BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c99483_g1_i1 len=155 path=[1:0-154]

Length=155
                                                                      Score     E

ref|XP_004145727.1|  PREDICTED: uncharacterized protein LOC101212001  93.6    4e-20   
emb|CCI55376.1|  PH01B035L11.21                                       92.8    6e-20   
emb|CAN60533.1|  hypothetical protein VITISV_001512                   86.7    7e-20   Vitis vinifera
emb|CAN77391.1|  hypothetical protein VITISV_003225                   86.3    9e-20   Vitis vinifera
gb|KFZ88828.1|  reverse transcriptase                                 84.7    1e-19   
emb|CAN75653.1|  hypothetical protein VITISV_004538                   86.3    1e-19   Vitis vinifera
gb|AAD09019.1|  copia protein                                         90.1    1e-19   Zea mays [maize]
emb|CAN83181.1|  hypothetical protein VITISV_013310                   90.1    1e-19   Vitis vinifera
emb|CAN74951.1|  hypothetical protein VITISV_030567                   90.9    3e-19   Vitis vinifera
gb|AEJ07899.1|  Opie3 putative pol protein                            90.1    3e-19   
gb|AAC49502.1|  Pol                                                   90.1    3e-19   Zea mays [maize]
gb|ABF67947.1|  Opie2 pol protein                                     90.1    4e-19   Zea mays [maize]
gb|AAW57789.1|  putative polyprotein                                  90.5    4e-19   Oryza sativa Japonica Group [Japonica rice]
emb|CAN64335.1|  hypothetical protein VITISV_001808                   90.5    4e-19   Vitis vinifera
gb|ABF94836.1|  retrotransposon protein, putative, unclassified       90.5    4e-19   Oryza sativa Japonica Group [Japonica rice]
gb|AAO37957.1|  putative gag-pol polyprotein                          90.5    4e-19   Oryza sativa Japonica Group [Japonica rice]
gb|AEJ07927.1|  Opie2 pol protein                                     90.1    4e-19   
gb|ABF67934.1|  Opie3 pol polyprotein                                 90.1    4e-19   Zea mays [maize]
gb|ABF93543.1|  retrotransposon protein, putative, unclassified       90.5    4e-19   Oryza sativa Japonica Group [Japonica rice]
gb|AAN60494.1|  Putative Zea mays retrotransposon Opie-2              90.5    4e-19   Oryza sativa Japonica Group [Japonica rice]
emb|CAE03600.2|  OSJNBb0004A17.2                                      90.5    4e-19   Oryza sativa [red rice]
gb|AAP94592.1|  retrotransposon Opie-2                                90.1    4e-19   Zea mays [maize]
gb|AAL66759.1|AF464738_10  putative pol protein                       90.1    4e-19   Zea mays [maize]
emb|CAA71814.1|  hypothetical protein                                 84.3    4e-19   Musa acuminata [banana]
gb|AEJ07931.1|  Opie3 pol protein                                     90.1    5e-19   
gb|AAX95391.1|  Integrase core domain, putative                       90.1    5e-19   Oryza sativa Japonica Group [Japonica rice]
gb|AEJ07909.1|  Opie1 putative pol protein                            89.4    6e-19   
emb|CAN63212.1|  hypothetical protein VITISV_002844                   89.4    6e-19   Vitis vinifera
ref|XP_007010276.1|  Cysteine-rich RLK (RECEPTOR-like protein kin...  86.3    6e-19   
gb|AAR89047.1|  putative integrase                                    89.7    6e-19   Oryza sativa Japonica Group [Japonica rice]
gb|ABF97694.1|  retrotransposon protein, putative, unclassified       89.7    6e-19   Oryza sativa Japonica Group [Japonica rice]
emb|CAN70635.1|  hypothetical protein VITISV_019049                   89.0    7e-19   Vitis vinifera
emb|CAN76922.1|  hypothetical protein VITISV_015624                   89.0    8e-19   Vitis vinifera
emb|CAN60489.1|  hypothetical protein VITISV_030840                   89.0    8e-19   Vitis vinifera
gb|AAD20307.1|  copia-type pol polyprotein                            89.0    9e-19   Zea mays [maize]
gb|AEJ07943.1|  Ji4 putative pol protein                              89.0    9e-19   
gb|ABF67921.1|  Ji1 putative pol protein                              89.0    9e-19   Zea mays [maize]
emb|CAH66675.1|  OSIGBa0107E14.5                                      87.4    9e-19   Oryza sativa [red rice]
gb|AAL66753.1|AF464738_4  putative copia-type pol polyprotein         89.0    1e-18   Zea mays [maize]
gb|AAL76004.1|AF466646_12  putative gag-pol polyprotein               89.0    1e-18   Zea mays [maize]
emb|CCI55284.1|  PH01B001G05.7                                        89.0    1e-18   
gb|AAN40035.1|  putative gag-pol polyprotein                          89.0    1e-18   Zea mays [maize]
gb|AAP94599.1|  putative copia-type pol polyprotein                   89.0    1e-18   Zea mays [maize]
gb|ACA21859.1|  Opie2a pol protein                                    88.6    1e-18   Zea mays [maize]
gb|AAN40025.1|  putative gag-pol polyprotein                          89.0    1e-18   Zea mays [maize]
gb|AAL35398.1|  Opie2 pol                                             88.2    1e-18   Zea mays [maize]
gb|AAL35396.1|  Opie2a pol                                            89.0    1e-18   Zea mays [maize]
emb|CAN69511.1|  hypothetical protein VITISV_021468                   83.2    1e-18   Vitis vinifera
gb|AEJ07944.1|  Opie1 putative pol protein                            88.6    1e-18   
gb|AAL75488.1|AF466202_14  putative pol protein                       88.2    1e-18   Zea mays [maize]
gb|AAX96275.1|  retrotransposon protein, putative, unclassified       88.6    1e-18   Oryza sativa Japonica Group [Japonica rice]
emb|CAE04585.2|  OSJNBb0006N15.2                                      88.6    1e-18   Oryza sativa Japonica Group [Japonica rice]
gb|AAT93986.1|  putative polyprotein                                  88.6    2e-18   Oryza sativa Japonica Group [Japonica rice]
emb|CAN83432.1|  hypothetical protein VITISV_036817                   82.8    2e-18   Vitis vinifera
gb|ABA98071.1|  retrotransposon protein, putative, unclassified       88.6    2e-18   Oryza sativa Japonica Group [Japonica rice]
gb|ABA98847.1|  retrotransposon protein, putative, unclassified       88.6    2e-18   Oryza sativa Japonica Group [Japonica rice]
gb|AAP53706.1|  retrotransposon protein, putative, unclassified       88.6    2e-18   Oryza sativa Japonica Group [Japonica rice]
gb|ABA98045.1|  retrotransposon protein, putative, unclassified       88.6    2e-18   Oryza sativa Japonica Group [Japonica rice]
emb|CAD40307.2|  OSJNBb0013O03.2                                      88.2    2e-18   Oryza sativa [red rice]
emb|CAN62460.1|  hypothetical protein VITISV_035911                   87.4    2e-18   Vitis vinifera
emb|CAN69531.1|  hypothetical protein VITISV_009937                   86.3    2e-18   Vitis vinifera
emb|CAN62895.1|  hypothetical protein VITISV_021518                   87.0    2e-18   Vitis vinifera
gb|ABF67946.1|  putative Opie4 pol protein                            87.8    2e-18   Zea mays [maize]
emb|CAN76957.1|  hypothetical protein VITISV_022306                   86.7    2e-18   Vitis vinifera
emb|CAN65058.1|  hypothetical protein VITISV_008902                   87.4    3e-18   Vitis vinifera
gb|ABB47538.2|  retrotransposon protein, putative, Ty1-copia subc...  87.8    3e-18   Oryza sativa Japonica Group [Japonica rice]
gb|AAK50413.1|AC021891_14  Putative retroelement                      87.8    3e-18   Oryza sativa Japonica Group [Japonica rice]
ref|WP_010863377.1|  Ribonuclease H                                   82.8    3e-18   
gb|EXX76353.1|  gag-pol fusion protein                                86.7    3e-18   
emb|CAN71245.1|  hypothetical protein VITISV_011091                   86.3    4e-18   Vitis vinifera
gb|ABA97696.1|  retrotransposon protein, putative, unclassified       87.4    4e-18   Oryza sativa Japonica Group [Japonica rice]
emb|CAD40455.2|  OSJNBa0041M21.13                                     86.7    4e-18   Oryza sativa Japonica Group [Japonica rice]
emb|CAN71349.1|  hypothetical protein VITISV_023812                   81.6    5e-18   Vitis vinifera
emb|CAN63777.1|  hypothetical protein VITISV_043745                   86.7    5e-18   Vitis vinifera
emb|CAN68210.1|  hypothetical protein VITISV_041836                   81.6    5e-18   Vitis vinifera
emb|CAN60227.1|  hypothetical protein VITISV_027166                   81.6    6e-18   Vitis vinifera
gb|AAL75483.1|AF466202_9  putative pol protein                        87.0    6e-18   Zea mays [maize]
ref|XP_009612215.1|  PREDICTED: uncharacterized protein LOC104105574  85.5    6e-18   
gb|AAX96493.1|  retrotransposon protein, putative, unclassified       86.7    6e-18   Oryza sativa Japonica Group [Japonica rice]
emb|CAN70134.1|  hypothetical protein VITISV_021662                   81.3    7e-18   Vitis vinifera
emb|CAN64879.1|  hypothetical protein VITISV_021993                   83.6    7e-18   Vitis vinifera
emb|CAN75346.1|  hypothetical protein VITISV_035359                   81.3    7e-18   Vitis vinifera
emb|CAN62159.1|  hypothetical protein VITISV_041771                   85.1    7e-18   Vitis vinifera
ref|XP_009794325.1|  PREDICTED: uncharacterized protein LOC104241107  83.2    7e-18   
emb|CAN72344.1|  hypothetical protein VITISV_000383                   86.3    8e-18   Vitis vinifera
gb|ABA96551.1|  retrotransposon protein, putative, Ty1-copia subc...  86.7    9e-18   Oryza sativa Japonica Group [Japonica rice]
emb|CAN70326.1|  hypothetical protein VITISV_041472                   84.3    9e-18   Vitis vinifera
gb|AAX96565.1|  retrotransposon protein, putative, Ty1-copia sub-...  85.9    9e-18   Oryza sativa Japonica Group [Japonica rice]
gb|AAT76321.1|  putative integrase                                    86.3    1e-17   Oryza sativa Japonica Group [Japonica rice]
gb|AAL31657.1|AC079179_12  Putative Zea mays retrotransposon Opie-2   84.7    1e-17   Oryza sativa [red rice]
gb|ABA98369.1|  retrotransposon protein, putative, Ty1-copia subc...  85.1    2e-17   Oryza sativa Japonica Group [Japonica rice]
emb|CAN67656.1|  hypothetical protein VITISV_012485                   80.5    2e-17   Vitis vinifera
gb|AEL30380.1|  hypothetical protein 205D04_20                        85.5    2e-17   
emb|CAE01974.2|  OSJNBb0051N19.3                                      85.5    2e-17   Oryza sativa Japonica Group [Japonica rice]
gb|AAT85130.1|  putative polyprotein                                  85.5    2e-17   Oryza sativa Japonica Group [Japonica rice]
emb|CAE04887.3|  OSJNBa0042I15.9                                      85.5    2e-17   Oryza sativa [red rice]
emb|CAN73842.1|  hypothetical protein VITISV_008183                   79.3    2e-17   Vitis vinifera
ref|XP_004310161.1|  PREDICTED: uncharacterized protein LOC101309698  85.1    2e-17   
emb|CAD40731.2|  OSJNBa0072D21.17                                     85.1    2e-17   Oryza sativa Japonica Group [Japonica rice]
emb|CAN81640.1|  hypothetical protein VITISV_004897                   79.7    3e-17   Vitis vinifera
gb|AAO37458.1|  putative polyprotein                                  82.8    3e-17   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009792371.1|  PREDICTED: uncharacterized protein LOC104239442  84.3    3e-17   
ref|XP_004509513.1|  PREDICTED: uncharacterized protein LOC101489680  84.3    4e-17   
ref|XP_009881815.1|  PREDICTED: uncharacterized protein LOC104285113  84.3    4e-17   
gb|AAN40030.1|  putative gag-pol polyprotein                          84.7    4e-17   Zea mays [maize]
gb|AAK98718.1|AC090483_8  Putative retroelement                       84.3    5e-17   Oryza sativa [red rice]
ref|XP_002461993.1|  hypothetical protein SORBIDRAFT_02g011996        82.8    5e-17   Sorghum bicolor [broomcorn]
gb|ABA93940.1|  retrotransposon protein, putative, Ty1-copia subc...  84.3    5e-17   Oryza sativa Japonica Group [Japonica rice]
gb|AAK02025.2|AC074283_6  Putative copia-type pol polyprotein         84.0    5e-17   Oryza sativa [red rice]
gb|AAX96236.1|  retrotransposon protein, putative, Ty1-copia sub-...  84.0    6e-17   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007037126.1|  Uncharacterized protein TCM_013597               79.3    6e-17   
ref|XP_009792305.1|  PREDICTED: uncharacterized protein LOC104239375  80.1    6e-17   
gb|ABD32582.1|  Integrase, catalytic region; Zinc finger, CCHC-ty...  84.0    6e-17   Medicago truncatula
gb|AAK70631.1|AC091238_9  Putative copia-type pol polyprotein         84.0    6e-17   Oryza sativa Japonica Group [Japonica rice]
gb|KFK23114.1|  hypothetical protein AALP_AAs42267U000100             83.6    6e-17   
gb|AAP52457.2|  retrotransposon protein, putative, Ty1-copia subc...  84.0    6e-17   Oryza sativa Japonica Group [Japonica rice]
emb|CAN78658.1|  hypothetical protein VITISV_003631                   81.3    7e-17   Vitis vinifera
gb|ABA98480.1|  retrotransposon protein, putative, Ty1-copia subc...  82.8    8e-17   Oryza sativa Japonica Group [Japonica rice]
gb|ABA91128.1|  retrotransposon protein, putative, unclassified       83.6    9e-17   Oryza sativa Japonica Group [Japonica rice]
emb|CAN60378.1|  hypothetical protein VITISV_032103                   83.2    1e-16   Vitis vinifera
emb|CAN68036.1|  hypothetical protein VITISV_003429                   81.6    1e-16   Vitis vinifera
gb|ABF96972.1|  retrotransposon protein, putative, unclassified       82.8    1e-16   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002445775.1|  hypothetical protein SORBIDRAFT_07g025585        82.8    1e-16   Sorghum bicolor [broomcorn]
ref|NP_001183750.1|  uncharacterized protein LOC100502343             81.6    1e-16   
emb|CAN64520.1|  hypothetical protein VITISV_030941                   82.8    1e-16   Vitis vinifera
emb|CAD40165.2|  OSJNBa0061A09.4                                      82.8    1e-16   Oryza sativa Japonica Group [Japonica rice]
emb|CAN70885.1|  hypothetical protein VITISV_018629                   82.8    2e-16   Vitis vinifera
gb|ABB46911.2|  retrotransposon protein, putative, unclassified       82.8    2e-16   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008813439.1|  PREDICTED: uncharacterized protein LOC103724066  82.0    2e-16   
gb|AAM01150.2|AC113336_2  Putative retroelement                       82.8    2e-16   Oryza sativa Japonica Group [Japonica rice]
gb|ABF97245.1|  retrotransposon protein, putative, Ty1-copia subc...  81.6    2e-16   Oryza sativa Japonica Group [Japonica rice]
gb|KFK33802.1|  hypothetical protein AALP_AA5G062200                  82.0    2e-16   
gb|ABA91220.1|  retrotransposon protein, putative, unclassified       82.4    2e-16   Oryza sativa Japonica Group [Japonica rice]
gb|KFK33801.1|  hypothetical protein AALP_AA5G062200                  82.0    2e-16   
gb|AAR01754.1|  putative copia-type pol polyprotein                   82.0    3e-16   Oryza sativa Japonica Group [Japonica rice]
gb|AAR10863.1|  putative copia-type pol polyprotein                   81.6    3e-16   Oryza sativa Japonica Group [Japonica rice]
gb|KFK22150.1|  hypothetical protein AALP_AAs39584U000100             82.0    3e-16   
ref|XP_009589231.1|  PREDICTED: uncharacterized protein LOC104086621  80.9    3e-16   
emb|CAN82633.1|  hypothetical protein VITISV_028135                   82.0    3e-16   Vitis vinifera
ref|XP_010236578.1|  PREDICTED: uncharacterized protein LOC104584137  80.9    3e-16   
gb|ABR16288.1|  unknown                                               79.7    3e-16   Picea sitchensis
emb|CCI61386.1|  putative reverse transcriptase (RNA-dependent DN...  78.6    3e-16   
emb|CAN64324.1|  hypothetical protein VITISV_005640                   80.9    3e-16   Vitis vinifera
ref|XP_007037251.1|  Integrase, catalytic region, Zinc finger, CC...  81.6    4e-16   
emb|CAN61443.1|  hypothetical protein VITISV_044238                   81.3    4e-16   Vitis vinifera
gb|ABE88110.1|  Reverse transcriptase (RNA-dependent DNA polymera...  81.6    4e-16   Medicago truncatula
gb|AAU10766.1|  putative polyprotein                                  81.6    4e-16   Oryza sativa Japonica Group [Japonica rice]
emb|CAN71808.1|  hypothetical protein VITISV_011726                   80.5    4e-16   Vitis vinifera
ref|XP_009784034.1|  PREDICTED: uncharacterized protein LOC104232507  80.1    4e-16   
dbj|BAH79981.1|  putative unclassified retrotransposon protein        81.6    4e-16   Oryza sativa Indica Group [Indian rice]
gb|AAS90682.1|  pupative polyprotein                                  81.3    5e-16   Oryza sativa Japonica Group [Japonica rice]
emb|CAN60040.1|  hypothetical protein VITISV_012669                   76.3    5e-16   Vitis vinifera
ref|XP_007032526.1|  Cysteine-rich RLK (RECEPTOR-like protein kin...  79.7    6e-16   
ref|XP_009776875.1|  PREDICTED: uncharacterized protein LOC104226551  79.3    7e-16   
gb|AIC77183.1|  polyprotein                                           80.9    7e-16   
ref|XP_009785090.1|  PREDICTED: uncharacterized protein LOC104233401  79.7    7e-16   
emb|CCI61385.1|  putative reverse transcriptase (RNA-dependent DN...  77.4    8e-16   
gb|AGM34085.1|  cysteine-rich RLK                                     80.1    8e-16   
ref|NP_001061718.1|  Os08g0389500                                     80.9    8e-16   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002461816.1|  hypothetical protein SORBIDRAFT_02g008720        80.5    9e-16   Sorghum bicolor [broomcorn]
emb|CAN67730.1|  hypothetical protein VITISV_044473                   80.1    9e-16   Vitis vinifera
emb|CAN74493.1|  hypothetical protein VITISV_042722                   75.5    9e-16   Vitis vinifera
ref|XP_002464673.1|  hypothetical protein SORBIDRAFT_01g023130        80.5    9e-16   Sorghum bicolor [broomcorn]
ref|NP_001174195.1|  Os05g0126900                                     80.1    1e-15   
emb|CAN62791.1|  hypothetical protein VITISV_024905                   80.1    1e-15   Vitis vinifera
ref|XP_010240715.1|  PREDICTED: uncharacterized protein LOC100822190  80.5    1e-15   
ref|XP_002459428.1|  hypothetical protein SORBIDRAFT_02g004525        80.1    1e-15   Sorghum bicolor [broomcorn]
dbj|BAK01592.1|  predicted protein                                    77.0    1e-15   
gb|ABA98062.2|  retrotransposon protein, putative, Ty1-copia subc...  80.5    1e-15   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009796610.1|  PREDICTED: uncharacterized protein LOC104243155  77.0    1e-15   
ref|XP_007022430.1|  Uncharacterized protein TCM_032871               77.8    1e-15   
ref|XP_002449917.1|  hypothetical protein SORBIDRAFT_05g025655        79.7    1e-15   Sorghum bicolor [broomcorn]
emb|CAN69204.1|  hypothetical protein VITISV_023040                   75.5    1e-15   Vitis vinifera
ref|XP_010476022.1|  PREDICTED: uncharacterized protein LOC104755356  79.7    2e-15   
gb|AAO73521.1|  gag-pol polyprotein                                   79.7    2e-15   Glycine max [soybeans]
gb|AAO73523.1|  gag-pol polyprotein                                   79.7    2e-15   Glycine max [soybeans]
gb|AAO73527.1|  gag-pol polyprotein                                   79.7    2e-15   Glycine max [soybeans]
emb|CAN66968.1|  hypothetical protein VITISV_040712                   78.6    2e-15   Vitis vinifera
gb|AAY87199.1|  reverse transcriptase                                 75.1    2e-15   Ephedra distachya [sea-grape]
ref|XP_008238365.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  79.7    2e-15   
gb|ABB46561.1|  retrotransposon protein, putative, Ty1-copia subc...  79.7    2e-15   Oryza sativa Japonica Group [Japonica rice]
gb|AAM08642.1|AC108883_15  Putative copia-type pol polyprotein        79.7    2e-15   Oryza sativa [red rice]
emb|CAN70899.1|  hypothetical protein VITISV_022769                   77.8    2e-15   Vitis vinifera
ref|XP_008664310.1|  PREDICTED: uncharacterized protein LOC103642931  77.8    2e-15   
gb|EEE69435.1|  hypothetical protein OsJ_28824                        75.9    2e-15   Oryza sativa Japonica Group [Japonica rice]
emb|CAN74061.1|  hypothetical protein VITISV_017933                   77.8    2e-15   Vitis vinifera
emb|CAD39835.2|  OSJNBb0072N21.1                                      78.2    2e-15   Oryza sativa Japonica Group [Japonica rice]
gb|ABM55238.1|  integrase                                             79.3    2e-15   Beta vulgaris [beet]
gb|ABH08430.1|  putative integrase                                    79.3    2e-15   Beta vulgaris [beet]
gb|AAM08523.1|AC068654_25  Putative retroelement                      79.3    3e-15   Oryza sativa [red rice]
gb|AAY87197.1|  reverse transcriptase                                 74.7    3e-15   Ephedra distachya [sea-grape]
gb|AAM23248.1|AC092553_14  Putative copia-type pol polyprotein        79.0    3e-15   Oryza sativa Japonica Group [Japonica rice]
gb|AAD17409.1|  putative retroelement pol polyprotein                 79.3    3e-15   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009800411.1|  PREDICTED: uncharacterized protein LOC104246309  75.5    3e-15   
gb|KFK23370.1|  hypothetical protein AALP_AAs49046U000200             78.6    3e-15   
emb|CAN64779.1|  hypothetical protein VITISV_043230                   79.0    3e-15   Vitis vinifera
emb|CAH67708.1|  H0512B01.3                                           79.0    4e-15   Oryza sativa [red rice]
gb|ABB46679.2|  retrotransposon protein, putative, unclassified       78.6    4e-15   Oryza sativa Japonica Group [Japonica rice]
gb|KFK23369.1|  hypothetical protein AALP_AAs49046U000200             78.6    4e-15   
ref|XP_002442065.1|  hypothetical protein SORBIDRAFT_08g008672        78.6    4e-15   Sorghum bicolor [broomcorn]
ref|XP_006577547.1|  PREDICTED: uncharacterized protein LOC102662042  79.0    4e-15   
gb|AGH20668.1|  reverse transcriptase                                 75.9    5e-15   
emb|CAH67713.1|  H0512B01.8                                           78.6    5e-15   Oryza sativa [red rice]
gb|ABF97186.1|  retrotransposon protein, putative, unclassified       78.6    5e-15   Oryza sativa Japonica Group [Japonica rice]
gb|AAG59661.1|AC084319_19  putative copia-type pol polyprotein        78.6    5e-15   Oryza sativa [red rice]
ref|NP_001060934.2|  Os08g0133100                                     77.4    5e-15   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002444793.1|  hypothetical protein SORBIDRAFT_07g028153        78.6    5e-15   Sorghum bicolor [broomcorn]
ref|XP_010520710.1|  PREDICTED: uncharacterized protein LOC104799765  78.6    6e-15   
emb|CAN69241.1|  hypothetical protein VITISV_009386                   78.2    6e-15   Vitis vinifera
emb|CAD37115.3|  OSJNBa0033H08.15                                     77.4    6e-15   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010317381.1|  PREDICTED: uncharacterized protein LOC101262243  78.2    7e-15   
ref|XP_010501755.1|  PREDICTED: uncharacterized protein LOC104779057  77.4    7e-15   
emb|CAN78660.1|  hypothetical protein VITISV_044392                   73.6    7e-15   Vitis vinifera
gb|ABA98046.1|  retrotransposon protein, putative, Ty1-copia subc...  78.2    7e-15   Oryza sativa Japonica Group [Japonica rice]
gb|AAP94596.1|  putative copia-type pol polyprotein                   76.6    8e-15   Zea mays [maize]
emb|CAN65377.1|  hypothetical protein VITISV_014188                   77.4    9e-15   Vitis vinifera
gb|AGH20682.1|  reverse transcriptase                                 75.1    9e-15   
gb|AAT85178.1|  putative polyprotein                                  77.8    9e-15   Oryza sativa Japonica Group [Japonica rice]
gb|AGH20681.1|  reverse transcriptase                                 75.1    9e-15   
emb|CAN67526.1|  hypothetical protein VITISV_011686                   73.2    9e-15   Vitis vinifera
gb|AAP46257.1|  putative polyprotein                                  77.8    9e-15   Oryza sativa Japonica Group [Japonica rice]
gb|ABF96035.1|  retrotransposon protein, putative, unclassified       77.8    1e-14   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008369160.1|  PREDICTED: uncharacterized protein LOC103432739  77.4    1e-14   
gb|ABF97883.1|  retrotransposon protein, putative, unclassified       77.8    1e-14   Oryza sativa Japonica Group [Japonica rice]
gb|AGW47867.1|  polyprotein                                           77.4    1e-14   
emb|CAD41731.1|  OSJNBb0034I13.10                                     77.4    1e-14   Oryza sativa [red rice]
ref|XP_002456688.1|  hypothetical protein SORBIDRAFT_03g040848        77.4    1e-14   Sorghum bicolor [broomcorn]
emb|CAD41367.2|  OSJNBa0088A01.6                                      77.4    1e-14   Oryza sativa Japonica Group [Japonica rice]
gb|AGH20680.1|  reverse transcriptase                                 74.7    1e-14   
ref|NP_001059496.1|  Os07g0434200                                     77.4    1e-14   Oryza sativa Japonica Group [Japonica rice]
gb|AGH20673.1|  reverse transcriptase                                 74.7    1e-14   
ref|NP_001064098.1|  Os10g0130700                                     77.0    1e-14   Oryza sativa Japonica Group [Japonica rice]
emb|CAH66624.1|  OSIGBa0115A19.5                                      77.0    1e-14   Oryza sativa [red rice]
gb|AGH20677.1|  reverse transcriptase                                 74.3    1e-14   
emb|CAH66352.1|  OSIGBa0135C09.3                                      77.0    1e-14   Oryza sativa [red rice]
gb|ABA99612.1|  retrotransposon protein, putative, unclassified       77.0    1e-14   Oryza sativa Japonica Group [Japonica rice]
emb|CAN62871.1|  hypothetical protein VITISV_015208                   77.0    1e-14   Vitis vinifera
gb|AAT38786.2|  Gag-pol polyprotein, putative                         77.0    2e-14   Solanum demissum
emb|CAN63433.1|  hypothetical protein VITISV_033829                   77.0    2e-14   Vitis vinifera
gb|AAO23081.1|  putative copia-type retrotransposon protein           77.0    2e-14   Oryza sativa Japonica Group [Japonica rice]
gb|AAL75752.1|AC037197_10  Putative copia-type polyprotein            77.0    2e-14   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006588032.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...  74.7    2e-14   
gb|AGH20679.1|  reverse transcriptase                                 74.3    2e-14   
gb|ABF81447.1|  NBS type disease resistance protein                   76.6    2e-14   Populus trichocarpa [western balsam poplar]
gb|AAL66750.1|AF464738_1  putative gag protein                        76.6    2e-14   Zea mays [maize]
gb|ADB85424.1|  putative retrotransposon protein                      77.0    2e-14   Phyllostachys edulis [kikko-chiku]
gb|ABA95266.1|  retrotransposon protein, putative, Ty1-copia subc...  77.0    2e-14   Oryza sativa Japonica Group [Japonica rice]
gb|AAM94552.1|  putative polyprotein                                  77.0    2e-14   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008229173.1|  PREDICTED: uncharacterized protein LOC103328554  77.0    2e-14   
emb|CAE03128.3|  OJ000114_01.9                                        77.0    2e-14   Oryza sativa Japonica Group [Japonica rice]
gb|AAG60200.1|AC084763_20  putative gag-pol polyprotein               77.0    2e-14   Oryza sativa [red rice]
gb|AAP12940.1|  transposon protein, putative, CACTA, En/Spm sub-c...  77.0    2e-14   Oryza sativa Japonica Group [Japonica rice]
gb|ABG66113.1|  retrotransposon protein, putative, Ty1-copia subc...  77.0    2e-14   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009767581.1|  PREDICTED: uncharacterized protein LOC104218715  73.6    2e-14   
ref|XP_004986769.1|  PREDICTED: uncharacterized protein LOC101784335  76.3    2e-14   
gb|ABA95820.1|  retrotransposon protein, putative, unclassified       76.6    2e-14   Oryza sativa Japonica Group [Japonica rice]
emb|CAE04657.2|  OSJNBa0061G20.13                                     76.6    2e-14   Oryza sativa Japonica Group [Japonica rice]
emb|CAH66692.1|  OSIGBa0097A15.7                                      76.6    2e-14   Oryza sativa [red rice]
gb|EEC81933.1|  hypothetical protein OsI_25798                        76.6    2e-14   Oryza sativa Indica Group [Indian rice]
gb|AAT93883.1|  putative polyprotein                                  76.6    2e-14   Oryza sativa Japonica Group [Japonica rice]
gb|AAO73525.1|  gag-pol polyprotein                                   76.6    2e-14   Glycine max [soybeans]
gb|AAO73529.1|  gag-pol polyprotein                                   76.6    2e-14   Glycine max [soybeans]
emb|CAE04331.1|  OSJNBb0016D16.22                                     76.6    3e-14   Oryza sativa [red rice]
gb|AAO17005.1|  Putative gag-pol polyprotein                          76.6    3e-14   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009597067.1|  PREDICTED: uncharacterized protein LOC104093052  73.6    3e-14   
gb|ABA96719.2|  retrotransposon protein, putative, unclassified       76.3    3e-14   Oryza sativa Japonica Group [Japonica rice]
dbj|BAB01972.1|  copia-like retrotransposable element                 76.3    3e-14   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010451516.1|  PREDICTED: uncharacterized protein LOC104733649  76.3    3e-14   
gb|ABF95875.1|  retrotransposon protein, putative, unclassified       76.3    3e-14   Oryza sativa Japonica Group [Japonica rice]
gb|ABA99153.1|  retrotransposon protein, putative, Ty1-copia subc...  76.3    3e-14   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008337255.1|  PREDICTED: retrovirus-related Pol polyprotei...  76.3    3e-14   
ref|XP_002445205.1|  hypothetical protein SORBIDRAFT_07g005900        75.9    3e-14   Sorghum bicolor [broomcorn]
gb|ABA98827.2|  retrotransposon protein, putative, Ty1-copia subc...  75.9    3e-14   Oryza sativa Japonica Group [Japonica rice]
gb|AAK53850.1|AC016781_4  Putative retroelement                       75.9    4e-14   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001059837.1|  Os07g0528100                                     75.9    4e-14   Oryza sativa Japonica Group [Japonica rice]
gb|ABA92210.1|  retrotransposon protein, putative, unclassified       75.1    4e-14   Oryza sativa Japonica Group [Japonica rice]
emb|CAD39343.2|  OSJNBa0094O15.12                                     75.9    4e-14   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008237766.1|  PREDICTED: uncharacterized protein LOC103336496  75.9    5e-14   
gb|KFK32854.1|  hypothetical protein AALP_AA6G295700                  75.1    5e-14   
gb|ABF96984.1|  retrotransposon protein, putative, Ty1-copia subc...  75.5    6e-14   
gb|AAO37468.1|  putative polyprotein                                  75.5    6e-14   
gb|AAK92658.1|AC079634_19  Putative retroelement                      75.5    6e-14   
emb|CAN72965.1|  hypothetical protein VITISV_025340                   70.9    6e-14   
gb|AAN05371.1|  Putative retroelement                                 75.5    6e-14   
dbj|BAG94704.1|  unnamed protein product                              75.1    6e-14   
ref|XP_008244758.1|  PREDICTED: putative leucine-rich repeat rece...  74.7    6e-14   
gb|AGH20676.1|  reverse transcriptase                                 72.8    6e-14   
gb|AAU90089.1|  putative polyprotein                                  75.1    7e-14   
ref|XP_006341843.1|  PREDICTED: uncharacterized protein LOC102597917  74.7    7e-14   
emb|CAE05272.1|  OSJNBb0014D23.6                                      75.1    7e-14   
gb|AAW57784.1|  putative polyprotein                                  75.1    7e-14   
ref|XP_008387235.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  75.1    7e-14   
gb|ABN08974.1|  gag-pol polyprotein, putative                         73.9    7e-14   
emb|CAN66133.1|  hypothetical protein VITISV_026878                   75.1    7e-14   
emb|CAH66897.1|  OSIGBa0099L20.12                                     74.7    8e-14   
ref|XP_010039206.1|  PREDICTED: LOW QUALITY PROTEIN: scarecrow-li...  75.1    8e-14   
emb|CAE03782.2|  OSJNBa0063G07.6                                      75.1    8e-14   
emb|CAH66560.1|  OSIGBa0113K06.6                                      75.1    8e-14   
gb|EEE52905.1|  hypothetical protein OsJ_35506                        74.7    8e-14   
gb|ABA96076.1|  retrotransposon protein, putative, unclassified       75.1    8e-14   
emb|CAN77815.1|  hypothetical protein VITISV_023977                   74.7    8e-14   
gb|AGH20667.1|  reverse transcriptase                                 72.4    8e-14   
gb|AGH20671.1|  reverse transcriptase                                 72.4    8e-14   
gb|AFK88547.1|  reverse transcriptase                                 72.4    9e-14   
ref|XP_006598505.1|  PREDICTED: uncharacterized protein LOC102667806  73.9    9e-14   
ref|XP_004501790.1|  PREDICTED: uncharacterized protein LOC101505133  74.7    9e-14   
gb|AFN88207.1|  integrase core domain containing protein              74.7    9e-14   
ref|XP_007037557.1|  Uncharacterized protein TCM_014246               68.9    9e-14   
gb|AAG50698.1|AC079604_5  copia-type polyprotein, putative            74.7    1e-13   
ref|XP_008362270.1|  PREDICTED: pentatricopeptide repeat-containi...  73.2    1e-13   
gb|AAG60117.1|AC073555_1  copia-type polyprotein, putative            74.7    1e-13   
emb|CAB71063.1|  copia-type polyprotein                               74.7    1e-13   
gb|AAD50001.1|AC007259_14  Hypothetical protein                       74.7    1e-13   
gb|AAP68410.1|  putative gag/pol polyprotein                          74.3    1e-13   
gb|AFK88544.1|  reverse transcriptase                                 72.4    1e-13   
gb|ABF97935.1|  retrotransposon protein, putative, unclassified       74.3    1e-13   
emb|CAB75469.1|  copia-type reverse transcriptase-like protein        74.7    1e-13   
gb|AFK88553.1|  reverse transcriptase                                 72.4    1e-13   
ref|XP_008373256.1|  PREDICTED: uncharacterized protein LOC103436593  73.2    1e-13   
gb|AGH20678.1|  reverse transcriptase                                 72.4    1e-13   
gb|AFK88542.1|  reverse transcriptase                                 72.4    1e-13   
gb|AFK88543.1|  reverse transcriptase                                 72.0    1e-13   
gb|AAG52949.1|  gag/pol polyprotein                                   74.7    1e-13   
emb|CAH66391.1|  OSIGBa0134J07.9                                      74.3    1e-13   
emb|CAN81839.1|  hypothetical protein VITISV_033739                   74.3    1e-13   
gb|AGH20672.1|  reverse transcriptase                                 72.0    1e-13   
ref|XP_007050318.1|  Uncharacterized protein TCM_004065               74.3    1e-13   
gb|ABA95283.1|  retrotransposon protein, putative, unclassified, ...  74.3    1e-13   
ref|NP_001068391.2|  Os11g0656500                                     74.3    1e-13   
emb|CAH66177.1|  OSIGBa0130O15.1                                      74.3    1e-13   
ref|NP_001068460.1|  Os11g0682500                                     74.3    1e-13   
emb|CAE03978.3|  OSJNBa0033H08.2                                      74.3    1e-13   
gb|AAP53887.2|  retrotransposon protein, putative, Ty1-copia subc...  74.3    2e-13   
gb|EEC67008.1|  hypothetical protein OsI_33720                        73.9    2e-13   
ref|XP_009773554.1|  PREDICTED: uncharacterized protein LOC104223752  73.6    2e-13   
gb|AAK50132.1|AC087797_17  putative gag-pol polyprotein               74.3    2e-13   
gb|AAX95629.1|  Reverse transcriptase (RNA-dependent DNA polymera...  73.9    2e-13   
gb|ABF98474.1|  retrotransposon protein, putative, Ty1-copia subc...  74.3    2e-13   
gb|ADB85427.1|  putative retrotransposon protein                      73.9    2e-13   
gb|AFK88546.1|  reverse transcriptase                                 71.6    2e-13   
gb|ABA98030.2|  retrotransposon protein, putative, Ty1-copia subc...  73.9    2e-13   
emb|CAN65499.1|  hypothetical protein VITISV_010671                   73.6    2e-13   
gb|AAL77140.1|AC097447_6  Putative pol polyprotein                    73.9    2e-13   
emb|CAE03692.2|  OSJNBb0026E15.10                                     73.9    2e-13   
ref|XP_010657845.1|  PREDICTED: uncharacterized protein LOC104880998  72.0    2e-13   
gb|ABI34342.1|  Polyprotein, putative                                 73.9    2e-13   
emb|CAN64172.1|  hypothetical protein VITISV_041386                   73.9    2e-13   
gb|AAY87195.1|  reverse transcriptase                                 69.7    2e-13   
ref|XP_008462933.1|  PREDICTED: uncharacterized protein LOC103501196  73.6    2e-13   
emb|CAN77983.1|  hypothetical protein VITISV_000988                   73.6    2e-13   
ref|XP_004514847.1|  PREDICTED: uncharacterized protein LOC101506504  70.9    2e-13   
emb|CAE05094.3|  OSJNBa0009K15.14                                     73.6    2e-13   
emb|CAA69272.1|  lectin receptor kinase                               73.2    2e-13   
gb|AAC64917.1|  gag-pol polyprotein                                   73.6    2e-13   
emb|CAN59755.1|  hypothetical protein VITISV_034567                   73.6    2e-13   
gb|AAK26118.1|AC084406_1  putative gag-pol polyprotein                73.6    2e-13   
gb|AFK88541.1|  reverse transcriptase                                 71.2    3e-13   
gb|ABF98209.1|  retrotransposon protein, putative, Ty1-copia subc...  73.6    3e-13   
emb|CAN65188.1|  hypothetical protein VITISV_004365                   73.6    3e-13   
gb|AFK88549.1|  reverse transcriptase                                 71.2    3e-13   
emb|CAN75483.1|  hypothetical protein VITISV_042793                   73.2    3e-13   
emb|CAN79061.1|  hypothetical protein VITISV_024577                   73.2    3e-13   
gb|AAN60991.1|  Putative Zea mays retrotransposon Opie-2              73.6    3e-13   
gb|AAT38797.2|  Polyprotein, putative                                 73.2    3e-13   
gb|AGH20669.1|  reverse transcriptase                                 70.9    3e-13   
gb|ABF99351.1|  retrotransposon protein, putative, unclassified       73.2    3e-13   
ref|XP_010233157.1|  PREDICTED: protein CHROMATIN REMODELING 24-like  73.2    3e-13   
gb|KDP30510.1|  hypothetical protein JCGZ_16690                       71.6    3e-13   
gb|ABI34329.1|  Integrase core domain containing protein              73.2    4e-13   
gb|AFK88548.1|  reverse transcriptase                                 70.9    4e-13   
emb|CAN65521.1|  hypothetical protein VITISV_025368                   73.2    4e-13   
gb|AAP44677.1|  putative gag-pol polyprotein                          73.2    4e-13   
gb|ABF94034.1|  retrotransposon protein, putative, unclassified       73.2    4e-13   
gb|AFP55578.1|  copia-type polyprotein                                72.8    4e-13   
emb|CAN71132.1|  hypothetical protein VITISV_007235                   72.8    4e-13   
gb|KHN25158.1|  Copia protein                                         69.7    4e-13   
emb|CDO75139.1|  hypothetical protein BN946_scf184772.g6              72.8    5e-13   
ref|XP_008359946.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  72.8    5e-13   
ref|XP_009619297.1|  PREDICTED: uncharacterized protein LOC104111325  72.0    5e-13   
gb|ACN78973.1|  copia-type polyprotein                                72.4    5e-13   
ref|XP_009589820.1|  PREDICTED: uncharacterized protein LOC104087119  71.6    5e-13   
gb|ABA91088.1|  retrotransposon protein, putative, Ty1-copia subc...  72.8    5e-13   
gb|ABA95567.1|  retrotransposon protein, putative, Ty1-copia subc...  72.8    5e-13   
gb|EMT06479.1|  hypothetical protein F775_22266                       72.4    5e-13   
gb|AGH20675.1|  reverse transcriptase                                 70.5    6e-13   
gb|ABB46643.2|  retrotransposon protein, putative, Ty1-copia subc...  72.8    6e-13   
gb|AAM08718.1|AC116601_11  Putative gag-pol polyprotein               72.8    6e-13   
gb|AAO26686.1|AF478373_1  gag-pol polyprotein                         69.3    6e-13   
gb|EMS47553.1|  Glutamyl-tRNA reductase 1, chloroplastic              72.0    6e-13   
emb|CAD40418.3|  OSJNBa0065J03.14                                     72.0    6e-13   
emb|CAN63534.1|  hypothetical protein VITISV_001206                   72.4    6e-13   
emb|CAN65144.1|  hypothetical protein VITISV_026080                   72.4    7e-13   
emb|CAN71748.1|  hypothetical protein VITISV_019194                   72.4    7e-13   
gb|ABY49842.1|  hypothetical protein                                  72.4    7e-13   
gb|KHN06274.1|  Retrovirus-related Pol polyprotein from transposo...  72.4    7e-13   
ref|XP_002489262.1|  hypothetical protein SORBIDRAFT_0011s005440      72.4    7e-13   
emb|CAN83548.1|  hypothetical protein VITISV_035575                   72.4    7e-13   
gb|AAT38758.1|  Putative gag-pol polyprotein, identical               72.4    7e-13   
gb|AAV59370.1|  hypothetical protein                                  72.4    7e-13   
gb|AGH20664.1|  reverse transcriptase                                 69.7    8e-13   
gb|AAL79695.1|AC087599_14  putative gag-pol polyprotein               72.0    8e-13   
gb|AAN05503.1|  Putative gag-pol polyprotein                          72.0    8e-13   
gb|ACC63530.1|  polyprotein                                           72.0    9e-13   
emb|CAC06113.1|  reverse transcriptase                                67.4    9e-13   
gb|ABB47474.1|  retrotransposon protein, putative, unclassified       71.6    9e-13   
ref|NP_001060895.1|  Os08g0125300                                     72.0    9e-13   
ref|XP_008464774.1|  PREDICTED: uncharacterized protein LOC103502582  71.2    9e-13   
gb|AGH20665.1|  reverse transcriptase                                 69.7    9e-13   
ref|XP_007032471.1|  Cysteine-rich RLK (RECEPTOR-like protein kin...  69.7    1e-12   
ref|XP_004137882.1|  PREDICTED: ABC transporter C family member 1...  72.0    1e-12   
gb|EEC84282.1|  hypothetical protein OsI_30754                        72.0    1e-12   
ref|XP_006584292.1|  PREDICTED: uncharacterized protein LOC102668041  71.6    1e-12   
ref|XP_002489303.1|  hypothetical protein SORBIDRAFT_0010s005460      71.2    1e-12   
emb|CAN70384.1|  hypothetical protein VITISV_008145                   71.6    1e-12   
emb|CAN76029.1|  hypothetical protein VITISV_016069                   71.6    1e-12   
gb|ABA96626.1|  retrotransposon protein, putative, unclassified       71.6    1e-12   
emb|CAN76080.1|  hypothetical protein VITISV_008975                   70.1    1e-12   
emb|CAN73567.1|  hypothetical protein VITISV_003451                   71.6    1e-12   
ref|XP_009770788.1|  PREDICTED: uncharacterized protein LOC104221416  67.8    1e-12   
gb|KIK11065.1|  hypothetical protein PISMIDRAFT_19844                 67.0    1e-12   
emb|CAN74536.1|  hypothetical protein VITISV_023111                   71.6    1e-12   
emb|CAN69019.1|  hypothetical protein VITISV_006852                   70.5    1e-12   
ref|XP_008364662.1|  PREDICTED: actin-interacting protein 1-like      70.5    1e-12   
gb|AAD32906.1|  putative retroelement pol polyprotein                 71.2    1e-12   
gb|AAS98452.2|  putative polyprotein                                  71.2    2e-12   
gb|AFK88551.1|  reverse transcriptase                                 68.9    2e-12   
emb|CAN75289.1|  hypothetical protein VITISV_028208                   70.9    2e-12   
gb|ABW74566.1|  integrase                                             70.9    2e-12   
ref|XP_010091283.1|  ABC transporter C family member 9                71.2    2e-12   
gb|ABF97047.1|  retrotransposon protein, putative, Ty1-copia subc...  70.9    2e-12   
emb|CAN80930.1|  hypothetical protein VITISV_005279                   70.9    2e-12   
gb|EXX50149.1|  gag-pol fusion protein                                70.9    2e-12   
gb|AAK92587.1|AC074354_21  Putative retroelement                      70.9    2e-12   
ref|XP_008388960.1|  PREDICTED: DNA polymerase zeta catalytic sub...  70.9    2e-12   
ref|XP_010662190.1|  PREDICTED: uncharacterized protein LOC104882010  70.1    2e-12   
ref|XP_010319913.1|  PREDICTED: uncharacterized protein LOC104647048  68.9    2e-12   
emb|CAN83737.1|  hypothetical protein VITISV_032131                   70.1    2e-12   
ref|XP_008387315.1|  PREDICTED: uncharacterized protein LOC103449768  70.9    2e-12   
gb|AFK88552.1|  reverse transcriptase                                 68.6    2e-12   
gb|AAO26685.1|AF478371_1  gag-pol polyprotein                         69.3    3e-12   
gb|AAP44605.1|  putative polyprotein                                  70.5    3e-12   
emb|CAN60648.1|  hypothetical protein VITISV_033947                   70.5    3e-12   
gb|ABF96928.1|  retrotransposon protein, putative, Ty1-copia subc...  69.7    3e-12   
ref|XP_009784254.1|  PREDICTED: uncharacterized protein LOC104232692  69.7    3e-12   
ref|XP_010662448.1|  PREDICTED: uncharacterized protein LOC104882123  70.1    3e-12   
gb|ABW81017.1|  gag-pol polymerase                                    70.5    3e-12   
ref|XP_007045456.1|  Uncharacterized protein TCM_011225               68.9    3e-12   
ref|XP_008368289.1|  PREDICTED: uncharacterized protein LOC103431893  69.7    3e-12   
ref|XP_010412990.1|  PREDICTED: uncharacterized protein LOC104699374  70.5    3e-12   
emb|CAN64075.1|  hypothetical protein VITISV_017997                   70.1    3e-12   
emb|CAN61858.1|  hypothetical protein VITISV_016691                   70.1    3e-12   
emb|CAN63448.1|  hypothetical protein VITISV_008725                   70.1    3e-12   
emb|CAN70357.1|  hypothetical protein VITISV_013713                   70.5    3e-12   
emb|CAE02400.1|  OSJNBa0024J22.4                                      70.1    3e-12   
ref|XP_008460624.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  70.1    3e-12   
emb|CAN66710.1|  hypothetical protein VITISV_006397                   70.1    4e-12   
emb|CAN82637.1|  hypothetical protein VITISV_028818                   70.1    4e-12   
gb|AFK88550.1|  reverse transcriptase                                 68.2    4e-12   
emb|CAN66959.1|  hypothetical protein VITISV_013138                   70.1    4e-12   
gb|AAX95066.1|  retrotransposon protein, putative, unclassified       70.1    4e-12   
gb|ABG21864.1|  retrotransposon protein, putative, Ty1-copia subc...  70.1    4e-12   
gb|AAY87192.1|  reverse transcriptase                                 66.6    4e-12   
emb|CAN66873.1|  hypothetical protein VITISV_021427                   70.1    4e-12   
gb|AAM74419.1|AC123594_2  Putative retroelement                       70.1    4e-12   
gb|EMT27510.1|  hypothetical protein F775_52220                       70.1    4e-12   
ref|XP_009805041.1|  PREDICTED: uncharacterized protein LOC104250166  67.4    4e-12   
gb|AAS01945.1|  putative polyprotein                                  70.1    4e-12   
gb|ABF97213.1|  retrotransposon protein, putative, Ty1-copia subc...  70.1    4e-12   
gb|AAO66558.1|  putative copia-type pol polyprotein                   68.6    4e-12   
emb|CAN72600.1|  hypothetical protein VITISV_036712                   70.1    4e-12   
gb|AAX94901.1|  retrotransposon protein, putative, unclassified       69.7    4e-12   
emb|CDO76804.1|  hypothetical protein BN946_scf185033.g1              69.7    5e-12   
emb|CAN69158.1|  hypothetical protein VITISV_041593                   69.7    5e-12   
emb|CAN71619.1|  hypothetical protein VITISV_042294                   65.9    5e-12   
emb|CAN77977.1|  hypothetical protein VITISV_010463                   66.2    5e-12   
gb|AAX96510.1|  retrotransposon protein, putative, Ty1-copia sub-...  69.3    5e-12   
emb|CAN69707.1|  hypothetical protein VITISV_017209                   66.6    5e-12   
emb|CAE02520.2|  OSJNBb0003A12.7                                      69.7    5e-12   
emb|CDO74894.1|  hypothetical protein BN946_scf184988.g1              69.7    5e-12   
emb|CDO76211.1|  hypothetical protein BN946_scf184602.g1              69.7    5e-12   
gb|EGA81836.1|  hypothetical protein QA23_3043                        68.6    5e-12   
emb|CAD39659.2|  OSJNBa0074B10.16                                     69.7    6e-12   
emb|CAN72453.1|  hypothetical protein VITISV_008931                   69.7    6e-12   
emb|CAN74050.1|  hypothetical protein VITISV_040588                   69.7    6e-12   
ref|XP_008807904.1|  PREDICTED: uncharacterized protein LOC103720116  69.7    6e-12   
ref|XP_008362604.1|  PREDICTED: uncharacterized protein LOC103426292  69.7    6e-12   
ref|XP_007044112.1|  Cysteine-rich RLK (RECEPTOR-like protein kin...  68.9    6e-12   
emb|CAN82171.1|  hypothetical protein VITISV_040546                   69.7    6e-12   
gb|KIL57786.1|  hypothetical protein M378DRAFT_87411                  68.9    6e-12   
ref|XP_002437216.1|  hypothetical protein SORBIDRAFT_10g023023        69.7    6e-12   
emb|CAN77122.1|  hypothetical protein VITISV_013624                   69.7    6e-12   
emb|CAN69855.1|  hypothetical protein VITISV_041230                   69.3    6e-12   
ref|XP_008363252.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  69.3    6e-12   
gb|EEE67150.1|  hypothetical protein OsJ_24213                        69.3    6e-12   
dbj|BAA22288.1|  polyprotein                                          69.3    6e-12   
emb|CAN80919.1|  hypothetical protein VITISV_002640                   69.7    6e-12   
emb|CAE04807.2|  OSJNBb0022P19.2                                      69.3    6e-12   
gb|AAL83348.1|AC074282_15  Putative gag-pol polyprotein               69.3    7e-12   
gb|ABB47865.2|  retrotransposon protein, putative, Ty1-copia subc...  69.3    7e-12   
gb|AAM95676.1|  putative polyprotein                                  69.3    7e-12   



>ref|XP_004145727.1| PREDICTED: uncharacterized protein LOC101212001 [Cucumis sativus]
Length=2598

 Score = 93.6 bits (231),  Expect = 4e-20, Method: Composition-based stats.
 Identities = 41/50 (82%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = +2

Query  2     FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGF  151
             FAPVARLEAIR+ LA+A+YKNF +YQMDVKSAFLNG + EEVYVEQPPGF
Sbjct  1722  FAPVARLEAIRMLLAFASYKNFILYQMDVKSAFLNGYIVEEVYVEQPPGF  1771



>emb|CCI55376.1| PH01B035L11.21 [Phyllostachys edulis]
Length=2029

 Score = 92.8 bits (229),  Expect = 6e-20, Method: Composition-based stats.
 Identities = 42/50 (84%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = +2

Query  2     FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGF  151
             FAPVARLEAIRI LA+AA K F +YQMDVKSAFLNGL+EEEVYV QPPGF
Sbjct  1553  FAPVARLEAIRILLAFAASKGFKLYQMDVKSAFLNGLIEEEVYVRQPPGF  1602



>emb|CAN60533.1| hypothetical protein VITISV_001512 [Vitis vinifera]
Length=133

 Score = 86.7 bits (213),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 39/50 (78%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGF  151
            FAPVARLEAIR+ LA+A +K+F +YQMDVKSAFLNG + EEVYVEQPPGF
Sbjct  66   FAPVARLEAIRMLLAFACFKDFVLYQMDVKSAFLNGFINEEVYVEQPPGF  115



>emb|CAN77391.1| hypothetical protein VITISV_003225 [Vitis vinifera]
Length=127

 Score = 86.3 bits (212),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 39/50 (78%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGF  151
            FAPVARLEAIR+ LA+A +K+F +YQMDVKSAFLNG + EEVYVEQPPGF
Sbjct  66   FAPVARLEAIRMLLAFACFKDFVLYQMDVKSAFLNGFINEEVYVEQPPGF  115



>gb|KFZ88828.1| reverse transcriptase, partial [Thiobacillus prosperus]
Length=79

 Score = 84.7 bits (208),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 38/50 (76%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGF  151
            +APVARLEAI++ LA+A YKNF ++QMDVKSAFLNG + EEVYVEQPPGF
Sbjct  11   YAPVARLEAIQLLLAFACYKNFRLFQMDVKSAFLNGFIHEEVYVEQPPGF  60



>emb|CAN75653.1| hypothetical protein VITISV_004538 [Vitis vinifera]
Length=133

 Score = 86.3 bits (212),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 39/50 (78%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGF  151
            FAPVARLEAIR+ LA+A +K+F +YQMDVKSAFLNG + EEVYVEQPPGF
Sbjct  66   FAPVARLEAIRMLLAFACFKDFVLYQMDVKSAFLNGFINEEVYVEQPPGF  115



>gb|AAD09019.1| copia protein [Zea mays]
Length=447

 Score = 90.1 bits (222),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 40/50 (80%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGF  151
            FAPVARLE+IRI LAYAA+ +F +YQMDVKSAFLNG ++EEVYVEQPPGF
Sbjct  65   FAPVARLESIRILLAYAAHHSFRLYQMDVKSAFLNGPIKEEVYVEQPPGF  114



>emb|CAN83181.1| hypothetical protein VITISV_013310 [Vitis vinifera]
Length=455

 Score = 90.1 bits (222),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 39/50 (78%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGF  151
            FAPVARLEAIR+ LA+A +K+F +YQMDVKSAFLNG + EEVYVEQPPGF
Sbjct  31   FAPVARLEAIRMLLAFACFKDFVLYQMDVKSAFLNGFINEEVYVEQPPGF  80



>emb|CAN74951.1| hypothetical protein VITISV_030567 [Vitis vinifera]
Length=2203

 Score = 90.9 bits (224),  Expect = 3e-19, Method: Composition-based stats.
 Identities = 39/50 (78%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = +2

Query  2     FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGF  151
             FAPVARLEAIR+ LA+A +K+F +YQMDVKSAFLNG + EEVYVEQPPGF
Sbjct  1456  FAPVARLEAIRMLLAFACFKDFILYQMDVKSAFLNGFINEEVYVEQPPGF  1505



>gb|AEJ07899.1| Opie3 putative pol protein [Zea mays subsp. mexicana]
Length=1048

 Score = 90.1 bits (222),  Expect = 3e-19, Method: Composition-based stats.
 Identities = 40/50 (80%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGF  151
            FAPVARLE+IRI LAYAA+ +F +YQMDVKSAFLNG ++EEVYVEQPPGF
Sbjct  620  FAPVARLESIRILLAYAAHHSFRLYQMDVKSAFLNGPIKEEVYVEQPPGF  669



>gb|AAC49502.1| Pol [Zea mays]
Length=1068

 Score = 90.1 bits (222),  Expect = 3e-19, Method: Composition-based stats.
 Identities = 40/50 (80%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGF  151
            FAPVARLE+IRI LAYAA+ +F +YQMDVKSAFLNG ++EEVYVEQPPGF
Sbjct  640  FAPVARLESIRILLAYAAHHSFRLYQMDVKSAFLNGPIKEEVYVEQPPGF  689



>gb|ABF67947.1| Opie2 pol protein [Zea mays]
Length=1048

 Score = 90.1 bits (222),  Expect = 4e-19, Method: Composition-based stats.
 Identities = 40/50 (80%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGF  151
            FAPVARLE+IRI LAYAA+ +F +YQMDVKSAFLNG ++EEVYVEQPPGF
Sbjct  620  FAPVARLESIRILLAYAAHHSFRLYQMDVKSAFLNGPIKEEVYVEQPPGF  669



>gb|AAW57789.1| putative polyprotein [Oryza sativa Japonica Group]
Length=1799

 Score = 90.5 bits (223),  Expect = 4e-19, Method: Composition-based stats.
 Identities = 40/50 (80%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = +2

Query  2     FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGF  151
             FAPVARLEAIRI LA+AA K F ++QMDVKSAFLNG++EEEVYV+QPPGF
Sbjct  1371  FAPVARLEAIRILLAFAASKGFKLFQMDVKSAFLNGVIEEEVYVKQPPGF  1420



>emb|CAN64335.1| hypothetical protein VITISV_001808 [Vitis vinifera]
Length=1885

 Score = 90.5 bits (223),  Expect = 4e-19, Method: Composition-based stats.
 Identities = 38/50 (76%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = +2

Query  2     FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGF  151
             FAPVARLEAIR+ LA+A +K+F +YQMDVKSAFLNG + EE+YVEQPPGF
Sbjct  1044  FAPVARLEAIRMLLAFACFKDFILYQMDVKSAFLNGFINEEIYVEQPPGF  1093



>gb|ABF94836.1| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=1948

 Score = 90.5 bits (223),  Expect = 4e-19, Method: Composition-based stats.
 Identities = 40/50 (80%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = +2

Query  2     FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGF  151
             FAPVARLEAIRI LA+AA K F ++QMDVKSAFLNG++EEEVYV+QPPGF
Sbjct  1346  FAPVARLEAIRILLAFAASKGFKLFQMDVKSAFLNGVIEEEVYVKQPPGF  1395



>gb|AAO37957.1| putative gag-pol polyprotein [Oryza sativa Japonica Group]
 gb|ABF99896.1| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=1969

 Score = 90.5 bits (223),  Expect = 4e-19, Method: Composition-based stats.
 Identities = 40/50 (80%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = +2

Query  2     FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGF  151
             FAPVARLEAIRI LA+AA K F ++QMDVKSAFLNG++EEEVYV+QPPGF
Sbjct  1367  FAPVARLEAIRILLAFAASKGFKLFQMDVKSAFLNGVIEEEVYVKQPPGF  1416



>gb|AEJ07927.1| Opie2 pol protein [Zea mays subsp. mexicana]
Length=1048

 Score = 90.1 bits (222),  Expect = 4e-19, Method: Composition-based stats.
 Identities = 40/50 (80%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGF  151
            FAPVARLE+IRI LAYAA+ +F +YQMDVKSAFLNG ++EEVYVEQPPGF
Sbjct  620  FAPVARLESIRILLAYAAHHSFRLYQMDVKSAFLNGPIKEEVYVEQPPGF  669



>gb|ABF67934.1| Opie3 pol polyprotein [Zea mays]
Length=1048

 Score = 90.1 bits (222),  Expect = 4e-19, Method: Composition-based stats.
 Identities = 40/50 (80%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGF  151
            FAPVARLE+IRI LAYAA+ +F +YQMDVKSAFLNG ++EEVYVEQPPGF
Sbjct  620  FAPVARLESIRILLAYAAHHSFRLYQMDVKSAFLNGPIKEEVYVEQPPGF  669



>gb|ABF93543.1| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=2124

 Score = 90.5 bits (223),  Expect = 4e-19, Method: Composition-based stats.
 Identities = 40/50 (80%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = +2

Query  2     FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGF  151
             FAPVARLEAIRI LA+AA K F ++QMDVKSAFLNG++EEEVYV+QPPGF
Sbjct  1346  FAPVARLEAIRILLAFAASKGFKLFQMDVKSAFLNGVIEEEVYVKQPPGF  1395



>gb|AAN60494.1| Putative Zea mays retrotransposon Opie-2 [Oryza sativa Japonica 
Group]
Length=2145

 Score = 90.5 bits (223),  Expect = 4e-19, Method: Composition-based stats.
 Identities = 40/50 (80%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = +2

Query  2     FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGF  151
             FAPVARLEAIRI LA+AA K F ++QMDVKSAFLNG++EEEVYV+QPPGF
Sbjct  1367  FAPVARLEAIRILLAFAASKGFKLFQMDVKSAFLNGVIEEEVYVKQPPGF  1416



>emb|CAE03600.2| OSJNBb0004A17.2 [Oryza sativa Japonica Group]
Length=2256

 Score = 90.5 bits (223),  Expect = 4e-19, Method: Composition-based stats.
 Identities = 40/50 (80%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = +2

Query  2     FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGF  151
             FAPVARLEAIRI LA+AA K F ++QMDVKSAFLNG++EEEVYV+QPPGF
Sbjct  1346  FAPVARLEAIRILLAFAASKGFKLFQMDVKSAFLNGVIEEEVYVKQPPGF  1395



>gb|AAP94592.1| retrotransposon Opie-2 [Zea mays]
Length=1512

 Score = 90.1 bits (222),  Expect = 4e-19, Method: Composition-based stats.
 Identities = 40/50 (80%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = +2

Query  2     FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGF  151
             FAPVARLE+IRI LAYAA+ +F +YQMDVKSAFLNG ++EEVYVEQPPGF
Sbjct  1084  FAPVARLESIRILLAYAAHHSFRLYQMDVKSAFLNGPIKEEVYVEQPPGF  1133



>gb|AAL66759.1|AF464738_10 putative pol protein [Zea mays]
Length=1657

 Score = 90.1 bits (222),  Expect = 4e-19, Method: Composition-based stats.
 Identities = 40/50 (80%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = +2

Query  2     FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGF  151
             FAPVARLE+IRI LAYAA+ +F +YQMDVKSAFLNG ++EEVYVEQPPGF
Sbjct  1229  FAPVARLESIRILLAYAAHHSFRLYQMDVKSAFLNGPIKEEVYVEQPPGF  1278



>emb|CAA71814.1| hypothetical protein [Musa acuminata]
Length=120

 Score = 84.3 bits (207),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 38/50 (76%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGF  151
            FAPVARLEAIR+ LAYA+  NF ++QMDVKSAFLNG + EEV+VEQPPGF
Sbjct  66   FAPVARLEAIRMLLAYASSNNFKLFQMDVKSAFLNGFISEEVFVEQPPGF  115



>gb|AEJ07931.1| Opie3 pol protein [Zea mays subsp. mexicana]
Length=1048

 Score = 90.1 bits (222),  Expect = 5e-19, Method: Composition-based stats.
 Identities = 40/50 (80%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGF  151
            FAPVARLE+IRI LAYAA+ +F +YQMDVKSAFLNG ++EEVYVEQPPGF
Sbjct  620  FAPVARLESIRILLAYAAHHSFRLYQMDVKSAFLNGPIKEEVYVEQPPGF  669



>gb|AAX95391.1| Integrase core domain, putative [Oryza sativa Japonica Group]
 gb|ABA92891.2| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=1584

 Score = 90.1 bits (222),  Expect = 5e-19, Method: Composition-based stats.
 Identities = 39/50 (78%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = +2

Query  2     FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGF  151
             FAPVAR+EAIR+FLA+AA K F +YQMDVKSAFLNG ++EEVYV+QPPGF
Sbjct  1156  FAPVARIEAIRLFLAFAASKCFKLYQMDVKSAFLNGFIQEEVYVKQPPGF  1205



>gb|AEJ07909.1| Opie1 putative pol protein [Zea luxurians]
Length=830

 Score = 89.4 bits (220),  Expect = 6e-19, Method: Composition-based stats.
 Identities = 40/50 (80%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGF  151
            FAPVARLE+IRI LAYAA+ +F +YQMDVKSAFLNG ++EEVYVEQPPGF
Sbjct  620  FAPVARLESIRILLAYAAHHSFRLYQMDVKSAFLNGPIKEEVYVEQPPGF  669



>emb|CAN63212.1| hypothetical protein VITISV_002844 [Vitis vinifera]
Length=900

 Score = 89.4 bits (220),  Expect = 6e-19, Method: Composition-based stats.
 Identities = 39/50 (78%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGF  151
            FAPVARLEAIR+ LA+A +K+F +YQMDVKSAFLNG + EEVYVEQPPGF
Sbjct  66   FAPVARLEAIRMLLAFACFKDFVLYQMDVKSAFLNGFINEEVYVEQPPGF  115



>ref|XP_007010276.1| Cysteine-rich RLK (RECEPTOR-like protein kinase) 8, putative 
[Theobroma cacao]
 gb|EOY19086.1| Cysteine-rich RLK (RECEPTOR-like protein kinase) 8, putative 
[Theobroma cacao]
Length=275

 Score = 86.3 bits (212),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 38/50 (76%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGF  151
            FAPVAR+EAIR+ LA+A + NF +YQMDVKSAFLNG ++EEVYVEQPPGF
Sbjct  66   FAPVARIEAIRLLLAFACFMNFKLYQMDVKSAFLNGFIQEEVYVEQPPGF  115



>gb|AAR89047.1| putative integrase [Oryza sativa Japonica Group]
Length=1507

 Score = 89.7 bits (221),  Expect = 6e-19, Method: Composition-based stats.
 Identities = 38/50 (76%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = +2

Query  2     FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGF  151
             FAPVAR+EAIR+FLA+A+ K F +YQMDVKSAFLNG ++EEVYV+QPPGF
Sbjct  1104  FAPVARIEAIRLFLAFASSKGFKLYQMDVKSAFLNGFIQEEVYVKQPPGF  1153



>gb|ABF97694.1| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=1523

 Score = 89.7 bits (221),  Expect = 6e-19, Method: Composition-based stats.
 Identities = 38/50 (76%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = +2

Query  2     FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGF  151
             FAPVAR+EAIR+FLA+A+ K F +YQMDVKSAFLNG ++EEVYV+QPPGF
Sbjct  1120  FAPVARIEAIRLFLAFASSKGFKLYQMDVKSAFLNGFIQEEVYVKQPPGF  1169



>emb|CAN70635.1| hypothetical protein VITISV_019049 [Vitis vinifera]
Length=691

 Score = 89.0 bits (219),  Expect = 7e-19, Method: Composition-based stats.
 Identities = 39/50 (78%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGF  151
            FAPVARLEAIR+ LA+A +K+F +YQMDVKSAFLNG + EEVYVEQPPGF
Sbjct  319  FAPVARLEAIRMLLAFACFKDFILYQMDVKSAFLNGFINEEVYVEQPPGF  368



>emb|CAN76922.1| hypothetical protein VITISV_015624 [Vitis vinifera]
Length=781

 Score = 89.0 bits (219),  Expect = 8e-19, Method: Composition-based stats.
 Identities = 38/50 (76%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGF  151
            FAP+ARLEAIR+ LA+A +K+F +YQMDVKSAFLNG + EEVYVEQPPGF
Sbjct  177  FAPIARLEAIRMLLAFACFKDFVLYQMDVKSAFLNGFINEEVYVEQPPGF  226



>emb|CAN60489.1| hypothetical protein VITISV_030840 [Vitis vinifera]
Length=738

 Score = 89.0 bits (219),  Expect = 8e-19, Method: Composition-based stats.
 Identities = 39/50 (78%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGF  151
            FAPVARLEAIR+ LA+A +K+F +YQMDVKSAFLNG + EEVYVEQPPGF
Sbjct  30   FAPVARLEAIRMLLAFACFKDFILYQMDVKSAFLNGFINEEVYVEQPPGF  79



>gb|AAD20307.1| copia-type pol polyprotein [Zea mays]
Length=1063

 Score = 89.0 bits (219),  Expect = 9e-19, Method: Composition-based stats.
 Identities = 39/50 (78%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGF  151
            +APVARLE+IRI LAYA Y  F +YQMDVKSAFLNG ++EEVYVEQPPGF
Sbjct  634  YAPVARLESIRILLAYATYHGFKLYQMDVKSAFLNGPIKEEVYVEQPPGF  683



>gb|AEJ07943.1| Ji4 putative pol protein [Zea diploperennis]
Length=1063

 Score = 89.0 bits (219),  Expect = 9e-19, Method: Composition-based stats.
 Identities = 39/50 (78%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGF  151
            +APVARLE+IRI LAYA Y  F +YQMDVKSAFLNG ++EEVYVEQPPGF
Sbjct  634  YAPVARLESIRILLAYATYHGFKLYQMDVKSAFLNGPIKEEVYVEQPPGF  683



>gb|ABF67921.1| Ji1 putative pol protein [Zea mays]
Length=1063

 Score = 89.0 bits (219),  Expect = 9e-19, Method: Composition-based stats.
 Identities = 39/50 (78%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGF  151
            +APVARLE+IRI LAYA Y  F +YQMDVKSAFLNG ++EEVYVEQPPGF
Sbjct  634  YAPVARLESIRILLAYATYHGFKLYQMDVKSAFLNGPIKEEVYVEQPPGF  683



>emb|CAH66675.1| OSIGBa0107E14.5 [Oryza sativa Indica Group]
Length=419

 Score = 87.4 bits (215),  Expect = 9e-19, Method: Composition-based stats.
 Identities = 38/50 (76%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGF  151
            FAPVAR+EAIR+ LA+AA K F +YQMDVKSAFLNG ++EEVYV QPPGF
Sbjct  308  FAPVARIEAIRLLLAFAALKGFKLYQMDVKSAFLNGFIQEEVYVNQPPGF  357



>gb|AAL66753.1|AF464738_4 putative copia-type pol polyprotein [Zea mays]
Length=1604

 Score = 89.0 bits (219),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 39/50 (78%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = +2

Query  2     FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGF  151
             +APVARLE+IRI LAYA Y  F +YQMDVKSAFLNG ++EEVYVEQPPGF
Sbjct  1331  YAPVARLESIRILLAYATYHGFKLYQMDVKSAFLNGPIKEEVYVEQPPGF  1380



>gb|AAL76004.1|AF466646_12 putative gag-pol polyprotein [Zea mays]
Length=1694

 Score = 89.0 bits (219),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 39/50 (78%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = +2

Query  2     FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGF  151
             +APVARLE+IRI LAYA Y  F +YQMDVKSAFLNG ++EEVYVEQPPGF
Sbjct  1434  YAPVARLESIRILLAYATYHGFKLYQMDVKSAFLNGPIKEEVYVEQPPGF  1483



>emb|CCI55284.1| PH01B001G05.7 [Phyllostachys edulis]
Length=1697

 Score = 89.0 bits (219),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 39/50 (78%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = +2

Query  2     FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGF  151
             FAPVARLEAIRI LA+AA K F ++QMDVKS+FLNG +EEEVYV+QPPGF
Sbjct  1246  FAPVARLEAIRILLAFAASKGFKLFQMDVKSSFLNGFIEEEVYVKQPPGF  1295



>gb|AAN40035.1| putative gag-pol polyprotein [Zea mays]
Length=1706

 Score = 89.0 bits (219),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 39/50 (78%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = +2

Query  2     FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGF  151
             +APVARLE+IRI LAYA Y  F +YQMDVKSAFLNG ++EEVYVEQPPGF
Sbjct  1481  YAPVARLESIRILLAYATYHGFKLYQMDVKSAFLNGPIKEEVYVEQPPGF  1530



>gb|AAP94599.1| putative copia-type pol polyprotein [Zea mays]
Length=1760

 Score = 89.0 bits (219),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 39/50 (78%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = +2

Query  2     FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGF  151
             +APVARLE+IRI LAYA Y  F +YQMDVKSAFLNG ++EEVYVEQPPGF
Sbjct  1331  YAPVARLESIRILLAYATYHGFKLYQMDVKSAFLNGPIKEEVYVEQPPGF  1380



>gb|ACA21859.1| Opie2a pol protein [Zea mays]
Length=691

 Score = 88.6 bits (218),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 39/50 (78%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGF  151
            FAPVARL++IRI+LAYAA+ +F +YQMDVKSAFLNG ++EEVYVEQPPGF
Sbjct  263  FAPVARLKSIRIWLAYAAHHSFRLYQMDVKSAFLNGPIKEEVYVEQPPGF  312



>gb|AAN40025.1| putative gag-pol polyprotein [Zea mays]
Length=1892

 Score = 89.0 bits (219),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 39/50 (78%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = +2

Query  2     FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGF  151
             +APVARLE+IRI LAYA Y  F +YQMDVKSAFLNG ++EEVYVEQPPGF
Sbjct  1463  YAPVARLESIRILLAYATYHGFKLYQMDVKSAFLNGPIKEEVYVEQPPGF  1512



>gb|AAL35398.1| Opie2 pol [Zea mays]
Length=691

 Score = 88.2 bits (217),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 39/50 (78%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGF  151
            FAPVARL++IRI+LAYAA+ +F +YQMDVKSAFLNG ++EEVYVEQPPGF
Sbjct  263  FAPVARLKSIRIWLAYAAHHSFRLYQMDVKSAFLNGPIKEEVYVEQPPGF  312



>gb|AAL35396.1| Opie2a pol [Zea mays]
 gb|ACA21858.1| Opie2a pol protein [Zea mays]
Length=1048

 Score = 89.0 bits (219),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 39/50 (78%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGF  151
            FAPVARL++IRI+LAYAA+ +F +YQMDVKSAFLNG ++EEVYVEQPPGF
Sbjct  620  FAPVARLKSIRIWLAYAAHHSFRLYQMDVKSAFLNGPIKEEVYVEQPPGF  669



>emb|CAN69511.1| hypothetical protein VITISV_021468 [Vitis vinifera]
Length=117

 Score = 83.2 bits (204),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 38/50 (76%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGF  151
            FAPVARLEAIR+ LA+A +K+F +YQMDVKSAFLNG + EEVYVEQ PGF
Sbjct  66   FAPVARLEAIRMLLAFACFKDFILYQMDVKSAFLNGFINEEVYVEQQPGF  115



>gb|AEJ07944.1| Opie1 putative pol protein [Zea diploperennis]
Length=1065

 Score = 88.6 bits (218),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 39/50 (78%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGF  151
            FAPVARLE+IRI LAYAA+ +F ++QMDVKSAFLNG ++EEVYVEQPPGF
Sbjct  637  FAPVARLESIRILLAYAAHHSFRLFQMDVKSAFLNGPIKEEVYVEQPPGF  686



>gb|AAL75488.1|AF466202_14 putative pol protein [Zea mays]
Length=800

 Score = 88.2 bits (217),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 39/50 (78%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGF  151
            +APVARLE+IRI LAYA Y  F +YQMDVKSAFLNG ++EEVYVEQPPGF
Sbjct  413  YAPVARLESIRILLAYATYHGFKLYQMDVKSAFLNGPIKEEVYVEQPPGF  462



>gb|AAX96275.1| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
 gb|ABA93378.1| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=1115

 Score = 88.6 bits (218),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 38/50 (76%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGF  151
            FAPVAR+EAIR+ LA+AA K F +YQMDVKSAFLNG ++EEVYV+QPPGF
Sbjct  829  FAPVARIEAIRLLLAFAASKGFKLYQMDVKSAFLNGFIQEEVYVKQPPGF  878



>emb|CAE04585.2| OSJNBb0006N15.2 [Oryza sativa Japonica Group]
Length=1134

 Score = 88.6 bits (218),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 38/50 (76%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGF  151
            FAPVAR+EAIR+ LA+AA K F +YQMDVKSAFLNG ++EEVYV+QPPGF
Sbjct  765  FAPVARIEAIRLLLAFAASKGFKLYQMDVKSAFLNGFIQEEVYVKQPPGF  814



>gb|AAT93986.1| putative polyprotein [Oryza sativa Japonica Group]
Length=1326

 Score = 88.6 bits (218),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 38/50 (76%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = +2

Query  2     FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGF  151
             FAPVAR+EAIR+ LA+AA K F +YQMDVKSAFLNG ++EEVYV+QPPGF
Sbjct  990   FAPVARIEAIRLLLAFAASKGFKLYQMDVKSAFLNGFIQEEVYVKQPPGF  1039



>emb|CAN83432.1| hypothetical protein VITISV_036817 [Vitis vinifera]
Length=129

 Score = 82.8 bits (203),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 37/50 (74%), Positives = 43/50 (86%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGF  151
            FAPV RLEAIR+ L +A +K+F +YQMDVKSAFLNG + EEVYVEQPPGF
Sbjct  66   FAPVPRLEAIRMLLDFACFKDFVLYQMDVKSAFLNGFINEEVYVEQPPGF  115



>gb|ABA98071.1| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=1408

 Score = 88.6 bits (218),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 38/50 (76%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = +2

Query  2     FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGF  151
             FAPVAR+EAIR+ LA+AA K F +YQMDVKSAFLNG ++EEVYV+QPPGF
Sbjct  1035  FAPVARIEAIRLLLAFAASKGFKLYQMDVKSAFLNGFIQEEVYVKQPPGF  1084



>gb|ABA98847.1| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=1417

 Score = 88.6 bits (218),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 38/50 (76%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = +2

Query  2     FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGF  151
             FAPVAR+EAIR+ LA+AA K F +YQMDVKSAFLNG ++EEVYV+QPPGF
Sbjct  989   FAPVARIEAIRLLLAFAASKGFKLYQMDVKSAFLNGFIQEEVYVKQPPGF  1038



>gb|AAP53706.1| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=1419

 Score = 88.6 bits (218),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 38/50 (76%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = +2

Query  2     FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGF  151
             FAPVAR+EAIR+ LA+AA K F +YQMDVKSAFLNG ++EEVYV+QPPGF
Sbjct  991   FAPVARIEAIRLLLAFAASKGFKLYQMDVKSAFLNGFIQEEVYVKQPPGF  1040



>gb|ABA98045.1| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=1452

 Score = 88.6 bits (218),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 38/50 (76%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = +2

Query  2     FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGF  151
             FAPVAR+EAIR+ LA+AA K F +YQMDVKSAFLNG ++EEVYV+QPPGF
Sbjct  1151  FAPVARIEAIRLLLAFAASKGFKLYQMDVKSAFLNGFIQEEVYVKQPPGF  1200



>emb|CAD40307.2| OSJNBb0013O03.2 [Oryza sativa Japonica Group]
Length=1028

 Score = 88.2 bits (217),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 38/51 (75%), Positives = 46/51 (90%), Gaps = 0/51 (0%)
 Frame = +2

Query  2    FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGFA  154
            FAPVAR+EAIR+ LA+AA K+F +YQMDVKSAFLNG ++EEVYV+QPP FA
Sbjct  752  FAPVARIEAIRLLLAFAALKDFKLYQMDVKSAFLNGFIQEEVYVKQPPDFA  802



>emb|CAN62460.1| hypothetical protein VITISV_035911 [Vitis vinifera]
Length=557

 Score = 87.4 bits (215),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 38/50 (76%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGF  151
            FAPVARLEAIR+  A+A +K+F +YQMDVKSAFLNG + EEVYVEQPPGF
Sbjct  181  FAPVARLEAIRMLRAFACFKDFILYQMDVKSAFLNGFINEEVYVEQPPGF  230



>emb|CAN69531.1| hypothetical protein VITISV_009937 [Vitis vinifera]
Length=426

 Score = 86.3 bits (212),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 38/50 (76%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGF  151
            FAPV RLEAIR+ LA+A +K+F +YQMDVKSAFLNG + EEVYVEQPPGF
Sbjct  31   FAPVTRLEAIRMPLAFACFKDFILYQMDVKSAFLNGFINEEVYVEQPPGF  80



>emb|CAN62895.1| hypothetical protein VITISV_021518 [Vitis vinifera]
Length=573

 Score = 87.0 bits (214),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 38/50 (76%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGF  151
            FAPVARLEAIR+ LA+A +K+F +YQMDVKSAFLNG + EEVYVEQPP F
Sbjct  151  FAPVARLEAIRMLLAFACFKDFVLYQMDVKSAFLNGFINEEVYVEQPPSF  200



>gb|ABF67946.1| putative Opie4 pol protein [Zea mays]
Length=1068

 Score = 87.8 bits (216),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 39/50 (78%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGF  151
            FAPVARLE+I I LAYAA+ +F +YQMDVKSAFLNG ++EEVYVEQPPGF
Sbjct  640  FAPVARLESIHILLAYAAHHSFRLYQMDVKSAFLNGPIKEEVYVEQPPGF  689



>emb|CAN76957.1| hypothetical protein VITISV_022306 [Vitis vinifera]
Length=496

 Score = 86.7 bits (213),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 37/50 (74%), Positives = 43/50 (86%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGF  151
            FAPV RLEAIR+ LA+A +K+F +YQMDVKSAFLN  + EEVYVEQPPGF
Sbjct  31   FAPVTRLEAIRMLLAFACFKDFVLYQMDVKSAFLNDFINEEVYVEQPPGF  80



>emb|CAN65058.1| hypothetical protein VITISV_008902 [Vitis vinifera]
Length=857

 Score = 87.4 bits (215),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 39/50 (78%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGF  151
            FAPVARLEAIR+ LA+A +K F +YQMDVKSAFLNG + EEVYVEQPPGF
Sbjct  31   FAPVARLEAIRMLLAFACFKYFVLYQMDVKSAFLNGFINEEVYVEQPPGF  80



>gb|ABB47538.2| retrotransposon protein, putative, Ty1-copia subclass [Oryza 
sativa Japonica Group]
Length=1222

 Score = 87.8 bits (216),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 38/50 (76%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGF  151
            FAPVAR+EAIR+ LA+AA K F +YQMDVKSAFLNG + EEVYV+QPPGF
Sbjct  883  FAPVARIEAIRLLLAFAASKGFKLYQMDVKSAFLNGFIHEEVYVKQPPGF  932



>gb|AAK50413.1|AC021891_14 Putative retroelement [Oryza sativa Japonica Group]
Length=1232

 Score = 87.8 bits (216),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 38/50 (76%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGF  151
            FAPVAR+EAIR+ LA+AA K F +YQMDVKSAFLNG + EEVYV+QPPGF
Sbjct  919  FAPVARIEAIRLLLAFAASKGFKLYQMDVKSAFLNGFIHEEVYVKQPPGF  968



>ref|WP_010863377.1| Ribonuclease H, partial [Plesiomonas shigelloides]
 gb|EON88790.1| Ribonuclease H, partial [Plesiomonas shigelloides 302-73]
Length=148

 Score = 82.8 bits (203),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 37/50 (74%), Positives = 43/50 (86%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGF  151
            FAPVARLE IR+ ++ AA   + +YQMDVKSAFLNGLLEEEVY+EQPPGF
Sbjct  56   FAPVARLETIRLIISLAAQNAWKIYQMDVKSAFLNGLLEEEVYIEQPPGF  105



>gb|EXX76353.1| gag-pol fusion protein [Rhizophagus irregularis DAOM 197198w]
Length=514

 Score = 86.7 bits (213),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 37/50 (74%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGF  151
            +APVARLEAIRIFLAYAA+KNF V+QMDVK AFL+G ++ +VY++QPPGF
Sbjct  85   YAPVARLEAIRIFLAYAAHKNFKVFQMDVKCAFLHGEIDRDVYIQQPPGF  134



>emb|CAN71245.1| hypothetical protein VITISV_011091 [Vitis vinifera]
Length=550

 Score = 86.3 bits (212),  Expect = 4e-18, Method: Composition-based stats.
 Identities = 38/50 (76%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGF  151
            F PVARLEAIR+ LA+A +K+F +YQMDVKSAFLNG + EEVYVEQPPGF
Sbjct  254  FTPVARLEAIRMVLAFACFKDFVLYQMDVKSAFLNGFINEEVYVEQPPGF  303



>gb|ABA97696.1| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=1514

 Score = 87.4 bits (215),  Expect = 4e-18, Method: Composition-based stats.
 Identities = 37/50 (74%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = +2

Query  2     FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGF  151
             F+PVAR+EAIR+ LA+AA K F +YQMDVKSAFLNG ++EEVYV+QPPGF
Sbjct  1086  FSPVARIEAIRLLLAFAASKGFKLYQMDVKSAFLNGFIQEEVYVKQPPGF  1135



>emb|CAD40455.2| OSJNBa0041M21.13 [Oryza sativa Japonica Group]
 emb|CAD40362.2| OSJNBa0093P23.8 [Oryza sativa Japonica Group]
Length=711

 Score = 86.7 bits (213),  Expect = 4e-18, Method: Composition-based stats.
 Identities = 37/50 (74%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGF  151
            FAPVAR+EAIR+ LA+AA K+F +YQMDVKSAFLNG ++EE+YV+QPPGF
Sbjct  401  FAPVARIEAIRLLLAFAASKSFKLYQMDVKSAFLNGFIQEEIYVKQPPGF  450



>emb|CAN71349.1| hypothetical protein VITISV_023812 [Vitis vinifera]
Length=127

 Score = 81.6 bits (200),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 37/50 (74%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGF  151
            FAPVARLEAIR+ LA++ +K+F +YQMDVKSAFLN  + EEVYVEQPPGF
Sbjct  66   FAPVARLEAIRMLLAFSFFKDFVLYQMDVKSAFLNDFINEEVYVEQPPGF  115



>emb|CAN63777.1| hypothetical protein VITISV_043745 [Vitis vinifera]
Length=898

 Score = 86.7 bits (213),  Expect = 5e-18, Method: Composition-based stats.
 Identities = 37/50 (74%), Positives = 43/50 (86%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGF  151
            FAPVARLEAIR+ LA+A +K+F +YQMDVKS FLNG + EEVY EQPPGF
Sbjct  705  FAPVARLEAIRMLLAFACFKDFILYQMDVKSXFLNGFINEEVYXEQPPGF  754



>emb|CAN68210.1| hypothetical protein VITISV_041836 [Vitis vinifera]
Length=125

 Score = 81.6 bits (200),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 36/50 (72%), Positives = 42/50 (84%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGF  151
            F PVARLEAIR+ LA+  +K+F +YQMDVKSAFLNG + EE YVEQPPGF
Sbjct  66   FVPVARLEAIRMLLAFTCFKDFVLYQMDVKSAFLNGFINEEEYVEQPPGF  115



>emb|CAN60227.1| hypothetical protein VITISV_027166 [Vitis vinifera]
Length=126

 Score = 81.6 bits (200),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 37/48 (77%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPP  145
            FAPVARLEAIR+ LA+A +K+F +YQMDVKSAFLNG + EEVYVEQPP
Sbjct  66   FAPVARLEAIRMLLAFACFKDFILYQMDVKSAFLNGFINEEVYVEQPP  113



>gb|AAL75483.1|AF466202_9 putative pol protein [Zea mays]
Length=1553

 Score = 87.0 bits (214),  Expect = 6e-18, Method: Composition-based stats.
 Identities = 38/50 (76%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = +2

Query  2     FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGF  151
             FAPVARLE+IRI LAY A+ +F ++QMDVKSAFLNG ++EEVYVEQPPGF
Sbjct  1125  FAPVARLESIRILLAYVAHHSFRLFQMDVKSAFLNGPIKEEVYVEQPPGF  1174



>ref|XP_009612215.1| PREDICTED: uncharacterized protein LOC104105574 [Nicotiana tomentosiformis]
Length=499

 Score = 85.5 bits (210),  Expect = 6e-18, Method: Composition-based stats.
 Identities = 37/50 (74%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGF  151
            FAPVAR++AIR+ LA+AA+  FT+YQMDVKSAFLNG L+EEV+V+QPPGF
Sbjct  430  FAPVARMQAIRMLLAFAAHMEFTLYQMDVKSAFLNGYLKEEVFVKQPPGF  479



>gb|AAX96493.1| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
 gb|ABA91692.1| retrotransposon protein, putative, unclassified, expressed [Oryza 
sativa Japonica Group]
Length=1299

 Score = 86.7 bits (213),  Expect = 6e-18, Method: Composition-based stats.
 Identities = 37/50 (74%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = +2

Query  2     FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGF  151
             F PVAR+EAIR+ LA+AA K F +YQMDVKSAFLNG ++EEVYV+QPPGF
Sbjct  957   FVPVARIEAIRLLLAFAASKGFKLYQMDVKSAFLNGFIQEEVYVKQPPGF  1006



>emb|CAN70134.1| hypothetical protein VITISV_021662 [Vitis vinifera]
Length=119

 Score = 81.3 bits (199),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 36/50 (72%), Positives = 43/50 (86%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGF  151
            F PVARLEAIR+ LA+A +K+F +YQMDVK+AFLN  + EEVYVEQPPGF
Sbjct  66   FDPVARLEAIRMLLAFACFKDFVLYQMDVKNAFLNDFINEEVYVEQPPGF  115



>emb|CAN64879.1| hypothetical protein VITISV_021993 [Vitis vinifera]
Length=268

 Score = 83.6 bits (205),  Expect = 7e-18, Method: Composition-based stats.
 Identities = 37/50 (74%), Positives = 43/50 (86%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGF  151
            FAPV RLEAIR+ LA+  +K+F +YQMDVKSAFLNG + EEVYVEQPPGF
Sbjct  98   FAPVDRLEAIRMLLAFTCFKDFVLYQMDVKSAFLNGFINEEVYVEQPPGF  147



>emb|CAN75346.1| hypothetical protein VITISV_035359 [Vitis vinifera]
Length=129

 Score = 81.3 bits (199),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 36/49 (73%), Positives = 43/49 (88%), Gaps = 0/49 (0%)
 Frame = +2

Query  2    FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPG  148
            FAPVARLEAIR+ LA+A +K+F +YQMDVK+ FLNG + EEVYVEQPPG
Sbjct  66   FAPVARLEAIRMLLAFACFKDFILYQMDVKNVFLNGFINEEVYVEQPPG  114



>emb|CAN62159.1| hypothetical protein VITISV_041771 [Vitis vinifera]
Length=460

 Score = 85.1 bits (209),  Expect = 7e-18, Method: Composition-based stats.
 Identities = 37/50 (74%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGF  151
            FAPVARLEAIR+ L +A +K+F +YQMDVKSAFLNG + E+VYVEQPPGF
Sbjct  333  FAPVARLEAIRMLLVFACFKDFVLYQMDVKSAFLNGFINEDVYVEQPPGF  382



>ref|XP_009794325.1| PREDICTED: uncharacterized protein LOC104241107 [Nicotiana sylvestris]
Length=263

 Score = 83.2 bits (204),  Expect = 7e-18, Method: Composition-based stats.
 Identities = 37/50 (74%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGF  151
            FA VARLE+IRI LAYA++K F ++QM+VKSAFLNG +EEEVYV+QPPGF
Sbjct  86   FALVARLESIRILLAYASFKGFRLFQMNVKSAFLNGFIEEEVYVKQPPGF  135



>emb|CAN72344.1| hypothetical protein VITISV_000383 [Vitis vinifera]
Length=889

 Score = 86.3 bits (212),  Expect = 8e-18, Method: Composition-based stats.
 Identities = 36/50 (72%), Positives = 43/50 (86%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGF  151
            FAPVARLEAIR+  A+A +K+F +YQ+DVKS FLNG + EEVYVEQPPGF
Sbjct  307  FAPVARLEAIRMLFAFACFKDFVLYQIDVKSVFLNGFINEEVYVEQPPGF  356



>gb|ABA96551.1| retrotransposon protein, putative, Ty1-copia subclass [Oryza 
sativa Japonica Group]
Length=1487

 Score = 86.7 bits (213),  Expect = 9e-18, Method: Composition-based stats.
 Identities = 37/50 (74%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = +2

Query  2     FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGF  151
             FAPVAR+EAIR+ LA+AA K F ++QMDVKSAFLNG ++EEVYV+QPPGF
Sbjct  1059  FAPVARIEAIRLLLAFAASKGFKLHQMDVKSAFLNGFIQEEVYVKQPPGF  1108



>emb|CAN70326.1| hypothetical protein VITISV_041472 [Vitis vinifera]
Length=393

 Score = 84.3 bits (207),  Expect = 9e-18, Method: Composition-based stats.
 Identities = 37/50 (74%), Positives = 43/50 (86%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGF  151
            FAPVARLE+IR+ LA+A +K F +YQMDVKSAFLN  + EEVYVEQPPGF
Sbjct  31   FAPVARLESIRMLLAFACFKGFVLYQMDVKSAFLNDFINEEVYVEQPPGF  80



>gb|AAX96565.1| retrotransposon protein, putative, Ty1-copia sub-class [Oryza 
sativa Japonica Group]
 gb|ABA95469.1| retrotransposon protein, putative, Ty1-copia subclass [Oryza 
sativa Japonica Group]
Length=709

 Score = 85.9 bits (211),  Expect = 9e-18, Method: Composition-based stats.
 Identities = 37/50 (74%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGF  151
            FAPVAR+EAIR  LA+AA K F +YQMDVKSAFLNG ++EEVY++QPPGF
Sbjct  281  FAPVARIEAIRHLLAFAASKGFKLYQMDVKSAFLNGFIQEEVYIKQPPGF  330



>gb|AAT76321.1| putative integrase [Oryza sativa Japonica Group]
 gb|ABF97341.1| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=1425

 Score = 86.3 bits (212),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 36/50 (72%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = +2

Query  2     FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGF  151
             FAP+AR+EAIR+ LA+AA K F +YQMDVKSAFLNG ++E+VYV+QPPGF
Sbjct  1099  FAPIARIEAIRLLLAFAASKGFKLYQMDVKSAFLNGFIQEKVYVKQPPGF  1148



>gb|AAL31657.1|AC079179_12 Putative Zea mays retrotransposon Opie-2 [Oryza sativa]
 gb|AAM08711.1|AC116601_4 Putative Zea mays retrotransposon Opie-2 [Oryza sativa Japonica 
Group]
 gb|AAP51900.1| retrotransposon protein, putative, Ty1-copia subclass [Oryza 
sativa Japonica Group]
Length=494

 Score = 84.7 bits (208),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 37/50 (74%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGF  151
            FAPVAR+EAIR+ LA+AA K F ++QMDVKSAFLNG ++EEVYV+QPPGF
Sbjct  66   FAPVARIEAIRLLLAFAASKGFKLFQMDVKSAFLNGFIQEEVYVKQPPGF  115



>gb|ABA98369.1| retrotransposon protein, putative, Ty1-copia subclass [Oryza 
sativa Japonica Group]
Length=904

 Score = 85.1 bits (209),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 36/50 (72%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGF  151
            FAP+AR+EAIR+ L +AA K F +YQMDVKSAFLNG ++EEVYV+QPPGF
Sbjct  569  FAPIARIEAIRLLLTFAASKGFKLYQMDVKSAFLNGFIQEEVYVKQPPGF  618



>emb|CAN67656.1| hypothetical protein VITISV_012485 [Vitis vinifera]
Length=133

 Score = 80.5 bits (197),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 36/50 (72%), Positives = 42/50 (84%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGF  151
            FAPV  LEAIR+ LA+A +K+F +YQMDVKS FLNG + EEVYVEQPPGF
Sbjct  66   FAPVVILEAIRMLLAFACFKDFVLYQMDVKSTFLNGFINEEVYVEQPPGF  115



>gb|AEL30380.1| hypothetical protein 205D04_20 [Arachis hypogaea]
Length=1597

 Score = 85.5 bits (210),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 37/50 (74%), Positives = 42/50 (84%), Gaps = 0/50 (0%)
 Frame = +2

Query  2     FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGF  151
             FAPVAR EAIR+ LAYAAYK F ++QMDVK AFLNG ++ EVYV QPPGF
Sbjct  1316  FAPVARREAIRLLLAYAAYKGFKMFQMDVKCAFLNGFIDREVYVAQPPGF  1365



>emb|CAE01974.2| OSJNBb0051N19.3 [Oryza sativa Japonica Group]
Length=1414

 Score = 85.5 bits (210),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 36/50 (72%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = +2

Query  2     FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGF  151
             FAPVAR+EAIR+ LA+AA K F +YQMDVK+ FLNG ++EEVYV+QPPGF
Sbjct  1034  FAPVARIEAIRLLLAFAASKGFKLYQMDVKNVFLNGFIQEEVYVKQPPGF  1083



>gb|AAT85130.1| putative polyprotein [Oryza sativa Japonica Group]
Length=1362

 Score = 85.5 bits (210),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 38/50 (76%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = +2

Query  2     FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGF  151
             FAPVARLE+IRI LAYAA+ +F ++QMDVKSAFLNG + E VYVEQPPGF
Sbjct  1199  FAPVARLESIRILLAYAAHHDFRLFQMDVKSAFLNGPISELVYVEQPPGF  1248



>emb|CAE04887.3| OSJNBa0042I15.9 [Oryza sativa Japonica Group]
Length=1510

 Score = 85.5 bits (210),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 38/50 (76%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = +2

Query  2     FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGF  151
             FAPVARLE+IRI LAYAA+ +F ++QMDVKSAFLNG + E VYVEQPPGF
Sbjct  1077  FAPVARLESIRILLAYAAHHDFRLFQMDVKSAFLNGPISELVYVEQPPGF  1126



>emb|CAN73842.1| hypothetical protein VITISV_008183 [Vitis vinifera]
Length=110

 Score = 79.3 bits (194),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 37/50 (74%), Positives = 42/50 (84%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGF  151
            FAPVARLEAIR+ LA+A +KNF +YQMDVKSAFLNG + EEV VEQPP  
Sbjct  55   FAPVARLEAIRMLLAFACFKNFVLYQMDVKSAFLNGFIIEEVDVEQPPDL  104



>ref|XP_004310161.1| PREDICTED: uncharacterized protein LOC101309698 [Fragaria vesca 
subsp. vesca]
Length=1541

 Score = 85.1 bits (209),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 38/50 (76%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = +2

Query  2     FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGF  151
             FA VARLE++R+ LA A Y  FT+YQMDVKSAFLNG+L+EEVYVEQPPGF
Sbjct  1116  FAHVARLESVRLLLAVAYYLKFTLYQMDVKSAFLNGILKEEVYVEQPPGF  1165



>emb|CAD40731.2| OSJNBa0072D21.17 [Oryza sativa Japonica Group]
 emb|CAE05285.2| OSJNBa0084N21.3 [Oryza sativa Japonica Group]
Length=1452

 Score = 85.1 bits (209),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 36/50 (72%), Positives = 43/50 (86%), Gaps = 0/50 (0%)
 Frame = +2

Query  2     FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGF  151
             F PVAR+EAIR+ LA+A  K F +YQMDVKSAFLNG ++EEVYV+QPPGF
Sbjct  1099  FVPVARIEAIRLLLAFATSKGFKLYQMDVKSAFLNGFIQEEVYVKQPPGF  1148



>emb|CAN81640.1| hypothetical protein VITISV_004897 [Vitis vinifera]
Length=125

 Score = 79.7 bits (195),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 34/50 (68%), Positives = 42/50 (84%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGF  151
            F PVARLEAIR+ LA+  +K+F +YQMDVKSAFLN  ++EE+YVEQPP F
Sbjct  66   FVPVARLEAIRMLLAFTCFKDFVLYQMDVKSAFLNDFIDEEIYVEQPPSF  115



>gb|AAO37458.1| putative polyprotein [Oryza sativa Japonica Group]
 gb|AAS01925.1| putative polyprotein [Oryza sativa Japonica Group]
Length=374

 Score = 82.8 bits (203),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 37/50 (74%), Positives = 43/50 (86%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGF  151
            FAPVA LE+IRI LAYAA+ +F ++QMDVKSAFLNG + E VYVEQPPGF
Sbjct  67   FAPVAHLESIRILLAYAAHHDFRLFQMDVKSAFLNGPISELVYVEQPPGF  116



>ref|XP_009792371.1| PREDICTED: uncharacterized protein LOC104239442 [Nicotiana sylvestris]
Length=641

 Score = 84.3 bits (207),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 35/50 (70%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGF  151
            FAPVARL++I+I L+YA++K F ++QM+VKSAFLNG +EEEVYV+QPPGF
Sbjct  581  FAPVARLKSIQILLSYASFKGFRLFQMEVKSAFLNGFIEEEVYVKQPPGF  630



>ref|XP_004509513.1| PREDICTED: uncharacterized protein LOC101489680, partial [Cicer 
arietinum]
Length=1036

 Score = 84.3 bits (207),  Expect = 4e-17, Method: Composition-based stats.
 Identities = 38/50 (76%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGF  151
            FAPVARLEAIRI LAYA++K   ++QMDVKSAFLNG L E+VYV+QPPGF
Sbjct  81   FAPVARLEAIRILLAYASHKLIKLFQMDVKSAFLNGFLNEQVYVKQPPGF  130



>ref|XP_009881815.1| PREDICTED: uncharacterized protein LOC104285113, partial [Charadrius 
vociferus]
Length=1477

 Score = 84.3 bits (207),  Expect = 4e-17, Method: Composition-based stats.
 Identities = 39/50 (78%), Positives = 41/50 (82%), Gaps = 0/50 (0%)
 Frame = +2

Query  2     FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGF  151
             FAPVARLEAIRI LAYA   N  +YQMDVKSAFLNG + E VYVEQPPGF
Sbjct  1088  FAPVARLEAIRILLAYACAHNIKLYQMDVKSAFLNGKISELVYVEQPPGF  1137



>gb|AAN40030.1| putative gag-pol polyprotein [Zea mays]
Length=2319

 Score = 84.7 bits (208),  Expect = 4e-17, Method: Composition-based stats.
 Identities = 37/50 (74%), Positives = 43/50 (86%), Gaps = 0/50 (0%)
 Frame = +2

Query  2     FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGF  151
             +APVARLE+IRI +AYA   +F +YQMDVKSAFLNG L+E VYVEQPPGF
Sbjct  1394  YAPVARLESIRILIAYATNHDFKLYQMDVKSAFLNGPLQERVYVEQPPGF  1443



>gb|AAK98718.1|AC090483_8 Putative retroelement [Oryza sativa Japonica Group]
Length=1660

 Score = 84.3 bits (207),  Expect = 5e-17, Method: Composition-based stats.
 Identities = 36/50 (72%), Positives = 43/50 (86%), Gaps = 0/50 (0%)
 Frame = +2

Query  2     FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGF  151
             FAPVAR+EAIR+ LA+A  K F +YQMDVKS FLNG ++EEVYV+QPPGF
Sbjct  1203  FAPVARIEAIRLLLAFAVSKGFKLYQMDVKSDFLNGFIQEEVYVKQPPGF  1252



>ref|XP_002461993.1| hypothetical protein SORBIDRAFT_02g011996 [Sorghum bicolor]
 gb|EER98514.1| hypothetical protein SORBIDRAFT_02g011996 [Sorghum bicolor]
Length=438

 Score = 82.8 bits (203),  Expect = 5e-17, Method: Composition-based stats.
 Identities = 35/50 (70%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGF  151
            FAPVARLE++R+ LA+AA + + V+ MDVKSAFLNG+L+E+VYVEQPPGF
Sbjct  299  FAPVARLESVRLLLAHAASQGWAVHHMDVKSAFLNGVLQEQVYVEQPPGF  348



>gb|ABA93940.1| retrotransposon protein, putative, Ty1-copia subclass [Oryza 
sativa Japonica Group]
Length=1508

 Score = 84.3 bits (207),  Expect = 5e-17, Method: Composition-based stats.
 Identities = 36/50 (72%), Positives = 43/50 (86%), Gaps = 0/50 (0%)
 Frame = +2

Query  2     FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGF  151
             FAPVAR+EAIR+ LA+AA K F +YQMDV S FLNG ++EEVYV+QPPGF
Sbjct  1080  FAPVARIEAIRLLLAFAASKGFKLYQMDVNSDFLNGFIQEEVYVKQPPGF  1129



>gb|AAK02025.2|AC074283_6 Putative copia-type pol polyprotein [Oryza sativa]
 gb|AAP52042.1| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=963

 Score = 84.0 bits (206),  Expect = 5e-17, Method: Composition-based stats.
 Identities = 37/50 (74%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGF  151
            FA VAR+EAIR+ LA+AA K F +YQMDVKSAFLNG ++EEVYV+QPPGF
Sbjct  638  FAAVARIEAIRLLLAFAASKGFKLYQMDVKSAFLNGSIQEEVYVKQPPGF  687



>gb|AAX96236.1| retrotransposon protein, putative, Ty1-copia sub-class [Oryza 
sativa Japonica Group]
 gb|ABA92692.1| retrotransposon protein, putative, Ty1-copia subclass [Oryza 
sativa Japonica Group]
Length=1500

 Score = 84.0 bits (206),  Expect = 6e-17, Method: Composition-based stats.
 Identities = 36/50 (72%), Positives = 43/50 (86%), Gaps = 0/50 (0%)
 Frame = +2

Query  2     FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGF  151
             FAPVAR+EAIR+  A+AA K F +YQM VKSAFLNG ++EEVYV+QPPGF
Sbjct  1072  FAPVARIEAIRLLFAFAASKGFKLYQMGVKSAFLNGFIQEEVYVKQPPGF  1121



>ref|XP_007037126.1| Uncharacterized protein TCM_013597 [Theobroma cacao]
 gb|EOY21627.1| Uncharacterized protein TCM_013597 [Theobroma cacao]
Length=157

 Score = 79.3 bits (194),  Expect = 6e-17, Method: Composition-based stats.
 Identities = 34/50 (68%), Positives = 41/50 (82%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGF  151
            F P+ RLEAIR+ +AYA + NF V+QMD KS FLNG ++EEVYVEQPPGF
Sbjct  42   FTPLVRLEAIRLLIAYARFMNFNVFQMDFKSTFLNGFIKEEVYVEQPPGF  91



>ref|XP_009792305.1| PREDICTED: uncharacterized protein LOC104239375 [Nicotiana sylvestris]
Length=206

 Score = 80.1 bits (196),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 35/50 (70%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGF  151
            FAPVA LE++RI  AYA++K F ++QMDVKSAFLNG +EEEVYV++PPGF
Sbjct  57   FAPVAHLESVRILPAYASFKGFRLFQMDVKSAFLNGFIEEEVYVKEPPGF  106



>gb|ABD32582.1| Integrase, catalytic region; Zinc finger, CCHC-type; Peptidase 
aspartic, catalytic [Medicago truncatula]
Length=1715

 Score = 84.0 bits (206),  Expect = 6e-17, Method: Composition-based stats.
 Identities = 37/50 (74%), Positives = 43/50 (86%), Gaps = 0/50 (0%)
 Frame = +2

Query  2     FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGF  151
             FAPVARLEAIR+ L+YA      +YQMDVKSAFLNG++EEEVYV+QPPGF
Sbjct  1289  FAPVARLEAIRLLLSYAINHGIILYQMDVKSAFLNGVIEEEVYVKQPPGF  1338



>gb|AAK70631.1|AC091238_9 Putative copia-type pol polyprotein [Oryza sativa Japonica Group]
 gb|AAM47283.1|AC122146_2 Putative copia-type pol polyprotein [Oryza sativa Japonica Group]
Length=1289

 Score = 84.0 bits (206),  Expect = 6e-17, Method: Composition-based stats.
 Identities = 37/50 (74%), Positives = 43/50 (86%), Gaps = 0/50 (0%)
 Frame = +2

Query  2     FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGF  151
             FAPVAR E+IRI LAYAA+ +F ++QMDVKSAFLNG + E VYVEQPPGF
Sbjct  1101  FAPVARFESIRILLAYAAHHDFRLFQMDVKSAFLNGPISELVYVEQPPGF  1150



>gb|KFK23114.1| hypothetical protein AALP_AAs42267U000100, partial [Arabis alpina]
Length=852

 Score = 83.6 bits (205),  Expect = 6e-17, Method: Composition-based stats.
 Identities = 38/50 (76%), Positives = 41/50 (82%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGF  151
            FAPVARLE+IR FL  A   NF V+QMDVKSAFLNG L+EEVYVEQP GF
Sbjct  495  FAPVARLESIRFFLGMACILNFKVFQMDVKSAFLNGFLQEEVYVEQPKGF  544



>gb|AAP52457.2| retrotransposon protein, putative, Ty1-copia subclass [Oryza 
sativa Japonica Group]
Length=1305

 Score = 84.0 bits (206),  Expect = 6e-17, Method: Composition-based stats.
 Identities = 37/50 (74%), Positives = 43/50 (86%), Gaps = 0/50 (0%)
 Frame = +2

Query  2     FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGF  151
             FAPVAR E+IRI LAYAA+ +F ++QMDVKSAFLNG + E VYVEQPPGF
Sbjct  1117  FAPVARFESIRILLAYAAHHDFRLFQMDVKSAFLNGPISELVYVEQPPGF  1166



>emb|CAN78658.1| hypothetical protein VITISV_003631 [Vitis vinifera]
Length=361

 Score = 81.3 bits (199),  Expect = 7e-17, Method: Composition-based stats.
 Identities = 36/50 (72%), Positives = 43/50 (86%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGF  151
            FA V RLEAIR+ LA+A +K+F +YQMDVK+AFLNG + EEVYVEQPPGF
Sbjct  31   FALVVRLEAIRMLLAFACFKDFVLYQMDVKNAFLNGFINEEVYVEQPPGF  80



>gb|ABA98480.1| retrotransposon protein, putative, Ty1-copia subclass [Oryza 
sativa Japonica Group]
Length=538

 Score = 82.8 bits (203),  Expect = 8e-17, Method: Composition-based stats.
 Identities = 36/50 (72%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGF  151
            FAPVAR+EAIR+ L++AA K F +YQMDVKSAFLNG ++E+VYV+QPPGF
Sbjct  224  FAPVARVEAIRLLLSFAASKGFKLYQMDVKSAFLNGFIQEKVYVKQPPGF  273



>gb|ABA91128.1| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=1258

 Score = 83.6 bits (205),  Expect = 9e-17, Method: Composition-based stats.
 Identities = 36/50 (72%), Positives = 43/50 (86%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGF  151
            FA VAR+EAIR+ LA+A  K F +YQMDVKSAFLNG ++EEVYV+QPPGF
Sbjct  933  FASVARIEAIRLLLAFATSKGFKLYQMDVKSAFLNGFIQEEVYVKQPPGF  982



>emb|CAN60378.1| hypothetical protein VITISV_032103 [Vitis vinifera]
Length=1359

 Score = 83.2 bits (204),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 36/50 (72%), Positives = 42/50 (84%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGF  151
            FA VARLEAIR+ LA+A +K+F +YQMDVKS FLNG + EEVYVEQPP F
Sbjct  840  FASVARLEAIRMLLAFACFKDFVLYQMDVKSVFLNGFINEEVYVEQPPNF  889



>emb|CAN68036.1| hypothetical protein VITISV_003429 [Vitis vinifera]
Length=461

 Score = 81.6 bits (200),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 35/50 (70%), Positives = 43/50 (86%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGF  151
            FAP+ RLEAIR+ LA+A +K+F +YQ+DVKSAFLNG + EEVYVEQPP F
Sbjct  354  FAPIXRLEAIRMLLAFACFKDFVLYQIDVKSAFLNGFINEEVYVEQPPXF  403



>gb|ABF96972.1| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=900

 Score = 82.8 bits (203),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 37/50 (74%), Positives = 43/50 (86%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGF  151
            FAPVA LE+IRI LAYAA+ +F ++QMDVKSAFLNG + E VYVEQPPGF
Sbjct  593  FAPVAHLESIRILLAYAAHHDFRLFQMDVKSAFLNGPISELVYVEQPPGF  642



>ref|XP_002445775.1| hypothetical protein SORBIDRAFT_07g025585 [Sorghum bicolor]
 gb|EES15270.1| hypothetical protein SORBIDRAFT_07g025585 [Sorghum bicolor]
Length=841

 Score = 82.8 bits (203),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 36/50 (72%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGF  151
            FAPVARLE++R+ LA+AA + + V+ MDVKSAFLNG+L+EEVYVEQPPGF
Sbjct  410  FAPVARLESVRLLLAHAACQGWAVHHMDVKSAFLNGVLQEEVYVEQPPGF  459



>ref|NP_001183750.1| uncharacterized protein LOC100502343 [Zea mays]
 gb|ACR38223.1| unknown [Zea mays]
Length=493

 Score = 81.6 bits (200),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 37/50 (74%), Positives = 42/50 (84%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGF  151
            +APVARLE+IRI LAYA Y  F +YQMDVKSAFLNG ++EEVYVEQP  F
Sbjct  65   YAPVARLESIRILLAYATYHGFKLYQMDVKSAFLNGPIKEEVYVEQPSSF  114



>emb|CAN64520.1| hypothetical protein VITISV_030941 [Vitis vinifera]
Length=1527

 Score = 82.8 bits (203),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 36/50 (72%), Positives = 43/50 (86%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGF  151
            FAPVARLEAIR+ LA+A +K+F +YQMDVKSAFLNG + EE+YVEQP  F
Sbjct  578  FAPVARLEAIRMLLAFACFKDFVLYQMDVKSAFLNGFINEEIYVEQPLDF  627



>emb|CAD40165.2| OSJNBa0061A09.4 [Oryza sativa Japonica Group]
Length=1535

 Score = 82.8 bits (203),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 38/50 (76%), Positives = 42/50 (84%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGF  151
            FAPVARLE+IRI LA+A   NF +YQMDVKSAFLNG + E VYVEQPPGF
Sbjct  756  FAPVARLESIRILLAFATNLNFKLYQMDVKSAFLNGPINELVYVEQPPGF  805



>emb|CAN70885.1| hypothetical protein VITISV_018629 [Vitis vinifera]
Length=1003

 Score = 82.8 bits (203),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 36/50 (72%), Positives = 43/50 (86%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGF  151
            FAPV RLEAIR+ LA+A +K+F +YQM VK+AFLNG + EEVYVEQPPGF
Sbjct  167  FAPVVRLEAIRMLLAFACFKDFVLYQMYVKNAFLNGFINEEVYVEQPPGF  216



>gb|ABB46911.2| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=1453

 Score = 82.8 bits (203),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 36/50 (72%), Positives = 43/50 (86%), Gaps = 0/50 (0%)
 Frame = +2

Query  2     FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGF  151
             FA VAR+EAIR+ LA+AA K F +YQMDVKS FLNG ++EEVYV+QPPGF
Sbjct  1120  FALVARIEAIRLLLAFAASKGFNLYQMDVKSVFLNGFIQEEVYVKQPPGF  1169



>ref|XP_008813439.1| PREDICTED: uncharacterized protein LOC103724066 [Phoenix dactylifera]
Length=666

 Score = 82.0 bits (201),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 36/50 (72%), Positives = 42/50 (84%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGF  151
            FAPVARL+ IR+ LA+A Y +F +YQMDVKSAFLNG + EEVYVEQPP F
Sbjct  212  FAPVARLKTIRLLLAFACYIDFKLYQMDVKSAFLNGYITEEVYVEQPPDF  261



>gb|AAM01150.2|AC113336_2 Putative retroelement [Oryza sativa Japonica Group]
 gb|AAM08852.2|AC113337_16 Putative retroelement [Oryza sativa Japonica Group]
Length=1813

 Score = 82.8 bits (203),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 36/50 (72%), Positives = 43/50 (86%), Gaps = 0/50 (0%)
 Frame = +2

Query  2     FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGF  151
             FA VAR+EAIR+ LA+AA K F +YQMDVKS FLNG ++EEVYV+QPPGF
Sbjct  1455  FALVARIEAIRLLLAFAASKGFNLYQMDVKSVFLNGFIQEEVYVKQPPGF  1504



>gb|ABF97245.1| retrotransposon protein, putative, Ty1-copia subclass [Oryza 
sativa Japonica Group]
Length=632

 Score = 81.6 bits (200),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 35/50 (70%), Positives = 43/50 (86%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGF  151
            FAPV R+EAIR+ LA+AA K F +YQMDVK+AFLNG ++EEVY +QPPGF
Sbjct  204  FAPVTRIEAIRLLLAFAASKGFKLYQMDVKNAFLNGFIQEEVYGKQPPGF  253



>gb|KFK33802.1| hypothetical protein AALP_AA5G062200 [Arabis alpina]
Length=774

 Score = 82.0 bits (201),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 37/50 (74%), Positives = 40/50 (80%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGF  151
            FAPVARLE+IR FL      NF V+QMDVKSAFLNG L+EEVYVEQP GF
Sbjct  673  FAPVARLESIRFFLGMTCILNFKVFQMDVKSAFLNGFLQEEVYVEQPKGF  722



>gb|ABA91220.1| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=1860

 Score = 82.4 bits (202),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 36/50 (72%), Positives = 43/50 (86%), Gaps = 0/50 (0%)
 Frame = +2

Query  2     FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGF  151
             FAPVAR+E+IRI LAYAA+ +F ++ MDVKSAFLNG + E VYVEQPPGF
Sbjct  973   FAPVARIESIRILLAYAAHHDFRLFHMDVKSAFLNGPISELVYVEQPPGF  1022



>gb|KFK33801.1| hypothetical protein AALP_AA5G062200 [Arabis alpina]
Length=853

 Score = 82.0 bits (201),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 37/50 (74%), Positives = 40/50 (80%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGF  151
            FAPVARLE+IR FL      NF V+QMDVKSAFLNG L+EEVYVEQP GF
Sbjct  752  FAPVARLESIRFFLGMTCILNFKVFQMDVKSAFLNGFLQEEVYVEQPKGF  801



>gb|AAR01754.1| putative copia-type pol polyprotein [Oryza sativa Japonica Group]
 gb|ABF96746.1| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=1177

 Score = 82.0 bits (201),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 36/50 (72%), Positives = 43/50 (86%), Gaps = 0/50 (0%)
 Frame = +2

Query  2     FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGF  151
             FAPV RLE+IRI LAYAA+ +F ++QMDVKSAFLNG + + VYVEQPPGF
Sbjct  1026  FAPVGRLESIRILLAYAAHHDFRLFQMDVKSAFLNGPISKLVYVEQPPGF  1075



>gb|AAR10863.1| putative copia-type pol polyprotein [Oryza sativa Japonica Group]
Length=649

 Score = 81.6 bits (200),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 35/50 (70%), Positives = 43/50 (86%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGF  151
            FAPV R+EAIR+ LA+AA K F +YQMDVK+AFLNG ++EEVY +QPPGF
Sbjct  221  FAPVTRIEAIRLLLAFAASKGFKLYQMDVKNAFLNGFIQEEVYGKQPPGF  270



>gb|KFK22150.1| hypothetical protein AALP_AAs39584U000100, partial [Arabis alpina]
Length=943

 Score = 82.0 bits (201),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 37/50 (74%), Positives = 41/50 (82%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGF  151
            FAPVARLE+IR FL  A   NF V+QMDVKSAFLNG L+E+VYVEQP GF
Sbjct  698  FAPVARLESIRFFLGMACILNFKVFQMDVKSAFLNGFLQEKVYVEQPKGF  747



>ref|XP_009589231.1| PREDICTED: uncharacterized protein LOC104086621 [Nicotiana tomentosiformis]
Length=490

 Score = 80.9 bits (198),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 34/50 (68%), Positives = 43/50 (86%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGF  151
            FAPVARLE+I I LAY A+K F ++QMDVKSAFLNG + +EV+++QPPGF
Sbjct  394  FAPVARLESIHILLAYVAHKCFRLFQMDVKSAFLNGFISKEVFIKQPPGF  443



>emb|CAN82633.1| hypothetical protein VITISV_028135 [Vitis vinifera]
Length=978

 Score = 82.0 bits (201),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 35/50 (70%), Positives = 41/50 (82%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGF  151
            F PV RLE IR+ L +A +K+F +YQMDVKSAFLNG + EEVYVEQPPGF
Sbjct  66   FXPVXRLEXIRMLLXFACFKDFILYQMDVKSAFLNGFINEEVYVEQPPGF  115



>ref|XP_010236578.1| PREDICTED: uncharacterized protein LOC104584137 [Brachypodium 
distachyon]
Length=527

 Score = 80.9 bits (198),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 37/50 (74%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGF  151
            +APVARLE+IRI LAYA + + ++YQMDVKSAFLNG +EE VYVEQPPGF
Sbjct  65   YAPVARLESIRIVLAYANHHDISLYQMDVKSAFLNGKIEELVYVEQPPGF  114



>gb|ABR16288.1| unknown [Picea sitchensis]
Length=363

 Score = 79.7 bits (195),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 37/50 (74%), Positives = 42/50 (84%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGF  151
            FAPVARL+ IR+ LA AA  N+ VYQMDVKSAFLNG LEEEVYV+QPP +
Sbjct  66   FAPVARLDTIRMVLAIAAQHNWKVYQMDVKSAFLNGYLEEEVYVQQPPRY  115



>emb|CCI61386.1| putative reverse transcriptase (RNA-dependent DNA polymerase), 
partial [Lens orientalis]
Length=225

 Score = 78.6 bits (192),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 34/50 (68%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGF  151
            FAP+ARLE+IR+ +++AA  + T+Y MDVKS FLNGL+EEEVYV+QPPGF
Sbjct  31   FAPIARLESIRLLISFAAQFSITLYHMDVKSDFLNGLIEEEVYVKQPPGF  80



>emb|CAN64324.1| hypothetical protein VITISV_005640 [Vitis vinifera]
Length=557

 Score = 80.9 bits (198),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 37/50 (74%), Positives = 43/50 (86%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGF  151
            FA VARLEAIR+ LA A +K+F +YQ+DVKSAFLNG + EEVYVEQPPGF
Sbjct  66   FALVARLEAIRMLLALACFKDFILYQVDVKSAFLNGFINEEVYVEQPPGF  115



>ref|XP_007037251.1| Integrase, catalytic region, Zinc finger, CCHC-type, Peptidase 
aspartic, catalytic, putative [Theobroma cacao]
 gb|EOY21752.1| Integrase, catalytic region, Zinc finger, CCHC-type, Peptidase 
aspartic, catalytic, putative [Theobroma cacao]
Length=1037

 Score = 81.6 bits (200),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 34/50 (68%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGF  151
            FAPVA +EAIR+ LA+A + NF ++QM+VKSAFLNGL++EEVY+EQ PGF
Sbjct  422  FAPVASVEAIRLLLAFACFMNFKLFQMNVKSAFLNGLIQEEVYIEQSPGF  471



>emb|CAN61443.1| hypothetical protein VITISV_044238 [Vitis vinifera]
Length=650

 Score = 81.3 bits (199),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 35/50 (70%), Positives = 41/50 (82%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGF  151
            FAPVARLEAIR+ LA+A +K+F +YQMDVKS FLN  + E VYVE PPGF
Sbjct  234  FAPVARLEAIRMLLAFACFKDFVLYQMDVKSXFLNDFINEXVYVEXPPGF  283



>gb|ABE88110.1| Reverse transcriptase (RNA-dependent DNA polymerase), putative 
[Medicago truncatula]
Length=1654

 Score = 81.6 bits (200),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 36/50 (72%), Positives = 42/50 (84%), Gaps = 0/50 (0%)
 Frame = +2

Query  2     FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGF  151
             FAPVARLEAIR+ L+YA      +YQMDVKSA LNG++EEEVYV+QPPGF
Sbjct  1228  FAPVARLEAIRLLLSYAINHGIILYQMDVKSALLNGVIEEEVYVKQPPGF  1277



>gb|AAU10766.1| putative polyprotein [Oryza sativa Japonica Group]
Length=1282

 Score = 81.6 bits (200),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 35/50 (70%), Positives = 42/50 (84%), Gaps = 0/50 (0%)
 Frame = +2

Query  2     FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGF  151
             FAPVAR+ +IR+ L +AA K F +YQMDVKSAFLNG  +EEVYV+QPPGF
Sbjct  970   FAPVARIGSIRLLLTFAASKGFKLYQMDVKSAFLNGFTQEEVYVKQPPGF  1019



>emb|CAN71808.1| hypothetical protein VITISV_011726 [Vitis vinifera]
Length=553

 Score = 80.5 bits (197),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 35/50 (70%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGF  151
            FAPVARLEAIR+ LA+A +K+F +YQM++KSAFLNG + EEV+VEQP GF
Sbjct  227  FAPVARLEAIRMLLAFACFKDFVLYQMNMKSAFLNGFINEEVFVEQPLGF  276



>ref|XP_009784034.1| PREDICTED: uncharacterized protein LOC104232507 [Nicotiana sylvestris]
Length=418

 Score = 80.1 bits (196),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 34/50 (68%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGF  151
            FAPVAR+EAIRI +A+A++  FT++Q+DVKS FLNG L+EEVYV+QP GF
Sbjct  343  FAPVARMEAIRILIAFASHMEFTLFQLDVKSVFLNGFLKEEVYVKQPSGF  392



>dbj|BAH79981.1| putative unclassified retrotransposon protein [Oryza sativa Indica 
Group]
Length=1425

 Score = 81.6 bits (200),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 35/50 (70%), Positives = 43/50 (86%), Gaps = 0/50 (0%)
 Frame = +2

Query  2     FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGF  151
             FAPVA +EAIR+ LA+AA K F +YQ DVKSAFLNG +++EVYV+QPPGF
Sbjct  1052  FAPVATIEAIRLLLAFAASKGFKLYQRDVKSAFLNGFIQDEVYVKQPPGF  1101



>gb|AAS90682.1| pupative polyprotein [Oryza sativa Japonica Group]
Length=1404

 Score = 81.3 bits (199),  Expect = 5e-16, Method: Composition-based stats.
 Identities = 36/50 (72%), Positives = 43/50 (86%), Gaps = 0/50 (0%)
 Frame = +2

Query  2     FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGF  151
             FAPVARLE++R+ LAYAA + + V+ MDVKSAFLNG L+EEVYV QPPGF
Sbjct  972   FAPVARLESVRLLLAYAASEGWAVHHMDVKSAFLNGELKEEVYVAQPPGF  1021



>emb|CAN60040.1| hypothetical protein VITISV_012669 [Vitis vinifera]
Length=126

 Score = 76.3 bits (186),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 34/50 (68%), Positives = 41/50 (82%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGF  151
             AP+ARLEA R+ LA+A + +F +YQMDVKSAFLNG + EEVYVEQPP F
Sbjct  66   LAPIARLEAXRMLLAFACFXDFVLYQMDVKSAFLNGFINEEVYVEQPPXF  115



>ref|XP_007032526.1| Cysteine-rich RLK (RECEPTOR-like protein kinase) 8 [Theobroma 
cacao]
 gb|EOY03452.1| Cysteine-rich RLK (RECEPTOR-like protein kinase) 8 [Theobroma 
cacao]
Length=452

 Score = 79.7 bits (195),  Expect = 6e-16, Method: Composition-based stats.
 Identities = 31/50 (62%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGF  151
            F+PVAR++AIR+ LA+A + NF ++QMDVKSAFL+G+++EE+Y+EQPP F
Sbjct  319  FSPVARIKAIRLLLAFACFMNFKLFQMDVKSAFLSGVIQEELYIEQPPSF  368



>ref|XP_009776875.1| PREDICTED: uncharacterized protein LOC104226551 [Nicotiana sylvestris]
Length=412

 Score = 79.3 bits (194),  Expect = 7e-16, Method: Composition-based stats.
 Identities = 34/50 (68%), Positives = 43/50 (86%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGF  151
            FAPV RLEAIR+ +A+AAY  FT +QMD+KSAFL+  L+EEV+V+QPPGF
Sbjct  315  FAPVTRLEAIRLLIAFAAYMKFTHHQMDIKSAFLSDYLKEEVFVKQPPGF  364



>gb|AIC77183.1| polyprotein [Gossypium barbadense]
Length=1369

 Score = 80.9 bits (198),  Expect = 7e-16, Method: Composition-based stats.
 Identities = 34/51 (67%), Positives = 43/51 (84%), Gaps = 0/51 (0%)
 Frame = +2

Query  2    FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGFA  154
            FAPVAR++ IR+ +A AA   + +YQMDVKSAFLNG LEEEVY+EQPPG++
Sbjct  938  FAPVARIDTIRLLIAVAAQYKWKIYQMDVKSAFLNGYLEEEVYIEQPPGYS  988



>ref|XP_009785090.1| PREDICTED: uncharacterized protein LOC104233401 [Nicotiana sylvestris]
Length=502

 Score = 79.7 bits (195),  Expect = 7e-16, Method: Composition-based stats.
 Identities = 36/51 (71%), Positives = 41/51 (80%), Gaps = 0/51 (0%)
 Frame = +2

Query  2    FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGFA  154
            FAPVARLE+IRI L +AA+K    YQMDVKS FLNG + EEVYV+QP GFA
Sbjct  433  FAPVARLESIRILLGFAAHKGLKRYQMDVKSVFLNGYMSEEVYVKQPLGFA  483



>emb|CCI61385.1| putative reverse transcriptase (RNA-dependent DNA polymerase), 
partial [Lens culinaris subsp. culinaris]
Length=225

 Score = 77.4 bits (189),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 34/50 (68%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGF  151
            FAPVARLE+IR+ ++ A+  N T+Y MDVKSAFLNG+++EEVYV+QPPGF
Sbjct  31   FAPVARLESIRLLISSASQFNITLYPMDVKSAFLNGIIDEEVYVKQPPGF  80



>gb|AGM34085.1| cysteine-rich RLK [Lactuca sativa]
Length=580

 Score = 80.1 bits (196),  Expect = 8e-16, Method: Composition-based stats.
 Identities = 37/50 (74%), Positives = 43/50 (86%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGF  151
            FAP+ARLE++RIFLAYAA+KNF V+QMDVK AF+N  LEE VY EQP GF
Sbjct  416  FAPIARLESVRIFLAYAAHKNFEVFQMDVKCAFINRELEETVYAEQPLGF  465



>ref|NP_001061718.1| Os08g0389500 [Oryza sativa Japonica Group]
 dbj|BAF23632.1| Os08g0389500 [Oryza sativa Japonica Group]
Length=1453

 Score = 80.9 bits (198),  Expect = 8e-16, Method: Composition-based stats.
 Identities = 34/50 (68%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = +2

Query  2     FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGF  151
             FAPVAR+E++R+ LA AA+++++V+ MDVKSAFLNG L EEVYV+QPPGF
Sbjct  1026  FAPVARIESVRVLLAVAAHRSWSVHHMDVKSAFLNGDLAEEVYVQQPPGF  1075



>ref|XP_002461816.1| hypothetical protein SORBIDRAFT_02g008720 [Sorghum bicolor]
 gb|EER98337.1| hypothetical protein SORBIDRAFT_02g008720 [Sorghum bicolor]
Length=859

 Score = 80.5 bits (197),  Expect = 9e-16, Method: Composition-based stats.
 Identities = 35/50 (70%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGF  151
            FAPVARLE++R+ LA+AA + + V+ MDVKSAFLNG+L+EEVYV QPPGF
Sbjct  442  FAPVARLESVRLLLAHAACQGWAVHHMDVKSAFLNGVLQEEVYVAQPPGF  491



>emb|CAN67730.1| hypothetical protein VITISV_044473 [Vitis vinifera]
Length=669

 Score = 80.1 bits (196),  Expect = 9e-16, Method: Composition-based stats.
 Identities = 35/50 (70%), Positives = 42/50 (84%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGF  151
            FA  ARLEAIR+ LA+A +K+F +YQM+VKSAFLNG + EEVYVEQPPG 
Sbjct  31   FALXARLEAIRMLLAFACFKDFVLYQMBVKSAFLNGFINEEVYVEQPPGL  80



>emb|CAN74493.1| hypothetical protein VITISV_042722 [Vitis vinifera]
Length=123

 Score = 75.5 bits (184),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 33/49 (67%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = +2

Query  2    FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPG  148
            FAPVARL+ IR+ LA AA K + ++QMDVKSAFLNG LEEE+++EQP G
Sbjct  69   FAPVARLDTIRMLLALAAQKGWNIHQMDVKSAFLNGYLEEEIFMEQPEG  117



>ref|XP_002464673.1| hypothetical protein SORBIDRAFT_01g023130 [Sorghum bicolor]
 gb|EER91671.1| hypothetical protein SORBIDRAFT_01g023130 [Sorghum bicolor]
Length=885

 Score = 80.5 bits (197),  Expect = 9e-16, Method: Composition-based stats.
 Identities = 34/50 (68%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGF  151
            FAPVARLE++R+ LA+AA + + V+ MDVKSAFLNG+L+E+V+VEQPPGF
Sbjct  424  FAPVARLESVRLLLAHAASQGWAVHHMDVKSAFLNGVLQEQVFVEQPPGF  473



>ref|NP_001174195.1| Os05g0126900 [Oryza sativa Japonica Group]
 dbj|BAH92923.1| Os05g0126900 [Oryza sativa Japonica Group]
Length=742

 Score = 80.1 bits (196),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 36/50 (72%), Positives = 43/50 (86%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGF  151
            FAPVARLE++R+ LAYAA + + V+ MDVKSAFLNG L+EEVYV QPPGF
Sbjct  310  FAPVARLESVRLLLAYAASEGWAVHHMDVKSAFLNGELKEEVYVAQPPGF  359



>emb|CAN62791.1| hypothetical protein VITISV_024905 [Vitis vinifera]
Length=956

 Score = 80.1 bits (196),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 37/50 (74%), Positives = 41/50 (82%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGF  151
            FAPVARLE+IRI LA A    F ++QMDVKSAFLNG+L EEVYVEQP GF
Sbjct  575  FAPVARLESIRILLAVACVWKFKLFQMDVKSAFLNGILNEEVYVEQPKGF  624



>ref|XP_010240715.1| PREDICTED: uncharacterized protein LOC100822190 [Brachypodium 
distachyon]
Length=1315

 Score = 80.5 bits (197),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 37/49 (76%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = +2

Query  5     APVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGF  151
             APVARLE IRI LAY  + + T+YQMDVKSAFLNG +EE VYVEQPPGF
Sbjct  1195  APVARLEFIRILLAYDNHHDITLYQMDVKSAFLNGKIEELVYVEQPPGF  1243



>ref|XP_002459428.1| hypothetical protein SORBIDRAFT_02g004525 [Sorghum bicolor]
 gb|EER95949.1| hypothetical protein SORBIDRAFT_02g004525 [Sorghum bicolor]
Length=868

 Score = 80.1 bits (196),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 35/50 (70%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGF  151
            FAPVARLE++R+ LA+AA + + V+ MDVKSAFLNG+L+EEVYV QPPGF
Sbjct  437  FAPVARLESVRLLLAHAACQGWAVHHMDVKSAFLNGVLQEEVYVAQPPGF  486



>dbj|BAK01592.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=237

 Score = 77.0 bits (188),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 34/51 (67%), Positives = 43/51 (84%), Gaps = 0/51 (0%)
 Frame = +2

Query  2    FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGFA  154
            FAPVAR+E++R+ LA AA + + V+ MDVKSAFLNG+L+EEVYV Q PGFA
Sbjct  66   FAPVARMESVRLILALAAQEGWRVHHMDVKSAFLNGVLKEEVYVHQSPGFA  116



>gb|ABA98062.2| retrotransposon protein, putative, Ty1-copia subclass [Oryza 
sativa Japonica Group]
Length=1932

 Score = 80.5 bits (197),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 37/50 (74%), Positives = 42/50 (84%), Gaps = 0/50 (0%)
 Frame = +2

Query  2     FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGF  151
             FAPVARLE+IRI LAYAA+ +F + QMDVKSAFLN  + E VYVEQPPGF
Sbjct  1205  FAPVARLESIRILLAYAAHHDFRLLQMDVKSAFLNRPISELVYVEQPPGF  1254



>ref|XP_009796610.1| PREDICTED: uncharacterized protein LOC104243155 [Nicotiana sylvestris]
Length=234

 Score = 77.0 bits (188),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 34/51 (67%), Positives = 43/51 (84%), Gaps = 0/51 (0%)
 Frame = +2

Query  2    FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGFA  154
            F+PVARL +IRI LA+AA+K F ++QMD+KS FLNG + EEVYV+QPP FA
Sbjct  160  FSPVARLGSIRILLAFAAHKGFMLFQMDIKSTFLNGYISEEVYVKQPPEFA  210



>ref|XP_007022430.1| Uncharacterized protein TCM_032871 [Theobroma cacao]
 gb|EOY13955.1| Uncharacterized protein TCM_032871 [Theobroma cacao]
Length=332

 Score = 77.8 bits (190),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 33/50 (66%), Positives = 43/50 (86%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGF  151
            FAPVAR+EAIR+ LA+A + NF +YQMDVK A LNGL++EE++V+QPP F
Sbjct  68   FAPVARIEAIRLLLAFARFMNFKLYQMDVKCALLNGLIQEELFVQQPPSF  117



>ref|XP_002449917.1| hypothetical protein SORBIDRAFT_05g025655 [Sorghum bicolor]
 gb|EES08905.1| hypothetical protein SORBIDRAFT_05g025655 [Sorghum bicolor]
Length=846

 Score = 79.7 bits (195),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 35/50 (70%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGF  151
            FAPVARLE++R+ LA+AA + + V+ MDVKSAFLNG+L+EEVYV QPPGF
Sbjct  437  FAPVARLESVRLLLAHAACQGWAVHHMDVKSAFLNGVLQEEVYVAQPPGF  486



>emb|CAN69204.1| hypothetical protein VITISV_023040 [Vitis vinifera]
Length=126

 Score = 75.5 bits (184),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 34/50 (68%), Positives = 40/50 (80%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGF  151
            F  V RLEAIR+ L +A +K+F +YQMDVKS FLNG + EEVYVEQPPGF
Sbjct  66   FTFVPRLEAIRMLLDFACFKDFVLYQMDVKSDFLNGFINEEVYVEQPPGF  115



>ref|XP_010476022.1| PREDICTED: uncharacterized protein LOC104755356 [Camelina sativa]
Length=1126

 Score = 79.7 bits (195),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 36/50 (72%), Positives = 42/50 (84%), Gaps = 0/50 (0%)
 Frame = +2

Query  2     FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGF  151
             FAPVARLE+IR+F+  A   NF V+QMDVKSAFLNG+L+EEVYVEQ  GF
Sbjct  999   FAPVARLESIRLFIGMACILNFKVFQMDVKSAFLNGILQEEVYVEQRKGF  1048



>gb|AAO73521.1| gag-pol polyprotein [Glycine max]
Length=1574

 Score = 79.7 bits (195),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 37/51 (73%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = +2

Query  2     FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGFA  154
             FAPVARLE+IR+ L  A    F +YQMDVKSAFLNG L EEVYVEQP GFA
Sbjct  1147  FAPVARLESIRLLLGVACILKFKLYQMDVKSAFLNGYLNEEVYVEQPKGFA  1197



>gb|AAO73523.1| gag-pol polyprotein [Glycine max]
Length=1576

 Score = 79.7 bits (195),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 37/51 (73%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = +2

Query  2     FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGFA  154
             FAPVARLE+IR+ L  A    F +YQMDVKSAFLNG L EEVYVEQP GFA
Sbjct  1149  FAPVARLESIRLLLGVACILKFKLYQMDVKSAFLNGYLNEEVYVEQPKGFA  1199



>gb|AAO73527.1| gag-pol polyprotein [Glycine max]
Length=1576

 Score = 79.7 bits (195),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 37/51 (73%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = +2

Query  2     FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGFA  154
             FAPVARLE+IR+ L  A    F +YQMDVKSAFLNG L EEVYVEQP GFA
Sbjct  1149  FAPVARLESIRLLLGVACILKFKLYQMDVKSAFLNGYLNEEVYVEQPKGFA  1199



>emb|CAN66968.1| hypothetical protein VITISV_040712 [Vitis vinifera]
Length=481

 Score = 78.6 bits (192),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 35/50 (70%), Positives = 42/50 (84%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGF  151
            FAPVARLEAIR+ L +  +K+F +YQ+DVK AFLNG + EEVYVEQPPGF
Sbjct  31   FAPVARLEAIRMLLVFRCFKDFILYQIDVKCAFLNGFINEEVYVEQPPGF  80



>gb|AAY87199.1| reverse transcriptase, partial [Ephedra distachya]
Length=135

 Score = 75.1 bits (183),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 33/50 (66%), Positives = 41/50 (82%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGF  151
            FAPVARL+ IR+ LA AA++ + ++ +DVKSAFLNG LEEEVYV QP GF
Sbjct  13   FAPVARLDTIRMILALAAHRGWEIHHLDVKSAFLNGDLEEEVYVSQPEGF  62



>ref|XP_008238365.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103337005 
[Prunus mume]
Length=1769

 Score = 79.7 bits (195),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 35/50 (70%), Positives = 42/50 (84%), Gaps = 0/50 (0%)
 Frame = +2

Query  2     FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGF  151
             FAPVARLE++R+ LA A +  F +YQMDVK+AFLNG+L EEVYVEQP GF
Sbjct  1210  FAPVARLESVRLLLAIACHLKFKLYQMDVKTAFLNGVLNEEVYVEQPKGF  1259



>gb|ABB46561.1| retrotransposon protein, putative, Ty1-copia subclass [Oryza 
sativa Japonica Group]
Length=1991

 Score = 79.7 bits (195),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 36/50 (72%), Positives = 40/50 (80%), Gaps = 0/50 (0%)
 Frame = +2

Query  2     FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGF  151
             FAPVARLE+IRI LA+    NF +YQMDVKS FLNG + E VYVEQPPGF
Sbjct  1124  FAPVARLESIRILLAFVTNLNFKLYQMDVKSTFLNGPMNELVYVEQPPGF  1173



>gb|AAM08642.1|AC108883_15 Putative copia-type pol polyprotein [Oryza sativa Japonica Group]
Length=1866

 Score = 79.7 bits (195),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 36/50 (72%), Positives = 40/50 (80%), Gaps = 0/50 (0%)
 Frame = +2

Query  2     FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGF  151
             FAPVARLE+IRI LA+    NF +YQMDVKS FLNG + E VYVEQPPGF
Sbjct  999   FAPVARLESIRILLAFVTNLNFKLYQMDVKSTFLNGPMNELVYVEQPPGF  1048



>emb|CAN70899.1| hypothetical protein VITISV_022769 [Vitis vinifera]
Length=397

 Score = 77.8 bits (190),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 35/50 (70%), Positives = 42/50 (84%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGF  151
            FA VARLEAIR+ LA+A + +F +YQMDVKSA LNG + EEV+VEQPPGF
Sbjct  31   FALVARLEAIRMLLAFACFNDFILYQMDVKSALLNGFINEEVHVEQPPGF  80



>ref|XP_008664310.1| PREDICTED: uncharacterized protein LOC103642931 [Zea mays]
Length=374

 Score = 77.8 bits (190),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 35/50 (70%), Positives = 42/50 (84%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGF  151
            FAPVAR+E+IR+ LA AA + + V+ MDVKSAFLNG L+EEVYV QPPGF
Sbjct  66   FAPVARMESIRVLLALAAQEGWAVHHMDVKSAFLNGELKEEVYVTQPPGF  115



>gb|EEE69435.1| hypothetical protein OsJ_28824 [Oryza sativa Japonica Group]
Length=192

 Score = 75.9 bits (185),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 34/50 (68%), Positives = 41/50 (82%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGF  151
            FAPVAR+E++R  LA AA + + V+ MDVKSAFLNG L+EEVYV QPPGF
Sbjct  62   FAPVARMESVRFLLALAAQEGWGVHHMDVKSAFLNGDLKEEVYVHQPPGF  111



>emb|CAN74061.1| hypothetical protein VITISV_017933 [Vitis vinifera]
Length=404

 Score = 77.8 bits (190),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 33/50 (66%), Positives = 42/50 (84%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGF  151
            F  VARLEAIR+ LA+A +K+F +YQ+D+KS FLNG + EEVYV+QPPGF
Sbjct  66   FVSVARLEAIRMLLAFACFKDFVLYQLDLKSVFLNGFINEEVYVKQPPGF  115



>emb|CAD39835.2| OSJNBb0072N21.1 [Oryza sativa Japonica Group]
Length=420

 Score = 78.2 bits (191),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 36/50 (72%), Positives = 43/50 (86%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGF  151
            FA VAR+EAIR+ LA+AA K F +YQMDVKSAFLNG ++EEVYV+Q PGF
Sbjct  66   FAHVARIEAIRLLLAFAASKGFKLYQMDVKSAFLNGFIQEEVYVKQLPGF  115



>gb|ABM55238.1| integrase [Beta vulgaris]
Length=1516

 Score = 79.3 bits (194),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 35/46 (76%), Positives = 39/46 (85%), Gaps = 0/46 (0%)
 Frame = +2

Query  14    ARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGF  151
             ARLEAIRI +A+AAY  F +YQMDVK AFLNG L E+VYVEQPPGF
Sbjct  1095  ARLEAIRILIAFAAYMGFKLYQMDVKCAFLNGYLNEDVYVEQPPGF  1140



>gb|ABH08430.1| putative integrase [Beta vulgaris]
Length=1516

 Score = 79.3 bits (194),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 35/46 (76%), Positives = 39/46 (85%), Gaps = 0/46 (0%)
 Frame = +2

Query  14    ARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGF  151
             ARLEAIRI +A+AAY  F +YQMDVK AFLNG L E+VYVEQPPGF
Sbjct  1095  ARLEAIRILIAFAAYMGFKLYQMDVKCAFLNGYLNEDVYVEQPPGF  1140



>gb|AAM08523.1|AC068654_25 Putative retroelement [Oryza sativa Japonica Group]
 gb|AAP51828.1| retrotransposon protein, putative, Ty1-copia subclass [Oryza 
sativa Japonica Group]
Length=1522

 Score = 79.3 bits (194),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 35/50 (70%), Positives = 42/50 (84%), Gaps = 0/50 (0%)
 Frame = +2

Query  2     FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGF  151
             FA VA +EAIR+ LA+A  K F +YQMDVKSAFLNG ++EEVYV+QPPGF
Sbjct  1094  FANVAIIEAIRLLLAFATSKGFKLYQMDVKSAFLNGFIQEEVYVKQPPGF  1143



>gb|AAY87197.1| reverse transcriptase, partial [Ephedra distachya]
Length=142

 Score = 74.7 bits (182),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 33/50 (66%), Positives = 41/50 (82%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGF  151
            FAPVARL+ IR+ LA AA++ + ++ +DVKSAFLNG LEEEVYV QP GF
Sbjct  20   FAPVARLDTIRMILALAAHRGWEIHHLDVKSAFLNGDLEEEVYVSQPEGF  69



>gb|AAM23248.1|AC092553_14 Putative copia-type pol polyprotein [Oryza sativa Japonica Group]
 gb|AAM47619.1|AC122147_8 Putative copia-type pol polyprotein [Oryza sativa Japonica Group]
Length=845

 Score = 79.0 bits (193),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 35/50 (70%), Positives = 42/50 (84%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGF  151
            FA VAR+EAIR+ LA+A  K F +YQMDVKS FLNG ++EEVYV+QPPGF
Sbjct  417  FAHVARVEAIRLLLAFAISKGFKLYQMDVKSDFLNGFIQEEVYVKQPPGF  466



>gb|AAD17409.1| putative retroelement pol polyprotein [Arabidopsis thaliana]
Length=1347

 Score = 79.3 bits (194),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 36/50 (72%), Positives = 40/50 (80%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGF  151
            FAPV+R + IR  LAYAA   + +YQMDVKSAFLNG LEEEVYV QPPGF
Sbjct  918  FAPVSRYDTIRALLAYAAQMKWRLYQMDVKSAFLNGELEEEVYVTQPPGF  967



>ref|XP_009800411.1| PREDICTED: uncharacterized protein LOC104246309 [Nicotiana sylvestris]
Length=184

 Score = 75.5 bits (184),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 31/50 (62%), Positives = 43/50 (86%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGF  151
            F PVARLEAIR+ +A++AY  FT++QMDVK+A LNG L+E+++V+QPP F
Sbjct  126  FTPVARLEAIRLIIAFSAYMEFTLHQMDVKNAVLNGYLKEQMFVKQPPSF  175



>gb|KFK23370.1| hypothetical protein AALP_AAs49046U000200 [Arabis alpina]
Length=727

 Score = 78.6 bits (192),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 37/50 (74%), Positives = 40/50 (80%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGF  151
            FA VARLE+IR FL  A   NF V+QMDVKSAFLNG L+EEVYVEQP GF
Sbjct  317  FAAVARLESIRFFLGMACILNFKVFQMDVKSAFLNGFLQEEVYVEQPKGF  366



>emb|CAN64779.1| hypothetical protein VITISV_043230 [Vitis vinifera]
Length=1102

 Score = 79.0 bits (193),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 35/50 (70%), Positives = 42/50 (84%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGF  151
            FAPVARL+ IR+ LA AA K + ++QMDVKSAFLNG LEEE++VEQP GF
Sbjct  685  FAPVARLDTIRMLLALAAQKGWNIHQMDVKSAFLNGYLEEEIFVEQPEGF  734



>emb|CAH67708.1| H0512B01.3 [Oryza sativa Indica Group]
Length=1283

 Score = 79.0 bits (193),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 36/50 (72%), Positives = 42/50 (84%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGF  151
            FAPVAR+E+IR+ LA AA K + V+ MDVKSAFLNG L EEVYV+QPPGF
Sbjct  951  FAPVARMESIRLLLAVAAQKGWRVHHMDVKSAFLNGDLAEEVYVKQPPGF  1000



>gb|ABB46679.2| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=809

 Score = 78.6 bits (192),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 35/50 (70%), Positives = 42/50 (84%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGF  151
            FA VAR+EAIR+ LA+A  K F +YQMDVKS FLNG ++EEVYV+QPPGF
Sbjct  381  FAHVARVEAIRLLLAFAISKGFKLYQMDVKSDFLNGFIQEEVYVKQPPGF  430



>gb|KFK23369.1| hypothetical protein AALP_AAs49046U000200 [Arabis alpina]
Length=729

 Score = 78.6 bits (192),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 37/50 (74%), Positives = 40/50 (80%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGF  151
            FA VARLE+IR FL  A   NF V+QMDVKSAFLNG L+EEVYVEQP GF
Sbjct  317  FAAVARLESIRFFLGMACILNFKVFQMDVKSAFLNGFLQEEVYVEQPKGF  366



>ref|XP_002442065.1| hypothetical protein SORBIDRAFT_08g008672 [Sorghum bicolor]
 gb|EES15903.1| hypothetical protein SORBIDRAFT_08g008672 [Sorghum bicolor]
Length=831

 Score = 78.6 bits (192),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 34/50 (68%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGF  151
            FAPVARLE++R+ LA+AA + + V+ MDVKSAFLNG+++EEVYV QPPGF
Sbjct  416  FAPVARLESVRLLLAHAACEGWAVHHMDVKSAFLNGVIQEEVYVAQPPGF  465



>ref|XP_006577547.1| PREDICTED: uncharacterized protein LOC102662042 [Glycine max]
Length=1857

 Score = 79.0 bits (193),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 37/51 (73%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = +2

Query  2     FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGFA  154
             FAPVARLE+IR+ L  A    F +YQMDVKSAFLNG L EEVYVEQP GFA
Sbjct  1445  FAPVARLESIRLLLGVACILKFKLYQMDVKSAFLNGYLNEEVYVEQPKGFA  1495



>gb|AGH20668.1| reverse transcriptase, partial [Arabis hirsuta]
Length=315

 Score = 75.9 bits (185),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 34/50 (68%), Positives = 41/50 (82%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGF  151
            FAPVARLE IR+ +  AA  N+ ++QMDVKSAFLNG LEEEVY+EQP G+
Sbjct  80   FAPVARLETIRLIILLAAQNNWRIHQMDVKSAFLNGDLEEEVYIEQPQGY  129



>emb|CAH67713.1| H0512B01.8 [Oryza sativa Indica Group]
Length=1454

 Score = 78.6 bits (192),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 36/50 (72%), Positives = 42/50 (84%), Gaps = 0/50 (0%)
 Frame = +2

Query  2     FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGF  151
             FAPVAR+E+IR+ LA AA K + V+ MDVKSAFLNG L EEVYV+QPPGF
Sbjct  1020  FAPVARMESIRLLLAVAAQKGWHVHHMDVKSAFLNGDLAEEVYVKQPPGF  1069



>gb|ABF97186.1| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=1759

 Score = 78.6 bits (192),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 36/50 (72%), Positives = 42/50 (84%), Gaps = 0/50 (0%)
 Frame = +2

Query  2     FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGF  151
             FA VA LE+IR+ LAYAA+ +F +YQMDVKSAFLNG + E VYVEQPPGF
Sbjct  1241  FAAVACLESIRMLLAYAAHHDFRLYQMDVKSAFLNGPISELVYVEQPPGF  1290



>gb|AAG59661.1|AC084319_19 putative copia-type pol polyprotein [Oryza sativa Japonica Group]
Length=1778

 Score = 78.6 bits (192),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 36/50 (72%), Positives = 42/50 (84%), Gaps = 0/50 (0%)
 Frame = +2

Query  2     FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGF  151
             FA VA LE+IR+ LAYAA+ +F +YQMDVKSAFLNG + E VYVEQPPGF
Sbjct  1241  FAAVACLESIRMLLAYAAHHDFRLYQMDVKSAFLNGPISELVYVEQPPGF  1290



>ref|NP_001060934.2| Os08g0133100 [Oryza sativa Japonica Group]
 dbj|BAF22848.2| Os08g0133100 [Oryza sativa Japonica Group]
Length=495

 Score = 77.4 bits (189),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 36/50 (72%), Positives = 42/50 (84%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGF  151
            FAPVAR+E+IR+ LA AA K + V+ MDVKSAFLNG L EEVYV+QPPGF
Sbjct  66   FAPVARMESIRLLLAVAAQKGWHVHHMDVKSAFLNGDLAEEVYVKQPPGF  115



>ref|XP_002444793.1| hypothetical protein SORBIDRAFT_07g028153 [Sorghum bicolor]
 gb|EES14288.1| hypothetical protein SORBIDRAFT_07g028153 [Sorghum bicolor]
Length=1288

 Score = 78.6 bits (192),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 35/51 (69%), Positives = 43/51 (84%), Gaps = 0/51 (0%)
 Frame = +2

Query  2     FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGFA  154
             FAPVAR+E++R+ LA AA + + V+ MDVKSAFLNG L+EEVYV QPPGFA
Sbjct  1136  FAPVARMESVRVLLALAAQEGWAVHHMDVKSAFLNGELQEEVYVTQPPGFA  1186



>ref|XP_010520710.1| PREDICTED: uncharacterized protein LOC104799765 [Tarenaya hassleriana]
Length=2275

 Score = 78.6 bits (192),  Expect = 6e-15, Method: Composition-based stats.
 Identities = 35/50 (70%), Positives = 42/50 (84%), Gaps = 0/50 (0%)
 Frame = +2

Query  2     FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGF  151
             FAPVARLE+IR+ L  A   +F ++QMDVKSAFLNG+L+EEVYVEQP GF
Sbjct  1448  FAPVARLESIRLLLGVACSLHFKLFQMDVKSAFLNGVLQEEVYVEQPTGF  1497



>emb|CAN69241.1| hypothetical protein VITISV_009386 [Vitis vinifera]
Length=925

 Score = 78.2 bits (191),  Expect = 6e-15, Method: Composition-based stats.
 Identities = 35/50 (70%), Positives = 42/50 (84%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGF  151
            FAPVARL+ IR+ LA AA K + ++QMDVKSAFLNG LEEE++VEQP GF
Sbjct  522  FAPVARLDTIRMLLALAAQKGWNIHQMDVKSAFLNGYLEEEIFVEQPEGF  571



>emb|CAD37115.3| OSJNBa0033H08.15 [Oryza sativa Japonica Group]
Length=546

 Score = 77.4 bits (189),  Expect = 6e-15, Method: Composition-based stats.
 Identities = 35/50 (70%), Positives = 41/50 (82%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGF  151
            FAPV R+EAIR  LA  A K F +YQMDVKSAFLNG ++E+VYV+QPPGF
Sbjct  426  FAPVDRIEAIRHLLACTASKGFKLYQMDVKSAFLNGFIQEKVYVKQPPGF  475



>ref|XP_010317381.1| PREDICTED: uncharacterized protein LOC101262243 [Solanum lycopersicum]
Length=2102

 Score = 78.2 bits (191),  Expect = 7e-15, Method: Composition-based stats.
 Identities = 34/46 (74%), Positives = 41/46 (89%), Gaps = 0/46 (0%)
 Frame = +2

Query  14   ARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGF  151
            AR+EAIRI +A+AA+  F +YQMDVKSAFLNG L+EEVYV+QPPGF
Sbjct  782  ARMEAIRILIAFAAFMGFKLYQMDVKSAFLNGDLKEEVYVKQPPGF  827



>ref|XP_010501755.1| PREDICTED: uncharacterized protein LOC104779057 [Camelina sativa]
Length=635

 Score = 77.4 bits (189),  Expect = 7e-15, Method: Composition-based stats.
 Identities = 34/50 (68%), Positives = 40/50 (80%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGF  151
            FAP+AR E+IR     A   NFT++QMDVKSAFLNG+L+EEVYVEQP GF
Sbjct  66   FAPMARFESIRFLFGMACALNFTLHQMDVKSAFLNGVLQEEVYVEQPKGF  115



>emb|CAN78660.1| hypothetical protein VITISV_044392 [Vitis vinifera]
Length=127

 Score = 73.6 bits (179),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 32/49 (65%), Positives = 40/49 (82%), Gaps = 0/49 (0%)
 Frame = +2

Query  2    FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPG  148
            FAP+ARL+ IR+ LA AA K + ++QMDVKSAFLNG LEEE++VEQ  G
Sbjct  69   FAPIARLDTIRMLLALAAQKGWNIHQMDVKSAFLNGYLEEEIFVEQHQG  117



>gb|ABA98046.1| retrotransposon protein, putative, Ty1-copia subclass [Oryza 
sativa Japonica Group]
Length=1328

 Score = 78.2 bits (191),  Expect = 7e-15, Method: Composition-based stats.
 Identities = 33/49 (67%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = +2

Query  2     FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPG  148
             FAPVAR+EAIR+ LA++A K F +YQ DVKSAFLNG ++E+VYV+QPP 
Sbjct  1024  FAPVARIEAIRLLLAFSASKGFKLYQKDVKSAFLNGFIQEKVYVKQPPA  1072



>gb|AAP94596.1| putative copia-type pol polyprotein [Zea mays]
Length=469

 Score = 76.6 bits (187),  Expect = 8e-15, Method: Composition-based stats.
 Identities = 35/50 (70%), Positives = 40/50 (80%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGF  151
            +  VARLE+IRI LAYA Y  F +YQMDVKSAFLNG ++ EVYVEQP GF
Sbjct  252  YTLVARLESIRILLAYATYHGFKLYQMDVKSAFLNGPIKGEVYVEQPSGF  301



>emb|CAN65377.1| hypothetical protein VITISV_014188 [Vitis vinifera]
Length=738

 Score = 77.4 bits (189),  Expect = 9e-15, Method: Composition-based stats.
 Identities = 35/50 (70%), Positives = 42/50 (84%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGF  151
            FAPVARL+ IR+ LA AA K + ++QMDVKSAFLNG LEEE++VEQP GF
Sbjct  353  FAPVARLDTIRMLLALAAQKGWNIHQMDVKSAFLNGYLEEEIFVEQPEGF  402



>gb|AGH20682.1| reverse transcriptase, partial [Raphanus sativus]
Length=315

 Score = 75.1 bits (183),  Expect = 9e-15, Method: Composition-based stats.
 Identities = 33/50 (66%), Positives = 43/50 (86%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGF  151
            FAPVARLE +R+ ++ AA K++ ++QMDVKSAFLNG LEEEVY+EQP G+
Sbjct  80   FAPVARLETVRLIISLAAQKSWKIHQMDVKSAFLNGDLEEEVYIEQPQGY  129



>gb|AAT85178.1| putative polyprotein [Oryza sativa Japonica Group]
 gb|AAT94044.1| putative polyprotein [Oryza sativa Japonica Group]
Length=1398

 Score = 77.8 bits (190),  Expect = 9e-15, Method: Composition-based stats.
 Identities = 34/49 (69%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = +2

Query  2     FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPG  148
             FA VAR++AIR  LA+AA K F +YQMDVKSAFLNG ++EEVYV+QPP 
Sbjct  993   FAHVARIQAIRFLLAFAASKGFKLYQMDVKSAFLNGFIQEEVYVKQPPA  1041



>gb|AGH20681.1| reverse transcriptase, partial [Raphanus sativus]
Length=315

 Score = 75.1 bits (183),  Expect = 9e-15, Method: Composition-based stats.
 Identities = 33/50 (66%), Positives = 43/50 (86%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGF  151
            FAPVARLE +R+ ++ AA K++ ++QMDVKSAFLNG LEEEVY+EQP G+
Sbjct  80   FAPVARLETVRLIISLAAQKSWKIHQMDVKSAFLNGDLEEEVYIEQPQGY  129



>emb|CAN67526.1| hypothetical protein VITISV_011686 [Vitis vinifera]
Length=124

 Score = 73.2 bits (178),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 32/47 (68%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = +2

Query  2    FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQP  142
            FAPVARL+ IR+ LA AA K + ++QMDVKS FLNG LEEE++VEQP
Sbjct  69   FAPVARLDTIRMLLALAAQKGWNIHQMDVKSTFLNGYLEEEIFVEQP  115



>gb|AAP46257.1| putative polyprotein [Oryza sativa Japonica Group]
 gb|ABF99717.1| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=1335

 Score = 77.8 bits (190),  Expect = 9e-15, Method: Composition-based stats.
 Identities = 34/51 (67%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = +2

Query  2    FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGFA  154
            +APVARLE IR  +A AA K + +YQ+DVKSAFLNG L+EE+YVEQP GF+
Sbjct  927  YAPVARLETIRTIIALAAQKRWKIYQLDVKSAFLNGYLDEEIYVEQPEGFS  977



>gb|ABF96035.1| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=1705

 Score = 77.8 bits (190),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 35/51 (69%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = +2

Query  2     FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGFA  154
             FAPVARLEAIRI LA+A+  +  ++QMDVKSAFLNG + E V+VEQPPGF 
Sbjct  1026  FAPVARLEAIRILLAFASCFDIKLFQMDVKSAFLNGEIAEPVFVEQPPGFG  1076



>ref|XP_008369160.1| PREDICTED: uncharacterized protein LOC103432739 [Malus domestica]
Length=1034

 Score = 77.4 bits (189),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 35/50 (70%), Positives = 41/50 (82%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGF  151
            FAPVARL+ IR  +A AA K + +YQ+DVKSAFLNG L+EEVYVEQP GF
Sbjct  762  FAPVARLDXIRTLIALAAXKKWNLYQLDVKSAFLNGXLKEEVYVEQPQGF  811



>gb|ABF97883.1| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=1441

 Score = 77.8 bits (190),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 35/50 (70%), Positives = 42/50 (84%), Gaps = 0/50 (0%)
 Frame = +2

Query  2     FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGF  151
             FAPV RLEAIRIFLA+A+  +  ++QMDVKSAFLNG + E V+VEQPPGF
Sbjct  1013  FAPVTRLEAIRIFLAFASCFDIKLFQMDVKSAFLNGEIAELVFVEQPPGF  1062



>gb|AGW47867.1| polyprotein [Phaseolus vulgaris]
Length=1471

 Score = 77.4 bits (189),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 32/50 (64%), Positives = 42/50 (84%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGF  151
            FAPV R+E IR+ ++ AA   + ++QMDVKSAFLNG+LEEEVY+EQPPG+
Sbjct  918  FAPVVRMETIRLLISQAAQFKWPIFQMDVKSAFLNGVLEEEVYIEQPPGY  967



>emb|CAD41731.1| OSJNBb0034I13.10 [Oryza sativa Japonica Group]
Length=1425

 Score = 77.4 bits (189),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 34/50 (68%), Positives = 41/50 (82%), Gaps = 0/50 (0%)
 Frame = +2

Query  2     FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGF  151
             FAPVAR+E +R+ +A AA K + ++ MDVKSAFLNG LEEEVYV QPPGF
Sbjct  995   FAPVARMETVRLLVALAAQKGWEIHHMDVKSAFLNGELEEEVYVVQPPGF  1044



>ref|XP_002456688.1| hypothetical protein SORBIDRAFT_03g040848 [Sorghum bicolor]
 gb|EES01808.1| hypothetical protein SORBIDRAFT_03g040848 [Sorghum bicolor]
Length=1145

 Score = 77.4 bits (189),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 34/50 (68%), Positives = 42/50 (84%), Gaps = 0/50 (0%)
 Frame = +2

Query  2     FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGF  151
             FAPVAR+E +R+ LA AA K + V+ MDVKSAFLNG L+EEVYV+QPPG+
Sbjct  993   FAPVARMEFVRVLLALAAQKGWCVHHMDVKSAFLNGDLKEEVYVQQPPGY  1042



>emb|CAD41367.2| OSJNBa0088A01.6 [Oryza sativa Japonica Group]
Length=1403

 Score = 77.4 bits (189),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 35/50 (70%), Positives = 41/50 (82%), Gaps = 0/50 (0%)
 Frame = +2

Query  2     FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGF  151
             F PVARLE++R+ LA AA   +TV+ MDVKSAFLNG L EEVYV+QPPGF
Sbjct  971   FTPVARLESVRLLLAQAAQAGWTVHHMDVKSAFLNGELAEEVYVKQPPGF  1020



>gb|AGH20680.1| reverse transcriptase, partial [Raphanus sativus]
Length=315

 Score = 74.7 bits (182),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 33/50 (66%), Positives = 43/50 (86%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGF  151
            FAPVARLE +R+ ++ AA K++ ++QMDVKSAFLNG LEEEVY+EQP G+
Sbjct  80   FAPVARLETVRLIISLAAQKSWRIHQMDVKSAFLNGDLEEEVYIEQPQGY  129



>ref|NP_001059496.1| Os07g0434200 [Oryza sativa Japonica Group]
 dbj|BAF21410.1| Os07g0434200, partial [Oryza sativa Japonica Group]
Length=1212

 Score = 77.4 bits (189),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 35/50 (70%), Positives = 42/50 (84%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGF  151
            FAPVARLE++R+ LA+AA + + V+ MDVKSAFLNG L EEVYV QPPGF
Sbjct  781  FAPVARLESVRLLLAHAACEGWAVHHMDVKSAFLNGELLEEVYVAQPPGF  830



>gb|AGH20673.1| reverse transcriptase, partial [Crucihimalaya wallichii]
Length=315

 Score = 74.7 bits (182),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 41/50 (82%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGF  151
            FAPVARLE +R+ ++ AA   + ++QMDVKSAFLNG LEEEVY+EQP G+
Sbjct  80   FAPVARLETVRLIISLAAQNKWKIHQMDVKSAFLNGDLEEEVYIEQPQGY  129



>ref|NP_001064098.1| Os10g0130700 [Oryza sativa Japonica Group]
 gb|AAM23251.1|AC092553_17 Putative pol polyprotein [Oryza sativa Japonica Group]
 gb|AAM47622.1|AC122147_11 Putative pol polyprotein [Oryza sativa Japonica Group]
 gb|AAP51989.1| retrotransposon protein, putative, Ty1-copia subclass, expressed 
[Oryza sativa Japonica Group]
 dbj|BAF26012.1| Os10g0130700 [Oryza sativa Japonica Group]
Length=1426

 Score = 77.0 bits (188),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 34/50 (68%), Positives = 41/50 (82%), Gaps = 0/50 (0%)
 Frame = +2

Query  2     FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGF  151
             FAPVAR+E +R+ +A AA K + ++ MDVKSAFLNG LEEEVYV QPPGF
Sbjct  996   FAPVARMETVRLLIAVAANKGWEIHHMDVKSAFLNGDLEEEVYVVQPPGF  1045



>emb|CAH66624.1| OSIGBa0115A19.5 [Oryza sativa Indica Group]
Length=1426

 Score = 77.0 bits (188),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 34/50 (68%), Positives = 41/50 (82%), Gaps = 0/50 (0%)
 Frame = +2

Query  2     FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGF  151
             FAPVAR+E +R+ +A AA K + ++ MDVKSAFLNG LEEEVYV QPPGF
Sbjct  996   FAPVARMETVRLLIAVAANKGWEIHHMDVKSAFLNGDLEEEVYVVQPPGF  1045



>gb|AGH20677.1| reverse transcriptase, partial [Olimarabidopsis cabulica]
Length=286

 Score = 74.3 bits (181),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 41/50 (82%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGF  151
            FAPVARLE +R+ ++ AA   + ++QMDVKSAFLNG LEEEVY+EQP G+
Sbjct  80   FAPVARLETVRLIISLAAQNEWKIHQMDVKSAFLNGDLEEEVYIEQPQGY  129



>emb|CAH66352.1| OSIGBa0135C09.3 [Oryza sativa Indica Group]
Length=1366

 Score = 77.0 bits (188),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 35/50 (70%), Positives = 41/50 (82%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGF  151
            FAPVARLE +R+ LA AA++ + V+ MDVKSAFLNG L EEVYV QPPGF
Sbjct  932  FAPVARLELVRLLLAIAAHQGWQVHHMDVKSAFLNGELLEEVYVSQPPGF  981



>gb|ABA99612.1| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=1198

 Score = 77.0 bits (188),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 34/51 (67%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = +2

Query  2    FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGFA  154
            +APVARLE IR  +A AA K + +YQ+DVKSAFLNG L+EE+YVEQP GF+
Sbjct  790  YAPVARLETIRTIIALAAQKRWKIYQLDVKSAFLNGYLDEEIYVEQPEGFS  840



>emb|CAN62871.1| hypothetical protein VITISV_015208 [Vitis vinifera]
Length=893

 Score = 77.0 bits (188),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 34/50 (68%), Positives = 40/50 (80%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGF  151
            FA V RLEAIR+ LA+  +K+  +YQMDVKS FLNG + EEVYVEQPPGF
Sbjct  276  FALVPRLEAIRMLLAFTFFKDIVLYQMDVKSDFLNGFINEEVYVEQPPGF  325



>gb|AAT38786.2| Gag-pol polyprotein, putative [Solanum demissum]
Length=1140

 Score = 77.0 bits (188),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 33/50 (66%), Positives = 42/50 (84%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGF  151
            FAPVAR + IR+ LA AA++ + V+Q+DVKSAFLNG LEE++YVEQP GF
Sbjct  724  FAPVARFDTIRLLLAVAAHQGWQVFQLDVKSAFLNGYLEEKIYVEQPEGF  773



>emb|CAN63433.1| hypothetical protein VITISV_033829 [Vitis vinifera]
Length=1072

 Score = 77.0 bits (188),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 34/51 (67%), Positives = 43/51 (84%), Gaps = 0/51 (0%)
 Frame = +2

Query  2    FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGFA  154
            FAPVARL+ IR+ LA AA + + +Y++DVKSAFLNG LEEE++VEQP GFA
Sbjct  729  FAPVARLDTIRMLLALAAQRKWKIYKLDVKSAFLNGYLEEEIFVEQPEGFA  779



>gb|AAO23081.1| putative copia-type retrotransposon protein [Oryza sativa Japonica 
Group]
 gb|ABF96850.1| retrotransposon protein, putative, Ty1-copia subclass [Oryza 
sativa Japonica Group]
Length=1183

 Score = 77.0 bits (188),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 35/50 (70%), Positives = 42/50 (84%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGF  151
            FAPVARLEAIRI LA+A+  +  ++QMDVKSAFLNG + E V+VEQPPGF
Sbjct  676  FAPVARLEAIRILLAFASCFDIKLFQMDVKSAFLNGEIAELVFVEQPPGF  725



>gb|AAL75752.1|AC037197_10 Putative copia-type polyprotein [Oryza sativa Japonica Group]
 gb|AAP51797.1| retrotransposon protein, putative, Ty1-copia subclass [Oryza 
sativa Japonica Group]
Length=1350

 Score = 77.0 bits (188),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 34/51 (67%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = +2

Query  2    FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGFA  154
            +APVARLE IR  +A AA K + +YQ+DVKSAFLNG L+EE+YVEQP GF+
Sbjct  850  YAPVARLETIRTIIALAAQKRWKIYQLDVKSAFLNGYLDEEIYVEQPEGFS  900



>ref|XP_006588032.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic-like 
[Glycine max]
Length=330

 Score = 74.7 bits (182),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 32/50 (64%), Positives = 43/50 (86%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGF  151
            +AP+ARLEAIR+ LA+A+  +F +YQMDVKS FLNG ++E+VYV+QP GF
Sbjct  7    YAPIARLEAIRMLLAFASILDFKLYQMDVKSEFLNGFIQEKVYVDQPHGF  56



>gb|AGH20679.1| reverse transcriptase, partial [Raphanus sativus]
Length=315

 Score = 74.3 bits (181),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 33/50 (66%), Positives = 43/50 (86%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGF  151
            FAPVARLE +R+ ++ AA K++ ++QMDVKSAFLNG LEEEVY+EQP G+
Sbjct  80   FAPVARLETVRLIISLAAQKSWRIHQMDVKSAFLNGDLEEEVYIEQPQGY  129



>gb|ABF81447.1| NBS type disease resistance protein [Populus trichocarpa]
Length=972

 Score = 76.6 bits (187),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 33/50 (66%), Positives = 41/50 (82%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGF  151
            FAPVARLE IR+ ++ AA   + +YQ+DVKSAFLNG LEEE+YVEQP G+
Sbjct  66   FAPVARLETIRLMISLAAQHRWKIYQLDVKSAFLNGFLEEEIYVEQPLGY  115



>gb|AAL66750.1|AF464738_1 putative gag protein [Zea mays]
Length=1016

 Score = 76.6 bits (187),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 35/50 (70%), Positives = 40/50 (80%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGF  151
            +  VARLE+IRI LAYA Y  F +YQMDVKSAFLNG ++ EVYVEQP GF
Sbjct  799  YTLVARLESIRILLAYATYHGFKLYQMDVKSAFLNGPIKGEVYVEQPSGF  848



>gb|ADB85424.1| putative retrotransposon protein [Phyllostachys edulis]
Length=1946

 Score = 77.0 bits (188),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 34/50 (68%), Positives = 42/50 (84%), Gaps = 0/50 (0%)
 Frame = +2

Query  2     FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGF  151
             FAPVAR+E++R+ LA AA + + V+ MDVKSAFLNG L+EEVYV QPPGF
Sbjct  1527  FAPVARMESVRLLLALAAQEGWCVHHMDVKSAFLNGDLKEEVYVRQPPGF  1576



>gb|ABA95266.1| retrotransposon protein, putative, Ty1-copia subclass [Oryza 
sativa Japonica Group]
Length=1388

 Score = 77.0 bits (188),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 34/50 (68%), Positives = 42/50 (84%), Gaps = 0/50 (0%)
 Frame = +2

Query  2     FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGF  151
             FAPVAR+E++R+ LA AA + + V+ MDVKSAFLNG L+EEVYV QPPGF
Sbjct  954   FAPVARMESVRLLLALAAQEGWGVHHMDVKSAFLNGDLKEEVYVHQPPGF  1003



>gb|AAM94552.1| putative polyprotein [Oryza sativa Japonica Group]
Length=1584

 Score = 77.0 bits (188),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 35/50 (70%), Positives = 42/50 (84%), Gaps = 0/50 (0%)
 Frame = +2

Query  2     FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGF  151
             FAPVARLEAIRI LA+A+  +  ++QMDVKSAFLNG + E V+VEQPPGF
Sbjct  1156  FAPVARLEAIRILLAFASCFDIKLFQMDVKSAFLNGEIAELVFVEQPPGF  1205



>ref|XP_008229173.1| PREDICTED: uncharacterized protein LOC103328554 [Prunus mume]
Length=1574

 Score = 77.0 bits (188),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 34/50 (68%), Positives = 41/50 (82%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGF  151
            FAPVARLE++R+ LA A +  F +YQMDVK+AFLNG+L EEVYVEQP  F
Sbjct  297  FAPVARLESVRLLLAIACHLKFKLYQMDVKTAFLNGVLNEEVYVEQPKSF  346



>emb|CAE03128.3| OJ000114_01.9 [Oryza sativa Japonica Group]
Length=1601

 Score = 77.0 bits (188),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 34/50 (68%), Positives = 42/50 (84%), Gaps = 0/50 (0%)
 Frame = +2

Query  2     FAPVARLEAIRIFLAYAAYKNFTVYQMDVKSAFLNGLLEEEVYVEQPPGF  151
             FAPVAR+E++R+ LA AA + + V+ MDVKSAFLNG L+EEVYV QPPGF
Sbjct  1167  FAPVARMESVRLLLALAAQEGWGVHHMDVKSAFLNGDLKEEVYVHQPPGF  1216



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 535674460086