BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c9939_g2_i1 len=405 path=[511:0-404]

Length=405
                                                                      Score     E

ref|XP_011035401.1|  PREDICTED: miraculin-like                          103   4e-24   
ref|XP_002266302.2|  PREDICTED: miraculin-like                          101   5e-24   Vitis vinifera
gb|AEK26933.1|  Kunitz-type trypsin inhibitor B2                        102   6e-24   
gb|ACS92509.1|  Kunitz-type protease inhibitor KPI-D2.3                 102   7e-24   Populus trichocarpa [western balsam poplar]
ref|XP_002305032.2|  trypsin protein inhibitor 3                        102   8e-24   Populus trichocarpa [western balsam poplar]
emb|CAN81015.1|  hypothetical protein VITISV_025776                     102   9e-24   Vitis vinifera
gb|ADD51186.1|  tumor-related protein                                   101   1e-23   Vitis cinerea var. helleri x Vitis riparia
emb|CAN65022.1|  hypothetical protein VITISV_027379                     100   2e-23   Vitis vinifera
ref|XP_002270111.1|  PREDICTED: miraculin                               100   2e-23   Vitis vinifera
ref|XP_002265965.1|  PREDICTED: miraculin                             99.8    7e-23   Vitis vinifera
emb|CAN75396.1|  hypothetical protein VITISV_028636                   99.4    8e-23   Vitis vinifera
ref|XP_002266430.1|  PREDICTED: miraculin                             99.4    9e-23   Vitis vinifera
emb|CBI35464.3|  unnamed protein product                              99.4    1e-22   
ref|XP_006372631.1|  trypsin protein inhibitor 3                      99.0    1e-22   
gb|ADW95389.1|  Kunitz-type trypsin inhibitor                         97.4    5e-22   
gb|AEK26936.1|  Kunitz-type trypsin inhibitor B3                      97.4    5e-22   
emb|CBI35471.3|  unnamed protein product                                101   1e-21   
gb|ACS92519.1|  Kunitz-type protease inhibitor KPI-D8                 95.1    3e-21   Populus trichocarpa x Populus nigra
ref|XP_006347379.1|  PREDICTED: miraculin-like                        95.1    3e-21   
ref|XP_006495063.1|  PREDICTED: miraculin-like                        95.1    4e-21   
ref|XP_006441456.1|  hypothetical protein CICLE_v10023572mg           94.4    6e-21   
gb|AFK39812.1|  unknown                                               93.6    1e-20   
ref|XP_007029361.1|  Kunitz family trypsin and protease inhibitor...  93.2    1e-20   
ref|XP_006351548.1|  PREDICTED: miraculin-like                        93.6    1e-20   
ref|XP_011046090.1|  PREDICTED: miraculin-like                        93.6    2e-20   
ref|XP_004301214.1|  PREDICTED: miraculin-like                        93.6    2e-20   
ref|XP_011035403.1|  PREDICTED: 21 kDa seed protein-like              93.2    2e-20   
ref|XP_010663911.1|  PREDICTED: miraculin-like                        92.8    3e-20   
ref|XP_006441459.1|  hypothetical protein CICLE_v10022284mg           92.4    3e-20   
ref|XP_011035402.1|  PREDICTED: 21 kDa seed protein-like              92.4    4e-20   
emb|CAZ64526.1|  Kunitz trypsin inhibitor                             90.9    4e-20   Populus trichocarpa [western balsam poplar]
ref|XP_006495061.1|  PREDICTED: miraculin-like                        92.0    5e-20   
ref|XP_006441460.1|  hypothetical protein CICLE_v10024584mg           90.9    5e-20   
ref|XP_006441435.1|  hypothetical protein CICLE_v10023257mg           92.0    5e-20   
ref|XP_006493432.1|  PREDICTED: miraculin-like                        93.2    7e-20   
ref|XP_006493430.1|  PREDICTED: miraculin-like                        91.7    7e-20   
ref|XP_002305033.1|  trypsin protein inhibitor 3                      91.7    8e-20   Populus trichocarpa [western balsam poplar]
ref|XP_006441439.1|  hypothetical protein CICLE_v10022282mg           91.3    8e-20   
ref|XP_006493433.1|  PREDICTED: miraculin-like                        91.7    8e-20   
ref|XP_010041215.1|  PREDICTED: miraculin-like                        91.3    9e-20   
ref|XP_007211211.1|  hypothetical protein PRUPE_ppa011496mg           91.3    9e-20   
emb|CBJ94877.1|  kunitz trypsin inhibitor                             89.7    9e-20   Populus balsamifera [balsam poplar]
ref|XP_004137534.1|  PREDICTED: miraculin-like                        91.3    1e-19   
ref|XP_008238584.1|  PREDICTED: miraculin-like                        91.3    1e-19   
ref|XP_009608866.1|  PREDICTED: miraculin-like                        90.9    1e-19   
dbj|BAA82842.1|  miraculin homologue                                  89.4    1e-19   Taraxacum officinale [dandelion]
gb|ACS92500.1|  Kunitz-type protease inhibitor KPI-D9                 90.9    1e-19   Populus trichocarpa x Populus nigra
ref|XP_010537532.1|  PREDICTED: miraculin                             90.9    1e-19   
ref|XP_006495064.1|  PREDICTED: miraculin-like                        90.9    1e-19   
gb|AEK26926.1|  Kunitz-type trypsin inhibitor B1                      90.5    2e-19   
ref|XP_011072079.1|  PREDICTED: miraculin                             90.5    2e-19   
ref|XP_006441432.1|  hypothetical protein CICLE_v10022276mg           90.5    2e-19   
gb|ADK62529.1|  miraculin-like protein                                90.1    2e-19   
gb|AFL91230.1|  Kunitz-like protease inhibitor                        89.4    2e-19   
ref|XP_006441436.1|  hypothetical protein CICLE_v10023581mg           89.7    2e-19   
dbj|BAA05474.1|  tumor-related protein                                88.2    2e-19   Nicotiana glauca x Nicotiana langsdorffii
gb|AAQ84217.1|  Kunitz trypsin inhibitor 4                            90.1    2e-19   Populus trichocarpa x Populus deltoides
gb|AFL91229.1|  Kunitz-like protease inhibitor                        89.4    2e-19   
gb|AFL91228.1|  Kunitz-like protease inhibitor                        89.4    2e-19   
gb|ABK96521.1|  unknown                                               90.1    2e-19   Populus trichocarpa x Populus deltoides
gb|AFL91232.1|  Kunitz-like protease inhibitor                        89.4    3e-19   
gb|AFL91227.1|  Kunitz-like protease inhibitor                        89.4    3e-19   
ref|XP_003548289.1|  PREDICTED: miraculin-like                        89.7    3e-19   
gb|AFL91226.1|  Kunitz-like protease inhibitor                        89.4    3e-19   
gb|AFL91233.1|  Kunitz-like protease inhibitor                        89.4    3e-19   
gb|AFL91231.1|  Kunitz-like protease inhibitor                        89.4    3e-19   
gb|ACO40154.1|  kunitz trypsin inhibitor 4                            89.4    3e-19   Populus balsamifera [balsam poplar]
ref|XP_006441447.1|  hypothetical protein CICLE_v10021858mg           90.1    4e-19   
ref|XP_004235409.1|  PREDICTED: miraculin-like                        89.4    4e-19   
ref|XP_006441438.1|  hypothetical protein CICLE_v10023465mg           89.4    5e-19   
gb|KCW48670.1|  hypothetical protein EUGRSUZ_K02326                   89.4    5e-19   
ref|XP_009792285.1|  PREDICTED: miraculin                             89.4    6e-19   
emb|CDP20822.1|  unnamed protein product                              89.0    6e-19   
gb|AAC49969.1|  tumor-related protein                                 89.0    7e-19   Nicotiana tabacum [American tobacco]
ref|XP_003620169.1|  Kunitz-type trypsin inhibitor alpha chain        89.0    7e-19   
ref|XP_006441446.1|  hypothetical protein CICLE_v10023371mg           89.0    7e-19   
gb|ACO40104.1|  kunitz trypsin inhibitor 4                            88.6    7e-19   Populus balsamifera [balsam poplar]
gb|ACO40082.1|  kunitz trypsin inhibitor 4                            88.2    8e-19   Populus balsamifera [balsam poplar]
ref|XP_009401850.1|  PREDICTED: miraculin-like                        88.6    8e-19   
gb|EYU22302.1|  hypothetical protein MIMGU_mgv1a013790mg              88.6    9e-19   
ref|XP_008437058.1|  PREDICTED: miraculin-like                        88.6    1e-18   
ref|XP_007029360.1|  Kunitz family trypsin and protease inhibitor...  88.2    1e-18   
ref|XP_004137639.1|  PREDICTED: miraculin-like                        88.2    1e-18   
gb|ACO40078.1|  kunitz trypsin inhibitor 4                            87.8    1e-18   Populus balsamifera [balsam poplar]
ref|XP_006351546.1|  PREDICTED: miraculin-like                        87.8    1e-18   
ref|XP_006441441.1|  hypothetical protein CICLE_v10023320mg           87.8    2e-18   
gb|AAQ96377.1|  miraculin-like protein                                87.8    2e-18   Solanum palustre
gb|ACO40073.1|  kunitz trypsin inhibitor 4                            87.4    2e-18   Populus balsamifera [balsam poplar]
ref|XP_009777240.1|  PREDICTED: miraculin-like                        87.8    2e-18   
ref|XP_010037029.1|  PREDICTED: miraculin-like                        88.6    2e-18   
ref|XP_004234331.1|  PREDICTED: miraculin                             87.4    2e-18   
gb|ACO40086.1|  kunitz trypsin inhibitor 4                            87.0    2e-18   Populus balsamifera [balsam poplar]
gb|ACO40080.1|  kunitz trypsin inhibitor 4                            87.0    2e-18   Populus balsamifera [balsam poplar]
ref|XP_010042449.1|  PREDICTED: miraculin-like                        88.2    3e-18   
gb|ACO40119.1|  kunitz trypsin inhibitor 4                            86.7    3e-18   Populus balsamifera [balsam poplar]
dbj|BAA82843.1|  miraculin homologue                                  86.3    3e-18   Solanum melongena [aubergine]
gb|AFL91234.1|  Kunitz-like protease inhibitor                        86.3    3e-18   
ref|XP_004241480.1|  PREDICTED: miraculin-like                        87.0    3e-18   
gb|ACO40144.1|  kunitz trypsin inhibitor 4                            86.7    3e-18   Populus balsamifera [balsam poplar]
gb|ACO40084.1|  kunitz trypsin inhibitor 4                            86.7    3e-18   Populus balsamifera [balsam poplar]
ref|XP_009627067.1|  PREDICTED: miraculin                             87.0    4e-18   
gb|ACO40077.1|  kunitz trypsin inhibitor 4                            86.3    4e-18   Populus balsamifera [balsam poplar]
ref|XP_009782173.1|  PREDICTED: miraculin-like                        87.4    4e-18   
gb|ACO40133.1|  kunitz trypsin inhibitor 4                            86.3    5e-18   Populus balsamifera [balsam poplar]
gb|KHM99732.1|  Miraculin                                             86.7    5e-18   
gb|ACO40093.1|  kunitz trypsin inhibitor 4                            85.9    6e-18   Populus balsamifera [balsam poplar]
dbj|BAA82840.1|  miraculin homologue                                  84.7    7e-18   Youngia japonica
ref|XP_006353931.1|  PREDICTED: miraculin-like                        86.3    7e-18   
gb|ACO40074.1|  kunitz trypsin inhibitor 4                            85.5    8e-18   Populus balsamifera [balsam poplar]
emb|CAI77768.1|  kunitz trypsin inhibitor                             86.3    8e-18   Populus tremula [European aspen]
gb|ACO40100.1|  kunitz trypsin inhibitor 4                            85.5    8e-18   Populus balsamifera [balsam poplar]
gb|ACO40153.1|  kunitz trypsin inhibitor 4                            85.5    9e-18   Populus balsamifera [balsam poplar]
ref|NP_001237333.1|  uncharacterized protein LOC100500648 precursor   85.9    1e-17   
emb|CAI77785.1|  kunitz trypsin inhibitor                             85.9    1e-17   Populus tremula [European aspen]
gb|ACO40145.1|  kunitz trypsin inhibitor 4                            85.1    1e-17   Populus balsamifera [balsam poplar]
emb|CAI77765.1|  kunitz trypsin inhibitor                             85.5    1e-17   Populus tremula [European aspen]
emb|CAI77775.1|  kunitz trypsin inhibitor                             85.5    1e-17   Populus tremula [European aspen]
emb|CAI77783.1|  kunitz trypsin inhibitor                             85.5    1e-17   Populus tremula [European aspen]
ref|XP_009615974.1|  PREDICTED: miraculin-like                        85.5    1e-17   
emb|CAI77782.1|  kunitz trypsin inhibitor                             85.5    1e-17   Populus tremula [European aspen]
ref|XP_008437082.1|  PREDICTED: miraculin                             85.5    1e-17   
ref|XP_004299457.1|  PREDICTED: miraculin-like                        85.5    1e-17   
emb|CAI77777.1|  kunitz trypsin inhibitor                             85.5    1e-17   Populus tremula [European aspen]
emb|CAI77793.1|  kunitz trypsin inhibitor                             85.5    1e-17   Populus tremula [European aspen]
emb|CAI77798.1|  kunitz trypsin inhibitor                             85.5    1e-17   Populus tremula [European aspen]
emb|CAI77772.1|  kunitz trypsin inhibitor                             85.5    1e-17   Populus tremula [European aspen]
emb|CAI77803.1|  kunitz trypsin inhibitor                             85.5    1e-17   Populus tremula [European aspen]
emb|CAI77786.1|  kunitz trypsin inhibitor                             85.5    1e-17   Populus tremula [European aspen]
emb|CAI77773.1|  kunitz trypsin inhibitor                             85.5    1e-17   Populus tremula [European aspen]
emb|CAI77769.1|  kunitz trypsin inhibitor                             85.5    2e-17   Populus tremula [European aspen]
emb|CAI77764.1|  kunitz trypsin inhibitor                             85.1    2e-17   Populus tremula [European aspen]
emb|CAI77774.1|  kunitz trypsin inhibitor                             85.1    2e-17   Populus tremula [European aspen]
emb|CAI77790.1|  kunitz trypsin inhibitor                             85.1    2e-17   Populus tremula [European aspen]
emb|CAI77795.1|  kunitz trypsin inhibitor                             85.1    2e-17   Populus tremula [European aspen]
ref|NP_001238098.1|  uncharacterized protein LOC100306134 precursor   85.1    2e-17   
gb|AFK41478.1|  unknown                                               85.1    2e-17   
ref|XP_003620188.1|  Miraculin                                        84.7    2e-17   
gb|ACL12055.1|  Kunitz trypsin inhibitor                              84.7    2e-17   Nicotiana tabacum [American tobacco]
gb|AHJ25677.1|  Kunitz-type trypsin inhibitor                         84.7    3e-17   
gb|ACO40081.1|  kunitz trypsin inhibitor 4                            84.3    3e-17   Populus balsamifera [balsam poplar]
emb|CAI77770.1|  kunitz trypsin inhibitor                             84.7    3e-17   Populus tremula [European aspen]
ref|XP_009793041.1|  PREDICTED: miraculin-like                        84.3    3e-17   
emb|CDP16462.1|  unnamed protein product                              84.7    3e-17   
dbj|BAA82841.1|  miraculin homologue                                  82.8    3e-17   Youngia japonica
emb|CDO98552.1|  unnamed protein product                              84.3    4e-17   
emb|CDP21544.1|  unnamed protein product                              84.0    4e-17   
ref|XP_008778295.1|  PREDICTED: miraculin                             83.6    4e-17   
emb|CAI77766.1|  kunitz trypsin inhibitor                             84.0    4e-17   Populus tremula [European aspen]
ref|XP_010476950.1|  PREDICTED: miraculin-like                        83.6    5e-17   
emb|CAI77767.1|  kunitz trypsin inhibitor                             83.6    6e-17   Populus tremula [European aspen]
emb|CDO98557.1|  unnamed protein product                              83.6    6e-17   
emb|CAI77771.1|  kunitz trypsin inhibitor                             83.6    7e-17   Populus tremula [European aspen]
ref|XP_010459406.1|  PREDICTED: miraculin-like                        83.2    8e-17   
emb|CAN63617.1|  hypothetical protein VITISV_041430                   83.6    8e-17   Vitis vinifera
emb|CAI77800.1|  kunitz trypsin inhibitor                             83.2    9e-17   Populus tremula [European aspen]
emb|CDP21024.1|  unnamed protein product                              83.2    1e-16   
emb|CDP19136.1|  unnamed protein product                              83.2    1e-16   
ref|XP_011046091.1|  PREDICTED: miraculin-like                        82.8    1e-16   
gb|KHM99743.1|  Miraculin                                             82.8    1e-16   
emb|CDP22082.1|  unnamed protein product                              82.8    1e-16   
emb|CDP21540.1|  unnamed protein product                              82.8    1e-16   
ref|XP_009110379.1|  PREDICTED: miraculin-like                        82.4    1e-16   
emb|CDX83886.1|  BnaC08g17590D                                        82.4    1e-16   
ref|XP_003534079.1|  PREDICTED: miraculin-like                        82.4    2e-16   
gb|ACS92516.1|  Kunitz-type protease inhibitor KPI-D12                82.4    2e-16   Populus trichocarpa x Populus deltoides
ref|XP_007152537.1|  hypothetical protein PHAVU_004G138500g           82.0    2e-16   
gb|KHM99742.1|  Miraculin                                             80.9    2e-16   
ref|NP_001237312.1|  uncharacterized protein LOC100527782 precursor   82.0    2e-16   
ref|XP_006372632.1|  hypothetical protein POPTR_0017s03420g           82.0    2e-16   
ref|XP_006372633.1|  hypothetical protein POPTR_0017s03430g           82.0    2e-16   
ref|XP_006347376.1|  PREDICTED: miraculin-like                        82.0    2e-16   
ref|XP_009782174.1|  PREDICTED: miraculin-like                        81.6    3e-16   
gb|KHM99740.1|  Miraculin                                             80.5    3e-16   
ref|XP_003620172.1|  21 kDa seed protein                              81.6    3e-16   
gb|AFS33546.1|  Kunitz-type protease inhibitor                        80.1    3e-16   
emb|CDO98554.1|  unnamed protein product                              81.6    3e-16   
ref|NP_001241106.1|  uncharacterized protein LOC100790688 precursor   81.6    3e-16   
ref|XP_003620187.1|  Miraculin                                        81.6    4e-16   
gb|KHM99741.1|  Miraculin                                             81.3    4e-16   
ref|XP_003534080.1|  PREDICTED: miraculin-like                        81.3    4e-16   
ref|XP_010498164.1|  PREDICTED: miraculin-like                        81.3    4e-16   
ref|XP_009614754.1|  PREDICTED: miraculin-like                        81.6    4e-16   
ref|XP_006372654.1|  hypothetical protein POPTR_0017s03600g           81.3    5e-16   
emb|CDX96746.1|  BnaA08g22890D                                        80.9    5e-16   
emb|CDO98558.1|  unnamed protein product                              81.3    5e-16   
ref|XP_009614755.1|  PREDICTED: miraculin-like                        81.3    5e-16   
ref|XP_010918417.1|  PREDICTED: miraculin-like                        80.9    5e-16   
ref|XP_010101167.1|  hypothetical protein L484_005403                 80.5    7e-16   
gb|KHM99738.1|  Miraculin                                             80.5    7e-16   
ref|XP_003534078.1|  PREDICTED: miraculin-like                        80.5    7e-16   
emb|CDP21779.1|  unnamed protein product                              80.5    9e-16   
ref|XP_010279489.1|  PREDICTED: miraculin-like                        80.5    1e-15   
ref|XP_008437071.1|  PREDICTED: miraculin-like                        80.5    1e-15   
ref|XP_009803614.1|  PREDICTED: miraculin-like                        80.1    1e-15   
gb|KHM99744.1|  Miraculin                                             79.7    1e-15   
ref|XP_007210537.1|  hypothetical protein PRUPE_ppa011653mg           80.1    1e-15   
ref|XP_010279488.1|  PREDICTED: miraculin-like                        80.1    1e-15   
gb|KHM99735.1|  Miraculin                                             78.6    2e-15   
ref|XP_002890252.1|  trypsin and protease inhibitor family protein    79.3    2e-15   
emb|CDP21726.1|  unnamed protein product                              79.3    2e-15   
ref|XP_004241479.1|  PREDICTED: miraculin-like                        79.0    3e-15   
ref|XP_006304577.1|  hypothetical protein CARUB_v10011616mg           78.6    3e-15   
ref|XP_006353919.1|  PREDICTED: miraculin-like                        79.0    3e-15   
gb|ACV52580.1|  endopeptidase inhibitor                               76.6    4e-15   Nicotiana benthamiana
ref|XP_003534083.1|  PREDICTED: miraculin-like                        79.0    4e-15   
emb|CDP18338.1|  unnamed protein product                              79.0    4e-15   
ref|XP_006347377.1|  PREDICTED: miraculin-like                        78.6    4e-15   
ref|XP_004515058.1|  PREDICTED: miraculin-like                        77.8    6e-15   
gb|AFK34345.1|  unknown                                               78.2    6e-15   
emb|CDY19181.1|  BnaC05g13820D                                        77.8    7e-15   
gb|AFK33359.1|  unknown                                               77.4    9e-15   
ref|XP_006416660.1|  hypothetical protein EUTSA_v10008818mg           77.4    9e-15   
ref|XP_009149240.1|  PREDICTED: miraculin                             77.4    1e-14   
gb|KFK42293.1|  hypothetical protein AALP_AA2G237000                  77.0    1e-14   
gb|KHN24493.1|  Miraculin                                             77.0    1e-14   
ref|XP_009406658.1|  PREDICTED: miraculin-like                        77.0    1e-14   
emb|CDY26209.1|  BnaA06g12080D                                        76.6    2e-14   
gb|ADW95380.1|  Kunitz-type trypsin inhibitor                         77.0    2e-14   
ref|XP_002305034.2|  hypothetical protein POPTR_0004s06610g           76.6    2e-14   Populus trichocarpa [western balsam poplar]
gb|KFK31885.1|  hypothetical protein AALP_AA6G171300                  76.3    2e-14   
ref|XP_006477858.1|  PREDICTED: 21 kDa seed protein-like isoform X1   76.3    3e-14   
ref|XP_003548288.1|  PREDICTED: miraculin-like                        75.9    3e-14   
ref|XP_004235412.1|  PREDICTED: miraculin-like                        76.3    3e-14   
gb|AAL85660.1|  trypsin inhibitor                                     75.1    4e-14   Theobroma sylvestre
pdb|3IIR|A  Chain A, Crystal Structure Of Miraculin Like Protein ...  75.5    4e-14   
gb|ACS37303.1|  trypsin inhibitor                                     75.5    6e-14   
gb|AAL85640.1|  trypsin inhibitor                                     74.7    6e-14   Herrania albiflora
gb|KFK42291.1|  hypothetical protein AALP_AA2G236700                  75.1    6e-14   
gb|AEK26927.1|  Kunitz-type trypsin inhibitor B4                      75.1    7e-14   
ref|XP_011035408.1|  PREDICTED: miraculin-like                        74.7    9e-14   
ref|XP_003620174.1|  Pathogen-inducible trypsin-inhibitor-like pr...  74.7    1e-13   
ref|XP_003620175.1|  Pathogen-inducible trypsin-inhibitor-like pr...  74.7    1e-13   
ref|XP_010683194.1|  PREDICTED: miraculin-like                        74.3    1e-13   
gb|KFK42292.1|  hypothetical protein AALP_AA2G236900                  73.9    2e-13   
gb|ABK01288.1|  miraculin-like protein                                73.9    2e-13   Coffea arabica [arabica coffee]
ref|XP_010041216.1|  PREDICTED: miraculin-like                        73.6    2e-13   
ref|NP_173228.1|  kunitz family trypsin and protease inhibitor pr...  73.6    2e-13   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009782172.1|  PREDICTED: miraculin-like                        73.6    3e-13   
gb|AAL85644.1|  trypsin inhibitor                                     72.8    3e-13   Theobroma subincanum
gb|AAL85659.1|  trypsin inhibitor                                     72.8    3e-13   Theobroma speciosum
ref|XP_003622420.1|  Endopeptidase inhibitor                          73.2    3e-13   
gb|AAL85648.1|  trypsin inhibitor                                     72.8    3e-13   Theobroma obovatum
gb|AEK31191.1|  miraculin-like protein 1                              72.8    3e-13   
gb|AEK31190.1|  miraculin-like protein 1                              72.8    3e-13   
ref|XP_006441457.1|  hypothetical protein CICLE_v10024528mg           71.2    4e-13   
ref|XP_006847953.1|  hypothetical protein AMTR_s00029p00141480        72.8    4e-13   
gb|AAL85645.1|  trypsin inhibitor                                     72.4    4e-13   Theobroma grandiflorum
ref|XP_006442410.1|  hypothetical protein CICLE_v10022211mg           72.8    4e-13   
gb|AAL85661.1|  trypsin inhibitor                                     72.0    5e-13   Theobroma bicolor
emb|CDP20533.1|  unnamed protein product                              72.4    6e-13   
emb|CDP21543.1|  unnamed protein product                              72.4    7e-13   
ref|XP_006477857.1|  PREDICTED: 21 kDa seed protein-like              72.0    9e-13   
gb|AAL85657.1|  trypsin inhibitor                                     71.2    9e-13   Theobroma sylvestre
ref|XP_006477860.1|  PREDICTED: 21 kDa seed protein-like              72.0    1e-12   
emb|CDP19138.1|  unnamed protein product                              71.6    1e-12   
gb|AAV41234.1|  putative 21 kDa trypsin inhibitor                     71.6    1e-12   Theobroma microcarpum
sp|P13087.3|MIRA_SYNDU  RecName: Full=Miraculin; Short=MIR; Flags...  71.2    2e-12   Synsepalum dulcificum [miracle fruit]
ref|XP_007036750.1|  21 kDa seed protein                              70.9    2e-12   
ref|XP_007036746.1|  21 kDa seed protein                              70.9    2e-12   
ref|XP_003534100.1|  PREDICTED: miraculin-like                        70.9    2e-12   
gb|ABX76298.1|  sexual organ expressed protein                        70.9    2e-12   Nicotiana alata [flowering tobacco]
ref|XP_003534081.1|  PREDICTED: miraculin-like                        70.5    3e-12   
gb|KHM99737.1|  Miraculin                                             70.5    3e-12   
ref|XP_009789071.1|  PREDICTED: cysteine protease inhibitor 8-like    70.5    3e-12   
gb|AAL85656.1|  trypsin inhibitor                                     69.7    4e-12   Theobroma microcarpum
ref|XP_006441465.1|  hypothetical protein CICLE_v10022129mg           70.5    4e-12   
gb|AEK31197.1|  miraculin-like protein 2                              69.7    4e-12   
ref|XP_006478132.1|  PREDICTED: 21 kDa seed protein-like              70.1    4e-12   
gb|AEK31196.1|  miraculin-like protein 2                              69.3    5e-12   
ref|XP_006441467.1|  hypothetical protein CICLE_v10022124mg           69.7    6e-12   
gb|AAL85650.1|  trypsin inhibitor                                     68.6    8e-12   Theobroma mammosum
gb|AAL85651.1|  trypsin inhibitor                                     68.6    8e-12   Theobroma mammosum
gb|AAL85652.1|  trypsin inhibitor                                     68.6    8e-12   Theobroma mammosum
ref|XP_004515059.1|  PREDICTED: miraculin-like                        68.9    1e-11   
gb|AAL85643.1|  trypsin inhibitor                                     68.6    1e-11   Theobroma angustifolium
gb|AAV41233.1|  putative 21 kDa trypsin inhibitor                     68.9    1e-11   Theobroma bicolor
ref|XP_010683193.1|  PREDICTED: miraculin-like                        68.9    1e-11   
ref|XP_009614753.1|  PREDICTED: miraculin-like                        68.9    1e-11   
gb|AEK31202.1|  miraculin-like protein 2                              68.6    1e-11   
gb|AFR54471.1|  miraculin-like protein 2                              68.6    1e-11   
gb|ACF74332.1|  Kunitz trypsin inhibitor 4                            68.6    1e-11   
gb|ABG47463.1|  vegetative storage protein                            68.6    2e-11   
gb|AEK31192.1|  miraculin-like protein 1                              68.2    2e-11   
ref|XP_007036743.1|  21 kDa seed protein                              68.2    2e-11   
ref|XP_010683192.1|  PREDICTED: miraculin-like                        68.2    2e-11   
prf||1802409A  albumin                                                68.2    2e-11
gb|AAL85654.1|  trypsin inhibitor                                     67.4    2e-11   
dbj|BAE79511.1|  miraculin-like protein 2                             68.2    2e-11   
emb|CBI35466.3|  unnamed protein product                              66.6    2e-11   
ref|XP_009758946.1|  PREDICTED: miraculin-like                        67.8    3e-11   
emb|CDO98555.1|  unnamed protein product                              67.8    3e-11   
emb|CDO98560.1|  unnamed protein product                              67.4    4e-11   
ref|XP_010279465.1|  PREDICTED: miraculin-like                        67.4    4e-11   
ref|XP_010253721.1|  PREDICTED: miraculin-like                        67.4    4e-11   
ref|XP_003620185.1|  21 kDa seed protein                              67.0    4e-11   
gb|AEO27899.1|  miraculin-like protein                                67.0    4e-11   
ref|XP_007152529.1|  hypothetical protein PHAVU_004G138000g           66.6    5e-11   
ref|XP_006478136.1|  PREDICTED: 21 kDa seed protein-like              67.0    6e-11   
ref|XP_003534082.1|  PREDICTED: miraculin-like                        66.6    7e-11   
gb|ACJ51124.1|  talisin                                               66.6    7e-11   
ref|NP_001237597.1|  uncharacterized protein LOC100527288 precursor   66.6    7e-11   
gb|AEO27901.1|  miraculin-like protein 2                              66.2    8e-11   
emb|CBI35470.3|  unnamed protein product                              65.5    8e-11   
ref|XP_007036748.1|  21 kDa seed protein, putative                    66.2    8e-11   
gb|AEK31198.1|  miraculin-like protein 2                              65.9    9e-11   
gb|KHN24496.1|  Miraculin                                             66.2    1e-10   
ref|XP_010249125.1|  PREDICTED: miraculin-like                        65.9    1e-10   
ref|XP_011092684.1|  PREDICTED: miraculin-like                        65.9    1e-10   
gb|AAL85642.1|  trypsin inhibitor                                     65.1    2e-10   
gb|AAL85653.1|  trypsin inhibitor                                     65.1    2e-10   
gb|AEO27900.1|  miraculin-like protein 2                              65.1    2e-10   
gb|KDO40321.1|  hypothetical protein CISIN_1g028238mg                 65.1    2e-10   
ref|XP_010261301.1|  PREDICTED: uncharacterized protein LOC104600157  67.0    3e-10   
ref|XP_003620184.1|  Pathogen-inducible trypsin-inhibitor-like pr...  64.7    3e-10   
ref|XP_006441440.1|  hypothetical protein CICLE_v10022156mg           64.7    3e-10   
gb|AAS75739.1|  thermoinhibition-associated THB-6 protein             63.5    3e-10   
ref|XP_009601782.1|  PREDICTED: miraculin-like                        64.7    3e-10   
gb|AAL85637.1|  trypsin inhibitor                                     63.9    5e-10   
gb|AEK31201.1|  miraculin-like protein 2                              63.9    5e-10   
ref|XP_009344613.1|  PREDICTED: miraculin-like                        63.9    5e-10   
ref|XP_009344614.1|  PREDICTED: miraculin-like                        63.9    5e-10   
ref|XP_004237191.1|  PREDICTED: miraculin-like                        63.9    6e-10   
gb|KCW48668.1|  hypothetical protein EUGRSUZ_K02323                   63.5    7e-10   
gb|AAV41231.1|  putative 21 kDa trypsin inhibitor                     63.5    8e-10   
ref|XP_010540187.1|  PREDICTED: bark lectin isoform 2-like            62.8    1e-09   
gb|KDO46146.1|  hypothetical protein CISIN_1g047893mg                 62.4    2e-09   
gb|AIT42215.1|  Kunitz-type inhibitor D                               62.4    2e-09   
ref|XP_010683390.1|  PREDICTED: miraculin-like                        62.4    2e-09   
emb|CBJ94886.1|  kunitz trypsin inhibitor                             61.2    2e-09   
ref|XP_006442417.1|  hypothetical protein CICLE_v10022911mg           61.6    2e-09   
ref|XP_006441431.1|  hypothetical protein CICLE_v10023623mg           61.2    2e-09   
gb|AEK31200.1|  miraculin-like protein 2                              61.6    3e-09   
ref|XP_006478228.1|  PREDICTED: uncharacterized protein LOC102606959  64.3    3e-09   
ref|XP_010250347.1|  PREDICTED: 21 kDa seed protein-like              62.4    4e-09   
ref|XP_002888923.1|  trypsin and protease inhibitor family protein    61.6    4e-09   
gb|AIT42213.1|  Kunitz-type inhibitor D                               62.0    4e-09   
ref|XP_010416131.1|  PREDICTED: bark lectin isoform 2-like isofor...  61.6    4e-09   
ref|XP_003534101.1|  PREDICTED: 21 kDa seed protein-like              61.6    4e-09   
ref|XP_010416130.1|  PREDICTED: bark lectin isoform 2-like isofor...  61.6    4e-09   
emb|CBJ94870.1|  kunitz trypsin inhibitor                             59.7    5e-09   
gb|AEK31199.1|  miraculin-like protein 2                              60.5    7e-09   
ref|XP_006847952.1|  hypothetical protein AMTR_s00029p00141300        60.1    8e-09   
gb|KDO42306.1|  hypothetical protein CISIN_1g047198mg                 58.5    1e-08   
ref|XP_009608941.1|  PREDICTED: serine protease inhibitor 4-like      59.7    1e-08   
ref|XP_010683195.1|  PREDICTED: miraculin-like                        60.1    1e-08   
gb|KDO39703.1|  hypothetical protein CISIN_1g043243mg                 59.3    2e-08   
ref|XP_008226352.1|  PREDICTED: alpha-amylase/subtilisin inhibito...  59.3    2e-08   
ref|XP_010536414.1|  PREDICTED: miraculin-like                        59.3    2e-08   
ref|XP_009775241.1|  PREDICTED: latex serine proteinase inhibitor...  59.7    2e-08   
ref|XP_010253746.1|  PREDICTED: 21 kDa seed protein-like              59.7    3e-08   
ref|XP_006441461.1|  hypothetical protein CICLE_v10022001mg           58.9    4e-08   
gb|AAL85655.1|  trypsin inhibitor                                     58.2    4e-08   
gb|AIT42214.1|  Kunitz-type inhibitor D                               58.5    4e-08   
ref|XP_010428253.1|  PREDICTED: bark lectin isoform 2 isoform X2      58.5    4e-08   
ref|XP_006478135.1|  PREDICTED: miraculin-like                        58.9    4e-08   
ref|XP_004242148.1|  PREDICTED: miraculin-like                        58.2    5e-08   
ref|XP_010428252.1|  PREDICTED: bark lectin isoform 2 isoform X1      58.5    5e-08   
ref|XP_006347378.1|  PREDICTED: miraculin-like                        58.2    5e-08   
gb|KDO40852.1|  hypothetical protein CISIN_1g046118mg                 58.2    6e-08   
gb|AAG38518.1|AF283533_1  miraculin-like protein 2                    58.2    7e-08   
ref|XP_007041758.1|  21 kDa seed protein, putative                    57.4    8e-08   
gb|AAF15901.1|AF208020_1  putative proteinase inhibitor               58.2    9e-08   
ref|XP_004295679.1|  PREDICTED: miraculin-like                        57.4    9e-08   
ref|XP_002265535.2|  PREDICTED: alpha-amylase/subtilisin inhibito...  57.4    9e-08   
emb|CAC40756.1|  putative miraculin                                   57.4    1e-07   
ref|NP_565062.1|  Kunitz family trypsin and protease inhibitor pr...  57.8    1e-07   
ref|XP_006441469.1|  hypothetical protein CICLE_v10024002mg           57.4    1e-07   
gb|KDO37403.1|  hypothetical protein CISIN_1g035912mg                 56.6    1e-07   
ref|XP_010264783.1|  PREDICTED: miraculin-like                        57.0    1e-07   
ref|XP_010250346.1|  PREDICTED: 21 kDa seed protein-like              57.8    1e-07   
ref|XP_006371005.1|  truncated Kunitz trypsin inhibitor family pr...  56.6    2e-07   
ref|XP_008386290.1|  PREDICTED: kunitz-type elastase inhibitor Br...  56.6    2e-07   
gb|ADW95385.1|  Kunitz-type trypsin inhibitor                         56.2    2e-07   
ref|XP_007212054.1|  hypothetical protein PRUPE_ppa011448mg           56.6    2e-07   
gb|KDO44067.1|  hypothetical protein CISIN_1g031474mg                 55.8    3e-07   
ref|XP_010471390.1|  PREDICTED: bark lectin isoform 2-like            56.2    3e-07   
ref|XP_011023016.1|  PREDICTED: endogenous alpha-amylase/subtilis...  55.8    3e-07   
ref|XP_010248438.1|  PREDICTED: 21 kDa seed protein-like              56.2    4e-07   
ref|XP_009588833.1|  PREDICTED: latex serine proteinase inhibitor...  55.8    4e-07   
ref|XP_010250345.1|  PREDICTED: 21 kDa seed protein-like              56.2    5e-07   
ref|XP_002309884.2|  hypothetical protein POPTR_0007s03650g           55.5    5e-07   
ref|XP_010428237.1|  PREDICTED: miraculin-like                        55.5    6e-07   
ref|XP_004514548.1|  PREDICTED: endogenous alpha-amylase/subtilis...  55.1    6e-07   
emb|CDQ51987.1|  alpha amylase/subtilisin inhibitor                   55.1    7e-07   
ref|NP_001233769.1|  uncharacterized protein LOC544001 precursor      55.5    8e-07   
gb|ADW95376.1|  Kunitz-type trypsin inhibitor                         54.7    9e-07   
gb|AFK41530.1|  unknown                                               54.7    1e-06   
gb|AAV41232.1|  putative 21 kDa trypsin inhibitor                     54.7    1e-06   
gb|AEK26923.1|  Kunitz-type trypsin inhibitor C7                      54.3    1e-06   
ref|XP_006441434.1|  hypothetical protein CICLE_v10023743mg           53.5    1e-06   
gb|ACS92520.1|  Kunitz-type protease inhibitor KPI-F9                 54.3    1e-06   
ref|XP_004514494.1|  PREDICTED: endogenous alpha-amylase/subtilis...  54.3    2e-06   
gb|AEK26932.1|  Kunitz-type trypsin inhibitor C6                      53.9    2e-06   
ref|XP_006353920.1|  PREDICTED: 21 kDa seed protein-like              53.9    2e-06   
ref|XP_002309881.2|  hypothetical protein POPTR_0007s03620g           53.5    2e-06   
ref|XP_009630289.1|  PREDICTED: miraculin-like                        53.9    2e-06   
ref|XP_006441433.1|  hypothetical protein CICLE_v10023442mg           52.4    2e-06   
gb|AIS71915.1|  hypothetical protein                                  53.9    2e-06   
ref|XP_009105993.1|  PREDICTED: latex serine proteinase inhibitor...  53.9    2e-06   
gb|AFK42680.1|  unknown                                               53.9    2e-06   
ref|XP_006441443.1|  hypothetical protein CICLE_v10023590mg           52.0    3e-06   
gb|KEH19472.1|  Kunitz type trypsin inhibitor                         53.1    3e-06   
gb|KEH16150.1|  Kunitz type trypsin inhibitor                         53.1    4e-06   
gb|ABX76297.1|  stigma expressed protein                              53.5    4e-06   
ref|XP_010471385.1|  PREDICTED: trypsin inhibitor BvTI-like           53.1    4e-06   
ref|XP_006442412.1|  hypothetical protein CICLE_v10023557mg           52.4    4e-06   
ref|XP_006360663.1|  PREDICTED: miraculin-like                        53.1    5e-06   
ref|XP_002300199.1|  truncated Kunitz trypsin inhibitor family pr...  52.4    6e-06   
gb|AEK26922.1|  Kunitz-type trypsin inhibitor C1                      52.4    6e-06   
ref|XP_011045717.1|  PREDICTED: miraculin-like                        52.0    7e-06   
gb|KHN45554.1|  Miraculin                                             50.8    8e-06   
ref|XP_006390569.1|  hypothetical protein EUTSA_v10019129mg           52.4    8e-06   
ref|XP_010098224.1|  Alpha-amylase/subtilisin inhibitor               52.0    9e-06   
gb|AGX93234.1|  Kunitz proteinase inhibitor 5                         52.4    1e-05   
ref|XP_011023019.1|  PREDICTED: endogenous alpha-amylase/subtilis...  52.0    1e-05   
ref|XP_004514493.1|  PREDICTED: endogenous alpha-amylase/subtilis...  51.6    1e-05   
ref|XP_010098221.1|  Alpha-amylase/subtilisin inhibitor               51.6    1e-05   
gb|AGX93230.1|  Kunitz proteinase inhibitor 5                         52.0    1e-05   
emb|CDY11118.1|  BnaC06g23700D                                        51.6    1e-05   
ref|XP_006383817.1|  truncated Kunitz trypsin inhibitor family pr...  51.2    1e-05   
ref|XP_002525871.1|  Alpha-amylase/subtilisin inhibitor precursor...  51.2    2e-05   
ref|XP_010416116.1|  PREDICTED: miraculin-like                        51.2    2e-05   
gb|KDO39799.1|  hypothetical protein CISIN_1g039827mg                 50.1    2e-05   
ref|XP_003620167.1|  Kunitz trypsin inhibitor                         49.7    2e-05   
ref|XP_010277875.1|  PREDICTED: miraculin-like                        51.6    2e-05   
ref|XP_004488980.1|  PREDICTED: alpha-amylase/subtilisin inhibito...  50.8    2e-05   
gb|AEK26931.1|  Kunitz-type trypsin inhibitor C5                      50.8    2e-05   
ref|XP_009376741.1|  PREDICTED: LOW QUALITY PROTEIN: aspartic pro...  50.8    3e-05   
ref|XP_006441437.1|  hypothetical protein CICLE_v10023565mg           48.9    3e-05   
emb|CDX72981.1|  BnaC06g34290D                                        50.8    4e-05   
ref|XP_006465039.1|  PREDICTED: 21 kDa seed protein-like              50.1    5e-05   
ref|XP_010537526.1|  PREDICTED: bark lectin isoform 1-like            49.7    7e-05   
ref|XP_006432185.1|  hypothetical protein CICLE_v10002395mg           49.7    8e-05   
ref|XP_009588822.1|  PREDICTED: kunitz-type serine protease inhib...  49.7    8e-05   
gb|KDO42543.1|  hypothetical protein CISIN_1g031740mg                 48.5    9e-05   
gb|ACS92521.1|  Kunitz-type protease inhibitor KPI-F4                 49.3    9e-05   
gb|AFK38218.1|  unknown                                               47.8    9e-05   
ref|XP_006495062.1|  PREDICTED: miraculin-like                        48.1    9e-05   
sp|P58515.1|SPI2_SOLTU  RecName: Full=Serine protease inhibitor 2...  48.9    1e-04   
ref|XP_006441455.1|  hypothetical protein CICLE_v10023253mg           47.4    1e-04   
ref|XP_011012012.1|  PREDICTED: alpha-amylase/subtilisin inhibito...  48.9    1e-04   
pdb|3S8J|A  Chain A, Crystal Structure Of A Papaya Latex Serine P...  48.5    1e-04   
pdb|3TC2|A  Chain A, Crystal Structure Of Potato Serine Protease ...  48.5    2e-04   
ref|XP_006353927.1|  PREDICTED: cysteine protease inhibitor 8-like    48.9    2e-04   
ref|XP_010673342.1|  PREDICTED: miraculin-like                        48.5    2e-04   
gb|KDP27281.1|  hypothetical protein JCGZ_21012                       47.8    2e-04   
ref|XP_004235492.2|  PREDICTED: kunitz-type trypsin inhibitor alp...  47.8    3e-04   
ref|XP_007133320.1|  hypothetical protein PHAVU_011G169800g           47.8    3e-04   
gb|KDP46945.1|  hypothetical protein JCGZ_07962                       47.4    3e-04   
ref|XP_010673346.1|  PREDICTED: miraculin-like                        47.4    5e-04   
dbj|BAB85997.1|  trypsin inhibitor homolog                            47.4    5e-04   
ref|XP_006353918.1|  PREDICTED: miraculin-like                        47.0    5e-04   
ref|XP_004235491.1|  PREDICTED: cysteine protease inhibitor 8-like    47.4    6e-04   
gb|KGN60879.1|  hypothetical protein Csa_2G021500                     46.6    6e-04   
emb|CAJ21344.1|  kunitz trypsin inhibitor TI6                         47.0    7e-04   
ref|XP_004139192.1|  PREDICTED: miraculin-like                        46.6    7e-04   
ref|XP_007041757.1|  21 kDa seed protein, putative                    47.0    8e-04   
ref|NP_001237543.1|  trypsin inhibitor                                46.2    8e-04   



>ref|XP_011035401.1| PREDICTED: miraculin-like [Populus euphratica]
Length=215

 Score =   103 bits (256),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 61/138 (44%), Positives = 85/138 (62%), Gaps = 6/138 (4%)
 Frame = -1

Query  405  CPKSVVQVGPNVV-GNTVTFSPVNPKD-VVRNGTDLNVQFSGSNAGCPESTVWQITHDPE  232
            CP  VVQ    +  G  +TF+PVNPK  V+R  TDLN++FS S+  C +STVW+I     
Sbjct  70   CPLDVVQDPLEISKGLPLTFTPVNPKKGVIRVSTDLNIKFSASSI-CVQSTVWKI-QKSV  127

Query  231  DTDTTHYVVSGGVKGNPSSSTTRNWFMIVKTKNGYKFKFCPVSVCDCDPICQDIAISV-E  55
            +++   +V +GGV+GNP   T  NWF I K  + YK  FCP +VCDC  +C+DI I + +
Sbjct  128  NSEIQWFVTTGGVEGNPGIETITNWFKIEKAGDDYKLVFCP-TVCDCGALCRDIGIYIHD  186

Query  54   SGHRLLDVDVSLPPLEVN  1
            +G R L +  +L P  VN
Sbjct  187  NGVRTLSLSDALQPFLVN  204



>ref|XP_002266302.2| PREDICTED: miraculin-like, partial [Vitis vinifera]
Length=162

 Score =   101 bits (252),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 57/128 (45%), Positives = 81/128 (63%), Gaps = 7/128 (5%)
 Frame = -1

Query  405  CPKSVVQVGPNVV-GNTVTFSPVNPKD-VVRNGTDLNVQFSGSNAGCPESTVWQITHDPE  232
            CP  VVQ    V  G  +TF+PVNPK  V+R  TD N++FS S   C +ST+W++ +D  
Sbjct  27   CPLDVVQEQQEVSNGLPLTFTPVNPKKGVIRVSTDHNIKFSASTI-CVQSTLWKLEYD--  83

Query  231  DTDTTHYVVSGGVKGNPSSSTTRNWFMIVKTKNGYKFKFCPVSVCD-CDPICQDIAISVE  55
            ++    +V +GGV+GNP   T  NWF I K ++ YK  FCP +VCD C P+C DI I ++
Sbjct  84   ESSGQRFVTTGGVEGNPGRETLDNWFKIEKYEDDYKLVFCP-TVCDFCKPVCGDIGIYIQ  142

Query  54   SGHRLLDV  31
            +G+R L +
Sbjct  143  NGYRRLAL  150



>gb|AEK26933.1| Kunitz-type trypsin inhibitor B2 [Populus nigra]
Length=215

 Score =   102 bits (254),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 60/138 (43%), Positives = 85/138 (62%), Gaps = 6/138 (4%)
 Frame = -1

Query  405  CPKSVVQVGPNVV-GNTVTFSPVNPKD-VVRNGTDLNVQFSGSNAGCPESTVWQITHDPE  232
            CP  VVQ    +  G  +TF+PVNPK  V+R  TDLN++FS S+  C +STVW+I     
Sbjct  70   CPLDVVQDPLEISKGLPLTFTPVNPKKGVIRVSTDLNIKFSASSI-CVQSTVWKI-QKSV  127

Query  231  DTDTTHYVVSGGVKGNPSSSTTRNWFMIVKTKNGYKFKFCPVSVCDCDPICQDIAISV-E  55
            +++   +V +GGV+GNP   T  NWF I K  + YK  FCP +VCDC  +C+D+ I + +
Sbjct  128  NSEIQWFVTTGGVEGNPGIETITNWFKIEKADDDYKLVFCP-TVCDCGALCRDVGIYIHD  186

Query  54   SGHRLLDVDVSLPPLEVN  1
            +G R L +  +L P  VN
Sbjct  187  NGVRTLSLSDALQPFLVN  204



>gb|ACS92509.1| Kunitz-type protease inhibitor KPI-D2.3 [Populus trichocarpa]
 gb|ACS92510.1| Kunitz-type protease inhibitor KPI-D2 [Populus trichocarpa x 
Populus deltoides]
Length=215

 Score =   102 bits (254),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 60/138 (43%), Positives = 85/138 (62%), Gaps = 6/138 (4%)
 Frame = -1

Query  405  CPKSVVQVGPNVV-GNTVTFSPVNPKD-VVRNGTDLNVQFSGSNAGCPESTVWQITHDPE  232
            CP  VVQ    +  G  +TF+PVNPK  V+R  TDLN++FS S+  C +STVW+I     
Sbjct  70   CPLDVVQDPLEISKGLPLTFTPVNPKKGVIRVSTDLNIKFSASSI-CVQSTVWKI-QKSV  127

Query  231  DTDTTHYVVSGGVKGNPSSSTTRNWFMIVKTKNGYKFKFCPVSVCDCDPICQDIAISV-E  55
            +++   +V +GGV+GNP   T  NWF I K  + YK  FCP +VCDC  +C+D+ I + +
Sbjct  128  NSEIQWFVTTGGVEGNPGIETITNWFKIEKAGDDYKLVFCP-TVCDCGALCRDVGIYIHD  186

Query  54   SGHRLLDVDVSLPPLEVN  1
            +G R L +  +L P  VN
Sbjct  187  NGVRTLSLSDALQPFLVN  204



>ref|XP_002305032.2| trypsin protein inhibitor 3 [Populus trichocarpa]
 gb|ACS92483.1| Kunitz-type protease inhibitor KPI-D2.2 [Populus trichocarpa]
 gb|ADW95386.1| Kunitz-type trypsin inhibitor [Populus nigra]
 gb|EEE85543.2| trypsin protein inhibitor 3 [Populus trichocarpa]
Length=215

 Score =   102 bits (253),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 60/138 (43%), Positives = 85/138 (62%), Gaps = 6/138 (4%)
 Frame = -1

Query  405  CPKSVVQVGPNVV-GNTVTFSPVNPKD-VVRNGTDLNVQFSGSNAGCPESTVWQITHDPE  232
            CP  VVQ    +  G  +TF+PVNPK  V+R  TDLN++FS S+  C +STVW+I     
Sbjct  70   CPLDVVQDPLEISKGLPLTFTPVNPKKGVIRVSTDLNIKFSASSI-CVQSTVWKI-QKSV  127

Query  231  DTDTTHYVVSGGVKGNPSSSTTRNWFMIVKTKNGYKFKFCPVSVCDCDPICQDIAISV-E  55
            +++   +V +GGV+GNP   T  NWF I K  + YK  FCP +VCDC  +C+D+ I + +
Sbjct  128  NSEIQWFVTTGGVEGNPGIETITNWFKIEKAGDDYKLVFCP-TVCDCGALCRDVGIYIHD  186

Query  54   SGHRLLDVDVSLPPLEVN  1
            +G R L +  +L P  VN
Sbjct  187  NGVRTLSLSDALQPFLVN  204



>emb|CAN81015.1| hypothetical protein VITISV_025776 [Vitis vinifera]
Length=203

 Score =   102 bits (253),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 57/128 (45%), Positives = 81/128 (63%), Gaps = 7/128 (5%)
 Frame = -1

Query  405  CPKSVVQVGPNVV-GNTVTFSPVNPKD-VVRNGTDLNVQFSGSNAGCPESTVWQITHDPE  232
            CP  VVQ    V  G  +TF+PVNPK  V+R  TD N++FS S   C +ST+W++ +D  
Sbjct  68   CPLDVVQEQHEVSNGLPLTFTPVNPKKGVIRVSTDHNIKFSASTI-CVQSTLWKLEYD--  124

Query  231  DTDTTHYVVSGGVKGNPSSSTTRNWFMIVKTKNGYKFKFCPVSVCD-CDPICQDIAISVE  55
            ++    +V +GGV+GNP   T  NWF I K ++ YK  FCP +VCD C P+C DI I ++
Sbjct  125  ESSGQRFVTTGGVEGNPGXETLDNWFKIEKYEDDYKLVFCP-TVCDFCKPVCGDIGIYIQ  183

Query  54   SGHRLLDV  31
            +G+R L +
Sbjct  184  NGYRRLAL  191



>gb|ADD51186.1| tumor-related protein [Vitis cinerea var. helleri x Vitis riparia]
Length=203

 Score =   101 bits (252),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 57/128 (45%), Positives = 80/128 (63%), Gaps = 7/128 (5%)
 Frame = -1

Query  405  CPKSVVQVGPNVV-GNTVTFSPVNPKD-VVRNGTDLNVQFSGSNAGCPESTVWQITHDPE  232
            CP  VVQ    V  G  +TF+PVNPK  V+R  TD N++FS S   C +ST+W++ +D  
Sbjct  68   CPLDVVQEQQEVSNGLPLTFTPVNPKKGVIRVSTDHNIKFSASTI-CVQSTLWKLEYD--  124

Query  231  DTDTTHYVVSGGVKGNPSSSTTRNWFMIVKTKNGYKFKFCPVSVCD-CDPICQDIAISVE  55
            ++    +V +GGV+GNP   T  NWF I K  + YK  FCP +VCD C P+C DI I ++
Sbjct  125  ESSGQRFVTTGGVEGNPGRETLDNWFKIEKYDDDYKLVFCP-TVCDFCKPVCGDIGIYIQ  183

Query  54   SGHRLLDV  31
            +G+R L +
Sbjct  184  NGYRRLAL  191



>emb|CAN65022.1| hypothetical protein VITISV_027379 [Vitis vinifera]
Length=203

 Score =   100 bits (250),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 57/128 (45%), Positives = 81/128 (63%), Gaps = 7/128 (5%)
 Frame = -1

Query  405  CPKSVVQVGPNVV-GNTVTFSPVNPKD-VVRNGTDLNVQFSGSNAGCPESTVWQITHDPE  232
            CP  VVQ    V  G  +TF+PVNPK  V+R  TD N++FS S   C +ST+W++ +D  
Sbjct  68   CPLDVVQEQQEVSNGLPLTFTPVNPKKGVIRVSTDHNIKFSASTI-CVQSTLWKLEYD--  124

Query  231  DTDTTHYVVSGGVKGNPSSSTTRNWFMIVKTKNGYKFKFCPVSVCD-CDPICQDIAISVE  55
            ++    +V +GGV+GNP   T  NWF I K ++ YK  FCP +VCD C P+C DI I ++
Sbjct  125  ESSGQWFVTTGGVEGNPGRETLDNWFKIEKYEDDYKLVFCP-TVCDFCKPVCGDIGIYIQ  183

Query  54   SGHRLLDV  31
            +G+R L +
Sbjct  184  NGYRRLAL  191



>ref|XP_002270111.1| PREDICTED: miraculin [Vitis vinifera]
 emb|CBI35474.3| unnamed protein product [Vitis vinifera]
Length=203

 Score =   100 bits (250),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 57/128 (45%), Positives = 81/128 (63%), Gaps = 7/128 (5%)
 Frame = -1

Query  405  CPKSVVQVGPNVV-GNTVTFSPVNPKD-VVRNGTDLNVQFSGSNAGCPESTVWQITHDPE  232
            CP  VVQ    V  G  +TF+PVNPK  V+R  TD N++FS S   C +ST+W++ +D  
Sbjct  68   CPLDVVQEQHEVSNGLPLTFTPVNPKKGVIRVSTDHNIKFSASTI-CVQSTLWKLEYD--  124

Query  231  DTDTTHYVVSGGVKGNPSSSTTRNWFMIVKTKNGYKFKFCPVSVCD-CDPICQDIAISVE  55
            ++    +V +GGV+GNP   T  NWF I K ++ YK  FCP +VCD C P+C DI I ++
Sbjct  125  ESSGQRFVTTGGVEGNPGHETLDNWFKIEKYEDDYKLVFCP-TVCDFCKPVCGDIGIYIQ  183

Query  54   SGHRLLDV  31
            +G+R L +
Sbjct  184  NGYRRLAL  191



>ref|XP_002265965.1| PREDICTED: miraculin [Vitis vinifera]
 emb|CBI35463.3| unnamed protein product [Vitis vinifera]
Length=205

 Score = 99.8 bits (247),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 55/133 (41%), Positives = 81/133 (61%), Gaps = 7/133 (5%)
 Frame = -1

Query  405  CPKSVVQVGPNVV-GNTVTFSPVNPK-DVVRNGTDLNVQFSGSNAGCPESTVWQITHDPE  232
            CP  VVQ    V  G  +TF+PVNPK DV+R  TD N++FS +   C +STVW++ +D  
Sbjct  69   CPLDVVQDKLEVSHGLPLTFTPVNPKQDVIRVSTDHNIKFSAATI-CAQSTVWKLEYD--  125

Query  231  DTDTTHYVVSGGVKGNPSSSTTRNWFMIVKTKNGYKFKFCPVSVCD-CDPICQDIAISVE  55
            ++    ++ +GGV+GNP   T  NWF I K  + YK  FCP +VC+ C  IC+D+ + ++
Sbjct  126  ESTGQRFITTGGVEGNPGRGTLSNWFKIEKYGDDYKLVFCP-TVCNFCKVICRDVGVYIQ  184

Query  54   SGHRLLDVDVSLP  16
             G+R L +    P
Sbjct  185  KGYRRLALTTDAP  197



>emb|CAN75396.1| hypothetical protein VITISV_028636 [Vitis vinifera]
Length=203

 Score = 99.4 bits (246),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 56/126 (44%), Positives = 79/126 (63%), Gaps = 7/126 (6%)
 Frame = -1

Query  405  CPKSVVQVGPNVV-GNTVTFSPVNPKD-VVRNGTDLNVQFSGSNAGCPESTVWQITHDPE  232
            CP  VVQ    V  G  +TF+PVNPK  V+R  TD N++FS S   C +ST+W++ +D  
Sbjct  68   CPLDVVQEQQEVSNGLPLTFTPVNPKKGVIRVSTDHNIKFSASTI-CVQSTLWKLEYD--  124

Query  231  DTDTTHYVVSGGVKGNPSSSTTRNWFMIVKTKNGYKFKFCPVSVCD-CDPICQDIAISVE  55
            ++    +V +GGV+GNP   T  NWF I K ++ YK  FCP +VCD C P+C DI I ++
Sbjct  125  ESSGQRFVTTGGVEGNPGRETLDNWFKIEKYEDDYKLVFCP-TVCDFCKPVCGDIGIYIQ  183

Query  54   SGHRLL  37
            + +R L
Sbjct  184  NXYRRL  189



>ref|XP_002266430.1| PREDICTED: miraculin [Vitis vinifera]
Length=203

 Score = 99.4 bits (246),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 56/126 (44%), Positives = 79/126 (63%), Gaps = 7/126 (6%)
 Frame = -1

Query  405  CPKSVVQVGPNVV-GNTVTFSPVNPKD-VVRNGTDLNVQFSGSNAGCPESTVWQITHDPE  232
            CP  VVQ    V  G  +TF+PVNPK  V+R  TD N++FS S   C +ST+W++ +D  
Sbjct  68   CPLDVVQEQQEVSNGLPLTFTPVNPKKGVIRVSTDHNIKFSASTI-CVQSTLWKLEYD--  124

Query  231  DTDTTHYVVSGGVKGNPSSSTTRNWFMIVKTKNGYKFKFCPVSVCD-CDPICQDIAISVE  55
            ++    +V +GGV+GNP   T  NWF I K ++ YK  FCP +VCD C P+C DI I ++
Sbjct  125  ESSGQRFVTTGGVEGNPGRETLDNWFKIEKYEDDYKLVFCP-TVCDFCKPVCGDIGIYIQ  183

Query  54   SGHRLL  37
            + +R L
Sbjct  184  NEYRRL  189



>emb|CBI35464.3| unnamed protein product [Vitis vinifera]
Length=225

 Score = 99.4 bits (246),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 56/128 (44%), Positives = 80/128 (63%), Gaps = 7/128 (5%)
 Frame = -1

Query  405  CPKSVVQVGPNVV-GNTVTFSPVNPKD-VVRNGTDLNVQFSGSNAGCPESTVWQITHDPE  232
            CP  VVQ    V  G  +TF+PVNPK  V+R  TD N++FS S   C +ST+W++ +D  
Sbjct  90   CPLDVVQEQQEVSNGLPLTFTPVNPKKGVIRVSTDHNIKFSASTI-CVQSTLWKLEYD--  146

Query  231  DTDTTHYVVSGGVKGNPSSSTTRNWFMIVKTKNGYKFKFCPVSVCD-CDPICQDIAISVE  55
            ++    +V +GGV+GNP   T  NWF I K ++ YK  FCP +VCD C P+C DI I ++
Sbjct  147  ESSGQRFVTTGGVEGNPGRETLDNWFKIEKYEDDYKLVFCP-TVCDFCKPVCGDIGIYIQ  205

Query  54   SGHRLLDV  31
            + +R L +
Sbjct  206  NEYRRLAL  213



>ref|XP_006372631.1| trypsin protein inhibitor 3 [Populus trichocarpa]
 gb|ERP50428.1| trypsin protein inhibitor 3 [Populus trichocarpa]
Length=209

 Score = 99.0 bits (245),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 57/139 (41%), Positives = 81/139 (58%), Gaps = 6/139 (4%)
 Frame = -1

Query  405  CPKSVVQVGPNVV-GNTVTFSPV--NPKDVVRNGTDLNVQFSGSNAGCPESTVWQITHDP  235
            CP +VVQ    V  G  +TF+P   + K V+   TDLN++F      CP+STVW+IT   
Sbjct  64   CPLAVVQDRLEVSKGLPLTFTPAADDKKGVILVSTDLNIKFLAKTT-CPQSTVWKITKS-  121

Query  234  EDTDTTHYVVSGGVKGNPSSSTTRNWFMIVKTKNGYKFKFCPVSVCDCDPICQDIAISVE  55
             ++    +V +GGV+GNP  +T  NWF I K  + YK  FCP  VC+C  +C+DI I +E
Sbjct  122  SNSKVQWFVSTGGVEGNPGFNTVTNWFQIEKADDDYKIVFCPTKVCNCGVLCRDIGIYIE  181

Query  54   -SGHRLLDVDVSLPPLEVN  1
             +G R L +  +L P +V 
Sbjct  182  DNGTRTLSLSDALQPFKVQ  200



>gb|ADW95389.1| Kunitz-type trypsin inhibitor [Populus nigra]
Length=209

 Score = 97.4 bits (241),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 56/139 (40%), Positives = 80/139 (58%), Gaps = 6/139 (4%)
 Frame = -1

Query  405  CPKSVVQVGPNVV-GNTVTFSPV--NPKDVVRNGTDLNVQFSGSNAGCPESTVWQITHDP  235
            CP +VVQ    V  G  +TF+P   + K V+   TDLN++F      CP+STVW+I    
Sbjct  64   CPLAVVQDRLEVSKGLPLTFTPAADDKKGVILVSTDLNIKFLAKTT-CPQSTVWKIIKS-  121

Query  234  EDTDTTHYVVSGGVKGNPSSSTTRNWFMIVKTKNGYKFKFCPVSVCDCDPICQDIAISVE  55
             ++    +V +GGV+GNP  +T  NWF I K  + YK  FCP  VC+C  +C+DI I +E
Sbjct  122  SNSKVQWFVSTGGVEGNPGFNTVTNWFQIEKADDDYKLVFCPTKVCNCGVLCRDIGIYIE  181

Query  54   -SGHRLLDVDVSLPPLEVN  1
             +G R L +  +L P +V 
Sbjct  182  DNGTRTLSLSDALQPFKVQ  200



>gb|AEK26936.1| Kunitz-type trypsin inhibitor B3 [Populus nigra]
Length=209

 Score = 97.4 bits (241),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 56/139 (40%), Positives = 80/139 (58%), Gaps = 6/139 (4%)
 Frame = -1

Query  405  CPKSVVQVGPNVV-GNTVTFSPV--NPKDVVRNGTDLNVQFSGSNAGCPESTVWQITHDP  235
            CP +VVQ    V  G  +TF+P   + K V+   TDLN++F      CP+STVW+I    
Sbjct  64   CPLAVVQDRLEVSNGLPLTFTPAADDKKGVILVSTDLNIKFLAKTT-CPQSTVWKIIKS-  121

Query  234  EDTDTTHYVVSGGVKGNPSSSTTRNWFMIVKTKNGYKFKFCPVSVCDCDPICQDIAISVE  55
             ++    +V +GGV+GNP  +T  NWF I K  + YK  FCP  VC+C  +C+DI I +E
Sbjct  122  SNSKVQWFVSTGGVEGNPGFNTVTNWFQIEKADDDYKLVFCPTKVCNCGVLCRDIGIYIE  181

Query  54   -SGHRLLDVDVSLPPLEVN  1
             +G R L +  +L P +V 
Sbjct  182  DNGTRTLSLSDALQPFKVQ  200



>emb|CBI35471.3| unnamed protein product [Vitis vinifera]
Length=2095

 Score =   101 bits (252),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 57/128 (45%), Positives = 81/128 (63%), Gaps = 7/128 (5%)
 Frame = -1

Query  405   CPKSVVQVGPNVV-GNTVTFSPVNPKD-VVRNGTDLNVQFSGSNAGCPESTVWQITHDPE  232
             CP  VVQ    V  G  +TF+PVNPK  V+R  TD N++FS S   C +ST+W++ +D  
Sbjct  1960  CPLDVVQEQQEVSNGLPLTFTPVNPKKGVIRVSTDHNIKFSASTI-CVQSTLWKLEYD--  2016

Query  231   DTDTTHYVVSGGVKGNPSSSTTRNWFMIVKTKNGYKFKFCPVSVCD-CDPICQDIAISVE  55
             ++    +V +GGV+GNP   T  NWF I K ++ YK  FCP +VCD C P+C DI I ++
Sbjct  2017  ESSGQRFVTTGGVEGNPGRETLDNWFKIEKYEDDYKLVFCP-TVCDFCKPVCGDIGIYIQ  2075

Query  54    SGHRLLDV  31
             +G+R L +
Sbjct  2076  NGYRRLAL  2083



>gb|ACS92519.1| Kunitz-type protease inhibitor KPI-D8 [Populus trichocarpa x 
Populus nigra]
Length=211

 Score = 95.1 bits (235),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 54/137 (39%), Positives = 79/137 (58%), Gaps = 5/137 (4%)
 Frame = -1

Query  405  CPKSVVQVGPNVV-GNTVTFSPVNPKD-VVRNGTDLNVQFSGSNAGCPESTVWQITHDPE  232
            CP  V+Q   +++ G  VTFSP + +D ++R  TDLN++FS   A C  S+VW+I     
Sbjct  65   CPDDVIQYSSDLLQGLPVTFSPASSEDDIIRVSTDLNIKFSIKKA-CDHSSVWKI-QKSS  122

Query  231  DTDTTHYVVSGGVKGNPSSSTTRNWFMIVKTKNGYKFKFCPVSVCDCDPICQDIAISVE-  55
            +++   +V +GG +GNP   T  NWF I K   GYK   CP ++C C  +C+DI I  E 
Sbjct  123  NSEVQWFVTTGGEEGNPGIDTLTNWFKIEKAGIGYKLVSCPENICHCGVLCRDIGIYREN  182

Query  54   SGHRLLDVDVSLPPLEV  4
            +G R+L +   L P  V
Sbjct  183  NGRRILSLSDKLSPFLV  199



>ref|XP_006347379.1| PREDICTED: miraculin-like [Solanum tuberosum]
Length=204

 Score = 95.1 bits (235),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 51/127 (40%), Positives = 74/127 (58%), Gaps = 4/127 (3%)
 Frame = -1

Query  405  CPKSVVQVGPNVVGNTVTFSPVNPKD-VVRNGTDLNVQFSGSNAGCPESTVWQITHDPED  229
            C   VVQ   +V G +V   P+NPK+ V+R  TDLN+    ++    +STVWQ+  +  D
Sbjct  64   CQLGVVQEIYDVHGGSVALLPLNPKEGVIRVSTDLNIAIFSTHGCGDQSTVWQL--ETYD  121

Query  228  TDTTHYVVS-GGVKGNPSSSTTRNWFMIVKTKNGYKFKFCPVSVCDCDPICQDIAISVES  52
            + T  Y +  GGV+GNP   T RNWF I K  +GYKF +CP     C  IC+D+ + +++
Sbjct  122  SKTGKYFIKDGGVEGNPDPKTIRNWFKIEKYGHGYKFVYCPSVCSKCKVICKDVGVYMKN  181

Query  51   GHRLLDV  31
            G R L +
Sbjct  182  GQRRLAL  188



>ref|XP_006495063.1| PREDICTED: miraculin-like [Citrus sinensis]
Length=206

 Score = 95.1 bits (235),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 63/134 (47%), Positives = 81/134 (60%), Gaps = 9/134 (7%)
 Frame = -1

Query  405  CPKSVVQVGPNVV-GNTVTFSPVNPKD-VVRNGTDLNVQFSGSNAGCPESTVWQITHDPE  232
            CP  VVQ   +   G  VTFSPVNPK  VVR  TDLN++F  + + C +STVW++  D  
Sbjct  70   CPLDVVQEQHSFRNGLPVTFSPVNPKKGVVRESTDLNIKFDAATS-CAQSTVWKL--DNF  126

Query  231  DTDTTHYVVS-GGVKGNPSSSTTRNWFMIVKTKNGYKFKFCPVSVCD-CDPICQDIAISV  58
            DT    ++V+ GGV+GNP   T RNWF I K    YK  FCP SVC+ C  +C+D+ I +
Sbjct  127  DTAFGQWLVTTGGVEGNPGPRTMRNWFKIEKFYGDYKLVFCP-SVCNFCRGLCRDVGIFI  185

Query  57   ESGHRLLDV-DVSL  19
              G R L + DV L
Sbjct  186  NGGVRRLALSDVPL  199



>ref|XP_006441456.1| hypothetical protein CICLE_v10023572mg [Citrus clementina]
 gb|ESR54696.1| hypothetical protein CICLE_v10023572mg [Citrus clementina]
Length=206

 Score = 94.4 bits (233),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 59/129 (46%), Positives = 78/129 (60%), Gaps = 8/129 (6%)
 Frame = -1

Query  405  CPKSVVQVGPNVV-GNTVTFSPVNPKD-VVRNGTDLNVQFSGSNAGCPESTVWQITHDPE  232
            CP  VVQ   ++  G  VTFSPVNPK  VVR  TDLN++F  + + C +STVW++  D  
Sbjct  70   CPLDVVQEQHSLRNGFPVTFSPVNPKKGVVRESTDLNIKFDAATS-CAQSTVWKL--DNF  126

Query  231  DTDTTHYVVS-GGVKGNPSSSTTRNWFMIVKTKNGYKFKFCPVSVCD-CDPICQDIAISV  58
            D     ++V+ GGV+GNP   T RNWF I K    YK  FCP SVC+ C  +C+D+ I +
Sbjct  127  DAALGQWLVTTGGVEGNPGPRTMRNWFKIEKFYGDYKLVFCP-SVCNFCRGLCRDVGIFI  185

Query  57   ESGHRLLDV  31
              G R L +
Sbjct  186  NGGVRRLAL  194



>gb|AFK39812.1| unknown [Lotus japonicus]
 gb|AFK45182.1| unknown [Lotus japonicus]
Length=208

 Score = 93.6 bits (231),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 50/136 (37%), Positives = 76/136 (56%), Gaps = 6/136 (4%)
 Frame = -1

Query  405  CPKSVVQVGPNVV-GNTVTFSPVNPKD-VVRNGTDLNVQFSGSNAGCPESTVWQITHDPE  232
            CP  VVQ    V+ G +VTF+P N K  V+   TDLN++ S +N  C ++ VW++    +
Sbjct  72   CPLHVVQEKLEVLKGQSVTFTPYNAKGGVILTSTDLNIKSSLTNTTCAKAPVWKLL---K  128

Query  231  DTDTTHYVVSGGVKGNPSSSTTRNWFMIVKTKNGYKFKFCPVSVCDCDPICQDIAISVES  52
            +     ++ +GGV+GNP  +T  NWF I K    Y F FCP SVC C  +C+++ I    
Sbjct  129  ELSGVWFLATGGVEGNPGMATISNWFKIEKADKDYVFSFCP-SVCKCQTLCRELGIYDYG  187

Query  51   GHRLLDVDVSLPPLEV  4
            G + L +   +PP  +
Sbjct  188  GDKHLSLSDQVPPFRI  203



>ref|XP_007029361.1| Kunitz family trypsin and protease inhibitor protein, putative 
[Theobroma cacao]
 gb|EOY09863.1| Kunitz family trypsin and protease inhibitor protein, putative 
[Theobroma cacao]
Length=198

 Score = 93.2 bits (230),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 56/126 (44%), Positives = 76/126 (60%), Gaps = 7/126 (6%)
 Frame = -1

Query  405  CPKSVVQVGPNVV-GNTVTFSPVN-PKDVVRNGTDLNVQFSGSNAGCPESTVWQITHDPE  232
            CP  VVQ    V  G  +TFSPVN  K VVR  TDLN++FS +   C +STVW++ +D  
Sbjct  63   CPLDVVQEQLEVSNGLPLTFSPVNITKGVVRVSTDLNIKFSAATI-CVQSTVWKLDND--  119

Query  231  DTDTTHYVVSGGVKGNPSSSTTRNWFMIVKTKNGYKFKFCPVSVCD-CDPICQDIAISVE  55
            +      V +GGV+GNP   T  NWF I + ++ YK  FCP  VCD C P+C D+ + ++
Sbjct  120  EATQKMVVTTGGVEGNPGIETLSNWFKIERYEDDYKLVFCP-GVCDFCRPVCGDLGVFID  178

Query  54   SGHRLL  37
            +G R L
Sbjct  179  AGIRRL  184



>ref|XP_006351548.1| PREDICTED: miraculin-like [Solanum tuberosum]
Length=208

 Score = 93.6 bits (231),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 59/138 (43%), Positives = 82/138 (59%), Gaps = 8/138 (6%)
 Frame = -1

Query  405  CPKSVVQVGPNVVGNTVTFSPVNPKD-VVRNGTDLNVQFSGSNAGCPE-STVWQITH-DP  235
            CP  +     N  G ++ F PVN K  V+R   DLNV+F+ +   C   S VW++ H +P
Sbjct  70   CPLGIGPRLNNDSGLSINFFPVNSKKGVIRESIDLNVEFTETYTICQHHSNVWRLDHYNP  129

Query  234  EDTDTTHYVVSGGVKGNPSSSTTRNWFMIVKTKNGYKFKFCPVSVCD-CDPICQDIAISV  58
            +  D  H + +GGVKGNP   T  NWF IVK   GYKF FCP SVC+ CD IC+++ + V
Sbjct  130  QKED--HMITNGGVKGNPGRDTISNWFKIVKYGVGYKFVFCP-SVCNYCDVICKNVGVFV  186

Query  57   ESGHRLLDVDVSLPPLEV  4
            ++  + L + +S  PLEV
Sbjct  187  QNNGQTL-LTLSNEPLEV  203



>ref|XP_011046090.1| PREDICTED: miraculin-like [Populus euphratica]
Length=209

 Score = 93.6 bits (231),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 55/139 (40%), Positives = 77/139 (55%), Gaps = 6/139 (4%)
 Frame = -1

Query  405  CPKSVVQVGPNVV-GNTVTFSPV--NPKDVVRNGTDLNVQFSGSNAGCPESTVWQITHDP  235
            CP +VVQ       G  +TF+P   + K V+   TDLN++F      CP STVW+I    
Sbjct  64   CPLAVVQDRLEASKGLPLTFTPAADDKKGVILVSTDLNIKFLDKTT-CPHSTVWKIIKS-  121

Query  234  EDTDTTHYVVSGGVKGNPSSSTTRNWFMIVKTKNGYKFKFCPVSVCDCDPICQDIAISVE  55
             ++    +V +GGV+GNP  +T  NWF I K  + YK  FCP  VC C  +C+DI I +E
Sbjct  122  SNSKVQWFVSTGGVEGNPGFNTVGNWFQIEKADDDYKLVFCPTKVCKCGVLCRDIGIYIE  181

Query  54   -SGHRLLDVDVSLPPLEVN  1
             +G R L +  +L P +V 
Sbjct  182  DNGTRTLSLSDALQPFKVQ  200



>ref|XP_004301214.1| PREDICTED: miraculin-like [Fragaria vesca subsp. vesca]
Length=226

 Score = 93.6 bits (231),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 63/139 (45%), Positives = 78/139 (56%), Gaps = 6/139 (4%)
 Frame = -1

Query  405  CPKSVVQVGPNVV-GNTVTFSPVN-PKDVVRNGTDLNVQFSGSNA--GCPE-STVWQITH  241
            CP  VVQ    V  G  +TFSPVN  K VVR  TDLN++FS S A   CP+ S VW++  
Sbjct  84   CPLDVVQEQSEVSNGLPLTFSPVNLTKGVVRLSTDLNIKFSTSAAVTLCPQTSKVWKLDE  143

Query  240  DPEDTDTTHYVVSGGVKGNPSSSTTRNWFMIVKTKNGYKFKFCPVSVCDCDPICQDIAIS  61
              E T     V +GGV+GNPS  T  NWF I K  + YK  FCP     C  IC D+ + 
Sbjct  144  VDESTGQ-RSVTTGGVEGNPSPKTLMNWFKIEKYDDDYKLVFCPKVCRFCRVICGDVGVH  202

Query  60   VESGHRLLDVDVSLPPLEV  4
            +ESG R L +   + PL+V
Sbjct  203  LESGVRRLALSDVIVPLKV  221



>ref|XP_011035403.1| PREDICTED: 21 kDa seed protein-like [Populus euphratica]
Length=212

 Score = 93.2 bits (230),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 56/138 (41%), Positives = 77/138 (56%), Gaps = 6/138 (4%)
 Frame = -1

Query  405  CPKSVVQVGPNVV-GNTVTFSPVN-PKDVVRNGTDLNVQFSGSNAGCPESTVWQITHDPE  232
            CP  V+Q   +++ G  VTFSP N   DV+R  TDLN++FS   A C  S+VW+I     
Sbjct  65   CPDDVIQYSLDLLRGLPVTFSPANYGDDVIRISTDLNIKFSIKKA-CDHSSVWKI-QKSS  122

Query  231  DTDTTHYVVSGGVKGNPSSSTTRNWFMIVKTK-NGYKFKFCPVSVCDCDPICQDIAISVE  55
            +++   +V +GG +GNP   T  NWF I K    GYK  FCP  +C C  +C+DI I  E
Sbjct  123  NSEVQWFVTTGGEEGNPGVDTLTNWFKIEKAGILGYKLVFCPKDICHCGVLCRDIGIYFE  182

Query  54   SGH-RLLDVDVSLPPLEV  4
            +   R+L +   L P  V
Sbjct  183  NNRGRILSLSDQLSPFVV  200



>ref|XP_010663911.1| PREDICTED: miraculin-like [Vitis vinifera]
Length=209

 Score = 92.8 bits (229),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 54/126 (43%), Positives = 75/126 (60%), Gaps = 7/126 (6%)
 Frame = -1

Query  405  CPKSVVQVGPNVV-GNTVTFSPVNPKD-VVRNGTDLNVQFSGSNAGCPESTVWQITHDPE  232
            CP  VVQ    V  G  + F PVNPK  V+R  TD N++FS +   C +STVW++ +D  
Sbjct  74   CPLDVVQEQHEVSNGLPLMFIPVNPKKGVIRVSTDHNIEFSAATI-CIQSTVWKLEYD--  130

Query  231  DTDTTHYVVSGGVKGNPSSSTTRNWFMIVKTKNGYKFKFCPVSVCD-CDPICQDIAISVE  55
            ++    +V +GGV+GNP   T  NWF I K ++     FCP +VCD C P+C DI I ++
Sbjct  131  ESSGQQFVTTGGVEGNPGRGTLSNWFKIEKYEDDNNLVFCP-TVCDFCKPVCGDIVIYIQ  189

Query  54   SGHRLL  37
             G+R L
Sbjct  190  DGYRRL  195



>ref|XP_006441459.1| hypothetical protein CICLE_v10022284mg [Citrus clementina]
 gb|ESR54699.1| hypothetical protein CICLE_v10022284mg [Citrus clementina]
Length=206

 Score = 92.4 bits (228),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 61/134 (46%), Positives = 79/134 (59%), Gaps = 9/134 (7%)
 Frame = -1

Query  405  CPKSVVQVGPNVV-GNTVTFSPVNPKD-VVRNGTDLNVQFSGSNAGCPESTVWQITHDPE  232
            CP  VVQ   +   G  VTFSPVNPK  VVR  TD N++F  + + C +STVW++  D  
Sbjct  70   CPLDVVQEQHSFRNGLPVTFSPVNPKKGVVRESTDFNIKFDAATS-CAQSTVWKL--DNF  126

Query  231  DTDTTHYVVS-GGVKGNPSSSTTRNWFMIVKTKNGYKFKFCPVSVCD-CDPICQDIAISV  58
            D     ++V+ GGV+GNP   T RNWF I K    YK  FCP SVC+ C  +C+D+ I +
Sbjct  127  DAALGQWLVTTGGVEGNPGPRTMRNWFKIEKFYGDYKLVFCP-SVCNFCRGLCRDVGIFI  185

Query  57   ESGHRLLDV-DVSL  19
              G R L + DV L
Sbjct  186  NGGVRRLALSDVPL  199



>ref|XP_011035402.1| PREDICTED: 21 kDa seed protein-like [Populus euphratica]
Length=212

 Score = 92.4 bits (228),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 55/138 (40%), Positives = 77/138 (56%), Gaps = 6/138 (4%)
 Frame = -1

Query  405  CPKSVVQVGPNVV-GNTVTFSPVNPKD-VVRNGTDLNVQFSGSNAGCPESTVWQITHDPE  232
            CP  V+Q   +++ G  VTFSP +  D V+R  TDLN++FS   A C  S+VW+I     
Sbjct  65   CPDDVIQYSLDLLRGLPVTFSPASSDDDVIRVSTDLNIKFSIEKA-CDHSSVWKI-QKSS  122

Query  231  DTDTTHYVVSGGVKGNPSSSTTRNWFMIVKTK-NGYKFKFCPVSVCDCDPICQDIAISVE  55
            +++   +V +GG +GNP   T  NWF I K    GYK  FCP  +C C  +C+DI I  E
Sbjct  123  NSEVQWFVTTGGAEGNPGVDTLFNWFKIEKAGILGYKLVFCPKDICHCGVLCRDIGIYFE  182

Query  54   SGH-RLLDVDVSLPPLEV  4
            +   R+L +   L P  V
Sbjct  183  NNRGRILSLSDQLSPFVV  200



>emb|CAZ64526.1| Kunitz trypsin inhibitor [Populus trichocarpa]
Length=149

 Score = 90.9 bits (224),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 55/138 (40%), Positives = 77/138 (56%), Gaps = 6/138 (4%)
 Frame = -1

Query  405  CPKSVVQVGPNVV-GNTVTFSPVNPKD-VVRNGTDLNVQFSGSNAGCPESTVWQITHDPE  232
            CP  V+Q   + + G  VTFSP + +D V+R  TDLN++FS   A C  S+VW+I     
Sbjct  12   CPDDVIQYSSDQLQGLPVTFSPASSEDDVIRVSTDLNIKFSIKKA-CDHSSVWKI-QKSS  69

Query  231  DTDTTHYVVSGGVKGNPSSSTTRNWFMIVKTKN-GYKFKFCPVSVCDCDPICQDIAISVE  55
            +++   +V +GG +GNP   T  NWF I K    GYK  FCP  +C C  +C+DI I  E
Sbjct  70   NSEVQWFVTTGGEEGNPGVDTLTNWFKIEKAGTLGYKLVFCPEDICHCGVLCRDIGIYFE  129

Query  54   SGH-RLLDVDVSLPPLEV  4
            +   R+L +   L P  V
Sbjct  130  NNRGRILSLSDKLSPFVV  147



>ref|XP_006495061.1| PREDICTED: miraculin-like [Citrus sinensis]
Length=206

 Score = 92.0 bits (227),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 62/138 (45%), Positives = 81/138 (59%), Gaps = 10/138 (7%)
 Frame = -1

Query  405  CPKSVVQVGPNVV-GNTVTFSPVNPKD-VVRNGTDLNVQFSGSNAGCPESTVWQITHDPE  232
            CP  VVQ   +   G  VTFSPVNPK  VVR  TDLN++F  + + C +STVW++  D  
Sbjct  70   CPLDVVQEQHSFRNGLPVTFSPVNPKKGVVRESTDLNIKFDAATS-CAQSTVWKL--DNF  126

Query  231  DTDTTHYVVS-GGVKGNPSSSTTRNWFMIVKTKNGYKFKFCPVSVCD-CDPICQDIAISV  58
            D     ++V+ GGV+GNP   T RNWF I K    YK  +CP SVC+ C  +C+D+ I +
Sbjct  127  DAAFGQWLVTTGGVEGNPGPRTMRNWFKIEKFFGDYKLVYCP-SVCNFCRGLCRDVGIFI  185

Query  57   ESGHRLLDVD--VSLPPL  10
              G R L +    SL PL
Sbjct  186  NGGVRRLALSDFHSLGPL  203



>ref|XP_006441460.1| hypothetical protein CICLE_v10024584mg, partial [Citrus clementina]
 gb|ESR54700.1| hypothetical protein CICLE_v10024584mg, partial [Citrus clementina]
Length=153

 Score = 90.9 bits (224),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 58/129 (45%), Positives = 77/129 (60%), Gaps = 8/129 (6%)
 Frame = -1

Query  405  CPKSVVQVGPNVV-GNTVTFSPVNPKD-VVRNGTDLNVQFSGSNAGCPESTVWQITHDPE  232
            CP  VVQ   +   G  VTFSPVNPK  VVR  TDLN++F  + + C +STVW++  D  
Sbjct  17   CPLDVVQEQHSFKNGFPVTFSPVNPKKGVVRESTDLNIKFDAATS-CAQSTVWKL--DNF  73

Query  231  DTDTTHYVVS-GGVKGNPSSSTTRNWFMIVKTKNGYKFKFCPVSVCD-CDPICQDIAISV  58
            D     ++V+ GGV+GNP   T RNWF I K    YK  +CP SVC+ C  +C+D+ I +
Sbjct  74   DAAFGQWLVTTGGVEGNPGPRTMRNWFKIEKFFGDYKLVYCP-SVCNFCRGLCRDVGIFI  132

Query  57   ESGHRLLDV  31
              G R L +
Sbjct  133  NGGVRRLAL  141



>ref|XP_006441435.1| hypothetical protein CICLE_v10023257mg [Citrus clementina]
 gb|ESR54675.1| hypothetical protein CICLE_v10023257mg [Citrus clementina]
Length=206

 Score = 92.0 bits (227),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 58/129 (45%), Positives = 77/129 (60%), Gaps = 8/129 (6%)
 Frame = -1

Query  405  CPKSVVQVGPNVV-GNTVTFSPVNPKD-VVRNGTDLNVQFSGSNAGCPESTVWQITHDPE  232
            CP  VVQ   +   G  VTFSPVNPK  VVR  TDLN++F  + + C +STVW++  D  
Sbjct  70   CPVDVVQEQHSFRNGLPVTFSPVNPKKGVVRESTDLNIKFDAATS-CAQSTVWKL--DNF  126

Query  231  DTDTTHYVVS-GGVKGNPSSSTTRNWFMIVKTKNGYKFKFCPVSVCD-CDPICQDIAISV  58
            D     ++V+ GGV+GNP   T RNWF I K    YK  +CP SVC+ C  +C+D+ I +
Sbjct  127  DAALGQWLVTTGGVEGNPGPRTMRNWFKIEKFFGNYKLVYCP-SVCNFCRGLCRDVGIFI  185

Query  57   ESGHRLLDV  31
              G R L +
Sbjct  186  NGGVRRLAL  194



>ref|XP_006493432.1| PREDICTED: miraculin-like [Citrus sinensis]
Length=342

 Score = 93.2 bits (230),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 62/134 (46%), Positives = 80/134 (60%), Gaps = 9/134 (7%)
 Frame = -1

Query  405  CPKSVVQVGPNVV-GNTVTFSPVNPKD-VVRNGTDLNVQFSGSNAGCPESTVWQITHDPE  232
            CP  VVQ   +   G  VTFSPVNPK  VVR  TDLN++F  + + C +STVW++  D  
Sbjct  70   CPLDVVQEQHSFRNGLPVTFSPVNPKKGVVRESTDLNIKFDAATS-CAQSTVWKL--DNF  126

Query  231  DTDTTHYVVS-GGVKGNPSSSTTRNWFMIVKTKNGYKFKFCPVSVCD-CDPICQDIAISV  58
            D     ++V+ GGV+GNP   T RNWF I K    YK  FCP SVC+ C  +C+D+ I +
Sbjct  127  DAVLGQWLVTTGGVEGNPGPRTMRNWFKIEKFYGDYKLVFCP-SVCNFCRGLCRDVGIFI  185

Query  57   ESGHRLLDV-DVSL  19
              G R L + DV L
Sbjct  186  NGGVRRLALSDVPL  199


 Score = 65.9 bits (159),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 39/87 (45%), Positives = 49/87 (56%), Gaps = 4/87 (5%)
 Frame = -1

Query  366  GNTVTFSPVNPKD-VVRNGTDLNVQFSGSNAGCPESTVWQITHDPEDTDTTHYVVSGGVK  190
            G+ +TFSPVNPK+ V+R   DLN++F        +STVW++  D            GGV+
Sbjct  250  GSPMTFSPVNPKNGVIRESIDLNIKFEVVKTSV-QSTVWKL--DNLMQYWGRICAIGGVR  306

Query  189  GNPSSSTTRNWFMIVKTKNGYKFKFCP  109
            GNP   TTRNWFMI K    YK  F P
Sbjct  307  GNPGPQTTRNWFMIEKFYGDYKLVFYP  333



>ref|XP_006493430.1| PREDICTED: miraculin-like [Citrus sinensis]
Length=206

 Score = 91.7 bits (226),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 59/129 (46%), Positives = 77/129 (60%), Gaps = 8/129 (6%)
 Frame = -1

Query  405  CPKSVVQVGPNVV-GNTVTFSPVNPKD-VVRNGTDLNVQFSGSNAGCPESTVWQITHDPE  232
            CP  VVQ   +   G  VTFSPVNPK  VVR  TDLN++F  + + C +STVW++  D  
Sbjct  70   CPVDVVQEQHSFRNGLPVTFSPVNPKKGVVRESTDLNIKFDAATS-CAQSTVWKL--DNF  126

Query  231  DTDTTHYVVS-GGVKGNPSSSTTRNWFMIVKTKNGYKFKFCPVSVCD-CDPICQDIAISV  58
            D     +VV+ GGV+GNP   T RNWF I K    YK  +CP SVC+ C  +C+D+ I +
Sbjct  127  DAAFGQWVVTTGGVEGNPGPRTMRNWFKIEKFFGDYKLVYCP-SVCNFCRGLCRDVGIFI  185

Query  57   ESGHRLLDV  31
              G R L +
Sbjct  186  NGGVRRLAL  194



>ref|XP_002305033.1| trypsin protein inhibitor 3 [Populus trichocarpa]
 gb|EEE85544.1| trypsin protein inhibitor 3 [Populus trichocarpa]
 gb|ACS92484.1| Kunitz-type protease inhibitor KPI-D1.2 [Populus trichocarpa]
 gb|ADW95379.1| Kunitz-type trypsin inhibitor [Populus nigra]
Length=212

 Score = 91.7 bits (226),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 55/138 (40%), Positives = 77/138 (56%), Gaps = 6/138 (4%)
 Frame = -1

Query  405  CPKSVVQVGPNVV-GNTVTFSPVNPKD-VVRNGTDLNVQFSGSNAGCPESTVWQITHDPE  232
            CP  V+Q   + + G  VTFSP + +D V+R  TDLN++FS   A C  S+VW+I     
Sbjct  65   CPDDVIQYSLDQLQGLPVTFSPASSEDDVIRVSTDLNIKFSIKKA-CDHSSVWKI-QKSS  122

Query  231  DTDTTHYVVSGGVKGNPSSSTTRNWFMIVKTKN-GYKFKFCPVSVCDCDPICQDIAISVE  55
            +++   +V +GG +GNP   T  NWF I K    GYK  FCP  +C C  +C+DI I  E
Sbjct  123  NSEVQWFVTTGGEEGNPGVHTLTNWFKIEKAGTLGYKLVFCPEDICHCGVLCRDIGIYFE  182

Query  54   SGH-RLLDVDVSLPPLEV  4
            +   R+L +   L P  V
Sbjct  183  NNRGRILSLSDKLSPFVV  200



>ref|XP_006441439.1| hypothetical protein CICLE_v10022282mg [Citrus clementina]
 gb|ESR54679.1| hypothetical protein CICLE_v10022282mg [Citrus clementina]
Length=206

 Score = 91.3 bits (225),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 58/129 (45%), Positives = 77/129 (60%), Gaps = 8/129 (6%)
 Frame = -1

Query  405  CPKSVVQVGPNVV-GNTVTFSPVNPKD-VVRNGTDLNVQFSGSNAGCPESTVWQITHDPE  232
            CP  VVQ   +   G  VTFSPVNPK  VVR  TDLN++F  + + C +STVW++  D  
Sbjct  70   CPLDVVQEQHSFKNGLPVTFSPVNPKKGVVRESTDLNIKFDAATS-CAQSTVWKL--DNF  126

Query  231  DTDTTHYVVS-GGVKGNPSSSTTRNWFMIVKTKNGYKFKFCPVSVCD-CDPICQDIAISV  58
            D     ++V+ GGV+GNP   T RNWF I K    YK  +CP SVC+ C  +C+D+ I +
Sbjct  127  DAAFGQWLVTTGGVEGNPGPRTMRNWFKIEKFFGDYKLVYCP-SVCNFCRGLCRDVGIFI  185

Query  57   ESGHRLLDV  31
              G R L +
Sbjct  186  NGGVRRLAL  194



>ref|XP_006493433.1| PREDICTED: miraculin-like [Citrus sinensis]
Length=221

 Score = 91.7 bits (226),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 58/129 (45%), Positives = 77/129 (60%), Gaps = 8/129 (6%)
 Frame = -1

Query  405  CPKSVVQVGPNVV-GNTVTFSPVNPKD-VVRNGTDLNVQFSGSNAGCPESTVWQITHDPE  232
            CP  VVQ   +   G  VTFSPVNPK  VVR  TDLN++F  + + C +STVW++  D  
Sbjct  70   CPLDVVQEQHSFKNGLPVTFSPVNPKKGVVRESTDLNIKFDAATS-CAQSTVWKL--DNF  126

Query  231  DTDTTHYVVS-GGVKGNPSSSTTRNWFMIVKTKNGYKFKFCPVSVCD-CDPICQDIAISV  58
            D     ++V+ GGV+GNP   T RNWF I K    YK  +CP SVC+ C  +C+D+ I +
Sbjct  127  DAAFGQWLVTTGGVEGNPGPRTMRNWFKIEKFFGDYKLVYCP-SVCNFCRGLCRDVGIFI  185

Query  57   ESGHRLLDV  31
              G R L +
Sbjct  186  NGGVRRLAL  194



>ref|XP_010041215.1| PREDICTED: miraculin-like [Eucalyptus grandis]
 gb|KCW44534.1| hypothetical protein EUGRSUZ_L01961 [Eucalyptus grandis]
Length=203

 Score = 91.3 bits (225),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 53/125 (42%), Positives = 70/125 (56%), Gaps = 5/125 (4%)
 Frame = -1

Query  405  CPKSVVQVGPNVV-GNTVTFSPVNPKDVVRNGTDLNVQFSGSNAGCPESTVWQITHDPED  229
            CP +VVQ    +  G    FSPV+ +  +R  TDLNV F  +   C +STVW++    E+
Sbjct  68   CPLAVVQEQQELSDGLPAKFSPVDGRSTIRLSTDLNVWFDAATI-CVQSTVWRLAAFDEE  126

Query  228  TDTTHYVVSGGVKGNPSSSTTRNWFMIVKTKNGYKFKFCPVSVCD-CDPICQDIAISVES  52
                ++V SGGV GNP   T  NWF I K    Y F+FCP +VCD C  IC+D+ I V+ 
Sbjct  127  V-KQYFVESGGVLGNPGRETVSNWFKIEKMDEDYNFRFCP-TVCDTCKVICRDVGIYVDG  184

Query  51   GHRLL  37
              R L
Sbjct  185  ATRRL  189



>ref|XP_007211211.1| hypothetical protein PRUPE_ppa011496mg [Prunus persica]
 gb|EMJ12410.1| hypothetical protein PRUPE_ppa011496mg [Prunus persica]
Length=208

 Score = 91.3 bits (225),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 59/128 (46%), Positives = 74/128 (58%), Gaps = 6/128 (5%)
 Frame = -1

Query  405  CPKSVVQVGPNVV-GNTVTFSPVN-PKDVVRNGTDLNVQFSGSNAGCPESTVWQITHDPE  232
            CP  VVQ    V  G  + FSPVN  K VVR  TDLN++FS +   C +STVW++    E
Sbjct  72   CPLDVVQEQNEVSNGLPLKFSPVNVTKGVVRVSTDLNIKFSATTI-CVQSTVWKLGKFDE  130

Query  231  DTDTTHYVVSGGVKGNPSSSTTRNWFMIVKTKNGYKFKFCPVSVCD-CDPICQDIAISVE  55
             T    +V SGGV+GNP   TT NWF I K  + YK  FCP +VC+ C  IC D+ I  +
Sbjct  131  QTGQ-WFVTSGGVEGNPGRQTTSNWFKIEKFGDDYKLVFCP-TVCNFCKVICGDVGIFFQ  188

Query  54   SGHRLLDV  31
             G R L +
Sbjct  189  DGKRRLAL  196



>emb|CBJ94877.1| kunitz trypsin inhibitor [Populus balsamifera]
Length=143

 Score = 89.7 bits (221),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 55/138 (40%), Positives = 77/138 (56%), Gaps = 6/138 (4%)
 Frame = -1

Query  405  CPKSVVQVGPNVV-GNTVTFSPVNPKD-VVRNGTDLNVQFSGSNAGCPESTVWQITHDPE  232
            CP  V+Q   + + G  VTFSP + +D V+R  TDLN++FS   A C  S+VW+I     
Sbjct  6    CPDDVIQYSLDQLQGLPVTFSPASSEDDVIRVSTDLNIKFSIKKA-CDHSSVWKI-QKSS  63

Query  231  DTDTTHYVVSGGVKGNPSSSTTRNWFMIVKTK-NGYKFKFCPVSVCDCDPICQDIAISVE  55
            +++   +V +GG +GNP   T  NWF I K    GYK  FCP  +C C  +C+DI I  E
Sbjct  64   NSEVQWFVTTGGEEGNPGVHTLTNWFKIEKAGILGYKLVFCPEDICHCGVLCRDIGIYFE  123

Query  54   SGH-RLLDVDVSLPPLEV  4
            +   R+L +   L P  V
Sbjct  124  NNRGRILSLSDKLSPFVV  141



>ref|XP_004137534.1| PREDICTED: miraculin-like [Cucumis sativus]
 ref|XP_004165460.1| PREDICTED: miraculin-like [Cucumis sativus]
 gb|KGN64217.1| Tumor-related protein [Cucumis sativus]
Length=206

 Score = 91.3 bits (225),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 60/129 (47%), Positives = 75/129 (58%), Gaps = 8/129 (6%)
 Frame = -1

Query  405  CPKSVVQVGPNVV-GNTVTFSPVNPKD-VVRNGTDLNVQFSGSNAGCPESTVWQITHDPE  232
            CP +VVQ    V+ G   TF PVNPK  VVR  TDLNVQF  S   C  STVW++  D  
Sbjct  70   CPLNVVQEQLEVMNGFPTTFHPVNPKKGVVRVSTDLNVQFEASTI-CVTSTVWKL--DKF  126

Query  231  DTDTTHYVVS-GGVKGNPSSSTTRNWFMIVKTKNGYKFKFCPVSVCD-CDPICQDIAISV  58
            D  T  ++V+ GG +GNP   T  NWF I K    YK  FCP +VC+ C  +C+DI I  
Sbjct  127  DESTGQWLVTIGGSRGNPGVETVDNWFKIEKHGKDYKLVFCP-TVCNFCKVMCRDIGIFF  185

Query  57   ESGHRLLDV  31
            ++G R L +
Sbjct  186  KNGERALAL  194



>ref|XP_008238584.1| PREDICTED: miraculin-like [Prunus mume]
Length=208

 Score = 91.3 bits (225),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 58/128 (45%), Positives = 75/128 (59%), Gaps = 6/128 (5%)
 Frame = -1

Query  405  CPKSVVQVGPNVV-GNTVTFSPVN-PKDVVRNGTDLNVQFSGSNAGCPESTVWQITHDPE  232
            CP  VVQ    V  G ++ FSPVN  K VV   TDLN++FS +   C +STVW++    E
Sbjct  72   CPLDVVQEQNEVSNGLSLKFSPVNVTKGVVLVSTDLNIKFSATTI-CVQSTVWKLGKFDE  130

Query  231  DTDTTHYVVSGGVKGNPSSSTTRNWFMIVKTKNGYKFKFCPVSVCD-CDPICQDIAISVE  55
             T    +V SGGV+GNP   TT NWF I K  + YK  FCP +VC+ C  IC+D+ I  +
Sbjct  131  QTGQ-WFVTSGGVEGNPGRQTTSNWFKIEKFGDDYKLVFCP-TVCNFCKVICRDVGIFFQ  188

Query  54   SGHRLLDV  31
             G R L +
Sbjct  189  DGKRRLAL  196



>ref|XP_009608866.1| PREDICTED: miraculin-like [Nicotiana tomentosiformis]
Length=209

 Score = 90.9 bits (224),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 53/128 (41%), Positives = 76/128 (59%), Gaps = 6/128 (5%)
 Frame = -1

Query  405  CPKSVVQVGPNVV-GNTVTFSPVNPKD-VVRNGTDLNVQFSGSNAGCPESTVWQITHDPE  232
            CP+ ++Q   +V  G  V F+PV+PK  V+R  +DLNV+F      C   T+W++  D +
Sbjct  72   CPRDIIQESLDVQQGLPVVFTPVDPKKGVIRLSSDLNVRFFTPTI-CARETIWKV-GDFD  129

Query  231  DTDTTHYVVSGGVKGNPSSSTTRNWFMIVKTKNGYKFKFCPVSVCD-CDPICQDIAISVE  55
            +    ++VV+GGV+GNP   T  NWF I K    YKF FCP SVC  C  IC+D+ I  +
Sbjct  130  EKLKQYFVVTGGVEGNPGPQTVSNWFKIEKLGTDYKFVFCP-SVCSFCKVICKDVGIFTK  188

Query  54   SGHRLLDV  31
            +G R L +
Sbjct  189  NGVRFLAL  196



>dbj|BAA82842.1| miraculin homologue [Taraxacum officinale]
Length=136

 Score = 89.4 bits (220),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 56/125 (45%), Positives = 74/125 (59%), Gaps = 10/125 (8%)
 Frame = -1

Query  405  CPKSVVQVGPNVV-GNTVTFSPVNPKD-VVRNGTDLNVQFSGSNAGCPESTVWQITHDPE  232
            CP  VVQ    +  G  +TF+PV+PK  V+R  TDLN+ FS S+  C +S VW I    E
Sbjct  18   CPLDVVQANQELDNGLPLTFTPVDPKKGVIRESTDLNIIFSASSI-CIQSNVWMI----E  72

Query  231  DTDTTHYVVSGGVKGNPSSSTTRNWFMIVKTKNGYKFKFCPVSVCD-CDPICQDIAISV-  58
            + D +  V + GV+GNP   T  NWF I K  + YK  FCP +VCD C P+C DI + + 
Sbjct  73   EYDGSLIVSAHGVQGNPGQETLSNWFKIEKFDDDYKIVFCP-AVCDVCRPLCGDIGVEID  131

Query  57   ESGHR  43
            E+G R
Sbjct  132  ENGRR  136



>gb|ACS92500.1| Kunitz-type protease inhibitor KPI-D9 [Populus trichocarpa x 
Populus nigra]
Length=211

 Score = 90.9 bits (224),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 53/137 (39%), Positives = 77/137 (56%), Gaps = 5/137 (4%)
 Frame = -1

Query  405  CPKSVVQVGPNVV-GNTVTFSPVNPKD-VVRNGTDLNVQFSGSNAGCPESTVWQITHDPE  232
            CP  V++   + + G  VTFSP + +D V+R  TDLN++FS   A C  S+VW+I     
Sbjct  65   CPDDVIKYSSDRLQGLPVTFSPASSEDDVIRVSTDLNIKFSIKKA-CDHSSVWKI-QKSS  122

Query  231  DTDTTHYVVSGGVKGNPSSSTTRNWFMIVKTKNGYKFKFCPVSVCDCDPICQDIAISVE-  55
            +++   +V +GG +GNP   T  NWF I K   GYK   CP  +C C  +C+DI I  E 
Sbjct  123  NSEVQWFVTTGGEEGNPGIDTLTNWFKIEKAGIGYKLVSCPEDICHCGVLCRDIGIYREN  182

Query  54   SGHRLLDVDVSLPPLEV  4
            +G ++L +   L P  V
Sbjct  183  NGRKILSLSDQLSPFLV  199



>ref|XP_010537532.1| PREDICTED: miraculin [Tarenaya hassleriana]
Length=202

 Score = 90.9 bits (224),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 58/132 (44%), Positives = 77/132 (58%), Gaps = 6/132 (5%)
 Frame = -1

Query  405  CPKSVVQVGPNVV-GNTVTFSPVNPKDVVRNGTDLNVQFSGSNAGCPESTVWQITHDPED  229
            CP SVVQ    V  G  +TFSP +   +V   TD NV+FS +   C +STVW++    ++
Sbjct  67   CPMSVVQDKFEVSPGFPLTFSPSDKSRIVGISTDQNVKFSAATI-CVQSTVWKL-ESFDE  124

Query  228  TDTTHYVVSGGVKGNPSSSTTRNWFMIVKTKNGYKFKFCPVSVCD-CDPICQDIAISVES  52
            T    +V +GGV+GNP   T  NWF I K  N YK  FCP +VC+ C  IC+DI + V+ 
Sbjct  125  TTKQWFVTTGGVEGNPGRETISNWFKIEKLGNDYKLVFCP-TVCNFCKVICRDIGVFVQD  183

Query  51   GHRLLDV-DVSL  19
            G R L + DV L
Sbjct  184  GKRRLALSDVPL  195



>ref|XP_006495064.1| PREDICTED: miraculin-like [Citrus sinensis]
Length=206

 Score = 90.9 bits (224),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 58/129 (45%), Positives = 77/129 (60%), Gaps = 8/129 (6%)
 Frame = -1

Query  405  CPKSVVQVGPNVV-GNTVTFSPVNPKD-VVRNGTDLNVQFSGSNAGCPESTVWQITHDPE  232
            CP  VVQ   +   G  VTFSPVNPK  VVR  TDLN++F  + + C +STVW++  D  
Sbjct  70   CPVDVVQEQHSFKNGFPVTFSPVNPKKGVVRESTDLNIKFDAATS-CAQSTVWKL--DNF  126

Query  231  DTDTTHYVVS-GGVKGNPSSSTTRNWFMIVKTKNGYKFKFCPVSVCD-CDPICQDIAISV  58
            D     ++V+ GGV+GNP   T RNWF I K    YK  +CP SVC+ C  +C+D+ I +
Sbjct  127  DAAFGQWLVTTGGVEGNPGPRTMRNWFKIEKFFGDYKLVYCP-SVCNFCRGLCRDVGIFI  185

Query  57   ESGHRLLDV  31
              G R L +
Sbjct  186  NGGVRRLAL  194



>gb|AEK26926.1| Kunitz-type trypsin inhibitor B1 [Populus nigra]
Length=212

 Score = 90.5 bits (223),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 55/138 (40%), Positives = 77/138 (56%), Gaps = 6/138 (4%)
 Frame = -1

Query  405  CPKSVVQVGPNVV-GNTVTFSPVNPKD-VVRNGTDLNVQFSGSNAGCPESTVWQITHDPE  232
            CP  V+Q   + + G  VTFSP + +D V+R  TDLN++FS   A C  S+VW+I     
Sbjct  65   CPDDVIQYSLDQLQGLPVTFSPASSEDDVIRVSTDLNIKFSIKKA-CDHSSVWKI-QKSS  122

Query  231  DTDTTHYVVSGGVKGNPSSSTTRNWFMIVKTK-NGYKFKFCPVSVCDCDPICQDIAISVE  55
            +++   +V +GG +GNP   T  NWF I K    GYK  FCP  +C C  +C+DI I  E
Sbjct  123  NSEVQWFVTTGGEEGNPGVHTLTNWFKIEKAGILGYKLVFCPEDICHCGVLCRDIGIYFE  182

Query  54   SGH-RLLDVDVSLPPLEV  4
            +   R+L +   L P  V
Sbjct  183  NNRGRILSLSDKLSPFVV  200



>ref|XP_011072079.1| PREDICTED: miraculin [Sesamum indicum]
Length=206

 Score = 90.5 bits (223),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 55/133 (41%), Positives = 73/133 (55%), Gaps = 6/133 (5%)
 Frame = -1

Query  405  CPKSVVQVGPNVV-GNTVTFSPVNPKD-VVRNGTDLNVQFSGSNAGCPESTVWQITHDPE  232
            CP  VVQ    V  G  +TF PVNPK  VVR  TD N++FSG+   C +STVW++  D  
Sbjct  69   CPLDVVQEQLEVRNGLPLTFRPVNPKKGVVRVSTDQNIKFSGATI-CVQSTVWKL--DNY  125

Query  231  DTDT-THYVVSGGVKGNPSSSTTRNWFMIVKTKNGYKFKFCPVSVCDCDPICQDIAISVE  55
            D  T  +++ +GGV+G P   T  NWF I    + YK  FCP     C  IC+D+ I ++
Sbjct  126  DASTGKYFITTGGVEGKPGRETISNWFKIETYGDDYKLVFCPTVCNYCKVICKDVGIFMQ  185

Query  54   SGHRLLDVDVSLP  16
             G R L +    P
Sbjct  186  DGKRRLALTEDAP  198



>ref|XP_006441432.1| hypothetical protein CICLE_v10022276mg [Citrus clementina]
 gb|ESR54672.1| hypothetical protein CICLE_v10022276mg [Citrus clementina]
Length=206

 Score = 90.5 bits (223),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 57/129 (44%), Positives = 77/129 (60%), Gaps = 8/129 (6%)
 Frame = -1

Query  405  CPKSVVQVGPNVV-GNTVTFSPVNPKD-VVRNGTDLNVQFSGSNAGCPESTVWQITHDPE  232
            CP  VVQ   +   G  VTFSPVNPK  VVR  TD+N++F  + + C +STVW++  D  
Sbjct  70   CPVDVVQEQHSFRNGLPVTFSPVNPKKGVVRESTDINIKFDAATS-CAQSTVWKL--DNF  126

Query  231  DTDTTHYVVS-GGVKGNPSSSTTRNWFMIVKTKNGYKFKFCPVSVCD-CDPICQDIAISV  58
            D     ++V+ GGV+GNP   T RNWF I K    YK  +CP SVC+ C  +C+D+ I +
Sbjct  127  DAAIGQWLVTTGGVEGNPGPRTMRNWFKIEKFFGDYKLVYCP-SVCNFCRGLCRDVGIFI  185

Query  57   ESGHRLLDV  31
              G R L +
Sbjct  186  NGGVRRLAL  194



>gb|ADK62529.1| miraculin-like protein [Nicotiana benthamiana]
Length=205

 Score = 90.1 bits (222),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 45/113 (40%), Positives = 69/113 (61%), Gaps = 3/113 (3%)
 Frame = -1

Query  366  GNTVTFSPVNPKD-VVRNGTDLNVQFSGSNAGCPESTVWQITHDPEDTDTTHYVVSGGVK  190
            G  +TF+PVNPK  V+R  TDLN++FS ++  C ++T+W++  D ++T   +++  GG +
Sbjct  83   GFPLTFTPVNPKKGVIRESTDLNIKFSAASI-CVQTTLWKL-DDFDETTGKYFITIGGNE  140

Query  189  GNPSSSTTRNWFMIVKTKNGYKFKFCPVSVCDCDPICQDIAISVESGHRLLDV  31
            GNP   T  NWF I K +  YK  +CP     C  IC+DI I ++ G R L +
Sbjct  141  GNPGRETISNWFKIEKFERDYKLVYCPTVCNFCKVICKDIGIFIQDGTRRLAL  193



>gb|AFL91230.1| Kunitz-like protease inhibitor, partial [Helianthus annuus]
Length=159

 Score = 89.4 bits (220),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 55/129 (43%), Positives = 74/129 (57%), Gaps = 10/129 (8%)
 Frame = -1

Query  405  CPKSVVQVGPNVV-GNTVTFSPVNPKD-VVRNGTDLNVQFSGSNAGCPESTVWQITHDPE  232
            CP  VVQ G  +  G  +TF+PV+PK  V+R  TDLN+ FS S+  C +S VW +    E
Sbjct  25   CPLDVVQEGFELDDGLPLTFTPVDPKKGVIRESTDLNIIFSASSI-CIQSNVWML----E  79

Query  231  DTDTTHYVVSGGVKGNPSSSTTRNWFMIVKTKNGYKFKFCPVSVCD-CDPICQDIA-ISV  58
            + +    +   G  GNP   T  NWF I K +NGYK  +CP +VCD C P+C DI  +  
Sbjct  80   EYEGQRIISGRGTAGNPGGETISNWFKIEKYENGYKLVYCP-TVCDLCRPVCGDIGVVFA  138

Query  57   ESGHRLLDV  31
            E+G R L +
Sbjct  139  ENGSRRLAI  147



>ref|XP_006441436.1| hypothetical protein CICLE_v10023581mg [Citrus clementina]
 gb|ESR54676.1| hypothetical protein CICLE_v10023581mg [Citrus clementina]
Length=187

 Score = 89.7 bits (221),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 57/129 (44%), Positives = 77/129 (60%), Gaps = 8/129 (6%)
 Frame = -1

Query  405  CPKSVVQVGPNVV-GNTVTFSPVNPKD-VVRNGTDLNVQFSGSNAGCPESTVWQITHDPE  232
            CP  VVQ   +   G  VTFSPVNPK  VVR  TDLN++F  + + C +STVW++  D  
Sbjct  51   CPLDVVQEQHSFKNGLPVTFSPVNPKKGVVRESTDLNIKFDAATS-CAQSTVWKL--DNF  107

Query  231  DTDTTHYVVS-GGVKGNPSSSTTRNWFMIVKTKNGYKFKFCPVSVCD-CDPICQDIAISV  58
            D     ++++ GGV+GNP   T RNWF I K    YK  +CP SVC+ C  +C+D+ I +
Sbjct  108  DAVLGQWLLTTGGVEGNPGPRTMRNWFKIEKFFGDYKLVYCP-SVCNFCRGLCRDVGIFI  166

Query  57   ESGHRLLDV  31
              G R L +
Sbjct  167  NGGVRRLAL  175



>dbj|BAA05474.1| tumor-related protein [Nicotiana glauca x Nicotiana langsdorffii]
Length=125

 Score = 88.2 bits (217),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 44/111 (40%), Positives = 68/111 (61%), Gaps = 3/111 (3%)
 Frame = -1

Query  366  GNTVTFSPVNPKD-VVRNGTDLNVQFSGSNAGCPESTVWQITHDPEDTDTTHYVVSGGVK  190
            G  +TF+PVNPK  V+R  TDLN++FS ++  C ++T+W++  D ++T   +++  GG +
Sbjct  3    GLPLTFTPVNPKKGVIRESTDLNIKFSAASI-CVQTTLWKL-DDFDETTGKYFITIGGNE  60

Query  189  GNPSSSTTRNWFMIVKTKNGYKFKFCPVSVCDCDPICQDIAISVESGHRLL  37
            GNP   T  NWF I K +  YK  +CP     C  IC+D+ I ++ G R L
Sbjct  61   GNPGRETISNWFKIEKFERDYKLVYCPTVCNFCKVICKDVGIFIQDGIRRL  111



>gb|AAQ84217.1| Kunitz trypsin inhibitor 4 [Populus trichocarpa x Populus deltoides]
 gb|ACS92488.1| Kunitz-type protease inhibitor KPI-D10.2 [Populus trichocarpa 
x Populus deltoides]
Length=212

 Score = 90.1 bits (222),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 55/138 (40%), Positives = 77/138 (56%), Gaps = 6/138 (4%)
 Frame = -1

Query  405  CPKSVVQVGPNVV-GNTVTFSPVNPKD-VVRNGTDLNVQFSGSNAGCPESTVWQITHDPE  232
            CP  V+Q   +++ G  VTFSP +  D V+R  TDLN++FS   A C  S+VW+I     
Sbjct  65   CPDDVIQYSSDLLQGLPVTFSPASSDDDVIRVSTDLNIKFSIKKA-CDHSSVWKI-QKSS  122

Query  231  DTDTTHYVVSGGVKGNPSSSTTRNWFMIVKTK-NGYKFKFCPVSVCDCDPICQDIAISVE  55
            +++   +V +GG +GNP   T  NWF I K    GYK   CP  +C C  +C+DI I  E
Sbjct  123  NSEVQWFVTTGGEEGNPGIDTLTNWFKIEKAGILGYKLVSCPEGICHCGVLCRDIGIYRE  182

Query  54   S-GHRLLDVDVSLPPLEV  4
            + G R+L +   L P  V
Sbjct  183  NDGRRILSLSDKLSPFLV  200



>gb|AFL91229.1| Kunitz-like protease inhibitor, partial [Helianthus annuus]
Length=164

 Score = 89.4 bits (220),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 55/129 (43%), Positives = 74/129 (57%), Gaps = 10/129 (8%)
 Frame = -1

Query  405  CPKSVVQVGPNVV-GNTVTFSPVNPKD-VVRNGTDLNVQFSGSNAGCPESTVWQITHDPE  232
            CP  VVQ G  +  G  +TF+PV+PK  V+R  TDLN+ FS S+  C +S VW +    E
Sbjct  30   CPLDVVQEGFELDDGLPLTFTPVDPKKGVIRESTDLNIIFSASSI-CIQSNVWML----E  84

Query  231  DTDTTHYVVSGGVKGNPSSSTTRNWFMIVKTKNGYKFKFCPVSVCD-CDPICQDIA-ISV  58
            + +    +   G  GNP   T  NWF I K +NGYK  +CP +VCD C P+C DI  +  
Sbjct  85   EYEGQRIISGRGTAGNPGGETISNWFKIEKYENGYKLVYCP-TVCDLCRPVCGDIGVVFA  143

Query  57   ESGHRLLDV  31
            E+G R L +
Sbjct  144  ENGSRRLAI  152



>gb|AFL91228.1| Kunitz-like protease inhibitor, partial [Helianthus annuus]
Length=175

 Score = 89.4 bits (220),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 55/129 (43%), Positives = 74/129 (57%), Gaps = 10/129 (8%)
 Frame = -1

Query  405  CPKSVVQVGPNVV-GNTVTFSPVNPKD-VVRNGTDLNVQFSGSNAGCPESTVWQITHDPE  232
            CP  VVQ G  +  G  +TF+PV+PK  V+R  TDLN+ FS S+  C +S VW +    E
Sbjct  41   CPLDVVQEGFELDDGLPLTFTPVDPKKGVIRESTDLNIIFSASSI-CIQSNVWML----E  95

Query  231  DTDTTHYVVSGGVKGNPSSSTTRNWFMIVKTKNGYKFKFCPVSVCD-CDPICQDIA-ISV  58
            + +    +   G  GNP   T  NWF I K +NGYK  +CP +VCD C P+C DI  +  
Sbjct  96   EYEGQRIISGRGTAGNPGGETISNWFKIEKYENGYKLVYCP-TVCDLCRPVCGDIGVVFA  154

Query  57   ESGHRLLDV  31
            E+G R L +
Sbjct  155  ENGSRXLXI  163



>gb|ABK96521.1| unknown [Populus trichocarpa x Populus deltoides]
 gb|ACS92517.1| Kunitz-type protease inhibitor KPI-D11 [Populus trichocarpa x 
Populus deltoides]
Length=212

 Score = 90.1 bits (222),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 54/138 (39%), Positives = 77/138 (56%), Gaps = 6/138 (4%)
 Frame = -1

Query  405  CPKSVVQVGPNVV-GNTVTFSPVNPKD-VVRNGTDLNVQFSGSNAGCPESTVWQITHDPE  232
            CP  V+Q   +++ G  VTFSP + +D V+R  TDLN++FS     C  S+VW+I     
Sbjct  65   CPDDVIQYSLDLLQGLPVTFSPASSEDDVIRVSTDLNIKFS-IKKDCDHSSVWKI-QKSS  122

Query  231  DTDTTHYVVSGGVKGNPSSSTTRNWFMIVKTK-NGYKFKFCPVSVCDCDPICQDIAISVE  55
            +++   +V +GG +GNP   T  NWF I K    GYK  FCP  +C C  +C+DI I  E
Sbjct  123  NSEVQWFVTTGGEEGNPGVHTITNWFKIEKAGILGYKLVFCPEDICHCGVLCRDIGIYFE  182

Query  54   SGH-RLLDVDVSLPPLEV  4
            +   R+L +   L P  V
Sbjct  183  NNRGRILSLSDKLSPFLV  200



>gb|AFL91232.1| Kunitz-like protease inhibitor, partial [Helianthus annuus]
Length=172

 Score = 89.4 bits (220),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 55/129 (43%), Positives = 74/129 (57%), Gaps = 10/129 (8%)
 Frame = -1

Query  405  CPKSVVQVGPNVV-GNTVTFSPVNPKD-VVRNGTDLNVQFSGSNAGCPESTVWQITHDPE  232
            CP  VVQ G  +  G  +TF+PV+PK  V+R  TDLN+ FS S+  C +S VW +    E
Sbjct  38   CPLDVVQEGFELDDGLPLTFTPVDPKKGVIRESTDLNIIFSASSI-CIQSNVWML----E  92

Query  231  DTDTTHYVVSGGVKGNPSSSTTRNWFMIVKTKNGYKFKFCPVSVCD-CDPICQDIA-ISV  58
            + +    +   G  GNP   T  NWF I K +NGYK  +CP +VCD C P+C DI  +  
Sbjct  93   EYEGQRIISGRGTAGNPGGETISNWFKIEKYENGYKLVYCP-TVCDLCRPVCGDIGVVFA  151

Query  57   ESGHRLLDV  31
            E+G R L +
Sbjct  152  ENGSRRLAI  160



>gb|AFL91227.1| Kunitz-like protease inhibitor, partial [Helianthus annuus]
Length=175

 Score = 89.4 bits (220),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 55/129 (43%), Positives = 74/129 (57%), Gaps = 10/129 (8%)
 Frame = -1

Query  405  CPKSVVQVGPNVV-GNTVTFSPVNPKD-VVRNGTDLNVQFSGSNAGCPESTVWQITHDPE  232
            CP  VVQ G  +  G  +TF+PV+PK  V+R  TDLN+ FS S+  C +S VW +    E
Sbjct  41   CPLDVVQEGFELDDGLPLTFTPVDPKKGVIRESTDLNIIFSASSI-CIQSNVWML----E  95

Query  231  DTDTTHYVVSGGVKGNPSSSTTRNWFMIVKTKNGYKFKFCPVSVCD-CDPICQDIA-ISV  58
            + +    +   G  GNP   T  NWF I K +NGYK  +CP +VCD C P+C DI  +  
Sbjct  96   EYEGQRIISGRGTAGNPGGETISNWFKIEKYENGYKLVYCP-TVCDLCRPVCGDIGVVFA  154

Query  57   ESGHRLLDV  31
            E+G R L +
Sbjct  155  ENGSRRLAI  163



>ref|XP_003548289.1| PREDICTED: miraculin-like [Glycine max]
Length=201

 Score = 89.7 bits (221),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 48/124 (39%), Positives = 74/124 (60%), Gaps = 4/124 (3%)
 Frame = -1

Query  405  CPKSVVQVGPNVVGNTVTFSPVN-PKDVVRNGTDLNVQFSGSNAGCPESTVWQITHDPED  229
            CP  VV V  ++ G  ++F+PVN  K ++R  +DLN+ F+     CP++TVW++ +  +D
Sbjct  62   CPLDVVAVDGDL-GLPLSFTPVNDKKGIIRVSSDLNIYFTSYTIFCPQTTVWKLKY-YDD  119

Query  228  TDTTHYVVSGGVKGNPSSSTTRNWFMIVKTKNGYKFKFCPVSVCDCDPICQDIAISVES-  52
            + +  +V +GG  G+PSS T  NWF I K ++ YK  +CP    DC+  C DI I  +  
Sbjct  120  STSQWFVTTGGELGHPSSQTVANWFKIEKYEDAYKLVYCPSVCSDCNHQCSDIGIYQDQY  179

Query  51   GHRL  40
            G RL
Sbjct  180  GKRL  183



>gb|AFL91226.1| Kunitz-like protease inhibitor, partial [Helianthus annuus]
Length=175

 Score = 89.4 bits (220),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 55/129 (43%), Positives = 74/129 (57%), Gaps = 10/129 (8%)
 Frame = -1

Query  405  CPKSVVQVGPNV-VGNTVTFSPVNPKD-VVRNGTDLNVQFSGSNAGCPESTVWQITHDPE  232
            CP  VVQ G  +  G  +TF+PV+PK  V+R  TDLN+ FS S+  C +S VW +    E
Sbjct  41   CPLDVVQEGFELDNGLPLTFTPVDPKKGVIRESTDLNIIFSASSI-CIQSNVWML----E  95

Query  231  DTDTTHYVVSGGVKGNPSSSTTRNWFMIVKTKNGYKFKFCPVSVCD-CDPICQDIA-ISV  58
            + +    +   G  GNP   T  NWF I K +NGYK  +CP +VCD C P+C DI  +  
Sbjct  96   EYEGQRIISGRGTSGNPGGETISNWFKIEKYENGYKLVYCP-TVCDLCRPVCGDIGVVFA  154

Query  57   ESGHRLLDV  31
            E+G R L +
Sbjct  155  ENGSRRLAI  163



>gb|AFL91233.1| Kunitz-like protease inhibitor, partial [Helianthus annuus]
Length=175

 Score = 89.4 bits (220),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 55/129 (43%), Positives = 74/129 (57%), Gaps = 10/129 (8%)
 Frame = -1

Query  405  CPKSVVQVGPNVV-GNTVTFSPVNPKD-VVRNGTDLNVQFSGSNAGCPESTVWQITHDPE  232
            CP  VVQ G  +  G  +TF+PV+PK  V+R  TDLN+ FS S+  C +S VW +    E
Sbjct  41   CPLDVVQEGFELDDGLPLTFTPVDPKKGVIRESTDLNIIFSASSI-CIQSNVWML----E  95

Query  231  DTDTTHYVVSGGVKGNPSSSTTRNWFMIVKTKNGYKFKFCPVSVCD-CDPICQDIA-ISV  58
            + +    +   G  GNP   T  NWF I K +NGYK  +CP +VCD C P+C DI  +  
Sbjct  96   EYEGQRIISGRGTAGNPGGETISNWFKIEKYENGYKLVYCP-TVCDLCRPVCGDIGVVFA  154

Query  57   ESGHRLLDV  31
            E+G R L +
Sbjct  155  ENGSRRLAI  163



>gb|AFL91231.1| Kunitz-like protease inhibitor, partial [Helianthus annuus]
Length=175

 Score = 89.4 bits (220),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 55/129 (43%), Positives = 74/129 (57%), Gaps = 10/129 (8%)
 Frame = -1

Query  405  CPKSVVQVGPNVV-GNTVTFSPVNPKD-VVRNGTDLNVQFSGSNAGCPESTVWQITHDPE  232
            CP  VVQ G  +  G  +TF+PV+PK  V+R  TDLN+ FS S+  C +S VW +    E
Sbjct  41   CPLDVVQEGFELDDGLPLTFTPVDPKKGVIRESTDLNIIFSASSI-CIQSNVWML----E  95

Query  231  DTDTTHYVVSGGVKGNPSSSTTRNWFMIVKTKNGYKFKFCPVSVCD-CDPICQDIA-ISV  58
            + +    +   G  GNP   T  NWF I K +NGYK  +CP +VCD C P+C DI  +  
Sbjct  96   EYEGQRIISGRGTAGNPGGETISNWFKIEKYENGYKLVYCP-TVCDLCRPVCGDIGVVFA  154

Query  57   ESGHRLLDV  31
            E+G R L +
Sbjct  155  ENGSRRLAI  163



>gb|ACO40154.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
Length=181

 Score = 89.4 bits (220),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 54/133 (41%), Positives = 75/133 (56%), Gaps = 6/133 (5%)
 Frame = -1

Query  405  CPKSVVQVGPNVV-GNTVTFSPVNPKD-VVRNGTDLNVQFSGSNAGCPESTVWQITHDPE  232
            CP  V+Q   + + G TVTFSP +  D V+R  TDLN++FS   A C  S+VW+I     
Sbjct  50   CPDDVIQYSLDQLQGLTVTFSPASSDDDVIRVSTDLNIKFSIKKA-CDHSSVWKI-QKSS  107

Query  231  DTDTTHYVVSGGVKGNPSSSTTRNWFMIVKTK-NGYKFKFCPVSVCDCDPICQDIAISVE  55
            +++   +V +GG +GNP   T  NWF I K    GYK  FCP  +C C  +C+DI I  E
Sbjct  108  NSEVQWFVTTGGEEGNPGVHTLTNWFKIEKAGILGYKLVFCPEDICHCGVLCRDIGIYFE  167

Query  54   SGH-RLLDVDVSL  19
            +   R+L +   L
Sbjct  168  NNRGRILSLSDKL  180



>ref|XP_006441447.1| hypothetical protein CICLE_v10021858mg [Citrus clementina]
 gb|ESR54687.1| hypothetical protein CICLE_v10021858mg [Citrus clementina]
Length=249

 Score = 90.1 bits (222),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 57/129 (44%), Positives = 77/129 (60%), Gaps = 8/129 (6%)
 Frame = -1

Query  405  CPKSVVQVGPNVV-GNTVTFSPVNPKD-VVRNGTDLNVQFSGSNAGCPESTVWQITHDPE  232
            CP  VVQ   +   G  VTFSPVNPK  VVR  TDLN++F  + + C +STVW++  D  
Sbjct  113  CPLDVVQEQHSFKNGLPVTFSPVNPKKGVVRESTDLNIKFDAATS-CAQSTVWKL--DNF  169

Query  231  DTDTTHYVVS-GGVKGNPSSSTTRNWFMIVKTKNGYKFKFCPVSVCD-CDPICQDIAISV  58
            D     ++++ GGV+GNP   T RNWF I K    YK  +CP SVC+ C  +C+D+ I +
Sbjct  170  DAVLGQWLLTTGGVEGNPGPRTMRNWFKIEKFFGDYKLVYCP-SVCNFCRGLCRDVGIFI  228

Query  57   ESGHRLLDV  31
              G R L +
Sbjct  229  NGGVRRLAL  237



>ref|XP_004235409.1| PREDICTED: miraculin-like [Solanum lycopersicum]
Length=201

 Score = 89.4 bits (220),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 55/125 (44%), Positives = 73/125 (58%), Gaps = 5/125 (4%)
 Frame = -1

Query  375  NVVGNTVTFSPVNPKD-VVRNGTDLNVQFSGSNAGCPESTVWQITHDPEDTDTTHYVVSG  199
            +V+G  V FSPV+PK+  +R  TD+NV+F+ S      STVW+I  + E     + V  G
Sbjct  76   SVIGVNVQFSPVDPKENTIRLSTDMNVKFT-SMEISDSSTVWRI--NTELIPQRYLVTIG  132

Query  198  GVKGNPSSSTTRNWFMIVKTKNGYKFKFCPVSVCDCDPICQDIAISVESGHRLLDVDVSL  19
            GV+GNP   T  NWF I K ++ YK  +CPV    C P C +I I  ESG R+L V    
Sbjct  133  GVEGNPGRETLGNWFNIDKYEDAYKLVYCPVVCETCRPFCGEIGILEESGKRVLFVGRD-  191

Query  18   PPLEV  4
            PPL+V
Sbjct  192  PPLKV  196



>ref|XP_006441438.1| hypothetical protein CICLE_v10023465mg [Citrus clementina]
 gb|ESR54678.1| hypothetical protein CICLE_v10023465mg [Citrus clementina]
Length=206

 Score = 89.4 bits (220),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 57/129 (44%), Positives = 76/129 (59%), Gaps = 8/129 (6%)
 Frame = -1

Query  405  CPKSVVQVGPNVV-GNTVTFSPVNPKD-VVRNGTDLNVQFSGSNAGCPESTVWQITHDPE  232
            CP  VVQ   +   G  VTFSPVNPK  VVR  TD+N++F  + + C +STVW++  D  
Sbjct  70   CPLDVVQEQHSFRNGLPVTFSPVNPKKGVVRESTDINIKFDAATS-CAQSTVWKL--DNF  126

Query  231  DTDTTHYVVS-GGVKGNPSSSTTRNWFMIVKTKNGYKFKFCPVSVCDC-DPICQDIAISV  58
            D     ++V+ GGV+GNP   T RNWF I K    YK  FCP SVC+    +C+D+ I +
Sbjct  127  DAALGQWLVTTGGVEGNPGPRTMRNWFKIEKFYGDYKLVFCP-SVCNIFRGLCRDVGIFI  185

Query  57   ESGHRLLDV  31
              G R L +
Sbjct  186  NGGVRRLAL  194



>gb|KCW48670.1| hypothetical protein EUGRSUZ_K02326 [Eucalyptus grandis]
Length=203

 Score = 89.4 bits (220),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 53/125 (42%), Positives = 69/125 (55%), Gaps = 5/125 (4%)
 Frame = -1

Query  405  CPKSVVQVGPNVV-GNTVTFSPVNPKDVVRNGTDLNVQFSGSNAGCPESTVWQITHDPED  229
            CP +VVQ    +  G    FSPV+    +R  TDLNV F  +   C +STVW++    E+
Sbjct  68   CPLAVVQEQQELSDGLPAKFSPVDGNSTIRLSTDLNVWFDAATI-CVQSTVWRLAAFDEE  126

Query  228  TDTTHYVVSGGVKGNPSSSTTRNWFMIVKTKNGYKFKFCPVSVCD-CDPICQDIAISVES  52
                ++V SGGV GNP   T  NWF I K    Y F+FCP +VCD C  IC+D+ I V+ 
Sbjct  127  V-KQYFVESGGVLGNPGRETVSNWFKIEKVDEDYNFRFCP-TVCDTCRVICRDVGIYVDG  184

Query  51   GHRLL  37
              R L
Sbjct  185  STRRL  189



>ref|XP_009792285.1| PREDICTED: miraculin [Nicotiana sylvestris]
Length=210

 Score = 89.4 bits (220),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 46/112 (41%), Positives = 72/112 (64%), Gaps = 5/112 (4%)
 Frame = -1

Query  366  GNTVTFSPVNPKD-VVRNGTDLNVQFSGSNAGCPESTVWQITHDPEDTDTTHYVVSGGVK  190
            G  +TF+PVNPK  V+R  TDLN++FS ++  C ++T+W++  D ++T   +++  GG +
Sbjct  83   GLPLTFTPVNPKKGVIRESTDLNIKFSAASI-CVQTTLWKL-DDFDETTGKYFITIGGNE  140

Query  189  GNPSSSTTRNWFMIVKTKNGYKFKFCPVSVCD-CDPICQDIAISVESGHRLL  37
            GNP   T  NWF I K +  YK  +CP +VC+ C  IC+D+ I ++ G R L
Sbjct  141  GNPGRETISNWFKIEKFERDYKLVYCP-TVCNFCKVICKDVGIFIQDGIRRL  191



>emb|CDP20822.1| unnamed protein product [Coffea canephora]
Length=204

 Score = 89.0 bits (219),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 56/127 (44%), Positives = 75/127 (59%), Gaps = 9/127 (7%)
 Frame = -1

Query  405  CPKSVVQVGPNV-VGNTVTFSPVNP-KDVVRNGTDLNVQFSGSNAGCPESTVWQITHDPE  232
            CP  V+Q    V  G  +TF+PVN  K VV   TDLN++F  +   C +STVW++  D  
Sbjct  67   CPLDVIQEQFEVKRGLPLTFTPVNTTKGVVPVSTDLNIKFFAATI-CVQSTVWKLEFD--  123

Query  231  DTDTTHYV-VSGGVKGNPSSSTTRNWFMIVKTKNGYKFKFCPVSVCD-CDPICQDIAISV  58
              D + YV VSGG++GNP   T  NWF I K    YK  +CP +VC+ C  IC+D+ I V
Sbjct  124  -ADISQYVIVSGGIEGNPGRETISNWFKIEKYDQDYKLVYCP-TVCNFCKVICRDVGIFV  181

Query  57   ESGHRLL  37
            ++G R L
Sbjct  182  QNGRRRL  188



>gb|AAC49969.1| tumor-related protein [Nicotiana tabacum]
Length=210

 Score = 89.0 bits (219),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 46/112 (41%), Positives = 72/112 (64%), Gaps = 5/112 (4%)
 Frame = -1

Query  366  GNTVTFSPVNPKD-VVRNGTDLNVQFSGSNAGCPESTVWQITHDPEDTDTTHYVVSGGVK  190
            G  +TF+PVNPK  V+R  TDLN++FS ++  C ++T+W++  D ++T   +++  GG +
Sbjct  83   GLPLTFTPVNPKKGVIRESTDLNIKFSAASI-CVQTTLWKL-DDFDETTGKYFITIGGNE  140

Query  189  GNPSSSTTRNWFMIVKTKNGYKFKFCPVSVCD-CDPICQDIAISVESGHRLL  37
            GNP   T  NWF I K +  YK  +CP +VC+ C  IC+D+ I ++ G R L
Sbjct  141  GNPGRETISNWFKIEKFERDYKLVYCP-TVCNFCKVICKDVGIFIQDGIRRL  191



>ref|XP_003620169.1| Kunitz-type trypsin inhibitor alpha chain [Medicago truncatula]
 gb|AES76387.1| Kunitz type trypsin inhibitor / miraculin [Medicago truncatula]
 gb|AFK40758.1| unknown [Medicago truncatula]
 gb|AFK41434.1| unknown [Medicago truncatula]
Length=203

 Score = 89.0 bits (219),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 47/137 (34%), Positives = 73/137 (53%), Gaps = 6/137 (4%)
 Frame = -1

Query  405  CPKSVVQVGPNVV-GNTVTFSPVNPKD-VVRNGTDLNVQFSGSNAGCPESTVWQITHDPE  232
            CP  VVQ    V  G  VTF+P N K  V+   TDLN++   +   CP++ VW++    +
Sbjct  65   CPLYVVQEKLEVKNGEAVTFTPYNAKQGVILTSTDLNIKSFVTKTKCPQTQVWKLL---K  121

Query  231  DTDTTHYVVSGGVKGNPSSSTTRNWFMIVKTKNGYKFKFCPVSVCDCDPICQDIAISV-E  55
            +     ++ +GGV+GNPS +T  NWF I K    Y   FCP   C C  +C+++ + V +
Sbjct  122  ELTGVWFLATGGVEGNPSMATVGNWFKIEKADKDYVLSFCPAEACKCQTLCRELGLFVDD  181

Query  54   SGHRLLDVDVSLPPLEV  4
             G++ L +   +P   V
Sbjct  182  KGNKHLALSDQIPSFRV  198



>ref|XP_006441446.1| hypothetical protein CICLE_v10023371mg [Citrus clementina]
 gb|ESR54686.1| hypothetical protein CICLE_v10023371mg [Citrus clementina]
Length=206

 Score = 89.0 bits (219),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 52/115 (45%), Positives = 71/115 (62%), Gaps = 7/115 (6%)
 Frame = -1

Query  366  GNTVTFSPVNPKD-VVRNGTDLNVQFSGSNAGCPESTVWQITHDPEDTDTTHYVVS-GGV  193
            G  VTFSPVNPK  VVR  TDLN++F  + + C +STVW++  D  D     ++++ GGV
Sbjct  84   GLPVTFSPVNPKKGVVRESTDLNIKFDAATS-CAQSTVWKL--DNFDAVLGQWLLTTGGV  140

Query  192  KGNPSSSTTRNWFMIVKTKNGYKFKFCPVSVCD-CDPICQDIAISVESGHRLLDV  31
            +GNP   T RNWF I K    YK  +CP SVC+ C  +C+D+ I +  G R L +
Sbjct  141  EGNPGPRTMRNWFKIEKFFGDYKLVYCP-SVCNFCRGLCRDVGIFINGGVRRLAL  194



>gb|ACO40104.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40105.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40106.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40110.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40139.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40140.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40159.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40161.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40163.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
Length=181

 Score = 88.6 bits (218),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 54/133 (41%), Positives = 74/133 (56%), Gaps = 6/133 (5%)
 Frame = -1

Query  405  CPKSVVQVGPNVV-GNTVTFSPVNPKD-VVRNGTDLNVQFSGSNAGCPESTVWQITHDPE  232
            CP  V+Q   + + G TVTFSP +  D V+R  TDLN++FS   A C  S+VW+I     
Sbjct  50   CPDDVIQYSLDQLQGLTVTFSPASSDDDVIRVSTDLNIKFSIKKA-CDHSSVWKI-QKSS  107

Query  231  DTDTTHYVVSGGVKGNPSSSTTRNWFMIVKTK-NGYKFKFCPVSVCDCDPICQDIAISVE  55
            ++    +V +GG +GNP   T  NWF I K    GYK  FCP  +C C  +C+DI I  E
Sbjct  108  NSKVQWFVTTGGEEGNPGVHTLTNWFKIEKAGILGYKLVFCPEDICHCGVLCRDIGIYFE  167

Query  54   SGH-RLLDVDVSL  19
            +   R+L +   L
Sbjct  168  NNRGRILSLSDKL  180



>gb|ACO40082.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40094.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40118.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40124.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40128.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40146.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
Length=181

 Score = 88.2 bits (217),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 53/133 (40%), Positives = 75/133 (56%), Gaps = 6/133 (5%)
 Frame = -1

Query  405  CPKSVVQVGPNVV-GNTVTFSPVNPKD-VVRNGTDLNVQFSGSNAGCPESTVWQITHDPE  232
            CP  V+Q   + + G  VTFSP + +D V+R  TDLN++FS   A C  S+VW+I     
Sbjct  50   CPDDVIQYSLDQLQGLPVTFSPASSEDDVIRVSTDLNIKFSIKKA-CDHSSVWKI-QKSS  107

Query  231  DTDTTHYVVSGGVKGNPSSSTTRNWFMIVKTKN-GYKFKFCPVSVCDCDPICQDIAISVE  55
            +++   +V +GG +GNP   T  NWF I K    GYK  FCP  +C C  +C+DI I  E
Sbjct  108  NSEVQWFVTTGGEEGNPGVHTLTNWFKIEKAGTLGYKLVFCPEDICHCGVLCRDIGIYFE  167

Query  54   SGH-RLLDVDVSL  19
            +   R+L +   L
Sbjct  168  NNRGRILSLSDKL  180



>ref|XP_009401850.1| PREDICTED: miraculin-like [Musa acuminata subsp. malaccensis]
Length=203

 Score = 88.6 bits (218),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 58/129 (45%), Positives = 76/129 (59%), Gaps = 8/129 (6%)
 Frame = -1

Query  405  CPKSVVQVGPNVV-GNTVTFSPVNPKD-VVRNGTDLNVQFSGSNAGCPESTVWQITHDPE  232
            CP +V Q    V  G  +TFSPVNPKD  V+  TDLNV F+     C +STVW++  D E
Sbjct  61   CPLAVAQESSEVSDGLPLTFSPVNPKDKYVKMSTDLNVWFAAETI-CVQSTVWRLG-DAE  118

Query  231  DTDTTHYVVSGGVKGNPSSSTTRNWFMIVKT-KNGYKFKFCPVSVCD-CDPICQDIAISV  58
             T    YVV+GG+KG+P  +T  NWF I +  ++ YK   CP SVC  C  +C D+ + V
Sbjct  119  ATGR-RYVVTGGLKGDPGLATVSNWFKIERYGESDYKLVHCP-SVCRFCKVVCGDVGVFV  176

Query  57   ESGHRLLDV  31
            E G R L +
Sbjct  177  EGGKRWLGL  185



>gb|EYU22302.1| hypothetical protein MIMGU_mgv1a013790mg [Erythranthe guttata]
Length=210

 Score = 88.6 bits (218),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 54/131 (41%), Positives = 77/131 (59%), Gaps = 6/131 (5%)
 Frame = -1

Query  405  CPKSVVQVGPNVV-GNTVTFSPVNPKD-VVRNGTDLNVQFSGSNAGCPESTVWQITHDPE  232
            CP SVVQ    +  G  +TF PV+PK  VVR  TD N++FS S   C +STVW++  D +
Sbjct  70   CPLSVVQEQSELKKGLPLTFHPVDPKKGVVRLSTDHNIKFSASTI-CVQSTVWRL--DND  126

Query  231  DTDTTHYVVSGGVKGNPSSSTTRNWFMI-VKTKNGYKFKFCPVSVCDCDPICQDIAISVE  55
            ++   ++V +GGV+GNP S +  NWF I     + YK  FCP     C  IC+D+ I V+
Sbjct  127  ESTGKYFVNTGGVEGNPGSGSISNWFKIEAYGSSDYKLLFCPTVCNFCKVICRDVGIVVQ  186

Query  54   SGHRLLDVDVS  22
             G R L + ++
Sbjct  187  DGKRRLGLTLT  197



>ref|XP_008437058.1| PREDICTED: miraculin-like [Cucumis melo]
Length=205

 Score = 88.6 bits (218),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 57/128 (45%), Positives = 70/128 (55%), Gaps = 6/128 (5%)
 Frame = -1

Query  405  CPKSVVQVGPNVV-GNTVTFSPVNPKD-VVRNGTDLNVQFSGSNAGCPESTVWQITHDPE  232
            CP +VVQ    ++ G   TF PVNPK  VVR  TDLNVQF  S   C  STVW++  D  
Sbjct  69   CPVNVVQEQFELMNGFPTTFHPVNPKKGVVRVSTDLNVQFDASTI-CVTSTVWKL--DKF  125

Query  231  DTDTTHYVVS-GGVKGNPSSSTTRNWFMIVKTKNGYKFKFCPVSVCDCDPICQDIAISVE  55
            D  T  + V+ GG +GNP   T  NWF I K    YK  FCP     C  +C+DI I  +
Sbjct  126  DESTGQWFVTIGGSRGNPGVETVDNWFKIEKHGKDYKLVFCPTVCNFCKVMCRDIGIFFK  185

Query  54   SGHRLLDV  31
            +G R L +
Sbjct  186  NGKRALAL  193



>ref|XP_007029360.1| Kunitz family trypsin and protease inhibitor protein [Theobroma 
cacao]
 gb|EOY09862.1| Kunitz family trypsin and protease inhibitor protein [Theobroma 
cacao]
Length=195

 Score = 88.2 bits (217),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 54/126 (43%), Positives = 75/126 (60%), Gaps = 6/126 (5%)
 Frame = -1

Query  405  CPKSVVQVGPNVV-GNTVTFSPVN-PKDVVRNGTDLNVQFSGSNAGCPESTVWQITHDPE  232
            CP  VVQ    V  G  VTFSPVN  K VVR  TD N++FS +   C + T+W++    +
Sbjct  59   CPLDVVQEQLEVSDGLPVTFSPVNIKKGVVRVSTDQNIKFSAATI-CVQPTLWKL-DSFD  116

Query  231  DTDTTHYVVSGGVKGNPSSSTTRNWFMIVKTKNGYKFKFCPVSVCD-CDPICQDIAISVE  55
            D+    +V +GGV+GNP   T  NWF I K ++ YK  FCP +VCD C  +C+D+ + ++
Sbjct  117  DSTRQWFVTTGGVEGNPGRETIDNWFKIEKYEDDYKLVFCP-TVCDFCKVMCRDVGVFID  175

Query  54   SGHRLL  37
             G R L
Sbjct  176  GGVRRL  181



>ref|XP_004137639.1| PREDICTED: miraculin-like [Cucumis sativus]
 gb|KGN64219.1| hypothetical protein Csa_1G043220 [Cucumis sativus]
Length=205

 Score = 88.2 bits (217),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 45/114 (39%), Positives = 65/114 (57%), Gaps = 3/114 (3%)
 Frame = -1

Query  366  GNTVTFSPVNPKD-VVRNGTDLNVQFSGSNAGCPESTVWQITHDPEDTDTTHYVVSGGVK  190
            G   TFSP+NPK  VVR  TDLN+QF  +N  C  STVW++    E     ++V  GG+K
Sbjct  83   GLPATFSPINPKKGVVRVSTDLNIQFE-ANTRCGISTVWKVGKFDEYLKQ-YFVTMGGMK  140

Query  189  GNPSSSTTRNWFMIVKTKNGYKFKFCPVSVCDCDPICQDIAISVESGHRLLDVD  28
            GNP   T  NWF + K    YK  +CP     C  +C+D+ +  ++G R++ ++
Sbjct  141  GNPGRETIENWFKVEKYGKNYKLVYCPTVCKYCKVVCKDVGLFYKNGRRVIALN  194



>gb|ACO40078.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
Length=180

 Score = 87.8 bits (216),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 51/132 (39%), Positives = 75/132 (57%), Gaps = 5/132 (4%)
 Frame = -1

Query  405  CPKSVVQVGPNVV-GNTVTFSPVNPKD-VVRNGTDLNVQFSGSNAGCPESTVWQITHDPE  232
            CP  V++   + + G  VTFSP + +D V+R  TDLN++FS   A C  S+VW+I     
Sbjct  50   CPDDVIKYSSDRLQGLPVTFSPASSEDDVIRVSTDLNIKFSIKKA-CDHSSVWKI-QKSS  107

Query  231  DTDTTHYVVSGGVKGNPSSSTTRNWFMIVKTKNGYKFKFCPVSVCDCDPICQDIAISVE-  55
            +++   +V +GG +GNP   T  NWF I K   GYK   CP  +C C  +C+DI I  E 
Sbjct  108  NSEVQWFVTTGGEEGNPGIDTLTNWFKIEKAGIGYKLVSCPEDICHCGVLCRDIGIYREN  167

Query  54   SGHRLLDVDVSL  19
            +G ++L +   L
Sbjct  168  NGRKILSLSDQL  179



>ref|XP_006351546.1| PREDICTED: miraculin-like [Solanum tuberosum]
Length=205

 Score = 87.8 bits (216),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 48/112 (43%), Positives = 69/112 (62%), Gaps = 5/112 (4%)
 Frame = -1

Query  366  GNTVTFSPVNPKD-VVRNGTDLNVQFSGSNAGCPESTVWQITHDPEDTDTTHYVVSGGVK  190
            G  +TF+PVNPK  V+R  TDLN+ FS +N+ C ++T W++  D ++T   +++  GG +
Sbjct  83   GLPLTFTPVNPKKGVIRESTDLNIIFS-ANSICVQTTQWKL-DDFDETTGQYFITLGGTQ  140

Query  189  GNPSSSTTRNWFMIVKTKNGYKFKFCPVSVCD-CDPICQDIAISVESGHRLL  37
            GNP   T  NW  I K    YK  +CP +VCD C  IC+DI I ++ G R L
Sbjct  141  GNPGRETVSNWIKIEKFDRDYKLLYCP-TVCDICKVICKDIGIFIQDGVRRL  191



>ref|XP_006441441.1| hypothetical protein CICLE_v10023320mg [Citrus clementina]
 gb|ESR54681.1| hypothetical protein CICLE_v10023320mg [Citrus clementina]
Length=206

 Score = 87.8 bits (216),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 56/129 (43%), Positives = 76/129 (59%), Gaps = 8/129 (6%)
 Frame = -1

Query  405  CPKSVVQVGPNVV-GNTVTFSPVNPKD-VVRNGTDLNVQFSGSNAGCPESTVWQITHDPE  232
            CP  VVQ   +   G  VTFSPVNPK  VVR  TD+N++   + + C +STVW++  D  
Sbjct  70   CPLDVVQEQHSFKNGLPVTFSPVNPKKGVVRESTDINIKLDAATS-CAQSTVWKL--DNF  126

Query  231  DTDTTHYVVS-GGVKGNPSSSTTRNWFMIVKTKNGYKFKFCPVSVCD-CDPICQDIAISV  58
            D     ++V+ GGV+GNP   T RNWF I K    YK  +CP SVC+ C  +C+D+ I +
Sbjct  127  DAAFGQWLVTTGGVEGNPGPRTMRNWFKIEKFFGDYKLVYCP-SVCNFCRGLCRDVGIFI  185

Query  57   ESGHRLLDV  31
              G R L +
Sbjct  186  NGGVRRLAL  194



>gb|AAQ96377.1| miraculin-like protein [Solanum palustre]
Length=209

 Score = 87.8 bits (216),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 48/112 (43%), Positives = 70/112 (63%), Gaps = 5/112 (4%)
 Frame = -1

Query  366  GNTVTFSPVNPKD-VVRNGTDLNVQFSGSNAGCPESTVWQITHDPEDTDTTHYVVSGGVK  190
            G  +TF+PVNPK  V+R  TDLN+ FS +N+ C ++T W++  D ++T   +++  GG +
Sbjct  87   GLPLTFTPVNPKKGVIRESTDLNIIFS-ANSICVQTTQWKL-DDFDETTGQYFITLGGNQ  144

Query  189  GNPSSSTTRNWFMIVKTKNGYKFKFCPVSVCD-CDPICQDIAISVESGHRLL  37
            GNP   T  NWF I K    YK  +CP +VCD C  IC++I I ++ G R L
Sbjct  145  GNPGRETISNWFKIEKFDRDYKLLYCP-TVCDFCKVICKEIGIFIQDGVRRL  195



>gb|ACO40073.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40075.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40076.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40079.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40085.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40087.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40088.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40089.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40092.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40095.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40096.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40097.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40098.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40099.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40102.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40103.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40107.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40109.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40111.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40112.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40113.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40114.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40121.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40122.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40125.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40126.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40129.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40131.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40134.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40135.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40136.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40137.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40147.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40152.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40160.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40162.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40164.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
Length=181

 Score = 87.4 bits (215),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 53/133 (40%), Positives = 75/133 (56%), Gaps = 6/133 (5%)
 Frame = -1

Query  405  CPKSVVQVGPNVV-GNTVTFSPVNPKD-VVRNGTDLNVQFSGSNAGCPESTVWQITHDPE  232
            CP  V+Q   + + G  VTFSP + +D V+R  TDLN++FS   A C  S+VW+I     
Sbjct  50   CPDDVIQYSLDQLQGLPVTFSPASSEDDVIRVSTDLNIKFSIKKA-CDHSSVWKI-QKSS  107

Query  231  DTDTTHYVVSGGVKGNPSSSTTRNWFMIVKTK-NGYKFKFCPVSVCDCDPICQDIAISVE  55
            +++   +V +GG +GNP   T  NWF I K    GYK  FCP  +C C  +C+DI I  E
Sbjct  108  NSEVQWFVTTGGEEGNPGVHTLTNWFKIEKAGILGYKLVFCPEDICHCGVLCRDIGIYFE  167

Query  54   SGH-RLLDVDVSL  19
            +   R+L +   L
Sbjct  168  NNRGRILSLSDKL  180



>ref|XP_009777240.1| PREDICTED: miraculin-like [Nicotiana sylvestris]
Length=209

 Score = 87.8 bits (216),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 51/128 (40%), Positives = 72/128 (56%), Gaps = 6/128 (5%)
 Frame = -1

Query  405  CPKSVVQVGPNVV-GNTVTFSPVNPKD-VVRNGTDLNVQFSGSNAGCPESTVWQI-THDP  235
            CP+ ++Q    V  G  V F+PV+PK  V+R  TDLNV+F      C   T+W++ T+D 
Sbjct  72   CPRDIIQNSNEVQEGLPVVFTPVDPKKGVIRLSTDLNVRFFTPTI-CARETIWKLGTYD-  129

Query  234  EDTDTTHYVVSGGVKGNPSSSTTRNWFMIVKTKNGYKFKFCPVSVCDCDPICQDIAISVE  55
             +    +++V+GGV+GNP   T  NWF I K    YKF FCP     C  IC+D+ I  +
Sbjct  130  -EKLKQYFIVTGGVEGNPGPLTVSNWFKIEKLGTDYKFVFCPSVCTFCKVICKDVGIYNK  188

Query  54   SGHRLLDV  31
             G R L +
Sbjct  189  DGVRFLAL  196



>ref|XP_010037029.1| PREDICTED: miraculin-like [Eucalyptus grandis]
Length=262

 Score = 88.6 bits (218),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 53/127 (42%), Positives = 70/127 (55%), Gaps = 5/127 (4%)
 Frame = -1

Query  405  CPKSVVQVGPNVV-GNTVTFSPVNPKDVVRNGTDLNVQFSGSNAGCPESTVWQITHDPED  229
            CP +VVQ    +  G    FSPV+    +R  TDLNV F  +   C +STVW++    E+
Sbjct  127  CPLAVVQEQQELSDGLPAKFSPVDGNSTIRLSTDLNVWFDAATI-CVQSTVWRLAAFDEE  185

Query  228  TDTTHYVVSGGVKGNPSSSTTRNWFMIVKTKNGYKFKFCPVSVCD-CDPICQDIAISVES  52
                ++V SGGV GNP   T  NWF I K    Y F+FCP +VCD C  IC+D+ I V+ 
Sbjct  186  VKQ-YFVESGGVLGNPGRETVSNWFKIEKVDEDYNFRFCP-TVCDTCRVICRDVGIYVDG  243

Query  51   GHRLLDV  31
              R L +
Sbjct  244  STRRLAL  250



>ref|XP_004234331.1| PREDICTED: miraculin [Solanum lycopersicum]
 gb|AAC63057.1| Lemir [Solanum lycopersicum]
Length=205

 Score = 87.4 bits (215),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 52/127 (41%), Positives = 75/127 (59%), Gaps = 7/127 (6%)
 Frame = -1

Query  405  CPKSVVQVGPNVV--GNTVTFSPVNPKD-VVRNGTDLNVQFSGSNAGCPESTVWQITHDP  235
            CP   V    N +  G  +TF+PV+PK  V+R  TDLN+ FS +N+ C ++T W++  D 
Sbjct  68   CPLDAVVQEHNEIDQGLPLTFTPVDPKKGVIRESTDLNIIFS-ANSICVQTTQWKL-DDF  125

Query  234  EDTDTTHYVVSGGVKGNPSSSTTRNWFMIVKTKNGYKFKFCPVSVCD-CDPICQDIAISV  58
            ++T   +++  GG +GNP   T  NWF I K    YK  +CP +VCD C  IC+DI I +
Sbjct  126  DETTGQYFITLGGDQGNPGVETISNWFKIEKYDRDYKLLYCP-TVCDFCKVICRDIGIFI  184

Query  57   ESGHRLL  37
            + G R L
Sbjct  185  QDGVRRL  191



>gb|ACO40086.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40141.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40149.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40150.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40151.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
Length=181

 Score = 87.0 bits (214),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 53/133 (40%), Positives = 75/133 (56%), Gaps = 6/133 (5%)
 Frame = -1

Query  405  CPKSVVQVGPNVV-GNTVTFSPVNPKD-VVRNGTDLNVQFSGSNAGCPESTVWQITHDPE  232
            CP  V+Q   + + G  VTFSP + +D V+R  TDLN++FS   A C  S+VW+I     
Sbjct  50   CPDDVIQYSLDQLQGLPVTFSPASSEDDVIRVSTDLNIKFSIKKA-CVHSSVWKI-QKSS  107

Query  231  DTDTTHYVVSGGVKGNPSSSTTRNWFMIVKTK-NGYKFKFCPVSVCDCDPICQDIAISVE  55
            +++   +V +GG +GNP   T  NWF I K    GYK  FCP  +C C  +C+DI I  E
Sbjct  108  NSEVQWFVTTGGEEGNPGVHTLTNWFKIEKAGILGYKLVFCPEDICHCGVLCRDIGIYFE  167

Query  54   SGH-RLLDVDVSL  19
            +   R+L +   L
Sbjct  168  NNRGRILSLSDKL  180



>gb|ACO40080.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
Length=180

 Score = 87.0 bits (214),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 51/132 (39%), Positives = 74/132 (56%), Gaps = 5/132 (4%)
 Frame = -1

Query  405  CPKSVVQVGPNVV-GNTVTFSPVNPKD-VVRNGTDLNVQFSGSNAGCPESTVWQITHDPE  232
            CP  V++   + + G  VTFSP + +D V+R  TDLN++FS   A C  S+VW+I     
Sbjct  50   CPDDVIKYSSDRLQGLPVTFSPASSEDDVIRVSTDLNIKFSIKKA-CDHSSVWKI-QKSS  107

Query  231  DTDTTHYVVSGGVKGNPSSSTTRNWFMIVKTKNGYKFKFCPVSVCDCDPICQDIAISVE-  55
            + +   +V +GG +GNP   T  NWF I K   GYK   CP  +C C  +C+DI I  E 
Sbjct  108  NLEVQWFVTTGGEEGNPGIDTLTNWFKIEKAGIGYKLVSCPEDICHCGVLCRDIGIYREN  167

Query  54   SGHRLLDVDVSL  19
            +G ++L +   L
Sbjct  168  NGRKILSLSDQL  179



>ref|XP_010042449.1| PREDICTED: miraculin-like [Eucalyptus grandis]
Length=262

 Score = 88.2 bits (217),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 52/127 (41%), Positives = 70/127 (55%), Gaps = 5/127 (4%)
 Frame = -1

Query  405  CPKSVVQVGPNVV-GNTVTFSPVNPKDVVRNGTDLNVQFSGSNAGCPESTVWQITHDPED  229
            CP +VVQ    +  G    FSPV+    +R  TDLNV F  +   C +STVW++    E+
Sbjct  127  CPLAVVQEQQELSDGLPAKFSPVDGNSTIRLSTDLNVWFDAATI-CVQSTVWRLAAFDEE  185

Query  228  TDTTHYVVSGGVKGNPSSSTTRNWFMIVKTKNGYKFKFCPVSVCD-CDPICQDIAISVES  52
                +++ SGGV GNP   T  NWF I K    Y F+FCP +VCD C  IC+D+ I V+ 
Sbjct  186  VKQ-YFIESGGVLGNPGRETVSNWFKIEKVDEDYNFRFCP-TVCDTCRVICRDVGIYVDG  243

Query  51   GHRLLDV  31
              R L +
Sbjct  244  STRRLAL  250



>gb|ACO40119.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40127.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40130.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40142.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40157.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
Length=181

 Score = 86.7 bits (213),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 52/133 (39%), Positives = 74/133 (56%), Gaps = 6/133 (5%)
 Frame = -1

Query  405  CPKSVVQVGPNVV-GNTVTFSPVNPKD-VVRNGTDLNVQFSGSNAGCPESTVWQITHDPE  232
            CP  V+Q   + + G  VTFSP + +D V+R   DLN++FS   A C  S+VW+I     
Sbjct  50   CPDDVIQYSLDQLQGLPVTFSPASSEDDVIRVSADLNIKFSIKKA-CDHSSVWKI-QKSS  107

Query  231  DTDTTHYVVSGGVKGNPSSSTTRNWFMIVKTKN-GYKFKFCPVSVCDCDPICQDIAISVE  55
            +++   +V +GG +GNP   T  NWF I K    GYK  FCP  +C C  +C+DI I  E
Sbjct  108  NSEVQWFVTTGGEEGNPGVHTLTNWFKIEKAGTLGYKLVFCPEDICHCGVLCRDIGIYFE  167

Query  54   SGH-RLLDVDVSL  19
            +   R+L +   L
Sbjct  168  NNRGRILSLSDKL  180



>dbj|BAA82843.1| miraculin homologue [Solanum melongena]
Length=160

 Score = 86.3 bits (212),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 54/127 (43%), Positives = 76/127 (60%), Gaps = 7/127 (6%)
 Frame = -1

Query  405  CP-KSVVQVGPNV-VGNTVTFSPVNPKD-VVRNGTDLNVQFSGSNAGCPESTVWQITHDP  235
            CP  +VVQ    V  G  +TF+P NPK  V+R  TDLN+ FS +N+ C ++T W++ +  
Sbjct  33   CPLDAVVQEQEEVKQGLPLTFTPFNPKKGVIRESTDLNIIFS-ANSICVQTTQWKLDNFD  91

Query  234  EDTDTTHYVVSGGVKGNPSSSTTRNWFMIVKTKNGYKFKFCPVSVCD-CDPICQDIAISV  58
            E T   +++  GG +GNP   T  NWF I K +  YK  +CP +VCD C  IC+DI I +
Sbjct  92   ETTGK-YFITLGGNQGNPGRETISNWFKIEKFERDYKLVYCP-TVCDFCKVICKDIGIFI  149

Query  57   ESGHRLL  37
            + G R L
Sbjct  150  QDGVRRL  156



>gb|AFL91234.1| Kunitz-like protease inhibitor, partial [Helianthus annuus]
Length=161

 Score = 86.3 bits (212),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 54/129 (42%), Positives = 73/129 (57%), Gaps = 10/129 (8%)
 Frame = -1

Query  405  CPKSVVQVGPNV-VGNTVTFSPVNPKD-VVRNGTDLNVQFSGSNAGCPESTVWQITHDPE  232
            CP  VVQ G  +  G  +TF+PV+PK  V+R  TDLN+ FS S+  C +S VW +    E
Sbjct  27   CPLDVVQEGFELDNGLPLTFTPVDPKKGVIRESTDLNIIFSASSI-CIQSNVWML----E  81

Query  231  DTDTTHYVVSGGVKGNPSSSTTRNWFMIVKTKNGYKFKFCPVSVCD-CDPICQDIA-ISV  58
            + +    +   G  GNP   T  NWF I K +N YK  +CP +VCD C P+C DI  +  
Sbjct  82   EYEGQRIISGRGTSGNPGGETISNWFKIEKYENDYKLVYCP-TVCDLCRPVCGDIGVVFA  140

Query  57   ESGHRLLDV  31
            E+G R L +
Sbjct  141  ENGSRRLAI  149



>ref|XP_004241480.1| PREDICTED: miraculin-like [Solanum lycopersicum]
Length=211

 Score = 87.0 bits (214),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 56/138 (41%), Positives = 80/138 (58%), Gaps = 8/138 (6%)
 Frame = -1

Query  405  CPKSVVQVGPNVV-GNTVTFSPVNPKD-VVRNGTDLNVQFSGSNAGCPESTVWQITHDPE  232
            CP+ ++Q   +V  G  V F+ ++ K  VVR  TD+NV+F      C   T+W++    +
Sbjct  74   CPRDIIQETDDVQEGLPVVFTRLDAKKGVVRVSTDVNVRFFTPTI-CARETIWKLGAY-D  131

Query  231  DTDTTHYVVSGGVKGNPSSSTTRNWFMIVKTKNGYKFKFCPVSVCD-CDPICQDIAISVE  55
            D    ++VV+GGV+GNP   T  NWF IVK  +GYKF FCP SVC  C  IC+D+ + ++
Sbjct  132  DKLKQYFVVTGGVEGNPGPKTVGNWFKIVKFGSGYKFVFCP-SVCKFCKVICKDVGVFMK  190

Query  54   SGHRLLDVDVSLPPLEVN  1
             G R L   +S  P EV 
Sbjct  191  DGVRFL--ALSDTPFEVK  206



>gb|ACO40144.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40158.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
Length=181

 Score = 86.7 bits (213),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 52/133 (39%), Positives = 74/133 (56%), Gaps = 6/133 (5%)
 Frame = -1

Query  405  CPKSVVQVGPNVV-GNTVTFSPVNPKD-VVRNGTDLNVQFSGSNAGCPESTVWQITHDPE  232
            CP  V+Q   + + G  VTFSP + +D V+R  TDLN++F    A C  S+VW+I     
Sbjct  50   CPDDVIQYSLDQLQGLPVTFSPASSEDDVIRVSTDLNIKFYIKKA-CDHSSVWKI-QKSS  107

Query  231  DTDTTHYVVSGGVKGNPSSSTTRNWFMIVKTKN-GYKFKFCPVSVCDCDPICQDIAISVE  55
            +++   +V +GG +GNP   T  NWF I K    GYK  FCP  +C C  +C+DI I  E
Sbjct  108  NSEVQWFVTTGGEEGNPGVHTLTNWFKIEKAGTLGYKLVFCPEDICHCGVLCRDIGIYFE  167

Query  54   SGH-RLLDVDVSL  19
            +   R+L +   L
Sbjct  168  NNRGRILSLSDKL  180



>gb|ACO40084.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
Length=181

 Score = 86.7 bits (213),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 53/133 (40%), Positives = 74/133 (56%), Gaps = 6/133 (5%)
 Frame = -1

Query  405  CPKSVVQVGPNVV-GNTVTFSPVNPKD-VVRNGTDLNVQFSGSNAGCPESTVWQITHDPE  232
            CP  V+Q   + + G  VTFSP +  D V+R  TDLN++FS   A C  S+VW+I     
Sbjct  50   CPDDVIQYSLDQLQGLPVTFSPASSDDDVIRVSTDLNIKFSIKKA-CDHSSVWKI-QKSS  107

Query  231  DTDTTHYVVSGGVKGNPSSSTTRNWFMIVKTK-NGYKFKFCPVSVCDCDPICQDIAISVE  55
            +++   +V +GG +GNP   T  NWF I K    GYK  FCP  +C C  +C+DI I  E
Sbjct  108  NSEVQWFVTTGGEEGNPGVHTLTNWFKIEKAGILGYKLVFCPEDICHCGVLCRDIGIYFE  167

Query  54   SGH-RLLDVDVSL  19
            +   R+L +   L
Sbjct  168  NNRGRILSLSDKL  180



>ref|XP_009627067.1| PREDICTED: miraculin [Nicotiana tomentosiformis]
Length=205

 Score = 87.0 bits (214),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 43/113 (38%), Positives = 68/113 (60%), Gaps = 3/113 (3%)
 Frame = -1

Query  366  GNTVTFSPVNPKD-VVRNGTDLNVQFSGSNAGCPESTVWQITHDPEDTDTTHYVVSGGVK  190
            G  +TF+PVNPK  V+R  TDLN++FS ++  C ++T+W++  D ++    +++  GG +
Sbjct  83   GLPLTFTPVNPKKGVIRESTDLNIKFSAASI-CVQTTLWKL-DDFDEATGKYFITIGGNE  140

Query  189  GNPSSSTTRNWFMIVKTKNGYKFKFCPVSVCDCDPICQDIAISVESGHRLLDV  31
            GNP   T  NWF I K +  YK  +CP     C  IC+D+ I ++ G R L +
Sbjct  141  GNPGRETISNWFKIDKFERDYKLVYCPTVCNFCKVICKDVGIFIQDGTRRLAL  193



>gb|ACO40077.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40090.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40115.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40116.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40120.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40132.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40156.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
Length=181

 Score = 86.3 bits (212),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 53/133 (40%), Positives = 74/133 (56%), Gaps = 6/133 (5%)
 Frame = -1

Query  405  CPKSVVQVGPNVV-GNTVTFSPVNPKD-VVRNGTDLNVQFSGSNAGCPESTVWQITHDPE  232
            CP  V+Q   + + G  VTFSP +  D V+R  TDLN++FS   A C  S+VW+I     
Sbjct  50   CPDDVIQYSLDQLQGLPVTFSPASSDDDVIRVSTDLNIKFSIKKA-CDHSSVWKI-QKSS  107

Query  231  DTDTTHYVVSGGVKGNPSSSTTRNWFMIVKTK-NGYKFKFCPVSVCDCDPICQDIAISVE  55
            +++   +V +GG +GNP   T  NWF I K    GYK  FCP  +C C  +C+DI I  E
Sbjct  108  NSEVQWFVTTGGEEGNPGVHTLTNWFKIEKAGILGYKLVFCPEDICHCGVLCRDIGIYFE  167

Query  54   SGH-RLLDVDVSL  19
            +   R+L +   L
Sbjct  168  NNRGRILSLSDKL  180



>ref|XP_009782173.1| PREDICTED: miraculin-like [Nicotiana sylvestris]
Length=252

 Score = 87.4 bits (215),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 58/135 (43%), Positives = 74/135 (55%), Gaps = 7/135 (5%)
 Frame = -1

Query  402  PKSVVQVGPNVVGNTVTFSPVNPKD-VVRNGTDLNVQFSGSNAGCPESTVWQITHDPEDT  226
            P  V Q   N  G  V F PVNPK+  +R  TDLN++++        STVW+I  + E  
Sbjct  75   PLVVSQNTQNSSGTDVQFIPVNPKENTIRISTDLNIKYTAMTIS-DSSTVWRI--NTELI  131

Query  225  DTTHYVVSGGVKGNPSSSTTRNWFMIVKTKNGYKFKFCPVSVCD-CDPICQDIAISVESG  49
               + V  GGV+GNP   T  NWF I K ++ YKF +CP  VC+ C P C DI I VE  
Sbjct  132  PQRYLVTVGGVEGNPGRETLSNWFKIDKYEDAYKFAYCP-GVCETCRPFCGDIGILVEGS  190

Query  48   HRLLDVDVSLPPLEV  4
             R+L V  S  PL+V
Sbjct  191  KRVLFVG-SNQPLKV  204



>gb|ACO40133.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
Length=181

 Score = 86.3 bits (212),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 53/133 (40%), Positives = 74/133 (56%), Gaps = 6/133 (5%)
 Frame = -1

Query  405  CPKSVVQVGPNVV-GNTVTFSPVNPKD-VVRNGTDLNVQFSGSNAGCPESTVWQITHDPE  232
            CP  V+Q   + + G  VTFSP +  D V+R  TDLN++FS   A C  S+VW+I     
Sbjct  50   CPDDVIQYSLDQLQGLPVTFSPASSDDDVIRVSTDLNIKFSIKKA-CVHSSVWKI-QKSS  107

Query  231  DTDTTHYVVSGGVKGNPSSSTTRNWFMIVKTK-NGYKFKFCPVSVCDCDPICQDIAISVE  55
            +++   +V +GG +GNP   T  NWF I K    GYK  FCP  +C C  +C+DI I  E
Sbjct  108  NSEVQWFVTTGGEEGNPGVHTLTNWFKIEKAGILGYKLVFCPEDICHCGVLCRDIGIYFE  167

Query  54   SGH-RLLDVDVSL  19
            +   R+L +   L
Sbjct  168  NNRGRILSLSDKL  180



>gb|KHM99732.1| Miraculin [Glycine soja]
Length=207

 Score = 86.7 bits (213),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 51/124 (41%), Positives = 67/124 (54%), Gaps = 4/124 (3%)
 Frame = -1

Query  405  CPKSVVQVGPNVVGNTVTFSPVNPKD-VVRNGTDLNVQFSGSNAGCPE-STVWQITHDPE  232
            CP  V+    N  G  + FSPVN K  V+R  TDLN+ FS S+  CP  STVW +     
Sbjct  70   CPLDVIIEKANE-GLPLRFSPVNTKKGVIRVSTDLNIFFSDSDERCPHHSTVWMLDQFDA  128

Query  231  DTDTTHYVVSGGVKGNPSSSTTRNWFMIVKTKNGYKFKFCPVSVCDCDPICQDIAISVES  52
                T YV +GGV GNP   T  NWF I K ++ YK  +CP     C  +C+DI + V++
Sbjct  129  SIGQT-YVTTGGVVGNPGEHTILNWFKIQKYEDAYKLVYCPRVCPSCHHLCKDIGMFVDA  187

Query  51   GHRL  40
              R+
Sbjct  188  NRRM  191



>gb|ACO40093.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40143.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
Length=181

 Score = 85.9 bits (211),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 52/133 (39%), Positives = 74/133 (56%), Gaps = 6/133 (5%)
 Frame = -1

Query  405  CPKSVVQVGPNVV-GNTVTFSPVNPKD-VVRNGTDLNVQFSGSNAGCPESTVWQITHDPE  232
            CP  V+Q   + + G  VTFSP + +D V+R   DLN++FS   A C  S+VW+I     
Sbjct  50   CPDDVIQYSLDQLQGLPVTFSPASSEDDVIRVSADLNIKFSIKKA-CDHSSVWKI-QKSS  107

Query  231  DTDTTHYVVSGGVKGNPSSSTTRNWFMIVKTK-NGYKFKFCPVSVCDCDPICQDIAISVE  55
            +++   +V +GG +GNP   T  NWF I K    GYK  FCP  +C C  +C+DI I  E
Sbjct  108  NSEVQWFVTTGGEEGNPGVHTLTNWFKIEKAGILGYKLVFCPEDICHCGVLCRDIGIYFE  167

Query  54   SGH-RLLDVDVSL  19
            +   R+L +   L
Sbjct  168  NNRGRILSLSDKL  180



>dbj|BAA82840.1| miraculin homologue [Youngia japonica]
Length=142

 Score = 84.7 bits (208),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 53/119 (45%), Positives = 69/119 (58%), Gaps = 9/119 (8%)
 Frame = -1

Query  405  CPKSVVQVGPNVV-GNTVTFSPVNPKD-VVRNGTDLNVQFSGSNAGCPESTVWQITHDPE  232
            CP  VVQ    V  G  +TF+PV+PK  V+R  TDLN+ FS S+  C +S VW +    E
Sbjct  30   CPLDVVQADLEVDNGLPLTFTPVDPKKGVIRESTDLNIIFSASSI-CIQSNVWNL----E  84

Query  231  DTDTTHYVVSGGVKGNPSSSTTRNWFMIVKTKNGYKFKFCPVSVCD-CDPICQDIAISV  58
            + D    V + GV GNP   T  NWF I K ++ YK  FCP +VCD C P+C DI + +
Sbjct  85   EYDGQLIVSAHGVAGNPGRETISNWFKIEKYEDDYKIVFCP-TVCDFCRPVCGDIGVLI  142



>ref|XP_006353931.1| PREDICTED: miraculin-like [Solanum tuberosum]
Length=208

 Score = 86.3 bits (212),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 54/125 (43%), Positives = 72/125 (58%), Gaps = 5/125 (4%)
 Frame = -1

Query  375  NVVGNTVTFSPVNPKD-VVRNGTDLNVQFSGSNAGCPESTVWQITHDPEDTDTTHYVVSG  199
            +V+G  V FSPV+PK+  VR   D+NV+F+ S      STVW+I  + E     + V  G
Sbjct  83   SVIGVNVQFSPVDPKENTVRLSIDMNVKFT-SMVISDSSTVWRI--NTELIPERYLVTIG  139

Query  198  GVKGNPSSSTTRNWFMIVKTKNGYKFKFCPVSVCDCDPICQDIAISVESGHRLLDVDVSL  19
            GV+GNP   T  NWF I K ++ YK  +CPV    C P C +I I  E+G R+L V    
Sbjct  140  GVEGNPGRETLGNWFNIDKYEDAYKLVYCPVVCEICRPFCGEIGILEENGKRVLFVGRD-  198

Query  18   PPLEV  4
            PPL+V
Sbjct  199  PPLKV  203



>gb|ACO40074.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40083.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40091.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40101.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40108.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40117.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40123.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40138.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40148.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40155.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
Length=181

 Score = 85.5 bits (210),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 52/133 (39%), Positives = 74/133 (56%), Gaps = 6/133 (5%)
 Frame = -1

Query  405  CPKSVVQVGPNVV-GNTVTFSPVNPKD-VVRNGTDLNVQFSGSNAGCPESTVWQITHDPE  232
            CP  V+Q   + + G  VTFSP + +D V+R  TDLN++F    A C  S+VW+I     
Sbjct  50   CPDDVIQYSLDQLQGLPVTFSPASSEDDVIRVSTDLNIKFYIKKA-CDHSSVWKI-QKSS  107

Query  231  DTDTTHYVVSGGVKGNPSSSTTRNWFMIVKTK-NGYKFKFCPVSVCDCDPICQDIAISVE  55
            +++   +V +GG +GNP   T  NWF I K    GYK  FCP  +C C  +C+DI I  E
Sbjct  108  NSEVQWFVTTGGEEGNPGVHTLTNWFKIEKAGILGYKLVFCPEDICHCGVLCRDIGIYFE  167

Query  54   SGH-RLLDVDVSL  19
            +   R+L +   L
Sbjct  168  NNRGRILSLSDKL  180



>emb|CAI77768.1| kunitz trypsin inhibitor [Populus tremula]
Length=213

 Score = 86.3 bits (212),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 53/139 (38%), Positives = 76/139 (55%), Gaps = 7/139 (5%)
 Frame = -1

Query  405  CPKSVVQVGPNVV-GNTVTFSPVNPKD-VVRNGTDLNVQFSGSNAGCPESTVWQITHDPE  232
            CP  V+Q   +++ G  VTFSP + +D V+R  TDLN++FS   A C  S+VW+I     
Sbjct  65   CPDDVIQYSLDLLQGLPVTFSPASSEDDVIRVSTDLNIKFSIKKA-CDHSSVWKI-QKSS  122

Query  231  DTDTTHYVVSGGVKGNPSSSTTRNWFMIVKTKN--GYKFKFCPVSVCDCDPICQDIAISV  58
            +++    V +GG +GNP   T  NWF I K     GYK  +CP  +C    +C+D+ I  
Sbjct  123  NSEVQRLVTTGGEEGNPGCDTFTNWFKIEKGAGILGYKLVYCPEDICPSVGLCRDVGIYF  182

Query  57   ESGH-RLLDVDVSLPPLEV  4
            ES   R+L +   L P  V
Sbjct  183  ESNRGRILSLSDKLSPFLV  201



>gb|ACO40100.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
Length=181

 Score = 85.5 bits (210),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 52/133 (39%), Positives = 74/133 (56%), Gaps = 6/133 (5%)
 Frame = -1

Query  405  CPKSVVQVGPNVV-GNTVTFSPVNPKD-VVRNGTDLNVQFSGSNAGCPESTVWQITHDPE  232
            CP  V+Q   + + G  VTFSP + +D V+R  TDLN++F    A C  S+VW+I     
Sbjct  50   CPDDVIQYSLDQLQGLPVTFSPASSEDDVIRVSTDLNIKFYIKKA-CDHSSVWKI-QKSS  107

Query  231  DTDTTHYVVSGGVKGNPSSSTTRNWFMIVKTK-NGYKFKFCPVSVCDCDPICQDIAISVE  55
            +++   +V +GG +GNP   T  NWF I K    GYK  FCP  +C C  +C+DI I  E
Sbjct  108  NSEVQWFVTTGGEEGNPGVHTLTNWFKIEKAGILGYKLVFCPEDICHCGVLCRDIGIYFE  167

Query  54   SGH-RLLDVDVSL  19
            +   R+L +   L
Sbjct  168  NNRGRILSLSDKL  180



>gb|ACO40153.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
Length=181

 Score = 85.5 bits (210),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 53/133 (40%), Positives = 73/133 (55%), Gaps = 6/133 (5%)
 Frame = -1

Query  405  CPKSVVQVGPNVV-GNTVTFSPVNPKD-VVRNGTDLNVQFSGSNAGCPESTVWQITHDPE  232
            CP  V+Q   + + G  VTFSP +  D V+R  TDLN++FS   A C  S+VW+I     
Sbjct  50   CPDDVIQYSLDQLQGLPVTFSPASSDDDVIRVSTDLNIKFSIKKA-CDHSSVWKI-QKSS  107

Query  231  DTDTTHYVVSGGVKGNPSSSTTRNWFMIVKTK-NGYKFKFCPVSVCDCDPICQDIAISVE  55
            ++    +V +GG +GNP   T  NWF I K    GYK  FCP  +C C  +C+DI I  E
Sbjct  108  NSKVQWFVTTGGEEGNPGVHTLTNWFKIEKAGILGYKLVFCPEDICHCGVLCRDIGIYFE  167

Query  54   SGH-RLLDVDVSL  19
            +   R+L +   L
Sbjct  168  NNRGRILSLSDKL  180



>ref|NP_001237333.1| uncharacterized protein LOC100500648 precursor [Glycine max]
 gb|ACU15788.1| unknown [Glycine max]
Length=213

 Score = 85.9 bits (211),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 51/124 (41%), Positives = 67/124 (54%), Gaps = 4/124 (3%)
 Frame = -1

Query  405  CPKSVVQVGPNVVGNTVTFSPVNPKD-VVRNGTDLNVQFSGSNAGCPE-STVWQITHDPE  232
            CP  V+    N  G  + FSPVN K  V+R  TDLN+ FS S+  CP  STVW +     
Sbjct  76   CPLDVIIEKANE-GLPLRFSPVNTKKGVIRVSTDLNIFFSDSDERCPHHSTVWMLDQFDA  134

Query  231  DTDTTHYVVSGGVKGNPSSSTTRNWFMIVKTKNGYKFKFCPVSVCDCDPICQDIAISVES  52
                T YV +GGV GNP   T  NWF I K ++ YK  +CP     C  +C+DI + V++
Sbjct  135  SIGQT-YVTTGGVVGNPGEHTILNWFKIQKYEDAYKLVYCPRVCPSCHHLCKDIGMFVDA  193

Query  51   GHRL  40
              R+
Sbjct  194  NRRM  197



>emb|CAI77785.1| kunitz trypsin inhibitor [Populus tremula]
Length=213

 Score = 85.9 bits (211),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 53/139 (38%), Positives = 76/139 (55%), Gaps = 7/139 (5%)
 Frame = -1

Query  405  CPKSVVQVGPNVV-GNTVTFSPVNPKD-VVRNGTDLNVQFSGSNAGCPESTVWQITHDPE  232
            CP  V+Q   +++ G  VTFSP + +D V+R  TDLN++FS   A C  S+VW+I     
Sbjct  65   CPDDVIQYSLDLLQGLPVTFSPASSEDDVIRVSTDLNIKFSIKKA-CDRSSVWKI-QKSS  122

Query  231  DTDTTHYVVSGGVKGNPSSSTTRNWFMIVKTKN--GYKFKFCPVSVCDCDPICQDIAISV  58
            +++    V +GG +GNP   T  NWF I K     GYK  +CP  +C    +C+D+ I  
Sbjct  123  NSEVQWLVTTGGEEGNPGCDTFTNWFKIEKGAGILGYKLVYCPEDICPSVGLCRDVGIYF  182

Query  57   ESGH-RLLDVDVSLPPLEV  4
            ES   R+L +   L P  V
Sbjct  183  ESNRGRILSLSDKLSPFLV  201



>gb|ACO40145.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
Length=181

 Score = 85.1 bits (209),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 52/133 (39%), Positives = 73/133 (55%), Gaps = 6/133 (5%)
 Frame = -1

Query  405  CPKSVVQVGPNVV-GNTVTFSPVNPKD-VVRNGTDLNVQFSGSNAGCPESTVWQITHDPE  232
            CP  V+Q   + + G  VTFSP +  D V+R   DLN++FS   A C  S+VW+I     
Sbjct  50   CPDDVIQYSLDQLQGLPVTFSPASSDDDVIRVSADLNIKFSIKKA-CDHSSVWKI-QKSS  107

Query  231  DTDTTHYVVSGGVKGNPSSSTTRNWFMIVKTK-NGYKFKFCPVSVCDCDPICQDIAISVE  55
            +++   +V +GG +GNP   T  NWF I K    GYK  FCP  +C C  +C+DI I  E
Sbjct  108  NSEVQWFVTTGGEEGNPGVHTLTNWFKIEKAGILGYKLVFCPEDICHCGVLCRDIGIYFE  167

Query  54   SGH-RLLDVDVSL  19
            +   R+L +   L
Sbjct  168  NNRGRILSLSDKL  180



>emb|CAI77765.1| kunitz trypsin inhibitor [Populus tremula]
 emb|CAI77792.1| kunitz trypsin inhibitor [Populus tremula]
 emb|CAI77796.1| kunitz trypsin inhibitor [Populus tremula]
 emb|CAI77797.1| kunitz trypsin inhibitor [Populus tremula]
 emb|CAI77801.1| kunitz trypsin inhibitor [Populus tremula]
Length=213

 Score = 85.5 bits (210),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 53/139 (38%), Positives = 76/139 (55%), Gaps = 7/139 (5%)
 Frame = -1

Query  405  CPKSVVQVGPNVV-GNTVTFSPVNPKD-VVRNGTDLNVQFSGSNAGCPESTVWQITHDPE  232
            CP  V+Q   +++ G  VTFSP + +D V+R  TDLN++FS   A C  S+VW+I     
Sbjct  65   CPDDVIQYSLDLLQGLPVTFSPASSEDDVIRVSTDLNIKFSIKKA-CDRSSVWKI-QKSS  122

Query  231  DTDTTHYVVSGGVKGNPSSSTTRNWFMIVKTKN--GYKFKFCPVSVCDCDPICQDIAISV  58
            +++    V +GG +GNP   T  NWF I K     GYK  +CP  +C    +C+D+ I  
Sbjct  123  NSEVQWLVTTGGEEGNPGCDTFTNWFKIEKGAGILGYKLVYCPEDICPSVGLCRDVGIYF  182

Query  57   ESGH-RLLDVDVSLPPLEV  4
            ES   R+L +   L P  V
Sbjct  183  ESNRGRILSLSDKLSPFLV  201



>emb|CAI77775.1| kunitz trypsin inhibitor [Populus tremula]
Length=213

 Score = 85.5 bits (210),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 53/139 (38%), Positives = 76/139 (55%), Gaps = 7/139 (5%)
 Frame = -1

Query  405  CPKSVVQVGPNVV-GNTVTFSPVNPKD-VVRNGTDLNVQFSGSNAGCPESTVWQITHDPE  232
            CP  V+Q   +++ G  VTFSP + +D V+R  TDLN++FS   A C  S+VW+I     
Sbjct  65   CPDDVIQYSLDLLQGLPVTFSPASSEDDVIRVSTDLNIKFSIKKA-CDRSSVWKI-QKSS  122

Query  231  DTDTTHYVVSGGVKGNPSSSTTRNWFMIVKTKN--GYKFKFCPVSVCDCDPICQDIAISV  58
            +++    V +GG +GNP   T  NWF I K     GYK  +CP  +C    +C+D+ I  
Sbjct  123  NSEVQWLVTTGGEEGNPGCDTFTNWFKIEKGAGILGYKLVYCPEDICPSVGLCRDVGIYF  182

Query  57   ESGH-RLLDVDVSLPPLEV  4
            ES   R+L +   L P  V
Sbjct  183  ESNRGRILSLSDKLSPFLV  201



>emb|CAI77783.1| kunitz trypsin inhibitor [Populus tremula]
 emb|CAI77784.1| kunitz trypsin inhibitor [Populus tremula]
 emb|CAI77788.1| kunitz trypsin inhibitor [Populus tremula]
 emb|CAI77789.1| kunitz trypsin inhibitor [Populus tremula]
 emb|CAI77804.1| kunitz trypsin inhibitor [Populus tremula]
 emb|CAI77805.1| kunitz trypsin inhibitor [Populus tremula]
Length=213

 Score = 85.5 bits (210),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 53/139 (38%), Positives = 76/139 (55%), Gaps = 7/139 (5%)
 Frame = -1

Query  405  CPKSVVQVGPNVV-GNTVTFSPVNPKD-VVRNGTDLNVQFSGSNAGCPESTVWQITHDPE  232
            CP  V+Q   +++ G  VTFSP + +D V+R  TDLN++FS   A C  S+VW+I     
Sbjct  65   CPDDVIQYSLDLLQGLPVTFSPASSEDDVIRVSTDLNIKFSIKKA-CDRSSVWKI-QKSS  122

Query  231  DTDTTHYVVSGGVKGNPSSSTTRNWFMIVKTKN--GYKFKFCPVSVCDCDPICQDIAISV  58
            +++    V +GG +GNP   T  NWF I K     GYK  +CP  +C    +C+D+ I  
Sbjct  123  NSEVQWLVTTGGEEGNPGCDTFTNWFKIEKGAGILGYKLVYCPEDICPSVGLCRDVGIYF  182

Query  57   ESGH-RLLDVDVSLPPLEV  4
            ES   R+L +   L P  V
Sbjct  183  ESNRGRILSLSDKLSPFLV  201



>ref|XP_009615974.1| PREDICTED: miraculin-like [Nicotiana tomentosiformis]
Length=209

 Score = 85.5 bits (210),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 53/129 (41%), Positives = 73/129 (57%), Gaps = 8/129 (6%)
 Frame = -1

Query  405  CPKSVVQVGPNVV-GNTVTFSPVNPKD-VVRNGTDLNVQFSGSNAGCPESTVWQI-THDP  235
            CP+ ++Q    V  G  V F+P + K  VVR  TDLNV+F      C   T+W++ T+D 
Sbjct  72   CPRDIIQNSDEVQQGLPVVFTPFDAKKGVVRLSTDLNVRFYTPTI-CARETIWKLGTYD-  129

Query  234  EDTDTTHYVVSGGVKGNPSSSTTRNWFMIVKTKNGYKFKFCPVSVCD-CDPICQDIAISV  58
             D    +++V+GGV+GNP   T  +WF I K    YKF FCP SVC  C  IC+D+ I  
Sbjct  130  -DKLKQYFIVTGGVEGNPGPQTVSSWFKIEKLGTDYKFLFCP-SVCKICKVICKDVGIYT  187

Query  57   ESGHRLLDV  31
            + G R L +
Sbjct  188  KDGVRFLAL  196



>emb|CAI77782.1| kunitz trypsin inhibitor [Populus tremula]
 emb|CAI77794.1| kunitz trypsin inhibitor [Populus tremula]
Length=213

 Score = 85.5 bits (210),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 53/139 (38%), Positives = 76/139 (55%), Gaps = 7/139 (5%)
 Frame = -1

Query  405  CPKSVVQVGPNVV-GNTVTFSPVNPKD-VVRNGTDLNVQFSGSNAGCPESTVWQITHDPE  232
            CP  V+Q   +++ G  VTFSP + +D V+R  TDLN++FS   A C  S+VW+I     
Sbjct  65   CPDDVIQYSLDLLQGLPVTFSPASSEDDVIRVSTDLNIKFSIKKA-CDRSSVWKI-QKSS  122

Query  231  DTDTTHYVVSGGVKGNPSSSTTRNWFMIVKTKN--GYKFKFCPVSVCDCDPICQDIAISV  58
            +++    V +GG +GNP   T  NWF I K     GYK  +CP  +C    +C+D+ I  
Sbjct  123  NSEVQWLVTTGGEEGNPGCDTFTNWFKIEKGAGILGYKLVYCPEDICPSVGLCRDVGIYF  182

Query  57   ESGH-RLLDVDVSLPPLEV  4
            ES   R+L +   L P  V
Sbjct  183  ESNRGRILSLSDKLSPFLV  201



>ref|XP_008437082.1| PREDICTED: miraculin [Cucumis melo]
Length=207

 Score = 85.5 bits (210),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 45/114 (39%), Positives = 63/114 (55%), Gaps = 3/114 (3%)
 Frame = -1

Query  366  GNTVTFSPVNPKD-VVRNGTDLNVQFSGSNAGCPESTVWQITHDPEDTDTTHYVVSGGVK  190
            G   TFSPVNPK  VVR  TDLN++F  S   C  STVW++    +     ++V  GG K
Sbjct  83   GLPATFSPVNPKKGVVRVSTDLNIEFEASTR-CGISTVWKVGKFDQYLKQ-YFVTMGGTK  140

Query  189  GNPSSSTTRNWFMIVKTKNGYKFKFCPVSVCDCDPICQDIAISVESGHRLLDVD  28
            GNP   T  NWF + K    YKF +CP     C  +C+D+ +  ++G R+  ++
Sbjct  141  GNPGRETIGNWFKVEKHGKNYKFVYCPTVCKYCKVMCKDVGLFYKNGRRIFALN  194



>ref|XP_004299457.1| PREDICTED: miraculin-like [Fragaria vesca subsp. vesca]
Length=218

 Score = 85.5 bits (210),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 63/140 (45%), Positives = 78/140 (56%), Gaps = 10/140 (7%)
 Frame = -1

Query  405  CPKSVVQVGPNVV-GNTVTFSPVNPK-DVVRNGTDLNVQFSGSNA---GCPESTVWQITH  241
            CP  VVQ    V  G  +TFSPVN K  VVR  TDLN++FS S A       S VW++ +
Sbjct  78   CPLDVVQEQQEVSNGLPLTFSPVNLKIGVVRLSTDLNIKFSTSAAVTICLNTSKVWKLDN  137

Query  240  DPEDTDTTHYVVSGGVKGNPSSSTTRNWFMIVKTKNGYKFKFCPVSVCD-CDPICQDIAI  64
              E T    +V +GGV+GNP   T  NWF I K    YK  FCP +VC+ C  IC D+ I
Sbjct  138  LDESTGQ-RFVTTGGVEGNPGPKTISNWFKIEKYDKDYKLVFCP-TVCNFCKVICGDVGI  195

Query  63   SVESGHRLLDVDVSLPPLEV  4
             +E G R L   +S  PL+V
Sbjct  196  YLEGGVRRL--VLSKVPLKV  213



>emb|CAI77777.1| kunitz trypsin inhibitor [Populus tremula]
Length=213

 Score = 85.5 bits (210),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 53/139 (38%), Positives = 76/139 (55%), Gaps = 7/139 (5%)
 Frame = -1

Query  405  CPKSVVQVGPNVV-GNTVTFSPVNPKD-VVRNGTDLNVQFSGSNAGCPESTVWQITHDPE  232
            CP  V+Q   +++ G  VTFSP + +D V+R  TDLN++FS   A C  S+VW+I     
Sbjct  65   CPDDVIQYSLDLLQGLPVTFSPASSEDDVIRVSTDLNIKFSIKKA-CDRSSVWKI-QKSS  122

Query  231  DTDTTHYVVSGGVKGNPSSSTTRNWFMIVKTKN--GYKFKFCPVSVCDCDPICQDIAISV  58
            +++    V +GG +GNP   T  NWF I K     GYK  +CP  +C    +C+D+ I  
Sbjct  123  NSEVQWLVTTGGEEGNPGCDTFTNWFKIEKGAGILGYKLVYCPEDICPSVGLCRDVGIYF  182

Query  57   ESGH-RLLDVDVSLPPLEV  4
            ES   R+L +   L P  V
Sbjct  183  ESNRGRILSLSDKLSPFLV  201



>emb|CAI77793.1| kunitz trypsin inhibitor [Populus tremula]
Length=213

 Score = 85.5 bits (210),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 53/139 (38%), Positives = 76/139 (55%), Gaps = 7/139 (5%)
 Frame = -1

Query  405  CPKSVVQVGPNVV-GNTVTFSPVNPKD-VVRNGTDLNVQFSGSNAGCPESTVWQITHDPE  232
            CP  V+Q   +++ G  VTFSP + +D V+R  TDLN++FS   A C  S+VW+I     
Sbjct  65   CPDDVIQYSLDLLQGLPVTFSPASSEDDVIRVSTDLNIKFSIKKA-CDRSSVWKI-QKSS  122

Query  231  DTDTTHYVVSGGVKGNPSSSTTRNWFMIVKTKN--GYKFKFCPVSVCDCDPICQDIAISV  58
            +++    V +GG +GNP   T  NWF I K     GYK  +CP  +C    +C+D+ I  
Sbjct  123  NSEVQWLVTTGGEEGNPGCDTFTNWFKIEKGAGILGYKLVYCPEDICPSVGLCRDVGIYF  182

Query  57   ESGH-RLLDVDVSLPPLEV  4
            ES   R+L +   L P  V
Sbjct  183  ESNRGRILSLSDKLSPFLV  201



>emb|CAI77798.1| kunitz trypsin inhibitor [Populus tremula]
 emb|CAI77799.1| kunitz trypsin inhibitor [Populus tremula]
 emb|CAI77806.1| kunitz trypsin inhibitor [Populus tremula]
 emb|CAI77807.1| kunitz trypsin inhibitor [Populus tremula]
Length=213

 Score = 85.5 bits (210),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 53/139 (38%), Positives = 76/139 (55%), Gaps = 7/139 (5%)
 Frame = -1

Query  405  CPKSVVQVGPNVV-GNTVTFSPVNPKD-VVRNGTDLNVQFSGSNAGCPESTVWQITHDPE  232
            CP  V+Q   +++ G  VTFSP + +D V+R  TDLN++FS   A C  S+VW+I     
Sbjct  65   CPDDVIQYSLDLLQGLPVTFSPASSEDDVIRVSTDLNIKFSIKKA-CDRSSVWKI-QKSS  122

Query  231  DTDTTHYVVSGGVKGNPSSSTTRNWFMIVKTKN--GYKFKFCPVSVCDCDPICQDIAISV  58
            +++    V +GG +GNP   T  NWF I K     GYK  +CP  +C    +C+D+ I  
Sbjct  123  NSEVQWLVTTGGEEGNPGCDTFTNWFKIEKGAGILGYKLVYCPEDICPSVGLCRDVGIYF  182

Query  57   ESGH-RLLDVDVSLPPLEV  4
            ES   R+L +   L P  V
Sbjct  183  ESNRGRILSLSDKLSPFLV  201



>emb|CAI77772.1| kunitz trypsin inhibitor [Populus tremula]
 emb|CAI77776.1| kunitz trypsin inhibitor [Populus tremula]
 emb|CAI77780.1| kunitz trypsin inhibitor [Populus tremula]
 emb|CAI77781.1| kunitz trypsin inhibitor [Populus tremula]
 emb|CAI77791.1| kunitz trypsin inhibitor [Populus tremula]
 emb|CAI77802.1| kunitz trypsin inhibitor [Populus tremula]
Length=213

 Score = 85.5 bits (210),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 53/139 (38%), Positives = 76/139 (55%), Gaps = 7/139 (5%)
 Frame = -1

Query  405  CPKSVVQVGPNVV-GNTVTFSPVNPKD-VVRNGTDLNVQFSGSNAGCPESTVWQITHDPE  232
            CP  V+Q   +++ G  VTFSP + +D V+R  TDLN++FS   A C  S+VW+I     
Sbjct  65   CPDDVIQYSLDLLQGLPVTFSPASSEDDVIRVSTDLNIKFSIKKA-CDRSSVWKI-QKSS  122

Query  231  DTDTTHYVVSGGVKGNPSSSTTRNWFMIVKTKN--GYKFKFCPVSVCDCDPICQDIAISV  58
            +++    V +GG +GNP   T  NWF I K     GYK  +CP  +C    +C+D+ I  
Sbjct  123  NSEVQWLVTTGGEEGNPGCDTFTNWFKIEKGAGILGYKLVYCPEDICPSVGLCRDVGIYF  182

Query  57   ESGH-RLLDVDVSLPPLEV  4
            ES   R+L +   L P  V
Sbjct  183  ESNRGRILSLSDKLSPFLV  201



>emb|CAI77803.1| kunitz trypsin inhibitor [Populus tremula]
Length=213

 Score = 85.5 bits (210),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 53/139 (38%), Positives = 76/139 (55%), Gaps = 7/139 (5%)
 Frame = -1

Query  405  CPKSVVQVGPNVV-GNTVTFSPVNPKD-VVRNGTDLNVQFSGSNAGCPESTVWQITHDPE  232
            CP  V+Q   +++ G  VTFSP + +D V+R  TDLN++FS   A C  S+VW+I     
Sbjct  65   CPDDVIQYSLDLLQGLPVTFSPASSEDDVIRVSTDLNIKFSIKKA-CDRSSVWKI-QKSS  122

Query  231  DTDTTHYVVSGGVKGNPSSSTTRNWFMIVKTKN--GYKFKFCPVSVCDCDPICQDIAISV  58
            +++    V +GG +GNP   T  NWF I K     GYK  +CP  +C    +C+D+ I  
Sbjct  123  NSEVQWLVTTGGEEGNPGCDTFTNWFKIEKGAGILGYKLVYCPEDICPSVGLCRDVGIYF  182

Query  57   ESGH-RLLDVDVSLPPLEV  4
            ES   R+L +   L P  V
Sbjct  183  ESNRGRILSLSDKLSPFLV  201



>emb|CAI77786.1| kunitz trypsin inhibitor [Populus tremula]
Length=212

 Score = 85.5 bits (210),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 53/138 (38%), Positives = 76/138 (55%), Gaps = 6/138 (4%)
 Frame = -1

Query  405  CPKSVVQVGPNVV-GNTVTFSPVNPKD-VVRNGTDLNVQFSGSNAGCPESTVWQITHDPE  232
            CP  V+Q   +++ G  VTFSP + +D V+R  TDLN++FS   A C  S+VW+I     
Sbjct  65   CPDDVIQYSLDLLQGLPVTFSPASSEDDVIRVSTDLNIKFSIKKA-CDRSSVWKI-QKSS  122

Query  231  DTDTTHYVVSGGVKGNPSSSTTRNWFMIVKTK-NGYKFKFCPVSVCDCDPICQDIAISVE  55
            +++    V +GG +GNP   T  NWF I K    GYK  +CP  +C    +C+D+ I  E
Sbjct  123  NSEVQWLVTTGGEEGNPGCDTFTNWFKIEKAGVLGYKLVYCPEDICPSVGLCRDVGIYFE  182

Query  54   SGH-RLLDVDVSLPPLEV  4
            S   R+L +   L P  V
Sbjct  183  SNRGRILSLSDKLSPFLV  200



>emb|CAI77773.1| kunitz trypsin inhibitor [Populus tremula]
Length=212

 Score = 85.5 bits (210),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 53/138 (38%), Positives = 76/138 (55%), Gaps = 6/138 (4%)
 Frame = -1

Query  405  CPKSVVQVGPNVV-GNTVTFSPVNPKD-VVRNGTDLNVQFSGSNAGCPESTVWQITHDPE  232
            CP  V+Q   +++ G  VTFSP + +D V+R  TDLN++FS   A C  S+VW+I     
Sbjct  65   CPDDVIQYSLDLLQGLPVTFSPASSEDDVIRVSTDLNIKFSIKKA-CDRSSVWKI-QKSS  122

Query  231  DTDTTHYVVSGGVKGNPSSSTTRNWFMIVKTK-NGYKFKFCPVSVCDCDPICQDIAISVE  55
            +++    V +GG +GNP   T  NWF I K    GYK  +CP  +C    +C+D+ I  E
Sbjct  123  NSEVQWLVTTGGEEGNPGCDTFTNWFKIEKAGVLGYKLVYCPEDICPSVGLCRDVGIYFE  182

Query  54   SGH-RLLDVDVSLPPLEV  4
            S   R+L +   L P  V
Sbjct  183  SNRGRILSLSDKLSPFLV  200



>emb|CAI77769.1| kunitz trypsin inhibitor [Populus tremula]
 emb|CAI77787.1| kunitz trypsin inhibitor [Populus tremula]
Length=212

 Score = 85.5 bits (210),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 53/138 (38%), Positives = 76/138 (55%), Gaps = 6/138 (4%)
 Frame = -1

Query  405  CPKSVVQVGPNVV-GNTVTFSPVNPKD-VVRNGTDLNVQFSGSNAGCPESTVWQITHDPE  232
            CP  V+Q   +++ G  VTFSP + +D V+R  TDLN++FS   A C  S+VW+I     
Sbjct  65   CPDDVIQYSLDLLQGLPVTFSPASSEDDVIRVSTDLNIKFSIKKA-CDRSSVWKI-QKSS  122

Query  231  DTDTTHYVVSGGVKGNPSSSTTRNWFMIVKTK-NGYKFKFCPVSVCDCDPICQDIAISVE  55
            +++    V +GG +GNP   T  NWF I K    GYK  +CP  +C    +C+D+ I  E
Sbjct  123  NSEVQWLVTTGGEEGNPGCDTFTNWFKIEKAGVLGYKLVYCPEDICPSVGLCRDVGIYFE  182

Query  54   SGH-RLLDVDVSLPPLEV  4
            S   R+L +   L P  V
Sbjct  183  SNRGRILSLSDKLSPFLV  200



>emb|CAI77764.1| kunitz trypsin inhibitor [Populus tremula]
Length=213

 Score = 85.1 bits (209),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 53/139 (38%), Positives = 76/139 (55%), Gaps = 7/139 (5%)
 Frame = -1

Query  405  CPKSVVQVGPNVV-GNTVTFSPVNPKD-VVRNGTDLNVQFSGSNAGCPESTVWQITHDPE  232
            CP  V+Q   +++ G  VTFSP + +D V+R  TDLN++FS   A C  S+VW+I     
Sbjct  65   CPDDVIQYSLDLLQGLPVTFSPASSEDDVIRVSTDLNIKFSIKKA-CDHSSVWKI-QKSS  122

Query  231  DTDTTHYVVSGGVKGNPSSSTTRNWFMIVKTKN--GYKFKFCPVSVCDCDPICQDIAISV  58
            +++    V +GG +GNP   T  NWF I K     GYK  +CP  +C    +C+D+ I  
Sbjct  123  NSEVQWLVTTGGEEGNPGCDTFTNWFKIEKGAGILGYKLVYCPEDICPSVGLCRDVGIYF  182

Query  57   ESGH-RLLDVDVSLPPLEV  4
            ES   R+L +   L P  V
Sbjct  183  ESNRGRILSLSDKLSPFLV  201



>emb|CAI77774.1| kunitz trypsin inhibitor [Populus tremula]
Length=213

 Score = 85.1 bits (209),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 53/139 (38%), Positives = 76/139 (55%), Gaps = 7/139 (5%)
 Frame = -1

Query  405  CPKSVVQVGPNVV-GNTVTFSPVNPKD-VVRNGTDLNVQFSGSNAGCPESTVWQITHDPE  232
            CP  V+Q   +++ G  VTFSP + +D V+R  TDLN++FS   A C  S+VW+I     
Sbjct  65   CPDDVIQYSLDLLQGLPVTFSPASSEDDVIRVSTDLNIKFSIKKA-CDHSSVWKI-QKSS  122

Query  231  DTDTTHYVVSGGVKGNPSSSTTRNWFMIVKTKN--GYKFKFCPVSVCDCDPICQDIAISV  58
            +++    V +GG +GNP   T  NWF I K     GYK  +CP  +C    +C+D+ I  
Sbjct  123  NSEVQWLVTTGGEEGNPGCDTFTNWFKIEKGAGILGYKLVYCPEDICPSVGLCRDVGIYF  182

Query  57   ESGH-RLLDVDVSLPPLEV  4
            ES   R+L +   L P  V
Sbjct  183  ESNRGRILSLSDKLSPFLV  201



>emb|CAI77790.1| kunitz trypsin inhibitor [Populus tremula]
Length=212

 Score = 85.1 bits (209),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 53/138 (38%), Positives = 76/138 (55%), Gaps = 6/138 (4%)
 Frame = -1

Query  405  CPKSVVQVGPNVV-GNTVTFSPVNPKD-VVRNGTDLNVQFSGSNAGCPESTVWQITHDPE  232
            CP  V+Q   +++ G  VTFSP + +D V+R  TDLN++FS   A C  S+VW+I     
Sbjct  65   CPDDVIQYSLDLLQGLPVTFSPASSEDDVIRVSTDLNIKFSIKKA-CDRSSVWKI-QKSS  122

Query  231  DTDTTHYVVSGGVKGNPSSSTTRNWFMIVKTK-NGYKFKFCPVSVCDCDPICQDIAISVE  55
            +++    V +GG +GNP   T  NWF I K    GYK  +CP  +C    +C+D+ I  E
Sbjct  123  NSEVQWLVTTGGEEGNPGCDTFTNWFKIEKAGVLGYKLVYCPEDICPSVGLCRDVGIYFE  182

Query  54   SGH-RLLDVDVSLPPLEV  4
            S   R+L +   L P  V
Sbjct  183  SNRGRILSLSDKLSPFLV  200



>emb|CAI77795.1| kunitz trypsin inhibitor [Populus tremula]
Length=212

 Score = 85.1 bits (209),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 53/138 (38%), Positives = 76/138 (55%), Gaps = 6/138 (4%)
 Frame = -1

Query  405  CPKSVVQVGPNVV-GNTVTFSPVNPKD-VVRNGTDLNVQFSGSNAGCPESTVWQITHDPE  232
            CP  V+Q   +++ G  VTFSP + +D V+R  TDLN++FS   A C  S+VW+I     
Sbjct  65   CPDDVIQYSLDLLQGLPVTFSPASSEDDVIRVSTDLNIKFSIKKA-CDRSSVWKI-QKSS  122

Query  231  DTDTTHYVVSGGVKGNPSSSTTRNWFMIVKTK-NGYKFKFCPVSVCDCDPICQDIAISVE  55
            +++    V +GG +GNP   T  NWF I K    GYK  +CP  +C    +C+D+ I  E
Sbjct  123  NSEVQWLVTTGGEEGNPGCDTFTNWFKIEKAGVLGYKLVYCPEDICPSVGLCRDVGIYFE  182

Query  54   SGH-RLLDVDVSLPPLEV  4
            S   R+L +   L P  V
Sbjct  183  SNRGRILSLSDKLSPFLV  200



>ref|NP_001238098.1| uncharacterized protein LOC100306134 precursor [Glycine max]
 gb|ACU14169.1| unknown [Glycine max]
 gb|KHN24495.1| Miraculin [Glycine soja]
Length=214

 Score = 85.1 bits (209),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 49/119 (41%), Positives = 67/119 (56%), Gaps = 3/119 (3%)
 Frame = -1

Query  405  CPKSVVQVGPNVVGNTVTFSPVNPKD-VVRNGTDLNVQFSGSNAGCPESTVWQITHDPED  229
            CP SV  V     G  VTF  VNPK  V+R  TDLN++ S +N  C ESTVW++    +D
Sbjct  77   CPLSVAVV-EGFRGLAVTFKLVNPKKGVIRVSTDLNIKTSLTNTSCSESTVWKLDAF-DD  134

Query  228  TDTTHYVVSGGVKGNPSSSTTRNWFMIVKTKNGYKFKFCPVSVCDCDPICQDIAISVES  52
            +    +V +GGV GNP   T  NWF I +  + YK  FCP     C P+C+++ +  +S
Sbjct  135  STGQWFVTTGGVLGNPGKDTIDNWFKIEEYDDDYKLVFCPTVCNFCKPLCRNVGVFRDS  193



>gb|AFK41478.1| unknown [Medicago truncatula]
Length=213

 Score = 85.1 bits (209),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 54/120 (45%), Positives = 70/120 (58%), Gaps = 6/120 (5%)
 Frame = -1

Query  405  CPKSVVQVGPNVVGNTVTFSPVNPKD-VVRNGTDLNVQFSGSNAGCPESTVWQITHDPED  229
            CP +VV V     G  VTF+PVNPK  V+R  TDLN++ S  N  C EST+W  T D  D
Sbjct  77   CPLNVVVV-EGFRGQGVTFTPVNPKKGVIRVSTDLNIKTS-LNTSCEESTIW--TLDDFD  132

Query  228  TDTTH-YVVSGGVKGNPSSSTTRNWFMIVKTKNGYKFKFCPVSVCDCDPICQDIAISVES  52
            + T   +V +GGV GNP   T  NWF I K ++ YKF FCP     C  +C+++ I  +S
Sbjct  133  SSTGQWFVTTGGVLGNPGKDTVDNWFKIEKYEDDYKFVFCPTVCNFCKVMCRNVGIFRDS  192



>ref|XP_003620188.1| Miraculin [Medicago truncatula]
 gb|AES76406.1| Lipid transfer protein [Medicago truncatula]
Length=213

 Score = 84.7 bits (208),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 54/120 (45%), Positives = 70/120 (58%), Gaps = 6/120 (5%)
 Frame = -1

Query  405  CPKSVVQVGPNVVGNTVTFSPVNPKD-VVRNGTDLNVQFSGSNAGCPESTVWQITHDPED  229
            CP +VV V     G  VTF+PVNPK  V+R  TDLN++ S  N  C EST+W  T D  D
Sbjct  77   CPLNVVVV-EGFRGQGVTFTPVNPKKGVIRVSTDLNIKTS-LNTSCEESTIW--TLDDFD  132

Query  228  TDTTH-YVVSGGVKGNPSSSTTRNWFMIVKTKNGYKFKFCPVSVCDCDPICQDIAISVES  52
            + T   +V +GGV GNP   T  NWF I K ++ YKF FCP     C  +C+++ I  +S
Sbjct  133  SSTGQWFVTTGGVLGNPGKDTVDNWFKIEKYEDDYKFVFCPTVCNFCKVMCRNVGIFRDS  192



>gb|ACL12055.1| Kunitz trypsin inhibitor [Nicotiana tabacum]
Length=209

 Score = 84.7 bits (208),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 53/129 (41%), Positives = 72/129 (56%), Gaps = 8/129 (6%)
 Frame = -1

Query  405  CPKSVVQVGPNVV-GNTVTFSPVNPKD-VVRNGTDLNVQFSGSNAGCPESTVWQI-THDP  235
            CP+ ++Q    V  G  V F+P N K  VVR   DLNV+F      C   T+W++ T+D 
Sbjct  72   CPRDIIQNSDEVQEGLPVVFAPFNTKKGVVRLSIDLNVRFFTPTI-CARETIWKLGTYD-  129

Query  234  EDTDTTHYVVSGGVKGNPSSSTTRNWFMIVKTKNGYKFKFCPVSVCD-CDPICQDIAISV  58
             D    +++V+GGV+GNP   T  +WF I K    YKF FCP SVC  C  IC+D+ I  
Sbjct  130  -DKLKQYFIVTGGVEGNPGPQTLSSWFKIEKLGTDYKFVFCP-SVCKICKVICKDVGIYT  187

Query  57   ESGHRLLDV  31
            + G R L +
Sbjct  188  KDGVRFLAL  196



>gb|AHJ25677.1| Kunitz-type trypsin inhibitor [Curcuma longa]
Length=213

 Score = 84.7 bits (208),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 54/130 (42%), Positives = 75/130 (58%), Gaps = 7/130 (5%)
 Frame = -1

Query  405  CPKSVVQVGPNV-VGNTVTFSPV-NPKDVVRNGTDLNVQFSGSNAGCPESTVWQITHDPE  232
            CP +V Q G  V  G  V FSP     + V+  TDLNV+FS +   C +STVW++  D +
Sbjct  70   CPLAVAQEGLEVDSGLPVIFSPAPEGSEFVKMSTDLNVRFSAATI-CVQSTVWRLG-DVD  127

Query  231  DTDTTHYVVSGGVKGNPSSSTTRNWFMIVKT-KNGYKFKFCPVSVC-DCDPICQDIAISV  58
             +    YV+SGGV+G+P + T  NWF I +  +  YK   CP SVC DC  +C D+ + V
Sbjct  128  ASTGRRYVISGGVEGSPGAGTASNWFKIERYGERDYKLVHCP-SVCQDCKVVCGDLGVFV  186

Query  57   ESGHRLLDVD  28
            E  +R L +D
Sbjct  187  EGENRWLGLD  196



>gb|ACO40081.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
Length=181

 Score = 84.3 bits (207),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 51/133 (38%), Positives = 73/133 (55%), Gaps = 6/133 (5%)
 Frame = -1

Query  405  CPKSVVQVGPNVV-GNTVTFSPVNPKD-VVRNGTDLNVQFSGSNAGCPESTVWQITHDPE  232
            CP  V+Q   + + G  VTFSP + +D V+R   DLN++F    A C  S+VW+I     
Sbjct  50   CPDDVIQYSLDQLQGLPVTFSPASSEDDVIRVSADLNIKFYIKKA-CDHSSVWKI-QKSS  107

Query  231  DTDTTHYVVSGGVKGNPSSSTTRNWFMIVKTK-NGYKFKFCPVSVCDCDPICQDIAISVE  55
            +++   +V +GG +GNP   T  NWF I K    GYK  FCP  +C C  +C+DI I  E
Sbjct  108  NSEVQWFVTTGGEEGNPGVHTLTNWFKIEKAGILGYKLVFCPEDICHCGVLCRDIGIYFE  167

Query  54   SGH-RLLDVDVSL  19
            +   R+L +   L
Sbjct  168  NNRGRILSLSDKL  180



>emb|CAI77770.1| kunitz trypsin inhibitor [Populus tremula]
Length=213

 Score = 84.7 bits (208),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 52/139 (37%), Positives = 76/139 (55%), Gaps = 7/139 (5%)
 Frame = -1

Query  405  CPKSVVQVGPNVV-GNTVTFSPVNPKD-VVRNGTDLNVQFSGSNAGCPESTVWQITHDPE  232
            CP  V+Q   +++ G  VTFSP + +D V+R  TDLN++FS   A C  S+VW+I     
Sbjct  65   CPDDVIQYSLDLLQGLPVTFSPASSEDDVIRVSTDLNIKFSIKKA-CDRSSVWKI-QKSS  122

Query  231  DTDTTHYVVSGGVKGNPSSSTTRNWFMIVKTKN--GYKFKFCPVSVCDCDPICQDIAISV  58
            +++    V +GG +GNP   T  NWF I K     GYK  +CP  +C    +C+D+ I  
Sbjct  123  NSEVQWLVTTGGEEGNPGCDTFTNWFKIEKGAGILGYKLVYCPEDICPSVGLCRDVGIYF  182

Query  57   ESGH-RLLDVDVSLPPLEV  4
            E+   R+L +   L P  V
Sbjct  183  ETNRGRILSLSDKLSPFLV  201



>ref|XP_009793041.1| PREDICTED: miraculin-like [Nicotiana sylvestris]
Length=209

 Score = 84.3 bits (207),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 53/129 (41%), Positives = 72/129 (56%), Gaps = 8/129 (6%)
 Frame = -1

Query  405  CPKSVVQVGPNVV-GNTVTFSPVNPKD-VVRNGTDLNVQFSGSNAGCPESTVWQI-THDP  235
            CP+ ++Q    V  G  V F+P N K  VVR   DLNV+F      C   T+W++ T+D 
Sbjct  72   CPRDIIQNSDEVQEGLPVVFTPFNTKKGVVRLSIDLNVRFFTPTI-CARETIWKLGTYD-  129

Query  234  EDTDTTHYVVSGGVKGNPSSSTTRNWFMIVKTKNGYKFKFCPVSVCD-CDPICQDIAISV  58
             D    +++V+GGV+GNP   T  +WF I K    YKF FCP SVC  C  IC+D+ I  
Sbjct  130  -DKLKQYFIVTGGVEGNPGPQTLSSWFKIEKLGTDYKFVFCP-SVCKICKVICKDVGIYT  187

Query  57   ESGHRLLDV  31
            + G R L +
Sbjct  188  KDGVRFLAL  196



>emb|CDP16462.1| unnamed protein product [Coffea canephora]
Length=220

 Score = 84.7 bits (208),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 48/117 (41%), Positives = 69/117 (59%), Gaps = 5/117 (4%)
 Frame = -1

Query  405  CPKSVVQVGPNVV-GNTVTFSPVNPKD-VVRNGTDLNVQFSGSNAGCPESTVWQITHDPE  232
            CP  VVQ   +++ G+ VTF+PVN K+ VVR  TDLN++FS +   C ES VW++  D E
Sbjct  66   CPLPVVQEKLDLLRGHPVTFTPVNSKEGVVRVSTDLNIKFSKAAPVCNESNVWKLDFDEE  125

Query  231  DTDTTHYVVSGGVKGNPSSSTTRNWFMIVK-TKNGYKFKFCPVSVCDCDPICQDIAI  64
                 H++++ GV+GNP   T  NWF I       Y+  FCP     C+ IC+D+ +
Sbjct  126  LGQ--HFILTNGVEGNPGCGTIHNWFKIEGPYHKSYRLVFCPTVCNICNVICKDVGV  180



>dbj|BAA82841.1| miraculin homologue [Youngia japonica]
Length=136

 Score = 82.8 bits (203),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 51/119 (43%), Positives = 67/119 (56%), Gaps = 9/119 (8%)
 Frame = -1

Query  405  CPKSVVQVGPNVV-GNTVTFSPVNPKD-VVRNGTDLNVQFSGSNAGCPESTVWQITHDPE  232
            CP  VVQ    +  G  +TF+PV+PK  V+R  TDLN+ F   +  C +S VW +    E
Sbjct  18   CPPDVVQADQELDNGLPLTFTPVDPKKGVIRESTDLNIIFRAYSI-CIQSNVWML----E  72

Query  231  DTDTTHYVVSGGVKGNPSSSTTRNWFMIVKTKNGYKFKFCPVSVCD-CDPICQDIAISV  58
            + D +  V   GV GNP   T  NWF I K ++ YK  FCP +VCD C PIC DI + +
Sbjct  73   EYDGSLIVSGHGVAGNPGQETISNWFKIEKYEDDYKLVFCP-TVCDTCRPICGDIGVEI  130



>emb|CDO98552.1| unnamed protein product [Coffea canephora]
Length=205

 Score = 84.3 bits (207),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 54/129 (42%), Positives = 73/129 (57%), Gaps = 8/129 (6%)
 Frame = -1

Query  405  CPKSVVQVGPNVV-GNTVTFSPVNPKD-VVRNGTDLNVQFSGSNAGCPESTVWQITHDPE  232
            CP  V+Q       G  + FSP++PK  +VR  +D NV+FS S + C +S+VW+++    
Sbjct  69   CPPEVIQDNYEFTDGIPLIFSPLDPKKGIVRVSSDTNVKFS-STSKCAQSSVWKLSE--L  125

Query  231  DTDTTHYVVS-GGVKGNPSSSTTRNWFMIVKTKNGYKFKFCPVSVCD-CDPICQDIAISV  58
            D  T  Y V  GGV+GNP   T  +WF I      YK KFCP SVC  C  IC+DI I  
Sbjct  126  DALTGKYFVGIGGVEGNPGPKTLSSWFKIETFDRSYKLKFCP-SVCKFCKVICKDIGIVF  184

Query  57   ESGHRLLDV  31
            ++G R L +
Sbjct  185  QNGKRRLAL  193



>emb|CDP21544.1| unnamed protein product [Coffea canephora]
Length=207

 Score = 84.0 bits (206),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 52/125 (42%), Positives = 67/125 (54%), Gaps = 4/125 (3%)
 Frame = -1

Query  405  CPKSVVQ-VGPNVVGNTVTFSPVNPKD-VVRNGTDLNVQFSGSNAGCPESTVWQITHDPE  232
            CP  V Q +     G  +TFSP+ PKD VVR  TDLN+QF+     C ES VW++  +  
Sbjct  71   CPVGVFQELSEQRNGIPLTFSPLKPKDGVVRISTDLNIQFAYPET-CGESPVWRV-DNYL  128

Query  231  DTDTTHYVVSGGVKGNPSSSTTRNWFMIVKTKNGYKFKFCPVSVCDCDPICQDIAISVES  52
            D      V  GGV GNP  +T  +WF I K    YK  +CP     CD IC+D+ I  ++
Sbjct  129  DPSADSIVSIGGVVGNPGPATLGSWFKIQKLGYDYKLVYCPAVCSYCDVICKDVGILYQN  188

Query  51   GHRLL  37
            G R L
Sbjct  189  GERRL  193



>ref|XP_008778295.1| PREDICTED: miraculin, partial [Phoenix dactylifera]
Length=184

 Score = 83.6 bits (205),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 48/120 (40%), Positives = 66/120 (55%), Gaps = 7/120 (6%)
 Frame = -1

Query  405  CPKSV-VQVGPNVVGNTVTFSPVNPK-DVVRNGTDLNVQFSGSNAGCPESTVWQITHDPE  232
            CP  V + + P   G  +TF P +P+ D +   TDLN+ FS     C +STVW++  D +
Sbjct  69   CPLDVTLAISPTSNGLPLTFLPADPEEDTINTSTDLNIVFSAVTI-CVQSTVWKL--DFD  125

Query  231  DTDTTHYVVSGGVKGNPSSSTTRNWFMIVKTKNGYKFKFCPVSVCD-CDPICQDIAISVE  55
            D     YV +GGV GNP   T  NWF I   +  YK  FCP +VCD C P+C ++ +  E
Sbjct  126  DAAGRFYVTTGGVAGNPGRETLANWFKIENDRGAYKLVFCP-TVCDICKPVCGNLGVYRE  184



>emb|CAI77766.1| kunitz trypsin inhibitor [Populus tremula]
Length=213

 Score = 84.0 bits (206),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 52/139 (37%), Positives = 76/139 (55%), Gaps = 7/139 (5%)
 Frame = -1

Query  405  CPKSVVQVGPNVV-GNTVTFSPVNPKD-VVRNGTDLNVQFSGSNAGCPESTVWQITHDPE  232
            CP  V+Q   +++ G  VTFSP + +D V+R  TDLN++FS   A C  S+VW+I     
Sbjct  65   CPDDVIQYSLDLLQGLPVTFSPASSEDDVIRVSTDLNIKFSIKKA-CDRSSVWKI-QKSS  122

Query  231  DTDTTHYVVSGGVKGNPSSSTTRNWFMIVKTKN--GYKFKFCPVSVCDCDPICQDIAISV  58
            +++    V +GG +GNP   T  NWF I K     GYK  +CP  +C    +C+D+ I  
Sbjct  123  NSEVQWLVTTGGEEGNPGCDTFINWFKIEKGAGILGYKLVYCPEDICPSVGLCRDVGIYF  182

Query  57   ESGH-RLLDVDVSLPPLEV  4
            E+   R+L +   L P  V
Sbjct  183  ETNRGRILSLSDKLSPFLV  201



>ref|XP_010476950.1| PREDICTED: miraculin-like [Camelina sativa]
Length=195

 Score = 83.6 bits (205),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 49/135 (36%), Positives = 76/135 (56%), Gaps = 11/135 (8%)
 Frame = -1

Query  405  CPKSVVQVGPNVV-GNTVTFSPVNPKDVVRNGTDLNVQFSGSNAGCPESTVWQITHDPED  229
            CP+SV+Q    V  G  V+FSP +   +VR  TD N++FS        +++W++  D ++
Sbjct  66   CPRSVIQDQFEVSQGLPVSFSPYDKSRIVRVSTDQNIKFS-------STSIWELA-DFDE  117

Query  228  TDTTHYVVSGGVKGNPSSSTTRNWFMIVKTKNGYKFKFCPVSVCDCDPICQDIAISVESG  49
                +++ + GV+GNP  +T  NWF I K  N YK +FCP     C  IC+D+ + V+ G
Sbjct  118  ATRQNFISTCGVEGNPGQTTVDNWFKIDKFDNDYKIRFCPTVCNFCKVICRDVGVFVQDG  177

Query  48   HRLLDVDVSLPPLEV  4
             R L   +S  PL+V
Sbjct  178  KRRL--ALSDVPLKV  190



>emb|CAI77767.1| kunitz trypsin inhibitor [Populus tremula]
 emb|CAI77778.1| kunitz trypsin inhibitor [Populus tremula]
 emb|CAI77779.1| kunitz trypsin inhibitor [Populus tremula]
Length=215

 Score = 83.6 bits (205),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 55/141 (39%), Positives = 76/141 (54%), Gaps = 9/141 (6%)
 Frame = -1

Query  405  CPKSVVQVGPNVV-GNTVTFSPVNPKD-VVRNGTDLNVQFSGSNAGCPESTVWQITHDPE  232
            CP  V+Q   +V  G  VTFSP + +D V+R  TDLN++FS   A C  S+VW+I     
Sbjct  65   CPDDVIQYSLDVFQGLPVTFSPASSEDDVIRVSTDLNIKFSIKKA-CDRSSVWKI-QKSS  122

Query  231  DTDTTHYVVSGGVKGNPSSSTTRNWFMIVKTKN--GYKFK--FCPVSVCDCDPICQDIAI  64
            +++    V +GG +GNP   T  NWF I K     GY +K  FCP  +C    +C+D+ I
Sbjct  123  NSEVQWLVTTGGEEGNPGCDTFTNWFKIEKGAGTFGYNYKLVFCPEDICPSVGLCRDVGI  182

Query  63   SVESGH-RLLDVDVSLPPLEV  4
              ES   R+L +   L P  V
Sbjct  183  YFESNRGRILSLSDKLSPFLV  203



>emb|CDO98557.1| unnamed protein product [Coffea canephora]
Length=207

 Score = 83.6 bits (205),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 51/128 (40%), Positives = 70/128 (55%), Gaps = 4/128 (3%)
 Frame = -1

Query  405  CPKSVVQ-VGPNVVGNTVTFSPVNPKD-VVRNGTDLNVQFSGSNAGCPESTVWQITHDPE  232
            CP  V Q +     G  +TFSPV P+  VVR  TDLN+QF+     C ES VW++  +  
Sbjct  71   CPVGVFQELSEQRNGIPLTFSPVKPRHGVVRTSTDLNIQFAYPET-CGESPVWRV-DNYL  128

Query  231  DTDTTHYVVSGGVKGNPSSSTTRNWFMIVKTKNGYKFKFCPVSVCDCDPICQDIAISVES  52
            D     +V  GGV GNP  +T  +WF I K    YK  +CP    +CD IC+D+ I  ++
Sbjct  129  DPLVDSFVSIGGVVGNPGPATLGSWFKIQKFGYDYKLVYCPTVCSNCDVICKDVGILYQN  188

Query  51   GHRLLDVD  28
            G R L ++
Sbjct  189  GERRLFLN  196



>emb|CAI77771.1| kunitz trypsin inhibitor [Populus tremula]
Length=215

 Score = 83.6 bits (205),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 55/141 (39%), Positives = 76/141 (54%), Gaps = 9/141 (6%)
 Frame = -1

Query  405  CPKSVVQVGPNVV-GNTVTFSPVNPKD-VVRNGTDLNVQFSGSNAGCPESTVWQITHDPE  232
            CP  V+Q   +V  G  VTFSP + +D V+R  TDLN++FS   A C  S+VW+I     
Sbjct  65   CPDDVIQYSLDVFQGLPVTFSPASSEDDVIRVSTDLNIKFSIKKA-CDRSSVWKI-QKSS  122

Query  231  DTDTTHYVVSGGVKGNPSSSTTRNWFMIVKTKN--GYKFK--FCPVSVCDCDPICQDIAI  64
            +++    V +GG +GNP   T  NWF I K     GY +K  FCP  +C    +C+D+ I
Sbjct  123  NSEVQWLVTTGGEEGNPGCDTFTNWFKIEKGAGTFGYNYKLVFCPEDICPSVGLCRDVGI  182

Query  63   SVESGH-RLLDVDVSLPPLEV  4
              ES   R+L +   L P  V
Sbjct  183  YFESNRGRILSLSDKLSPFLV  203



>ref|XP_010459406.1| PREDICTED: miraculin-like [Camelina sativa]
Length=195

 Score = 83.2 bits (204),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 50/135 (37%), Positives = 77/135 (57%), Gaps = 11/135 (8%)
 Frame = -1

Query  405  CPKSVVQVGPNVV-GNTVTFSPVNPKDVVRNGTDLNVQFSGSNAGCPESTVWQITHDPED  229
            CP+SV+Q    V  G  V+FSP +   +VR  TD N++FS        +++W++ +  E 
Sbjct  66   CPRSVIQDRFEVSQGLPVSFSPYDKSRIVRVSTDQNIKFS-------PTSIWELANFDEA  118

Query  228  TDTTHYVVSGGVKGNPSSSTTRNWFMIVKTKNGYKFKFCPVSVCDCDPICQDIAISVESG  49
            T + +++ + GV+GNP  +T  NWF I K  N YK +FCP     C  IC+D+ + V+ G
Sbjct  119  T-SQNFISTCGVEGNPGQTTVDNWFKIDKFDNDYKIRFCPTVCNFCKVICRDVGVFVQDG  177

Query  48   HRLLDVDVSLPPLEV  4
             R L   +S  PL+V
Sbjct  178  KRRL--ALSDVPLKV  190



>emb|CAN63617.1| hypothetical protein VITISV_041430 [Vitis vinifera]
Length=220

 Score = 83.6 bits (205),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 52/128 (41%), Positives = 74/128 (58%), Gaps = 7/128 (5%)
 Frame = -1

Query  405  CPKSVVQVGPNVV-GNTVTFSPVNPKD-VVRNGTDLNVQFSGSNAGCPESTVWQITHDPE  232
            CP  VVQ    V  G T+ FSPVNPK  V+R  TD N++FS +   C +STVW++ +D  
Sbjct  69   CPLDVVQEQNEVSNGLTLMFSPVNPKKGVIRVSTDHNIEFSAATI-CVQSTVWKLEYD--  125

Query  231  DTDTTHYVVSGGVKGNPSSSTTRNWFMIVKTKNGYKFKFCPVSVCD-CDPICQDIAISVE  55
            ++    +  +G V+GN    T  N F I K ++     FCP +VCD C P+C DI I ++
Sbjct  126  ESSGQWFFTTGWVEGNLGRGTLSNQFKIEKYEDDNNLVFCP-TVCDFCKPVCGDIGIYIQ  184

Query  54   SGHRLLDV  31
             G+R L +
Sbjct  185  DGYRHLAL  192



>emb|CAI77800.1| kunitz trypsin inhibitor [Populus tremula]
Length=213

 Score = 83.2 bits (204),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 52/139 (37%), Positives = 75/139 (54%), Gaps = 7/139 (5%)
 Frame = -1

Query  405  CPKSVVQVGPNVVGNT-VTFSPVNPKD-VVRNGTDLNVQFSGSNAGCPESTVWQITHDPE  232
            CP  V+Q   +++    VTFSP + +D V+R  TDLN++FS   A C  S+VW+I     
Sbjct  65   CPDDVIQYSLDLLQVLPVTFSPASSEDDVIRVSTDLNIKFSIKKA-CDRSSVWKI-QKSS  122

Query  231  DTDTTHYVVSGGVKGNPSSSTTRNWFMIVKTKN--GYKFKFCPVSVCDCDPICQDIAISV  58
            +++    V +GG +GNP   T  NWF I K     GYK  +CP  +C    +C+D+ I  
Sbjct  123  NSEVQWLVTTGGEEGNPGCDTFTNWFKIEKGAGILGYKLVYCPEDICPSVGLCRDVGIYF  182

Query  57   ESGH-RLLDVDVSLPPLEV  4
            ES   R+L +   L P  V
Sbjct  183  ESNRGRILSLSDKLSPFLV  201



>emb|CDP21024.1| unnamed protein product [Coffea canephora]
Length=207

 Score = 83.2 bits (204),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 51/125 (41%), Positives = 68/125 (54%), Gaps = 4/125 (3%)
 Frame = -1

Query  405  CPKSVVQ-VGPNVVGNTVTFSPVNPKD-VVRNGTDLNVQFSGSNAGCPESTVWQITHDPE  232
            CP  V Q +     G  VTFSPV P++ VVR  TDLN++F+     C ES VW++  +  
Sbjct  71   CPVGVFQELSAQRNGIPVTFSPVKPRNGVVRISTDLNIEFAYPET-CGESPVWRV-DNYL  128

Query  231  DTDTTHYVVSGGVKGNPSSSTTRNWFMIVKTKNGYKFKFCPVSVCDCDPICQDIAISVES  52
            D     +V  GGV GNP  +T  +WF I K    YK  +CP     CD IC+D+ I  ++
Sbjct  129  DPSADSFVSIGGVVGNPGPATLGSWFKIQKFGYDYKLVYCPTVCSYCDVICKDVGILYQN  188

Query  51   GHRLL  37
            G R L
Sbjct  189  GERRL  193



>emb|CDP19136.1| unnamed protein product [Coffea canephora]
Length=216

 Score = 83.2 bits (204),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 57/131 (44%), Positives = 78/131 (60%), Gaps = 11/131 (8%)
 Frame = -1

Query  405  CPKSVVQVGPNV-VGNTVTFSPVNPKD-VVRNGTDLNVQFSGSNA--GCPESTVWQITHD  238
            CP +VVQ  P+   G+ VTF+PVNP++ VVR  TDLN++FS       C  S VW++  +
Sbjct  66   CPLAVVQARPDFNRGHPVTFTPVNPEESVVRVSTDLNIKFSEPPFINFCRGSNVWKVHFN  125

Query  237  PEDTDTTHYVVSGGVKGNPSSSTTRNWFMIVKTKN-GYKFKFCPVSVCD--CDPICQDIA  67
              +    H+V++ GV+GN    T  NWF I  T N GYKF FCP +VCD   + IC+D+ 
Sbjct  126  --EALKQHFVLTDGVEGNSGCETEANWFKIELTGNVGYKFVFCP-AVCDSSSEAICKDVG  182

Query  66   ISV-ESGHRLL  37
            I   + G R L
Sbjct  183  IYYDDDGTRRL  193



>ref|XP_011046091.1| PREDICTED: miraculin-like [Populus euphratica]
Length=206

 Score = 82.8 bits (203),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 53/128 (41%), Positives = 72/128 (56%), Gaps = 5/128 (4%)
 Frame = -1

Query  405  CPKSVVQVGPNVV-GNTVTFSPVNPKD-VVRNGTDLNVQFSGSNAGCPESTVWQITHDPE  232
            CP  VVQ       G  + F+PVN K  VVR  TDLN++FS ++  C +ST W++    E
Sbjct  69   CPLDVVQERYEASNGLPLKFTPVNTKKGVVRVHTDLNIRFSAASI-CQQSTAWKLDSYDE  127

Query  231  DTDTTHYVVSGGVKGNPSSSTTRNWFMIVKTKNGYKFKFCPVSVCDCDPICQDIAISVES  52
             T    +V + GV+GNP S TT NWF I K ++ YK   CP     C  +C+DI I V++
Sbjct  128  WTKQ-WFVTTNGVEGNPGSETTNNWFKIEKLEDKYKLVVCPTVCQHCKVMCKDIGIYVDA  186

Query  51   -GHRLLDV  31
             G R L +
Sbjct  187  IGVRRLAL  194



>gb|KHM99743.1| Miraculin [Glycine soja]
Length=199

 Score = 82.8 bits (203),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 54/125 (43%), Positives = 72/125 (58%), Gaps = 7/125 (6%)
 Frame = -1

Query  405  CPKSVVQVGPNVVGNTVTFSPVN-PKDVVRNGTDLNVQFSGSNAGCPESTVWQITHDPED  229
            CP  VV V     G  + F+PVN  K V+R  TDLN+ F  + + CP++TVW++  D + 
Sbjct  65   CPLDVVAVD-GYQGQPLIFTPVNFNKGVIRVSTDLNIYFPVATS-CPQTTVWKL-KDYDY  121

Query  228  TDTTHYVVSGGVKGNPSSSTTRNWFMIVKTKNGYKFKFCPVSVC-DCDPICQDIAISV-E  55
            + +  +V +GG  GNP S T  NWF I K ++ YK  +CP SVC DC   C DI I   E
Sbjct  122  STSQWFVTTGGDFGNPGSQTVANWFKIEKYEDAYKLVYCP-SVCNDCSYPCSDIGIYQDE  180

Query  54   SGHRL  40
             G RL
Sbjct  181  YGKRL  185



>emb|CDP22082.1| unnamed protein product [Coffea canephora]
Length=207

 Score = 82.8 bits (203),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 51/125 (41%), Positives = 68/125 (54%), Gaps = 4/125 (3%)
 Frame = -1

Query  405  CPKSVVQ-VGPNVVGNTVTFSPVNPKD-VVRNGTDLNVQFSGSNAGCPESTVWQITHDPE  232
            CP  V Q +     G  VTFSPV P++ VVR  TDLN++F+     C ES VW++  +  
Sbjct  71   CPVGVFQELSAQRNGIPVTFSPVKPRNGVVRISTDLNIEFAYPET-CGESPVWRV-DNYV  128

Query  231  DTDTTHYVVSGGVKGNPSSSTTRNWFMIVKTKNGYKFKFCPVSVCDCDPICQDIAISVES  52
            D     +V  GGV GNP  +T  +WF I K    YK  +CP     CD IC+D+ I  ++
Sbjct  129  DPSADSFVSIGGVVGNPGPATLGSWFKIQKFGYDYKLVYCPTVCSYCDVICKDVGILYQN  188

Query  51   GHRLL  37
            G R L
Sbjct  189  GERRL  193



>emb|CDP21540.1| unnamed protein product [Coffea canephora]
Length=207

 Score = 82.8 bits (203),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 51/125 (41%), Positives = 68/125 (54%), Gaps = 4/125 (3%)
 Frame = -1

Query  405  CPKSVVQ-VGPNVVGNTVTFSPVNPKD-VVRNGTDLNVQFSGSNAGCPESTVWQITHDPE  232
            CP  V Q +     G  VTFSPV P++ VVR  TDLN++F+     C ES VW++  +  
Sbjct  71   CPVGVFQELSAQRNGIPVTFSPVKPRNGVVRISTDLNIEFAYPET-CGESPVWRV-DNYV  128

Query  231  DTDTTHYVVSGGVKGNPSSSTTRNWFMIVKTKNGYKFKFCPVSVCDCDPICQDIAISVES  52
            D     +V  GGV GNP  +T  +WF I K    YK  +CP     CD IC+D+ I  ++
Sbjct  129  DPSADSFVSIGGVVGNPGPATLGSWFKIQKFGYDYKLVYCPTVCSYCDVICKDVGILYQN  188

Query  51   GHRLL  37
            G R L
Sbjct  189  GERRL  193



>ref|XP_009110379.1| PREDICTED: miraculin-like [Brassica rapa]
Length=195

 Score = 82.4 bits (202),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 54/135 (40%), Positives = 78/135 (58%), Gaps = 12/135 (9%)
 Frame = -1

Query  405  CPKSVVQVGPNVV-GNTVTFSPVNPKDVVRNGTDLNVQFSGSNAGCPESTVWQITHDPED  229
            CPKSV+Q    V  G  +TFSP +   V+R  TDLN +FS +       +VW + +  E 
Sbjct  66   CPKSVIQERFEVSNGMPLTFSPSDKSKVIRVSTDLNFKFSAT-------SVWNLDNVDEK  118

Query  228  TDTTHYVVSGGVKGNPSSSTTRNWFMIVKTKNGYKFKFCPVSVCD-CDPICQDIAISVES  52
            T+   ++ + GV+GNP  +T  NWF I K ++ YK  FCP SVCD C  +C+D+ + V+ 
Sbjct  119  TNQ-WFIGTCGVEGNPGRTTVGNWFKIDKYEDHYKIVFCP-SVCDICRVMCRDVGVFVQD  176

Query  51   G-HRLLDVDVSLPPL  10
            G  RL+  DV L  +
Sbjct  177  GIRRLVLSDVPLKVM  191



>emb|CDX83886.1| BnaC08g17590D [Brassica napus]
Length=195

 Score = 82.4 bits (202),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 53/135 (39%), Positives = 78/135 (58%), Gaps = 12/135 (9%)
 Frame = -1

Query  405  CPKSVVQVGPNVV-GNTVTFSPVNPKDVVRNGTDLNVQFSGSNAGCPESTVWQITHDPED  229
            CPKSV+Q    V  G  +TFSP +   V+R  TDLN +FS +       ++W + +  E 
Sbjct  66   CPKSVIQERFEVSNGMPLTFSPSDKSKVIRVSTDLNFKFSAT-------SIWNLDNVDEK  118

Query  228  TDTTHYVVSGGVKGNPSSSTTRNWFMIVKTKNGYKFKFCPVSVCD-CDPICQDIAISVES  52
            T+   ++ + GV+GNP  +T  NWF I K ++ YK  FCP SVCD C  +C+D+ + V+ 
Sbjct  119  TNQ-WFIGTCGVEGNPGRTTVGNWFKIDKYEDHYKILFCP-SVCDICRVMCRDVGVFVQD  176

Query  51   G-HRLLDVDVSLPPL  10
            G  RL+  DV L  +
Sbjct  177  GIRRLVLSDVPLKVM  191



>ref|XP_003534079.1| PREDICTED: miraculin-like [Glycine max]
Length=199

 Score = 82.4 bits (202),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 54/125 (43%), Positives = 72/125 (58%), Gaps = 7/125 (6%)
 Frame = -1

Query  405  CPKSVVQVGPNVVGNTVTFSPVN-PKDVVRNGTDLNVQFSGSNAGCPESTVWQITHDPED  229
            CP  VV V     G  + F+PVN  K V+R  TDLN+ F  + + CP++TVW++  D + 
Sbjct  65   CPLDVVVVD-GYQGQPLIFTPVNFNKGVIRVSTDLNIYFPVATS-CPQTTVWKL-KDYDY  121

Query  228  TDTTHYVVSGGVKGNPSSSTTRNWFMIVKTKNGYKFKFCPVSVC-DCDPICQDIAISV-E  55
            + +  +V +GG  GNP S T  NWF I K ++ YK  +CP SVC DC   C DI I   E
Sbjct  122  STSQRFVTTGGDFGNPGSQTVANWFKIEKYEDAYKLVYCP-SVCNDCSYPCGDIGIYQDE  180

Query  54   SGHRL  40
             G RL
Sbjct  181  YGKRL  185



>gb|ACS92516.1| Kunitz-type protease inhibitor KPI-D12 [Populus trichocarpa x 
Populus deltoides]
Length=206

 Score = 82.4 bits (202),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 57/137 (42%), Positives = 77/137 (56%), Gaps = 7/137 (5%)
 Frame = -1

Query  405  CPKSVVQVGPNVV-GNTVTFSPVNPKD-VVRNGTDLNVQFSGSNAGCPESTVWQITHDPE  232
            CP  VVQ       G  + F+PVN K  VVR  TDLN++FS ++  C +ST W++    E
Sbjct  69   CPLDVVQDRYEASNGLPLKFTPVNTKKGVVRVHTDLNIRFSAASI-CHQSTAWKLGSYDE  127

Query  231  DTDTTHYVVSGGVKGNPSSSTTRNWFMIVKTKNGYKFKFCPVSVCDCDPICQDIAISVES  52
             T    +V + GV+GNP   TT NWF I K ++ YK  FCP     C  +C+DI I V++
Sbjct  128  WTKQ-WFVTTNGVEGNPGPETTNNWFKIEKFEDKYKLVFCPTVCQHCKVMCKDIGIYVDA  186

Query  51   -GHRLLDVDVSLPPLEV  4
             G R L   +S  PL+V
Sbjct  187  KGVRRL--ALSSVPLKV  201



>ref|XP_007152537.1| hypothetical protein PHAVU_004G138500g [Phaseolus vulgaris]
 gb|ESW24531.1| hypothetical protein PHAVU_004G138500g [Phaseolus vulgaris]
Length=205

 Score = 82.0 bits (201),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 49/137 (36%), Positives = 74/137 (54%), Gaps = 7/137 (5%)
 Frame = -1

Query  405  CPKSVVQVGPNVV-GNTVTFSPVNPKD-VVRNGTDLNVQFSGSNAGCPESTVWQITHDPE  232
            CP  VVQ  P V+ G  VTF+P N K  V+   TDLN++  G+   C +  VW++    +
Sbjct  68   CPLFVVQEKPEVLNGTPVTFTPYNAKSGVILTSTDLNIKSYGTTTSCDKPPVWKLL---K  124

Query  231  DTDTTHYVVSGGVKGNPSSSTTRNWFMIVKTKNGYKFKFCPVSVCDCDPICQDIAISV-E  55
                  ++ +GGV+GNP   T  NWF I K +  Y   FCP SVC C  +C+++ + V +
Sbjct  125  VLTGVWFLSTGGVEGNPGIDTIVNWFKIEKAEKDYVISFCP-SVCKCQTLCRELGLYVGD  183

Query  54   SGHRLLDVDVSLPPLEV  4
             G++ L +   +P   V
Sbjct  184  DGNKHLSLSDKVPSFRV  200



>gb|KHM99742.1| Miraculin, partial [Glycine soja]
Length=146

 Score = 80.9 bits (198),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 54/125 (43%), Positives = 71/125 (57%), Gaps = 7/125 (6%)
 Frame = -1

Query  405  CPKSVVQVGPNVVGNTVTFSPVN-PKDVVRNGTDLNVQFSGSNAGCPESTVWQITHDPED  229
            CP  VV V     G  + F+PVN  K V+R  TDLN+ F    + CP++TVW++  D + 
Sbjct  12   CPLDVVAV-DGYQGQPLIFTPVNFNKGVIRVSTDLNIYFPVGTS-CPQTTVWKL-KDYDY  68

Query  228  TDTTHYVVSGGVKGNPSSSTTRNWFMIVKTKNGYKFKFCPVSVC-DCDPICQDIAISV-E  55
            + +  +V +GG  GNP S T  NWF I K ++ YK  +CP SVC DC   C DI I   E
Sbjct  69   SASQWFVTTGGDFGNPGSQTMANWFKIEKYEDAYKLVYCP-SVCNDCSYPCSDIGIYQDE  127

Query  54   SGHRL  40
             G RL
Sbjct  128  YGKRL  132



>ref|NP_001237312.1| uncharacterized protein LOC100527782 precursor [Glycine max]
 gb|ACU16955.1| unknown [Glycine max]
Length=199

 Score = 82.0 bits (201),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 54/125 (43%), Positives = 71/125 (57%), Gaps = 7/125 (6%)
 Frame = -1

Query  405  CPKSVVQVGPNVVGNTVTFSPVN-PKDVVRNGTDLNVQFSGSNAGCPESTVWQITHDPED  229
            CP  VV V     G  + F+PVN  K V+R  TDLN+ F    + CP++TVW++  D + 
Sbjct  65   CPLDVVAVD-GYQGQPLIFTPVNFNKGVIRVSTDLNIYFPVGTS-CPQTTVWKL-KDYDY  121

Query  228  TDTTHYVVSGGVKGNPSSSTTRNWFMIVKTKNGYKFKFCPVSVC-DCDPICQDIAISV-E  55
            + +  +V +GG  GNP S T  NWF I K ++ YK  +CP SVC DC   C DI I   E
Sbjct  122  STSQWFVTTGGDFGNPGSQTVANWFKIEKYEDAYKLVYCP-SVCNDCSYPCSDIGIYQDE  180

Query  54   SGHRL  40
             G RL
Sbjct  181  YGKRL  185



>ref|XP_006372632.1| hypothetical protein POPTR_0017s03420g [Populus trichocarpa]
 gb|ERP50429.1| hypothetical protein POPTR_0017s03420g [Populus trichocarpa]
Length=206

 Score = 82.0 bits (201),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 54/133 (41%), Positives = 74/133 (56%), Gaps = 6/133 (5%)
 Frame = -1

Query  405  CPKSVVQVGPNVV-GNTVTFSPVNPKD-VVRNGTDLNVQFSGSNAGCPESTVWQITHDPE  232
            CP  VVQ       G  + F+PVN K  VVR  TDLN++FS ++  C +ST W++ +  E
Sbjct  69   CPLDVVQDRYEASNGLPLKFTPVNTKKGVVRVHTDLNIRFSAASI-CHQSTAWKLDNYDE  127

Query  231  DTDTTHYVVSGGVKGNPSSSTTRNWFMIVKTKNGYKFKFCPVSVCDCDPICQDIAISVES  52
             T    +V + GV+GNP   TT NWF I K ++ YK  FCP     C  +C+DI I V++
Sbjct  128  WTKQ-WFVTTDGVEGNPGPETTNNWFKIEKFEDKYKLVFCPTVCQHCKVMCKDIGIYVDA  186

Query  51   G--HRLLDVDVSL  19
                RL   +V L
Sbjct  187  KGVRRLALTNVPL  199



>ref|XP_006372633.1| hypothetical protein POPTR_0017s03430g [Populus trichocarpa]
 gb|ERP50430.1| hypothetical protein POPTR_0017s03430g [Populus trichocarpa]
Length=206

 Score = 82.0 bits (201),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 54/133 (41%), Positives = 74/133 (56%), Gaps = 6/133 (5%)
 Frame = -1

Query  405  CPKSVVQVGPNVV-GNTVTFSPVNPKD-VVRNGTDLNVQFSGSNAGCPESTVWQITHDPE  232
            CP  VVQ       G  + F+PVN K  VVR  TDLN++FS ++  C +ST W++ +  E
Sbjct  69   CPLDVVQDRYEASNGLPLKFTPVNTKKGVVRVHTDLNIRFSAASI-CHQSTAWKLDNYDE  127

Query  231  DTDTTHYVVSGGVKGNPSSSTTRNWFMIVKTKNGYKFKFCPVSVCDCDPICQDIAISVES  52
             T    +V + GV+GNP   TT NWF I K ++ YK  FCP     C  +C+DI I V++
Sbjct  128  WTKQ-WFVTTDGVEGNPGPETTNNWFKIEKFEDKYKLVFCPTVCQHCKVMCKDIGIYVDA  186

Query  51   G--HRLLDVDVSL  19
                RL   +V L
Sbjct  187  KGVRRLALTNVPL  199



>ref|XP_006347376.1| PREDICTED: miraculin-like [Solanum tuberosum]
Length=202

 Score = 82.0 bits (201),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 51/129 (40%), Positives = 75/129 (58%), Gaps = 7/129 (5%)
 Frame = -1

Query  405  CPKSVVQVG-PNVVGNTVTFSPVNPKD-VVRNGTDLNVQFSGSNAGCPESTVWQITHDPE  232
            CP+ ++Q       G  V F+ ++ K  VVR  TD+NV+F      C   T+W++    E
Sbjct  64   CPRDIIQWDDEEQEGLPVVFTRIDAKKSVVRVSTDVNVRFYTPTI-CARETIWKLGEYDE  122

Query  231  DTDTTHYVVSGGVKGNPSSSTTRNWFMIVKTKNGYKFKFCPVSVCD-CDPICQDIAISV-  58
            +    ++VV+GGV+GNP   T  NWF I K ++GYKF +CP SVC  C  IC+D+ I + 
Sbjct  123  NLKQ-YFVVTGGVEGNPGLKTVGNWFKIEKFESGYKFVYCP-SVCKFCKVICKDVGILIT  180

Query  57   ESGHRLLDV  31
            + G RLL +
Sbjct  181  KDGVRLLAL  189



>ref|XP_009782174.1| PREDICTED: miraculin-like [Nicotiana sylvestris]
Length=208

 Score = 81.6 bits (200),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 52/124 (42%), Positives = 71/124 (57%), Gaps = 7/124 (6%)
 Frame = -1

Query  369  VGNTVTFSPVNP-KDVVRNGTDLNVQFSGSNAGCPESTVWQITHDPEDTDTTHYVVSGGV  193
            +G  + FSP NP ++++   TDLNV+F+  +     STVW+I  + E     + V  GGV
Sbjct  85   IGGYLQFSPANPNENIIGISTDLNVKFTSIHI-SDSSTVWRI--NTEIIPQRYLVTVGGV  141

Query  192  KGNPSSSTTRNWFMIVKTKNGYKFKFCPVSVCD-CDPICQDIAISVESGHRLLDVDVSLP  16
            +GNP   T  NWF I K ++ YK  +CP  VC+ C P C DI I VE   R+L V  S  
Sbjct  142  EGNPGRETLSNWFKIDKYEDAYKLVYCP-GVCETCRPFCGDIGILVEGSKRVLFVR-SDQ  199

Query  15   PLEV  4
            PL+V
Sbjct  200  PLKV  203



>gb|KHM99740.1| Miraculin [Glycine soja]
Length=142

 Score = 80.5 bits (197),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 53/125 (42%), Positives = 72/125 (58%), Gaps = 7/125 (6%)
 Frame = -1

Query  405  CPKSVVQVGPNVVGNTVTFSPVN-PKDVVRNGTDLNVQFSGSNAGCPESTVWQITHDPED  229
            CP  VV V     G  + F+PVN  K V+R  TDLN+ F  + + CP++TVW++  D + 
Sbjct  8    CPLDVVAVD-GYQGQPLIFTPVNFNKGVIRVSTDLNIYFPVATS-CPQTTVWKL-KDYDY  64

Query  228  TDTTHYVVSGGVKGNPSSSTTRNWFMIVKTKNGYKFKFCPVSVC-DCDPICQDIAISVES  52
            + +  +V +GG  GNP S T  NWF I K ++ YK  +CP SVC DC   C DI I  + 
Sbjct  65   STSQWFVTTGGDFGNPGSQTMANWFKIEKYEDAYKLVYCP-SVCNDCSYPCSDIGIYQDQ  123

Query  51   -GHRL  40
             G RL
Sbjct  124  YGKRL  128



>ref|XP_003620172.1| 21 kDa seed protein [Medicago truncatula]
 gb|AES76390.1| Kunitz type trypsin inhibitor / miraculin [Medicago truncatula]
Length=205

 Score = 81.6 bits (200),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 48/137 (35%), Positives = 71/137 (52%), Gaps = 7/137 (5%)
 Frame = -1

Query  405  CPKSVVQVGPNVV-GNTVTFSPVNPKD-VVRNGTDLNVQFSGSNAGCPESTVWQITHDPE  232
            CP  V+Q    V  G  VTF+P N K  V+   TDLN++   +   C +S VW++    +
Sbjct  68   CPLYVLQEKLEVKNGQAVTFTPYNAKKGVILTSTDLNIKSYVTKTTCAQSQVWKLN---K  124

Query  231  DTDTTHYVVSGGVKGNPSSSTTRNWFMIVKTKNGYKFKFCPVSVCDCDPICQDIAISV-E  55
                  ++ +GGV+GNP   T  NWF I K    Y F FCP SVC C  +C+++ + V +
Sbjct  125  VLSGVWFLATGGVEGNPGFDTIFNWFKIEKADKDYVFSFCP-SVCKCQTLCRELGLYVYD  183

Query  54   SGHRLLDVDVSLPPLEV  4
             G + L +   +P   V
Sbjct  184  HGKKHLALSDQVPSFRV  200



>gb|AFS33546.1| Kunitz-type protease inhibitor, partial [Nicotiana tabacum]
Length=133

 Score = 80.1 bits (196),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 51/125 (41%), Positives = 72/125 (58%), Gaps = 7/125 (6%)
 Frame = -1

Query  369  VGNTVTFSPVNP-KDVVRNGTDLNVQFSGSNAGCPESTVWQITHDPEDTDTTHYVVSGGV  193
            +G  + FSPVNP ++++   TDLNV+F+  +     STVW+I  + E     + V  GGV
Sbjct  8    IGGYLQFSPVNPNENIIGISTDLNVKFTSIHIS-DSSTVWRI--NTELIPQRYLVTVGGV  64

Query  192  KGNPSSSTTRNWFMIVKTKNGYKFKFCPVSVCD-CDPICQDIAISVESGHRLLDV-DVSL  19
            +GNP   T  NWF I K ++ YK  +CP  VC+ C P C +I I VE   R+L +   S 
Sbjct  65   EGNPGRETLSNWFRIDKYEDAYKLVYCP-GVCETCRPFCGEIGILVEGSKRVLFIGSRSD  123

Query  18   PPLEV  4
             PL+V
Sbjct  124  QPLKV  128



>emb|CDO98554.1| unnamed protein product [Coffea canephora]
Length=209

 Score = 81.6 bits (200),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 50/125 (40%), Positives = 66/125 (53%), Gaps = 4/125 (3%)
 Frame = -1

Query  405  CPKSVVQ-VGPNVVGNTVTFSPVNPK-DVVRNGTDLNVQFSGSNAGCPESTVWQITHDPE  232
            CP  V Q +     G  +TFSPV  +  VVR  TDLN+QF+     C ES VW++  +  
Sbjct  73   CPVGVFQEMSEQRNGIPLTFSPVKQRYGVVRTSTDLNIQFAYPET-CGESPVWRV-DNYL  130

Query  231  DTDTTHYVVSGGVKGNPSSSTTRNWFMIVKTKNGYKFKFCPVSVCDCDPICQDIAISVES  52
            D     +V  GGV GNP  +T  +WF I K    YK  +CP     CD IC+D+ I  ++
Sbjct  131  DPSADSFVSIGGVVGNPGPATLGSWFKIQKFGYDYKLVYCPAVCSYCDAICKDVGILYQN  190

Query  51   GHRLL  37
            G R L
Sbjct  191  GERRL  195



>ref|NP_001241106.1| uncharacterized protein LOC100790688 precursor [Glycine max]
 gb|ACU23857.1| unknown [Glycine max]
 gb|KHM99731.1| Miraculin [Glycine soja]
Length=209

 Score = 81.6 bits (200),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 60/135 (44%), Positives = 77/135 (57%), Gaps = 10/135 (7%)
 Frame = -1

Query  405  CPKSVVQVGPNVVGNTVTFSPVNPKD-VVRNGTDLNVQFSGSNAGCPE--STVWQITHDP  235
            CP  VV V     G  VTFSPVNPK  V+R  TDLN++FS   + CP   STVW++  D 
Sbjct  72   CPLDVVVVN-GYHGLPVTFSPVNPKKGVIRVSTDLNIKFSARTS-CPRQYSTVWKL-DDF  128

Query  234  EDTDTTHYVVSGGVKGNPSSSTTRNWFMIVKTKNGYKFKFCPVSVCDC-DPICQDIAISV  58
            + +    +V +GGV GNPS  T  NWF I K    YK  +CP SV  C   +C+++ + V
Sbjct  129  DFSKRQWFVTTGGVVGNPSLETIHNWFKIEKYDGAYKLVYCP-SVVKCPKHLCKNVGLFV  187

Query  57   -ESGH-RLLDVDVSL  19
             E G+ RL   DV L
Sbjct  188  DEKGNKRLALTDVPL  202



>ref|XP_003620187.1| Miraculin [Medicago truncatula]
 gb|AES76405.1| Kunitz type trypsin inhibitor / miraculin [Medicago truncatula]
Length=212

 Score = 81.6 bits (200),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 56/138 (41%), Positives = 78/138 (57%), Gaps = 9/138 (7%)
 Frame = -1

Query  405  CPKSVVQVGPNVVGNTVTFSPVN-PKDVVRNGTDLNVQFS--GSNAGCP-ESTVWQITHD  238
            CP  VV V  N  G  + F+PVN  K VVR  TDLN++FS    ++ CP  S VW+I  D
Sbjct  75   CPLDVVVVKHNQ-GLPLRFTPVNNKKGVVRVSTDLNIKFSNDAYDSRCPNHSLVWKI--D  131

Query  237  PEDTDTTHYVVSGGVKGNPSSSTTRNWFMIVKTKNGYKFKFCPVSVCDCDPICQDIAISV  58
            P   + T +V + GV GNP S+T  NWF I K ++ YK  +CP     C  +C+DI I V
Sbjct  132  PFSKEET-FVTTNGVLGNPGSNTIHNWFQIEKYEDAYKLVYCPNVCPSCKHVCKDIGIYV  190

Query  57   ESGHRLLDVDVSLPPLEV  4
               +R + + ++  P +V
Sbjct  191  YK-YREMRLALTNVPFKV  207



>gb|KHM99741.1| Miraculin [Glycine soja]
Length=199

 Score = 81.3 bits (199),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 54/125 (43%), Positives = 72/125 (58%), Gaps = 7/125 (6%)
 Frame = -1

Query  405  CPKSVVQVGPNVVGNTVTFSPVN-PKDVVRNGTDLNVQFSGSNAGCPESTVWQITHDPED  229
            CP  VV V     G  + F+PVN  K V+R  TDLN+ F  + + CP++TVW++  D + 
Sbjct  65   CPLDVVVVD-GYQGQPLIFTPVNFNKGVIRVSTDLNIYFPVATS-CPQTTVWKL-KDYDY  121

Query  228  TDTTHYVVSGGVKGNPSSSTTRNWFMIVKTKNGYKFKFCPVSVC-DCDPICQDIAISV-E  55
            + +  +V +GG  GNP S T  NWF I K ++ YK  +CP SVC DC   C DI I   E
Sbjct  122  STSQWFVTTGGDFGNPGSQTVANWFKIEKYEDAYKLVYCP-SVCNDCSYPCGDIGIYQDE  180

Query  54   SGHRL  40
             G RL
Sbjct  181  YGKRL  185



>ref|XP_003534080.1| PREDICTED: miraculin-like [Glycine max]
Length=199

 Score = 81.3 bits (199),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 52/125 (42%), Positives = 72/125 (58%), Gaps = 7/125 (6%)
 Frame = -1

Query  405  CPKSVVQVGPNVVGNTVTFSPVN-PKDVVRNGTDLNVQFSGSNAGCPESTVWQITHDPED  229
            CP  VV +     G  + F+PVN  K V+R  TDLN+ F  + + CP++TVW++  D + 
Sbjct  65   CPLDVVAID-GYQGQPLIFTPVNFNKGVIRVSTDLNIYFPVATS-CPQTTVWKL-KDYDY  121

Query  228  TDTTHYVVSGGVKGNPSSSTTRNWFMIVKTKNGYKFKFCPVSVC-DCDPICQDIAISVES  52
            + +  +V +GG  GNP S T  NWF I K ++ YK  +CP SVC DC   C DI I  + 
Sbjct  122  STSQWFVTTGGDFGNPGSQTMANWFKIEKYEDAYKLVYCP-SVCNDCSYPCSDIGIYQDQ  180

Query  51   -GHRL  40
             G RL
Sbjct  181  YGKRL  185



>ref|XP_010498164.1| PREDICTED: miraculin-like [Camelina sativa]
Length=195

 Score = 81.3 bits (199),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 50/135 (37%), Positives = 76/135 (56%), Gaps = 11/135 (8%)
 Frame = -1

Query  405  CPKSVVQVGPNVV-GNTVTFSPVNPKDVVRNGTDLNVQFSGSNAGCPESTVWQITHDPED  229
            CP+SV+Q    V  G  V+FSP +   +VR  TD N++FS        +++W++ +  E 
Sbjct  66   CPRSVIQDQFEVSHGLPVSFSPYDRSRIVRVSTDQNIKFS-------PTSIWELANFDEA  118

Query  228  TDTTHYVVSGGVKGNPSSSTTRNWFMIVKTKNGYKFKFCPVSVCDCDPICQDIAISVESG  49
            T + + + + GV+GNP  +T  NWF I K  N YK +FCP     C  IC+D+ + V+ G
Sbjct  119  T-SQNLISTCGVEGNPGQTTVDNWFKIDKFDNDYKIRFCPTVCNFCKVICRDVGVFVQDG  177

Query  48   HRLLDVDVSLPPLEV  4
             R L   +S  PL+V
Sbjct  178  KRRL--ALSDVPLKV  190



>ref|XP_009614754.1| PREDICTED: miraculin-like [Nicotiana tomentosiformis]
Length=251

 Score = 81.6 bits (200),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 55/132 (42%), Positives = 73/132 (55%), Gaps = 7/132 (5%)
 Frame = -1

Query  393  VVQVGPNVVGNTVTFSPVNPKDV-VRNGTDLNVQFSGSNAGCPESTVWQITHDPEDTDTT  217
            V Q   N  G  + FSPVNPK+  +R  TDLN++++        STVW+I  + E     
Sbjct  77   VSQNTQNSSGTYLQFSPVNPKENNIRTSTDLNIKYTAMIIS-DLSTVWRI--NTELIPQR  133

Query  216  HYVVSGGVKGNPSSSTTRNWFMIVKTKNGYKFKFCPVSVCD-CDPICQDIAISVESGHRL  40
            + V  GGV+GNP   T  NWF I K ++ YK  +CP  VC+ C P C DI I VE   R+
Sbjct  134  NLVTVGGVEGNPGRETLSNWFKIDKYEDAYKLVYCP-GVCETCRPFCGDIGILVEGSKRV  192

Query  39   LDVDVSLPPLEV  4
            + V  S  PL+V
Sbjct  193  MFVG-SNQPLKV  203



>ref|XP_006372654.1| hypothetical protein POPTR_0017s03600g [Populus trichocarpa]
 gb|ERP50451.1| hypothetical protein POPTR_0017s03600g [Populus trichocarpa]
Length=206

 Score = 81.3 bits (199),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 54/133 (41%), Positives = 73/133 (55%), Gaps = 6/133 (5%)
 Frame = -1

Query  405  CPKSVVQVGPNVV-GNTVTFSPVNPKD-VVRNGTDLNVQFSGSNAGCPESTVWQITHDPE  232
            CP  VVQ       G  + F+PVN K  VVR  TDLN++FS  +  C +ST W++ +  E
Sbjct  69   CPLDVVQDRYEASNGLPLKFTPVNTKKGVVRVHTDLNIRFSAGSI-CHQSTAWKLDNYDE  127

Query  231  DTDTTHYVVSGGVKGNPSSSTTRNWFMIVKTKNGYKFKFCPVSVCDCDPICQDIAISVES  52
             T    +V + GV+GNP   TT NWF I K ++ YK  FCP     C  +C+DI I V++
Sbjct  128  WTKQ-WFVTTDGVEGNPGPETTNNWFKIEKFEDKYKLVFCPTVCQHCKVMCKDIGIYVDA  186

Query  51   G--HRLLDVDVSL  19
                RL   +V L
Sbjct  187  KGVRRLALTNVPL  199



>emb|CDX96746.1| BnaA08g22890D [Brassica napus]
Length=195

 Score = 80.9 bits (198),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 52/135 (39%), Positives = 78/135 (58%), Gaps = 12/135 (9%)
 Frame = -1

Query  405  CPKSVVQVGPNVV-GNTVTFSPVNPKDVVRNGTDLNVQFSGSNAGCPESTVWQITHDPED  229
            CP+SV+Q    V  G  +TFSP +   V+R  TDLN +FS +       ++W + +  E 
Sbjct  66   CPRSVIQERFEVSNGLPLTFSPSDKSKVIRVSTDLNFKFSAT-------SIWNLDNVDEK  118

Query  228  TDTTHYVVSGGVKGNPSSSTTRNWFMIVKTKNGYKFKFCPVSVCD-CDPICQDIAISVES  52
            T+   ++ + GV+GNP  +T  NWF I K ++ YK  FCP SVCD C  +C+D+ + V+ 
Sbjct  119  TNQ-WFIGTCGVEGNPGRTTVGNWFKIDKYEDHYKIVFCP-SVCDICKVMCRDVGVFVQD  176

Query  51   G-HRLLDVDVSLPPL  10
            G  RL+  DV L  +
Sbjct  177  GIRRLVLSDVPLKVM  191



>emb|CDO98558.1| unnamed protein product [Coffea canephora]
 emb|CDO98559.1| unnamed protein product [Coffea canephora]
Length=212

 Score = 81.3 bits (199),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 53/133 (40%), Positives = 69/133 (52%), Gaps = 5/133 (4%)
 Frame = -1

Query  405  CPKSVVQ-VGPNVVGNTVTFSPVNPKD-VVRNGTDLNVQFSGSNAGCPESTVWQITHDPE  232
            CP  V Q     + G  +TF PVNPK  VVR  TDLN++F   +  C ES VW + +   
Sbjct  74   CPAGVFQETSQQINGIPLTFFPVNPKKGVVRVSTDLNIKFDYPDT-CDESPVWSVDNYVY  132

Query  231  DTDTTHYVVSGGVKGNPSSSTTRNWFMIVKT-KNGYKFKFCPVSVCDCDPICQDIAISVE  55
             +D + +V  GGV GNP   T  +WF I K     YK  FCP     CD IC+D+ I+ +
Sbjct  133  PSDDS-FVNIGGVVGNPGPETLSSWFKIQKFGYRDYKLVFCPTVCSYCDVICKDVGITYQ  191

Query  54   SGHRLLDVDVSLP  16
             G R L +    P
Sbjct  192  DGKRRLSLTTDYP  204



>ref|XP_009614755.1| PREDICTED: miraculin-like [Nicotiana tomentosiformis]
Length=210

 Score = 81.3 bits (199),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 47/115 (41%), Positives = 67/115 (58%), Gaps = 6/115 (5%)
 Frame = -1

Query  369  VGNTVTFSPVNP-KDVVRNGTDLNVQFSGSNAGCPESTVWQITHDPEDTDTTHYVVSGGV  193
            +G  + FSPVNP ++++   TDLNV+F+  +     STVW+I  + E     + V  GGV
Sbjct  85   IGGYLQFSPVNPNENIIGISTDLNVKFTSIHI-SDSSTVWRI--NTELIPQRYLVTVGGV  141

Query  192  KGNPSSSTTRNWFMIVKTKNGYKFKFCPVSVCD-CDPICQDIAISVESGHRLLDV  31
            +GNP   T  NWF I K ++ YK  +CP  VC+ C P C +I I VE   R+L +
Sbjct  142  EGNPGRETLSNWFRIDKYEDAYKLVYCP-GVCETCRPFCGEIGILVEGSKRVLFI  195



>ref|XP_010918417.1| PREDICTED: miraculin-like [Elaeis guineensis]
Length=199

 Score = 80.9 bits (198),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 53/139 (38%), Positives = 73/139 (53%), Gaps = 10/139 (7%)
 Frame = -1

Query  405  CPKSV-VQVGPNVVGNTVTFSPVNPK-DVVRNGTDLNVQFSGSNAGCPESTVWQITHDPE  232
            CP  V + + P   G  VTF P +P+ D +   TDLN+ FS     C +ST W++  D +
Sbjct  61   CPLDVTLAISPTNNGLPVTFLPADPEEDTINTSTDLNIVFSAFTI-CLQSTAWKL--DFD  117

Query  231  DTDTTHYVVSGGVKGNPSSSTTRNWFMI--VKTKNGYKFKFCPVSVCD-CDPICQDIAIS  61
            +T    YV +GGV GNP   T  NWF I     ++GY   FCP SVC+ C P+C  + + 
Sbjct  118  NTTRRFYVTTGGVTGNPGRETLDNWFKIQSASGRSGYNLVFCP-SVCNICRPVCGSLGVV  176

Query  60   VESGHRLLDVDVSLP-PLE  7
             E G   L +    P P+E
Sbjct  177  REDGRLRLGISSDAPLPVE  195



>ref|XP_010101167.1| hypothetical protein L484_005403 [Morus notabilis]
 gb|EXB87528.1| hypothetical protein L484_005403 [Morus notabilis]
Length=197

 Score = 80.5 bits (197),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 47/114 (41%), Positives = 66/114 (58%), Gaps = 5/114 (4%)
 Frame = -1

Query  366  GNTVTFSPVNP-KDVVRNGTDLNVQFSGSNAGCPESTVWQITHDPEDTDTTHYVVSGGVK  190
            G  +TFSP N  +  V   TDLN++FS +   C +STVW++    E      +V SGGV+
Sbjct  75   GFPLTFSPANQNQSFVCLSTDLNIKFSAATT-CAQSTVWKLDSFDESLGQ-WFVTSGGVE  132

Query  189  GNPSSSTTRNWFMIVKTKNGYKFKFCPVSVCD-CDPICQDIAISVESGHRLLDV  31
            GNP   T  NWF I K  + YK  FCP +VC+ C  +C+D+ I ++ G R L +
Sbjct  133  GNPGRQTISNWFKIEKYNDDYKLVFCP-TVCNFCKVLCRDVGIYIKDGIRRLAL  185



>gb|KHM99738.1| Miraculin [Glycine soja]
Length=199

 Score = 80.5 bits (197),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 53/125 (42%), Positives = 70/125 (56%), Gaps = 7/125 (6%)
 Frame = -1

Query  405  CPKSVVQVGPNVVGNTVTFSPVN-PKDVVRNGTDLNVQFSGSNAGCPESTVWQITHDPED  229
            CP  VV V     G  + F+PVN  K V+R  TDLN+ F    + CP++T W++  D + 
Sbjct  65   CPLDVVAVD-GYQGQPLIFTPVNFNKGVIRVSTDLNIYFPVGTS-CPQTTAWKL-KDYDY  121

Query  228  TDTTHYVVSGGVKGNPSSSTTRNWFMIVKTKNGYKFKFCPVSVC-DCDPICQDIAISV-E  55
            + +  +V +GG  GNP S T  NWF I K ++ YK  +CP SVC DC   C DI I   E
Sbjct  122  STSQWFVTTGGDFGNPGSQTVANWFKIEKYEDAYKLVYCP-SVCNDCSYPCSDIGIYQDE  180

Query  54   SGHRL  40
             G RL
Sbjct  181  YGKRL  185



>ref|XP_003534078.1| PREDICTED: miraculin-like [Glycine max]
Length=199

 Score = 80.5 bits (197),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 53/125 (42%), Positives = 70/125 (56%), Gaps = 7/125 (6%)
 Frame = -1

Query  405  CPKSVVQVGPNVVGNTVTFSPVN-PKDVVRNGTDLNVQFSGSNAGCPESTVWQITHDPED  229
            CP  VV V     G  + F+PVN  K V+R  TDLN+ F    + CP++T W++  D + 
Sbjct  65   CPLDVVAVD-GYQGQPLIFTPVNFNKGVIRVSTDLNIYFPVGTS-CPQTTAWKL-KDYDY  121

Query  228  TDTTHYVVSGGVKGNPSSSTTRNWFMIVKTKNGYKFKFCPVSVC-DCDPICQDIAISV-E  55
            + +  +V +GG  GNP S T  NWF I K ++ YK  +CP SVC DC   C DI I   E
Sbjct  122  STSQWFVTTGGDFGNPGSQTVANWFKIEKYEDAYKLVYCP-SVCNDCSYPCSDIGIYQDE  180

Query  54   SGHRL  40
             G RL
Sbjct  181  YGKRL  185



>emb|CDP21779.1| unnamed protein product [Coffea canephora]
Length=213

 Score = 80.5 bits (197),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 53/129 (41%), Positives = 76/129 (59%), Gaps = 10/129 (8%)
 Frame = -1

Query  405  CPKSVVQVGPNVVGNTVTFSPVNPKD-VVRNGTDLNVQFSGSNA--GCPESTVWQITHDP  235
            CP +VVQ      G+ VTF+PVNP++ VVR  TDLN++F+       C  S VW++  + 
Sbjct  64   CPLAVVQAWLQR-GDPVTFTPVNPEEGVVRVSTDLNIKFAEPPIINFCRGSNVWKVHFN-  121

Query  234  EDTDTTHYVVSGGVKGNPSSSTTRNWFMI-VKTKNGYKFKFCPVSVCD--CDPICQDIAI  64
             +    H+V++ GV+GN    TT NWF I   +   YKF FCP +VCD   + IC+D+ I
Sbjct  122  -EALKQHFVLTDGVEGNSGCETTANWFKIEAVSDRDYKFVFCP-TVCDSSSEAICKDVGI  179

Query  63   SVESGHRLL  37
             ++ G R L
Sbjct  180  YMDDGTRRL  188



>ref|XP_010279489.1| PREDICTED: miraculin-like [Nelumbo nucifera]
Length=208

 Score = 80.5 bits (197),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 50/138 (36%), Positives = 75/138 (54%), Gaps = 6/138 (4%)
 Frame = -1

Query  405  CPKSVVQ-VGPNVVGNTVTFSPVNP-KDVVRNGTDLNVQFSGSNAGCPESTVWQITHDPE  232
            CP  V+Q       G  ++FSPVNP ++++   TD N++F+   +  P+ TVW +    E
Sbjct  70   CPFVVIQDEDQESDGLPLSFSPVNPTEEIIHVSTDHNIRFAIETS-LPQPTVWSLEGLDE  128

Query  231  DTDTTHYVVSGGVKGNPSSSTTRNWFMIVKTKNGYKFKFCPVSVCD-CDPICQDIAISVE  55
             T+T      G + GNP   T  NWF I +  + YK  FCP +VCD C P+C ++ I ++
Sbjct  129  STNTFSVDTCGSI-GNPGRGTLSNWFTIERYDDNYKLVFCP-TVCDFCRPVCGELGIVIQ  186

Query  54   SGHRLLDVDVSLPPLEVN  1
             G R L +   L PLE+ 
Sbjct  187  DGIRHLAMRSGLEPLEIK  204



>ref|XP_008437071.1| PREDICTED: miraculin-like [Cucumis melo]
Length=212

 Score = 80.5 bits (197),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 49/113 (43%), Positives = 63/113 (56%), Gaps = 6/113 (5%)
 Frame = -1

Query  366  GNTVTFSPVNPKD-VVRNGTDLNVQFSGSNAGCPESTVWQI-THDPEDTDTTHYVVSGGV  193
            G+  TF P+NPK  VVR  TDLN++F  +   C +STVW++ T D       ++V  GG 
Sbjct  87   GDPTTFLPINPKKGVVRVSTDLNIEFDATTR-CRKSTVWKLGTFD--RYLRQYFVTIGGT  143

Query  192  KGNPSSSTTRNWFMIVKTKNG-YKFKFCPVSVCDCDPICQDIAISVESGHRLL  37
            KGNP   TT NWF I K   G YK  +CP     C  +C+DI I   +G R L
Sbjct  144  KGNPGRETTENWFKIEKYGKGNYKLVYCPRVCKYCKVMCKDIGIFENNGIRGL  196



>ref|XP_009803614.1| PREDICTED: miraculin-like [Nicotiana sylvestris]
Length=210

 Score = 80.1 bits (196),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 53/130 (41%), Positives = 74/130 (57%), Gaps = 9/130 (7%)
 Frame = -1

Query  405  CPKSVVQVGPNVV-GNTVTFSPVNPKD-VVRNGTDLNVQFSGSNAGCPESTVWQI-THDP  235
            CP+ ++Q    V  G  V F+P + K  VVR  TDLNV+F      C   T+W++ T+D 
Sbjct  72   CPRDIIQEVDEVQQGLPVVFTPFDAKKGVVRLSTDLNVRFFTPTI-CARETIWKLGTYD-  129

Query  234  EDTDTTHYVVSGGVKGNPSSSTTRNWFMIVKTKNGYKFKFCPVSVCD-CDPICQDIAI-S  61
             D    +++V+GGV+GNP   T  +WF I K    YKF FCP SVC  C  IC+D+ I S
Sbjct  130  -DKLKQYFMVTGGVEGNPGPQTLSSWFKIEKLGTDYKFVFCP-SVCKICKVICKDVGIYS  187

Query  60   VESGHRLLDV  31
             + G R + +
Sbjct  188  TKDGVRFMAL  197



>gb|KHM99744.1| Miraculin [Glycine soja]
Length=174

 Score = 79.7 bits (195),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 53/125 (42%), Positives = 70/125 (56%), Gaps = 7/125 (6%)
 Frame = -1

Query  405  CPKSVVQVGPNVVGNTVTFSPVN-PKDVVRNGTDLNVQFSGSNAGCPESTVWQITHDPED  229
            CP  VV V     G  + F+PVN  K V+R  TDLN+ F    + CP++T W++  D + 
Sbjct  40   CPLDVVAVD-GYQGQPLIFTPVNFNKGVIRVSTDLNIYFPVGTS-CPQTTAWKL-KDYDY  96

Query  228  TDTTHYVVSGGVKGNPSSSTTRNWFMIVKTKNGYKFKFCPVSVC-DCDPICQDIAISV-E  55
            + +  +V +GG  GNP S T  NWF I K ++ YK  +CP SVC DC   C DI I   E
Sbjct  97   STSQWFVTTGGDFGNPGSQTVANWFKIEKYEDAYKLVYCP-SVCNDCSYPCSDIGIYQDE  155

Query  54   SGHRL  40
             G RL
Sbjct  156  YGKRL  160



>ref|XP_007210537.1| hypothetical protein PRUPE_ppa011653mg [Prunus persica]
 gb|EMJ11736.1| hypothetical protein PRUPE_ppa011653mg [Prunus persica]
Length=202

 Score = 80.1 bits (196),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 51/106 (48%), Positives = 63/106 (59%), Gaps = 5/106 (5%)
 Frame = -1

Query  405  CPKSVVQVGPNVV-GNTVTFSPVNPKD-VVRNGTDLNVQFSGSNAGCPESTVWQITHDPE  232
            CP  VVQ    V  G  +TFSPVNPK  VVR  TD N++FS +   C +ST+W++    E
Sbjct  68   CPLDVVQEQHEVSNGLPLTFSPVNPKKGVVRVSTDHNIKFSAATI-CVQSTMWKLDKFDE  126

Query  231  DTDTTHYVVSGGVKGNPSSSTTRNWFMIVKTKNGYKFKFCPVSVCD  94
             T    +V SGGV+GNP   TT NWF I K    YK  FCP +VC+
Sbjct  127  QTGQ-WFVTSGGVEGNPGRQTTSNWFKIEKYDEDYKLVFCP-TVCN  170



>ref|XP_010279488.1| PREDICTED: miraculin-like [Nelumbo nucifera]
Length=208

 Score = 80.1 bits (196),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 50/137 (36%), Positives = 72/137 (53%), Gaps = 4/137 (3%)
 Frame = -1

Query  405  CPKSVVQ-VGPNVVGNTVTFSPVNPKD-VVRNGTDLNVQFSGSNAGCPESTVWQITHDPE  232
            CP  VVQ       G  + FSPVNPK+ ++R  TD N++F+  +   P+ TVW +  D  
Sbjct  70   CPFDVVQDEDEESNGLPLAFSPVNPKEEIIRVLTDQNIRFA-IDTLLPQPTVWNL-GDFN  127

Query  231  DTDTTHYVVSGGVKGNPSSSTTRNWFMIVKTKNGYKFKFCPVSVCDCDPICQDIAISVES  52
            ++  T  V + G  GNP   T  NWF I    + YK  FCP     C P+C D+ I+++ 
Sbjct  128  ESARTFLVETCGSIGNPGIETLSNWFRIEPFDDDYKLVFCPTVCNFCRPVCGDLGIAIQD  187

Query  51   GHRLLDVDVSLPPLEVN  1
            G R L +   L PL++ 
Sbjct  188  GVRHLALGSGLEPLKIK  204



>gb|KHM99735.1| Miraculin [Glycine soja]
Length=154

 Score = 78.6 bits (192),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 54/130 (42%), Positives = 70/130 (54%), Gaps = 7/130 (5%)
 Frame = -1

Query  405  CPKSVVQVGPNVVGNTVTFSPVNPKD-VVRNGTDLNVQFSGSNAGCPE-STVWQITHDPE  232
            CP  VV V P   G  + FSPV+PK  VVR  TDLN+ FS  +  C E S VW++ H  +
Sbjct  15   CPLDVVVV-PRSHGLPLQFSPVDPKKGVVRVSTDLNIMFSTDHTSCAEYSPVWKLDHF-D  72

Query  231  DTDTTHYVVSGGVKGNPSSSTTRNWFMIVKTKNGYKFKFCP--VSVCDCDPICQDIAISV  58
             +    +V +GG  GNPS  T RNWF I K    YK  +CP          +C+DI + V
Sbjct  73   VSKGKWFVSTGGSMGNPSWETIRNWFKIEKCDGAYKIVYCPSVFPSSSSKHMCKDIGVFV  132

Query  57   -ESGHRLLDV  31
             E+G R L +
Sbjct  133  DENGFRRLAL  142



>ref|XP_002890252.1| trypsin and protease inhibitor family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH66511.1| trypsin and protease inhibitor family protein [Arabidopsis lyrata 
subsp. lyrata]
Length=196

 Score = 79.3 bits (194),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 50/136 (37%), Positives = 78/136 (57%), Gaps = 13/136 (10%)
 Frame = -1

Query  405  CPKSVVQVGPNVV-GNTVTFSPVNPKDVVRNGTDLNVQFSGSNAGCPESTVWQITHDPED  229
            CP+SV+Q    V  G  V FSP +   +VR  TD N++FS        +++W++ +  E 
Sbjct  66   CPRSVIQDQFEVSQGLPVKFSPYDKSRIVRVSTDQNIKFS-------PTSIWELANFDER  118

Query  228  TDTTHYVVSGGVKGNPSSSTTRNWFMIVKTKNGYKFKFCPVSVCD-CDPICQDIAISVES  52
            T +  ++ + GV+GNP   T  NWF I + +  YK +FCP +VC+ C  IC+D+ + V+ 
Sbjct  119  T-SQWFISTCGVEGNPGQKTVGNWFKIDEFEKDYKIRFCP-TVCNFCKVICRDVGVFVQD  176

Query  51   GHRLLDVDVSLPPLEV  4
            G R L   +S  PL+V
Sbjct  177  GKRRL--ALSEVPLKV  190



>emb|CDP21726.1| unnamed protein product [Coffea canephora]
Length=215

 Score = 79.3 bits (194),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 51/128 (40%), Positives = 74/128 (58%), Gaps = 8/128 (6%)
 Frame = -1

Query  405  CPKSVVQVGPNV-VGNTVTFSPVNPKD-VVRNGTDLNVQFSGSNAGCPESTVWQITHDPE  232
            CP +VVQ   +V  G+ VTF+PVNP++ V+R  TDLN++FS     C  S VW++  +  
Sbjct  66   CPLAVVQALSDVNRGHPVTFTPVNPEEGVIRVSTDLNIKFSPFINFCRGSNVWKVHFN--  123

Query  231  DTDTTHYVVSGGVKGNPSSSTTRNWFMIVKTKNGYKFKFCPVSVCD--CDPICQDIAISV  58
            +    H+V++ GV+GN    T  NWF I      Y+  FCP +VCD   + IC+D+ I  
Sbjct  124  EALEQHFVLTDGVEGNSGCETEANWFKIEGNYPFYRLVFCP-AVCDSSSEAICKDVGIYY  182

Query  57   -ESGHRLL  37
             + G R L
Sbjct  183  DDDGTRRL  190



>ref|XP_004241479.1| PREDICTED: miraculin-like [Solanum lycopersicum]
Length=200

 Score = 79.0 bits (193),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 50/127 (39%), Positives = 73/127 (57%), Gaps = 7/127 (6%)
 Frame = -1

Query  405  CPKSVVQVG-PNVVGNTVTFSPVNPKD-VVRNGTDLNVQFSGSNAGCPESTVWQITHDPE  232
            CP+ ++Q       G  V F+ ++ K  VVR  TD+NV+F      C   T+W++  D +
Sbjct  62   CPRDIIQWDDEEQEGLPVVFTRIDAKKSVVRVSTDVNVRFYTPTI-CARETIWKL-GDYD  119

Query  231  DTDTTHYVVSGGVKGNPSSSTTRNWFMIVKTKNGYKFKFCPVSVCD-CDPICQDIAISVE  55
            D    ++VV+GGV+GNP   T  NWF I +  +GYK  +CP SVC  C  IC+D+ I + 
Sbjct  120  DKLKKYFVVTGGVEGNPGLKTVGNWFKIERFGSGYKLVYCP-SVCKFCKVICKDVGIFIT  178

Query  54   S-GHRLL  37
            + G RLL
Sbjct  179  NDGVRLL  185



>ref|XP_006304577.1| hypothetical protein CARUB_v10011616mg [Capsella rubella]
 gb|EOA37475.1| hypothetical protein CARUB_v10011616mg [Capsella rubella]
Length=195

 Score = 78.6 bits (192),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 49/136 (36%), Positives = 77/136 (57%), Gaps = 13/136 (10%)
 Frame = -1

Query  405  CPKSVVQVGPNVV-GNTVTFSPVNPKDVVRNGTDLNVQFSGSNAGCPESTVWQITHDPED  229
            C  SV+Q    V  G  + FSP +   +VR  TD N++FS       ++++W++ +  E 
Sbjct  66   CRTSVIQARFEVSQGLPLKFSPFDKSRIVRVSTDQNIKFS-------QTSIWELANFDET  118

Query  228  TDTTHYVVSGGVKGNPSSSTTRNWFMIVKTKNGYKFKFCPVSVCD-CDPICQDIAISVES  52
            T  + ++ + GV+GNP  +T  NWF I K    YK +FCP +VC+ C  IC+D+ + V+ 
Sbjct  119  TSQS-FISTCGVEGNPGLTTVSNWFKIDKFDKDYKIRFCP-TVCNFCKVICRDVGVFVQD  176

Query  51   GHRLLDVDVSLPPLEV  4
            G R L   +S  PL+V
Sbjct  177  GMRRL--ALSEVPLKV  190



>ref|XP_006353919.1| PREDICTED: miraculin-like [Solanum tuberosum]
Length=245

 Score = 79.0 bits (193),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 52/135 (39%), Positives = 74/135 (55%), Gaps = 9/135 (7%)
 Frame = -1

Query  393  VVQVGPNVVGNTVTFSPVNPKD-VVRNGTDLNVQFSGSNAGCPESTVWQI--THDPEDTD  223
            V Q   + +G+++ F+PV+  + ++R  TDLNV+F         STVW I  T  P+   
Sbjct  71   VTQYAQSSMGSSLRFTPVDSNETIIRLSTDLNVKFMSIVFTYNMSTVWTINTTLIPQR--  128

Query  222  TTHYVVSGGVKGNPSSSTTRNWFMIVKTKNGYKFKFCPVSVCD-CDPICQDIAISVESGH  46
              + V  GGV+GNP   T  NWF I K ++ YKF +CP  VC+ C P C DI I VE  +
Sbjct  129  --YLVAVGGVEGNPGRDTLGNWFKIDKYEDAYKFVYCP-GVCETCRPFCGDIGIIVEPNN  185

Query  45   RLLDVDVSLPPLEVN  1
            + +    S  PL+V 
Sbjct  186  KRVLFVGSDKPLKVK  200



>gb|ACV52580.1| endopeptidase inhibitor [Nicotiana benthamiana]
Length=102

 Score = 76.6 bits (187),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 36/96 (38%), Positives = 57/96 (59%), Gaps = 2/96 (2%)
 Frame = -1

Query  324  VRNGTDLNVQFSGSNAGCPESTVWQITHDPEDTDTTHYVVSGGVKGNPSSSTTRNWFMIV  145
            +R  TDLN++FS ++  C ++T+W++  D ++T   +++  GG +GNP   T  NWF I 
Sbjct  1    IRESTDLNIKFSAASI-CVQTTLWKL-DDFDETTGKYFITIGGNEGNPGRETISNWFKIE  58

Query  144  KTKNGYKFKFCPVSVCDCDPICQDIAISVESGHRLL  37
            K +  YK  +CP     C  IC+DI I ++ G R L
Sbjct  59   KFERDYKLVYCPTVCNFCKVICKDIGIFIQDGTRRL  94



>ref|XP_003534083.1| PREDICTED: miraculin-like [Glycine max]
Length=215

 Score = 79.0 bits (193),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 54/130 (42%), Positives = 70/130 (54%), Gaps = 7/130 (5%)
 Frame = -1

Query  405  CPKSVVQVGPNVVGNTVTFSPVNPKD-VVRNGTDLNVQFSGSNAGCPE-STVWQITHDPE  232
            CP  VV V P   G  + FSPV+PK  VVR  TDLN+ FS  +  C E S VW++ H  +
Sbjct  76   CPLDVVVV-PRSHGLPLQFSPVDPKKGVVRVSTDLNIMFSTDHTSCAEYSPVWKLDHF-D  133

Query  231  DTDTTHYVVSGGVKGNPSSSTTRNWFMIVKTKNGYKFKFCP--VSVCDCDPICQDIAISV  58
             +    +V +GG  GNPS  T RNWF I K    YK  +CP          +C+DI + V
Sbjct  134  VSKGKWFVSTGGSMGNPSWETIRNWFKIEKCDGAYKIVYCPSVFPSSSSKHMCKDIGVFV  193

Query  57   -ESGHRLLDV  31
             E+G R L +
Sbjct  194  DENGFRRLAL  203



>emb|CDP18338.1| unnamed protein product [Coffea canephora]
Length=215

 Score = 79.0 bits (193),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 51/128 (40%), Positives = 74/128 (58%), Gaps = 8/128 (6%)
 Frame = -1

Query  405  CPKSVVQVGPNV-VGNTVTFSPVNPKD-VVRNGTDLNVQFSGSNAGCPESTVWQITHDPE  232
            CP +VVQ   ++  G+ V+F+PVNP++ VVR  TDLN++FS     C  S VW++  +  
Sbjct  66   CPLAVVQALSDLNRGHPVSFTPVNPEEGVVRVSTDLNIKFSPFINFCRGSNVWKVHFN--  123

Query  231  DTDTTHYVVSGGVKGNPSSSTTRNWFMIVKTKNGYKFKFCPVSVCD--CDPICQDIAISV  58
            +    H+V++ GV+GN    T  NWF I      YK  FCP +VCD   + IC+D+ I  
Sbjct  124  EALEQHFVLTDGVEGNSGCETEANWFKIEGNYPFYKLVFCP-AVCDSSSEAICKDVGIYY  182

Query  57   -ESGHRLL  37
             + G R L
Sbjct  183  DDDGTRRL  190



>ref|XP_006347377.1| PREDICTED: miraculin-like [Solanum tuberosum]
Length=210

 Score = 78.6 bits (192),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 50/126 (40%), Positives = 72/126 (57%), Gaps = 6/126 (5%)
 Frame = -1

Query  405  CPKSVVQVGPNVV-GNTVTFSPVNPKD-VVRNGTDLNVQFSGSNAGCPESTVWQITHDPE  232
            CP+ +VQ    V  G  V F+ ++ K  VVR  TD+NV+F      C   T+W++    +
Sbjct  73   CPRDIVQETDEVQQGLPVVFTRLDAKKGVVRVSTDVNVRFYTPTI-CARETIWKLGAY-D  130

Query  231  DTDTTHYVVSGGVKGNPSSSTTRNWFMIVKTKNGYKFKFCPVSVCDC-DPICQDIAISVE  55
            D    ++VV+GGV+GNP   T  NWF I K  + YKF FCP SVC+    IC+D+ + ++
Sbjct  131  DKLKQYFVVTGGVEGNPGPQTVGNWFKIEKFGSDYKFVFCP-SVCEFYKVICKDVGVFMK  189

Query  54   SGHRLL  37
             G R L
Sbjct  190  DGVRFL  195



>ref|XP_004515058.1| PREDICTED: miraculin-like [Cicer arietinum]
Length=196

 Score = 77.8 bits (190),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 46/123 (37%), Positives = 66/123 (54%), Gaps = 7/123 (6%)
 Frame = -1

Query  405  CPKSVVQVGPNVVGNTVTFSPVNPKDVVRNGTDLNVQFSGSNAGCPE-STVWQITHDPED  229
            CP  VV V  +  G  + F+P+  K V+R   DLN+  +  ++ CP  S VW+I  DP  
Sbjct  64   CPLHVV-VDKHSQGLPLRFAPI--KGVIRVSIDLNIMLANYDSRCPHHSIVWKI--DPSS  118

Query  228  TDTTHYVVSGGVKGNPSSSTTRNWFMIVKTKNGYKFKFCPVSVCDCDPICQDIAISVESG  49
             + T +V  GGV G PSS T ++WF I K ++ YK  +CP     C  +C+DI I V   
Sbjct  119  KEET-FVTLGGVLGYPSSKTIQSWFKIEKYEDAYKLVYCPYVCPSCKHVCKDIGIYVYKD  177

Query  48   HRL  40
              +
Sbjct  178  REM  180



>gb|AFK34345.1| unknown [Medicago truncatula]
Length=212

 Score = 78.2 bits (191),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 54/138 (39%), Positives = 76/138 (55%), Gaps = 9/138 (7%)
 Frame = -1

Query  405  CPKSVVQVGPNVVGNTVTFSPVN-PKDVVRNGTDLNVQFS--GSNAGCP-ESTVWQITHD  238
            CP  VV V  N  G  + F+PVN  K  VR  TDLN++FS    ++ CP  S VW+I  D
Sbjct  75   CPLDVVVVKHNQ-GLPLRFTPVNNKKGAVRVSTDLNIKFSNDAYDSRCPNHSLVWKI--D  131

Query  237  PEDTDTTHYVVSGGVKGNPSSSTTRNWFMIVKTKNGYKFKFCPVSVCDCDPICQDIAISV  58
            P   + T +V + GV GNP  +T  NWF I K ++ YK  +CP     C  +C+DI I V
Sbjct  132  PFSKEET-FVTTNGVLGNPGFNTIHNWFQIEKYEDAYKLVYCPNVCPSCKHVCKDIGIYV  190

Query  57   ESGHRLLDVDVSLPPLEV  4
               +R + + ++  P +V
Sbjct  191  YK-YREMRLALTNVPFKV  207



>emb|CDY19181.1| BnaC05g13820D [Brassica napus]
Length=192

 Score = 77.8 bits (190),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 44/124 (35%), Positives = 67/124 (54%), Gaps = 9/124 (7%)
 Frame = -1

Query  405  CPKSVVQVGPNVV-GNTVTFSPVNPKDVVRNGTDLNVQFSGSNAGCPESTVWQITHDPED  229
            CPKSV+Q    +  G  + FSP +   ++R  TDLN +F  +       +VW + +  E 
Sbjct  63   CPKSVIQDQYEISQGLPLEFSPSDNSRIIRVSTDLNFKFCAA-------SVWNLDNYDEK  115

Query  228  TDTTHYVVSGGVKGNPSSSTTRNWFMIVKTKNGYKFKFCPVSVCDCDPICQDIAISVESG  49
            T+   +V + GV+GNP  +T  NWF I K ++ YK  FCP     C  +C+D+ + V+ G
Sbjct  116  TNQ-WFVTACGVEGNPGQATVDNWFKIEKYEDDYKIVFCPTVCNFCKVMCRDVGVFVQDG  174

Query  48   HRLL  37
             R L
Sbjct  175  MRRL  178



>gb|AFK33359.1| unknown [Medicago truncatula]
Length=202

 Score = 77.4 bits (189),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 46/136 (34%), Positives = 69/136 (51%), Gaps = 7/136 (5%)
 Frame = -1

Query  405  CPKSVVQVGPNVV-GNTVTFSPVNPKD-VVRNGTDLNVQFSGSNAGCPESTVWQITHDPE  232
            CP  V+Q    V  G  VTF+P N K  V+   TDLN++   +   C +S VW++    +
Sbjct  68   CPLYVLQEKLEVKNGQAVTFTPYNAKKGVILTSTDLNIKSYVTKTTCAQSQVWKLN---K  124

Query  231  DTDTTHYVVSGGVKGNPSSSTTRNWFMIVKTKNGYKFKFCPVSVCDCDPICQDIAISV-E  55
                  ++ +G V+GNP   T  NWF I K    Y F FCP SVC C  +C+++ + V +
Sbjct  125  VLSGVWFLATGSVEGNPGFDTIFNWFKIEKADKDYVFSFCP-SVCKCQTLCRELGLYVYD  183

Query  54   SGHRLLDVDVSLPPLE  7
             G + L +   +P   
Sbjct  184  HGKKHLALSDQVPSFR  199



>ref|XP_006416660.1| hypothetical protein EUTSA_v10008818mg [Eutrema salsugineum]
 gb|ESQ35013.1| hypothetical protein EUTSA_v10008818mg [Eutrema salsugineum]
Length=198

 Score = 77.4 bits (189),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 47/125 (38%), Positives = 68/125 (54%), Gaps = 11/125 (9%)
 Frame = -1

Query  405  CPKSVVQVGPNVV-GNTVTFSPVNPKDVVRNGTDLNVQFSGSNAGCPESTVWQITHDPED  229
            C KSV+Q    V  G  ++FSP    + +    DLN +FS +       ++W++ +  E 
Sbjct  69   CKKSVIQENYEVSQGLPLSFSPAEKSNTIGVSADLNFKFSAT-------SIWKLDYFDEA  121

Query  228  TDTTHYVVSGGVKGNPSSSTTRNWFMIVKTKNGYKFKFCPVSVCD-CDPICQDIAISVES  52
            T+   YV + GV GNP   T  NWF I K ++ YK  FCP SVC+ C  +C+DI + V+ 
Sbjct  122  TNQ-WYVSACGVAGNPGQKTVSNWFKIDKFEDAYKIVFCP-SVCNICKVMCRDIGVFVQD  179

Query  51   GHRLL  37
            G R L
Sbjct  180  GKRKL  184



>ref|XP_009149240.1| PREDICTED: miraculin [Brassica rapa]
Length=192

 Score = 77.4 bits (189),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 46/124 (37%), Positives = 66/124 (53%), Gaps = 9/124 (7%)
 Frame = -1

Query  405  CPKSVVQVGPNVV-GNTVTFSPVNPKDVVRNGTDLNVQFSGSNAGCPESTVWQITHDPED  229
            CPKSV+Q    V  G  V FSP +   ++R  TDLN +F  +       +VW + +  E 
Sbjct  63   CPKSVIQDPYEVSKGLPVEFSPSDNSRIIRVSTDLNFKFCAA-------SVWNLDNYDET  115

Query  228  TDTTHYVVSGGVKGNPSSSTTRNWFMIVKTKNGYKFKFCPVSVCDCDPICQDIAISVESG  49
            T+   +V + GV GNP  +T  NWF I K ++ YK  FCP     C  +C+D+ + V+ G
Sbjct  116  TNQ-WFVTACGVAGNPGQATVDNWFKIEKYEDDYKIVFCPTVCNFCKVMCRDVGVFVQDG  174

Query  48   HRLL  37
             R L
Sbjct  175  KRRL  178



>gb|KFK42293.1| hypothetical protein AALP_AA2G237000 [Arabis alpina]
Length=194

 Score = 77.0 bits (188),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 49/125 (39%), Positives = 69/125 (55%), Gaps = 12/125 (10%)
 Frame = -1

Query  405  CPKSVVQVGPNVV-GNTVTFSPVNPKDVVRNGTDLNVQFSGSNAGCPESTVWQITHDPED  229
            C  SV+Q    V  G  + FSP +   ++R  TDLN  FS       ++++W++  D +D
Sbjct  66   CLNSVIQDRYGVSNGLALKFSPSDNSKIIRVSTDLNFIFS-------KTSIWKL--DRDD  116

Query  228  TDTTHYVVSGGVKGNPSSSTTRNWFMIVKTKNGYKFKFCPVSVCD-CDPICQDIAISVES  52
            T    +V + GV GNP  +T  NWF I K +N YK  FCP SVC+ C  +C DI + V+ 
Sbjct  117  TANQWFVSTCGVAGNPGRTTVDNWFKIDKFENDYKIVFCP-SVCNFCKVMCGDIGVFVQG  175

Query  51   GHRLL  37
            G R L
Sbjct  176  GKRSL  180



>gb|KHN24493.1| Miraculin [Glycine soja]
Length=200

 Score = 77.0 bits (188),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 51/125 (41%), Positives = 69/125 (55%), Gaps = 7/125 (6%)
 Frame = -1

Query  405  CPKSVVQVGPNVVGNTVTFSPVN-PKDVVRNGTDLNVQFSGSNAGCPESTVWQITHDPED  229
            CP  VV V     G  + F+PVN  K V+R  TDLN+ F   +  CP +  W++  D ++
Sbjct  65   CPLDVVAVD-GYQGQPLIFTPVNVNKGVIRVSTDLNIYFP-IDTSCPLTKAWKL-KDYDN  121

Query  228  TDTTHYVVSGGVKGNPSSSTTRNWFMIVKTKNGYKFKFCPVSVC-DCDPICQDIAISVES  52
            + +  +V +GG  GNP S T  NWF I K ++ YK  +CP SVC DC   C DI I  + 
Sbjct  122  STSQWFVTTGGDFGNPGSQTLANWFKIEKYEDAYKLVYCP-SVCKDCSYPCSDIGIYQDQ  180

Query  51   -GHRL  40
             G RL
Sbjct  181  YGKRL  185



>ref|XP_009406658.1| PREDICTED: miraculin-like [Musa acuminata subsp. malaccensis]
Length=200

 Score = 77.0 bits (188),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 53/139 (38%), Positives = 69/139 (50%), Gaps = 8/139 (6%)
 Frame = -1

Query  405  CPKSVVQVG-PNVVGNTVTFSPVNPKD-VVRNGTDLNVQFSGSNAGCPESTVWQITHDPE  232
            CP SV     P   G  + FSP +  D  V   TD NV FS     C +STVW++  D  
Sbjct  64   CPLSVALASLPADNGLPLQFSPEDDDDDTVELSTDTNVIFSAFTT-CLQSTVWKLELD--  120

Query  231  DTDTTHYVVSGGVKGNPSSSTTRNWFMIVKTKNGYKFKFCPVSVCD-CDPICQDIAISVE  55
            + +  +YVV GGV GNP   T  NWF I   +  YK  FCP +VCD C P+C  + +  +
Sbjct  121  EGEGRYYVVIGGVAGNPGKETLSNWFKIESYQGVYKLVFCP-TVCDYCRPVCGSLGVYEQ  179

Query  54   SGHRLLDVDVSLP-PLEVN  1
             G + L +    P P E  
Sbjct  180  GGRQWLGIRDDTPFPFEFK  198



>emb|CDY26209.1| BnaA06g12080D [Brassica napus]
Length=192

 Score = 76.6 bits (187),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 45/124 (36%), Positives = 66/124 (53%), Gaps = 9/124 (7%)
 Frame = -1

Query  405  CPKSVVQVGPNVV-GNTVTFSPVNPKDVVRNGTDLNVQFSGSNAGCPESTVWQITHDPED  229
            CPKSV+Q    V  G  + FSP +   ++R  TDLN +F  +       +VW + +  E 
Sbjct  63   CPKSVIQDQYEVSKGLPLEFSPSDNSRIIRVSTDLNFKFCAA-------SVWNLDNYDEM  115

Query  228  TDTTHYVVSGGVKGNPSSSTTRNWFMIVKTKNGYKFKFCPVSVCDCDPICQDIAISVESG  49
            T+   +V + GV GNP  +T  NWF I K ++ YK  FCP     C  +C+D+ + V+ G
Sbjct  116  TNQ-WFVTACGVAGNPGQATVDNWFKIEKYQDDYKIVFCPTVCNFCKVMCRDVGVFVQDG  174

Query  48   HRLL  37
             R L
Sbjct  175  MRRL  178



>gb|ADW95380.1| Kunitz-type trypsin inhibitor [Populus nigra]
Length=210

 Score = 77.0 bits (188),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 50/121 (41%), Positives = 66/121 (55%), Gaps = 8/121 (7%)
 Frame = -1

Query  366  GNTVTFSPVN-PKDVVRNGTDLNVQFSGSNAGCPESTVWQITHDPEDTDTTHYVVSGGVK  190
            G  + F P N  K V+R  TDLN++F G  A C  + VW++    E T +  ++ + GV+
Sbjct  86   GLPLQFIPANRKKGVIRLSTDLNIKFPGP-ASCAATAVWKVEKYDELT-SQMFISTSGVE  143

Query  189  GNPSSSTTRNWFMIVKTKNGYKFKFCPVSVCD--CDPICQDIAISV--ESGHRLLDVDVS  22
            GNP   T  NWF I K  N YK  FCP +VC+  C  +C+DI I V  E   RL   DV 
Sbjct  144  GNPGPETVDNWFKIEKYGNDYKLVFCP-TVCNDHCKVLCKDIGIYVDKEGFKRLALSDVP  202

Query  21   L  19
            L
Sbjct  203  L  203



>ref|XP_002305034.2| hypothetical protein POPTR_0004s06610g [Populus trichocarpa]
 gb|EEE85545.2| hypothetical protein POPTR_0004s06610g [Populus trichocarpa]
Length=207

 Score = 76.6 bits (187),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 50/121 (41%), Positives = 66/121 (55%), Gaps = 8/121 (7%)
 Frame = -1

Query  366  GNTVTFSPVN-PKDVVRNGTDLNVQFSGSNAGCPESTVWQITHDPEDTDTTHYVVSGGVK  190
            G  + F P N  K V+R  TDLN++F G  A C  + VW++    E T +  ++ + GV+
Sbjct  83   GLPLQFIPANRKKGVIRLSTDLNIKFPGP-ASCAATAVWKVEKYDELT-SQMFISTSGVE  140

Query  189  GNPSSSTTRNWFMIVKTKNGYKFKFCPVSVCD--CDPICQDIAISV--ESGHRLLDVDVS  22
            GNP   T  NWF I K  N YK  FCP +VC+  C  +C+DI I V  E   RL   DV 
Sbjct  141  GNPGPETVDNWFKIEKYGNDYKLVFCP-TVCNDHCKVLCKDIGIYVDKEGFKRLALSDVP  199

Query  21   L  19
            L
Sbjct  200  L  200



>gb|KFK31885.1| hypothetical protein AALP_AA6G171300 [Arabis alpina]
Length=192

 Score = 76.3 bits (186),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 48/125 (38%), Positives = 67/125 (54%), Gaps = 11/125 (9%)
 Frame = -1

Query  405  CPKSVVQVGPNVV-GNTVTFSPVNPKDVVRNGTDLNVQFSGSNAGCPESTVWQITHDPED  229
            CP +V Q    V  G  + FSP      +R  TDLN  FS        +T+W++ +  E 
Sbjct  63   CPNTVHQDQNEVSEGKPLNFSPSVKSRFIRVSTDLNFMFS-------LATIWKLENMDER  115

Query  228  TDTTHYVVSGGVKGNPSSSTTRNWFMIVKTKNGYKFKFCPVSVCD-CDPICQDIAISVES  52
            T+ T ++ + GV GNP  +T  NW  I K +  YK +FCP +VCD C  IC++I + VE 
Sbjct  116  TNQT-FISTCGVAGNPGQTTISNWIKIDKFEGAYKIRFCP-TVCDFCRVICRNIGVFVEG  173

Query  51   GHRLL  37
            G R L
Sbjct  174  GKRSL  178



>ref|XP_006477858.1| PREDICTED: 21 kDa seed protein-like isoform X1 [Citrus sinensis]
 ref|XP_006477859.1| PREDICTED: 21 kDa seed protein-like isoform X2 [Citrus sinensis]
Length=213

 Score = 76.3 bits (186),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 43/128 (34%), Positives = 72/128 (56%), Gaps = 10/128 (8%)
 Frame = -1

Query  405  CPKSVVQVGPNVV-GNTVTFSPVNPKDVVRNGTDLNVQFSGSNAGCPESTVWQI-THDPE  232
            CP  V+Q+  ++  G  + F+  N   ++    DLNV+FS +   C E TVW++  +DP 
Sbjct  66   CPLDVIQLSSDLRRGTRLRFATYNNTRIIHENVDLNVRFSTATR-CNEPTVWKVDNYDP-  123

Query  231  DTDTTHYVVSGGVKGNPSSSTTRNWF---MIVKTKNGYKFKFCPVSVCD-CDPICQDIAI  64
             +    ++ +GG++GNP + T +NWF    I + ++ YK   CP SVC+ C  +C D+ +
Sbjct  124  -SRGKWFITTGGIEGNPGAQTLKNWFKFERIGRDRDAYKIVHCP-SVCESCVSLCNDVGV  181

Query  63   SVESGHRL  40
            S +   RL
Sbjct  182  SYDDNRRL  189



>ref|XP_003548288.1| PREDICTED: miraculin-like [Glycine max]
Length=200

 Score = 75.9 bits (185),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 51/125 (41%), Positives = 68/125 (54%), Gaps = 7/125 (6%)
 Frame = -1

Query  405  CPKSVVQVGPNVVGNTVTFSPVN-PKDVVRNGTDLNVQFSGSNAGCPESTVWQITHDPED  229
            CP  VV V     G  + F+PVN  K V+R  TDLN+ F   +  CP +  W++  D + 
Sbjct  65   CPLDVVAVD-GYQGQPLIFTPVNVNKGVIRVSTDLNIYFP-IDTSCPLTKAWKL-KDYDY  121

Query  228  TDTTHYVVSGGVKGNPSSSTTRNWFMIVKTKNGYKFKFCPVSVC-DCDPICQDIAISVES  52
            + +  +V +GG  GNP S T  NWF I K ++ YK  +CP SVC DC   C DI I  + 
Sbjct  122  STSQWFVTTGGDFGNPGSQTLANWFKIEKYEDAYKLVYCP-SVCKDCSYPCSDIGIYQDQ  180

Query  51   -GHRL  40
             G RL
Sbjct  181  YGKRL  185



>ref|XP_004235412.1| PREDICTED: miraculin-like [Solanum lycopersicum]
Length=246

 Score = 76.3 bits (186),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 52/132 (39%), Positives = 71/132 (54%), Gaps = 5/132 (4%)
 Frame = -1

Query  393  VVQVGPNVVGNTVTFSPVNP-KDVVRNGTDLNVQFSGSNAGCPESTVWQITHDPEDTDTT  217
            V Q   + VG ++ F+PV+  +++VR  TDLNV+F         STVW I  +       
Sbjct  71   VTQNAQSSVGKSLRFTPVDANENIVRLSTDLNVKFMNIIFSDNMSTVWTI--NTRLIPQR  128

Query  216  HYVVSGGVKGNPSSSTTRNWFMIVKTKNGYKFKFCPVSVCD-CDPICQDIAISVESGHRL  40
            + V  GGV+GNP   T  NWF I K +  YKF +CP  VC+ C P C DI I VE  ++ 
Sbjct  129  NLVSVGGVEGNPGRDTLGNWFKIDKYEEAYKFVYCP-GVCETCRPFCGDIGILVEPNNKR  187

Query  39   LDVDVSLPPLEV  4
            +    S  PL+V
Sbjct  188  VLFVGSDKPLKV  199



>gb|AAL85660.1| trypsin inhibitor [Theobroma sylvestre]
Length=153

 Score = 75.1 bits (183),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 52/117 (44%), Positives = 67/117 (57%), Gaps = 6/117 (5%)
 Frame = -1

Query  405  CPKSVVQVGPNVVGNTVTFSPVNPKD-VVRNGTDLNVQFSG-SNAGCPESTVWQITHDPE  232
            CP+ VVQ G N  G  V FS  + KD VVR  TD+N++F    +  C  STVW++ +   
Sbjct  39   CPEIVVQRGFNDDGIPVIFSNADGKDGVVRLSTDVNIEFVPIRDRLCLTSTVWKLDNYDH  98

Query  231  DTDTTHYVVSGGVKGNPSSSTTRNWFMIVKTKN-GYKFKFCPVSVCD-CDPICQDIA  67
             T    +V + GVKGNP  +T  +WF I      GYKF+FCP SVCD C  +C DI 
Sbjct  99   STGK-WWVTTDGVKGNPGHTTLTSWFKIENAGALGYKFRFCP-SVCDSCATLCSDIG  153



>pdb|3IIR|A Chain A, Crystal Structure Of Miraculin Like Protein From Seeds 
Of Mu Koenigii
 pdb|3IIR|B Chain B, Crystal Structure Of Miraculin Like Protein From Seeds 
Of Mu Koenigii
 pdb|3ZC8|A Chain A, Crystal Structure Of Murraya Koenigii Miraculin-like 
Protein At 2.2 A Resolution At Ph 7.0
 pdb|3ZC9|A Chain A, Crystal Structure Of Murraya Koenigii Miraculin-like 
Protein At 2.2 A Resolution At Ph 4.6
Length=190

 Score = 75.5 bits (184),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 46/128 (36%), Positives = 72/128 (56%), Gaps = 10/128 (8%)
 Frame = -1

Query  405  CPKSVVQVGPNV-VGNTVTFSPVNPKDVVRNGTDLNVQFSGSNAGCPESTVWQI-THDPE  232
            CP  V+Q+ P++  G  + F+  N   ++    DLNV+FS +   C E TVW++  +DP 
Sbjct  41   CPLDVIQLSPDLHKGTRLRFAAYNNTSIIHEAVDLNVKFS-TETSCNEPTVWRVDNYDP-  98

Query  231  DTDTTHYVVSGGVKGNPSSSTTRNWFMI--VKTKNG-YKFKFCPVSVC-DCDPICQDIAI  64
             +    ++ +GGV+GNP + T +NWF +  V T  G Y+   CP SVC  C  +C D+ +
Sbjct  99   -SRGKWFITTGGVEGNPGAQTLKNWFKLERVGTDQGTYEIVHCP-SVCKSCVFLCNDVGV  156

Query  63   SVESGHRL  40
            S +   RL
Sbjct  157  SYDYRRRL  164



>gb|ACS37303.1| trypsin inhibitor [Murraya koenigii]
 gb|ACS37304.1| trypsin inhibitor [Murraya koenigii]
Length=215

 Score = 75.5 bits (184),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 46/128 (36%), Positives = 72/128 (56%), Gaps = 10/128 (8%)
 Frame = -1

Query  405  CPKSVVQVGPNV-VGNTVTFSPVNPKDVVRNGTDLNVQFSGSNAGCPESTVWQI-THDPE  232
            CP  V+Q+ P++  G  + F+  N   ++    DLNV+FS +   C E TVW++  +DP 
Sbjct  66   CPLDVIQLSPDLHKGTRLRFAAYNNTSIIHEAVDLNVKFS-TETSCNEPTVWRVDNYDP-  123

Query  231  DTDTTHYVVSGGVKGNPSSSTTRNWFMI--VKTKNG-YKFKFCPVSVC-DCDPICQDIAI  64
             +    ++ +GGV+GNP + T +NWF +  V T  G Y+   CP SVC  C  +C D+ +
Sbjct  124  -SRGKWFITTGGVEGNPGAQTLKNWFKLERVGTDQGTYEIVHCP-SVCKSCVFLCNDVGV  181

Query  63   SVESGHRL  40
            S +   RL
Sbjct  182  SYDYRRRL  189



>gb|AAL85640.1| trypsin inhibitor [Herrania albiflora]
 gb|AAL85641.1| trypsin inhibitor [Herrania sp. 'Columbia']
Length=154

 Score = 74.7 bits (182),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 50/118 (42%), Positives = 69/118 (58%), Gaps = 7/118 (6%)
 Frame = -1

Query  405  CPKSVVQVGPNVV-GNTVTFSPVNPKD-VVRNGTDLNVQFSG-SNAGCPESTVWQITHDP  235
            CP+ VVQ   ++  G  V FS  + +D VVR  TDLN++F    +  C  STVW++  D 
Sbjct  39   CPEIVVQRRSDLDDGTPVIFSNADSEDDVVRVSTDLNIEFVPIRDRLCSTSTVWKL-DDY  97

Query  234  EDTDTTHYVVSGGVKGNPSSSTTRNWFMIVKTKN-GYKFKFCPVSVCD-CDPICQDIA  67
            +++    +V + GVKG P + T  +WF I      GYKF+FCP SVCD C P+C DI 
Sbjct  98   DNSAGKWWVTTDGVKGEPGARTLTSWFKIESAGALGYKFRFCP-SVCDSCAPLCSDIG  154



>gb|KFK42291.1| hypothetical protein AALP_AA2G236700 [Arabis alpina]
Length=192

 Score = 75.1 bits (183),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 48/125 (38%), Positives = 69/125 (55%), Gaps = 11/125 (9%)
 Frame = -1

Query  405  CPKSVVQVGPNVV-GNTVTFSPVNPKDVVRNGTDLNVQFSGSNAGCPESTVWQITHDPED  229
            CP +V Q    V  G  + FSP      +R  TDLN  FS        +T+W++ +  + 
Sbjct  63   CPNTVHQDQNEVSEGIPLNFSPSVKSRFIRVSTDLNFMFS-------LATIWKLENMDQR  115

Query  228  TDTTHYVVSGGVKGNPSSSTTRNWFMIVKTKNGYKFKFCPVSVCD-CDPICQDIAISVES  52
            T+ T ++ + GV GNP  +T  NWF I K ++ YK +FCP +VCD C  IC++I + VE 
Sbjct  116  TNQT-FISTCGVGGNPGQTTISNWFKIDKFEDDYKIRFCP-TVCDFCRVICRNIGVFVEG  173

Query  51   GHRLL  37
            G R L
Sbjct  174  GKRSL  178



>gb|AEK26927.1| Kunitz-type trypsin inhibitor B4 [Populus nigra]
Length=211

 Score = 75.1 bits (183),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 49/121 (40%), Positives = 66/121 (55%), Gaps = 8/121 (7%)
 Frame = -1

Query  366  GNTVTFSPVN-PKDVVRNGTDLNVQFSGSNAGCPESTVWQITHDPEDTDTTHYVVSGGVK  190
            G  + F P N  K V+R  TDLN++F G  A C  + VW++    + T +  ++ + GV+
Sbjct  87   GLPLQFIPANRKKGVIRLSTDLNIKFPGP-ASCAATAVWKVEKYDKLT-SQMFISTSGVE  144

Query  189  GNPSSSTTRNWFMIVKTKNGYKFKFCPVSVCD--CDPICQDIAISV--ESGHRLLDVDVS  22
            GNP   T  NWF I K  N YK  FCP +VC+  C  +C+DI I V  E   RL   DV 
Sbjct  145  GNPGPETVDNWFKIEKYGNDYKLVFCP-TVCNDHCKVLCKDIGIYVDKEGFKRLALSDVP  203

Query  21   L  19
            L
Sbjct  204  L  204



>ref|XP_011035408.1| PREDICTED: miraculin-like [Populus euphratica]
Length=206

 Score = 74.7 bits (182),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 48/127 (38%), Positives = 70/127 (55%), Gaps = 7/127 (6%)
 Frame = -1

Query  405  CPKSVVQVG-PNVVGNTVTFSPVN-PKDVVRNGTDLNVQFSGSNAGCPESTVWQITHDPE  232
            CP  V+Q    +  G  + F P N  K V+R  TDLN++F G+ A C  + VW++    E
Sbjct  69   CPVDVMQEDYEDSDGLPLQFIPANRKKGVIRLSTDLNIKFPGT-ASCAPTAVWKVEKYDE  127

Query  231  DTDTTHYVVSGGVKGNPSSSTTRNWFMIVKTKNGYKFKFCPVSVCD--CDPICQDIAISV  58
             T    ++ + GV+GNP   T  NWF I K  N YK  FCP +VC+  C  +C+DI I V
Sbjct  128  LTGQM-FISTSGVEGNPGPETVDNWFKIEKYGNDYKLVFCP-TVCNDHCKVLCKDIGIYV  185

Query  57   ESGHRLL  37
            +   +++
Sbjct  186  QEVLKII  192



>ref|XP_003620174.1| Pathogen-inducible trypsin-inhibitor-like protein [Medicago truncatula]
 gb|AES76392.1| Kunitz type trypsin inhibitor / miraculin [Medicago truncatula]
Length=213

 Score = 74.7 bits (182),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 47/122 (39%), Positives = 67/122 (55%), Gaps = 7/122 (6%)
 Frame = -1

Query  357  VTFSPVNPKD-VVRNGTDLNVQFSGSNAGCPESTVWQITHDPEDTDTTHYVVS-GGVKGN  184
            +TF PVNPK  V+R  TDLN++FS        S VW++  D  +     + ++ GGV GN
Sbjct  92   LTFIPVNPKKGVIRVSTDLNIKFSSRATCLHHSMVWKL--DRFNVSKRQWFITIGGVAGN  149

Query  183  PSSSTTRNWFMIVKTKNGYKFKFCPVSVCDCDPICQDIAISV-ESGHRLLDVDVSLPPLE  7
            P   T  NWF I K  + YK  FCP  V     +C+D+ + V E+G++ L   +S  PL+
Sbjct  150  PGWETINNWFKIEKYGDAYKLVFCPSVVQSFKHMCKDVGVFVDENGNKRL--ALSDVPLK  207

Query  6    VN  1
            V 
Sbjct  208  VK  209



>ref|XP_003620175.1| Pathogen-inducible trypsin-inhibitor-like protein [Medicago truncatula]
 gb|AAT45389.1| pathogen-inducible trypsin-inhibitor-like protein [Medicago truncatula]
 gb|AES76393.1| Kunitz type trypsin inhibitor / miraculin [Medicago truncatula]
Length=213

 Score = 74.7 bits (182),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 47/122 (39%), Positives = 67/122 (55%), Gaps = 7/122 (6%)
 Frame = -1

Query  357  VTFSPVNPKD-VVRNGTDLNVQFSGSNAGCPESTVWQITHDPEDTDTTHYVVS-GGVKGN  184
            +TF PVNPK  V+R  TDLN++FS        S VW++  D  +     + ++ GGV GN
Sbjct  92   LTFIPVNPKKGVIRVSTDLNIKFSSRATCLHHSMVWKL--DRFNVSKRQWFITIGGVAGN  149

Query  183  PSSSTTRNWFMIVKTKNGYKFKFCPVSVCDCDPICQDIAISV-ESGHRLLDVDVSLPPLE  7
            P   T  NWF I K  + YK  FCP  V     +C+D+ + V E+G++ L   +S  PL+
Sbjct  150  PGWETINNWFKIEKYGDAYKLVFCPSVVQSFKHMCKDVGVFVDENGNKRL--ALSDVPLK  207

Query  6    VN  1
            V 
Sbjct  208  VK  209



>ref|XP_010683194.1| PREDICTED: miraculin-like [Beta vulgaris subsp. vulgaris]
Length=208

 Score = 74.3 bits (181),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 53/134 (40%), Positives = 69/134 (51%), Gaps = 12/134 (9%)
 Frame = -1

Query  405  CPKS-VVQVGPNVV-GNTVTFSPVNPKD-VVRNGTDLNVQFSGSNAGCPESTVWQITHDP  235
            CP + V Q G  +  G  + F PVNPKD  +   TDLN  F  +   C +ST W++  D 
Sbjct  68   CPLAYVAQEGSELANGLPLKFYPVNPKDKTISLSTDLNFVFDAATI-CVQSTQWRLAFD-  125

Query  234  EDTDTTHYVVSGGVKGNPSSSTTRNWFMIVKTKNG---YKFKFCPVSVCD-CDPICQDIA  67
             +     YV  GG  GNP  +T  NWF I K + G   YK  FCP  VC+ C   C +I 
Sbjct  126  -EVTGRRYVGFGGEIGNPGGNTVSNWFKIEKAETGKYDYKIVFCP-GVCNFCKVACGEIG  183

Query  66   ISVES-GHRLLDVD  28
            + VE  G RLL ++
Sbjct  184  VFVEKDGRRLLGIN  197



>gb|KFK42292.1| hypothetical protein AALP_AA2G236900 [Arabis alpina]
Length=194

 Score = 73.9 bits (180),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 46/125 (37%), Positives = 66/125 (53%), Gaps = 12/125 (10%)
 Frame = -1

Query  405  CPKSVVQVGPNVV-GNTVTFSPVNPKDVVRNGTDLNVQFSGSNAGCPESTVWQITHDPED  229
            CP +V+Q    V  G  + FSP +   ++R   DLN  FS        +++W++  D ++
Sbjct  66   CPNNVIQDRYEVSNGLPLKFSPADSSKIIRVSADLNFIFS-------PTSIWKL--DSDE  116

Query  228  TDTTHYVVSGGVKGNPSSSTTRNWFMIVKTKNGYKFKFCPVSVCD-CDPICQDIAISVES  52
            T    +V + G  GNP   T  NWF I K +N YK  FCP SVC+ C  IC D+ + V+ 
Sbjct  117  TTNQRFVSTCGRAGNPGRETVSNWFRIDKFENDYKIVFCP-SVCNICRVICGDVGVFVQG  175

Query  51   GHRLL  37
            G R L
Sbjct  176  GKRSL  180



>gb|ABK01288.1| miraculin-like protein [Coffea arabica]
Length=214

 Score = 73.9 bits (180),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 50/120 (42%), Positives = 69/120 (58%), Gaps = 10/120 (8%)
 Frame = -1

Query  405  CPKSVVQVGPNVVGNTVTFSPVNPKD-VVRNGTDLNVQFSGSNAG--CPESTVWQITHDP  235
            CP +V Q      G  VTF+PVNP++ VVR  TDLN++F+    G  C  S VW++  + 
Sbjct  64   CPLAVAQAWLQR-GLPVTFTPVNPEEGVVRVSTDLNIKFAEPPVGRICSGSNVWKVHFN-  121

Query  234  EDTDTTHYVVSGGVKGNPSSSTTRNWFMIVKTKN-GYKFKFCPVSVCD--CDPICQDIAI  64
             D    H+V++ GV+GN    TT NWF I    + GYK  FCP +VCD   + IC+ + I
Sbjct  122  -DLFEKHFVLTDGVEGNSGCGTTANWFKIEAVGDRGYKLVFCP-TVCDSSSEAICKYVGI  179



>ref|XP_010041216.1| PREDICTED: miraculin-like [Eucalyptus grandis]
Length=175

 Score = 73.6 bits (179),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 42/104 (40%), Positives = 55/104 (53%), Gaps = 4/104 (4%)
 Frame = -1

Query  339  NPKDVVRNGTDLNVQFSGSNAGCPESTVWQITHDPEDTDTTHYVVSGGVKGNPSSSTTRN  160
             P   +R  TDLNV    +   C  STVW++    E+    ++V SGGV GNP   T  N
Sbjct  48   RPAGPIRLSTDLNVWLDAAKI-CMHSTVWRLGAYNEEVKQ-YFVESGGVLGNPGRETISN  105

Query  159  WFMIVKTKNGYKFKFCPVSVCD-CDPICQDIAISVESGHRLLDV  31
            WF I K    YK  FCP +VCD C  IC+D+ + V+   R L +
Sbjct  106  WFKIEKVDEDYKLVFCP-TVCDTCKVICRDVGVYVDGATRRLAL  148



>ref|NP_173228.1| kunitz family trypsin and protease inhibitor protein [Arabidopsis 
thaliana]
 gb|AAF97266.1|AC034106_9 Contains similarity to a tumor-related protein from Nicotiana 
tabacum gb|U66263 and contains a trypsin and protease inhibitor 
PF|00197 domain. ESTs gb|AV561824, gb|T44961, gb|H36186, 
gb|T45060, gb|N38006, gb|F19847 come from this gene [Arabidopsis 
thaliana]
 gb|AAG48779.1|AF332416_1 putative lemir (miraculin) protein [Arabidopsis thaliana]
 gb|AAK48962.1|AF370535_1 Unknown protein [Arabidopsis thaliana]
 gb|AAK95260.1|AF410274_1 At1g17860/F2H15_8 [Arabidopsis thaliana]
 gb|AAM10091.1| unknown protein [Arabidopsis thaliana]
 gb|AAM19885.1| At1g17860/F2H15_8 [Arabidopsis thaliana]
 gb|AEE29645.1| kunitz type trypsin and protease inhibitor domain-containing 
protein [Arabidopsis thaliana]
Length=196

 Score = 73.6 bits (179),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 49/136 (36%), Positives = 75/136 (55%), Gaps = 13/136 (10%)
 Frame = -1

Query  405  CPKSVVQVGPNVV-GNTVTFSPVNPKDVVRNGTDLNVQFSGSNAGCPESTVWQITHDPED  229
            CP SV+Q    V  G  V FSP +    +   TD+N++FS        +++W++ +  E 
Sbjct  66   CPTSVIQDQFEVSQGLPVKFSPYDKSRTIPVSTDVNIKFS-------PTSIWELANFDET  118

Query  228  TDTTHYVVSGGVKGNPSSSTTRNWFMIVKTKNGYKFKFCPVSVCD-CDPICQDIAISVES  52
            T    ++ + GV+GNP   T  NWF I K +  YK +FCP +VC+ C  IC+D+ + V+ 
Sbjct  119  TKQ-WFISTCGVEGNPGQKTVDNWFKIDKFEKDYKIRFCP-TVCNFCKVICRDVGVFVQD  176

Query  51   GHRLLDVDVSLPPLEV  4
            G R L   +S  PL+V
Sbjct  177  GKRRL--ALSDVPLKV  190



>ref|XP_009782172.1| PREDICTED: miraculin-like [Nicotiana sylvestris]
Length=252

 Score = 73.6 bits (179),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 47/127 (37%), Positives = 68/127 (54%), Gaps = 7/127 (6%)
 Frame = -1

Query  375  NVVGNTVTFSPVNP-KDVVRNGTDLNVQFSGSNAGCPESTVWQITHDPEDTDTTHYVVSG  199
            +++  +  FSP N  ++ ++  TDLN++F+        S VW+I  + E     + V  G
Sbjct  82   SIISISTQFSPANSNENTIKISTDLNIKFTSEITLSNSSNVWRI--NTELIPQRYLVTVG  139

Query  198  GVKGNPSSSTTRNWFMIVKTKNGYKFKFCPVSVCD--CDPICQDIAISVESGHRLLDVDV  25
            GV+GNP   T  NWF I K ++ YK  +CP  VC+    P C DI I VE   R+L V  
Sbjct  140  GVEGNPGRETLSNWFKIDKYEDAYKLVYCP-GVCETCSRPFCGDIGILVEGNERVLFVG-  197

Query  24   SLPPLEV  4
            S  PL+V
Sbjct  198  SDKPLKV  204



>gb|AAL85644.1| trypsin inhibitor [Theobroma subincanum]
Length=154

 Score = 72.8 bits (177),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 50/118 (42%), Positives = 70/118 (59%), Gaps = 7/118 (6%)
 Frame = -1

Query  405  CPKSVVQVGPNVVGNT-VTFSPVNPKD-VVRNGTDLNVQFSG-SNAGCPESTVWQITHDP  235
            CP+ VVQ   ++   T V FS  + +D VVR  TD+N++F    +  C  STVW++  D 
Sbjct  39   CPEIVVQRRSDLDNGTPVIFSNADSEDDVVRVSTDINIEFVPIRDRLCSTSTVWKL-DDY  97

Query  234  EDTDTTHYVVSGGVKGNPSSSTTRNWFMIVKT-KNGYKFKFCPVSVCD-CDPICQDIA  67
            +++    +V +GGVKG P  +T  NWF I +   N YKF+FCP SVCD C  +C DI 
Sbjct  98   DNSAGKWWVTTGGVKGEPGPNTLSNWFKIEEAGGNVYKFRFCP-SVCDSCATLCSDIG  154



>gb|AAL85659.1| trypsin inhibitor [Theobroma speciosum]
Length=153

 Score = 72.8 bits (177),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 50/117 (43%), Positives = 67/117 (57%), Gaps = 6/117 (5%)
 Frame = -1

Query  405  CPKSVVQVGPNVVGNTVTFSPVNPKD-VVRNGTDLNVQFSG-SNAGCPESTVWQITHDPE  232
            CP+ VVQ G N  G  V FS  + KD VVR  +D+N++F    +  C  STVW++ +   
Sbjct  39   CPEIVVQRGSNDDGIPVIFSNADDKDGVVRLSSDVNIEFVPIRDRLCLTSTVWKLDNYDH  98

Query  231  DTDTTHYVVSGGVKGNPSSSTTRNWFMIVKTK-NGYKFKFCPVSVCD-CDPICQDIA  67
             T    +V + GVKG P  +T  +WF + K    GYKF+FCP SVCD C  +C DI 
Sbjct  99   STGK-WWVTTDGVKGEPGHTTLTSWFKVEKAGVLGYKFRFCP-SVCDSCITLCSDIG  153



>ref|XP_003622420.1| Endopeptidase inhibitor [Medicago truncatula]
 gb|AES78638.1| Nodule Cysteine-Rich (NCR) secreted peptide [Medicago truncatula]
Length=205

 Score = 73.2 bits (178),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 46/123 (37%), Positives = 66/123 (54%), Gaps = 8/123 (7%)
 Frame = -1

Query  405  CPKSVVQVGPNVVGNTVTFSPVN-PKDVVRNGTDLNVQFSG-SNAGCPESTVWQITHDPE  232
            CP  VV+    +     +F P N  K V+R  TDLNV  S  +N      TVW++  D  
Sbjct  67   CPLDVVEEEEAM---QFSFVPFNFKKGVIRVSTDLNVIHSFPTNCSTSSVTVWKV--DKV  121

Query  231  DTDTTH-YVVSGGVKGNPSSSTTRNWFMIVKTKNGYKFKFCPVSVCDCDPICQDIAISVE  55
            D  T+  +V +GGV+GNP   T  NWF I + ++GYK  FCP    +C+ +C+DI I ++
Sbjct  122  DVATSQRFVTTGGVQGNPGRETVDNWFKIERFESGYKLVFCPTVCRECEVVCKDIGIFLD  181

Query  54   SGH  46
               
Sbjct  182  ENR  184



>gb|AAL85648.1| trypsin inhibitor [Theobroma obovatum]
 gb|AAL85649.1| trypsin inhibitor [Theobroma obovatum]
Length=154

 Score = 72.8 bits (177),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 50/118 (42%), Positives = 70/118 (59%), Gaps = 7/118 (6%)
 Frame = -1

Query  405  CPKSVVQVGPNVVGNT-VTFSPVNPKD-VVRNGTDLNVQFSG-SNAGCPESTVWQITHDP  235
            CP+ VVQ   ++   T V FS  + +D VVR  TD+N++F    +  C  STVW++  D 
Sbjct  39   CPEIVVQRRSDLDNGTPVIFSNADSEDDVVRVSTDINIEFVPIRDRLCSTSTVWKL-DDY  97

Query  234  EDTDTTHYVVSGGVKGNPSSSTTRNWFMIVKT-KNGYKFKFCPVSVCD-CDPICQDIA  67
            +++    +V +GGVKG P  +T  NWF I +   N YKF+FCP SVCD C  +C DI 
Sbjct  98   DNSAGKWWVTTGGVKGEPGPNTLSNWFKIEEAGGNVYKFRFCP-SVCDSCATLCSDIG  154



>gb|AEK31191.1| miraculin-like protein 1 [Citrus aurantiifolia]
 gb|AEK31193.1| miraculin-like protein 1 [Citrus sinensis]
 gb|AEK31194.1| miraculin-like protein 1 [Citrus reticulata]
 gb|AEK31195.1| miraculin-like protein 1 [Murraya paniculata]
Length=172

 Score = 72.8 bits (177),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 45/128 (35%), Positives = 71/128 (55%), Gaps = 10/128 (8%)
 Frame = -1

Query  405  CPKSVVQVGPNV-VGNTVTFSPVNPKDVVRNGTDLNVQFSGSNAGCPESTVWQI-THDPE  232
            CP  V+Q+  ++  G  + F+  N   ++    DLNV+FS +   C E TVW++  +DP 
Sbjct  41   CPLDVIQLSSDLHKGTRLRFAAYNNTSIIHEAVDLNVKFS-TETSCNEPTVWRVDNYDP-  98

Query  231  DTDTTHYVVSGGVKGNPSSSTTRNWFMI--VKTKNG-YKFKFCPVSVCD-CDPICQDIAI  64
             +    ++ +GGV+GNP + T +NWF +  V T  G Y+   CP SVC  C  +C D+ +
Sbjct  99   -SRGKWFITTGGVEGNPGAQTLKNWFKLERVGTDQGTYEIVHCP-SVCKSCVFLCNDVGV  156

Query  63   SVESGHRL  40
            S +   RL
Sbjct  157  SYDYRRRL  164



>gb|AEK31190.1| miraculin-like protein 1 [Citrus limonia]
Length=172

 Score = 72.8 bits (177),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 45/128 (35%), Positives = 71/128 (55%), Gaps = 10/128 (8%)
 Frame = -1

Query  405  CPKSVVQVGPNV-VGNTVTFSPVNPKDVVRNGTDLNVQFSGSNAGCPESTVWQI-THDPE  232
            CP  V+Q+  ++  G  + F+  N   ++    DLNV+FS +   C E TVW++  +DP 
Sbjct  41   CPLDVIQLSSDLHKGTRLRFAAYNNTSIIHEAVDLNVKFS-TETSCNEPTVWRVDNYDP-  98

Query  231  DTDTTHYVVSGGVKGNPSSSTTRNWFMI--VKTKNG-YKFKFCPVSVCD-CDPICQDIAI  64
             +    ++ +GGV+GNP + T +NWF +  V T  G Y+   CP SVC  C  +C D+ +
Sbjct  99   -SRGKWFITTGGVEGNPGAQTLKNWFKLERVGTDQGTYEIVHCP-SVCKSCVFLCNDVGV  156

Query  63   SVESGHRL  40
            S +   RL
Sbjct  157  SYDYRRRL  164



>ref|XP_006441457.1| hypothetical protein CICLE_v10024528mg, partial [Citrus clementina]
 gb|ESR54697.1| hypothetical protein CICLE_v10024528mg, partial [Citrus clementina]
Length=105

 Score = 71.2 bits (173),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 40/96 (42%), Positives = 58/96 (60%), Gaps = 6/96 (6%)
 Frame = -1

Query  312  TDLNVQFSGSNAGCPESTVWQITHDPEDTDTTHYVVS-GGVKGNPSSSTTRNWFMIVKTK  136
            TDLN++F  + + C +STVW++  D  D     ++V+ GGV+GNP   T RNWF I K  
Sbjct  2    TDLNIKFDAATS-CAQSTVWKL--DNFDAAFGQWLVTTGGVEGNPGPRTMRNWFKIEKFF  58

Query  135  NGYKFKFCPVSVCD-CDPICQDIAISVESGHRLLDV  31
              YK  +CP SVC+ C  +C+D+ I +  G R L +
Sbjct  59   GDYKLVYCP-SVCNFCRGLCRDVGIFINGGVRRLAL  93



>ref|XP_006847953.1| hypothetical protein AMTR_s00029p00141480 [Amborella trichopoda]
 gb|ERN09534.1| hypothetical protein AMTR_s00029p00141480 [Amborella trichopoda]
Length=196

 Score = 72.8 bits (177),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 51/130 (39%), Positives = 70/130 (54%), Gaps = 10/130 (8%)
 Frame = -1

Query  405  CPKSVVQVGPNVVGNTVTFSPVNPKD-VVRNGTDLNVQFSGSNAGCPESTVWQITHDPED  229
            CP +V        G  VTFSPVN  D VVR   D N+QF      C +STVW+ ++  + 
Sbjct  56   CPLNVALSTGISTGLPVTFSPVNAGDKVVRLSVDQNIQFEAITI-CIQSTVWRRSNFDQV  114

Query  228  TDTTHYVVSGGVKGNPSSSTTRNWFMIVK----TKNG-YKFKFCPVSVCD-CDPICQDIA  67
            T    +V++GGV GNP  +T  NWF + +      NG YK  FCP  VCD C   C ++ 
Sbjct  115  TGI-QFVITGGVTGNPGRATVSNWFTVERESEVVNNGRYKLVFCP-GVCDICRINCGNLG  172

Query  66   ISVESGHRLL  37
            +  E+G++ L
Sbjct  173  VYEENGNKWL  182



>gb|AAL85645.1| trypsin inhibitor [Theobroma grandiflorum]
 gb|AAL85646.1| trypsin inhibitor [Theobroma grandiflorum]
 gb|AAL85647.1| trypsin inhibitor [Theobroma grandiflorum]
Length=154

 Score = 72.4 bits (176),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 49/118 (42%), Positives = 70/118 (59%), Gaps = 7/118 (6%)
 Frame = -1

Query  405  CPKSVVQVGPNVVGNT-VTFSPVNPKD-VVRNGTDLNVQFSG-SNAGCPESTVWQITHDP  235
            CP+ V+Q   ++   T V FS  + +D VVR  TD+N++F    +  C  STVW++  D 
Sbjct  39   CPEIVIQRRSDLDNGTPVIFSNADSEDDVVRVSTDINIEFVPIRDRLCSTSTVWKL-DDY  97

Query  234  EDTDTTHYVVSGGVKGNPSSSTTRNWFMIVKT-KNGYKFKFCPVSVCD-CDPICQDIA  67
            +++    +V +GGVKG P  +T  NWF I +   N YKF+FCP SVCD C  +C DI 
Sbjct  98   DNSAGKWWVTTGGVKGEPGPNTLSNWFKIEEAGGNVYKFRFCP-SVCDSCATLCSDIG  154



>ref|XP_006442410.1| hypothetical protein CICLE_v10022211mg [Citrus clementina]
 gb|ABL67650.1| putative miraculin-like protein 2 [Citrus hybrid cultivar]
 gb|ESR55650.1| hypothetical protein CICLE_v10022211mg [Citrus clementina]
Length=213

 Score = 72.8 bits (177),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 45/128 (35%), Positives = 71/128 (55%), Gaps = 10/128 (8%)
 Frame = -1

Query  405  CPKSVVQVGPNV-VGNTVTFSPVNPKDVVRNGTDLNVQFSGSNAGCPESTVWQI-THDPE  232
            CP  VVQ+  +   G  + FS  +   ++    DLNV+FS +   C E TVW++ ++DP 
Sbjct  66   CPLDVVQLSSDSERGTRLRFSMSDKTSIINEDVDLNVRFS-TETRCNEPTVWRVDSYDP-  123

Query  231  DTDTTHYVVSGGVKGNPSSSTTRNWF---MIVKTKNGYKFKFCPVSVCD-CDPICQDIAI  64
             +    ++ +GGV+GNP + T +NWF    I + +  YK   CP SVC+ C  +C D+ +
Sbjct  124  -SRGKWFITTGGVEGNPGAQTLKNWFKFERIGRDRATYKIVHCP-SVCESCVSLCNDVGV  181

Query  63   SVESGHRL  40
            S +   RL
Sbjct  182  SNDHARRL  189



>gb|AAL85661.1| trypsin inhibitor [Theobroma bicolor]
Length=154

 Score = 72.0 bits (175),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 48/118 (41%), Positives = 68/118 (58%), Gaps = 7/118 (6%)
 Frame = -1

Query  405  CPKSVVQVGPNV-VGNTVTFSPVNPKDV-VRNGTDLNVQFS-GSNAGCPESTVWQITHDP  235
            CP  VVQ   ++  G  V FSPV P D+ +R  TDLN++F+   ++ C  + VW++  D 
Sbjct  39   CPDIVVQRRSDLDYGIPVIFSPVKPNDIFIRVSTDLNIEFTPLRDSLCLTTAVWKL-DDY  97

Query  234  EDTDTTHYVVSGGVKGNPSSSTTRNWFMIVKTK-NGYKFKFCPVSVCD-CDPICQDIA  67
            + +    +V++GGV G+    T  NWF I K    GYKF +CP SVCD C  +C DI 
Sbjct  98   DQSTGKWWVIAGGVAGDAGPHTLPNWFKIEKNGVLGYKFIYCP-SVCDSCTTLCSDIG  154



>emb|CDP20533.1| unnamed protein product [Coffea canephora]
Length=214

 Score = 72.4 bits (176),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 49/133 (37%), Positives = 66/133 (50%), Gaps = 5/133 (4%)
 Frame = -1

Query  405  CPKSVVQ-VGPNVVGNTVTFSPVNPKD-VVRNGTDLNVQFSGSNAGCPESTVWQITHDPE  232
            CP +V Q       G  + F PVNPK  VVR  TDLN++F+     C +S VW I +   
Sbjct  76   CPAAVFQETSEQKNGIPLAFLPVNPKKGVVRVSTDLNIKFAYPET-CGQSPVWSIDNYVY  134

Query  231  DTDTTHYVVSGGVKGNPSSSTTRNWFMIVKT-KNGYKFKFCPVSVCDCDPICQDIAISVE  55
             +  + +V  GGV GNP   T  +WF I K     YK  +CP     C  IC+D+ I  +
Sbjct  135  PSGDS-FVNIGGVVGNPGPKTLSSWFKIEKFGYQDYKLVYCPAVCSYCKVICKDVGIEYQ  193

Query  54   SGHRLLDVDVSLP  16
            +G R L +    P
Sbjct  194  NGKRRLHLTTDYP  206



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 506499748756