = 132/185 (71%), Gaps = 3/185 (2%)
 Frame = +2

Query  8    ALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGPAL  187
            A+S GLWLN+ DYDAPTQ +KP +RN+RYVDA+LT+P   L P+ G+N+AFDREL+GPA+
Sbjct  165  AVSHGLWLNIPDYDAPTQLVKPLERNTRYVDAILTIPKGTLFPMCGMNLAFDRELIGPAM  224

Query  188  SPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRKERGNAIESLKKEW  367
               F L  +G       +D+W+G C KV+ DHLGLGVK+GLPY+W  +  N   +LKKE+
Sbjct  225  --YFGLMGDGQ-PIGRYDDMWAGWCTKVITDHLGLGVKTGLPYIWHSKASNPFVNLKKEY  281

Query  368  EGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEWVEL  547
             G+   EE++PFFQS+ L  +ATTV+ C  E+A  V+ +LGK    F++ AD+MV W+E 
Sbjct  282  NGIFWQEELIPFFQSVSLPKEATTVQKCYLELAKQVRAKLGKVDGYFNKLADSMVTWIEA  341

Query  548  WNDVK  562
            W+++ 
Sbjct  342  WDELN  346



>ref|XP_007045810.1| Reversibly glycosylated polypeptide 3 [Theobroma cacao]
 gb|EOY01642.1| Reversibly glycosylated polypeptide 3 [Theobroma cacao]
Length=362

 Score =   204 bits (519),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 96/186 (52%), Positives = 131/186 (70%), Gaps = 3/186 (2%)
 Frame = +2

Query  8    ALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGPAL  187
            A+S GLWLN+ DYDAPTQ +KP +RN+RYVDAV+TVP   L P+ G+N+AFDREL+GPA+
Sbjct  165  AVSHGLWLNIPDYDAPTQLVKPLERNTRYVDAVMTVPKGTLFPMCGMNLAFDRELIGPAM  224

Query  188  SPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRKERGNAIESLKKEW  367
               F L  +G       +D+W+G C+KV+CDHLGLGVK+GLPY+W  +  N   +LKKE+
Sbjct  225  --YFGLMGDGQ-PIGRYDDMWAGWCMKVICDHLGLGVKTGLPYIWHSKASNPFVNLKKEY  281

Query  368  EGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEWVEL  547
             G+   E+ +PFFQS+ L    TTV+ C   +A  VK +LG+  P F + ADAMV W+E 
Sbjct  282  NGIFWQEKAIPFFQSVVLPKDCTTVQKCYLALADQVKTKLGEVDPYFLKLADAMVTWIEA  341

Query  548  WNDVKT  565
            W++V +
Sbjct  342  WDEVNS  347



>ref|XP_009609413.1| PREDICTED: alpha-1,4-glucan-protein synthase [UDP-forming] 2-like 
[Nicotiana tomentosiformis]
Length=357

 Score =   204 bits (518),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 94/182 (52%), Positives = 128/182 (70%), Gaps = 3/182 (2%)
 Frame = +2

Query  8    ALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGPAL  187
            A+S GLWLN+ DYDAPTQ +KP +RN+RYVD VLT+P   L P+ G+N+AFDREL+GPA+
Sbjct  161  AVSHGLWLNIPDYDAPTQLVKPLERNTRYVDMVLTIPKGTLFPMCGMNLAFDRELIGPAM  220

Query  188  SPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRKERGNAIESLKKEW  367
               F L  +G       +D+W+G C KV+CDHLGLG+K+GLPY++  +  N   +LKKE+
Sbjct  221  --YFGLMGDGQ-PIGRYDDMWAGWCCKVICDHLGLGIKTGLPYIYHSKASNPFVNLKKEY  277

Query  368  EGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEWVEL  547
             G+   E+I+PFFQS   S   T+V+ C  E++  VKE+LGK  P F + ADAMV W+E 
Sbjct  278  LGIFWQEDIIPFFQSHSFSKDCTSVQKCYVELSKQVKEKLGKVNPYFVKLADAMVTWIEA  337

Query  548  WN  553
            W+
Sbjct  338  WD  339



>ref|XP_010694098.1| PREDICTED: alpha-1,4-glucan-protein synthase [UDP-forming] 2 
[Beta vulgaris subsp. vulgaris]
Length=355

 Score =   204 bits (518),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 93/185 (50%), Positives = 130/185 (70%), Gaps = 3/185 (2%)
 Frame = +2

Query  8    ALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGPAL  187
            A+S GLWLN+ DYDAPTQ +KP +RN+RYVD VLT+P   L P+ G+N+AFDREL+GPA+
Sbjct  162  AVSHGLWLNIPDYDAPTQLVKPLERNTRYVDTVLTIPKGTLFPMCGMNLAFDRELIGPAM  221

Query  188  SPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRKERGNAIESLKKEW  367
               F L  +G       +D+W+G C KV+CDHLGLGVK+GLPY++  +  N   +L+KE+
Sbjct  222  --YFGLMGDGQ-PIGRYDDMWAGWCTKVICDHLGLGVKTGLPYIYHSKASNPFTNLRKEY  278

Query  368  EGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEWVEL  547
            +G+   EEI+PFFQS  +    TTV+ C  E+A  VK++L K  P F + ADAMV W++ 
Sbjct  279  KGIFWQEEIIPFFQSAVIPKDCTTVQQCYKELAKQVKDKLSKVDPYFDKLADAMVTWIDA  338

Query  548  WNDVK  562
            W+++ 
Sbjct  339  WDELN  343



>ref|XP_003552602.1| PREDICTED: UDP-arabinopyranose mutase 1-like [Glycine max]
 gb|KHN37932.1| UDP-arabinopyranose mutase 1 [Glycine soja]
Length=353

 Score =   204 bits (518),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 94/185 (51%), Positives = 133/185 (72%), Gaps = 3/185 (2%)
 Frame = +2

Query  8    ALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGPAL  187
            A+S GLWLN+ DYDAPTQ +KP +RN+RYVDAVLT+P   L P+ G+N+AFDR+L+G A+
Sbjct  161  AVSHGLWLNIPDYDAPTQLVKPLERNTRYVDAVLTIPKGTLFPMCGMNLAFDRDLIGAAM  220

Query  188  SPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRKERGNAIESLKKEW  367
               F L  +G       +D+W+G C KV+CDHLGLG+K+GLPY++  +  N   +L+KE+
Sbjct  221  Y--FGLMGDGQ-PIGRYDDMWAGWCCKVICDHLGLGIKTGLPYIYHSKASNPFVNLRKEY  277

Query  368  EGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEWVEL  547
            +G+   E+I+PFFQS+ L  +ATTV+ C  E+A  VKE+L K  P F + ADAMV W+E 
Sbjct  278  KGIFWQEDIIPFFQSVVLPKEATTVQKCYIELAKQVKEKLTKVDPYFDKLADAMVTWIEA  337

Query  548  WNDVK  562
            W+++ 
Sbjct  338  WDELN  342



>gb|ACN27755.1| unknown [Zea mays]
 tpg|DAA63529.1| TPA: alpha-1,4-glucan-protein synthase 1 [Zea mays]
Length=361

 Score =   204 bits (518),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 94/185 (51%), Positives = 132/185 (71%), Gaps = 3/185 (2%)
 Frame = +2

Query  8    ALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGPAL  187
            A+S GLWLN+ DYDAPTQ +KP +RN+RYVDA+LT+P   L P+ G+N+AFDREL+GPA+
Sbjct  165  AVSHGLWLNIPDYDAPTQLVKPLERNTRYVDAILTIPKGTLFPMCGMNLAFDRELIGPAM  224

Query  188  SPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRKERGNAIESLKKEW  367
               F L  +G       +D+W+G C KV+ DHLGLGVK+GLPY+W  +  N   +LKKE+
Sbjct  225  --YFGLMGDGQ-PIGRYDDMWAGWCTKVITDHLGLGVKTGLPYIWHSKASNPFVNLKKEY  281

Query  368  EGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEWVEL  547
             G+   EE++PFFQS+ L  +ATTV+ C  E+A  V+ +LGK    F++ AD+MV W+E 
Sbjct  282  NGIFWQEELIPFFQSVSLPKEATTVQKCYLELAKQVRAKLGKVDGYFNKLADSMVTWIEA  341

Query  548  WNDVK  562
            W+++ 
Sbjct  342  WDELN  346



>ref|XP_009146975.1| PREDICTED: UDP-arabinopyranose mutase 3-like [Brassica rapa]
Length=367

 Score =   204 bits (519),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 94/185 (51%), Positives = 130/185 (70%), Gaps = 3/185 (2%)
 Frame = +2

Query  8    ALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGPAL  187
            A+S GLWLN+ DYDAPTQ +KP +RNSRYVDAV+T+P   L P+ G+N+AFDREL+GPA+
Sbjct  167  AVSHGLWLNIPDYDAPTQLVKPLERNSRYVDAVMTIPKGTLFPMCGMNLAFDRELIGPAM  226

Query  188  SPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRKERGNAIESLKKEW  367
               F L  +G       +D+W+G CVKV+CDH+G GVK+GLPY+W  +  N   +L+KE+
Sbjct  227  --YFGLMGDGQ-PIGRYDDMWAGWCVKVICDHMGWGVKTGLPYIWHSKASNPFVNLRKEY  283

Query  368  EGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEWVEL  547
             G+   EE +PFFQS+ L  +  +V+ C  E+A  VKE+LGK  P F + AD MV W+E 
Sbjct  284  NGIFWQEEAIPFFQSVTLPKECDSVQQCYMELAKLVKEKLGKVDPYFIKLADGMVTWIEA  343

Query  548  WNDVK  562
            W+++ 
Sbjct  344  WDELN  348



>gb|KDP24292.1| hypothetical protein JCGZ_25588 [Jatropha curcas]
Length=364

 Score =   204 bits (519),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 94/185 (51%), Positives = 131/185 (71%), Gaps = 3/185 (2%)
 Frame = +2

Query  8    ALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGPAL  187
            A+S GLWLN+ DYDAPTQ +KP +RN+RYVDAVLT+P   L P+ G+N+AF+REL+GPA+
Sbjct  170  AVSHGLWLNIPDYDAPTQLVKPLERNTRYVDAVLTIPKGTLFPMCGMNLAFNRELIGPAM  229

Query  188  SPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRKERGNAIESLKKEW  367
               F L  +G       +D+W+G C KV+CDHLGLGVK+GLPY++  +  N   +L+KE+
Sbjct  230  Y--FGLMGDGQ-PIGRYDDMWAGWCTKVICDHLGLGVKTGLPYIYHSKASNPFVNLRKEY  286

Query  368  EGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEWVEL  547
            +G+   EEI+PFFQ+  L    TTV+ C  E++  VKE+L K  P F + ADAMV W+E 
Sbjct  287  KGIFWQEEIIPFFQAATLPKDCTTVQKCYIELSKQVKEKLSKVDPYFDKLADAMVTWIEA  346

Query  548  WNDVK  562
            W+++ 
Sbjct  347  WDELN  351



>gb|KDP41329.1| hypothetical protein JCGZ_15736 [Jatropha curcas]
Length=365

 Score =   204 bits (519),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 93/186 (50%), Positives = 132/186 (71%), Gaps = 3/186 (2%)
 Frame = +2

Query  8    ALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGPAL  187
            A+S GLWLN+ DYDAPTQ +KP +RN+RYVDAV+TVP   L P+ G+N+AF+REL+GPA+
Sbjct  165  AVSHGLWLNIPDYDAPTQLVKPLERNTRYVDAVMTVPKGTLFPMCGMNLAFNRELIGPAM  224

Query  188  SPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRKERGNAIESLKKEW  367
               F L  +G       +D+W+G C+KV+CDH+G GVK+GLPY+W  +  N   +LKKE+
Sbjct  225  --YFGLMGDGQPVGR-YDDMWAGWCMKVICDHMGWGVKTGLPYIWHSKASNPFVNLKKEY  281

Query  368  EGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEWVEL  547
            +G+   E+++PFFQS+ L  + TTV+ C  E+A  VKE+     P F + ADAMV W+E 
Sbjct  282  KGIFWQEQLIPFFQSVVLPKECTTVQKCYIELAKQVKEKFADEDPYFVKLADAMVTWIEA  341

Query  548  WNDVKT  565
            WN++ +
Sbjct  342  WNELNS  347



>ref|XP_007222173.1| hypothetical protein PRUPE_ppa007760mg [Prunus persica]
 gb|EMJ23372.1| hypothetical protein PRUPE_ppa007760mg [Prunus persica]
Length=356

 Score =   204 bits (518),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 95/187 (51%), Positives = 132/187 (71%), Gaps = 3/187 (2%)
 Frame = +2

Query  8    ALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGPAL  187
            A+S GLWLN+ DYDAPTQ  KP +RN+R+VDAVLT+P   L P+ G+N+AF+REL+GPA+
Sbjct  167  AVSHGLWLNIPDYDAPTQLAKPLERNTRFVDAVLTIPKGTLFPMCGMNLAFNRELIGPAM  226

Query  188  SPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRKERGNAIESLKKEW  367
               F L  +G       +D+W+G C+KV+CDHLG GVK+GLPY+W  +  N   +LKKE+
Sbjct  227  Y--FGLMGDGQ-PIGRYDDMWAGWCMKVICDHLGYGVKTGLPYIWHSKASNPFVNLKKEY  283

Query  368  EGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEWVEL  547
             G+   EE++PFFQS  L+ + TTV+ C  E++  VK +LGK  P F + ADAMV WVE 
Sbjct  284  NGIFWQEELIPFFQSAVLTKECTTVQQCYIELSKQVKAKLGKIDPYFLKLADAMVTWVEA  343

Query  548  WNDVKTQ  568
            W+++  +
Sbjct  344  WDELNGK  350



>emb|CAA77235.1| reversibly glycosylated polypeptide [Oryza sativa Indica Group]
Length=364

 Score =   204 bits (518),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 93/185 (50%), Positives = 132/185 (71%), Gaps = 3/185 (2%)
 Frame = +2

Query  8    ALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGPAL  187
            A+S GLWLN+ DYDAPTQ +KP++RNSRYVDAV+TVP   L P+ G+N+AFDR+L+GPA+
Sbjct  171  AVSHGLWLNIPDYDAPTQMVKPRERNSRYVDAVMTVPKGTLFPMCGMNLAFDRDLIGPAM  230

Query  188  SPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRKERGNAIESLKKEW  367
               F L  +G       +D+W+G C+KV+CDHL LGVK+GLPY+W  +  N   +LKKE+
Sbjct  231  --YFGLMGDGQ-PIGRYDDMWAGWCMKVICDHLSLGVKTGLPYIWHSKASNPFVNLKKEY  287

Query  368  EGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEWVEL  547
            +G+   E+I+PFFQ+  +  +  TV+ C   +A  V+E+LGK  P F + ADAMV W+E 
Sbjct  288  KGIFWQEDIIPFFQNATIPKECDTVQKCYLSLAEQVREKLGKIDPYFVKLADAMVTWIEA  347

Query  548  WNDVK  562
            W+++ 
Sbjct  348  WDELN  352



>ref|XP_010249072.1| PREDICTED: UDP-arabinopyranose mutase 1-like [Nelumbo nucifera]
Length=369

 Score =   204 bits (519),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 95/184 (52%), Positives = 130/184 (71%), Gaps = 3/184 (2%)
 Frame = +2

Query  8    ALSCGLWLNMADYDAPTQALKPKQRNSRYVDAVLTVPARALMPVSGINIAFDRELVGPAL  187
            A+S GLWLN+ DYDAPTQ +KP +RN+RYVDAV+TVP   L P+ G+N+AF++EL+GPA+
Sbjct  165  AISHGLWLNIPDYDAPTQLVKPLERNTRYVDAVMTVPKGTLFPMCGMNLAFNKELIGPAM  224

Query  188  SPAFRLAKEGNLRWETVEDVWSGMCVKVVCDHLGLGVKSGLPYVWRKERGNAIESLKKEW  367
               F L  +G       +D+W+G C KV+CDHL LGVK+GLPY+W  +  N   +LKKE+
Sbjct  225  --YFGLMGDGQ-PIGRYDDMWAGWCSKVICDHLSLGVKTGLPYIWHSKASNPFVNLKKEY  281

Query  368  EGVKLMEEIVPFFQSLRLSPQATTVEDCVTEIAAAVKEQLGKSAPVFSRAADAMVEWVEL  547
            +G+   EEI+PFFQS+ L  + TTV+ C  E+A  VKE+LG   P F +  DAMV W+E 
Sbjct  282  KGIYWQEEIIPFFQSVVLPRECTTVQKCYLELAKQVKEKLGPVDPYFQKLGDAMVTWIEA  341

Query  548  WNDV  559
            W ++
Sbjct  342  WEEL  345



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1376900468608