BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c9932_g1_i1 len=1618 path=[49:0-839 888:840-998 48:999-1617]

Length=1618
                                                                      Score     E

ref|XP_009599917.1|  PREDICTED: WAT1-related protein At1g70260-like     473   2e-160   
ref|XP_009629015.1|  PREDICTED: WAT1-related protein At1g70260-like     471   5e-159   
ref|XP_009790538.1|  PREDICTED: WAT1-related protein At1g70260-like     469   3e-158   
ref|XP_009765301.1|  PREDICTED: WAT1-related protein At1g70260-like     462   4e-156   
ref|XP_006355961.1|  PREDICTED: WAT1-related protein At1g70260-like     452   5e-152   
ref|XP_004238693.1|  PREDICTED: WAT1-related protein At1g70260          445   2e-149   
ref|XP_010319590.1|  PREDICTED: WAT1-related protein At1g70260-like     443   1e-148   
ref|XP_011071064.1|  PREDICTED: WAT1-related protein At1g70260          417   2e-138   
gb|EYU22474.1|  hypothetical protein MIMGU_mgv1a022660mg                372   2e-120   
gb|EYU22473.1|  hypothetical protein MIMGU_mgv1a008125mg                370   7e-120   
emb|CDP00196.1|  unnamed protein product                                350   4e-112   
ref|XP_002315812.2|  nodulin MtN21 family protein                       342   2e-109   Populus trichocarpa [western balsam poplar]
ref|XP_011021652.1|  PREDICTED: WAT1-related protein At1g70260-like     341   1e-108   
ref|XP_010653180.1|  PREDICTED: WAT1-related protein At1g70260          318   6e-100   
gb|KDP21317.1|  hypothetical protein JCGZ_21788                         318   1e-99    
ref|XP_007044600.1|  Nodulin MtN21 /EamA-like transporter family ...    311   4e-97    
emb|CDX68349.1|  BnaA07g23890D                                          310   2e-96    
ref|XP_009104959.1|  PREDICTED: WAT1-related protein At1g70260 is...    308   4e-96    
emb|CDY03759.1|  BnaA02g14780D                                          308   8e-96    
emb|CDY42998.1|  BnaC02g19720D                                          307   2e-95    
emb|CDY23506.1|  BnaC06g24750D                                          305   9e-95    
ref|XP_006390904.1|  hypothetical protein EUTSA_v10018724mg             305   1e-94    
ref|XP_010415702.1|  PREDICTED: WAT1-related protein At1g70260          304   2e-94    
ref|XP_009127782.1|  PREDICTED: WAT1-related protein At1g70260          304   3e-94    
ref|XP_010471020.1|  PREDICTED: WAT1-related protein At1g70260-like     304   3e-94    
ref|XP_009104958.1|  PREDICTED: WAT1-related protein At1g70260 is...    304   3e-94    
ref|XP_006302413.1|  hypothetical protein CARUB_v10020485mg             303   4e-94    
ref|XP_010512104.1|  PREDICTED: WAT1-related protein At1g70260-li...    301   3e-93    
ref|XP_011087082.1|  PREDICTED: WAT1-related protein At1g70260-like     296   4e-93    
emb|CAN71720.1|  hypothetical protein VITISV_034107                     299   1e-92    Vitis vinifera
ref|XP_009105695.1|  PREDICTED: WAT1-related protein At1g70260-like     299   2e-92    
ref|XP_010100503.1|  Auxin-induced protein 5NG4                         299   2e-92    
emb|CDY38802.1|  BnaA07g28740D                                          299   2e-92    
ref|XP_004297654.1|  PREDICTED: auxin-induced protein 5NG4-like         299   3e-92    
gb|KFK41447.1|  hypothetical protein AALP_AA2G131700                    299   3e-92    
ref|XP_006483799.1|  PREDICTED: WAT1-related protein At1g70260-like     298   5e-92    
gb|KHG22950.1|  Auxin-induced 5NG4                                      296   9e-92    
ref|XP_009104960.1|  PREDICTED: WAT1-related protein At1g70260 is...    297   2e-91    
ref|XP_002888762.1|  nodulin MtN21 family protein                       296   3e-91    
ref|NP_177183.2|  nodulin MtN21-like transporter UMAMIT36               295   6e-91    Arabidopsis thaliana [mouse-ear cress]
emb|CDY11606.1|  BnaC06g31330D                                          296   6e-90    
gb|KGN51825.1|  Nodulin MtN21 family protein                            290   8e-89    
ref|XP_004135476.1|  PREDICTED: auxin-induced protein 5NG4-like         290   9e-89    
ref|XP_006390906.1|  hypothetical protein EUTSA_v10018689mg             287   2e-87    
ref|XP_008446238.1|  PREDICTED: WAT1-related protein At1g70260          286   2e-87    
ref|XP_006438452.1|  hypothetical protein CICLE_v10033765mg             284   1e-86    
ref|XP_009113257.1|  PREDICTED: WAT1-related protein At1g60050          283   4e-86    
ref|XP_006392190.1|  hypothetical protein EUTSA_v10023532mg             283   4e-86    
ref|XP_006301348.1|  hypothetical protein CARUB_v10021757mg             281   2e-85    
ref|XP_008340345.1|  PREDICTED: LOW QUALITY PROTEIN: WAT1-related...    281   2e-85    
emb|CDY61698.1|  BnaCnng38340D                                          281   2e-85    
ref|XP_002886638.1|  hypothetical protein ARALYDRAFT_315326             281   3e-85    
gb|KHN23421.1|  Auxin-induced protein 5NG4                              280   3e-85    
ref|XP_008221760.1|  PREDICTED: WAT1-related protein At1g70260-like     280   5e-85    
ref|XP_003526676.1|  PREDICTED: WAT1-related protein At1g70260-like     279   8e-85    
ref|XP_010414610.1|  PREDICTED: WAT1-related protein At1g60050          279   9e-85    
gb|KCW85793.1|  hypothetical protein EUGRSUZ_B02545                     277   2e-84    
ref|XP_010510978.1|  PREDICTED: WAT1-related protein At1g60050          278   2e-84    
ref|XP_010470159.1|  PREDICTED: WAT1-related protein At1g60050-like     278   2e-84    
ref|XP_004502587.1|  PREDICTED: WAT1-related protein At1g70260-like     276   8e-84    
ref|XP_010046448.1|  PREDICTED: WAT1-related protein At1g70260-like     280   9e-84    
ref|XP_007137540.1|  hypothetical protein PHAVU_009G135300g             276   1e-83    
ref|NP_176213.1|  Nodulin MtN21 /EamA-like transporter family pro...    275   3e-83    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010543988.1|  PREDICTED: WAT1-related protein At1g60050          274   1e-82    
ref|XP_007224086.1|  hypothetical protein PRUPE_ppa015497mg             270   3e-81    
ref|XP_010551549.1|  PREDICTED: WAT1-related protein At1g70260-like     270   3e-81    
ref|XP_010533056.1|  PREDICTED: WAT1-related protein At1g70260          269   6e-81    
ref|XP_007137541.1|  hypothetical protein PHAVU_009G135400g             268   1e-80    
ref|XP_010682608.1|  PREDICTED: WAT1-related protein At1g70260-like     250   1e-73    
ref|XP_003608949.1|  Auxin-induced protein 5NG4                         248   3e-73    
ref|XP_008239731.1|  PREDICTED: WAT1-related protein At5g40240-like     248   1e-72    
ref|XP_007209260.1|  hypothetical protein PRUPE_ppa007344mg             246   3e-72    
ref|XP_004508845.1|  PREDICTED: WAT1-related protein At5g40240-like     246   3e-72    
ref|XP_010264833.1|  PREDICTED: WAT1-related protein At4g15540-like     239   7e-69    
ref|XP_002283377.1|  PREDICTED: WAT1-related protein At3g28050-like     236   3e-68    Vitis vinifera
gb|KDO38384.1|  hypothetical protein CISIN_1g041987mg                   232   5e-68    
ref|XP_011028603.1|  PREDICTED: LOW QUALITY PROTEIN: WAT1-related...    231   1e-66    
emb|CBI32105.3|  unnamed protein product                                226   6e-66    
ref|XP_004300887.1|  PREDICTED: auxin-induced protein 5NG4-like         227   6e-65    
gb|KDP31133.1|  hypothetical protein JCGZ_11509                         223   1e-63    
ref|XP_010043800.1|  PREDICTED: WAT1-related protein At5g40240-like     222   4e-63    
gb|KCW85792.1|  hypothetical protein EUGRSUZ_B02544                     221   3e-62    
gb|KHG29548.1|  Auxin-induced 5NG4                                      217   2e-61    
ref|XP_007036147.1|  Nodulin MtN21 /EamA-like transporter family ...    218   3e-61    
ref|XP_007036148.1|  Nodulin MtN21 /EamA-like transporter family ...    217   3e-61    
emb|CDY65646.1|  BnaA09g53320D                                          214   9e-61    
ref|XP_010043808.1|  PREDICTED: WAT1-related protein At5g40240-like     214   2e-60    
emb|CBI15069.3|  unnamed protein product                                214   2e-60    
ref|XP_002531394.1|  Auxin-induced protein 5NG4, putative               214   3e-60    Ricinus communis
ref|XP_008356601.1|  PREDICTED: WAT1-related protein At3g28050-like     210   3e-59    
ref|XP_003634251.2|  PREDICTED: LOW QUALITY PROTEIN: WAT1-related...    212   6e-59    
ref|XP_006582505.1|  PREDICTED: WAT1-related protein At1g70260-like     209   9e-59    
ref|XP_010043809.1|  PREDICTED: WAT1-related protein At4g15540-li...    210   1e-58    
ref|XP_010111532.1|  Auxin-induced protein 5NG4                         210   1e-58    
ref|XP_010682604.1|  PREDICTED: WAT1-related protein At3g28050-li...    209   3e-58    
ref|XP_006579558.1|  PREDICTED: WAT1-related protein At3g28050-like     209   3e-58    
ref|XP_010271999.1|  PREDICTED: WAT1-related protein At5g40240-li...    209   5e-58    
ref|XP_010272001.1|  PREDICTED: WAT1-related protein At5g40240-li...    207   1e-57    
ref|XP_006470384.1|  PREDICTED: WAT1-related protein At3g28050-like     207   1e-57    
ref|XP_007222235.1|  hypothetical protein PRUPE_ppa007913mg             206   2e-57    
gb|KCW85805.1|  hypothetical protein EUGRSUZ_B02552                     206   4e-57    
ref|XP_008221761.1|  PREDICTED: WAT1-related protein At3g28050-li...    203   4e-56    
ref|XP_006476741.1|  PREDICTED: WAT1-related protein At5g40240-li...    203   5e-56    
ref|XP_004232283.1|  PREDICTED: WAT1-related protein At5g40240-like     202   1e-55    
ref|XP_009761506.1|  PREDICTED: WAT1-related protein At5g40240-li...    201   2e-55    
ref|XP_009360476.1|  PREDICTED: WAT1-related protein At5g40240-like     201   2e-55    
ref|XP_008221767.1|  PREDICTED: WAT1-related protein At5g40210-li...    201   4e-55    
ref|XP_007044590.1|  Auxin-induced protein 5NG4, putative               199   8e-55    
ref|XP_010111736.1|  Auxin-induced protein 5NG4                         199   1e-54    
ref|XP_008340346.1|  PREDICTED: WAT1-related protein At4g15540-like     199   1e-54    
ref|XP_004304594.1|  PREDICTED: auxin-induced protein 5NG4-like         199   2e-54    
ref|XP_010043799.1|  PREDICTED: WAT1-related protein At5g40240-like     198   2e-54    
ref|XP_008221765.1|  PREDICTED: WAT1-related protein At5g40240-like     198   2e-54    
ref|XP_008389607.1|  PREDICTED: WAT1-related protein At5g40240-like     198   2e-54    
ref|XP_002266139.1|  PREDICTED: WAT1-related protein At5g40240          198   2e-54    Vitis vinifera
ref|XP_008341732.1|  PREDICTED: WAT1-related protein At5g40240-like     199   3e-54    
ref|XP_004304597.1|  PREDICTED: auxin-induced protein 5NG4-like         198   4e-54    
ref|XP_006483801.1|  PREDICTED: WAT1-related protein At3g28050-li...    197   5e-54    
ref|XP_007224712.1|  hypothetical protein PRUPE_ppa025053mg             197   6e-54    
ref|XP_006338541.1|  PREDICTED: WAT1-related protein At5g40240-like     197   6e-54    
ref|XP_008353406.1|  PREDICTED: WAT1-related protein At5g40240-like     197   8e-54    
ref|XP_002266096.1|  PREDICTED: WAT1-related protein At5g40240          197   9e-54    Vitis vinifera
gb|KHN01750.1|  Auxin-induced protein 5NG4                              196   2e-53    
ref|XP_007044594.1|  Nodulin MtN21 /EamA-like transporter family ...    196   2e-53    
ref|XP_002517371.1|  conserved hypothetical protein                     196   3e-53    Ricinus communis
ref|XP_009761505.1|  PREDICTED: WAT1-related protein At5g40240-li...    195   4e-53    
ref|XP_010028080.1|  PREDICTED: WAT1-related protein At3g28050-like     195   5e-53    
ref|XP_004142351.1|  PREDICTED: auxin-induced protein 5NG4-like         195   5e-53    
ref|XP_003553929.1|  PREDICTED: WAT1-related protein At3g28050-like     195   5e-53    
ref|NP_001239940.1|  uncharacterized protein LOC100814137               195   6e-53    
ref|XP_006476742.1|  PREDICTED: WAT1-related protein At5g40240-li...    194   6e-53    
ref|XP_002322156.2|  hypothetical protein POPTR_0015s08450g             192   7e-53    Populus trichocarpa [western balsam poplar]
ref|XP_010029213.1|  PREDICTED: WAT1-related protein At3g28050-like     194   7e-53    
ref|XP_010100500.1|  Auxin-induced protein 5NG4                         194   7e-53    
gb|KDP21318.1|  hypothetical protein JCGZ_21789                         193   1e-52    
ref|XP_004297653.1|  PREDICTED: auxin-induced protein 5NG4-like         194   1e-52    
ref|XP_009363570.1|  PREDICTED: uncharacterized protein LOC103953544    201   2e-52    
ref|XP_008230645.1|  PREDICTED: WAT1-related protein At3g28050-like     194   2e-52    
ref|XP_007215585.1|  hypothetical protein PRUPE_ppa007567mg             194   2e-52    
ref|XP_007031406.1|  Nodulin MtN21 /EamA transporter family protein     193   2e-52    
ref|XP_008221766.1|  PREDICTED: WAT1-related protein At5g40210-li...    193   2e-52    
ref|XP_007155399.1|  hypothetical protein PHAVU_003G198100g             193   2e-52    
ref|XP_008348035.1|  PREDICTED: WAT1-related protein At5g40240-li...    193   3e-52    
ref|XP_010653186.1|  PREDICTED: WAT1-related protein At3g28050          192   3e-52    
ref|XP_008230953.1|  PREDICTED: uncharacterized protein LOC103330182    200   3e-52    
ref|XP_010111531.1|  Auxin-induced protein 5NG4                         192   4e-52    
ref|XP_008458740.1|  PREDICTED: WAT1-related protein At3g28050-like     193   4e-52    
ref|XP_008230644.1|  PREDICTED: WAT1-related protein At5g40240-like     192   4e-52    
ref|XP_007216831.1|  hypothetical protein PRUPE_ppa022659mg             192   5e-52    
ref|XP_002266639.2|  PREDICTED: WAT1-related protein At5g40210-like     191   1e-51    Vitis vinifera
gb|KCW85790.1|  hypothetical protein EUGRSUZ_B02542                     190   1e-51    
ref|XP_011025524.1|  PREDICTED: WAT1-related protein At3g28050-li...    191   1e-51    
gb|KHG27655.1|  Auxin-induced 5NG4                                      191   2e-51    
ref|XP_002265468.2|  PREDICTED: WAT1-related protein At5g40240-li...    190   2e-51    Vitis vinifera
ref|XP_004239354.1|  PREDICTED: WAT1-related protein At3g28050-li...    190   2e-51    
gb|ABK93545.1|  unknown                                                 187   3e-51    Populus trichocarpa [western balsam poplar]
ref|XP_004304599.1|  PREDICTED: auxin-induced protein 5NG4-like         191   4e-51    
ref|XP_004304595.1|  PREDICTED: auxin-induced protein 5NG4-like         189   5e-51    
gb|KCW87483.1|  hypothetical protein EUGRSUZ_B03945                     189   6e-51    
ref|XP_007224400.1|  hypothetical protein PRUPE_ppa021705mg             189   6e-51    
gb|KGN52391.1|  hypothetical protein Csa_5G630930                       187   2e-50    
ref|XP_007151109.1|  hypothetical protein PHAVU_004G018600g             188   2e-50    
ref|XP_006355963.1|  PREDICTED: WAT1-related protein At3g28050-like     187   2e-50    
ref|XP_002311582.1|  hypothetical protein POPTR_0008s14510g             187   3e-50    Populus trichocarpa [western balsam poplar]
gb|KCW85789.1|  hypothetical protein EUGRSUZ_B02542                     187   3e-50    
ref|XP_009360510.1|  PREDICTED: LOW QUALITY PROTEIN: WAT1-related...    184   3e-50    
ref|XP_002303950.2|  hypothetical protein POPTR_0003s19220g             187   3e-50    Populus trichocarpa [western balsam poplar]
ref|XP_007031395.1|  Nodulin MtN21 /EamA-like transporter family ...    187   3e-50    
ref|XP_009360473.1|  PREDICTED: WAT1-related protein At5g40240-li...    187   3e-50    
ref|XP_011034696.1|  PREDICTED: WAT1-related protein At3g28050-li...    187   4e-50    
gb|KEH16737.1|  nodulin MtN21/EamA-like transporter family protein      187   4e-50    
ref|XP_006470389.1|  PREDICTED: WAT1-related protein At3g28050-like     187   4e-50    
ref|XP_002299184.1|  hypothetical protein POPTR_0001s06940g             187   4e-50    Populus trichocarpa [western balsam poplar]
ref|XP_008341477.1|  PREDICTED: WAT1-related protein At5g40240-like     187   5e-50    
emb|CAN71719.1|  hypothetical protein VITISV_034106                     186   7e-50    Vitis vinifera
ref|XP_008348038.1|  PREDICTED: WAT1-related protein At3g28050-like     186   8e-50    
gb|KHN09903.1|  Auxin-induced protein 5NG4-like protein                 186   8e-50    
ref|XP_004489873.1|  PREDICTED: WAT1-related protein At3g28070-li...    186   9e-50    
ref|XP_010667883.1|  PREDICTED: WAT1-related protein At3g28050-like     186   1e-49    
ref|XP_003516812.1|  PREDICTED: WAT1-related protein At3g28050-like     186   1e-49    
ref|XP_010111739.1|  Auxin-induced protein 5NG4                         189   2e-49    
ref|XP_009349859.1|  PREDICTED: WAT1-related protein At5g40240-like     186   2e-49    
ref|XP_006573058.1|  PREDICTED: WAT1-related protein At5g40240 is...    185   2e-49    
ref|XP_003517737.1|  PREDICTED: WAT1-related protein At5g40240 is...    184   2e-49    
ref|XP_009111588.1|  PREDICTED: WAT1-related protein At3g28050-like     185   3e-49    
gb|KHG04184.1|  Auxin-induced 5NG4                                      185   3e-49    
ref|XP_009797459.1|  PREDICTED: WAT1-related protein At4g15540-li...    184   3e-49    
ref|XP_008221768.1|  PREDICTED: WAT1-related protein At3g28050-like     184   3e-49    
ref|XP_010046740.1|  PREDICTED: uncharacterized protein LOC104435740    191   4e-49    
gb|KCW87484.1|  hypothetical protein EUGRSUZ_B03946                     184   4e-49    
ref|XP_002279776.1|  PREDICTED: WAT1-related protein At5g40230          184   4e-49    Vitis vinifera
ref|XP_006446450.1|  hypothetical protein CICLE_v10017903mg             186   5e-49    
gb|KDP45389.1|  hypothetical protein JCGZ_09638                         184   6e-49    
ref|XP_006581027.1|  PREDICTED: uncharacterized protein LOC100804...    183   8e-49    
emb|CBI32117.3|  unnamed protein product                                182   9e-49    
ref|XP_009599993.1|  PREDICTED: WAT1-related protein At3g28050-like     183   1e-48    
ref|NP_001241291.1|  uncharacterized protein LOC100804032               183   1e-48    
ref|XP_002517375.1|  Auxin-induced protein 5NG4, putative               184   1e-48    Ricinus communis
ref|XP_007227338.1|  hypothetical protein PRUPE_ppa015719mg             182   2e-48    
ref|XP_007031402.1|  Nodulin MtN21 /EamA-like transporter family ...    182   3e-48    
ref|XP_006483805.1|  PREDICTED: WAT1-related protein At3g28050-li...    182   3e-48    
ref|XP_007224366.1|  hypothetical protein PRUPE_ppa020906mg             182   3e-48    
ref|XP_007137544.1|  hypothetical protein PHAVU_009G135600g             182   3e-48    
ref|XP_007157481.1|  hypothetical protein PHAVU_002G073200g             182   3e-48    
emb|CDY00140.1|  BnaC09g01610D                                          182   3e-48    
ref|XP_007031403.1|  Nodulin MtN21 /EamA-like transporter family ...    182   4e-48    
ref|XP_008221764.1|  PREDICTED: WAT1-related protein At5g40240-like     182   4e-48    
ref|XP_009344537.1|  PREDICTED: WAT1-related protein At5g40210-like     181   5e-48    
gb|KDO82537.1|  hypothetical protein CISIN_1g018663mg                   181   7e-48    
ref|XP_010441137.1|  PREDICTED: WAT1-related protein At5g40240-like     181   7e-48    
ref|XP_011020453.1|  PREDICTED: WAT1-related protein At3g28050-like     181   8e-48    
ref|XP_008221769.1|  PREDICTED: WAT1-related protein At4g15540-like     181   8e-48    
gb|KHG19083.1|  Auxin-induced protein 5NG4                              180   9e-48    
ref|XP_008379799.1|  PREDICTED: WAT1-related protein At5g40240-like     186   1e-47    
gb|KCW85808.1|  hypothetical protein EUGRSUZ_B02553                     177   1e-47    
ref|XP_008443486.1|  PREDICTED: WAT1-related protein At5g40230-li...    181   1e-47    
emb|CAN67884.1|  hypothetical protein VITISV_015327                     180   1e-47    Vitis vinifera
ref|XP_006483798.1|  PREDICTED: WAT1-related protein At3g28050-li...    180   1e-47    
emb|CDY20031.1|  BnaA09g02200D                                          181   1e-47    
gb|KHG19084.1|  Auxin-induced protein 5NG4                              180   1e-47    
ref|XP_007157479.1|  hypothetical protein PHAVU_002G073100g             180   2e-47    
ref|XP_010435926.1|  PREDICTED: WAT1-related protein At5g40240 is...    180   2e-47    
ref|XP_003523396.1|  PREDICTED: WAT1-related protein At3g28050-like     179   2e-47    
gb|KDO82559.1|  hypothetical protein CISIN_1g022220mg                   177   2e-47    
emb|CBI34954.3|  unnamed protein product                                179   3e-47    
ref|XP_007217782.1|  hypothetical protein PRUPE_ppa020036mg             179   4e-47    
ref|XP_010254351.1|  PREDICTED: WAT1-related protein At4g15540-like     182   6e-47    
ref|XP_008443490.1|  PREDICTED: WAT1-related protein At5g40230-li...    178   7e-47    
ref|XP_009344542.1|  PREDICTED: WAT1-related protein At3g28050-like     178   7e-47    
ref|XP_004309502.1|  PREDICTED: auxin-induced protein 5NG4-like         177   9e-47    
ref|XP_007226752.1|  hypothetical protein PRUPE_ppa018854mg             177   1e-46    
gb|ABK25095.1|  unknown                                                 178   1e-46    Picea sitchensis
ref|XP_009349860.1|  PREDICTED: WAT1-related protein At3g28050-like     177   1e-46    
gb|KEH24884.1|  nodulin MtN21/EamA-like transporter family protein      177   2e-46    
ref|XP_006355962.1|  PREDICTED: WAT1-related protein At3g28050-like     176   2e-46    
ref|XP_010653215.1|  PREDICTED: WAT1-related protein At5g40240-li...    174   3e-46    
ref|XP_006586196.1|  PREDICTED: WAT1-related protein At5g40240-li...    176   3e-46    
ref|XP_004309501.1|  PREDICTED: auxin-induced protein 5NG4-like         176   4e-46    
ref|XP_006483800.1|  PREDICTED: WAT1-related protein At3g28050-li...    176   4e-46    
ref|XP_003602166.1|  Auxin-induced protein 5NG4                         176   4e-46    
gb|KDO66260.1|  hypothetical protein CISIN_1g019712mg                   175   4e-46    
gb|KHN48611.1|  Auxin-induced protein 5NG4                              173   5e-46    
gb|AFK39191.1|  unknown                                                 176   6e-46    
ref|XP_009348031.1|  PREDICTED: WAT1-related protein At3g28050-like     176   6e-46    
ref|XP_010320601.1|  PREDICTED: WAT1-related protein At3g28050-li...    172   6e-46    
ref|XP_010528268.1|  PREDICTED: WAT1-related protein At3g28050          176   7e-46    
ref|XP_004238690.2|  PREDICTED: WAT1-related protein At1g21890-like     181   8e-46    
gb|KEH16738.1|  nodulin MtN21/EamA-like transporter family protein      172   1e-45    
ref|XP_004304598.1|  PREDICTED: auxin-induced protein 5NG4-like         173   1e-45    
ref|XP_003588861.1|  Auxin-induced protein 5NG4                         174   2e-45    
ref|XP_007044593.1|  Nodulin MtN21 /EamA-like transporter family ...    173   2e-45    
ref|XP_007137543.1|  hypothetical protein PHAVU_009G135500g             174   2e-45    
ref|XP_010669710.1|  PREDICTED: WAT1-related protein At4g08300-like     175   3e-45    
ref|XP_009790539.1|  PREDICTED: WAT1-related protein At3g28050-like     174   3e-45    
ref|XP_009629024.1|  PREDICTED: WAT1-related protein At3g28050-like     174   3e-45    
ref|XP_006470385.1|  PREDICTED: WAT1-related protein At4g15540-like     177   3e-45    
ref|XP_009761504.1|  PREDICTED: WAT1-related protein At3g28050-like     174   4e-45    
gb|KHN23566.1|  Auxin-induced protein 5NG4                              174   4e-45    
gb|AES96253.2|  nodulin MtN21/EamA-like transporter family protein      173   4e-45    
ref|XP_007031399.1|  Nodulin MtN21 /EamA-like transporter family ...    173   5e-45    
ref|XP_002531393.1|  Auxin-induced protein 5NG4, putative               172   7e-45    Ricinus communis
ref|XP_004514450.1|  PREDICTED: WAT1-related protein At3g28050-li...    173   7e-45    
ref|XP_002531388.1|  Auxin-induced protein 5NG4, putative               172   7e-45    Ricinus communis
emb|CDP02142.1|  unnamed protein product                                172   8e-45    
ref|NP_198840.2|  nodulin MtN21 /EamA-like transporter family pro...    172   9e-45    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002279762.1|  PREDICTED: WAT1-related protein At3g28050          172   1e-44    Vitis vinifera
ref|XP_006283966.1|  hypothetical protein CARUB_v10005089mg             172   1e-44    
ref|XP_010278027.1|  PREDICTED: WAT1-related protein At4g30420-like     172   1e-44    
emb|CDY11676.1|  BnaC06g12840D                                          172   2e-44    
ref|NP_001190441.1|  nodulin MtN21 /EamA-like transporter family ...    172   2e-44    
gb|KDO82550.1|  hypothetical protein CISIN_1g018400mg                   171   2e-44    
gb|KDP45391.1|  hypothetical protein JCGZ_09640                         171   2e-44    
gb|KEH24886.1|  nodulin MtN21/EamA-like transporter family protein      171   2e-44    
dbj|BAH01249.1|  unnamed protein product                                172   2e-44    Oryza sativa Japonica Group [Japonica rice]
gb|KDO82548.1|  hypothetical protein CISIN_1g018256mg                   171   2e-44    
gb|KHN44249.1|  Auxin-induced protein 5NG4                              171   2e-44    
gb|KEH39875.1|  nodulin MtN21/EamA-like transporter family protein      173   3e-44    
ref|XP_007208872.1|  hypothetical protein PRUPE_ppa026053mg             171   3e-44    
ref|XP_004309563.1|  PREDICTED: auxin-induced protein 5NG4-like         171   4e-44    
ref|XP_006286126.1|  hypothetical protein CARUB_v10007676mg             171   4e-44    
ref|XP_006405518.1|  hypothetical protein EUTSA_v10027803mg             171   4e-44    
gb|KDO66278.1|  hypothetical protein CISIN_1g019098mg                   170   5e-44    
ref|XP_004502588.1|  PREDICTED: WAT1-related protein At5g40240-li...    170   5e-44    
ref|XP_007044589.1|  Auxin-induced protein 5NG4, putative               170   6e-44    
ref|XP_007044598.1|  Nodulin MtN21 /EamA-like transporter family ...    169   6e-44    
ref|XP_002869378.1|  predicted protein                                  170   6e-44    
ref|XP_006581617.1|  PREDICTED: WAT1-related protein At3g28050-like     169   8e-44    
ref|XP_009594126.1|  PREDICTED: WAT1-related protein At3g28050-li...    169   8e-44    
ref|XP_011045221.1|  PREDICTED: WAT1-related protein At3g28050-li...    170   9e-44    
emb|CDX67449.1|  BnaA07g14890D                                          170   9e-44    
gb|KDP45393.1|  hypothetical protein JCGZ_09642                         169   1e-43    
ref|XP_006470392.1|  PREDICTED: WAT1-related protein At5g40240-like     169   1e-43    
ref|NP_198839.1|  nodulin MtN21 /EamA-like transporter family pro...    169   1e-43    
ref|XP_006338539.1|  PREDICTED: WAT1-related protein At3g28050-li...    169   1e-43    
ref|XP_006484313.1|  PREDICTED: uncharacterized protein LOC102615432    175   1e-43    
emb|CBI34955.3|  unnamed protein product                                169   1e-43    
ref|XP_003519811.1|  PREDICTED: WAT1-related protein At5g40240-li...    169   1e-43    
gb|KDP21320.1|  hypothetical protein JCGZ_21791                         169   1e-43    
ref|XP_008458741.1|  PREDICTED: WAT1-related protein At3g28050-li...    169   1e-43    
gb|ABR16695.1|  unknown                                                 170   2e-43    
ref|XP_011045220.1|  PREDICTED: WAT1-related protein At3g28050-li...    169   2e-43    
ref|NP_194771.1|  nodulin MtN21-like transporter family protein         169   3e-43    
ref|XP_009594124.1|  PREDICTED: WAT1-related protein At3g28050-li...    168   3e-43    
ref|XP_004514449.1|  PREDICTED: WAT1-related protein At3g28050-li...    168   3e-43    
ref|XP_009108984.1|  PREDICTED: WAT1-related protein At4g30420-like     168   3e-43    
ref|XP_010502812.1|  PREDICTED: WAT1-related protein At3g28050          168   3e-43    
ref|XP_003613295.1|  Auxin-induced protein 5NG4                         172   3e-43    
gb|KHN23420.1|  Auxin-induced protein 5NG4                              167   3e-43    
ref|XP_004514451.1|  PREDICTED: WAT1-related protein At3g28050-li...    168   4e-43    
ref|XP_002324505.1|  hypothetical protein POPTR_0018s10840g             168   4e-43    
ref|XP_002517372.1|  Auxin-induced protein 5NG4, putative               168   4e-43    
ref|XP_010682440.1|  PREDICTED: WAT1-related protein At4g08300-like     169   4e-43    
ref|XP_011018102.1|  PREDICTED: WAT1-related protein At4g30420-li...    168   5e-43    
ref|XP_010031116.1|  PREDICTED: WAT1-related protein At3g28050-li...    167   5e-43    
ref|XP_010514518.1|  PREDICTED: WAT1-related protein At3g28050-like     167   6e-43    
ref|XP_010450700.1|  PREDICTED: WAT1-related protein At5g40240-like     167   6e-43    
ref|XP_006338537.1|  PREDICTED: WAT1-related protein At3g28050-like     167   7e-43    
ref|XP_004141080.1|  PREDICTED: auxin-induced protein 5NG4-like         167   7e-43    
emb|CDY11678.1|  BnaC06g12860D                                          167   7e-43    
ref|XP_009599994.1|  PREDICTED: WAT1-related protein At3g28050-like     167   7e-43    
gb|AES96246.2|  auxin-induced 5NG4-like protein                         167   8e-43    
ref|XP_004304596.1|  PREDICTED: auxin-induced protein 5NG4-like         167   8e-43    
emb|CDY03534.1|  BnaC03g67930D                                          167   8e-43    
emb|CAN62735.1|  hypothetical protein VITISV_027749                     172   9e-43    
ref|XP_008392675.1|  PREDICTED: WAT1-related protein At1g43650-li...    167   1e-42    
ref|XP_010045320.1|  PREDICTED: WAT1-related protein At5g40240-like     167   1e-42    
ref|XP_009129385.1|  PREDICTED: WAT1-related protein At3g28050 is...    165   1e-42    
ref|XP_009140232.1|  PREDICTED: WAT1-related protein At4g15540          166   1e-42    
emb|CDP00195.1|  unnamed protein product                                166   1e-42    
ref|XP_008353011.1|  PREDICTED: WAT1-related protein At5g40240-like     163   2e-42    
ref|XP_006355988.1|  PREDICTED: WAT1-related protein At4g15540-like     164   2e-42    
emb|CDY04005.1|  BnaC02g37200D                                          166   2e-42    
ref|XP_004232282.1|  PREDICTED: WAT1-related protein At3g28050-like     166   2e-42    
ref|XP_009129384.1|  PREDICTED: WAT1-related protein At3g28050 is...    166   2e-42    
emb|CDY15933.1|  BnaA04g11780D                                          166   2e-42    
ref|XP_010425588.1|  PREDICTED: WAT1-related protein At3g28050-like     166   2e-42    
ref|XP_011086525.1|  PREDICTED: WAT1-related protein At3g28050-like     166   2e-42    
ref|XP_006285169.1|  hypothetical protein CARUB_v10006514mg             166   2e-42    
emb|CDX99641.1|  BnaC04g33980D                                          165   2e-42    
ref|XP_003543391.2|  PREDICTED: WAT1-related protein At5g40230-li...    166   3e-42    
emb|CDY66864.1|  BnaCnng52640D                                          165   3e-42    
ref|XP_004238687.1|  PREDICTED: WAT1-related protein At3g28050-like     165   3e-42    
ref|XP_006355989.1|  PREDICTED: WAT1-related protein At5g40240-like     165   3e-42    
gb|AEX97055.1|  auxin-induced nodulin                                   165   3e-42    
ref|NP_566831.1|  nodulin MtN21-like transporter UMAMIT41               166   3e-42    
ref|XP_011025493.1|  PREDICTED: WAT1-related protein At3g28050-li...    166   3e-42    
ref|XP_010241742.1|  PREDICTED: WAT1-related protein At1g43650-like     165   3e-42    
ref|XP_009360246.1|  PREDICTED: WAT1-related protein At5g64700-like     165   3e-42    
ref|XP_006593634.1|  PREDICTED: WAT1-related protein At5g40230-li...    165   4e-42    
ref|XP_004489865.1|  PREDICTED: WAT1-related protein At3g28050-like     164   5e-42    
ref|XP_002875421.1|  nodulin MtN21 family protein                       165   5e-42    
ref|XP_009139980.1|  PREDICTED: WAT1-related protein At5g40240-li...    165   5e-42    
ref|XP_004489874.1|  PREDICTED: WAT1-related protein At3g28070-li...    163   5e-42    
ref|XP_010260942.1|  PREDICTED: WAT1-related protein At1g43650          164   6e-42    
ref|XP_006493416.1|  PREDICTED: WAT1-related protein At5g64700-like     164   6e-42    
ref|XP_009125131.1|  PREDICTED: WAT1-related protein At5g40240-like     164   6e-42    
gb|ADE76940.1|  unknown                                                 165   7e-42    
ref|XP_006470490.1|  PREDICTED: WAT1-related protein At5g40240-like     164   8e-42    
ref|XP_006483802.1|  PREDICTED: WAT1-related protein At3g28050-li...    161   8e-42    
ref|XP_010441134.1|  PREDICTED: WAT1-related protein At5g40230-like     165   8e-42    
ref|XP_010031130.1|  PREDICTED: WAT1-related protein At3g28050-li...    164   9e-42    
gb|KFK33141.1|  hypothetical protein AALP_AA6G336300                    164   9e-42    
ref|XP_009125128.1|  PREDICTED: WAT1-related protein At5g40240-like     164   9e-42    
ref|XP_006412708.1|  hypothetical protein EUTSA_v10025504mg             164   9e-42    
ref|XP_006453494.1|  hypothetical protein CICLE_v10008665mg             164   1e-41    
ref|XP_009627376.1|  PREDICTED: WAT1-related protein At4g15540-like     162   1e-41    
ref|XP_006661252.1|  PREDICTED: WAT1-related protein At4g30420-like     164   1e-41    
ref|XP_002868664.1|  nodulin MtN21 family protein                       164   1e-41    
gb|KDO48741.1|  hypothetical protein CISIN_1g018219mg                   164   1e-41    
ref|XP_010432988.1|  PREDICTED: WAT1-related protein At4g30420-like     164   1e-41    
ref|XP_010031132.1|  PREDICTED: WAT1-related protein At3g28050-li...    163   1e-41    
ref|XP_008375444.1|  PREDICTED: WAT1-related protein At1g43650-like     164   1e-41    
ref|XP_011086526.1|  PREDICTED: WAT1-related protein At3g28050-li...    163   1e-41    
dbj|BAB10904.1|  nodulin-like protein                                   163   2e-41    
ref|XP_011098512.1|  PREDICTED: WAT1-related protein At5g40240-like     164   2e-41    
ref|XP_006386233.1|  hypothetical protein POPTR_0002s04130g             162   2e-41    
ref|XP_010450705.1|  PREDICTED: WAT1-related protein At5g40230 is...    163   2e-41    
gb|KHN00335.1|  Auxin-induced protein 5NG4                              162   2e-41    
ref|XP_006474092.1|  PREDICTED: WAT1-related protein At4g30420-like     164   2e-41    
gb|AAM65952.1|  nodulin MtN21-like protein                              163   2e-41    
ref|XP_002317651.2|  hypothetical protein POPTR_0011s15150g             163   3e-41    
ref|XP_003517734.1|  PREDICTED: WAT1-related protein At3g28050-like     162   3e-41    
ref|XP_006369957.1|  nodulin MtN21 family protein                       163   3e-41    
emb|CDY36827.1|  BnaC04g32200D                                          163   3e-41    
ref|XP_003519813.1|  PREDICTED: WAT1-related protein At3g28050-like     162   3e-41    
ref|XP_007013959.1|  Nodulin MtN21 /EamA-like transporter family ...    163   3e-41    
gb|KEH24887.1|  nodulin MtN21/EamA-like transporter family protein      167   3e-41    
gb|KDO82557.1|  hypothetical protein CISIN_1g018400mg                   161   3e-41    
ref|XP_002273800.3|  PREDICTED: WAT1-related protein At1g43650-li...    162   4e-41    
emb|CDY00403.1|  BnaC07g14230D                                          162   4e-41    
gb|KFK29616.1|  hypothetical protein AALP_AA7G157200                    162   4e-41    
ref|XP_003553931.1|  PREDICTED: WAT1-related protein At5g40230 is...    162   4e-41    
ref|XP_009360245.1|  PREDICTED: WAT1-related protein At1g43650-like     162   4e-41    
ref|XP_006441412.1|  hypothetical protein CICLE_v10020812mg             162   5e-41    
gb|KHG08817.1|  Auxin-induced 5NG4                                      161   5e-41    
ref|XP_009373690.1|  PREDICTED: WAT1-related protein At5g64700-like     162   5e-41    
ref|XP_007039289.1|  Nodulin MtN21 /EamA-like transporter family ...    162   6e-41    
ref|XP_002271326.3|  PREDICTED: WAT1-related protein At1g43650-like     162   7e-41    
ref|XP_010664224.1|  PREDICTED: WAT1-related protein At1g21890          162   7e-41    
ref|XP_011004369.1|  PREDICTED: WAT1-related protein At5g07050-li...    161   8e-41    
ref|XP_009604082.1|  PREDICTED: WAT1-related protein At1g43650          161   8e-41    
ref|XP_009767073.1|  PREDICTED: WAT1-related protein At3g28050-like     161   8e-41    
ref|XP_009793606.1|  PREDICTED: WAT1-related protein At1g43650-like     161   8e-41    
ref|XP_009139982.1|  PREDICTED: WAT1-related protein At5g40240-like     162   8e-41    
emb|CDY28186.1|  BnaA01g06630D                                          162   9e-41    
gb|KDP25183.1|  hypothetical protein JCGZ_20339                         161   1e-40    
ref|XP_011098767.1|  PREDICTED: WAT1-related protein At5g40240-like     160   1e-40    
gb|KEH24885.1|  nodulin MtN21/EamA-like transporter family protein      160   1e-40    
gb|EYU25979.1|  hypothetical protein MIMGU_mgv1a009103mg                160   2e-40    
ref|XP_011015924.1|  PREDICTED: WAT1-related protein At1g43650-li...    160   2e-40    
ref|XP_010435922.1|  PREDICTED: WAT1-related protein At5g40230-li...    160   2e-40    
emb|CDP04273.1|  unnamed protein product                                161   2e-40    
ref|XP_010438180.1|  PREDICTED: WAT1-related protein At4g30420          161   2e-40    
ref|XP_007151110.1|  hypothetical protein PHAVU_004G018700g             160   2e-40    
ref|XP_002531390.1|  Auxin-induced protein 5NG4, putative               160   2e-40    
ref|XP_006395380.1|  hypothetical protein EUTSA_v10004446mg             160   3e-40    
ref|XP_010447720.1|  PREDICTED: WAT1-related protein At4g30420-like     160   3e-40    
ref|XP_004498806.1|  PREDICTED: WAT1-related protein At5g40240-li...    159   3e-40    
gb|AFK38302.1|  unknown                                                 160   3e-40    
ref|XP_010436326.1|  PREDICTED: WAT1-related protein At4g30420-like     160   3e-40    
ref|XP_006851393.1|  hypothetical protein AMTR_s00040p00037300          159   3e-40    
emb|CDX67448.1|  BnaA07g14880D                                          164   4e-40    
ref|XP_006470387.1|  PREDICTED: WAT1-related protein At5g40240-li...    160   4e-40    
ref|XP_006470386.1|  PREDICTED: WAT1-related protein At5g40240-li...    160   4e-40    
ref|XP_009382149.1|  PREDICTED: WAT1-related protein At5g07050-like     159   5e-40    
ref|XP_002529296.1|  Auxin-induced protein 5NG4, putative               159   5e-40    
dbj|BAD33614.1|  putative MtN21                                         159   5e-40    
ref|XP_008391190.1|  PREDICTED: WAT1-related protein At5g07050-like     159   5e-40    
gb|ABR18253.1|  unknown                                                 160   6e-40    
ref|XP_011034699.1|  PREDICTED: WAT1-related protein At3g28050-li...    157   6e-40    
ref|XP_008224471.1|  PREDICTED: WAT1-related protein At4g08300-like     159   6e-40    
gb|KEH42716.1|  auxin-induced 5NG4-like protein                         159   7e-40    
ref|XP_004165822.1|  PREDICTED: auxin-induced protein 5NG4-like         158   7e-40    
emb|CDP11398.1|  unnamed protein product                                159   7e-40    
ref|XP_011028783.1|  PREDICTED: WAT1-related protein At4g08300-li...    159   8e-40    
ref|XP_006845483.1|  hypothetical protein AMTR_s00019p00140850          159   8e-40    
dbj|BAJ53175.1|  JHL18I08.9                                             159   8e-40    
emb|CDP02894.1|  unnamed protein product                                159   9e-40    
ref|XP_006405519.1|  hypothetical protein EUTSA_v10027803mg             156   9e-40    
ref|XP_010435923.1|  PREDICTED: WAT1-related protein At5g40230-li...    158   1e-39    
ref|XP_011004368.1|  PREDICTED: WAT1-related protein At5g07050-li...    158   1e-39    
ref|XP_009344538.1|  PREDICTED: WAT1-related protein At5g40230-like     158   1e-39    
ref|XP_009379003.1|  PREDICTED: WAT1-related protein At5g07050-like     158   1e-39    
emb|CDY44583.1|  BnaA04g10070D                                          166   1e-39    
ref|XP_006413000.1|  hypothetical protein EUTSA_v10025553mg             158   1e-39    
emb|CDX72240.1|  BnaC07g42620D                                          158   1e-39    
ref|XP_011027560.1|  PREDICTED: WAT1-related protein At4g08300-like     159   1e-39    
gb|AFK37412.1|  unknown                                                 157   2e-39    
gb|KEH24888.1|  nodulin MtN21/EamA-like transporter family protein      157   2e-39    
ref|XP_009137916.1|  PREDICTED: WAT1-related protein At4g30420-like     158   2e-39    
ref|XP_002517373.1|  Auxin-induced protein 5NG4, putative               157   2e-39    
ref|XP_009137918.1|  PREDICTED: WAT1-related protein At4g30420-like     157   2e-39    
ref|XP_011071065.1|  PREDICTED: WAT1-related protein At3g28050-li...    157   2e-39    
ref|XP_009369498.1|  PREDICTED: WAT1-related protein At4g08300-like     157   2e-39    
ref|XP_011015922.1|  PREDICTED: WAT1-related protein At1g43650-li...    157   2e-39    
ref|XP_009360475.1|  PREDICTED: WAT1-related protein At5g40240-li...    156   2e-39    
gb|AET01174.2|  nodulin MtN21/EamA-like transporter family protein      157   3e-39    
ref|XP_004142470.1|  PREDICTED: auxin-induced protein 5NG4-like         157   3e-39    
ref|XP_009373689.1|  PREDICTED: WAT1-related protein At1g43650-like     157   3e-39    
ref|XP_010687694.1|  PREDICTED: WAT1-related protein At4g30420          157   3e-39    
ref|XP_010534673.1|  PREDICTED: WAT1-related protein At1g21890 is...    158   3e-39    
gb|KFK33719.1|  hypothetical protein AALP_AA5G051100                    157   3e-39    
gb|KEH24883.1|  nodulin MtN21/EamA-like transporter family protein      159   3e-39    
ref|XP_010450712.1|  PREDICTED: WAT1-related protein At5g40230 is...    156   3e-39    
ref|XP_009140233.1|  PREDICTED: WAT1-related protein At5g40240-li...    157   4e-39    
ref|XP_006453495.1|  hypothetical protein CICLE_v10008665mg             157   4e-39    
ref|XP_009137919.1|  PREDICTED: WAT1-related protein At4g30420-like     157   4e-39    
ref|XP_002868665.1|  hypothetical protein ARALYDRAFT_330483             157   4e-39    
ref|XP_003613292.1|  Auxin-induced protein 5NG4                         156   4e-39    
ref|XP_009623146.1|  PREDICTED: WAT1-related protein At4g08300 is...    157   4e-39    
ref|XP_006405532.1|  hypothetical protein EUTSA_v10027820mg             156   4e-39    
ref|XP_009125127.1|  PREDICTED: WAT1-related protein At5g40230-like     156   4e-39    
ref|XP_010031134.1|  PREDICTED: WAT1-related protein At3g28050-li...    156   5e-39    
gb|EYU22475.1|  hypothetical protein MIMGU_mgv1a009299mg                156   5e-39    
ref|XP_007224058.1|  hypothetical protein PRUPE_ppa015276mg             156   5e-39    
ref|XP_006489750.1|  PREDICTED: WAT1-related protein At5g07050-like     156   6e-39    
gb|KDO57625.1|  hypothetical protein CISIN_1g018804mg                   156   6e-39    
emb|CDP04677.1|  unnamed protein product                                156   6e-39    
emb|CDY39201.1|  BnaA03g50130D                                          156   6e-39    
gb|KHN44251.1|  Auxin-induced protein 5NG4                              155   6e-39    
ref|XP_004498807.1|  PREDICTED: WAT1-related protein At5g40240-li...    155   6e-39    
emb|CDY39203.1|  BnaA03g50150D                                          156   7e-39    
ref|XP_007039287.1|  Nodulin MtN21 /EamA-like transporter family ...    156   7e-39    
ref|XP_006851384.1|  hypothetical protein AMTR_s00040p00026230          155   8e-39    
ref|XP_009360474.1|  PREDICTED: WAT1-related protein At5g40240-li...    155   9e-39    
ref|XP_011086524.1|  PREDICTED: WAT1-related protein At3g28050-like     155   9e-39    
ref|XP_006420194.1|  hypothetical protein CICLE_v10005315mg             155   9e-39    
emb|CDP16602.1|  unnamed protein product                                155   1e-38    
ref|XP_006441413.1|  hypothetical protein CICLE_v10023533mg             155   1e-38    
ref|XP_011018103.1|  PREDICTED: WAT1-related protein At4g30420-li...    155   1e-38    
ref|XP_004491753.1|  PREDICTED: WAT1-related protein At3g28050-like     154   1e-38    
ref|XP_003626705.1|  Auxin-induced protein 5NG4                         158   1e-38    
ref|XP_006351896.1|  PREDICTED: WAT1-related protein At4g08300-like     155   1e-38    
ref|XP_003601058.1|  Auxin-induced protein 5NG4                         155   1e-38    
ref|XP_009623147.1|  PREDICTED: WAT1-related protein At4g08300 is...    156   1e-38    
emb|CDX72237.1|  BnaC07g42590D                                          155   1e-38    
emb|CDP04675.1|  unnamed protein product                                155   1e-38    
ref|XP_010053986.1|  PREDICTED: WAT1-related protein At1g43650-like     155   1e-38    
ref|XP_009403687.1|  PREDICTED: WAT1-related protein At5g64700-li...    154   2e-38    
ref|XP_004498117.1|  PREDICTED: WAT1-related protein At3g30340-li...    155   2e-38    



>ref|XP_009599917.1| PREDICTED: WAT1-related protein At1g70260-like [Nicotiana tomentosiformis]
Length=369

 Score =   473 bits (1218),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 232/365 (64%), Positives = 299/365 (82%), Gaps = 1/365 (0%)
 Frame = +1

Query  205   AMEVKAAFGEVVPCMAMVMVEACTIFLTIMASTAMAKFGTNPFVFVVYTNALASIFLVPY  384
              + V  A GE++PC AMV++EA TIFLTIMASTAM+KFG + F+FVVYTNAL+ I L+PY
Sbjct  2     GVRVANAIGEMLPCTAMVIIEAATIFLTIMASTAMSKFGMSSFIFVVYTNALSFILLLPY  61

Query  385   SIIYHRRDKAQEQlftfplllrlfflglIGVTISQNLAFVGLSYSSPIAACGTANIVPAL  564
             S+ +HRRDK +E LFTFPLLLR+FFLGL+GVTI+QNLAF GLSYSSPI ACG AN++PA 
Sbjct  62    SLFFHRRDKTEEPLFTFPLLLRVFFLGLVGVTIAQNLAFAGLSYSSPIVACGAANMIPAF  121

Query  565   SFILAIILRRTKIDWESGGSQARMIGALICTVGTISLIFYRGPVVNNYSPTFLHLSTTQF  744
             SFI++IILR+ ++DW+  GSQ R++G LI  VG +S+ FY+GPVVN YSP+FL L+  Q 
Sbjct  122   SFIVSIILRKIRMDWKRQGSQVRVVGTLISIVGILSMTFYKGPVVNKYSPSFLQLARPQL  181

Query  745   VFSSSTNQQNWVLGCLCFIAASLTLSIWNIIQVGTIRIYPQVMKIMCVYSLFGTVQSGAL  924
             +  +ST++ NWVLGC  F AAS  L+IWNIIQ G+ + +P VMKI C+Y+LFGT+QS   
Sbjct  182   LVFTSTHE-NWVLGCFLFAAASFALTIWNIIQAGSSKKHPHVMKITCLYTLFGTIQSAVF  240

Query  925   SLFIVRDLNAWRLGLNFQLIVILLTAIFGSIIRSSVQLWCMRMKGPSFPLIFKPVGIVVA  1104
             +LF+ +DL+AWRL LNF+L+VI+LTAIFGS+IRSSVQ+WCMR+KGPS+ L FKPVG+ VA
Sbjct  241   ALFMEKDLSAWRLKLNFELLVIVLTAIFGSLIRSSVQMWCMRLKGPSYTLFFKPVGVPVA  300

Query  1105  SSCGCLFFADTFHYGSMFSAFICGMGYYTTIWGQLKDEEIQQIKGSSVSLPDEKVPLLQQ  1284
             S+CGC+ FA TFHYGSM +A ICG+GYYTT+WGQLK++E ++    +VS  DEKVPLLQ+
Sbjct  301   STCGCVLFAATFHYGSMLNACICGLGYYTTLWGQLKEDETKKDIKGNVSTSDEKVPLLQE  360

Query  1285  SQDDS  1299
              +D+ 
Sbjct  361   KEDED  365



>ref|XP_009629015.1| PREDICTED: WAT1-related protein At1g70260-like [Nicotiana tomentosiformis]
Length=400

 Score =   471 bits (1212),  Expect = 5e-159, Method: Compositional matrix adjust.
 Identities = 240/380 (63%), Positives = 299/380 (79%), Gaps = 8/380 (2%)
 Frame = +1

Query  190   EKMLAAMEVKAAFGEVVPCMAMVMVEACTIFLTIMASTAMAKFGTNPFVFVVYTNALASI  369
             E+    M VKA   +++PC AMV++E CTIFLTIMAST M++ G +PFVFVVYTNAL+SI
Sbjct  21    ERGRDNMGVKAVVEDILPCTAMVLIEICTIFLTIMASTTMSRLGMSPFVFVVYTNALSSI  80

Query  370   FLVPYSIIYHRRDKAQEQlftfplllrlfflglIGVTISQNLAFVGLSYSSPIAACGTAN  549
              L+PYS +YHRRDK Q  LFTFPLLLR+  LGL+GVTI+QNLAF GLSYSSPI ACG AN
Sbjct  81    ILLPYSFLYHRRDKIQAPLFTFPLLLRVSLLGLVGVTIAQNLAFAGLSYSSPIVACGMAN  140

Query  550   IVPALSFILAIILRRTKIDWESGGSQARMIGALICTVGTISLIFYRGPVVNNYSPTFLHL  729
              +PA +FILAI LR+ K+D +S GSQAR+IG+LI  +G +S+ +Y+GPVV  YSP FL L
Sbjct  141   QIPAFTFILAIFLRKIKVDLKSQGSQARIIGSLISIMGALSITYYKGPVVKQYSPFFLQL  200

Query  730   STTQFVFSSSTNQQNWVLGCLCFIAASLTLSIWNIIQVGTIRIYPQVMKIMCVYSLFGTV  909
             +  + +   ++  +NWVLGC+ F AAS  L IWNIIQ GTIR +PQVMKI+ +Y+LFGT+
Sbjct  201   ARPRLLAVFTSTHENWVLGCILFAAASFALCIWNIIQAGTIRKHPQVMKIVFLYTLFGTI  260

Query  910   QSGALSLFIVRDLNAWRLGLNFQLIVILLTAIFGSIIRSSVQLWCMRMKGPSFPLIFKPV  1089
             QS  L+L + +DL  WRL LN +L+VI+LTAIFGS+IRSSVQ+WCMR+KG SFPL FKPV
Sbjct  261   QSAILALLMEKDLRVWRLELNMELLVIVLTAIFGSLIRSSVQMWCMRLKGASFPLFFKPV  320

Query  1090  GIVVASSCGCLFFADTFHYGSMFSAFICGMGYYTTIWGQLKDEEI-QQIKGSSVSLPDEK  1266
             GI  AS+CGCL FA+TFHYGSMFSA ICG+GYYTT+WGQLKD+E  + IKGS+ +  DEK
Sbjct  321   GIPTASTCGCLLFAETFHYGSMFSAIICGLGYYTTLWGQLKDDETSKNIKGSTSTTSDEK  380

Query  1267  VPLLQ-------QSQDDSPV  1305
             VPLLQ       + ++DSPV
Sbjct  381   VPLLQEKEEGEEEEEEDSPV  400



>ref|XP_009790538.1| PREDICTED: WAT1-related protein At1g70260-like [Nicotiana sylvestris]
Length=400

 Score =   469 bits (1207),  Expect = 3e-158, Method: Compositional matrix adjust.
 Identities = 237/374 (63%), Positives = 297/374 (79%), Gaps = 8/374 (2%)
 Frame = +1

Query  208   MEVKAAFGEVVPCMAMVMVEACTIFLTIMASTAMAKFGTNPFVFVVYTNALASIFLVPYS  387
             M VKA   +++PC AMV++E CTIFLTIMAST M++ G +PFVFVVYTNAL+SI L+PYS
Sbjct  27    MGVKAVVEDILPCTAMVLIEICTIFLTIMASTTMSRLGMSPFVFVVYTNALSSIILLPYS  86

Query  388   IIYHRRDKAQEQlftfplllrlfflglIGVTISQNLAFVGLSYSSPIAACGTANIVPALS  567
              +YHRRDK Q  LFTFPLLLR+  LGL+GVTI+QNLAF GLSYSSPI ACG AN +PA +
Sbjct  87    FLYHRRDKIQAPLFTFPLLLRVSLLGLVGVTIAQNLAFAGLSYSSPIVACGMANQIPAFT  146

Query  568   FILAIILRRTKIDWESGGSQARMIGALICTVGTISLIFYRGPVVNNYSPTFLHLSTTQFV  747
             FILAI LR+ K+D +S GSQAR+IG+LI  +G +S+ +Y+GPVV  YSP FL L+  + +
Sbjct  147   FILAIFLRKIKVDLKSQGSQARIIGSLISIMGALSITYYKGPVVKQYSPFFLQLARPRLL  206

Query  748   FSSSTNQQNWVLGCLCFIAASLTLSIWNIIQVGTIRIYPQVMKIMCVYSLFGTVQSGALS  927
                ++  +NWVLGC  F AAS +L IWNIIQ GTIR +PQVMKI+ +Y+LFGT+QS  L+
Sbjct  207   AVFTSTHENWVLGCFLFAAASFSLCIWNIIQAGTIRKHPQVMKIVFLYTLFGTIQSAILA  266

Query  928   LFIVRDLNAWRLGLNFQLIVILLTAIFGSIIRSSVQLWCMRMKGPSFPLIFKPVGIVVAS  1107
             L + +DL  WRL LN +L+V++LTAIFGS+IRSSVQ+WCMR+KG SFPL FKPVG+  AS
Sbjct  267   LLMEKDLRVWRLELNMELLVVVLTAIFGSLIRSSVQMWCMRLKGASFPLFFKPVGVPTAS  326

Query  1108  SCGCLFFADTFHYGSMFSAFICGMGYYTTIWGQLKDEEI-QQIKGSSVSLPDEKVPLLQ-  1281
             +CGCL FA+TFHYGSMFSA ICG+GYYTT+WGQLKD+E  + IKGS+ +  DEKVPLLQ 
Sbjct  327   TCGCLLFAETFHYGSMFSAIICGLGYYTTLWGQLKDDETNKNIKGSTSTTSDEKVPLLQE  386

Query  1282  ------QSQDDSPV  1305
                   + ++DSPV
Sbjct  387   KEVEEEEEEEDSPV  400



>ref|XP_009765301.1| PREDICTED: WAT1-related protein At1g70260-like [Nicotiana sylvestris]
Length=370

 Score =   462 bits (1190),  Expect = 4e-156, Method: Compositional matrix adjust.
 Identities = 232/358 (65%), Positives = 290/358 (81%), Gaps = 1/358 (0%)
 Frame = +1

Query  205   AMEVKAAFGEVVPCMAMVMVEACTIFLTIMASTAMAKFGTNPFVFVVYTNALASIFLVPY  384
              + V  A GE++PC AMV++EA TIFLTIMASTAM+KFG + F+FVVYTNAL+ I L+PY
Sbjct  2     GVRVANAIGEMLPCTAMVIIEAVTIFLTIMASTAMSKFGMSSFIFVVYTNALSFILLIPY  61

Query  385   SIIYHRRDKAQEQlftfplllrlfflglIGVTISQNLAFVGLSYSSPIAACGTANIVPAL  564
             S+ +HRRDK  E LFT PLLLR+FFLGL+GVTI+QNLAF GLSYSSPI ACG AN++PA 
Sbjct  62    SLFFHRRDKTDEPLFTLPLLLRVFFLGLVGVTIAQNLAFAGLSYSSPIVACGAANMIPAF  121

Query  565   SFILAIILRRTKIDWESGGSQARMIGALICTVGTISLIFYRGPVVNNYSPTFLHLSTTQF  744
             SFI+AIILR+ KIDW S GSQAR++G LI  VG +S+ F +GP VN YSP+FL L+  Q 
Sbjct  122   SFIVAIILRKIKIDWTSQGSQARVVGTLISIVGILSMTFSKGPKVNKYSPSFLQLARPQL  181

Query  745   VFSSSTNQQNWVLGCLCFIAASLTLSIWNIIQVGTIRIYPQVMKIMCVYSLFGTVQSGAL  924
             +  +ST++ NWVLGC  F AAS  L+IWNIIQ G+ + +PQVMKI C+Y+LFGT+QS   
Sbjct  182   LVFTSTHE-NWVLGCFLFAAASFALTIWNIIQAGSSKKHPQVMKITCLYTLFGTIQSAVF  240

Query  925   SLFIVRDLNAWRLGLNFQLIVILLTAIFGSIIRSSVQLWCMRMKGPSFPLIFKPVGIVVA  1104
             +LF+  +L+AWRL LNF+L+VI+LTAIFGS+IRSSVQ+WCMR+KGPS+ L FKPVG+ VA
Sbjct  241   ALFMENNLSAWRLKLNFELLVIVLTAIFGSLIRSSVQMWCMRLKGPSYALFFKPVGVPVA  300

Query  1105  SSCGCLFFADTFHYGSMFSAFICGMGYYTTIWGQLKDEEIQQIKGSSVSLPDEKVPLL  1278
             S+CGC+ FA TFHYGSM SA ICG+GYYTT+WGQLK++E ++    +VS  DEKVP L
Sbjct  301   STCGCVLFAATFHYGSMLSACICGLGYYTTLWGQLKEDETKKDIKGNVSTSDEKVPFL  358



>ref|XP_006355961.1| PREDICTED: WAT1-related protein At1g70260-like [Solanum tuberosum]
Length=372

 Score =   452 bits (1163),  Expect = 5e-152, Method: Compositional matrix adjust.
 Identities = 231/351 (66%), Positives = 287/351 (82%), Gaps = 3/351 (1%)
 Frame = +1

Query  232   EVVPCMAMVMVEACTIFLTIMASTAMAKFGTNPFVFVVYTNALASIFLVPYSIIYHRRDK  411
             +++PC+AMV++E CTIFLTIMAST+M++ G + +VFVVYTNAL+SI L+P S  YHRRDK
Sbjct  6     DILPCIAMVIIEMCTIFLTIMASTSMSRLGMSSYVFVVYTNALSSIILLPCSYFYHRRDK  65

Query  412   AQEQlftfplllrlfflglIGVTISQNLAFVGLSYSSPIAACGTANIVPALSFILAIILR  591
              Q  LFTFP+L+R+F LGL+GVTI+QNLAF GLSYSSPI ACG AN+VPAL+FILAI LR
Sbjct  66    IQASLFTFPILIRVFILGLVGVTIAQNLAFAGLSYSSPIVACGMANMVPALTFILAIFLR  125

Query  592   RTKIDWESGGSQARMIGALICTVGTISLIFYRGPVVNNYSPTFLHLSTTQFVFSSSTNQQ  771
             + +ID +S GSQARMIG LI  +G + + +Y+G VV  YSPTFLHL+    +  +ST ++
Sbjct  126   KIRIDVKSQGSQARMIGTLISIIGGLLMTYYKGGVVKQYSPTFLHLANPHLLVFTST-RE  184

Query  772   NWVLGCLCFIAASLTLSIWNIIQVGTIRIYPQVMKIMCVYSLFGTVQSGALSLFIVRDLN  951
             NWVLGC  F +ASL L IWNIIQVGTIR YP VMK++ +Y+LFGT+QS   +L + +DLN
Sbjct  185   NWVLGCFLFASASLALCIWNIIQVGTIRKYPHVMKLVFLYTLFGTIQSAIFALVMEKDLN  244

Query  952   AWRLGLNFQLIVILLTAIFGSIIRSSVQLWCMRMKGPSFPLIFKPVGIVVASSCGCLFFA  1131
             AW+L LN +L+VI+LTAIFGS+IRSSVQ+WCMR+KG SFPL FKPVGI  AS+CGCL FA
Sbjct  245   AWKLELNMELLVIVLTAIFGSLIRSSVQMWCMRLKGSSFPLFFKPVGIPTASACGCLLFA  304

Query  1132  DTFHYGSMFSAFICGMGYYTTIWGQLKDEEI-QQIKGSSV-SLPDEKVPLL  1278
             DTFHYGSM SA ICGMGY+TT+WGQLKD+E  + IKGS + +  DEKVPLL
Sbjct  305   DTFHYGSMLSAIICGMGYFTTLWGQLKDDETSKNIKGSILPTTSDEKVPLL  355



>ref|XP_004238693.1| PREDICTED: WAT1-related protein At1g70260 [Solanum lycopersicum]
Length=372

 Score =   445 bits (1145),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 226/351 (64%), Positives = 285/351 (81%), Gaps = 3/351 (1%)
 Frame = +1

Query  232   EVVPCMAMVMVEACTIFLTIMASTAMAKFGTNPFVFVVYTNALASIFLVPYSIIYHRRDK  411
             +++PC+AMV++E CTIFLTIMAST+M++ G + +VFVVYTNAL+SI L+P S  YHRRDK
Sbjct  6     DILPCIAMVIIEMCTIFLTIMASTSMSRLGMSSYVFVVYTNALSSIILLPSSYFYHRRDK  65

Query  412   AQEQlftfplllrlfflglIGVTISQNLAFVGLSYSSPIAACGTANIVPALSFILAIILR  591
              Q  LFTFP+L+R+F LGL+GVTI+QNLAF GLSYSSPI ACG AN+VPAL+FILAI LR
Sbjct  66    IQASLFTFPILIRVFILGLVGVTIAQNLAFAGLSYSSPIVACGMANMVPALTFILAIFLR  125

Query  592   RTKIDWESGGSQARMIGALICTVGTISLIFYRGPVVNNYSPTFLHLSTTQFVFSSSTNQQ  771
             + +ID +S GSQAR+IG LI  +G I + +Y+G VV  Y+PTFLHL+    +  +ST++ 
Sbjct  126   KIRIDVKSQGSQARIIGTLISIIGGILMTYYKGGVVKQYTPTFLHLANPHLLVFTSTHE-  184

Query  772   NWVLGCLCFIAASLTLSIWNIIQVGTIRIYPQVMKIMCVYSLFGTVQSGALSLFIVRDLN  951
             NWVLGC  F +ASL L IWNIIQVGTI+ YP VMK++ +Y+ FGT+QS   +L + +DLN
Sbjct  185   NWVLGCFLFASASLALCIWNIIQVGTIKKYPHVMKLVFLYTFFGTIQSAIFALVMEKDLN  244

Query  952   AWRLGLNFQLIVILLTAIFGSIIRSSVQLWCMRMKGPSFPLIFKPVGIVVASSCGCLFFA  1131
             AW+L LN +L+VI+LTAIFGS+IRS+VQ+WCMR+KG SFPL FKPVGI  AS+CGCL FA
Sbjct  245   AWKLELNMELLVIVLTAIFGSLIRSNVQMWCMRLKGSSFPLFFKPVGIPTASACGCLLFA  304

Query  1132  DTFHYGSMFSAFICGMGYYTTIWGQLKDEEI-QQIKGSSV-SLPDEKVPLL  1278
             DTFHYGSM SA ICGMGY+TT+WGQLKD+E  + IKG  + +  DEKVPLL
Sbjct  305   DTFHYGSMLSAIICGMGYFTTLWGQLKDDETSKNIKGRILPTTSDEKVPLL  355



>ref|XP_010319590.1| PREDICTED: WAT1-related protein At1g70260-like [Solanum lycopersicum]
Length=358

 Score =   443 bits (1140),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 214/354 (60%), Positives = 290/354 (82%), Gaps = 0/354 (0%)
 Frame = +1

Query  235   VVPCMAMVMVEACTIFLTIMASTAMAKFGTNPFVFVVYTNALASIFLVPYSIIYHRRDKA  414
             ++PC +M+++EAC+IFLTIMAST M+K G + FVFVVYTNAL+ I L+P+SI +H+ +K 
Sbjct  1     MLPCTSMIIIEACSIFLTIMASTTMSKLGMSSFVFVVYTNALSFILLIPFSIFFHKNNKI  60

Query  415   QEQlftfplllrlfflglIGVTISQNLAFVGLSYSSPIAACGTANIVPALSFILAIILRR  594
             +E LFTFPL+LR FFLGL+GVTI+QNLAFVGLSYSSPI ACG AN++PA SFI+AIILR+
Sbjct  61    EEPLFTFPLVLRAFFLGLVGVTIAQNLAFVGLSYSSPIVACGAANMIPAFSFIIAIILRK  120

Query  595   TKIDWESGGSQARMIGALICTVGTISLIFYRGPVVNNYSPTFLHLSTTQFVFSSSTNQQN  774
              +ID +  GS  R+IG+LI  +G +++ FY+GPVV  +SP+FLHL+T+  +F  ++  +N
Sbjct  121   IRIDLKRQGSIVRVIGSLISIMGILAMTFYKGPVVKQHSPSFLHLATSPHLFIFTSTHEN  180

Query  775   WVLGCLCFIAASLTLSIWNIIQVGTIRIYPQVMKIMCVYSLFGTVQSGALSLFIVRDLNA  954
             WVLGC  F++AS  L IWNIIQVGT + +P VMKI C+Y+LFGT+QS  L+LF+ +D++ 
Sbjct  181   WVLGCFLFVSASFALVIWNIIQVGTSKKHPHVMKITCLYTLFGTIQSALLALFMEKDVSV  240

Query  955   WRLGLNFQLIVILLTAIFGSIIRSSVQLWCMRMKGPSFPLIFKPVGIVVASSCGCLFFAD  1134
             W+L L+ +L+VI+LTAIFGS+IRS+VQ+WC R+KGPS+ L FKPVG+ VAS+CGC+ FA 
Sbjct  241   WKLKLDMELLVIVLTAIFGSLIRSNVQIWCSRLKGPSYILYFKPVGVPVASTCGCVLFAA  300

Query  1135  TFHYGSMFSAFICGMGYYTTIWGQLKDEEIQQIKGSSVSLPDEKVPLLQQSQDD  1296
             TFHYGSM SA ICG+GYYTT+WGQLK++E  + K  +V+  DE+VPLLQ+ Q++
Sbjct  301   TFHYGSMLSACICGLGYYTTLWGQLKEDETMKNKKGNVTTSDERVPLLQEQQEE  354



>ref|XP_011071064.1| PREDICTED: WAT1-related protein At1g70260 [Sesamum indicum]
Length=363

 Score =   417 bits (1072),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 219/365 (60%), Positives = 273/365 (75%), Gaps = 8/365 (2%)
 Frame = +1

Query  214   VKAAFGEVVPCMAMVMVEACTIFLTIMASTAMAKFGTNPFVFVVYTNALASIFLVPYSII  393
             +KA  GEV+PC AMV+VE C I LTIMASTAMA+ G +PFVFVVYTNAL SI L+P+S  
Sbjct  1     MKAVIGEVLPCAAMVLVEGCIIGLTIMASTAMAR-GMSPFVFVVYTNALGSIILLPFSFF  59

Query  394   YHRRDKAQEQlftfplllrlfflglIGVTISQNLAFVGLSYSSPIAACGTANIVPALSFI  573
             YHR ++++E LFT P LLR+FFLGLIG+TI+QNLAFVGLSYSSPI ACG AN +PAL+FI
Sbjct  60    YHRDNRSEESLFTTPFLLRVFFLGLIGITIAQNLAFVGLSYSSPIVACGMANQIPALTFI  119

Query  574   LAIILRRTKIDWESGGSQARMIGALICTVGTISLIFYRGPVVNNYS-PTFLHLSTTQFVF  750
             L IILR+ + DW   GS+AR+IG+LI   G IS+  Y+GP + N+S P+    +    VF
Sbjct  120   LGIILRKARFDWRRPGSKARLIGSLISLGGAISITLYKGPTIRNHSSPSLSAAAPRLLVF  179

Query  751   SSSTNQQNWVLGCLCFIAASLTLSIWNIIQVGTIRIYPQVMKIMCVYSLFGTVQSGALSL  930
             SS    +NWVLGCL F A+S+TL+IWN +QVGT+++  QVMKI+  YS FGTVQ+  L+ 
Sbjct  180   SSP--HENWVLGCLLFAASSVTLTIWNFVQVGTVKMCSQVMKIISFYSFFGTVQTALLAF  237

Query  931   FIVRDLNAWRLGLNFQLIVILLTAIFGSIIRSSVQLWCMRMKGPSFPLIFKPVGIVVASS  1110
             F+ RD NAWRL LNF+L++I+LTAIF S+IRSSVQ+WC R+KGP F   FKP GI  AS+
Sbjct  238   FLERDPNAWRLHLNFELLIIILTAIFSSVIRSSVQIWCTRLKGPYFVPAFKPFGIPYAST  297

Query  1111  CGCLFFADTFHYGSMFSAFICGMGYYTTIWGQLKDEEIQQIKGS----SVSLPDEKVPLL  1278
              G L F DTFHYGSM  AFICG+GYYT  WGQ+KDEE  +        + S+ D+KVPLL
Sbjct  298   FGSLLFPDTFHYGSMMGAFICGVGYYTVFWGQIKDEETHKSDDEGKIVNSSMDDQKVPLL  357

Query  1279  QQSQD  1293
             Q+   
Sbjct  358   QEDSQ  362



>gb|EYU22474.1| hypothetical protein MIMGU_mgv1a022660mg [Erythranthe guttata]
Length=388

 Score =   372 bits (955),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 211/388 (54%), Positives = 269/388 (69%), Gaps = 28/388 (7%)
 Frame = +1

Query  214   VKAAFGEVVPCMAMVMVEACTIFLTIMASTAMAKFGTNPFVFVVYTNALASIFLVPYSII  393
             +KA  GEV+PC AMV+VE   I LTIMASTAMA+ G +P+VFVVYTNAL S  L+ YS  
Sbjct  5     MKAVLGEVLPCTAMVVVEGLIIGLTIMASTAMAR-GMSPYVFVVYTNALGSFILLLYSFF  63

Query  394   YHRRDKAQEQlftfplllrlfflglIGVTISQNLAFVGLSYSSPIAACGTANIVPALSFI  573
             + R D+++E  FT P  LR+  LG +G+TI+QNLAFVGLSYSSPI ACG AN +PA+SFI
Sbjct  64    FDR-DRSEEPFFTLPFFLRVCLLGFVGITIAQNLAFVGLSYSSPIVACGMANQIPAMSFI  122

Query  574   LAIILRRTKIDWESGGSQARMIGALICTVGTISLIFYRGPVVNNYSPTFLHLSTTQFVFS  753
             L IILR  K DW+S GS+AR+IG+LI   G ISL  Y+GP + ++S   L L  T    +
Sbjct  123   LGIILRTAKFDWKSTGSRARLIGSLISFTGAISLTLYKGPTIRSHSSPSLSLHKTAAAAA  182

Query  754   S------------STNQQNWVLGCLCFIAASLTLSIWNIIQVGTIRIYPQVMKIMCVYSL  897
                          S+  +NW+LGC  F A+SLTL IWNIIQVGT+++  Q+MKI+ +Y+ 
Sbjct  183   LVVVPPPPRLLVFSSPHENWILGCALFAASSLTLVIWNIIQVGTVKMCSQIMKIISLYTF  242

Query  898   FGTVQSGALS-LFIVRDLNAWRLGLNFQLIVILLTAIFGSIIRSSVQLWCMRMKGPSFPL  1074
             FGTVQS  L+ LF+ RDL AW+L LNF+L++I+LTAIF S IRSS+Q+WC ++KGP F  
Sbjct  243   FGTVQSALLAILFLERDLTAWKLELNFELLIIVLTAIFSSAIRSSIQIWCTKLKGPYFVP  302

Query  1075  IFKPVGIVVASSCGCLFFADTFHYGSMFSAFICGMGYYTTIWGQLKDEEIQ---------  1227
              FKP GI  AS+ G L FADTFHYGSM  AF+CG+GYYT +WGQ+KD+E           
Sbjct  303   AFKPFGIPYASTFGSLLFADTFHYGSMMGAFVCGVGYYTVLWGQIKDDEAHNKSDNNKNN  362

Query  1228  --QIKGSSVSLPDEKVPLLQQSQDDSPV  1305
                 K +S S+ D +VPLL+    DSPV
Sbjct  363   NNNGKINSSSIDDVRVPLLE--DQDSPV  388



>gb|EYU22473.1| hypothetical protein MIMGU_mgv1a008125mg [Erythranthe guttata]
Length=384

 Score =   370 bits (951),  Expect = 7e-120, Method: Compositional matrix adjust.
 Identities = 206/382 (54%), Positives = 269/382 (70%), Gaps = 26/382 (7%)
 Frame = +1

Query  214   VKAAFGEVVPCMAMVMVEACTIFLTIMASTAMAKFGTNPFVFVVYTNALASIFLVPYSII  393
             +KA  GEV+PC AMV+VE C I LTIMASTA+A+ G +P+VFVVYTNAL SI L+ YS  
Sbjct  6     MKAVLGEVLPCTAMVVVEGCIIGLTIMASTAIAR-GMSPYVFVVYTNALGSIILLLYSFF  64

Query  394   YHRRDKAQEQlftfplllrlfflglIGVTISQNLAFVGLSYSSPIAACGTANIVPALSFI  573
             +H+ D++    FT P  LR+F LG +G+T++QNLAFVGLSYSSPI ACG AN +PA+SFI
Sbjct  65    FHK-DRSGGPFFTLPFFLRVFLLGFVGITMAQNLAFVGLSYSSPIVACGMANQIPAISFI  123

Query  574   LAIILRRTKIDWESGGSQARMIGALICTVGTISLIFYRGPVVNNYS-PTFLHLSTTQ---  741
             L IILR  K +W S GS+AR++G+LI   G ISL  Y+GP + N+S P+ L         
Sbjct  124   LGIILRTVKFNWRSTGSRARLVGSLISFTGAISLTLYKGPTIKNHSSPSLLMAGVAAAPP  183

Query  742   -----FVFSSSTNQQNWVLGCLCFIAASLTLSIWNIIQVGTIRIYPQVMKIMCVYSLFGT  906
                   VF+S+   +NWVLGC+ F A+SLT+ IWNIIQVGT+++  QVMKI+ +Y+ FGT
Sbjct  184   PPPPLLVFTST--HENWVLGCVLFAASSLTMVIWNIIQVGTMKMCSQVMKIISLYTFFGT  241

Query  907   VQSGALS-LFIVRDLNAWRLGLNFQLIVILLTAIFGSIIRSSVQLWCMRMKGPSFPLIFK  1083
             VQS  L+ LF+ RDL AW+L LNF+L++I+LTAIF S IRSS+Q+WC ++KGP F   FK
Sbjct  242   VQSALLAILFLERDLTAWKLDLNFELLIIVLTAIFSSAIRSSIQIWCTKLKGPYFVPAFK  301

Query  1084  PVGIVVASSCGCLFFADTFHYGSMFSAFICGMGYYTTIWGQLKDEE-----------IQQ  1230
             P GI  AS+ G L F  TFHYGS+  AF+CG+GYYT +WGQ+KD+E              
Sbjct  302   PFGIPYASTFGSLLFPYTFHYGSIMGAFVCGVGYYTVLWGQIKDDEAYNKLDNNKNKNNN  361

Query  1231  IKGSSVSLPDEKVPLLQQSQDD  1296
              K +S ++ D +VPLL+  QD 
Sbjct  362   GKINSSTIDDVRVPLLED-QDS  382



>emb|CDP00196.1| unnamed protein product [Coffea canephora]
Length=368

 Score =   350 bits (897),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 195/369 (53%), Positives = 256/369 (69%), Gaps = 9/369 (2%)
 Frame = +1

Query  214   VKAAFGEVVPCMAMVMVEACTIFLTIMASTAMAKFGTNPFVFVVYTNALASIFLVPYSII  393
             ++   GE +P   M ++E CTI LTIMA T +++ G +PFVFVVYTNAL SI L+     
Sbjct  4     MRTVLGEAIPSTVMFIMEFCTISLTIMAKTIISR-GMSPFVFVVYTNALGSILLL-LYSC  61

Query  394   YHRRDKAQEQlftfplllrlfflglIGVTISQNLAFVGLSYSSPIAACGTANIVPALSFI  573
                R+++++ L +F LL R+F LGLIG+T++QNLAF+GLSY SPI ACG  N++PA SFI
Sbjct  62    LCYRNQSEQPLLSFQLLPRVFLLGLIGITVAQNLAFLGLSYGSPIVACGMGNLIPAFSFI  121

Query  574   LAIILRRTKIDWESGGSQARMIGALICTVGTISLIFYRGPVVNNYS-PTF-LHLSTTQFV  747
             LAII+RR + DW+S  SQ + IG +I  VG  S+  Y+GPVV     P+F L L     +
Sbjct  122   LAIIIRRKENDWKSLSSQVKAIGTVISFVGAASVALYKGPVVKQSPLPSFSLQLIPPPLL  181

Query  748   FSSSTNQQNWVLGCLCFIAASLTLSIWNIIQVGTIRIYPQVMKIMCVYSLFGTVQSGALS  927
               SS   +NW+LGC+   AAS+ +S+WNIIQVGT+  YPQVMKI+ +YSL GT+ S  LS
Sbjct  182   IFSSPQDENWILGCVLLAAASVAISVWNIIQVGTVEKYPQVMKIVSLYSLVGTLLSAILS  241

Query  928   LFIVRDLNAWRLGLNFQLIVILLTAIFGSIIRSSVQLWCMRMKGPSFPLIFKPVGIVVAS  1107
             + I RD++AW+L L+ +L+VI+LT IFGS+IRSSV LWCM+ KGP F  IFKPVGI +AS
Sbjct  242   VIIERDVDAWKLKLDMELLVIILTGIFGSVIRSSVHLWCMQKKGPLFASIFKPVGIPIAS  301

Query  1108  SCGCLFFADTFHYGSMFSAFICGMGYYTTIWGQL---KDEEIQQIKGSSVSLPDEKVPLL  1278
               GC  FADTFHYGS+  A  CG+G+YT IWGQ+    +  I+  K  S    D+K PLL
Sbjct  302   MFGCFLFADTFHYGSIIGALACGLGHYTLIWGQIMGYDEAGIKNHKSRSSPSDDQKTPLL  361

Query  1279  QQSQDDSPV  1305
             Q  Q+DS V
Sbjct  362   Q--QEDSQV  368



>ref|XP_002315812.2| nodulin MtN21 family protein [Populus trichocarpa]
 gb|EEF01983.2| nodulin MtN21 family protein [Populus trichocarpa]
Length=358

 Score =   342 bits (878),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 185/364 (51%), Positives = 254/364 (70%), Gaps = 9/364 (2%)
 Frame = +1

Query  208   MEVKAAFGEVVPCMAMVMVEACTIFLTIMASTAMAKFGTNPFVFVVYTNALASIFLVPYS  387
             M V +  GEV P   MV++E CTI LTIMA T M++ G +PFVFVVYTNAL ++ L+PYS
Sbjct  1     MGVGSKLGEVAPFTVMVIMEGCTIALTIMAKTVMSR-GMSPFVFVVYTNALGTLILLPYS  59

Query  388   IIYHRRDKAQEQlftfplllrlfflglIGVTISQNLAFVGLSYSSPIAACGTANIVPALS  567
             ++YHR ++A++ LFT P+ LR FFLGL G+ +SQNLAFVGLSYSSPI  C    ++PA S
Sbjct  60    VLYHR-ERAEQPLFTLPVFLRFFFLGLTGIALSQNLAFVGLSYSSPIVVCAMGLLIPAFS  118

Query  568   FILAIILRRTKIDWESGGSQARMIGALICTVGTISLIFYRGPVV--NNYSPTFLHLSTTQ  741
             FIL+++LRR+K++W     Q ++IG L+  +G IS++ Y+GP +  ++ S    H     
Sbjct  119   FILSVVLRRSKVEWRCSSFQFKVIGTLVSIMGAISVVIYKGPYIRPSSSSQKLQHSEHQL  178

Query  742   FVFSSSTNQQNWVLGCLCFIAASLTLSIWNIIQVGTIRIYPQVMKIMCVYSLFGTVQSGA  921
             FVF SS +  NW+LGC+   A+   +S+WNIIQ+GTI++YPQVMKI   YSL GT+Q   
Sbjct  179   FVFYSSPD--NWILGCMLLAASFFCVSLWNIIQLGTIKLYPQVMKIASFYSLAGTIQCAI  236

Query  922   LSLFIVRDLNAWRLGLNFQLIVILLTAIFGSIIRSSVQLWCMRMKGPSFPLIFKPVGIVV  1101
              SL + RDLNAW+L LN +L++I++TAIFGS++RSSVQ+ C RMKGP +  +F+P  I  
Sbjct  237   FSLIVERDLNAWKLRLNMELLLIVITAIFGSVVRSSVQISCTRMKGPFYVPLFQPFRIFW  296

Query  1102  ASSCGCLFFADTFHYGSMFSAFICGMGYYTTIWGQLKDEEIQQIKGSSVSLPDEKVPLLQ  1281
             A+  G  FF +  HYGS+  A I G+GYYT  WGQ++ +E Q+    SV   DEK PLLQ
Sbjct  297   ATFFGVGFFVNGLHYGSVIGAVISGVGYYTVSWGQMRGDEKQE---ESVRSSDEKNPLLQ  353

Query  1282  QSQD  1293
             +  +
Sbjct  354   EDSE  357



>ref|XP_011021652.1| PREDICTED: WAT1-related protein At1g70260-like [Populus euphratica]
Length=358

 Score =   341 bits (874),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 182/364 (50%), Positives = 253/364 (70%), Gaps = 9/364 (2%)
 Frame = +1

Query  208   MEVKAAFGEVVPCMAMVMVEACTIFLTIMASTAMAKFGTNPFVFVVYTNALASIFLVPYS  387
             M V +  GE+ P   MV++E CTI LTIMA T M++ G +PFVFVVYTNA+ ++ L+PYS
Sbjct  1     MGVGSKLGEIAPFTVMVIMEGCTIALTIMAKTVMSR-GMSPFVFVVYTNAIGTLILLPYS  59

Query  388   IIYHRRDKAQEQlftfplllrlfflglIGVTISQNLAFVGLSYSSPIAACGTANIVPALS  567
              +YHR ++A++ LFT P+ LR FFLGL G+ +SQNLAFVGLSYSSPI  C    ++PA S
Sbjct  60    FLYHR-ERAEQPLFTLPVFLRFFFLGLTGIALSQNLAFVGLSYSSPIVVCAMGLLIPAFS  118

Query  568   FILAIILRRTKIDWESGGSQARMIGALICTVGTISLIFYRGPVV--NNYSPTFLHLSTTQ  741
             FIL+++LRR+K++W     Q ++IG L+  +G IS++ Y+GP +  ++ S    H     
Sbjct  119   FILSVVLRRSKVEWRCSSFQFKVIGTLVSIMGAISVVIYKGPYIRPSSSSQKLQHSEHQL  178

Query  742   FVFSSSTNQQNWVLGCLCFIAASLTLSIWNIIQVGTIRIYPQVMKIMCVYSLFGTVQSGA  921
             FVF SS   +NW+LGC+   A+   +S+WNIIQVGTI++YPQVMKI   YSL GT+Q   
Sbjct  179   FVFYSSP--ENWILGCMLLAASFFCVSLWNIIQVGTIKLYPQVMKIASFYSLAGTIQCAI  236

Query  922   LSLFIVRDLNAWRLGLNFQLIVILLTAIFGSIIRSSVQLWCMRMKGPSFPLIFKPVGIVV  1101
              SL + RDLNAW+L LN +L++I++TAIFGS++R SVQ+ C RMKGP +  +F+P  I  
Sbjct  237   FSLIVERDLNAWKLKLNMELLLIIITAIFGSVVRGSVQISCTRMKGPFYVPLFQPFRIFW  296

Query  1102  ASSCGCLFFADTFHYGSMFSAFICGMGYYTTIWGQLKDEEIQQIKGSSVSLPDEKVPLLQ  1281
             A+  G  FF +  HYGS+  A + G+GYYT +WGQ++ +E Q+    SV   DEK PLLQ
Sbjct  297   ATFFGVGFFVNGLHYGSVIGAVVSGVGYYTVLWGQMRGDEKQE---ESVRSSDEKNPLLQ  353

Query  1282  QSQD  1293
             +  +
Sbjct  354   EDSE  357



>ref|XP_010653180.1| PREDICTED: WAT1-related protein At1g70260 [Vitis vinifera]
Length=360

 Score =   318 bits (815),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 179/366 (49%), Positives = 248/366 (68%), Gaps = 11/366 (3%)
 Frame = +1

Query  208   MEVKAAFGEVVPCMAMVMVEACTIFLTIMASTAMAKFGTNPFVFVVYTNALASIFLVPYS  387
             MEV+    EV+P   MV++E CT+ LTIM  T MAK G + FVFVVY+NAL+SI L+PYS
Sbjct  1     MEVRMRLWEVIPFSVMVLMEGCTVGLTIMTKTVMAK-GMSQFVFVVYSNALSSIILLPYS  59

Query  388   IIYHRRDKAQEQlftfplllrlfflglIGVTISQNLAFVGLSYSSPIAACGTANIVPALS  567
             +I+ R    Q+  FTFPLL R FFLGL G+TI+Q  AF GLSYSSPI ACG  N++PA S
Sbjct  60    LIFRR---TQQSFFTFPLLTRFFFLGLTGITIAQIFAFTGLSYSSPILACGMGNLIPAFS  116

Query  568   FILAIILRRTKIDWESGGSQARMIGALICTVGTISLIFYRGPVVNN--YSPTFLHLS--T  735
             F+LAIILR TK+DW     QA++IG  I   G   +I Y+GP+V    +S  F HL    
Sbjct  117   FVLAIILRTTKLDWRVTSGQAKIIGTFISISGGTLMILYKGPLVRKTAFSAPFHHLELIP  176

Query  736   TQFVFSSSTNQQNWVLGCLCFIAASLTLSIWNIIQVGTIRIYPQVMKIMCVYSLFGTVQS  915
               F+FSS+   + W LG +    ASL+ S+W IIQVGT++ YP+ + I  +Y+  GT+QS
Sbjct  177   RHFIFSST--PEYWALGGILLAVASLSASVWGIIQVGTVKQYPEPITIAALYTSMGTIQS  234

Query  916   GALSLFIVRDLNAWRLGLNFQLIVILLTAIFGSIIRSSVQLWCMRMKGPSFPLIFKPVGI  1095
               ++    R+L+AW+L LN +L++I L+AIFGS IR SV +WCM  KGP +  +FKP GI
Sbjct  235   AIVAFVAERNLSAWKLELNMELLLIFLSAIFGSAIRCSVHIWCMHNKGPFYVPMFKPFGI  294

Query  1096  VVASSCGCLFFADTFHYGSMFSAFICGMGYYTTIWGQLKDEEIQQIKGSSVSLPDEKVPL  1275
             ++AS    +FF D+ HYGS+  A+I G+GYYT +WGQ+++++++   G  +   ++KVPL
Sbjct  295   IIASIASVIFFGDSLHYGSVIGAYIIGIGYYTLMWGQIREDDMKA-GGEGIDSSEQKVPL  353

Query  1276  LQQSQD  1293
             LQ+ + 
Sbjct  354   LQEEEQ  359



>gb|KDP21317.1| hypothetical protein JCGZ_21788 [Jatropha curcas]
Length=364

 Score =   318 bits (814),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 179/353 (51%), Positives = 235/353 (67%), Gaps = 3/353 (1%)
 Frame = +1

Query  232   EVVPCMAMVMVEACTIFLTIMASTAMAKFGTNPFVFVVYTNALASIFLVPYSIIYHRRDK  411
             E++P   MV++E CTI LTI+A TAM   G +PFVFVVYTN LA++ L+PYS +YHR ++
Sbjct  11    EIMPFAVMVILEGCTIALTILAKTAMTG-GLSPFVFVVYTNGLATLILLPYSFLYHR-ER  68

Query  412   AQEQlftfplllrlfflglIGVTISQNLAFVGLSYSSPIAACGTANIVPALSFILAIILR  591
              ++ LFT PLLLR FFLGLIG  ISQNL FVGLSYSSPI  C    ++PA SFILAI LR
Sbjct  69    TEKSLFTLPLLLRFFFLGLIGTCISQNLLFVGLSYSSPIVVCAMGLLIPAFSFILAIFLR  128

Query  592   RTKIDWESGGSQARMIGALICTVGTISLIFYRGPVVNNYSPTFLHLSTTQFVFSSSTNQQ  771
             R K++W S     ++IG LI  +G   + FY+GP V   S +   L   Q +F   +   
Sbjct  129   RIKLNWRSSSFHYKVIGTLISIIGAAVVDFYKGPFVQEASSSSFKLMQKQKLFVFYSTPD  188

Query  772   NWVLGCLCFIAASLTLSIWNIIQVGTIRIYPQVMKIMCVYSLFGTVQSGALSLFIVRDLN  951
             +WVLG L   A+SL +SIWNIIQ+GT++ YPQVMKI   YSL GTVQ    S  + RDL 
Sbjct  189   HWVLGGLLLAASSLCISIWNIIQMGTVKHYPQVMKIAAFYSLAGTVQCAIFSFVMERDLK  248

Query  952   AWRLGLNFQLIVILLTAIFGSIIRSSVQLWCMRMKGPSFPLIFKPVGIVVASSCGCLFFA  1131
             AW+L LN  L++I+LTAIF SI+RS+V +   RMKGP +  +F+P  +  A+  G  FFA
Sbjct  249   AWKLKLNMDLLLIVLTAIFNSIVRSNVHILFTRMKGPFYVPLFQPFRVFWATYFGVSFFA  308

Query  1132  DTFHYGSMFSAFICGMGYYTTIWGQLKD-EEIQQIKGSSVSLPDEKVPLLQQS  1287
             ++ HYGS+    ICG+GYYT  WG +K+ +E  +     V+  + KVPLLQ+ 
Sbjct  309   NSLHYGSIIGTVICGIGYYTVTWGNIKEVDEKYKENVEKVNSSEAKVPLLQED  361



>ref|XP_007044600.1| Nodulin MtN21 /EamA-like transporter family protein [Theobroma 
cacao]
 gb|EOY00432.1| Nodulin MtN21 /EamA-like transporter family protein [Theobroma 
cacao]
Length=368

 Score =   311 bits (797),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 178/368 (48%), Positives = 253/368 (69%), Gaps = 14/368 (4%)
 Frame = +1

Query  214   VKAAFGEVVPCMAMVMVEACTIFLTIMASTAMAKFGTNPFVFVVYTNALASIFLVPYSII  393
             ++   GEVVP   MV++E CTI LTI+A TA+   G +PFVFVVYTNA+ S+ L+P S I
Sbjct  4     LREKMGEVVPFTLMVIMEGCTIGLTILAKTAITG-GMSPFVFVVYTNAIGSLLLLPLSFI  62

Query  394   YHRRDKAQEQlftfplllrlfflglIGVTISQNLAFVGLSYSSPIAACGTANIVPALSFI  573
             +HR ++ ++ L TFPLL+R+FFLGL G+ +SQNLAFVGLSYSSPI  C    ++P+LSF+
Sbjct  63    FHR-ERTEQSLLTFPLLVRIFFLGLTGIAVSQNLAFVGLSYSSPIVVCAMGLLIPSLSFL  121

Query  574   LAIILRRTKIDWESGGSQARMIGALICTVGTISLIFYRGPVVNNYSPTFLH---LSTTQF  744
             L+II R T++DW +  SQA+++G LI   G   +  Y+GP +   S  + H   +    F
Sbjct  122   LSIIPRTTRLDWRNSSSQAKLMGTLISITGAAVVELYKGPFIRKSSYFYAHQLKVIPKLF  181

Query  745   VFSSSTNQQNWVLGCLCFIAASLTLSIWNIIQVGTIRIYPQVMKIMCVYSLFGTVQSGAL  924
             VF S+ +  NW+LG +   AASL++++WN+IQ+GT++ YPQVMK++  YSL GT+Q    
Sbjct  182   VFYSAPD--NWILGGILLAAASLSVAMWNVIQLGTVKQYPQVMKVVSFYSLAGTIQCLVF  239

Query  925   SLFIVRDLNAWRLGLNFQLIVILLTAIFGSIIRSSVQLWCMRMKGPSFPLIFKPVGIVVA  1104
             SL + RDLNAW+L LN +L++I++T +FGSIIRS+V L   RMKGP +  +FKP GIV A
Sbjct  240   SLIMERDLNAWKLKLNLELLLIVVTGVFGSIIRSNVHLAWSRMKGPFYVPMFKPFGIVFA  299

Query  1105  SSCGCLFFADTFHYGSMFSAFICGMGYYTTIWGQLKDEEIQQIKGSSVSLPDE-----KV  1269
             +  G  FF ++ HYGS+    I GMGYY  +WGQ+++EE++  K   V   D+     K 
Sbjct  300   TFFGVSFFTNSLHYGSVIGTLITGMGYYAVMWGQIREEELR--KERDVERTDDTSDQIKT  357

Query  1270  PLLQQSQD  1293
             PLLQ+ ++
Sbjct  358   PLLQEQEE  365



>emb|CDX68349.1| BnaA07g23890D [Brassica napus]
Length=373

 Score =   310 bits (793),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 175/376 (47%), Positives = 251/376 (67%), Gaps = 15/376 (4%)
 Frame = +1

Query  214   VKAAFGEVVPCMAMVMVEACTIFLTIMASTAMAKFGTNPFVFVVYTNALASIFLVPYSII  393
             +K   GE VP +AMV++EACTI LTIMA TA+   G +PFVFVVYTNAL SI L+P+S  
Sbjct  1     MKVKVGEFVPFVAMVIMEACTIALTIMAKTALTG-GMSPFVFVVYTNALGSILLLPFSFF  59

Query  394   YHRRDKAQEQlftfplllrlfflglIGVTISQNLAFVGLSYSSPIAACGTANIVPALSFI  573
             +HR+D+ +E +F++PL +R+FFLG  G+ + QNLAFVGLS+SSPI  C    ++P+ SF+
Sbjct  60    FHRKDRTKESIFSWPLFVRVFFLGFTGIFLFQNLAFVGLSFSSPIVVCAMGLLIPSFSFL  119

Query  574   LAIILRRTKIDWESGGSQARMIGALICTVGTISLIFYRGPVV---NNYSPTFLHLSTTQF  744
             L +IL R+K+DW +  ++AR++G +I   G  S   Y+GP +   ++ SPT L  S  + 
Sbjct  120   LNLILGRSKLDWRNTSTRARVMGTIISLSGAFSEELYKGPFIRPASSASPTRLLKSIPKL  179

Query  745   VFSSSTNQQNWVLGCLCFIAASLTLSIWNIIQVGTIRIYPQVMKIMCVYSLFGTVQSGAL  924
             +   +    NW LGC+   AA  ++S++N+IQ GT++ YP VMK+   YS+ GT+Q    
Sbjct  180   LVYYNI-PDNWFLGCIFLAAAVFSVSLFNVIQTGTVKKYPHVMKVASFYSIVGTIQCLIF  238

Query  925   SLFIVRDLNAWRLGLNFQLIVILLTAIFGSIIRSSVQLWCMRMKGPSFPLIFKPVGIVVA  1104
             SLF+ RDL+AW++  N+ L +I+ T IFGS+IR+SVQ+ C +MKGP +  +FKP GI  A
Sbjct  239   SLFMERDLSAWKIEPNYDLCLIIATGIFGSVIRTSVQVKCTQMKGPYYVPLFKPFGIFWA  298

Query  1105  SSCGCLFFADTFHYGSMFSAFICGMGYYTTIWGQLKDEEIQQ--------IKGSSVSLPD  1260
             +  G  FF ++ HYGS+  A I G+GYYT  WGQL++ E +Q        IK       D
Sbjct  299   TLFGTSFFVNSLHYGSVLGAVIGGVGYYTVSWGQLRETEEKQNSKDERKPIKTIHHHEDD  358

Query  1261  E-KVPLLQQSQDDSPV  1305
             E K+PLL  +Q++SPV
Sbjct  359   EYKIPLL-INQEESPV  373



>ref|XP_009104959.1| PREDICTED: WAT1-related protein At1g70260 isoform X2 [Brassica 
rapa]
Length=373

 Score =   308 bits (790),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 175/376 (47%), Positives = 249/376 (66%), Gaps = 15/376 (4%)
 Frame = +1

Query  214   VKAAFGEVVPCMAMVMVEACTIFLTIMASTAMAKFGTNPFVFVVYTNALASIFLVPYSII  393
             +K   GE VP +AMV++EACTI LTIMA TA+   G +PFVFVVYTNAL SI L+P+S  
Sbjct  1     MKVKVGEFVPFVAMVIMEACTIALTIMAKTALTG-GMSPFVFVVYTNALGSILLLPFSFF  59

Query  394   YHRRDKAQEQlftfplllrlfflglIGVTISQNLAFVGLSYSSPIAACGTANIVPALSFI  573
             +HR+D+ +E +F++PL +R+FFLG  G+ + QNLAFVGLS+SSPI  C    ++P+ SF+
Sbjct  60    FHRKDRTKESIFSWPLFVRVFFLGFTGIFLFQNLAFVGLSFSSPIVVCAMGLLIPSFSFL  119

Query  574   LAIILRRTKIDWESGGSQARMIGALICTVGTISLIFYRGPVVNNYS---PTFLHLSTTQF  744
             L +IL R+K+DW +  ++AR++G +I   G  S   Y+GP +   S   PT L  S  + 
Sbjct  120   LNLILGRSKLDWRNTSTRARVMGTIISLSGAFSEELYKGPFIRPASSAFPTRLLKSIPKL  179

Query  745   VFSSSTNQQNWVLGCLCFIAASLTLSIWNIIQVGTIRIYPQVMKIMCVYSLFGTVQSGAL  924
             +   +    NW LGC+   AA  ++S++N+IQ GT++ YP VMK+   YS+ GT+Q    
Sbjct  180   LVYYNI-PDNWFLGCIFLAAAVFSVSLFNVIQTGTVKKYPHVMKVASFYSIVGTIQCLIF  238

Query  925   SLFIVRDLNAWRLGLNFQLIVILLTAIFGSIIRSSVQLWCMRMKGPSFPLIFKPVGIVVA  1104
             SLF+ RDL+AW++  N+ L +I+ T IFGS+IR+SVQ+ C +MKGP +  +FKP GI  A
Sbjct  239   SLFMERDLSAWKIEPNYDLCLIIATGIFGSVIRTSVQVKCTQMKGPYYVPLFKPFGIFWA  298

Query  1105  SSCGCLFFADTFHYGSMFSAFICGMGYYTTIWGQLKDEEIQQ--------IKGSSVSLPD  1260
             +  G  FF ++ HYGS+  A I G+GYYT  WGQL++ E +Q        IK       D
Sbjct  299   TLFGTSFFVNSLHYGSVLGAVIGGVGYYTVSWGQLRETEEKQNSKDERKPIKTIHHHEDD  358

Query  1261  E-KVPLLQQSQDDSPV  1305
             E K+PLL  +Q++SPV
Sbjct  359   EYKIPLL-INQEESPV  373



>emb|CDY03759.1| BnaA02g14780D [Brassica napus]
Length=375

 Score =   308 bits (789),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 178/378 (47%), Positives = 249/378 (66%), Gaps = 15/378 (4%)
 Frame = +1

Query  208   MEVKAAFGEVVPCMAMVMVEACTIFLTIMASTAMAKFGTNPFVFVVYTNALASIFLVPYS  387
             MEVK    E VP MAMV++EACTI LTIMA TA+   G +PFVFVVYTNAL SI L+P+S
Sbjct  1     MEVKVRKQEFVPFMAMVIMEACTIALTIMAKTALTG-GMSPFVFVVYTNALGSILLLPFS  59

Query  388   IIYHRRDKAQEQlftfplllrlfflglIGVTISQNLAFVGLSYSSPIAACGTANIVPALS  567
             + +HR D+ +E +F++PL++R+FFLG  GV + QNLAFVGLS+SSPI  C    ++P+ S
Sbjct  60    LFFHRNDRTEESIFSWPLVVRVFFLGFTGVFLFQNLAFVGLSFSSPIVVCAMGLLIPSFS  119

Query  568   FILAIILRRTKIDWESGGSQARMIGALICTVGTISLIFYRGPVV---NNYSPTFLHLSTT  738
             F+L +IL R+K+D  +  ++A+++G +I   G      Y+GP +   ++ SP  L  S  
Sbjct  120   FLLNLILGRSKLDLRNTSTRAKVMGTVISLSGAFVEELYKGPFIRPASSPSPNHLLKSIP  179

Query  739   QFVFSSSTNQQNWVLGCLCFIAASLTLSIWNIIQVGTIRIYPQVMKIMCVYSLFGTVQSG  918
             + +   +    NW LGC+C  AA   +S++N++Q GT++ YP VMK+   YS+ GTVQ  
Sbjct  180   KLLVYYNL-PDNWFLGCICLAAAVFFVSLFNVVQTGTVKKYPHVMKVASFYSIVGTVQCL  238

Query  919   ALSLFIVRDLNAWRLGLNFQLIVILLTAIFGSIIRSSVQLWCMRMKGPSFPLIFKPVGIV  1098
               SL++ RDL+AW++  NF L +I+ T IFGS+IR+SV + C +MKGP +  +FKP GI 
Sbjct  239   IFSLYMERDLSAWKIEPNFDLFLIIATGIFGSVIRTSVHVKCTQMKGPYYVPLFKPFGIF  298

Query  1099  VASSCGCLFFADTFHYGSMFSAFICGMGYYTTIWGQLKD--------EEIQQIKGSSVSL  1254
              A+  G  FF ++ HYGS+  A I G+GYYT  WGQLK+        EE + IK      
Sbjct  299   WATLFGTSFFVNSLHYGSVLGAAIGGVGYYTVSWGQLKETEEKQNPKEERKPIKTIYHQE  358

Query  1255  PDE-KVPLLQQSQDDSPV  1305
              DE KVPLL  SQ++SPV
Sbjct  359   EDEYKVPLL-ISQEESPV  375



>emb|CDY42998.1| BnaC02g19720D [Brassica napus]
Length=375

 Score =   307 bits (787),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 179/378 (47%), Positives = 250/378 (66%), Gaps = 15/378 (4%)
 Frame = +1

Query  208   MEVKAAFGEVVPCMAMVMVEACTIFLTIMASTAMAKFGTNPFVFVVYTNALASIFLVPYS  387
             MEVK    E VP MAMV++EACTI LTIMA TA+   G +PFVFVVYTNAL SI L+P+S
Sbjct  1     MEVKVRKQEFVPFMAMVIMEACTIALTIMAKTALTG-GMSPFVFVVYTNALGSILLLPFS  59

Query  388   IIYHRRDKAQEQlftfplllrlfflglIGVTISQNLAFVGLSYSSPIAACGTANIVPALS  567
             + +HR D+ +E +F++PL++R+FFLG  GV + QNLAFVGLS+SSPIA C    ++P+ S
Sbjct  60    LFFHRNDRTEESIFSWPLVVRVFFLGFTGVFLFQNLAFVGLSFSSPIAVCAMGLLIPSFS  119

Query  568   FILAIILRRTKIDWESGGSQARMIGALICTVGTISLIFYRGPVV---NNYSPTFLHLSTT  738
             F+L +IL R+K+D  +  ++A+++G +I   G      Y+GP +   ++ SP  L L + 
Sbjct  120   FLLNLILGRSKLDLRNTSTRAKVMGTIISLSGAFVEELYKGPFIRPASSPSPDRL-LKSI  178

Query  739   QFVFSSSTNQQNWVLGCLCFIAASLTLSIWNIIQVGTIRIYPQVMKIMCVYSLFGTVQSG  918
               +F       NW LGC+   AA  ++S++N++Q GT++ YP VMK+   YS+ GTVQ  
Sbjct  179   PKLFIYYNLPDNWFLGCIFLAAAVFSVSLFNVVQTGTVKKYPHVMKVASFYSIVGTVQCL  238

Query  919   ALSLFIVRDLNAWRLGLNFQLIVILLTAIFGSIIRSSVQLWCMRMKGPSFPLIFKPVGIV  1098
               SL++ RDL+AW++  NF L +I+ T IFGS+IR+SV + C +MKGP +  +FKP GI 
Sbjct  239   FFSLYMERDLSAWKIEPNFDLFLIIATGIFGSVIRTSVHVKCTQMKGPYYVPLFKPFGIF  298

Query  1099  VASSCGCLFFADTFHYGSMFSAFICGMGYYTTIWGQLKD--------EEIQQIKGSSVSL  1254
              A+  G  FF ++ HYGS+  A I G+GYYT  WGQLK+        EE + IK      
Sbjct  299   WATLFGTSFFVNSLHYGSVLGAAIGGVGYYTVSWGQLKETEEKQNPKEERKPIKTIYHQE  358

Query  1255  PDE-KVPLLQQSQDDSPV  1305
              DE KVPLL  SQ++SPV
Sbjct  359   EDEYKVPLL-ISQEESPV  375



>emb|CDY23506.1| BnaC06g24750D [Brassica napus]
Length=373

 Score =   305 bits (782),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 175/378 (46%), Positives = 250/378 (66%), Gaps = 17/378 (4%)
 Frame = +1

Query  208   MEVKAAFGEVVPCMAMVMVEACTIFLTIMASTAMAKFGTNPFVFVVYTNALASIFLVPYS  387
             MEVK    E VP +AMV++EACTI LTIMA TA+   G +PFVFVVYTNAL ++ L+P+S
Sbjct  1     MEVKVR--EFVPFVAMVIMEACTIALTIMAKTALTG-GMSPFVFVVYTNALGAMLLLPFS  57

Query  388   IIYHRRDKAQEQlftfplllrlfflglIGVTISQNLAFVGLSYSSPIAACGTANIVPALS  567
               +HR+D+ +E +F +PLL R+F LG  G+ + QNLAFVGLS+SSPI  C    ++P+ S
Sbjct  58    FFFHRKDRTKESIFAWPLLARVFCLGFTGIFLFQNLAFVGLSFSSPIVVCAMGLLIPSFS  117

Query  568   FILAIILRRTKIDWESGGSQARMIGALICTVGTISLIFYRGPVV---NNYSPTFLHLSTT  738
             F+L +IL R+K+DW +  ++AR++G +I   G  +   Y+GP +   ++ SPT L  S  
Sbjct  118   FLLNLILGRSKLDWRNTSTRARVMGTIISLSGAFTEELYKGPFIRPASSASPTRLLNSIP  177

Query  739   QFVFSSSTNQQNWVLGCLCFIAASLTLSIWNIIQVGTIRIYPQVMKIMCVYSLFGTVQSG  918
             + +   +    NW LGC+   AA  ++S++N+IQ GT++ YP VMK+   YS+ GT+Q  
Sbjct  178   KLLVYYNI-PDNWFLGCIFLAAAVFSVSLFNVIQTGTVKKYPHVMKVASFYSIVGTIQCL  236

Query  919   ALSLFIVRDLNAWRLGLNFQLIVILLTAIFGSIIRSSVQLWCMRMKGPSFPLIFKPVGIV  1098
               SLF+ RDL+AW++  N+ L +I+ T IFGS+IR+SVQ+ C +MKGP +  +FKP GI 
Sbjct  237   IFSLFMERDLSAWKIEPNYDLCLIIATGIFGSVIRTSVQVKCTQMKGPYYVPLFKPFGIF  296

Query  1099  VASSCGCLFFADTFHYGSMFSAFICGMGYYTTIWGQLKD--------EEIQQIKGSSVSL  1254
              A+  G  FF ++ HYGS+  A I G+GYYT  WGQL++        EE + IK      
Sbjct  297   WATLFGTSFFVNSLHYGSVLGAVIGGVGYYTVSWGQLRETEKKQNPKEERKTIKTIHHHE  356

Query  1255  PDE-KVPLLQQSQDDSPV  1305
              DE KVPLL  +Q++SPV
Sbjct  357   DDEYKVPLL-INQEESPV  373



>ref|XP_006390904.1| hypothetical protein EUTSA_v10018724mg [Eutrema salsugineum]
 gb|ESQ28190.1| hypothetical protein EUTSA_v10018724mg [Eutrema salsugineum]
Length=375

 Score =   305 bits (780),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 175/379 (46%), Positives = 252/379 (66%), Gaps = 17/379 (4%)
 Frame = +1

Query  208   MEVKAAFGEVVPCMAMVMVEACTIFLTIMASTAMAKFGTNPFVFVVYTNALASIFLVPYS  387
             MEVK    E VP +AM ++EACTI LTIMA TA+   G +PFVFV+YTNA  S  L+P+S
Sbjct  1     MEVKVRREEFVPFVAMAIMEACTIALTIMAKTALTG-GMSPFVFVLYTNAFGSALLLPFS  59

Query  388   IIYHRRDKAQEQlftfplllrlfflglIGVTISQNLAFVGLSYSSPIAACGTANIVPALS  567
               +H+ ++ +E +F++PLL+R+FFLG  G+ + QNLAFVGLS+SSPI  C    ++P+ S
Sbjct  60    FFFHKNERTEESIFSWPLLVRVFFLGFTGIFLFQNLAFVGLSFSSPIVVCAMGLLMPSFS  119

Query  568   FILAIILRRTKIDWESGGSQARMIGALICTVGTISLIFYRGPVV---NNYSPT-FLHLST  735
             F+L++IL R+K+DW +  S+A+++G +I   G I    Y+GP +   ++ SPT FL+   
Sbjct  120   FLLSLILGRSKVDWRNTSSRAKVMGTIISISGAIVEELYKGPFIRPASSSSPTRFLNSIP  179

Query  736   TQFVFSSSTNQQNWVLGCLCFIAASLTLSIWNIIQVGTIRIYPQVMKIMCVYSLFGTVQS  915
               FV+ +  +  NW LGC+   AA  ++S++N++Q GT++ YP VMK+   YS+ GT+Q 
Sbjct  180   RLFVYYNIPD--NWFLGCIFLAAAVFSVSLFNVVQTGTVKNYPHVMKVASFYSIVGTIQC  237

Query  916   GALSLFIVRDLNAWRLGLNFQLIVILLTAIFGSIIRSSVQLWCMRMKGPSFPLIFKPVGI  1095
                SLF+ RDL AW++  NF L +I+ T IFGS+IR+SV + C +MKGP +  +FKP GI
Sbjct  238   LMFSLFMERDLTAWKIQPNFDLFLIIATGIFGSVIRTSVHVKCTQMKGPYYVPLFKPFGI  297

Query  1096  VVASSCGCLFFADTFHYGSMFSAFICGMGYYTTIWGQLKD--------EEIQQIKGSSVS  1251
               A+  G  FF ++ HYGS+  A I G+GYYT  WGQLK+        EE + IK +   
Sbjct  298   FWATLFGTSFFVNSLHYGSVLGAAIGGVGYYTVSWGQLKETEEKQNPKEERKPIKTTHHY  357

Query  1252  LPDE-KVPLLQQSQDDSPV  1305
               DE KVPLL  +Q++SPV
Sbjct  358   EEDEYKVPLL-INQEESPV  375



>ref|XP_010415702.1| PREDICTED: WAT1-related protein At1g70260 [Camelina sativa]
Length=375

 Score =   304 bits (779),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 175/379 (46%), Positives = 249/379 (66%), Gaps = 17/379 (4%)
 Frame = +1

Query  208   MEVKAAFGEVVPCMAMVMVEACTIFLTIMASTAMAKFGTNPFVFVVYTNALASIFLVPYS  387
             ME+K    E VP +AM ++EACTI LTIMA TA+   G +PFVFVVYTNA  SI L+P+S
Sbjct  1     MELKVRRDEFVPFVAMAIMEACTIALTIMAKTALTG-GMSPFVFVVYTNAFGSILLLPFS  59

Query  388   IIYHRRDKAQEQlftfplllrlfflglIGVTISQNLAFVGLSYSSPIAACGTANIVPALS  567
               +HR D+ ++ +F++PLL+R+FFLG  G+ + QNLAFVGLS+SSPI  C     +P+ S
Sbjct  60    FFFHRNDRTEQSIFSWPLLVRVFFLGFTGIFMFQNLAFVGLSFSSPIVLCAMGLQIPSFS  119

Query  568   FILAIILRRTKIDWESGGSQARMIGALICTVGTISLIFYRGPVV---NNYSPT-FLHLST  735
             F+L+I+L R+K+DW +  ++A+M+G +I   G      Y+GP +   ++ SPT FL    
Sbjct  120   FLLSILLGRSKLDWRNTSTRAKMMGTIISLSGAFVEELYKGPFIRPASSASPTRFLKSIP  179

Query  736   TQFVFSSSTNQQNWVLGCLCFIAASLTLSIWNIIQVGTIRIYPQVMKIMCVYSLFGTVQS  915
                V+ +  +  NW LGC+   AA  ++S++N++Q GT++ YP VMK+   YS+ GT+Q 
Sbjct  180   KLLVYYNLPD--NWFLGCIFLAAAIFSVSLFNVVQTGTVKKYPHVMKVASFYSIVGTIQC  237

Query  916   GALSLFIVRDLNAWRLGLNFQLIVILLTAIFGSIIRSSVQLWCMRMKGPSFPLIFKPVGI  1095
                SL++ RDL+AW++  NF L +I+ T  FGS+IR+SV + C +MKGPS+  +FKP GI
Sbjct  238   LIFSLYMERDLSAWKIQPNFDLYLIIATGTFGSVIRTSVHVKCTQMKGPSYVPLFKPFGI  297

Query  1096  VVASSCGCLFFADTFHYGSMFSAFICGMGYYTTIWGQLKDEEIQQ--------IKGSSVS  1251
               A+  G  FF ++ HYGS+  A I G+GYYT  WGQLK+ E +Q        IK     
Sbjct  298   FWATLFGTSFFVNSLHYGSVLGAAIGGVGYYTVSWGQLKESEEKQNPNDERKSIKTIHSR  357

Query  1252  LPDE-KVPLLQQSQDDSPV  1305
               DE KVPLL  +Q+DSPV
Sbjct  358   KEDEYKVPLL-TNQEDSPV  375



>ref|XP_009127782.1| PREDICTED: WAT1-related protein At1g70260 [Brassica rapa]
Length=375

 Score =   304 bits (778),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 177/378 (47%), Positives = 248/378 (66%), Gaps = 15/378 (4%)
 Frame = +1

Query  208   MEVKAAFGEVVPCMAMVMVEACTIFLTIMASTAMAKFGTNPFVFVVYTNALASIFLVPYS  387
             MEVK    E VP MAMV++EACTI LTIMA TA+   G +PFVFVVYTNAL SI L+P+S
Sbjct  1     MEVKVRKQEFVPFMAMVIMEACTIALTIMAKTALTG-GMSPFVFVVYTNALGSILLLPFS  59

Query  388   IIYHRRDKAQEQlftfplllrlfflglIGVTISQNLAFVGLSYSSPIAACGTANIVPALS  567
             + +HR D+ +E +F++PL++R+FFLG  GV + QNLAFVGLS+SSPI  C    ++P+ S
Sbjct  60    LFFHRNDRTEESIFSWPLVVRVFFLGFTGVFLFQNLAFVGLSFSSPIVVCAMGLLIPSFS  119

Query  568   FILAIILRRTKIDWESGGSQARMIGALICTVGTISLIFYRGPVV---NNYSPTFLHLSTT  738
             F+L +IL R+K+D  +  ++A+++G +I   G      Y+GP +   ++ SP  L  S  
Sbjct  120   FLLNLILGRSKLDLRNTSTRAKVMGTVISLSGAFVEELYKGPFIRPASSPSPNHLLKSIP  179

Query  739   QFVFSSSTNQQNWVLGCLCFIAASLTLSIWNIIQVGTIRIYPQVMKIMCVYSLFGTVQSG  918
             + +   +    NW LGC+   AA   +S++N++Q GT++ YP VMK+   YS+ GTVQ  
Sbjct  180   KLLVYYNL-PDNWFLGCIFLAAAVFFVSLFNVVQTGTVKKYPHVMKVASFYSIVGTVQCL  238

Query  919   ALSLFIVRDLNAWRLGLNFQLIVILLTAIFGSIIRSSVQLWCMRMKGPSFPLIFKPVGIV  1098
               SL++ RDL+AW++  NF L +I+ T IFGS+IR+SV + C +MKGP +  +FKP GI 
Sbjct  239   IFSLYMERDLSAWKIEPNFDLFLIIATGIFGSVIRTSVHVKCTQMKGPYYVPLFKPFGIF  298

Query  1099  VASSCGCLFFADTFHYGSMFSAFICGMGYYTTIWGQLKD--------EEIQQIKGSSVSL  1254
              A+  G  FF ++ HYGS+  A I G+GYYT  WGQLK+        EE + IK      
Sbjct  299   WATLFGTSFFVNSLHYGSVLGAAIGGVGYYTVSWGQLKETEEKQNPKEERKPIKTIYHQE  358

Query  1255  PDE-KVPLLQQSQDDSPV  1305
              DE KVPLL  SQ++SPV
Sbjct  359   EDEYKVPLL-ISQEESPV  375



>ref|XP_010471020.1| PREDICTED: WAT1-related protein At1g70260-like [Camelina sativa]
Length=374

 Score =   304 bits (778),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 172/378 (46%), Positives = 248/378 (66%), Gaps = 16/378 (4%)
 Frame = +1

Query  208   MEVKAAFGEVVPCMAMVMVEACTIFLTIMASTAMAKFGTNPFVFVVYTNALASIFLVPYS  387
             ME+K    E VP +AM ++EACTI LTIMA TA+   G +PFVFVVYTNA  SI L+P+S
Sbjct  1     MELKVRRDEFVPFVAMAIMEACTIALTIMAKTALTG-GMSPFVFVVYTNAFGSILLLPFS  59

Query  388   IIYHRRDKAQEQlftfplllrlfflglIGVTISQNLAFVGLSYSSPIAACGTANIVPALS  567
               +HR ++ ++ +F++PLL+R+FFLG  G+ + QNLAFVGLS+SSPI  C     +P+ S
Sbjct  60    FFFHRNERTEQSIFSWPLLVRVFFLGFTGIFMFQNLAFVGLSFSSPIVVCAMGLQIPSFS  119

Query  568   FILAIILRRTKIDWESGGSQARMIGALICTVGTISLIFYRGPVV---NNYSPT-FLHLST  735
             F+L+I+L R+K+DW +  ++A+M+G +I   G      Y+GP +   ++ SPT FL    
Sbjct  120   FLLSIVLGRSKLDWRNTSTRAKMMGTIISLSGAFVEELYKGPFIRPASSASPTRFLKSIP  179

Query  736   TQFVFSSSTNQQNWVLGCLCFIAASLTLSIWNIIQVGTIRIYPQVMKIMCVYSLFGTVQS  915
                V+ +  +  NW LGC+   AA  ++S++N++Q GT++ YP VMK+   YS+ GT+Q 
Sbjct  180   KLLVYYNLPD--NWFLGCIFLAAAVFSVSLFNVVQTGTVKKYPHVMKVASFYSIVGTIQC  237

Query  916   GALSLFIVRDLNAWRLGLNFQLIVILLTAIFGSIIRSSVQLWCMRMKGPSFPLIFKPVGI  1095
                SL++ RDL+AW++  NF L +I+ T  FGS+IR+SV + C +MKGPS+  +FKP GI
Sbjct  238   VMFSLYMERDLSAWKIQPNFDLYLIIATGTFGSVIRTSVHVKCTQMKGPSYVPLFKPFGI  297

Query  1096  VVASSCGCLFFADTFHYGSMFSAFICGMGYYTTIWGQLKD--------EEIQQIKGSSVS  1251
               A+  G  FF ++ HYGS+  A I G+GYYT  WGQLK+        EE + IK     
Sbjct  298   FWATLFGTSFFVNSLHYGSVLGAAIGGVGYYTVSWGQLKEIEEKQYPNEERKSIKTIHHE  357

Query  1252  LPDEKVPLLQQSQDDSPV  1305
               + KVPLL  +Q+DSPV
Sbjct  358   EDEYKVPLL-TNQEDSPV  374



>ref|XP_009104958.1| PREDICTED: WAT1-related protein At1g70260 isoform X1 [Brassica 
rapa]
Length=374

 Score =   304 bits (778),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 175/377 (46%), Positives = 249/377 (66%), Gaps = 16/377 (4%)
 Frame = +1

Query  214   VKAAFGEVVPCMAMVMVEACTIFLTIMASTAMAKFGTNPFVFVVYTNALASIFLVPYSII  393
             +K   GE VP +AMV++EACTI LTIMA TA+   G +PFVFVVYTNAL SI L+P+S  
Sbjct  1     MKVKVGEFVPFVAMVIMEACTIALTIMAKTALTG-GMSPFVFVVYTNALGSILLLPFSFF  59

Query  394   YHRRDKAQEQlftfplllrlfflglIGVTISQNLAFVGLSYSSPIAACGTANIVPALSFI  573
             +HR+D+ +E +F++PL +R+FFLG  G+ + QNLAFVGLS+SSPI  C    ++P+ SF+
Sbjct  60    FHRKDRTKESIFSWPLFVRVFFLGFTGIFLFQNLAFVGLSFSSPIVVCAMGLLIPSFSFL  119

Query  574   LAIILRRTKIDWESGGSQARMIGALICTVGTISLIFYRGPVVNNYS---PTFLHLSTTQF  744
             L +IL R+K+DW +  ++AR++G +I   G  S   Y+GP +   S   PT L  S  + 
Sbjct  120   LNLILGRSKLDWRNTSTRARVMGTIISLSGAFSEELYKGPFIRPASSAFPTRLLKSIPKL  179

Query  745   VFSSSTNQQNWVLGCLCFIAASLTLSIWNIIQ-VGTIRIYPQVMKIMCVYSLFGTVQSGA  921
             +   +    NW LGC+   AA  ++S++N+IQ  GT++ YP VMK+   YS+ GT+Q   
Sbjct  180   LVYYNI-PDNWFLGCIFLAAAVFSVSLFNVIQQTGTVKKYPHVMKVASFYSIVGTIQCLI  238

Query  922   LSLFIVRDLNAWRLGLNFQLIVILLTAIFGSIIRSSVQLWCMRMKGPSFPLIFKPVGIVV  1101
              SLF+ RDL+AW++  N+ L +I+ T IFGS+IR+SVQ+ C +MKGP +  +FKP GI  
Sbjct  239   FSLFMERDLSAWKIEPNYDLCLIIATGIFGSVIRTSVQVKCTQMKGPYYVPLFKPFGIFW  298

Query  1102  ASSCGCLFFADTFHYGSMFSAFICGMGYYTTIWGQLKDEEIQQ--------IKGSSVSLP  1257
             A+  G  FF ++ HYGS+  A I G+GYYT  WGQL++ E +Q        IK       
Sbjct  299   ATLFGTSFFVNSLHYGSVLGAVIGGVGYYTVSWGQLRETEEKQNSKDERKPIKTIHHHED  358

Query  1258  DE-KVPLLQQSQDDSPV  1305
             DE K+PLL  +Q++SPV
Sbjct  359   DEYKIPLL-INQEESPV  374



>ref|XP_006302413.1| hypothetical protein CARUB_v10020485mg [Capsella rubella]
 gb|EOA35311.1| hypothetical protein CARUB_v10020485mg [Capsella rubella]
Length=375

 Score =   303 bits (777),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 176/379 (46%), Positives = 247/379 (65%), Gaps = 17/379 (4%)
 Frame = +1

Query  208   MEVKAAFGEVVPCMAMVMVEACTIFLTIMASTAMAKFGTNPFVFVVYTNALASIFLVPYS  387
             ME+K    E VP +AM ++EACTI LTIMA TA+   G +PFVFVVYTNA  SI L+P+S
Sbjct  1     MELKVRRDEFVPFVAMAIMEACTIALTIMAKTALTG-GMSPFVFVVYTNAFGSILLLPFS  59

Query  388   IIYHRRDKAQEQlftfplllrlfflglIGVTISQNLAFVGLSYSSPIAACGTANIVPALS  567
               +HR D+ ++ +F++PLL+R+FFLG  GV + QNLAFVGLS+SSPI  C     +P  S
Sbjct  60    FFFHRNDRTEQSIFSWPLLVRVFFLGFTGVFMFQNLAFVGLSFSSPIVVCAMGLQIPTFS  119

Query  568   FILAIILRRTKIDWESGGSQARMIGALICTVGTISLIFYRGPVV---NNYSPT-FLHLST  735
             F+L+I+L ++K+DW +  ++A+++GA+I   G      Y+GP +   +  SPT FL    
Sbjct  120   FLLSILLGKSKLDWRNTSTRAKVMGAIISLSGAFVEELYKGPFIRPASTASPTRFLKSIP  179

Query  736   TQFVFSSSTNQQNWVLGCLCFIAASLTLSIWNIIQVGTIRIYPQVMKIMCVYSLFGTVQS  915
                V+ +  +  NW LGC+   AA  ++S++N++Q GT++ YP VMK+   YS+ GT+Q 
Sbjct  180   KLMVYYNLPD--NWFLGCIFLAAAVFSISLFNVVQTGTVKKYPHVMKVASFYSIVGTIQC  237

Query  916   GALSLFIVRDLNAWRLGLNFQLIVILLTAIFGSIIRSSVQLWCMRMKGPSFPLIFKPVGI  1095
                SLF+ RDL+AW++  NF L +I+ T  FGS+IR+SV + C +MKGP +  +FKP GI
Sbjct  238   LIFSLFMERDLSAWKIQPNFDLYLIIATGTFGSVIRTSVHVKCTQMKGPYYVPLFKPFGI  297

Query  1096  VVASSCGCLFFADTFHYGSMFSAFICGMGYYTTIWGQLKDEEIQQ--------IKGSSVS  1251
               A+  G  FF ++ HYGS+  A I G+GYYT  WGQLK+ E +Q        IK     
Sbjct  298   FWATLFGTSFFVNSLHYGSVLGAAIGGVGYYTVSWGQLKETEEKQNPNRETKSIKTIHHH  357

Query  1252  LPDE-KVPLLQQSQDDSPV  1305
               DE KVPLL  +QDDSPV
Sbjct  358   EEDENKVPLL-TNQDDSPV  375



>ref|XP_010512104.1| PREDICTED: WAT1-related protein At1g70260-like isoform X1 [Camelina 
sativa]
 ref|XP_010512105.1| PREDICTED: WAT1-related protein At1g70260-like isoform X2 [Camelina 
sativa]
Length=375

 Score =   301 bits (771),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 171/379 (45%), Positives = 248/379 (65%), Gaps = 17/379 (4%)
 Frame = +1

Query  208   MEVKAAFGEVVPCMAMVMVEACTIFLTIMASTAMAKFGTNPFVFVVYTNALASIFLVPYS  387
             ME+K    E VP +AM ++EACTI LTIMA TA+   G +PFVFVVYTNA  SI L+P+S
Sbjct  1     MELKVRRDEFVPFVAMAIMEACTIALTIMAKTALTG-GMSPFVFVVYTNAFGSILLLPFS  59

Query  388   IIYHRRDKAQEQlftfplllrlfflglIGVTISQNLAFVGLSYSSPIAACGTANIVPALS  567
               +HR ++ ++ +F++PL++R+FFLG  G+ + QNLAFVGLS+SSPI  C     +P+ S
Sbjct  60    FFFHRNERTEQSIFSWPLIVRVFFLGFTGIFMFQNLAFVGLSFSSPIVVCAMGLQIPSFS  119

Query  568   FILAIILRRTKIDWESGGSQARMIGALICTVGTISLIFYRGPVV---NNYSPT-FLHLST  735
             F+L+I+L R+K+DW +  ++A+M+G +I   G      Y+GP +   +  SPT FL    
Sbjct  120   FLLSILLGRSKLDWRNTSTRAKMMGTIISLSGAFVEELYKGPFIRPASTASPTRFLKSIP  179

Query  736   TQFVFSSSTNQQNWVLGCLCFIAASLTLSIWNIIQVGTIRIYPQVMKIMCVYSLFGTVQS  915
                V+ +  +  NW LGC+   AA  ++S++N++Q GT++ YP VMK+   YS+ GT+Q 
Sbjct  180   KLLVYYNLPD--NWFLGCIFLAAAVFSVSLFNVVQTGTVKKYPHVMKVASFYSIVGTIQC  237

Query  916   GALSLFIVRDLNAWRLGLNFQLIVILLTAIFGSIIRSSVQLWCMRMKGPSFPLIFKPVGI  1095
                SL++ RDL+AW++  NF L +I+ T  FGS+IR+SV + C +MKGPS+  +FKP GI
Sbjct  238   LIFSLYMERDLSAWKIQPNFDLYLIIATGTFGSVIRTSVHVKCTQMKGPSYVPLFKPFGI  297

Query  1096  VVASSCGCLFFADTFHYGSMFSAFICGMGYYTTIWGQLKDEEIQQ-----IKGSSVSLPD  1260
               A+  G  FF ++ HYGS+  A I G+GYYT  WGQLK+ E +Q      K +    P 
Sbjct  298   FWATLFGTSFFVNSLHYGSVLGAAIGGVGYYTVSWGQLKESEEKQNPNEERKSTKTIYPR  357

Query  1261  E----KVPLLQQSQDDSPV  1305
             E    KVPLL  +Q++SPV
Sbjct  358   EQDEYKVPLL-TNQEESPV  375



>ref|XP_011087082.1| PREDICTED: WAT1-related protein At1g70260-like [Sesamum indicum]
Length=255

 Score =   296 bits (759),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 150/259 (58%), Positives = 194/259 (75%), Gaps = 10/259 (4%)
 Frame = +1

Query  544   ANIVPALSFILAIILRRTKIDWESGGSQARMIGALICTVGTISLIFYRGPVVNNYSPTFL  723
             AN +PA+SFILAIILR TK  W+S GSQAR+IG LI   G IS+  Y+GP V ++S +  
Sbjct  2     ANQIPAMSFILAIILRSTKFAWKSSGSQARLIGTLISAAGAISITLYKGPTVRSHSSSSP  61

Query  724   HLSTTQ----FVFSSSTNQQNWVLGCLCFIAASLTLSIWNIIQVGTIRIYPQVMKIMCVY  891
              L+       FVF+S+   +NW+LGC+ F A+S TL+IWN +QVGTI++ PQVMKI+  Y
Sbjct  62    SLAAPSPPRLFVFTST--HENWILGCILFAASSFTLTIWNTVQVGTIKMCPQVMKIISFY  119

Query  892   SLFGTVQSGALSLFIVRDLNAWRLGLNFQLIVILLTAIFGSIIRSSVQLWCMRMKGPSFP  1071
             SLFGT+QS  ++LF+ RD +AW L L+FQL+VI+LTAIF S+IRSSVQ+WC R+KGP F 
Sbjct  120   SLFGTLQSAVVALFMERDPSAWALHLDFQLLVIVLTAIFSSLIRSSVQIWCTRLKGPYFV  179

Query  1072  LIFKPVGIVVASSCGCLFFADTFHYGSMFSAFICGMGYYTTIWGQLKDEEIQQIKGSSVS  1251
              IFKP GI  AS+ GCL F DTFHYGSM  AF+CG+GYYT +WGQ+KDE +Q+  G + +
Sbjct  180   PIFKPFGIAYASTFGCLLFPDTFHYGSMMGAFVCGVGYYTVLWGQMKDEAMQKSDGGNKN  239

Query  1252  -LPDEKVPLLQQSQDDSPV  1305
              +PD+KVPLL   QD+S V
Sbjct  240   DVPDQKVPLL---QDESQV  255



>emb|CAN71720.1| hypothetical protein VITISV_034107 [Vitis vinifera]
Length=360

 Score =   299 bits (766),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 179/366 (49%), Positives = 248/366 (68%), Gaps = 11/366 (3%)
 Frame = +1

Query  208   MEVKAAFGEVVPCMAMVMVEACTIFLTIMASTAMAKFGTNPFVFVVYTNALASIFLVPYS  387
             MEV+    EV+P   MV++E CT+ LTIM  T MAK G + FVFVVY+NAL+SI L+PYS
Sbjct  1     MEVRMRLWEVIPFSVMVLMEGCTVGLTIMTKTVMAK-GMSQFVFVVYSNALSSIILLPYS  59

Query  388   IIYHRRDKAQEQlftfplllrlfflglIGVTISQNLAFVGLSYSSPIAACGTANIVPALS  567
             +I+ R    Q+  FTFPLL R FFLGL G+TI+Q  AF GLSYSSPI ACG  N++PA S
Sbjct  60    LIFRR---TQQSFFTFPLLTRFFFLGLTGITIAQIFAFTGLSYSSPILACGMGNLIPAFS  116

Query  568   FILAIILRRTKIDWESGGSQARMIGALICTVGTISLIFYRGPVVNN--YSPTFLHLS--T  735
             F+LAIILR TK+DW     QA++IG  I   G   +I Y+GP+V    +S  F HL    
Sbjct  117   FVLAIILRTTKLDWRVTSGQAKIIGTFISISGGTLMILYKGPLVRKTAFSAPFHHLELIP  176

Query  736   TQFVFSSSTNQQNWVLGCLCFIAASLTLSIWNIIQVGTIRIYPQVMKIMCVYSLFGTVQS  915
               F+FSS+   + W LG +    ASL+ S+W IIQVGT++ YP+ + I  +Y+  GT+QS
Sbjct  177   RHFIFSSTP--EYWALGGILLAVASLSASVWGIIQVGTVKQYPEPITIAALYTSMGTIQS  234

Query  916   GALSLFIVRDLNAWRLGLNFQLIVILLTAIFGSIIRSSVQLWCMRMKGPSFPLIFKPVGI  1095
               ++    R+L+AW+L LN +L++I L+AIFGS IR SV +WCM  KGP +  +FKP GI
Sbjct  235   AIVAFVAERNLSAWKLELNMELLLIFLSAIFGSAIRCSVHIWCMHNKGPFYVPMFKPFGI  294

Query  1096  VVASSCGCLFFADTFHYGSMFSAFICGMGYYTTIWGQLKDEEIQQIKGSSVSLPDEKVPL  1275
             ++AS    +FF D+ HYGS+  A+I G+GYYT +WGQ+++++++   G  +   ++KVPL
Sbjct  295   IIASIASVIFFGDSLHYGSIIGAYIIGIGYYTLMWGQIREDDMKA-GGEGIDSSEQKVPL  353

Query  1276  LQQSQD  1293
             LQ+ + 
Sbjct  354   LQEEEQ  359



>ref|XP_009105695.1| PREDICTED: WAT1-related protein At1g70260-like [Brassica rapa]
Length=375

 Score =   299 bits (766),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 172/378 (46%), Positives = 249/378 (66%), Gaps = 15/378 (4%)
 Frame = +1

Query  208   MEVKAAFGEVVPCMAMVMVEACTIFLTIMASTAMAKFGTNPFVFVVYTNALASIFLVPYS  387
             MEVK    + VP ++MV++EACTI LTIMA TA+   G +PFVFVVYTNA  SI L+P+S
Sbjct  1     MEVKGKKEKFVPFVSMVIMEACTIALTIMAKTAITG-GMSPFVFVVYTNAFGSILLLPFS  59

Query  388   IIYHRRDKAQEQlftfplllrlfflglIGVTISQNLAFVGLSYSSPIAACGTANIVPALS  567
               +HR D+ +E +F++PLL+R+FFLG  G+ + QNLAFVGLS+SSPI  C    ++P+ S
Sbjct  60    FFFHRNDRTEESIFSWPLLVRVFFLGFTGIFLFQNLAFVGLSFSSPIVVCAMGLLIPSFS  119

Query  568   FILAIILRRTKIDWESGGSQARMIGALICTVGTISLIFYRGPVV---NNYSPTFLHLSTT  738
             F+L +IL R+K+DW +  ++A+++G +I   G      Y+GP +   ++ SPT L L + 
Sbjct  120   FLLNLILGRSKLDWRNTSTRAKVMGTIISFSGAFVEELYKGPFIRPASSPSPTRL-LKSI  178

Query  739   QFVFSSSTNQQNWVLGCLCFIAASLTLSIWNIIQVGTIRIYPQVMKIMCVYSLFGTVQSG  918
               +    T   NW LGC+   AA  ++S++N+IQ GT++ YP VMK+   YS+ GT+Q  
Sbjct  179   PKLLVYYTIPNNWFLGCIFLAAAFFSVSLFNVIQTGTVKKYPHVMKVASFYSIVGTIQCI  238

Query  919   ALSLFIVRDLNAWRLGLNFQLIVILLTAIFGSIIRSSVQLWCMRMKGPSFPLIFKPVGIV  1098
               SLF+ RDL+AW++  NF L +I+ T IFG++IR S+Q+ C +MKGP +  +FKP GI 
Sbjct  239   IFSLFMERDLSAWKIKPNFDLFLIIATGIFGNVIRPSIQVKCAQMKGPYYVPLFKPFGIF  298

Query  1099  VASSCGCLFFADTFHYGSMFSAFICGMGYYTTIWGQLKD--------EEIQQIKGSSVSL  1254
              A+  G  FF ++  YG++  A I G+GYY+  WGQLK+        EE + IK   +  
Sbjct  299   WATVFGTSFFVNSLRYGNVLGAAIGGVGYYSVSWGQLKETEEKQNPMEERKAIKPMHLHG  358

Query  1255  PDE-KVPLLQQSQDDSPV  1305
              DE KVPLL  +Q++SPV
Sbjct  359   EDENKVPLL-INQEESPV  375



>ref|XP_010100503.1| Auxin-induced protein 5NG4 [Morus notabilis]
 gb|EXB82637.1| Auxin-induced protein 5NG4 [Morus notabilis]
Length=366

 Score =   299 bits (766),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 168/369 (46%), Positives = 241/369 (65%), Gaps = 12/369 (3%)
 Frame = +1

Query  208   MEVKAAFGEVVPCMAMVMVEACTIFLTIMASTAMAKFGTNPFVFVVYTNALASIFLVPYS  387
             M VK    EVVP +AMV +E  TI LTI A T +   G +PFVFVVYT+AL+S+ L P+S
Sbjct  1     MSVKPKVWEVVPFLAMVTMEGSTIALTIWAKTVLTN-GMSPFVFVVYTHALSSLILFPFS  59

Query  388   IIYHRRDKAQEQlftfplllrlfflglIGVTISQNLAFVGLSYSSPIAACGTANIVPALS  567
             I +HR D+ ++ +FT  L LR F LGL G+TI QNLAF+GLS+SSPI  C     +PA S
Sbjct  60    IFFHRNDRTEQPIFTVSLFLRFFLLGLTGITIPQNLAFLGLSHSSPIVVCAMGLTLPAFS  119

Query  568   FILAIILRRTKIDWESGGSQARMIGALICTVGTISLIFYRGPVVNNYSPTFLH---LSTT  738
             FIL+++LR+T+IDW S   Q ++ GA++C +G  ++  ++GP++ + S   LH   LST 
Sbjct  120   FILSLVLRKTEIDWRSSSFQTKVTGAIVCFMGATTVELFKGPLIKHSSS--LHVPLLSTN  177

Query  739   QFVFSSSTNQQNWVLGCLCFIAASLTLSIWNIIQVGTIRIYPQVMKIMCVYSLFGTVQSG  918
             +F+  SST  + W+LG L   AA++++S+WN++Q+ T++ YPQ MK    YS  GT+QS 
Sbjct  178   RFLIFSST-PEYWILGGLLLAAANVSVSVWNVLQMETVKQYPQPMKAAAFYSALGTIQSA  236

Query  919   ALSLFIV-RDLNAWRLGL-NFQLIVILLTAIFGSIIRSSVQLWCMRMKGPSFPLIFKPVG  1092
              LS F++ R  +AW + + N ++ +I+LTA F  +IRS V LWCMRMKGP +  +FKP G
Sbjct  237   ILSFFVLERKPDAWEVDVNNTEIPLIVLTATFVGLIRSCVHLWCMRMKGPFYVPMFKPFG  296

Query  1093  IVVASSCGCLFFADTFHYGSMFSAFICGMGYYTTIWGQLKDEEIQQIKGSSVSL---PDE  1263
             ++ A++ G    A T  YGS+    I  MGY T ++GQ  ++E     G+   L   P+E
Sbjct  297   LLFATTFGVSLPASTLRYGSVIGTAIVAMGYLTMMYGQQNEDEASTKHGTVDKLGETPEE  356

Query  1264  KVPLLQQSQ  1290
             KVPLLQ+  
Sbjct  357   KVPLLQEEN  365



>emb|CDY38802.1| BnaA07g28740D [Brassica napus]
Length=375

 Score =   299 bits (766),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 172/378 (46%), Positives = 249/378 (66%), Gaps = 15/378 (4%)
 Frame = +1

Query  208   MEVKAAFGEVVPCMAMVMVEACTIFLTIMASTAMAKFGTNPFVFVVYTNALASIFLVPYS  387
             MEVK    + VP ++MV++EACTI LTIMA TA+   G +PFVFVVYTNA  SI L+P+S
Sbjct  1     MEVKGKKEKFVPFVSMVIMEACTIALTIMAKTAITG-GMSPFVFVVYTNAFGSILLLPFS  59

Query  388   IIYHRRDKAQEQlftfplllrlfflglIGVTISQNLAFVGLSYSSPIAACGTANIVPALS  567
               +HR D+ +E +F++PLL+R+FFLG  G+ + QNLAFVGLS+SSPI  C    ++P+ S
Sbjct  60    FFFHRNDRTEESIFSWPLLVRVFFLGFTGIFLFQNLAFVGLSFSSPIVVCAMGLLIPSFS  119

Query  568   FILAIILRRTKIDWESGGSQARMIGALICTVGTISLIFYRGPVV---NNYSPTFLHLSTT  738
             F+L +IL R+K+DW +  ++A+++G +I   G      Y+GP +   ++ SPT L L + 
Sbjct  120   FLLNLILGRSKLDWRNTSTRAKVMGTIISFSGAFVEELYKGPFIRPASSPSPTRL-LKSI  178

Query  739   QFVFSSSTNQQNWVLGCLCFIAASLTLSIWNIIQVGTIRIYPQVMKIMCVYSLFGTVQSG  918
               +    T   NW LGC+   AA  ++S++N+IQ GT++ YP VMK+   YS+ GT+Q  
Sbjct  179   PKLLVYYTIPNNWFLGCIFLAAAFFSVSLFNVIQTGTVKKYPHVMKVASFYSIVGTIQCI  238

Query  919   ALSLFIVRDLNAWRLGLNFQLIVILLTAIFGSIIRSSVQLWCMRMKGPSFPLIFKPVGIV  1098
               SLF+ RDL+AW++  NF L +I+ T IFG++IR S+Q+ C +MKGP +  +FKP GI 
Sbjct  239   IFSLFMERDLSAWKIEPNFDLFLIIATGIFGNVIRPSIQVKCAQMKGPYYVPLFKPFGIF  298

Query  1099  VASSCGCLFFADTFHYGSMFSAFICGMGYYTTIWGQLKD--------EEIQQIKGSSVSL  1254
              A+  G  FF ++  YG++  A I G+GYY+  WGQLK+        EE + IK   +  
Sbjct  299   WATVFGTSFFVNSLRYGNVLGAAIGGVGYYSVSWGQLKETEEKQNPMEERKAIKPMHLHG  358

Query  1255  PDE-KVPLLQQSQDDSPV  1305
              DE KVPLL  +Q++SPV
Sbjct  359   EDENKVPLL-INQEESPV  375



>ref|XP_004297654.1| PREDICTED: auxin-induced protein 5NG4-like [Fragaria vesca subsp. 
vesca]
Length=384

 Score =   299 bits (766),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 165/368 (45%), Positives = 241/368 (65%), Gaps = 16/368 (4%)
 Frame = +1

Query  232   EVVPCMAMVMVEACTIFLTIMASTAMAKFGTNPFVFVVYTNALASIFLVPYSIIYHRRDK  411
             E++P   MV++E CTI LTI A TAM  +  +PFVFVVYT+AL+SI L+ Y+ ++H R +
Sbjct  14    EMLPFSVMVVMEGCTIVLTIWAKTAMTDYDMSPFVFVVYTHALSSIILLLYTFVFHCRSR  73

Query  412   A--QEQlftfplllrlfflglIGVTISQNLAFVGLSYSSPIAACGTANIVPALSFILAII  585
             +  Q+ LF+  L +R F LG  G+ +SQNLAF+GLSYSSPI  C    ++P  SF+L+II
Sbjct  74    SSTQQSLFSSGLFIRCFLLGFTGIAVSQNLAFLGLSYSSPILVCAMGLMLPTFSFLLSII  133

Query  586   LRRTKIDWESGGSQARMIGALICTVGTISLIFYRGP------VVNNYSPTFLHLSTTQFV  747
             LRRTK DW S   QA++IG +I  +G I +  Y+GP      V+++ S   L     Q++
Sbjct  134   LRRTKTDWRSSSFQAKVIGTIISIMGAIVVELYKGPYIRPSAVLSSSSYLVLFQKAGQYL  193

Query  748   FSSSTNQQNWVLGCLCFIAASLTLSIWNIIQVGTIRIYP--QVMKIMCVYSLFGTVQSGA  921
               SS   ++WVLG +    AS+++S+WNIIQ+GT+++YP  +VM+++  YSL GT+Q   
Sbjct  194   VFSSAATEHWVLGGILLAGASVSVSVWNIIQMGTMKLYPAVEVMEVVSYYSLLGTIQCVI  253

Query  922   LSLFIVRDLNAWRLGLNFQLIVILLTAIFGSIIRSSVQLWCMRMKGPSFPLIFKPVGIVV  1101
              SLFI R L+AW++ LN  L++I+LTA FG ++RS V  WCM MKG  +  +FKP GIV 
Sbjct  254   FSLFIERSLSAWKIKLNMDLLLIVLTACFGGLVRSRVHNWCMNMKGTHYVPMFKPFGIVF  313

Query  1102  ASSCGCLFFADTFHYGSMFSAFICGMGYYTTIWGQLKDEEIQQI---KGSS---VSLPDE  1263
             A+  G    A+  HYGS+  A + G+GY+T +WGQ +++E +Q     G S    +  + 
Sbjct  314   ATIFGVSLSANNLHYGSVLGAVVIGVGYFTIMWGQTREDEDEQCVNRNGQSNLESTNSEA  373

Query  1264  KVPLLQQS  1287
             KVPLL++ 
Sbjct  374   KVPLLEEE  381



>gb|KFK41447.1| hypothetical protein AALP_AA2G131700 [Arabis alpina]
Length=373

 Score =   299 bits (765),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 177/378 (47%), Positives = 250/378 (66%), Gaps = 17/378 (4%)
 Frame = +1

Query  208   MEVKAAFGEVVPCMAMVMVEACTIFLTIMASTAMAKFGTNPFVFVVYTNALASIFLVPYS  387
             MEVK    E VP +AMV++EACTI LTIMA TA+   G +PFVFVVYTNA  SI L+P+S
Sbjct  1     MEVKVRREEFVPFVAMVIMEACTIALTIMAKTALTG-GMSPFVFVVYTNAFGSILLLPFS  59

Query  388   IIYHRRDKAQEQlftfplllrlfflglIGVTISQNLAFVGLSYSSPIAACGTANIVPALS  567
               +H+ D+ +E +F++PLL+R+FFLG  GV + QNLAFVGLS+SSPI  C    ++P+ S
Sbjct  60    FFFHKNDRTEESIFSWPLLVRVFFLGFTGVFLFQNLAFVGLSFSSPIVVCAMGLLIPSFS  119

Query  568   FILAIILRRTKIDWESGGSQARMIGALICTVGTISLIFYRGPVV---NNYSPTFLHLSTT  738
             F+L++IL R+K+DW++  ++A+++G +I   G      Y+GP +   ++ SP  L L + 
Sbjct  120   FLLSLILGRSKLDWKNTSTRAKVMGTIISISGAFVEELYKGPFIRPASSSSPNRL-LKSI  178

Query  739   QFVFSSSTNQQNWVLGCLCFIAASLTLSIWNIIQVGTIRIYPQVMKIMCVYSLFGTVQSG  918
               +F       NW LGC+   AA   +S++N+IQ GT++ YP VMK+   YS+ GT+Q  
Sbjct  179   PKLFVYYNIPDNWFLGCIFLAAAVFCVSLFNVIQAGTVKKYPHVMKVASFYSIVGTIQCL  238

Query  919   ALSLFIVRDLNAWRLGLNFQLIVILLTAIFGSIIRSSVQLWCMRMKGPSFPLIFKPVGIV  1098
               SLF+ RDL+AW++  NF L +I+ TAIFGS+IR+SV + C +MKGP +  +FKP GI 
Sbjct  239   IFSLFMERDLSAWKIQPNFDLFLIIATAIFGSVIRTSVHVKCTQMKGPYYVPLFKPFGIF  298

Query  1099  VASSCGCLFFADTFHYGSMFSAFICGMGYYTTIWGQL--------KDEEIQQIKGSSVSL  1254
              A+  G  FF ++ HYGS+  A I G+GYYT  WGQL          EE + IK  ++  
Sbjct  299   WATLFGTSFFVNSLHYGSVLGAAIGGVGYYTVSWGQLKENEEKENPKEERKHIK--NIHH  356

Query  1255  PDE-KVPLLQQSQDDSPV  1305
              DE KVPLL  +Q++SPV
Sbjct  357   HDEYKVPLL-MNQEESPV  373



>ref|XP_006483799.1| PREDICTED: WAT1-related protein At1g70260-like [Citrus sinensis]
Length=374

 Score =   298 bits (763),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 171/365 (47%), Positives = 240/365 (66%), Gaps = 14/365 (4%)
 Frame = +1

Query  232   EVVPCMAMVMVEACTIFLTIMASTAMAKFGTNPFVFVVYTNALASIFLVPYSIIYHRRD-  408
             E+VP   MV++E CTI LTI+  TAM   G +PFVF+ YTNAL SI L+P S  +H R  
Sbjct  12    EMVPFTLMVIMEGCTIGLTILTKTAMNG-GMSPFVFIAYTNALGSILLLPCSFFFHHRGS  70

Query  409   ------KAQEQlftfplllrlfflglIGVTISQNLAFVGLSYSSPIAACGTANIVPALSF  570
                   + ++ LFT PL+LR FFLGL GV ISQNLAF GL YSSPI  C    ++PA+SF
Sbjct  71    EAAAGGRIEQPLFTLPLMLRFFFLGLTGVAISQNLAFFGLYYSSPIVVCVMGLLIPAISF  130

Query  571   ILAIILRRTKIDWESGGSQARMIGALICTVGTISLIFYRGPVVNNYSPT---FLHLSTTQ  741
             +L+II R TK+DW S   + ++IG LI  +G I +  Y+GP +   +        ++   
Sbjct  131   LLSIITRTTKLDWRSSSIRVKVIGTLISIMGAIFVQVYKGPSMRKAASDDKLEAKINPPL  190

Query  742   FVFSSSTNQQNWVLGCLCFIAASLTLSIWNIIQVGTIRIYPQVMKIMCVYSLFGTVQSGA  921
              +F S+ ++  WVLG     A+SL++ +WNIIQVGTI+ YPQVMK++  YSL GT+Q   
Sbjct  191   LIFYSTPDR--WVLGSTLLAASSLSVCVWNIIQVGTIKQYPQVMKVVSFYSLAGTIQCSI  248

Query  922   LSLFIVRDLNAWRLGLNFQLIVILLTAIFGSIIRSSVQLWCMRMKGPSFPLIFKPVGIVV  1101
              SL + R++NAW+L LN +L++I++TAIFGS+IRS+V + C  MKG  +  +FKP GIV 
Sbjct  249   FSLIMERNINAWKLKLNMELLLIIITAIFGSVIRSTVHVSCAEMKGHLYVPMFKPFGIVF  308

Query  1102  ASSCGCLFFADTFHYGSMFSAFICGMGYYTTIWGQLKDEE-IQQIKGSSVSLPDEKVPLL  1278
             A++ G  FF ++ HYGS+  A I GMGYYT  WG ++++E +++   S  +  D+KVPLL
Sbjct  309   ATAFGLTFFTNSLHYGSVIGAVITGMGYYTVTWGNIREDELLRKGHNSKDAADDQKVPLL  368

Query  1279  QQSQD  1293
             Q+   
Sbjct  369   QEDSQ  373



>gb|KHG22950.1| Auxin-induced 5NG4 [Gossypium arboreum]
Length=349

 Score =   296 bits (759),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 163/370 (44%), Positives = 230/370 (62%), Gaps = 28/370 (8%)
 Frame = +1

Query  196   MLAAMEVKAAFGEVVPCMAMVMVEACTIFLTIMASTAMAKFGTNPFVFVVYTNALASIFL  375
             M+A M  +    EV P   M+++E CTI LTI+A TA+   G NP VFVVYTNA+ SI L
Sbjct  1     MVAEMR-RERRSEVAPFAVMLIMEGCTIALTILAKTALTA-GINPLVFVVYTNAVGSILL  58

Query  376   VPYSIIYHRRDKAQEQlftfplllrlfflglIGVTISQNLAFVGLSYSSPIAACGTANIV  555
             +P+S +YHR ++                     V ISQNLAF+GLSYSSPI  C    ++
Sbjct  59    LPFSFLYHRGER---------------------VAISQNLAFLGLSYSSPIVVCAMGLLM  97

Query  556   PALSFILAIILRRTKIDWESGGSQARMIGALICTVGTISLIFYRGPVVNNYSPTFL--HL  729
             P +SF+L+IILR  ++DW S  SQA+MIG  I   G I +  Y+GP     SP  L  HL
Sbjct  98    PTISFLLSIILRTVRLDWRSTSSQAKMIGTFISIAGAIFVELYKGPFTRP-SPVSLDHHL  156

Query  730   STTQFVFSSSTNQQNWVLGCLCFIAASLTLSIWNIIQVGTIRIYPQVMKIMCVYSLFGTV  909
                  +F   +    WVLG +   AA+L++S+WNI+Q+GT++ YPQVMK+   YSL GT+
Sbjct  157   QVIPKLFVFYSTPDRWVLGGILLAAATLSISVWNIVQMGTVKQYPQVMKVASSYSLVGTI  216

Query  910   QSGALSLFIVRDLNAWRLGLNFQLIVILLTAIFGSIIRSSVQLWCMRMKGPSFPLIFKPV  1089
             Q    SL +  DL+AW+L     L++I++T +FGSIIRS+V L C RMKGP +  +FKP 
Sbjct  217   QCLVFSLIMEGDLDAWKLKRKPDLLLIIVTGVFGSIIRSNVHLACTRMKGPFYVPMFKPF  276

Query  1090  GIVVASSCGCLFFADTFHYGSMFSAFICGMGYYTTIWGQLKDEEIQQIK--GSSVSLPDE  1263
             G+V A+  G  FF ++ HYGS+    I G GYY  ++GQ+++EE+++ +  G+   + D 
Sbjct  277   GVVFATVFGTSFFTNSLHYGSVIGTIIIGTGYYAVMFGQIREEELRKEREVGTVGDISDL  336

Query  1264  KVPLLQQSQD  1293
             K PLLQ+++D
Sbjct  337   KAPLLQENED  346



>ref|XP_009104960.1| PREDICTED: WAT1-related protein At1g70260 isoform X3 [Brassica 
rapa]
Length=373

 Score =   297 bits (760),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 174/377 (46%), Positives = 248/377 (66%), Gaps = 17/377 (5%)
 Frame = +1

Query  214   VKAAFGEVVPCMAMVMVEACTIFLTIMASTAMAKFGTNPFVFVVYTNALASIFLVPYSII  393
             +K   GE VP +AMV++EACTI LTIMA TA+   G +PFVFVVYTNAL SI L+P+S  
Sbjct  1     MKVKVGEFVPFVAMVIMEACTIALTIMAKTALTG-GMSPFVFVVYTNALGSILLLPFSFF  59

Query  394   YHRRDKAQEQlftfplllrlfflglIGVTISQNLAFVGLSYSSPIAACGTANIVPALSFI  573
             +HR+D+ +E +F++PL +R+FFLG  G+ + QNLAFVGLS+SSPI  C    ++P+ SF+
Sbjct  60    FHRKDRTKESIFSWPLFVRVFFLGFTGIFLFQNLAFVGLSFSSPIVVCAMGLLIPSFSFL  119

Query  574   LAIILRRTKIDWESGGSQARMIGALICTVGTISLIFYRGPVVNNYS---PTFLHLSTTQF  744
             L +IL  +K+DW +  ++AR++G +I   G  S   Y+GP +   S   PT L  S  + 
Sbjct  120   LNLILG-SKLDWRNTSTRARVMGTIISLSGAFSEELYKGPFIRPASSAFPTRLLKSIPKL  178

Query  745   VFSSSTNQQNWVLGCLCFIAASLTLSIWNIIQ-VGTIRIYPQVMKIMCVYSLFGTVQSGA  921
             +   +    NW LGC+   AA  ++S++N+IQ  GT++ YP VMK+   YS+ GT+Q   
Sbjct  179   LVYYNI-PDNWFLGCIFLAAAVFSVSLFNVIQQTGTVKKYPHVMKVASFYSIVGTIQCLI  237

Query  922   LSLFIVRDLNAWRLGLNFQLIVILLTAIFGSIIRSSVQLWCMRMKGPSFPLIFKPVGIVV  1101
              SLF+ RDL+AW++  N+ L +I+ T IFGS+IR+SVQ+ C +MKGP +  +FKP GI  
Sbjct  238   FSLFMERDLSAWKIEPNYDLCLIIATGIFGSVIRTSVQVKCTQMKGPYYVPLFKPFGIFW  297

Query  1102  ASSCGCLFFADTFHYGSMFSAFICGMGYYTTIWGQLKDEEIQQ--------IKGSSVSLP  1257
             A+  G  FF ++ HYGS+  A I G+GYYT  WGQL++ E +Q        IK       
Sbjct  298   ATLFGTSFFVNSLHYGSVLGAVIGGVGYYTVSWGQLRETEEKQNSKDERKPIKTIHHHED  357

Query  1258  DE-KVPLLQQSQDDSPV  1305
             DE K+PLL  +Q++SPV
Sbjct  358   DEYKIPLL-INQEESPV  373



>ref|XP_002888762.1| nodulin MtN21 family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH65021.1| nodulin MtN21 family protein [Arabidopsis lyrata subsp. lyrata]
Length=375

 Score =   296 bits (758),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 171/379 (45%), Positives = 248/379 (65%), Gaps = 17/379 (4%)
 Frame = +1

Query  208   MEVKAAFGEVVPCMAMVMVEACTIFLTIMASTAMAKFGTNPFVFVVYTNALASIFLVPYS  387
             MEVK    E+VP +AM ++EACTI LTIMA TA+   G +PFVFVVYTNA  SI L+P+S
Sbjct  1     MEVKVRRNELVPFVAMAIMEACTIALTIMAKTALTG-GMSPFVFVVYTNAFGSILLLPFS  59

Query  388   IIYHRRDKAQEQlftfplllrlfflglIGVTISQNLAFVGLSYSSPIAACGTANIVPALS  567
             + +HR ++ ++ +F++PLL+R+FFLG  G+ + QNLAFVGL +SSPI  C     +P+ S
Sbjct  60    LFFHRNERTEQSIFSWPLLVRVFFLGFTGIFMFQNLAFVGLRFSSPIVVCAMGLQIPSFS  119

Query  568   FILAIILRRTKIDWESGGSQARMIGALICTVGTISLIFYRGPVV---NNYSPT-FLHLST  735
             F+L+I+L ++K+DW +  ++A+++G +I   G      Y+GP +   ++ SPT FL    
Sbjct  120   FLLSILLGKSKLDWRNTSTRAKLMGTIISLSGAFVEELYKGPFIRPASSASPTRFLKSVP  179

Query  736   TQFVFSSSTNQQNWVLGCLCFIAASLTLSIWNIIQVGTIRIYPQVMKIMCVYSLFGTVQS  915
                V+ +  +  NW LGC+   AA  ++S++N+IQ GT++ YP VMK+   YS+ GT+Q 
Sbjct  180   KLLVYYNLPD--NWFLGCIFLAAAVFSVSLFNVIQTGTVKQYPHVMKVASFYSIVGTIQC  237

Query  916   GALSLFIVRDLNAWRLGLNFQLIVILLTAIFGSIIRSSVQLWCMRMKGPSFPLIFKPVGI  1095
                SLF+  DL+AW++  NF L +I+ T  FGS+IR+SV + C +MKGP +  +FKP GI
Sbjct  238   LIFSLFMESDLSAWKIQPNFDLYLIIATGTFGSVIRTSVHVKCTQMKGPYYVPLFKPFGI  297

Query  1096  VVASSCGCLFFADTFHYGSMFSAFICGMGYYTTIWGQLKD--------EEIQQIKGSSVS  1251
               A+  G  FF ++ HYGS+  A I G+GYYT  WGQLK+        EE + IK     
Sbjct  298   FWATLFGTSFFVNSLHYGSVLGAAIAGVGYYTVSWGQLKESEEKQNPNEERKSIKNIHHC  357

Query  1252  LPDE-KVPLLQQSQDDSPV  1305
               DE KVPLL  +Q++SPV
Sbjct  358   QEDEHKVPLL-INQEESPV  375



>ref|NP_177183.2| nodulin MtN21-like transporter UMAMIT36 [Arabidopsis thaliana]
 sp|F4I5D5.1|WTR11_ARATH RecName: Full=WAT1-related protein At1g70260 [Arabidopsis thaliana]
 gb|AEE35038.1| nodulin MtN21-like transporter UMAMIT36 [Arabidopsis thaliana]
Length=375

 Score =   295 bits (756),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 169/379 (45%), Positives = 247/379 (65%), Gaps = 17/379 (4%)
 Frame = +1

Query  208   MEVKAAFGEVVPCMAMVMVEACTIFLTIMASTAMAKFGTNPFVFVVYTNALASIFLVPYS  387
             MEVK    E+VP +AM ++EACTI LTIMA TA+   G +PFVFVVYTNA  SI L+P+S
Sbjct  1     MEVKVRRDELVPFVAMAIMEACTIALTIMAKTALTG-GMSPFVFVVYTNAFGSILLLPFS  59

Query  388   IIYHRRDKAQEQlftfplllrlfflglIGVTISQNLAFVGLSYSSPIAACGTANIVPALS  567
              ++HR ++ ++ +F++PLL+R+FFLG  G+ + QNLAFVGL +SSPI  C     +P+ S
Sbjct  60    FLFHRNERTEQSIFSWPLLVRVFFLGFTGIFMFQNLAFVGLRFSSPIVVCAMGLQIPSFS  119

Query  568   FILAIILRRTKIDWESGGSQARMIGALICTVGTISLIFYRGPVV---NNYSPT-FLHLST  735
             F+L+IIL R+K+DW +  ++A+++G ++   G      Y+GP +   ++ SP  FL    
Sbjct  120   FLLSIILGRSKLDWRNTSTRAKLMGTIVSLSGAFVEELYKGPFIRPASSASPNRFLKSVP  179

Query  736   TQFVFSSSTNQQNWVLGCLCFIAASLTLSIWNIIQVGTIRIYPQVMKIMCVYSLFGTVQS  915
                V+ +  +  NW LGC+    A  ++S++N++Q GT++ YP VMK+   YS+ GT+Q 
Sbjct  180   KLLVYYNLPD--NWFLGCIFLAVAVFSVSLFNVVQTGTVKKYPHVMKVASFYSIVGTIQC  237

Query  916   GALSLFIVRDLNAWRLGLNFQLIVILLTAIFGSIIRSSVQLWCMRMKGPSFPLIFKPVGI  1095
                SLF+ RDL+AW++  NF L +I+ T  FGS+IR+SV + C +MKGP +  +FKP GI
Sbjct  238   LLFSLFMERDLSAWKIQPNFDLYLIIATGTFGSVIRTSVHVKCTQMKGPYYVPLFKPFGI  297

Query  1096  VVASSCGCLFFADTFHYGSMFSAFICGMGYYTTIWGQLKD--------EEIQQIKGSSVS  1251
               A+  G  FF ++ HYGS+  A I G+GY+T  WGQLK+        EE + IK     
Sbjct  298   FWATLFGTSFFVNSLHYGSVLGAAIAGVGYFTVSWGQLKESEEKQSSNEERKSIKTIHHR  357

Query  1252  LPDE-KVPLLQQSQDDSPV  1305
               DE KVPLL  +Q++SPV
Sbjct  358   DEDEYKVPLL-INQEESPV  375



>emb|CDY11606.1| BnaC06g31330D [Brassica napus]
Length=470

 Score =   296 bits (757),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 169/378 (45%), Positives = 246/378 (65%), Gaps = 15/378 (4%)
 Frame = +1

Query  208   MEVKAAFGEVVPCMAMVMVEACTIFLTIMASTAMAKFGTNPFVFVVYTNALASIFLVPYS  387
             MEVK      VP ++MV++EACTI LTIMA TA+   G +PFVFVVYTNA  SI L+P+S
Sbjct  1     MEVKGRKETFVPFVSMVIMEACTIALTIMAKTAITG-GMSPFVFVVYTNAFGSILLLPFS  59

Query  388   IIYHRRDKAQEQlftfplllrlfflglIGVTISQNLAFVGLSYSSPIAACGTANIVPALS  567
               +HR D+ +E +F+ PLL+R+FFLG  G+ + QNLAFVGLS+SSPI  C    ++P+ S
Sbjct  60    FFFHRNDRTEESIFSRPLLVRVFFLGFTGIFLFQNLAFVGLSFSSPIVVCAMGLLIPSFS  119

Query  568   FILAIILRRTKIDWESGGSQARMIGALICTVGTISLIFYRGPVV---NNYSPTFLHLSTT  738
             F+L +IL R+K+DW +  ++A+++G ++   G      Y+GP +   ++ SPT L L + 
Sbjct  120   FLLNLILGRSKLDWRNTSTRAKVLGTIMSFSGAFVEEMYKGPFIRPASSPSPTRL-LKSI  178

Query  739   QFVFSSSTNQQNWVLGCLCFIAASLTLSIWNIIQVGTIRIYPQVMKIMCVYSLFGTVQSG  918
               +    T   NW LGC+   AA  ++S++N+IQ GT++ YP VMK+   YS+ GT+Q  
Sbjct  179   PKLLVYYTIPNNWFLGCIFLAAAFFSVSLFNVIQTGTVKKYPHVMKVASFYSIVGTIQCI  238

Query  919   ALSLFIVRDLNAWRLGLNFQLIVILLTAIFGSIIRSSVQLWCMRMKGPSFPLIFKPVGIV  1098
               SLF+ RDL+AW++  NF L +I+ T IFG++IR S+Q+ C +MKGP +  +FKP GI 
Sbjct  239   IFSLFMERDLSAWKIEPNFDLFLIIATGIFGNVIRPSIQVKCAQMKGPYYVPLFKPFGIF  298

Query  1099  VASSCGCLFFADTFHYGSMFSAFICGMGYYTTIWGQLKD--------EEIQQIKGSSVSL  1254
              A+  G  FF ++  YG++  A I G+GYY+  WGQLK+        EE + IK   +  
Sbjct  299   WATVFGTSFFVNSLRYGNVLGAAIGGVGYYSVSWGQLKETEEKQNPMEERKAIKPMHLHE  358

Query  1255  PDE-KVPLLQQSQDDSPV  1305
              DE K PLL  +Q++SP+
Sbjct  359   EDENKAPLL-INQEESPI  375



>gb|KGN51825.1| Nodulin MtN21 family protein [Cucumis sativus]
Length=372

 Score =   290 bits (741),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 177/376 (47%), Positives = 247/376 (66%), Gaps = 18/376 (5%)
 Frame = +1

Query  208   MEVKAA--FGEVVPCMAMVMVEACTIFLTIMASTAMAKFGTNPFVFVVYTNALASIFLVP  381
             MEVK       VVP +AMV +E CTI LTI+A TA+  +G + FVFVVYTNA+ASI L+P
Sbjct  1     MEVKGGGILEMVVPFLAMVTMEGCTIALTILAKTAIT-YGMSTFVFVVYTNAVASIILLP  59

Query  382   YSIIYH--RRDKAQEQlftfplllrlfflglIGVTISQNLAFVGLSYSSPIAACGTANIV  555
             YS I+H  +R + Q+ LF+FPLLLR+F LGL G+ ISQNLAF+GLSYSSPI  C    ++
Sbjct  60    YSFIFHYNQRLEFQQSLFSFPLLLRVFLLGLTGICISQNLAFLGLSYSSPIVVCAMGLML  119

Query  556   PALSFILAIILRRTKIDWESGGSQARMIGALICTVGTISLIFYRGPVVNNYSPTFLHLST  735
             PA+SF+L+I+L +TK++W++     +++G +I  VG      Y GP V  +  +  HL  
Sbjct  120   PAISFLLSILLGKTKMEWKNPNFITKVVGTVISVVGATCEEVYLGPTVRQHPSSSTHLQF  179

Query  736   TQ--FVFSSSTNQQNWVLGCLCFIAASLTLSIWNIIQVGTIRIYPQVMKIMCVYSLFGTV  909
              Q   VF+S+T++  W+ G L   AA+L +SIWNIIQ+G ++ Y QVMK+   YS+ GT 
Sbjct  180   KQKLLVFTSTTDR--WIFGGLLLAAATLCVSIWNIIQLGVVKQYSQVMKVGSFYSIVGTF  237

Query  910   QSGALSLFIVRDLNAWRLGLNFQLIVILLTAIFGSIIRSSVQLWCMRMKGPSFPLIFKPV  1089
              S  ++ F+V D +AW +  +F L +I+ T  F  +IR+ VQ+WCM+ KGP +  +FKP 
Sbjct  238   MSAIVAYFVVNDSSAWTVKSSFDLYLIIATGTFSGLIRNRVQIWCMQKKGPYYVPMFKPF  297

Query  1090  GIVVASSCGCLFFADTFHYGSMFSAFICGMGYYTTIWGQL-------KDEEIQQIKGSSV  1248
             GI+ A+  G  FF DTFHYGS+ +AFI GMGY T +WGQ+       KD++I   K +  
Sbjct  298   GILFATFFGATFFGDTFHYGSVMAAFIAGMGYLTVMWGQINEDRGVGKDKDIN--KNNDD  355

Query  1249  SLPDEKVPLLQQSQDD  1296
             SL   KVPLL   + +
Sbjct  356   SLSSAKVPLLDDEESN  371



>ref|XP_004135476.1| PREDICTED: auxin-induced protein 5NG4-like [Cucumis sativus]
 ref|XP_004171838.1| PREDICTED: auxin-induced protein 5NG4-like [Cucumis sativus]
Length=374

 Score =   290 bits (741),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 177/376 (47%), Positives = 247/376 (66%), Gaps = 18/376 (5%)
 Frame = +1

Query  208   MEVKAA--FGEVVPCMAMVMVEACTIFLTIMASTAMAKFGTNPFVFVVYTNALASIFLVP  381
             MEVK       VVP +AMV +E CTI LTI+A TA+  +G + FVFVVYTNA+ASI L+P
Sbjct  3     MEVKGGGILEMVVPFLAMVTMEGCTIALTILAKTAIT-YGMSTFVFVVYTNAVASIILLP  61

Query  382   YSIIYH--RRDKAQEQlftfplllrlfflglIGVTISQNLAFVGLSYSSPIAACGTANIV  555
             YS I+H  +R + Q+ LF+FPLLLR+F LGL G+ ISQNLAF+GLSYSSPI  C    ++
Sbjct  62    YSFIFHYNQRLEFQQSLFSFPLLLRVFLLGLTGICISQNLAFLGLSYSSPIVVCAMGLML  121

Query  556   PALSFILAIILRRTKIDWESGGSQARMIGALICTVGTISLIFYRGPVVNNYSPTFLHLST  735
             PA+SF+L+I+L +TK++W++     +++G +I  VG      Y GP V  +  +  HL  
Sbjct  122   PAISFLLSILLGKTKMEWKNPNFITKVVGTVISVVGATCEEVYLGPTVRQHPSSSTHLQF  181

Query  736   TQ--FVFSSSTNQQNWVLGCLCFIAASLTLSIWNIIQVGTIRIYPQVMKIMCVYSLFGTV  909
              Q   VF+S+T++  W+ G L   AA+L +SIWNIIQ+G ++ Y QVMK+   YS+ GT 
Sbjct  182   KQKLLVFTSTTDR--WIFGGLLLAAATLCVSIWNIIQLGVVKQYSQVMKVGSFYSIVGTF  239

Query  910   QSGALSLFIVRDLNAWRLGLNFQLIVILLTAIFGSIIRSSVQLWCMRMKGPSFPLIFKPV  1089
              S  ++ F+V D +AW +  +F L +I+ T  F  +IR+ VQ+WCM+ KGP +  +FKP 
Sbjct  240   MSAIVAYFVVNDSSAWTVKSSFDLYLIIATGTFSGLIRNRVQIWCMQKKGPYYVPMFKPF  299

Query  1090  GIVVASSCGCLFFADTFHYGSMFSAFICGMGYYTTIWGQL-------KDEEIQQIKGSSV  1248
             GI+ A+  G  FF DTFHYGS+ +AFI GMGY T +WGQ+       KD++I   K +  
Sbjct  300   GILFATFFGATFFGDTFHYGSVMAAFIAGMGYLTVMWGQINEDRGVGKDKDIN--KNNDD  357

Query  1249  SLPDEKVPLLQQSQDD  1296
             SL   KVPLL   + +
Sbjct  358   SLSSAKVPLLDDEESN  373



>ref|XP_006390906.1| hypothetical protein EUTSA_v10018689mg [Eutrema salsugineum]
 gb|ESQ28192.1| hypothetical protein EUTSA_v10018689mg [Eutrema salsugineum]
Length=389

 Score =   287 bits (734),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 171/393 (44%), Positives = 247/393 (63%), Gaps = 31/393 (8%)
 Frame = +1

Query  208   MEVKAAFGEVVPCMAMVMVEACTIFLTIMASTAMAKFGTNPFVFVVYTNALASIFLVPYS  387
             MEVK    E VP +AM ++EACTI LTIMA TA+   G +PFVFVVYTNA  S+ L+P+S
Sbjct  1     MEVKVRREEFVPFVAMAIMEACTIALTIMAKTALTG-GMSPFVFVVYTNAFGSVLLLPFS  59

Query  388   IIYHRRDKAQEQlftfplllrlfflglIGVTISQNLAFVGLSYSSPIAACGTANIVPALS  567
               +H+ ++ +E +F++PLL+R+FFLG  G+ + QNLAFVGLS+SSPI  C    ++P+ S
Sbjct  60    FFFHKNERNEESIFSWPLLVRVFFLGFTGIFLFQNLAFVGLSFSSPIVVCAMVLLMPSFS  119

Query  568   FILAIILRRTKIDWESGGSQARMIGALICTVGTISLIFYRGPVV---NNYSPT-FLHLST  735
             F+L++IL R+K+DW +  S+A+++G +I   G      Y+GP +   ++ SPT FL    
Sbjct  120   FLLSVILGRSKLDWRNTSSRAKVMGTIISISGAFVEELYKGPFIRPASSSSPTRFLKSIP  179

Query  736   TQFVFSSSTNQQNWVLGCLCFIAASLTLSIWNIIQVGTIRIYPQVMKIMCVYSLFGTVQS  915
               FV+ +  +  NW LGC+   AA  ++S++N++Q GT++ YP VMK+   YS+ GT+Q 
Sbjct  180   RLFVYYNIPD--NWFLGCIFLAAAVFSVSLFNVVQTGTVKKYPHVMKVASFYSIVGTIQC  237

Query  916   GALSLFIVRDLNAWRLGLNFQLIVILLTAI--------------FGSIIRSSVQLWCMRM  1053
                SLF+ RDL AW++  NF L +I+ T I               G +IR+SV + C +M
Sbjct  238   LMFSLFMERDLTAWKIQPNFDLFLIIATVIKRKNISTKSLCYMSLGHVIRTSVHVKCTQM  297

Query  1054  KGPSFPLIFKPVGIVVASSCGCLFFADTFHYGSMFSAFICGMGYYTTIWGQLKD------  1215
             KGP +  +FKP GI  A+  G  FF ++ HYGS+  A I G+GYYT  WGQ K+      
Sbjct  298   KGPYYVPLFKPFGIFWATLFGTSFFVNSLHYGSVLGAAIGGVGYYTVSWGQFKETEEKQN  357

Query  1216  --EEIQQIKGSSVSLPDE-KVPLLQQSQDDSPV  1305
               EE + IK       +E KVPLL  +Q++SPV
Sbjct  358   PKEERKPIKTIHHHEENEYKVPLL-INQEESPV  389



>ref|XP_008446238.1| PREDICTED: WAT1-related protein At1g70260 [Cucumis melo]
Length=375

 Score =   286 bits (732),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 173/375 (46%), Positives = 244/375 (65%), Gaps = 15/375 (4%)
 Frame = +1

Query  208   MEVKAA--FGEVVPCMAMVMVEACTIFLTIMASTAMAKFGTNPFVFVVYTNALASIFLVP  381
             MEVK       VVP +AMV +E CTI LTI+A TA+  +G + FVFVVYTNA+AS+ L+P
Sbjct  3     MEVKGGRILEMVVPFLAMVTMEGCTIALTILAKTAIT-YGMSTFVFVVYTNAVASVILLP  61

Query  382   YSIIYH--RRDKAQEQlftfplllrlfflglIGVTISQNLAFVGLSYSSPIAACGTANIV  555
             YS I+H  +R + Q+ LF+FPLLLR+F LGL G+ ISQNLAF+GLSYSSPI  C    ++
Sbjct  62    YSFIFHYNQRLEFQQSLFSFPLLLRVFLLGLTGICISQNLAFLGLSYSSPIVVCAMGLML  121

Query  556   PALSFILAIILRRTKIDWESGGSQARMIGALICTVGTISLIFYRGPVVNNYSPTFLHLST  735
             P++SF+L+I+L +TKI+WE+     +++G +I  +G      Y GP V  +  +  HL  
Sbjct  122   PSISFLLSILLGKTKIEWENPNFITKVVGTVISVIGATCEELYLGPTVRQHPSSSTHLQF  181

Query  736   TQ--FVFSSSTNQQNWVLGCLCFIAASLTLSIWNIIQVGTIRIYPQVMKIMCVYSLFGTV  909
              Q   VF+S+T++  W+ G L   AA+L +SIWNIIQ+G ++ Y QVMK+   YS+ GT 
Sbjct  182   KQKLLVFTSTTDR--WIFGGLLLAAATLCVSIWNIIQLGVVKQYSQVMKVGSFYSIVGTF  239

Query  910   QSGALSLFIVRDLNAWRLGLNFQLIVILLTAIFGSIIRSSVQLWCMRMKGPSFPLIFKPV  1089
              S  ++ F+V D +AW +  +F L +I+ T  F  +IR+ VQ+WCM+ KGP +  +FKP 
Sbjct  240   MSAIVAYFVVNDSSAWTIKSSFDLYLIIATGTFSGLIRNRVQIWCMQKKGPHYVPMFKPF  299

Query  1090  GIVVASSCGCLFFADTFHYGSMFSAFICGMGYYTTIWGQLKDEE------IQQIKGSSVS  1251
             GI+ A+  G  FF DTFHYGS+ +AFI GMGY T +WGQ+ ++           K +  S
Sbjct  300   GILFATFFGATFFGDTFHYGSVMAAFIAGMGYLTVMWGQVNEDRGVGKDKDVDDKNNDDS  359

Query  1252  LPDEKVPLLQQSQDD  1296
             L   KVPLL   + +
Sbjct  360   LSSAKVPLLDDEESN  374



>ref|XP_006438452.1| hypothetical protein CICLE_v10033765mg [Citrus clementina]
 gb|ESR51692.1| hypothetical protein CICLE_v10033765mg [Citrus clementina]
Length=362

 Score =   284 bits (726),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 160/364 (44%), Positives = 228/364 (63%), Gaps = 16/364 (4%)
 Frame = +1

Query  232   EVVPCMAMVMVEACTIFLTIMASTAMAKFGTNPFVFVVYTNALASIFLVPYSIIYHRRDK  411
             E+VP   MV++E CTI LTI+  TAM   G +PFVF+ YTNAL SI L+P S  +H R  
Sbjct  4     EMVPFTLMVIMEGCTIGLTILTKTAMNG-GMSPFVFIAYTNALGSILLLPCSFFFHHRGS  62

Query  412   AQ------EQlftfplllrlfflglIGVTISQNLAFVGLSYSSPIAACGTANIVPALSFI  573
                     EQ      L+  FF   +G+T   NLAF GL YSSPI  C    ++PA+SF+
Sbjct  63    EAAAGGRIEQPLFTLPLMLRFFF--LGLT-GFNLAFFGLYYSSPIVVCVMGLLIPAISFL  119

Query  574   LAIILRRTKIDWESGGSQARMIGALICTVGTISLIFYRGPVVNNYSPT---FLHLSTTQF  744
             L+II R TK+DW S   + ++IG LI  +G I +  Y+GP +   +        ++    
Sbjct  120   LSIITRTTKLDWRSSSIRVKVIGTLISIMGAIFVQVYKGPSMRKAASDDKLEAKINPPLL  179

Query  745   VFSSSTNQQNWVLGCLCFIAASLTLSIWNIIQVGTIRIYPQVMKIMCVYSLFGTVQSGAL  924
             +F S+ ++  WVLG     A+SL++ +WNIIQVGTI+ YPQVMK++  YSL GT+Q    
Sbjct  180   IFYSTPDR--WVLGSTLLAASSLSVCVWNIIQVGTIKQYPQVMKVVSFYSLAGTIQCSIF  237

Query  925   SLFIVRDLNAWRLGLNFQLIVILLTAIFGSIIRSSVQLWCMRMKGPSFPLIFKPVGIVVA  1104
             SL + R++NAW+L LN +L++I++TAIFGS+IR +V + C  MKG  +  +FKP GIV A
Sbjct  238   SLIMERNINAWKLKLNMELLLIIITAIFGSVIRCTVHVSCAEMKGHLYVPMFKPFGIVFA  297

Query  1105  SSCGCLFFADTFHYGSMFSAFICGMGYYTTIWGQLKDEE-IQQIKGSSVSLPDEKVPLLQ  1281
             ++ G  FF ++ HYGS+  A I GMGYYT  WG ++++E +++   S  +  D+KVPLLQ
Sbjct  298   TAFGLTFFTNSLHYGSVIGAVITGMGYYTVTWGNIREDELLRKGHNSKDAADDQKVPLLQ  357

Query  1282  QSQD  1293
             +   
Sbjct  358   EDSQ  361



>ref|XP_009113257.1| PREDICTED: WAT1-related protein At1g60050 [Brassica rapa]
Length=373

 Score =   283 bits (723),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 158/367 (43%), Positives = 223/367 (61%), Gaps = 8/367 (2%)
 Frame = +1

Query  214   VKAAFGEVVPCMAMVMVEACTIFLTIMASTAMAKFGTNPFVFVVYTNALASIFLVPYSII  393
             ++A +  +VP +AM ++EACTI LTI+A TA+   G +PFVF+VYTNAL S+ L+PYS  
Sbjct  4     MEARWENIVPFIAMALMEACTIALTILAKTALTG-GMSPFVFIVYTNALGSLLLLPYSFF  62

Query  394   YHRRDKAQEQlftfplllrlfflglIGVTISQNLAFVGLSYSSPIAACGTANIVPALSFI  573
             +HR ++  E   T P ++R+F LG  GV + QNLAF+GLSYSSPI  C      PA SF+
Sbjct  63    FHRDERDDEPFLTKPSVVRIFLLGFTGVFLYQNLAFLGLSYSSPIVVCAMGLQSPAFSFL  122

Query  574   LAIILRRTKIDWESGGSQARMIGALICTVGTISLIFYRGPVVNNYSPTFL---HLSTTQF  744
             L+I L    + WE   ++ R+IG LIC  G    + Y GP +     +      L+T   
Sbjct  123   LSIALGEGGLGWECKRTRGRVIGTLICFTGAFVEVIYLGPFIRPSPSSSPNSNFLTTISH  182

Query  745   VFSSSTNQQNWVLGCLCFIAASLTLSIWNIIQVGTIRIYPQVMKIMCVYSLFGTVQSGAL  924
               +   N  NW LG L    A+L++SIWNIIQ+ T++ YPQVMK++  YSL GT+Q    
Sbjct  183   YLTFFKNSDNWALGSLFLACATLSISIWNIIQLDTVQKYPQVMKVVSAYSLAGTLQCAIF  242

Query  925   SLFIVRDLNAWRLGLNFQLIVILLTAIFGSIIRSSVQLWCMRMKGPSFPLIFKPVGIVVA  1104
             S F+  DL+AW+L LN    +I+ T IFGSIIR+SVQ+ C +MKGP +  +FKP GI+ A
Sbjct  243   SAFMEPDLSAWKLELNMDFYLIIATGIFGSIIRTSVQVKCSKMKGPYYVPLFKPFGILWA  302

Query  1105  SSCGCLFFADTFHYGSMFSAFICGMGYYTTIWGQ----LKDEEIQQIKGSSVSLPDEKVP  1272
             S  G  FF ++ HYGS+  A I G GY   +W Q    ++ + +++     +   D+  P
Sbjct  303   SIFGTSFFVNSLHYGSVLGAAIAGTGYLLIMWSQVQRDVQKDMVEEKANHQLDSDDQITP  362

Query  1273  LLQQSQD  1293
             LL  + D
Sbjct  363   LLLGNDD  369



>ref|XP_006392190.1| hypothetical protein EUTSA_v10023532mg [Eutrema salsugineum]
 gb|ESQ29476.1| hypothetical protein EUTSA_v10023532mg [Eutrema salsugineum]
Length=373

 Score =   283 bits (723),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 158/367 (43%), Positives = 225/367 (61%), Gaps = 8/367 (2%)
 Frame = +1

Query  214   VKAAFGEVVPCMAMVMVEACTIFLTIMASTAMAKFGTNPFVFVVYTNALASIFLVPYSII  393
             + A +  +VP +AM  +EACTI LTI+A TA+   G +PFVF+VYTNAL S+ L+PYS  
Sbjct  4     MDARWETIVPFIAMASMEACTIALTILAKTALTD-GMSPFVFIVYTNALGSLLLLPYSFF  62

Query  394   YHRRDKAQEQlftfplllrlfflglIGVTISQNLAFVGLSYSSPIAACGTANIVPALSFI  573
             +HR ++  E   T P L+R+F LG  GV + QNLAF+GLSYSSPI  C      PA SF+
Sbjct  63    FHRYERDDEPFLTKPSLVRIFLLGFTGVFLYQNLAFLGLSYSSPIVVCAMGLQSPAFSFL  122

Query  574   LAIILRRTKIDWESGGSQARMIGALICTVGTISLIFYRGPVVN---NYSPTFLHLSTTQF  744
             L+I L +  + WE   ++ R+IG LIC  G    + Y GP +    + +P    L+T   
Sbjct  123   LSIALGQGGLGWECRRTKGRVIGTLICFTGAFVEVMYLGPFIRPSPSSTPNSNFLTTISH  182

Query  745   VFSSSTNQQNWVLGCLCFIAASLTLSIWNIIQVGTIRIYPQVMKIMCVYSLFGTVQSGAL  924
               +   N +NW LG L    A+ ++SIWNIIQ+ T++ YPQVMK++  YS+ GTVQ    
Sbjct  183   YLTFFKNSENWALGSLLLACATFSISIWNIIQLDTVQKYPQVMKVVSAYSVAGTVQCAIF  242

Query  925   SLFIVRDLNAWRLGLNFQLIVILLTAIFGSIIRSSVQLWCMRMKGPSFPLIFKPVGIVVA  1104
             S F+  D++AW+L  N  L +I+ T IFGSIIR+SVQ+ C +MKGP +  +FKP GI+ A
Sbjct  243   SAFMEPDISAWKLENNMNLYLIIATGIFGSIIRTSVQVKCSKMKGPYYVPLFKPFGILWA  302

Query  1105  SSCGCLFFADTFHYGSMFSAFICGMGYYTTIWGQLKDEE----IQQIKGSSVSLPDEKVP  1272
             S  G  FF ++ HYGS+  A I G GY   +W Q++ ++    +++     +   D+  P
Sbjct  303   SIFGTSFFVNSLHYGSVLGAAIAGAGYLLIMWSQVQRDDQKGTVEENNNHQLDSDDQTTP  362

Query  1273  LLQQSQD  1293
             LL  + D
Sbjct  363   LLLGNGD  369



>ref|XP_006301348.1| hypothetical protein CARUB_v10021757mg [Capsella rubella]
 gb|EOA34246.1| hypothetical protein CARUB_v10021757mg [Capsella rubella]
Length=373

 Score =   281 bits (719),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 159/360 (44%), Positives = 221/360 (61%), Gaps = 8/360 (2%)
 Frame = +1

Query  235   VVPCMAMVMVEACTIFLTIMASTAMAKFGTNPFVFVVYTNALASIFLVPYSIIYHRRDKA  414
             +VP   M ++EACTI LTI+A TA+   G +PFVF+VYTNAL S+ L+PYS  +HR ++ 
Sbjct  11    IVPFTVMALMEACTIALTILAKTALTG-GMSPFVFIVYTNALGSLLLLPYSFYFHRDERD  69

Query  415   QEQlftfplllrlfflglIGVTISQNLAFVGLSYSSPIAACGTANIVPALSFILAIILRR  594
              E   T P L+R+F LG  GV + QN+AF+GLSYSSPI  C      PA SF+L+++   
Sbjct  70    DEPFLTKPSLVRIFLLGFTGVFLYQNMAFLGLSYSSPIVVCAMGLQSPAFSFLLSLVHGE  129

Query  595   TKIDWESGGSQARMIGALICTVGTISLIFYRGPVVNNYSPTFLH---LSTTQFVFSSSTN  765
               + WES  ++ R+IG LIC  G    + Y GP +     +  +   L+T     +   N
Sbjct  130   GGLRWESKRTKGRVIGTLICFTGAFVEVIYLGPFIRPSPSSSPNSNFLTTISHYLTFFKN  189

Query  766   QQNWVLGCLCFIAASLTLSIWNIIQVGTIRIYPQVMKIMCVYSLFGTVQSGALSLFIVRD  945
               NW LG L    A+L++SIWNIIQ+ T++ YPQVMK++  YSL GTVQ    S F+  D
Sbjct  190   SDNWALGSLLLACATLSISIWNIIQLDTVQKYPQVMKVVSAYSLAGTVQCAIFSAFMEPD  249

Query  946   LNAWRLGLNFQLIVILLTAIFGSIIRSSVQLWCMRMKGPSFPLIFKPVGIVVASSCGCLF  1125
             LN W+L LN  L +I+ T IFGSIIR+SVQ+ C +MKGP +  +FKP GI+ AS  G  F
Sbjct  250   LNEWKLKLNMDLYLIIATGIFGSIIRTSVQVKCSKMKGPYYVPLFKPFGILWASIFGTSF  309

Query  1126  FADTFHYGSMFSAFICGMGYYTTIWGQLKDEEIQQ--IKGSSVSLPDEK--VPLLQQSQD  1293
             F ++ HYGS+  A I G GY   +W Q + E+ ++  +K  +  L  ++   PLL  + D
Sbjct  310   FVNSLHYGSVLGAAIAGTGYLLIMWSQNQREDQKETVVKNDNHQLDSDEQTTPLLLGNGD  369



>ref|XP_008340345.1| PREDICTED: LOW QUALITY PROTEIN: WAT1-related protein At1g70260 
[Malus domestica]
Length=376

 Score =   281 bits (719),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 161/366 (44%), Positives = 239/366 (65%), Gaps = 14/366 (4%)
 Frame = +1

Query  232   EVVPCMAMVMVEACTIFLTIMASTAMAKFGTNPFVFVVYTNALASIFLVPYSIIYHRRDK  411
             E VP   MV +E CTI LTI A + M  +G +PFVFVVYT++L+S+FL+  S    R D 
Sbjct  11    ETVPFAVMVAMEGCTIILTIWAKSVMTNYGMSPFVFVVYTHSLSSLFLL-LSSFLFRXDS  69

Query  412   AQEQlftfplllrlfflglIGVTISQNLAFVGLSYSSPIAACGTANIVPALSFILAIILR  591
              Q+ +FT+ L +R F LG  G+T+SQNL F+GLSYSSPI  C    ++P+ SF+L+I LR
Sbjct  70    TQQSVFTWALFVRCFPLGFTGITVSQNLGFLGLSYSSPILVCAMGLMIPSFSFLLSISLR  129

Query  592   RTKIDWESGGSQARMIGALICTVGTISLIFYRGPVV--NNYSPTFLHLSTTQFVFSS---  756
             R K+DW S   QA++ G LI  +G I +  Y+G  +  ++ S ++ +++  Q        
Sbjct  130   RAKLDWRSSSFQAKVSGTLITIIGAIVVELYKGEYIRKSSVSSSYWYINQLQLRVEKLGL  189

Query  757   --STNQQNWVLGCLCFIAASLTLSIWNIIQVGTIRIYPQV--MKIMCVYSLFGTVQSGAL  924
               S+ +++WV+G L   A++L++S+WNIIQ+GT+++YPQV  M+++  YSL GT+QS  L
Sbjct  190   IFSSEKEHWVVGGLLLAASTLSVSVWNIIQMGTMKLYPQVEVMEVVTFYSLLGTIQSAML  249

Query  925   SLFIVRDLNAWRLGLNFQLIVILLTAIFGSIIRSSVQLWCMRMKGPSFPLIFKPVGIVVA  1104
             SLF+ R+ +AW+L LN +L++ +LTAIFG ++RS VQ WCM +KGP +  +FKP GIV A
Sbjct  250   SLFLERNPSAWKLKLNGELLLXVLTAIFGGLVRSRVQHWCMNIKGPYYVPLFKPFGIVFA  309

Query  1105  SSCGCLFFADTFHYGSMFSAFICGMGYYTTIWGQLKDEEIQQ----IKGSSVSLPDEKVP  1272
             +  G    A+   YGS+  A I GMGY+  IWGQ++++E       +  +  S  + KVP
Sbjct  310   TIFGVSLSANXLCYGSVMGAVITGMGYFIIIWGQIREDEKHDQDHCVDENLESSSERKVP  369

Query  1273  LLQQSQ  1290
             LLQ+  
Sbjct  370   LLQEEN  375



>emb|CDY61698.1| BnaCnng38340D [Brassica napus]
Length=373

 Score =   281 bits (718),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 158/367 (43%), Positives = 223/367 (61%), Gaps = 8/367 (2%)
 Frame = +1

Query  214   VKAAFGEVVPCMAMVMVEACTIFLTIMASTAMAKFGTNPFVFVVYTNALASIFLVPYSII  393
             ++A +  +VP +AM ++EACTI LTI+A TA+   G +PFVF+VYTNAL S+ L+PYS  
Sbjct  4     MEARWENIVPFIAMALMEACTIALTILAKTALTG-GMSPFVFIVYTNALGSLLLLPYSFF  62

Query  394   YHRRDKAQEQlftfplllrlfflglIGVTISQNLAFVGLSYSSPIAACGTANIVPALSFI  573
             +HR ++  E   T P ++R+F LG  GV + QNLAF+GLSYSSPI  C      PA SF+
Sbjct  63    FHRDERDDEPFLTKPSVVRIFLLGFTGVFLYQNLAFLGLSYSSPIVVCAMGLQSPAFSFL  122

Query  574   LAIILRRTKIDWESGGSQARMIGALICTVGTISLIFYRGPVVNNYSPTFL---HLSTTQF  744
             L+I L    + WE   ++ R+IG LIC  G    + Y GP +     +      L+T   
Sbjct  123   LSIALGEGGLGWECKRTRGRVIGTLICFTGAFVEVIYLGPFIRPSPSSSPNSNFLTTISH  182

Query  745   VFSSSTNQQNWVLGCLCFIAASLTLSIWNIIQVGTIRIYPQVMKIMCVYSLFGTVQSGAL  924
               +   N  NW LG L    A+L++SIWNIIQ+ T++ YPQVMK++  YSL GT+Q    
Sbjct  183   YLTFFKNSDNWALGSLFLACATLSISIWNIIQLDTVQKYPQVMKVVSAYSLAGTLQCAIF  242

Query  925   SLFIVRDLNAWRLGLNFQLIVILLTAIFGSIIRSSVQLWCMRMKGPSFPLIFKPVGIVVA  1104
             S F+  DL+AW+L LN    +I+ T IFGSIIR+SVQ+ C +MKGP +  +FKP GI+ A
Sbjct  243   SAFMEPDLSAWKLELNMDFYLIIATGIFGSIIRTSVQVKCSKMKGPYYVPLFKPFGILWA  302

Query  1105  SSCGCLFFADTFHYGSMFSAFICGMGYYTTIWGQ----LKDEEIQQIKGSSVSLPDEKVP  1272
             S  G  FF ++ HYGS+  A I G GY   +W Q    ++ + +++     +   D+  P
Sbjct  303   SIFGTSFFVNSLHYGSVLGAAIAGTGYLLIMWSQVQRDVQKDMVEEKVNHQLDSDDQITP  362

Query  1273  LLQQSQD  1293
             LL  + D
Sbjct  363   LLLGNGD  369



>ref|XP_002886638.1| hypothetical protein ARALYDRAFT_315326 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH62897.1| hypothetical protein ARALYDRAFT_315326 [Arabidopsis lyrata subsp. 
lyrata]
Length=373

 Score =   281 bits (718),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 160/360 (44%), Positives = 221/360 (61%), Gaps = 7/360 (2%)
 Frame = +1

Query  235   VVPCMAMVMVEACTIFLTIMASTAMAKFGTNPFVFVVYTNALASIFLVPYSIIYHRRDKA  414
             +VP   M ++EACTI LTI+A T++   G +PFVF+VYTNAL S+ L+PYS  +HR +  
Sbjct  11    IVPFTVMALMEACTIALTILAKTSLTG-GMSPFVFIVYTNALGSLLLLPYSFYFHRDESD  69

Query  415   QEQlftfplllrlfflglIGVTISQNLAFVGLSYSSPIAACGTANIVPALSFILAIILRR  594
              E   T P L+R+F LG  GV + QN+AF+GLSYSSPI  C      PA SF+L++    
Sbjct  70    DEPFLTKPSLVRIFLLGFTGVFLFQNMAFLGLSYSSPIVVCAMGLQSPAFSFLLSLARGE  129

Query  595   TKIDWESGGSQARMIGALICTVGTISLIFYRGPVV---NNYSPTFLHLSTTQFVFSSSTN  765
               + W S  ++ R+IG LIC  G    + Y GP +   +  SP    L+T     +   N
Sbjct  130   GGLGWASKRTKGRVIGTLICFTGAFVEVIYLGPFIRPSHPSSPNSNFLATISHYLTFFKN  189

Query  766   QQNWVLGCLCFIAASLTLSIWNIIQVGTIRIYPQVMKIMCVYSLFGTVQSGALSLFIVRD  945
               NWVLG L    A+L++SIWNIIQ+ T++ YPQVMK++  YSL GT+Q    S F+  D
Sbjct  190   SDNWVLGSLLLACATLSISIWNIIQLDTVQKYPQVMKVVSAYSLAGTLQCAIFSAFMEPD  249

Query  946   LNAWRLGLNFQLIVILLTAIFGSIIRSSVQLWCMRMKGPSFPLIFKPVGIVVASSCGCLF  1125
             L+AW+L LN  L +I+ T IFGSIIR+SVQ+ C +MKGP +  +FKP GI+ AS  G  F
Sbjct  250   LSAWKLKLNMDLYLIIATGIFGSIIRTSVQVKCSKMKGPYYVPLFKPFGILWASIFGTSF  309

Query  1126  FADTFHYGSMFSAFICGMGYYTTIWGQLKDEEIQQI--KGSSVSLP-DEKVPLLQQSQDD  1296
             F ++ HYGS+  A I G GY   +W Q++ E+  ++  K  +  L  DE+   L  + DD
Sbjct  310   FVNSLHYGSVLGAAIAGTGYLLIMWSQVQKEDQNEMAEKNDNHQLDSDEQTTPLLLANDD  369



>gb|KHN23421.1| Auxin-induced protein 5NG4 [Glycine soja]
Length=360

 Score =   280 bits (716),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 156/363 (43%), Positives = 233/363 (64%), Gaps = 5/363 (1%)
 Frame = +1

Query  208   MEVKAAFGEVVPCMAMVMVEACTIFLTIMASTAMAKFGTNPFVFVVYTNALASIFLVPYS  387
             ME +    EV+P + MV++E  TI LTI A TA+   G +PFVF+VYTNALA+I L P  
Sbjct  1     MEARTKMSEVLPFIVMVIMEGWTIGLTIFAKTAITN-GMSPFVFIVYTNALATIILFPCF  59

Query  388   IIYHRRDKAQEQlftfplllrlfflglIGVTISQNLAFVGLSYSSPIAACGTANIVPALS  567
              + H+ D+ +   FTF L +R  FLG IG+T++Q   F+GLSYSSPI  C  ++++P  +
Sbjct  60    FLPHQEDRKERPSFTFSLFMRFLFLGFIGMTMTQAFLFLGLSYSSPILVCAMSHLIPTFN  119

Query  568   FILAIILRRTKIDWESGGSQARMIGALICTVGTISLIFYRGPVVNNYSPTFLHLSTTQFV  747
             F+L++ILR+T+++  S G Q ++IG L+  +G +   F++GP+V   S    H      V
Sbjct  120   FLLSLILRKTELNLRSPGIQVQVIGILVSIMGAVLAEFFKGPLVRPSSHHLRHTDKQYLV  179

Query  748   FSSSTNQQNWVLGCLCFIAASLTLSIWNIIQVGTIRIYPQVMKIMCVYSLFGTVQSGALS  927
             FSS+   + WVLG     AAS ++SI N IQ  T++ YP+ MK++   SL GT+ S  +S
Sbjct  180   FSST--PEFWVLGGALLAAASFSVSISNFIQKETLKQYPEPMKLLSYSSLLGTILSAIVS  237

Query  928   LFIVRDLNAWRLGLNFQLIVILLTAIFGSIIRSSVQLWCMRMKGPSFPLIFKPVGIVVAS  1107
               + RD+NAW++  N  +I+I+LTA+ G +IR ++Q+W  RMKGP +  +FKP GI  A+
Sbjct  238   GIVERDINAWKIKRNKDVILIVLTALVGGVIRPNIQVWFTRMKGPLYVPLFKPFGIAFAT  297

Query  1108  SCGCLFFADTFHYGSMFSAFICGMGYYTTIWGQLK-DEEIQQIKGSSVSLPDEKVPLLQQ  1284
             +    FF+++ HYGS+    + GMGYYT ++GQL+ +EE      SS SL D+ VPLLQ+
Sbjct  298   TFAVCFFSNSLHYGSVIGTTVLGMGYYTVMYGQLRGNEEETSCDESSDSL-DKMVPLLQE  356

Query  1285  SQD  1293
               +
Sbjct  357   KME  359



>ref|XP_008221760.1| PREDICTED: WAT1-related protein At1g70260-like [Prunus mume]
Length=375

 Score =   280 bits (716),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 163/368 (44%), Positives = 239/368 (65%), Gaps = 17/368 (5%)
 Frame = +1

Query  232   EVVPCMAMVMVEACTIFLTIMASTAMAKFGTNPFVFVVYTNALASIFLVPYSIIYH--RR  405
             E VP   MV +E CTI LTI A T M   G +PFVFV+YT++L+S+ L+ YS I+H  RR
Sbjct  10    EAVPFSVMVTMEGCTIILTIWAKTVMTVDGMSPFVFVLYTHSLSSLILLLYSFIFHCPRR  69

Query  406   DKAQEQlftfplllrlfflglIGVTISQNLAFVGLSYSSPIAACGTANIVPALSFILAII  585
             +++   LF+  L +R FFLGL G+TISQNL F+GLSYSSPI  C    ++P  SF+L+II
Sbjct  70    EQS---LFSLNLFVRCFFLGLTGITISQNLGFLGLSYSSPILVCAMGLMIPTFSFLLSII  126

Query  586   LRRTKIDWESGGSQARMIGALICTVGTISLIFYRGPVVNNYS------PTFLHLSTTQFV  747
             LRRT++DW S   QA++ G +I   G +++  Y+G  +   S           L+    +
Sbjct  127   LRRTRLDWRSSNFQAKVSGTIISITGAVAVELYKGAYIRTSSVSSSPGKQLQVLAQKALL  186

Query  748   FSSSTNQQNWVLGCLCFIAASLTLSIWNIIQVGTIRIYPQV--MKIMCVYSLFGTVQSGA  921
               SS   ++WV+G +   +ASL++S+WNIIQ+GT+++YP+V  M+++  YSL GT+QS  
Sbjct  187   VFSSEPTEHWVVGGILLASASLSVSVWNIIQLGTMKLYPEVDAMEVVTFYSLLGTIQSAI  246

Query  922   LSLFIVRDLNAWRLGLNFQLIVILLTAIFGSIIRSSVQLWCMRMKGPSFPLIFKPVGIVV  1101
             LSLF+ R+ +AWRL LN + ++I+LTA+FG ++RS V  WCM MKGP +  +FKP GIV 
Sbjct  247   LSLFLERNPSAWRLKLNMEPLLIILTALFGGLVRSRVHNWCMSMKGPYYVPLFKPFGIVF  306

Query  1102  ASSCGCLFFADTFHYGSMFSAFICGMGYYTTIWGQLKDEEIQQ----IKGSSVSLPDEKV  1269
             A+  G    A++ HYGS+  + + GMGY+   WGQ++++E QQ    +        + KV
Sbjct  307   ATIFGVSLSANSLHYGSVIGSVVIGMGYFAISWGQIREDEGQQDQQCVDERLEPNSERKV  366

Query  1270  PLLQQSQD  1293
             PLLQ+  +
Sbjct  367   PLLQEENN  374



>ref|XP_003526676.1| PREDICTED: WAT1-related protein At1g70260-like [Glycine max]
Length=360

 Score =   279 bits (713),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 151/362 (42%), Positives = 230/362 (64%), Gaps = 3/362 (1%)
 Frame = +1

Query  208   MEVKAAFGEVVPCMAMVMVEACTIFLTIMASTAMAKFGTNPFVFVVYTNALASIFLVPYS  387
             ME +    EV+P + MV++E  TI LTI A TA+   G +PFVF+VYTNALA+I L P  
Sbjct  1     MEARTKMSEVLPFIVMVIMEGWTIGLTIFAKTAITN-GMSPFVFIVYTNALATIILFPCF  59

Query  388   IIYHRRDKAQEQlftfplllrlfflglIGVTISQNLAFVGLSYSSPIAACGTANIVPALS  567
              + H+ D+ +   FTF L +R  FLG IG+T++Q   F+GLSYSSPI  C  ++++P  +
Sbjct  60    FLPHQEDRKERPSFTFSLFMRFLFLGFIGMTMTQAFLFLGLSYSSPILVCAMSHLIPTFN  119

Query  568   FILAIILRRTKIDWESGGSQARMIGALICTVGTISLIFYRGPVVNNYSPTFLHLSTTQFV  747
             F+L++ILR+T+++  S G Q ++IG L+  +G +   F++GP+V   S    H      V
Sbjct  120   FLLSLILRKTELNLRSPGIQVQVIGILVSIMGAVLAEFFKGPLVRPSSHHLRHTDKQYLV  179

Query  748   FSSSTNQQNWVLGCLCFIAASLTLSIWNIIQVGTIRIYPQVMKIMCVYSLFGTVQSGALS  927
             FSS+   + WVLG     AAS ++SI N IQ  T++ YP+ MK++   SL GT+ S  +S
Sbjct  180   FSST--PEFWVLGGALLAAASFSVSISNFIQKETLKQYPEPMKLLSYSSLLGTILSAIVS  237

Query  928   LFIVRDLNAWRLGLNFQLIVILLTAIFGSIIRSSVQLWCMRMKGPSFPLIFKPVGIVVAS  1107
               + RD+NAW++  N  +I+I+LTA+ G +IR ++Q+W  RMKGP +  +FKP GI  A+
Sbjct  238   GIVERDINAWKIKRNKDVILIVLTALVGGVIRPNIQVWFTRMKGPLYVPLFKPFGIAFAT  297

Query  1108  SCGCLFFADTFHYGSMFSAFICGMGYYTTIWGQLKDEEIQQIKGSSVSLPDEKVPLLQQS  1287
             +    FF+++ HYGS+    + GMG+YT ++GQL++ E +     S    D+ VPLLQ+ 
Sbjct  298   TFAVCFFSNSLHYGSVIGTTVLGMGHYTVMYGQLRENEEETSCDESSDSLDKMVPLLQEK  357

Query  1288  QD  1293
              +
Sbjct  358   ME  359



>ref|XP_010414610.1| PREDICTED: WAT1-related protein At1g60050 [Camelina sativa]
Length=373

 Score =   279 bits (714),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 156/360 (43%), Positives = 219/360 (61%), Gaps = 8/360 (2%)
 Frame = +1

Query  235   VVPCMAMVMVEACTIFLTIMASTAMAKFGTNPFVFVVYTNALASIFLVPYSIIYHRRDKA  414
             +VP + M ++EACTI LTI+A TA+   G +PFVF+VYTNAL S+ L+PYS  +HR ++ 
Sbjct  11    IVPFIVMALMEACTIALTILAKTALTG-GMSPFVFIVYTNALGSLLLLPYSFYFHRDERD  69

Query  415   QEQlftfplllrlfflglIGVTISQNLAFVGLSYSSPIAACGTANIVPALSFILAIILRR  594
              E   T P L+R+F LG  GV + QN+AF+GLSYSSPI  C      PA SF+L++ L  
Sbjct  70    DEPFLTKPSLVRIFLLGFTGVFLFQNMAFLGLSYSSPIVVCAMGLQSPAFSFLLSLALGE  129

Query  595   TKIDWESGGSQARMIGALICTVGTISLIFYRGPVVNNYSPTFL---HLSTTQFVFSSSTN  765
               + WES  ++ R+IG LIC  G    + Y GP +     +      L+T     +   N
Sbjct  130   GGVRWESKITKGRVIGTLICFTGAFVEVIYLGPFIRPSPSSSPNSNFLTTVSHYLTFFKN  189

Query  766   QQNWVLGCLCFIAASLTLSIWNIIQVGTIRIYPQVMKIMCVYSLFGTVQSGALSLFIVRD  945
               NW LG L    A+L++SIWNIIQ+ T++ YPQVMK++  YSL GT+Q    S F+  D
Sbjct  190   SDNWALGSLLLACATLSISIWNIIQLDTVQKYPQVMKVVSAYSLAGTLQCAIFSAFMEPD  249

Query  946   LNAWRLGLNFQLIVILLTAIFGSIIRSSVQLWCMRMKGPSFPLIFKPVGIVVASSCGCLF  1125
             L+ W+L LN  L +I+ T IFGSIIR+SVQ+ C +MKGP +  +FKP GI+ AS  G  F
Sbjct  250   LSEWKLKLNMDLYLIIATGIFGSIIRTSVQVKCSKMKGPYYVPLFKPFGILWASIFGTSF  309

Query  1126  FADTFHYGSMFSAFICGMGYYTTIWGQLKDEE----IQQIKGSSVSLPDEKVPLLQQSQD  1293
             F ++ HYGS+  A I G GY   +W Q + E+    +++     +   ++  PLL  + D
Sbjct  310   FVNSLHYGSVLGAAIAGTGYLLIMWSQNQREDQKETVEKNDNHQLDADEQTTPLLLGNGD  369



>gb|KCW85793.1| hypothetical protein EUGRSUZ_B02545 [Eucalyptus grandis]
Length=334

 Score =   277 bits (709),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 155/353 (44%), Positives = 226/353 (64%), Gaps = 24/353 (7%)
 Frame = +1

Query  232   EVVPCMAMVMVEACTIFLTIMASTAMAKFGTNPFVFVVYTNALASIFLVPYSIIYHRRDK  411
             EV   + MV++E CTI LTI+A TAM+  G +PFVFV+YTNALAS+ L+PYS ++HR D+
Sbjct  2     EVARFVVMVIMEGCTIGLTILAKTAMSN-GMSPFVFVLYTNALASLILLPYSFVFHR-DR  59

Query  412   AQEQlftfplllrlfflglIGVTISQNLAFVGLSYSSPIAACGTANIVPALSFILAIILR  591
                                  +TI+Q LAF+GL +SSPI  C   ++VP  SF+LA++LR
Sbjct  60    ---------------------ITITQYLAFIGLDFSSPILVCAMGHLVPTFSFLLALLLR  98

Query  592   RTKIDWESGGSQARMIGALICTVGTISLIFYRGPVVNNYSPTFLHLSTTQFVFSSSTNQQ  771
              TK+DW S   QA++IG  +  VG I +  Y+GPVV+  S +  +    + +F  S+  +
Sbjct  99    TTKLDWRSSSIQAKVIGTFLSVVGAIFVDLYKGPVVSRSSVSSPNRLQYRQLFIYSSMPE  158

Query  772   NWVLGCLCFIAASLTLSIWNIIQVGTIRIYPQVMKIMCVYSLFGTVQSGALSLFIVRDLN  951
             +W +G +    ASL++ IWNIIQVGT+  YPQVMK++  YSL GT+Q   +S  + R+L+
Sbjct  159   HWAVGGILLAGASLSVCIWNIIQVGTLTQYPQVMKVVSFYSLVGTLQCAVVSFAVERNLS  218

Query  952   AWRLGLNFQLIVILLTAIFGSIIRSSVQLWCMRMKGPSFPLIFKPVGIVVASSCGCLFFA  1131
             AW+L L+ +L++I+ TAIF  +IR  VQ+WC + KGP +  +FKP GI+ A      FFA
Sbjct  219   AWKLKLDLKLLLIISTAIFRGVIRPQVQIWCTQAKGPFYVPMFKPFGILYACFFAVCFFA  278

Query  1132  DTFHYGSMFSAFICGMGYYTTIWGQLKDEEIQQIKGS-SVSLPDEKVPLLQQS  1287
             ++ HYGS+  AFI G+GYY+ +WGQ+++ E +    + +    D KVPLLQ  
Sbjct  279   NSLHYGSVIGAFIIGIGYYSLMWGQIREGEARDDHDNRNGDSHDNKVPLLQDE  331



>ref|XP_010510978.1| PREDICTED: WAT1-related protein At1g60050 [Camelina sativa]
Length=373

 Score =   278 bits (712),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 156/360 (43%), Positives = 219/360 (61%), Gaps = 8/360 (2%)
 Frame = +1

Query  235   VVPCMAMVMVEACTIFLTIMASTAMAKFGTNPFVFVVYTNALASIFLVPYSIIYHRRDKA  414
             +VP + M ++EACTI LTI+A TA+   G +PFVF+VYTNAL S+ L+PYS  +HR ++ 
Sbjct  11    IVPFIVMALMEACTIALTILAKTALTG-GMSPFVFIVYTNALGSLLLLPYSFYFHRDERD  69

Query  415   QEQlftfplllrlfflglIGVTISQNLAFVGLSYSSPIAACGTANIVPALSFILAIILRR  594
              E   T P L+R+F LG  GV + QN+AF+GLSYSSPI  C      PA SF+L++ L  
Sbjct  70    DEPFLTKPSLVRIFLLGFTGVFLFQNMAFLGLSYSSPIVVCAMGLQSPAFSFLLSLALGE  129

Query  595   TKIDWESGGSQARMIGALICTVGTISLIFYRGPVVNNYSPTFL---HLSTTQFVFSSSTN  765
               + WES  ++ R+IG LIC  G    + Y GP +     +      L+T     +   N
Sbjct  130   GGLRWESKITKGRVIGTLICFTGAFVEVIYLGPFIRPSPSSSPNSNFLTTVSHYLTFFKN  189

Query  766   QQNWVLGCLCFIAASLTLSIWNIIQVGTIRIYPQVMKIMCVYSLFGTVQSGALSLFIVRD  945
               NW LG L    A+L++SIWNIIQ+ T++ YPQVMK++  YSL GT+Q    S F+  D
Sbjct  190   SDNWALGSLLLACATLSISIWNIIQLDTVQKYPQVMKVVSAYSLAGTLQCAIFSAFMEPD  249

Query  946   LNAWRLGLNFQLIVILLTAIFGSIIRSSVQLWCMRMKGPSFPLIFKPVGIVVASSCGCLF  1125
             L+ W+L LN  L +I+ T IFGSIIR+SVQ+ C +MKGP +  +FKP GI+ AS  G  F
Sbjct  250   LSEWKLKLNMDLYLIIATGIFGSIIRTSVQVKCSKMKGPYYVPLFKPFGILWASIFGTSF  309

Query  1126  FADTFHYGSMFSAFICGMGYYTTIWGQLKDEE----IQQIKGSSVSLPDEKVPLLQQSQD  1293
             F ++ HYGS+  A I G GY   +W Q + E+    +++     +   ++  PLL  + D
Sbjct  310   FVNSLHYGSVLGAAIAGTGYLLIMWSQNQREDQKETVEKNDNHQLDSDEQTTPLLLGNGD  369



>ref|XP_010470159.1| PREDICTED: WAT1-related protein At1g60050-like [Camelina sativa]
Length=373

 Score =   278 bits (712),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 156/360 (43%), Positives = 220/360 (61%), Gaps = 8/360 (2%)
 Frame = +1

Query  235   VVPCMAMVMVEACTIFLTIMASTAMAKFGTNPFVFVVYTNALASIFLVPYSIIYHRRDKA  414
             +VP + M ++EACTI LTI+A TA+   G +PFVF+VYTNAL SI L+PYS+ +HR ++ 
Sbjct  11    IVPFIVMALMEACTIALTILAKTALTG-GMSPFVFIVYTNALGSILLLPYSLYFHRDERD  69

Query  415   QEQlftfplllrlfflglIGVTISQNLAFVGLSYSSPIAACGTANIVPALSFILAIILRR  594
              E   T P L+R+F LG  GV + QN+AF+GLSYSSPI  C      PA SF+L++ L  
Sbjct  70    DEPFLTKPSLVRIFLLGFTGVFLFQNMAFLGLSYSSPIVVCAMGLQSPAFSFLLSLALGE  129

Query  595   TKIDWESGGSQARMIGALICTVGTISLIFYRGPVVNNYSPTFL---HLSTTQFVFSSSTN  765
               + WES  ++ R+IG LIC  G    + Y GP +     +      L+T     +   N
Sbjct  130   GGLRWESKITKGRVIGTLICFTGAFVEVIYLGPFIRPSPSSSPNSNFLTTVSHYLTFFKN  189

Query  766   QQNWVLGCLCFIAASLTLSIWNIIQVGTIRIYPQVMKIMCVYSLFGTVQSGALSLFIVRD  945
               NW LG L    A+L++SIWNIIQ+ T++ YPQVMK++  YSL GT+Q    S F+  D
Sbjct  190   SDNWALGSLLLACATLSISIWNIIQLDTVQKYPQVMKVVSAYSLAGTLQCAIFSAFMEPD  249

Query  946   LNAWRLGLNFQLIVILLTAIFGSIIRSSVQLWCMRMKGPSFPLIFKPVGIVVASSCGCLF  1125
             L+ W+L LN  L +I+ T +FGSIIR+SVQ+ C +MKGP +  +FKP GI+ AS  G  F
Sbjct  250   LSEWKLKLNMDLYLIIATGVFGSIIRTSVQVKCSKMKGPYYVPLFKPFGILWASIFGTSF  309

Query  1126  FADTFHYGSMFSAFICGMGYYTTIWGQLKDEE----IQQIKGSSVSLPDEKVPLLQQSQD  1293
             F ++ HYGS+  A I G GY   +W Q + E+    +++     +   ++  PLL  + D
Sbjct  310   FVNSLHYGSVLGAAIAGTGYLLIMWSQNQREDHKETVEKNDNHLLDSDEQTTPLLLGNGD  369



>ref|XP_004502587.1| PREDICTED: WAT1-related protein At1g70260-like [Cicer arietinum]
Length=357

 Score =   276 bits (706),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 153/363 (42%), Positives = 234/363 (64%), Gaps = 8/363 (2%)
 Frame = +1

Query  208   MEVKAAFGEVVPCMAMVMVEACTIFLTIMASTAMAKFGTNPFVFVVYTNALASIFLVPYS  387
             ME K    E+V  + MV++E CTI LTI+A TA+   G +PFVF+VYTNAL++I L P S
Sbjct  1     MEGKNKSSELVAFIVMVIMEGCTIGLTILAKTAITN-GMSPFVFIVYTNALSTIILFPSS  59

Query  388   -IIYHRRDKAQEQlftfplllrlfflglIGVTISQNLAFVGLSYSSPIAACGTANIVPAL  564
              ++  ++D+ ++ LF+  L +R  FLG  G+T++Q L F+GLSYSSPI  C  ++++P  
Sbjct  60    FLLKQQQDRKEKPLFSLSLFMRFLFLGFTGITMTQTLLFLGLSYSSPILVCAMSHLIPTF  119

Query  565   SFILAIILRRTKIDWESGGSQARMIGALICTVGTISLIFYRGPVVNNYSPTFLHLSTTQF  744
             +F+L II R+ +++  S G Q +MIG ++  +G I   F++GP++ + S    H +   F
Sbjct  120   NFLLNIIHRKIELNLRSYGIQVQMIGIMVSLMGAIVAEFFKGPLIRHSSHNLRH-TKQLF  178

Query  745   VFSSSTNQQNWVLGCLCFIAASLTLSIWNIIQVGTIRIYPQVMKIMCVYSLFGTVQSGAL  924
             VFSS+   + WV G +   AAS ++SI N IQ  TI+ YP+ MK++  Y+L GT+ S  +
Sbjct  179   VFSSTP--EFWVFGGILLAAASFSVSIGNFIQKETIKQYPEQMKVVSYYTLLGTILSAIV  236

Query  925   SLFIVRDLNAWRLGLNFQLIVILLTAIFGSIIRSSVQLWCMRMKGPSFPLIFKPVGIVVA  1104
             S  + RD NAW+L  N +LI+I+LTA FG  IR ++Q+W  R KGP +   FKP GI  A
Sbjct  237   SSILERDANAWKLKSNMELILIVLTATFGGAIRPNIQVWFSRTKGPLYVPQFKPFGIAFA  296

Query  1105  SSCGCLFFADTFHYGSMFSAFICGMGYYTTIWGQLKDEEIQQIKGSSVSLPDEKVPLLQQ  1284
             ++ G  FF ++ HYGS+  A + GMGYYT ++G+ K +   +    S+   D+K+PLLQ+
Sbjct  297   TTFGVCFFPNSLHYGSVIGASVIGMGYYTILYGEFKGDIEDEENSDSL---DKKIPLLQE  353

Query  1285  SQD  1293
             + +
Sbjct  354   NME  356



>ref|XP_010046448.1| PREDICTED: WAT1-related protein At1g70260-like [Eucalyptus grandis]
Length=465

 Score =   280 bits (715),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 160/333 (48%), Positives = 229/333 (69%), Gaps = 2/333 (1%)
 Frame = +1

Query  232   EVVPCMAMVMVEACTIFLTIMASTAMAKFGTNPFVFVVYTNALASIFLVPYSIIYHRRDK  411
             EV   + MV++E CTI LTI+A TAM+  G +PFVFV+YTNALAS+ L+PYS ++HR D+
Sbjct  15    EVARFVVMVIMEGCTIGLTILAKTAMSN-GMSPFVFVLYTNALASLILLPYSFVFHR-DR  72

Query  412   AQEQlftfplllrlfflglIGVTISQNLAFVGLSYSSPIAACGTANIVPALSFILAIILR  591
               E      LLLRLFFLGL G+TI+Q LAF+GL +SSPI  C   ++VP  SF+LA++LR
Sbjct  73    TGEAAIAPTLLLRLFFLGLTGITITQYLAFIGLDFSSPILVCAMGHLVPTFSFLLALLLR  132

Query  592   RTKIDWESGGSQARMIGALICTVGTISLIFYRGPVVNNYSPTFLHLSTTQFVFSSSTNQQ  771
              TK+DW S   QA++IG  +  VG I +  Y+GPVV+  S +  +    + +F  S+  +
Sbjct  133   TTKLDWRSSSIQAKVIGTFLSVVGAIFVDLYKGPVVSRSSVSSPNRLQYRQLFIYSSMPE  192

Query  772   NWVLGCLCFIAASLTLSIWNIIQVGTIRIYPQVMKIMCVYSLFGTVQSGALSLFIVRDLN  951
             +W +G +    ASL++ IWNIIQVGT+  YPQVMK++  YSL GT+Q   +S  + R+L+
Sbjct  193   HWAVGGILLAGASLSVCIWNIIQVGTLTQYPQVMKVVSFYSLVGTLQCAVVSFAVERNLS  252

Query  952   AWRLGLNFQLIVILLTAIFGSIIRSSVQLWCMRMKGPSFPLIFKPVGIVVASSCGCLFFA  1131
             AW+L L+ +L++I+ TAIF  +IR  VQ+WC + KGP +  +FKP GI+ A      FFA
Sbjct  253   AWKLKLDLKLLLIISTAIFRGVIRPQVQIWCTQAKGPFYVPMFKPFGILYACFFAVCFFA  312

Query  1132  DTFHYGSMFSAFICGMGYYTTIWGQLKDEEIQQ  1230
             ++ HYGS+  AFI G+GYY+ +WGQ+++ E + 
Sbjct  313   NSLHYGSVIGAFIIGIGYYSLMWGQIREGEARD  345



>ref|XP_007137540.1| hypothetical protein PHAVU_009G135300g [Phaseolus vulgaris]
 gb|ESW09534.1| hypothetical protein PHAVU_009G135300g [Phaseolus vulgaris]
Length=359

 Score =   276 bits (705),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 157/363 (43%), Positives = 232/363 (64%), Gaps = 6/363 (2%)
 Frame = +1

Query  208   MEVKAAFGEVVPCMAMVMVEACTIFLTIMASTAMAKFGTNPFVFVVYTNALASIFLVPYS  387
             ME K    EV+P + MV++E  TI LTI A TA+   G +PFVF+VYTNALA+I L P S
Sbjct  1     MEAKTKMSEVLPFIIMVIMEGWTIGLTIFAKTAITN-GMSPFVFIVYTNALATIILFPCS  59

Query  388   IIYHRRDKAQEQlftfplllrlfflglIGVTISQNLAFVGLSYSSPIAACGTANIVPALS  567
              +  + ++     FTF L +R  FLGLIGVT++Q   F+GLSYSSPI  C  +++VP  +
Sbjct  60    FLSQQENRKDRLTFTFSLFMRFLFLGLIGVTMTQAFLFLGLSYSSPILVCAMSHLVPTFN  119

Query  568   FILAIILRRTKIDWESGGSQARMIGALICTVGTISLIFYRGPVVNNYSPTFLHLSTTQFV  747
             F+L++ILR+T+++      Q ++IG L+  +G +   FY+GP+V    P+  HL  T+ +
Sbjct  120   FLLSLILRKTELNLRRPSIQVQVIGVLVSVMGAVLAEFYKGPLVR---PSSHHLRQTKQL  176

Query  748   FSSSTNQQNWVLGCLCFIAASLTLSIWNIIQVGTIRIYPQVMKIMCVYSLFGTVQSGALS  927
             F  S+  + W+LG     A+S +LSI N IQ  T+  YPQ MK++   SL G + S  +S
Sbjct  177   FLFSSTPEFWLLGGALLAASSFSLSISNFIQKETLEQYPQPMKVISYSSLIGMILSATVS  236

Query  928   LFIVRDLNAWRLGLNFQLIVILLTAIFGSIIRSSVQLWCMRMKGPSFPLIFKPVGIVVAS  1107
               + RD+ AW++  N  LI+I+LTA+ G +IR ++Q+W  R KG  +  +FKP GI  A+
Sbjct  237   CIVERDIQAWKIKRNKDLILIVLTALVGGVIRPNIQVWLTRTKGSLYVPLFKPFGIAFAA  296

Query  1108  SCGCLFFADTFHYGSMFSAFICGMGYYTTIWGQLK-DEEIQQIKGSSVSLPDEKVPLLQQ  1284
             +    FF+++ HYGS+ +  I GMGYYT ++GQ+K +EE  +   SS SL DEK+PLLQ+
Sbjct  297   TFAVCFFSNSLHYGSVIATSILGMGYYTVMYGQIKGNEEETRCDDSSDSL-DEKIPLLQE  355

Query  1285  SQD  1293
               +
Sbjct  356   KME  358



>ref|NP_176213.1| Nodulin MtN21 /EamA-like transporter family protein [Arabidopsis 
thaliana]
 sp|Q9ZUI8.1|WTR9_ARATH RecName: Full=WAT1-related protein At1g60050 [Arabidopsis thaliana]
 gb|AAD14481.1| Similar to gi|4056506 F3G5.25 nodulin-like protein from Arabidopsis 
thaliana BAC gb|AC005896 [Arabidopsis thaliana]
 gb|AEE33653.1| Nodulin MtN21 /EamA-like transporter family protein [Arabidopsis 
thaliana]
Length=374

 Score =   275 bits (703),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 157/361 (43%), Positives = 220/361 (61%), Gaps = 9/361 (2%)
 Frame = +1

Query  235   VVPCMAMVMVEACTIFLTIMASTAMAKFGTNPFVFVVYTNALASIFLVPYSIIYHRRDKA  414
             +VP + M ++EACTI LTI+A TA+   G +PFVF+VYTNAL S+ L+PYS  +HR +  
Sbjct  11    IVPFIVMALMEACTIALTILAKTALTG-GMSPFVFIVYTNALGSLLLLPYSFYFHRDESD  69

Query  415   QEQlftfplllrlfflglIGVTISQNLAFVGLSYSSPIAACGTANIVPALSFILAIIL-R  591
              E   T P L+R+F LG  GV + QN+AF+GLSYSSPI  C      PA SF+L++ L +
Sbjct  70    DEPFLTKPSLVRIFLLGFTGVFLFQNMAFLGLSYSSPIVVCAMGLQSPAFSFLLSLALGK  129

Query  592   RTKIDWESGGSQARMIGALICTVGTISLIFYRGPVVNNYSPTFL---HLSTTQFVFSSST  762
                + W S  ++ R+IG LIC  G    + Y GP +    P+      L+T     +   
Sbjct  130   EGGLGWASKRTKGRVIGTLICFTGAFVEVIYLGPFIRPSPPSSPTSNFLTTISHYLTFFK  189

Query  763   NQQNWVLGCLCFIAASLTLSIWNIIQVGTIRIYPQVMKIMCVYSLFGTVQSGALSLFIVR  942
             N  NW LG L    A+L++SIWNIIQ+ T++ YPQVMK++  YSL GT+Q    S F+  
Sbjct  190   NSDNWALGSLLLACATLSISIWNIIQLDTVQKYPQVMKVVSAYSLAGTLQCAIFSAFMEP  249

Query  943   DLNAWRLGLNFQLIVILLTAIFGSIIRSSVQLWCMRMKGPSFPLIFKPVGIVVASSCGCL  1122
             DL+AW L LN  L +I+ T IFGSIIR+SVQ+ C +MKGP +  +FKP GI+ AS  G  
Sbjct  250   DLSAWELKLNMDLYLIIATGIFGSIIRTSVQVKCSKMKGPYYVPLFKPFGILWASIFGTS  309

Query  1123  FFADTFHYGSMFSAFICGMGYYTTIWGQLK----DEEIQQIKGSSVSLPDEKVPLLQQSQ  1290
             FF ++ HYGS+  A I G GY   +W Q++    +E +++     +   ++  PLL  + 
Sbjct  310   FFVNSLHYGSVLGAAIAGTGYLLIMWSQVQKDDPNETVEKNDNHQLDSDEQTTPLLLANG  369

Query  1291  D  1293
             D
Sbjct  370   D  370



>ref|XP_010543988.1| PREDICTED: WAT1-related protein At1g60050 [Tarenaya hassleriana]
Length=369

 Score =   274 bits (700),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 156/357 (44%), Positives = 222/357 (62%), Gaps = 7/357 (2%)
 Frame = +1

Query  232   EVVPCMAMVMVEACTIFLTIMASTAMAKFGTNPFVFVVYTNALASIFLVPYSIIYHRRDK  411
             + VP  AMV++EA TI LTI+A TA+   G +PFVFVVYTNAL S+ LVPYS ++H+ ++
Sbjct  10    DTVPFGAMVLMEASTIALTILAKTALTG-GMSPFVFVVYTNALGSLLLVPYSFLFHQHER  68

Query  412   AQEQlftfplllrlfflglIGVTISQNLAFVGLSYSSPIAACGTANIVPALSFILAIILR  591
                  FT   ++    LG  GV + QNLAF+GLSYSSPI  C      PALS++L++ L 
Sbjct  69    TDRTFFTLNFIICTLLLGFTGVFLFQNLAFMGLSYSSPIVVCAMGLQTPALSYLLSLALG  128

Query  592   RTKIDWESGGSQARMIGALICTVGTISLIFYRGPVVNNYSPTFLHLSTTQ-FVFSSSTNQ  768
             + K++WE   ++ ++IG L+   G +  + Y GP       +  +   ++  VF    N 
Sbjct  129   KAKLEWERTTTRGKVIGTLVSLTGAMVEVIYLGPYTRPSPSSSPNSLLSRHLVFFK--NS  186

Query  769   QNWVLGCLCFIAASLTLSIWNIIQVGTIRIYPQVMKIMCVYSLFGTVQSGALSLFIVRDL  948
              NWVLGC     ASL++S WN IQV T+R YPQVMK++  YSL GTVQ    S  +  DL
Sbjct  187   DNWVLGCFLLACASLSVSAWNFIQVDTVRKYPQVMKVVAAYSLAGTVQCSIFSAIMESDL  246

Query  949   NAWRLGLNFQLIVILLTAIFGSIIRSSVQLWCMRMKGPSFPLIFKPVGIVVASSCGCLFF  1128
             NAW+L  N  L++I+ T IFGSIIR+SV + C ++KGP +  +FKP GI+ A+  G  FF
Sbjct  247   NAWKLKPNMDLMLIIATGIFGSIIRTSVHVKCAKLKGPYYVPLFKPFGILWATIFGTSFF  306

Query  1129  ADTFHYGSMFSAFICGMGYYTTIWGQLKDEEIQQI---KGSSVSLPDEKVPLLQQSQ  1290
              ++ HYGS+  A + G+GY   +WGQ+ +EE +     KG  ++   E VPLL+++ 
Sbjct  307   VNSLHYGSVLGATVAGIGYLMIMWGQVHEEEDKNHMNQKGEIINNTQETVPLLREND  363



>ref|XP_007224086.1| hypothetical protein PRUPE_ppa015497mg [Prunus persica]
 gb|EMJ25285.1| hypothetical protein PRUPE_ppa015497mg [Prunus persica]
Length=373

 Score =   270 bits (691),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 156/368 (42%), Positives = 229/368 (62%), Gaps = 17/368 (5%)
 Frame = +1

Query  232   EVVPCMAMVMVEACTIFLTIMASTAMAKFGTNPFVFVVYTNALASIFLVPYSIIYH--RR  405
             E VP   MV +E CTI LTI A T M   G +PFVFVVYT+AL+S+ L+ YS I+H  R 
Sbjct  8     EAVPFSVMVTMEGCTIILTIWAKTVMTVDGMSPFVFVVYTHALSSLILLLYSFIFHCPRN  67

Query  406   DKAQEQlftfplllrlfflglIGVTISQNLAFVGLSYSSPIAACGTANIVPALSFILAII  585
                +EQ      L    F   +G+T S NL F+GLSYSSPI  C    ++P  SF+L++I
Sbjct  68    RGGREQSLFSLNLFVRCFF--LGLTGS-NLGFLGLSYSSPILVCAMGLMIPTFSFLLSVI  124

Query  586   LRRTKIDWESGGSQARMIGALICTVGTISLIFYRGPVVNNYS------PTFLHLSTTQFV  747
             LRRT++DW S   QA++ G +I  +G +++  Y+G  +   S           L+    +
Sbjct  125   LRRTRLDWRSSSFQAKVSGTIISIIGAVAVELYKGAYIRTSSVSSSPGKQLQVLAQKALL  184

Query  748   FSSSTNQQNWVLGCLCFIAASLTLSIWNIIQVGTIRIYPQV--MKIMCVYSLFGTVQSGA  921
               SS   ++WV+G +   +ASL++S+WNIIQ+GT+++YP+V  M+++  YSL GT+QS  
Sbjct  185   VFSSEPTEHWVVGGILLASASLSVSVWNIIQLGTMKLYPEVEAMEVVTFYSLLGTIQSAI  244

Query  922   LSLFIVRDLNAWRLGLNFQLIVILLTAIFGSIIRSSVQLWCMRMKGPSFPLIFKPVGIVV  1101
             LSLF+ R+ +AWRL LN + ++I+LTAIFG ++RS V  WCM +KGP +  +FKP GIV 
Sbjct  245   LSLFLERNPSAWRLKLNMEPLLIILTAIFGGLVRSRVHNWCMSIKGPYYVPLFKPFGIVF  304

Query  1102  ASSCGCLFFADTFHYGSMFSAFICGMGYYTTIWGQLKDEEIQQ----IKGSSVSLPDEKV  1269
             A+  G    A++ HYGS+  + + GMGY+    GQ++++E QQ    +     S  + KV
Sbjct  305   ATIFGVSLSANSLHYGSVIGSVVIGMGYFVISCGQIREDEGQQDQQCVDERLESNSERKV  364

Query  1270  PLLQQSQD  1293
             PLLQ+  +
Sbjct  365   PLLQEENN  372



>ref|XP_010551549.1| PREDICTED: WAT1-related protein At1g70260-like [Tarenaya hassleriana]
Length=372

 Score =   270 bits (690),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 171/376 (45%), Positives = 248/376 (66%), Gaps = 14/376 (4%)
 Frame = +1

Query  208   MEVKAAFGEVVPCMAMVMVEACTIFLTIMASTAMAKFGTNPFVFVVYTNALASIFLVPYS  387
             MEVK    E  P + MV++E CTI LTIMA TA+   G +PFVFVVYTNAL S  L+P+S
Sbjct  1     MEVKVRREETAPFLVMVLMEGCTIALTIMAKTALTG-GMSPFVFVVYTNALGSFLLLPFS  59

Query  388   IIYHRRDKAQEQlftfplllrlfflglIGVTISQNLAFVGLSYSSPIAACGTANIVPALS  567
              ++HR D+ Q  +F+ PLL+R+FFLG  G+ + QNLAFVGLS+SSPI  C    ++P+ S
Sbjct  60    FLFHRHDRTQLSIFSRPLLVRVFFLGFTGIFMFQNLAFVGLSFSSPIVVCAMGLLIPSFS  119

Query  568   FILAIILRRTKIDWESGGSQARMIGALICTVGTISLIFYRGPVV---NNYSPTFLHLSTT  738
             F+L+++LRR+ ++W++  ++A++IG+LI   G I   FY+GP +   ++ SPT L L + 
Sbjct  120   FLLSLLLRRSSLEWQNKSTRAKVIGSLISISGAIVEEFYKGPYIRPSSSSSPTEL-LRSI  178

Query  739   QFVFSSSTNQQNWVLGCLCFIAASLTLSIWNIIQVGTIRIYPQVMKIMCVYSLFGTVQSG  918
               +F       NWVLG L   AA+ ++SI+N IQ+GT++ YPQVMK+   YS+ GT+Q  
Sbjct  179   PRLFVYYKIPDNWVLGGLFLAAAAFSVSIFNAIQMGTVQKYPQVMKVASFYSIIGTLQCL  238

Query  919   ALSLFIVRDLNAWRLGLNFQLIVILLTAIFGSIIRSSVQLWCMRMKGPSFPLIFKPVGIV  1098
               S+F+ RD +AW +  +F L++I++T IFGS++R+SVQ+ C +MKGP +  +FKP GI 
Sbjct  239   TFSIFMERDPSAWVIKPDFDLLLIIVTGIFGSVVRTSVQVKCTKMKGPFYVPLFKPFGIF  298

Query  1099  VASSCGCLFFADTFHYGSMFSAFICGMGYYTTIWGQLKDEEIQQIKGSSVSL-------P  1257
              A+  G  FF ++ HYGS+  A I G+GY+T  WGQ+K+ E  QI               
Sbjct  299   WAALFGTSFFVNSLHYGSVLGAAIGGVGYFTVTWGQMKETEENQIPKKETKHVKGIHTDE  358

Query  1258  DEKVPLLQQSQDDSPV  1305
             + KVPLL   ++DS V
Sbjct  359   EHKVPLLH--EEDSHV  372



>ref|XP_010533056.1| PREDICTED: WAT1-related protein At1g70260 [Tarenaya hassleriana]
Length=374

 Score =   269 bits (688),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 170/376 (45%), Positives = 250/376 (66%), Gaps = 12/376 (3%)
 Frame = +1

Query  208   MEVKAAFGEVVPCMAMVMVEACTIFLTIMASTAMAKFGTNPFVFVVYTNALASIFLVPYS  387
             MEVK    E+VP M MV++E CTI LTIMA TA+   G +PFVFVVYTNAL S  L+P+S
Sbjct  1     MEVKVRREEIVPFMVMVLMEGCTIALTIMAKTALTG-GMSPFVFVVYTNALGSFLLLPFS  59

Query  388   IIYHRRDKAQEQlftfplllrlfflglIGVTISQNLAFVGLSYSSPIAACGTANIVPALS  567
               +H++++ +  +F+ PLL+R+FFLG  GV + QNLAFVGLS+SSPI  C    ++P+ S
Sbjct  60    FFFHKQERTELSIFSRPLLVRIFFLGFTGVFMFQNLAFVGLSFSSPIVVCAMGLLLPSFS  119

Query  568   FILAIILRRTKIDWESGGSQARMIGALICTVGTISLIFYRGPVV---NNYSPTFLHLSTT  738
             F+L+++L R+ ++W++  ++A+++G LI   G I   FY+GP +   ++ SPT L L + 
Sbjct  120   FLLSLLLGRSSLEWQNTSTRAKVVGTLISVSGAIVEEFYKGPYIRPSSSPSPTGL-LRSI  178

Query  739   QFVFSSSTNQQNWVLGCLCFIAASLTLSIWNIIQVGTIRIYPQVMKIMCVYSLFGTVQSG  918
               +F       NWVLG +   AA  +++I+N+IQ+GT++ YPQVMK+   YS+ GT+Q  
Sbjct  179   PRLFVYYKIPDNWVLGGVFLAAAVFSVAIFNVIQMGTVQKYPQVMKVASFYSIVGTLQCL  238

Query  919   ALSLFIVRDLNAWRLGLNFQLIVILLTAIFGSIIRSSVQLWCMRMKGPSFPLIFKPVGIV  1098
             A SLF+ RD +AW +  NF L++I++T IFGS++R+SVQ+ C +MKGP +  +FKP GI 
Sbjct  239   AFSLFMERDPSAWSIKPNFDLLLIIVTGIFGSVVRTSVQVKCAQMKGPFYVPLFKPFGIF  298

Query  1099  VASSCGCLFFADTFHYGSMFSAFICGMGYYTTIWGQLKDEEIQQIKGSSVSL-------P  1257
              AS  G  FF ++ HYGS+  A I G+GY+T  WGQ+K+ E +Q                
Sbjct  299   WASLFGTSFFVNSLHYGSVLGAAIGGVGYFTVTWGQMKEAEEKQKPRKETKCTKAIHYNE  358

Query  1258  DEKVPLLQQSQDDSPV  1305
             + KVPLL+  ++DS V
Sbjct  359   EHKVPLLRHGEEDSQV  374



>ref|XP_007137541.1| hypothetical protein PHAVU_009G135400g [Phaseolus vulgaris]
 gb|ESW09535.1| hypothetical protein PHAVU_009G135400g [Phaseolus vulgaris]
Length=358

 Score =   268 bits (685),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 147/362 (41%), Positives = 231/362 (64%), Gaps = 5/362 (1%)
 Frame = +1

Query  208   MEVKAAFGEVVPCMAMVMVEACTIFLTIMASTAMAKFGTNPFVFVVYTNALASIFLVPYS  387
             ME +    EV+P + MV++E  TI LTI A TA+   G +P VF+VYTNALA+I L P S
Sbjct  1     MEGRTEMSEVLPFIIMVIMEGWTIGLTIFAKTAITN-GMSPLVFIVYTNALATIILFPCS  59

Query  388   IIYHRRDKAQEQlftfplllrlfflglIGVTISQNLAFVGLSYSSPIAACGTANIVPALS  567
              + H+ D+ +   FTF L  R  FLG IG++++Q+  F+GL+YSSPI  C    ++P  +
Sbjct  60    FLSHKEDRKELPTFTFSLFKRFLFLGFIGISMAQSFLFLGLTYSSPILVCAMGLLIPTFN  119

Query  568   FILAIILRRTKIDWESGGSQARMIGALICTVGTISLIFYRGPVVNNYSPTFLHLSTTQFV  747
             F+L++ILR+T+++  S G Q ++IG L+  +G +   F++GP++    P+  HL  T+ +
Sbjct  120   FLLSLILRKTELNLRSPGIQVQVIGILVSIMGAVLAEFWKGPLIR---PSSHHLLQTKQL  176

Query  748   FSSSTNQQNWVLGCLCFIAASLTLSIWNIIQVGTIRIYPQVMKIMCVYSLFGTVQSGALS  927
                S+  + W+LG      A  +LS+ N+IQ  T+++YP+ MK++   SL GT+ S  +S
Sbjct  177   LVFSSTPEFWLLGGALLATAFFSLSLSNVIQKETLQLYPEPMKVISYSSLIGTILSATVS  236

Query  928   LFIVRDLNAWRLGLNFQLIVILLTAIFGSIIRSSVQLWCMRMKGPSFPLIFKPVGIVVAS  1107
              F+ RD+N W++  N  LI+I+LTA+ G +IR ++Q+W   +KGP +  +FKP GI  A+
Sbjct  237   CFVERDINTWKIKRNKDLILIVLTALVGGVIRPNIQVWLTSLKGPLYVSLFKPFGIAFAT  296

Query  1108  SCGCLFFADTFHYGSMFSAFICGMGYYTTIWGQLKDEEIQQIKGSSVSLPDEKVPLLQQS  1287
             + G  FF+++ HYGS+  A + GMGYYT I+GQ+K  E  +  G   S   +K+PLLQ+ 
Sbjct  297   TFGLCFFSNSLHYGSVIGATLLGMGYYTVIYGQIKGNE-DETSGDDSSDSLDKIPLLQEK  355

Query  1288  QD  1293
              +
Sbjct  356   ME  357



>ref|XP_010682608.1| PREDICTED: WAT1-related protein At1g70260-like [Beta vulgaris 
subsp. vulgaris]
Length=365

 Score =   250 bits (638),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 146/361 (40%), Positives = 223/361 (62%), Gaps = 9/361 (2%)
 Frame = +1

Query  232   EVVPCMAMVMVEACTIFLTIMASTAMAKFGTNPFVFVVYTNALASIFLVPYSIIYHRRDK  411
             EV+P M M ++E CTI LTI A +AM   G + FVFV Y+NAL+S+ L+ YS+IYHR   
Sbjct  11    EVIPFMTMFLIEGCTIALTITAKSAMG-LGMSQFVFVAYSNALSSVLLLAYSLIYHR--D  67

Query  412   AQEQlftfplllrlfflglIGVTISQNLAFVGLSYSSPIAACGTANIVPALSFILAIILR  591
             + +++F   L+ R F LGLIG+TI+QNLAF GL  SSPI  C    ++P+  F L +ILR
Sbjct  68    SMKKIFNGKLITRFFLLGLIGITIAQNLAFTGLRDSSPIVVCAMGLLLPSFQFFLNLILR  127

Query  592   RTKIDWESGGSQARMIGALICTVGTISLIFYRGPVVNN---YSPTFLHLSTTQFVFSSST  762
             +T++  +S  ++ +++G ++ +VG +++  Y GP +       P  LH +   FVF ++T
Sbjct  128   KTELKLKSKATRMKLVGVVVSSVGALTVALYLGPSMLPGPIIRPLMLHGTKLNFVFVATT  187

Query  763   NQQNWVLGCLCFIAASLTLSIWNIIQVGTIRIYPQVMKIMCVYSLFGTVQSGALSLFIVR  942
               Q W+ G L    A+  ++IW++IQV T + +P +M I+  Y++FGT+Q+  + +    
Sbjct  188   --QEWMFGTLLLACATFFIAIWSMIQVSTFKRFPDMMVIVTCYTIFGTLQTFFVDIIANG  245

Query  943   DLNAWRLGLNFQLIVILLTAIFGSIIRSSVQLWCMRMKGPSFPLIFKPVGIVVASSCGCL  1122
             DLNAW+L ++ +L++I+LTAIFG+++RS VQ W M +KGP +  +FKP GI  A+  G  
Sbjct  246   DLNAWKLQMDLELLIIVLTAIFGTLVRSRVQAWIMSLKGPMYVAMFKPAGIFWANFFGES  305

Query  1123  FFADTFHYGSMFSAFICGMGYYTTIWGQLKDEEIQQIKGSSVSLPDEKVPLLQQSQDDSP  1302
             FF  T  YGS+    + G+GYYT + G  ++    Q   +     D K PLLQ    D  
Sbjct  306   FFG-TLCYGSVIGTIVVGVGYYTVLLGVKEEARKDQEDSTKFDSSDIKAPLLQNQDGDEQ  364

Query  1303  V  1305
             V
Sbjct  365   V  365



>ref|XP_003608949.1| Auxin-induced protein 5NG4 [Medicago truncatula]
 gb|AES91146.1| nodulin MtN21/EamA-like transporter family protein [Medicago 
truncatula]
Length=353

 Score =   248 bits (634),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 147/362 (41%), Positives = 215/362 (59%), Gaps = 11/362 (3%)
 Frame = +1

Query  208   MEVKAAFGEVVPCMAMVMVEACTIFLTIMASTAMAKFGTNPFVFVVYTNALASIFLVPYS  387
             MEVK    E +P  AMV+VE   + LT ++  AM+  G N F+FV+Y+NALA+  L+P  
Sbjct  1     MEVKRYLLECIPFAAMVIVECLDVGLTTLSKEAMSTKGMNHFIFVLYSNALATFILLPSY  60

Query  388   IIYHRRDKAQEQlftfplllrlfflglIGVTISQNLAFVGLSYSSPIAACGTANIVPALS  567
              + +R  +      +F LL + FFLGL+G+TI QN  F G+SYSSP      +N+ PA++
Sbjct  61    FLINRTTRPP---LSFSLLAKFFFLGLVGITIMQNCVFTGISYSSPTLGSAMSNLTPAIT  117

Query  568   FILAIILRRTKIDWESGGSQARMIGALICTVGTISLIFYRGPVVNNYSPTFLHLSTTQFV  747
             F+LA+I R  K+D  S  SQ +++G ++   G + + FY+G  +++        ST+Q  
Sbjct  118   FVLAVIFRMEKLDAGSSISQIKIVGTVVSISGALIVTFYKGAPISSIQT---QPSTSQPF  174

Query  748   FSSSTNQQNWVLGCLCFIAASLTLSIWNIIQVGTIRIYPQVMKIMCVYSLFGTVQSGALS  927
             +S      NWV+G L    ASL+L+IWNI Q   +R YP  + I+  Y LFGT+Q   LS
Sbjct  175   WSLLAETSNWVIGGLFLATASLSLAIWNIAQAEILRGYPSQLTIVAFYCLFGTIQCALLS  234

Query  928   LFIVRDLNAWRLGLNFQLIVILLTAIFGSIIRSSVQLWCMRMKGPSFPLIFKPVGIVVAS  1107
             L +V+D NAW L L+ +LI I+ +AIFGS +  SV  WC+  KGP F  +FKPVGI +A+
Sbjct  235   LIVVKDPNAWNLSLDIELIAIIYSAIFGSAVTFSVLTWCIDRKGPVFVTMFKPVGIAIAA  294

Query  1108  SCGCLFFADTFHYGSMFSAFICGMGYYTTIWGQLKDEEIQQIKGSSVS-LP-DEKVPLLQ  1281
                  F  +T H GS+  A +  +G+YT +W Q K+   + +KG  V  LP     PLL+
Sbjct  295   FMSVAFLGETLHVGSVIGALVIAIGFYTVMWAQSKE---KNVKGLEVDRLPSSSSAPLLE  351

Query  1282  QS  1287
              +
Sbjct  352   ST  353



>ref|XP_008239731.1| PREDICTED: WAT1-related protein At5g40240-like [Prunus mume]
Length=399

 Score =   248 bits (633),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 143/368 (39%), Positives = 215/368 (58%), Gaps = 7/368 (2%)
 Frame = +1

Query  208   MEVKAAFGEVVPCMAMVMVEACTIFLTIMASTAMAKFGTNPFVFVVYTNALASIFLVPYS  387
             M +K++  E+VP  AMVMVE   + LT ++  AM++ G + FVFVVY+NALA++ L+P S
Sbjct  29    MGMKSSLVELVPFAAMVMVEIMDVGLTTLSKAAMSR-GMSHFVFVVYSNALATLILLPSS  87

Query  388   IIYHRRDKAQEQlftfplllrlfflglIGVTISQNLAFVGLSYSSPIAACGTANIVPALS  567
              I HR  +      TF +L + F L L G+T+ QN  F G+SYSSP  A   +N+VPA +
Sbjct  88    FIIHRNKRPP---LTFSVLCKFFLLSLAGITVMQNCVFAGVSYSSPTLASALSNLVPAFT  144

Query  568   FILAIILRRTKIDWESGGSQARMIGALICTVGTISLIFYRGPVVNNYSPTFLHLSTTQFV  747
             F LA+I R  K D  +  SQ +++G L+   G + +  Y+GP V  + P+   + ++   
Sbjct  145   FFLAVIFRMEKFDLRNSRSQIKIMGTLVSISGALIVTLYKGPAVG-FLPSQPAIDSSPPN  203

Query  748   FSSSTNQQNWVLGCLCFIAASLTLSIWNIIQVGTIRIYPQVMKIMCVYSLFGTVQSGALS  927
              +  T+  NWV+G L    ASL+L++WN  Q   ++ YP  M ++  Y  FGT+QS  L+
Sbjct  204   PTMLTSMNNWVIGGLFLTTASLSLAVWNTAQAAILKGYPSEMTVVSFYCFFGTIQSAILT  263

Query  928   LFIVRDLNAWRLGLNFQLIVILLTAIFGSIIRSSVQLWCMRMKGPSFPLIFKPVGIVVAS  1107
             L + ++   W L L+ +LI IL +AIFGS+I  S   WC++ KGP F  +FKP+GI +A+
Sbjct  264   LIVEKNPKVWALRLDMELISILYSAIFGSVITFSTLTWCIQKKGPVFVAMFKPLGIAIAA  323

Query  1108  SCGCLFFADTFHYGSMFSAFICGMGYYTTIWGQLKDEE--IQQIKGSSVSLPDEKVPLLQ  1281
               G +F  DT H GS+  A +  +G+Y  IW Q K+E+   Q+          E V  LQ
Sbjct  324   LMGAIFLGDTLHVGSVIGALVIVVGFYGVIWAQSKEEKSLDQKRDEKEQGETHEVVDRLQ  383

Query  1282  QSQDDSPV  1305
              S   +P+
Sbjct  384   SSSQSTPL  391



>ref|XP_007209260.1| hypothetical protein PRUPE_ppa007344mg [Prunus persica]
 gb|EMJ10459.1| hypothetical protein PRUPE_ppa007344mg [Prunus persica]
Length=371

 Score =   246 bits (629),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 142/368 (39%), Positives = 215/368 (58%), Gaps = 7/368 (2%)
 Frame = +1

Query  208   MEVKAAFGEVVPCMAMVMVEACTIFLTIMASTAMAKFGTNPFVFVVYTNALASIFLVPYS  387
             M +K++  E+VP  AMVMVE   + LT ++  AM++ G + FVFVVY+NALA++ L+P S
Sbjct  1     MGMKSSLVELVPFAAMVMVEIMDVGLTTLSKAAMSR-GMSHFVFVVYSNALATLILLPSS  59

Query  388   IIYHRRDKAQEQlftfplllrlfflglIGVTISQNLAFVGLSYSSPIAACGTANIVPALS  567
              I HR  +      TF +L + F L L G+T+ QN  F G+SYSSP  A   +N+VPA +
Sbjct  60    FIIHRNKRPP---LTFSVLCKFFLLSLAGITVMQNCVFTGVSYSSPTLASALSNLVPAFT  116

Query  568   FILAIILRRTKIDWESGGSQARMIGALICTVGTISLIFYRGPVVNNYSPTFLHLSTTQFV  747
             F LA++ R  K D  +  SQ +++G L+   G + +  Y+GP V  + P+   + ++   
Sbjct  117   FFLAVVFRMEKFDLRNSRSQIKIMGTLVSISGALIVTLYKGPAVG-FLPSQPAIDSSPPN  175

Query  748   FSSSTNQQNWVLGCLCFIAASLTLSIWNIIQVGTIRIYPQVMKIMCVYSLFGTVQSGALS  927
              +  T+  NWV G L    ASL+L+IWN  Q   ++ YP  M ++  Y  FGT+QS  L+
Sbjct  176   PTMLTSMNNWVTGGLFLTTASLSLAIWNTAQAAILKGYPSEMTVVSFYCFFGTIQSAILT  235

Query  928   LFIVRDLNAWRLGLNFQLIVILLTAIFGSIIRSSVQLWCMRMKGPSFPLIFKPVGIVVAS  1107
             L + ++ N W L L+ +LI I+ +AIFGS+I  S   WC++ KGP +  +FKP+GI +A+
Sbjct  236   LIVEKNPNVWALRLDMELISIVYSAIFGSVITFSTLTWCIQKKGPVYVAMFKPLGIAIAA  295

Query  1108  SCGCLFFADTFHYGSMFSAFICGMGYYTTIWGQLKDEE--IQQIKGSSVSLPDEKVPLLQ  1281
               G +F  DT H GS+  A +  +G+Y  IW Q K+E+   Q+          E V  LQ
Sbjct  296   LMGAIFLGDTLHIGSVIGALVIVVGFYGVIWAQSKEEKSLDQKRDEKEQGETHEVVDRLQ  355

Query  1282  QSQDDSPV  1305
              S   +P+
Sbjct  356   SSSQRTPL  363



>ref|XP_004508845.1| PREDICTED: WAT1-related protein At5g40240-like [Cicer arietinum]
Length=356

 Score =   246 bits (627),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 138/361 (38%), Positives = 211/361 (58%), Gaps = 8/361 (2%)
 Frame = +1

Query  208   MEVKAAFGEVVPCMAMVMVEACTIFLTIMASTAMAKFGTNPFVFVVYTNALASIFLVPYS  387
             M V+    E +P  AMV+VE   + LTI++  AM+  G N FVFV+Y+NALA+  L+P S
Sbjct  1     MGVRNYLLECIPFAAMVIVEFLAVGLTILSKVAMSTKGMNHFVFVLYSNALATFILLPSS  60

Query  388   IIYHRRDKAQEQlftfplllrlfflglIGVTISQNLAFVGLSYSSPIAACGTANIVPALS  567
              + +R  +   Q  +F LL + F L L+G+TI QN  F+G+SYSSP      +N+ PA++
Sbjct  61    FLINRSTR---QSLSFSLLGKFFLLSLVGITIMQNCVFIGISYSSPTLGSAMSNLTPAIT  117

Query  568   FILAIILRRTKIDWESGGSQARMIGALICTVGTISLIFYRGPVVNNYSPTFLHLSTTQFV  747
             F+LA+I R  K+D  S  SQ +++G ++   G + +  Y+G  + ++       ST+Q +
Sbjct  118   FVLAVIFRMEKLDVGSSISQIKIVGTVLSISGALLVTLYKGAPIGSFQT---EPSTSQPL  174

Query  748   FSSSTNQQNWVLGCLCFIAASLTLSIWNIIQVGTIRIYPQVMKIMCVYSLFGTVQSGALS  927
              S      NWV+G L    +SL+ ++WNI Q   ++ YP  + I+  Y LFGT+Q   LS
Sbjct  175   LSLLAETSNWVIGGLFLATSSLSFAVWNIAQAAILKSYPSQLTILAFYCLFGTIQCAILS  234

Query  928   LFIVRDLNAWRLGLNFQLIVILLTAIFGSIIRSSVQLWCMRMKGPSFPLIFKPVGIVVAS  1107
             L  V+D NAW L  + +LI I+ +A FGS++  SV  WC+  KGP F  +FKPVGI +A+
Sbjct  235   LVAVKDPNAWNLSTDIELISIIYSATFGSVVTFSVLTWCIDRKGPLFVTMFKPVGIAIAA  294

Query  1108  SCGCLFFADTFHYGSMFSAFICGMGYYTTIWGQLKDEEIQQIKGS--SVSLPDEKVPLLQ  1281
                  F  +T H GS+  A +  +G+YT +W Q K+   + ++    S S  D+  PLL+
Sbjct  295   FMSVAFLGETLHAGSVIGALVIAIGFYTVLWAQSKERHGKDLEFDELSPSSSDQASPLLE  354

Query  1282  Q  1284
              
Sbjct  355   S  355



>ref|XP_010264833.1| PREDICTED: WAT1-related protein At4g15540-like [Nelumbo nucifera]
Length=414

 Score =   239 bits (609),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 141/370 (38%), Positives = 217/370 (59%), Gaps = 23/370 (6%)
 Frame = +1

Query  214   VKAAFGEVVPCMAMVMVEACTIFLTIMASTAMAKFGTNPFVFVVYTNALASIFLVPYSII  393
             ++++ G ++P  AM+ +E   + +T ++  A++K G + FVFVVY+NALA++ L+  S I
Sbjct  55    LRSSVGALLPFAAMIALECLDVGMTTLSKAALSK-GMSHFVFVVYSNALATLILLS-SYI  112

Query  394   YHRRDKAQEQlftfplllrlfflglIGVTISQNLAFVGLSYSSPIAACGTANIVPALSFI  573
             + R+ +      T PLL + F L L+G+T+ Q+  + G+SYSSP       N+VPA +FI
Sbjct  113   FLRKKRLP---LTLPLLCKFFLLALVGITVMQSCVYTGISYSSPTLGSAIGNLVPACTFI  169

Query  574   LAIILRRTKIDWESGGSQARMIGALICTVGTISLIFYRGPVVNNYSPTFLHLSTTQF---  744
             LA+I R  K+D  S  SQ +++G L+   G + +  Y+GP +         LS++Q    
Sbjct  170   LAVIFRMEKLDLRSWSSQVKIMGTLVSISGALVVTLYKGPSIGT------TLSSSQLPDK  223

Query  745   VFSSSTNQ----QNWVLGCLCFIAASLTLSIWNIIQVGTIRIYPQVMKIMCVYSLFGTVQ  912
              FSSS +      NW+LG + F  ASL+LSIWN +Q   +R YP    I+  Y LFGT+Q
Sbjct  224   RFSSSPSNSLTGNNWILGGVFFAVASLSLSIWNTLQAAIVRGYPDETTIVSFYCLFGTIQ  283

Query  913   SGALSLFIVRDLNAWRLGLNFQLIVILLTAIFGSIIRSSVQLWCMRMKGPSFPLIFKPVG  1092
             +  +SL   RD N W L L+ +LI ++ +A+FGS+I   V  WC+  KGP F  +F+P+G
Sbjct  284   TAVISLIAERDPNGWSLELDVKLISVVYSAVFGSVITPWVSTWCIEKKGPVFVAMFRPLG  343

Query  1093  IVVASSCGCLFFADTFHYGSMFSAFICGMGYYTTIWGQLKDE---EIQQIKGSSVSLPDE  1263
             I +A+  G +F  DT H GS+  A I   G+Y  IWGQ K+E   E  ++ G   S+  +
Sbjct  344   IAIAALMGVIFLGDTLHLGSVVGAIIIAAGFYGVIWGQSKEEKNREDDKVDGFGASV--D  401

Query  1264  KVPLLQQSQD  1293
             K+P L    +
Sbjct  402   KIPFLSSQGE  411



>ref|XP_002283377.1| PREDICTED: WAT1-related protein At3g28050-like [Vitis vinifera]
Length=362

 Score =   236 bits (601),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 138/374 (37%), Positives = 204/374 (55%), Gaps = 28/374 (7%)
 Frame = +1

Query  208   MEVKAAFGEVVPCMAMVMVEACTIFLTIMASTAMAKFGTNPFVFVVYTNALASIFLVPYS  387
             M VKA    +VP  AMV VE   + LT ++  AM++ G + FVFVVY+NA AS+ L   S
Sbjct  1     MGVKAWLSGMVPIAAMVTVECLDVGLTTLSKAAMSR-GMDRFVFVVYSNAFASLILFSIS  59

Query  388   IIYHRRDKAQEQlftfplllrlfflglIGVTISQNLAFVGLSYSSPIAACGTANIVPALS  567
              I+ R  +             L      G+T+ QN  F G+SY SP      +N++PA +
Sbjct  60    FIFLRTKRPPLSFSLLCKFFLLSLA---GITVMQNCVFTGVSYGSPTLGSAMSNLIPAFT  116

Query  568   FILAIILRRTKIDWESGGSQARMIGALICTVGTISLIFYRGPVVNN---YSPTFL---HL  729
             F+LA+  R   +D  S  S  +++G L+   G + +  Y+GP +      SP+     HL
Sbjct  117   FLLAVAFRLENLDLRSSRSLIKILGTLVSISGALIVTLYKGPPIGAGLIKSPSISSNDHL  176

Query  730   STTQFVFSSSTNQQNWVLGCLCFIAASLTLSIWNIIQVGTIRIYPQVMKIMCVYSLFGTV  909
               T           NWV+G L F  A L++S+WNI Q   +R YP  + I+  ++LFG +
Sbjct  177   QKTA---------NNWVIGGLFFAMAGLSISVWNIFQAPILRRYPSEITIVSFFTLFGAI  227

Query  910   QSGALSLFIVRDLNAWRLGLNFQLIVILLTAIFGSIIRSSVQLWCMRMKGPSFPLIFKPV  1089
             Q  A++L  V+D NAW+L  +F+LI I+ +A+FG ++   VQ WC++ KGP F  IFKP+
Sbjct  228   QCAAVALIAVKDSNAWKLRPDFELITIIYSAVFGGVVSFCVQTWCIKRKGPVFVAIFKPL  287

Query  1090  GIVVASSCGCLFFADTFHYGSMFSAFICGMGYYTTIWGQLKD---EEIQQIKGSSVSLP-  1257
             GI +A+  G +F  DT + GS+  A I   G+Y  +W Q K+    E Q++ G    LP 
Sbjct  288   GIGIAAIMGVIFLGDTLYIGSVIGAIIIVTGFYGVMWAQTKEGEKGEAQEVDG----LPS  343

Query  1258  -DEKVPLLQQSQDD  1296
               EK PLLQ  +D+
Sbjct  344   TSEKAPLLQSRRDE  357



>gb|KDO38384.1| hypothetical protein CISIN_1g041987mg [Citrus sinensis]
Length=280

 Score =   232 bits (592),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 143/306 (47%), Positives = 186/306 (61%), Gaps = 37/306 (12%)
 Frame = +1

Query  232   EVVPCMAMVMVEACTIFLTIMASTAMAKFGTNPFVFVVYTNALASIFLVPYSIIYHRRDK  411
             E+VP   MV++E CTI LTI+  TAM   G +PFVF+ YTNAL SI L+PYS  +H R  
Sbjct  11    EMVPFTLMVIMEGCTIGLTIVTKTAMNG-GMSPFVFIAYTNALGSILLLPYSFFFHHRGS  69

Query  412   AQEQlftfplllrlfflglIGVTISQNLAFVGLSYSSPIAACGTANIVPALSFILAIILR  591
               + LFT PL+LR FFLGL GV ISQNLAF GL YSSPI  C    ++PA+SF+L+II R
Sbjct  70    EAQPLFTLPLMLRFFFLGLTGVAISQNLAFFGLYYSSPIVVCVMGLLIPAISFLLSIITR  129

Query  592   RTKIDWESGGSQARMIGALICTVGTISLIFYRGPVVNNYSPTFLHLSTTQFVFSSSTNQQ  771
             +   D             L   +    LIFY  P                          
Sbjct  130   KAASD-----------DKLEAKINPPLLIFYSTP-------------------------D  153

Query  772   NWVLGCLCFIAASLTLSIWNIIQVGTIRIYPQVMKIMCVYSLFGTVQSGALSLFIVRDLN  951
              WVLG     A+SL++ +WNIIQVGTI+ YPQVMK++  YSL GT+Q    SL + R++N
Sbjct  154   RWVLGSTLLAASSLSVCVWNIIQVGTIKQYPQVMKVVSFYSLAGTIQCSIFSLIMERNIN  213

Query  952   AWRLGLNFQLIVILLTAIFGSIIRSSVQLWCMRMKGPSFPLIFKPVGIVVASSCGCLFFA  1131
             AW+L LN +L++I++TAIFGS+IRS+V + C  MKG  +  +FKP GIV A++ G  FF 
Sbjct  214   AWKLKLNMELLLIIITAIFGSVIRSTVHVSCAEMKGHLYVPMFKPFGIVFATAFGLTFFT  273

Query  1132  DTFHYG  1149
             ++ HYG
Sbjct  274   NSLHYG  279



>ref|XP_011028603.1| PREDICTED: LOW QUALITY PROTEIN: WAT1-related protein At5g40240-like 
[Populus euphratica]
Length=352

 Score =   231 bits (589),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 131/344 (38%), Positives = 203/344 (59%), Gaps = 9/344 (3%)
 Frame = +1

Query  208   MEVKAAFGEVVPCMAMVMVEACTIFLTIMASTAMAKFGTNPFVFVVYTNALASIFLVPYS  387
             M VK+    ++P  AMVMVE   + LT ++  AM+K G + FVFVVY+NALA++ L+P S
Sbjct  1     MGVKSVLLNLLPFAAMVMVECLDVGLTTLSKAAMSK-GMSQFVFVVYSNALATLILLP-S  58

Query  388   IIYHRRDKAQEQlftfplllrlfflglIGVTISQNLAFVGLSYSSPIAACGTANIVPALS  567
             +I++R  +      TF LL + F L L+G+T+ QN  F G+SYSSP  A     ++PA +
Sbjct  59    LIFYRTKRPP---VTFSLLCKFFLLSLVGITLMQNCVFTGVSYSSPTLASAMGQLIPAFT  115

Query  568   FILAIILRRTKIDWESGGSQARMIGALICTVGTISLIFYRGPVVNNYSPTFLHLSTTQFV  747
             F+LA+I R  K+ W S  S+ +++G L+   G +++  Y+GP +   +      S  + +
Sbjct  116   FLLAVIFRMEKLHWRSSRSRIKIMGTLVSVSGALTITLYKGPAIGAITTQ----SNPEPI  171

Query  748   FSSSTNQQNWVLGCLCFIAASLTLSIWNIIQVGTIRIYPQVMKIMCVYSLFGTVQSGALS  927
              S  +   +W++G L  + A L +SI+  +Q   ++ YP  M ++    LFGT+QS  +S
Sbjct  172   PSIMSTTNSWIIGGLFLVTADLCISIFTTLQAAILKEYPSEMAMVSFLCLFGTIQSSIVS  231

Query  928   LFIVRDLNAWRLGLNFQLIVILLTAIFGSIIRSSVQLWCMRMKGPSFPLIFKPVGIVVAS  1107
             L   R+ NAW+L  + +LI I+ +A+ GS++   V  WC+  KGP F  IFKPVGI  A+
Sbjct  232   LIAERNPNAWKLRPDIELISIIYSAVVGSVVTFGVTAWCIHKKGPVFVAIFKPVGIATAA  291

Query  1108  SCGCLFFADTFHYGSMFSAFICGMGYYTTIWGQLKDEEIQQIKG  1239
               G +F  DT H GS+  A I   G+Y  IW Q K++E  ++ G
Sbjct  292   FLGVIFLGDTLHVGSIVGAIIIVAGFYGVIWAQSKEDEHSKVNG  335



>emb|CBI32105.3| unnamed protein product [Vitis vinifera]
Length=253

 Score =   226 bits (576),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 112/254 (44%), Positives = 167/254 (66%), Gaps = 7/254 (3%)
 Frame = +1

Query  544   ANIVPALSFILAIILRRTKIDWESGGSQARMIGALICTVGTISLIFYRGPVVNN--YSPT  717
              N++PA SF+LAIILR TK+DW     QA++IG  I   G   +I Y+GP+V    +S  
Sbjct  2     GNLIPAFSFVLAIILRTTKLDWRVTSGQAKIIGTFISISGGTLMILYKGPLVRKTAFSAP  61

Query  718   FLHLS--TTQFVFSSSTNQQNWVLGCLCFIAASLTLSIWNIIQVGTIRIYPQVMKIMCVY  891
             F HL      F+FSS+   + W LG +    ASL+ S+W IIQVGT++ YP+ + I  +Y
Sbjct  62    FHHLELIPRHFIFSSTP--EYWALGGILLAVASLSASVWGIIQVGTVKQYPEPITIAALY  119

Query  892   SLFGTVQSGALSLFIVRDLNAWRLGLNFQLIVILLTAIFGSIIRSSVQLWCMRMKGPSFP  1071
             +  GT+QS  ++    R+L+AW+L LN +L++I L+AIFGS IR SV +WCM  KGP + 
Sbjct  120   TSMGTIQSAIVAFVAERNLSAWKLELNMELLLIFLSAIFGSAIRCSVHIWCMHNKGPFYV  179

Query  1072  LIFKPVGIVVASSCGCLFFADTFHYGSMFSAFICGMGYYTTIWGQLKDEEIQQIKGSSVS  1251
              +FKP GI++AS    +FF D+ HYGS+  A+I G+GYYT +WGQ+++++++   G  + 
Sbjct  180   PMFKPFGIIIASIASVIFFGDSLHYGSVIGAYIIGIGYYTLMWGQIREDDMKA-GGEGID  238

Query  1252  LPDEKVPLLQQSQD  1293
               ++KVPLLQ+ + 
Sbjct  239   SSEQKVPLLQEEEQ  252



>ref|XP_004300887.1| PREDICTED: auxin-induced protein 5NG4-like [Fragaria vesca subsp. 
vesca]
Length=365

 Score =   227 bits (578),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 140/360 (39%), Positives = 209/360 (58%), Gaps = 9/360 (3%)
 Frame = +1

Query  250   AMVMVEACTIFLTIMASTAMAKFGTNPFVFVVYTNALASIFLVPYSIIYHRRDKAQEQlf  429
              MVMVE   + LT ++  AM++ G + FVFVVY+NALA++ L+P S I HR  +      
Sbjct  10    GMVMVECLDVGLTTLSKAAMSR-GMSHFVFVVYSNALATLILIPSSFIIHRNKRPP---L  65

Query  430   tfplllrlfflglIGVTISQNLAFVGLSYSSPIAACGTANIVPALSFILAIILRRTKIDW  609
             TF +L + F L L G+T+ QN  F G+SYSSP  A   +N+VPA +F LA+I R  K+D 
Sbjct  66    TFSILCKFFLLSLAGITVMQNCVFTGVSYSSPTLASAMSNLVPAFTFFLAVIFRMEKLDL  125

Query  610   ESGGSQARMIGALICTVGTISLIFYRG-PVVNNYSPTFLHLSTTQFVFSSSTNQQNWVLG  786
              +  SQ ++IG L+   G + +  Y+G P+++  +P      ++    SSST+  NW++G
Sbjct  126   RNSRSQIKIIGTLVSISGALVVTLYKGAPLLS--TPVQSTPDSSPSNTSSSTSMNNWIIG  183

Query  787   CLCFIAASLTLSIWNIIQVGTIRIYPQVMKIMCVYSLFGTVQSGALSLFIVRDLNAWRLG  966
              L    AS  L+IWN  Q   ++ YP  M I+  YSLFGT+Q   LSLF  R+ +AW L 
Sbjct  184   GLFLATASSCLAIWNTAQAAILKGYPSEMTIVSFYSLFGTIQCTILSLFFERNPSAWTLK  243

Query  967   LNFQLIVILLTAIFGSIIRSSVQLWCMRMKGPSFPLIFKPVGIVVASSCGCLFFADTFHY  1146
              + +L+ I  +AI G ++  SVQ WC++ KGP F  +FKP+GI +A+  G +F  +  H 
Sbjct  244   PDIELVSIFYSAICGGVVTFSVQTWCIKEKGPVFVAMFKPLGIAIAAMLGAIFLGEELHV  303

Query  1147  GSMFSAFICGMGYYTTIWGQLKDEE--IQQIKGSSVSLPDEKVPLLQQSQDDSPV*GCMI  1320
             GS+  A +  +G+Y  IW Q K+E+    + K    S  D++V  L  S    P+ G  +
Sbjct  304   GSLIGAVVIVVGFYGVIWAQSKEEKGLDLKTKEDGESQEDDEVDRLHSSSQKKPLLGSEV  363



>gb|KDP31133.1| hypothetical protein JCGZ_11509 [Jatropha curcas]
Length=356

 Score =   223 bits (568),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 135/362 (37%), Positives = 215/362 (59%), Gaps = 17/362 (5%)
 Frame = +1

Query  208   MEVKAAFGEVVPCMAMVMVEACTIFLTIMASTAMAKFGTNPFVFVVYTNALASIFLVPYS  387
             M +K+   +++P  AMVM+E     LT ++  AM+K  ++ FVFVVY+N LA++ + P +
Sbjct  3     MGMKSWLLKLLPFAAMVMIECLDTGLTTISKAAMSKEMSH-FVFVVYSNGLATLIMFPVA  61

Query  388   IIYHRRDKAQEQlftfplllrlfflglIGVTISQNLAFVGLSYSSPIAACGTANIVPALS  567
               ++R  +      TF LL + F L L+G+T+ QN  F G+SYSSP  A     ++PA +
Sbjct  62    FFFNRTKRPP---ITFALLCKFFLLSLVGITMMQNCVFTGISYSSPTLASALGQLIPAFT  118

Query  568   FILAIILRRTKIDWESGGSQARMIGALICTVGTISLIFYRG-PVVNNYSPTF--LHLSTT  738
             F+LA+I R  K+D  S  SQ +++  L+   G +++I Y+G P+     P    LH ST 
Sbjct  119   FVLAVIFRMEKLDLRSSKSQIKIMSTLVSISGALTIILYKGSPIGAKTLPPHPELHPST-  177

Query  739   QFVFSSSTNQQNWVLGCLCFIAASLTLSIWNIIQVGTIRIYPQVMKIMCVYSLFGTVQSG  918
                FS++TN  +W++G L    A L ++I N  Q   ++ Y   M ++  Y LFGT+Q  
Sbjct  178   ---FSAATN--SWIIGGLFIATAGLCIAICNTFQAAILKDYSSRMTLVFFYCLFGTIQCA  232

Query  919   ALSLFIVRDLNAWRLGLNFQLIVILLTAIFGSIIRSSVQLWCMRMKGPSFPLIFKPVGIV  1098
              +SL   ++ NAW+LG + +L+ IL +A+FGS++ S +  WC++ KGP F  +FKP+GI 
Sbjct  233   MVSLVAEKNPNAWKLGHDIELLSILYSAVFGSVVTSCIVTWCIQKKGPVFVAMFKPLGIA  292

Query  1099  VASSCGCLFFADTFHYGSMFSAFICGMGYYTTIWGQLKDEEIQQIKGSSVSLPDEKVPLL  1278
             +A+  G +F  DT H GS+  A I  +G+Y  IW + K+EE  Q K   V+  +++ PLL
Sbjct  293   IAAFLGVIFLGDTLHVGSIIGAVIIVVGFYGVIWAESKEEE--QYKVHKVT--EQRAPLL  348

Query  1279  QQ  1284
             + 
Sbjct  349   ES  350



>ref|XP_010043800.1| PREDICTED: WAT1-related protein At5g40240-like [Eucalyptus grandis]
Length=359

 Score =   222 bits (565),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 124/359 (35%), Positives = 194/359 (54%), Gaps = 13/359 (4%)
 Frame = +1

Query  238   VPCMAMVMVEACTIFLTIMASTAMAKFGTNPFVFVVYTNALASIFLVPYSIIYHRRDKAQ  417
             VP + MVM E   + L I++   M+  G +  VFV Y+NA AS+ L+P S+I+HR  +  
Sbjct  7     VPVVGMVMAECAQVGLMIVSKAVMSN-GMSNLVFVFYSNAFASLILLPASLIFHRSGRPP  65

Query  418   EQlftfplllrlfflglIGVT--ISQNLAFVGLSYSSPIAACGTANIVPALSFILAIILR  591
                        +    ++G+   ++Q L + G++YSSP       N+VPA +F+LAII R
Sbjct  66    ------LTPSLVLQFFVLGLLGCLAQILGYAGINYSSPTLGSALLNLVPAFTFVLAIICR  119

Query  592   RTKIDWESGGSQARMIGALICTVGTISLIFYRGPVV---NNYSPTFLHLSTTQFVFSSST  762
               ++DW S  S A+  G ++C  G   +  Y+GP +   +  S + LH           T
Sbjct  120   LERLDWSSSSSLAKCAGTIVCIAGAFVVTLYKGPAIVTTSTSSLSNLHNEVFNLHHKLLT  179

Query  763   NQQNWVLGCLCFIAASLTLSIWNIIQVGTIRIYPQVMKIMCVYSLFGTVQSGALSLFIVR  942
              + NWVLG L  +A  +  S W I+Q   ++ YP  + I+  Y  F  +QS A+S F+ R
Sbjct  180   PESNWVLGGLFLVADCVMTSSWLIVQASVLKKYPAELIIVFFYCFFVAIQSAAISFFVER  239

Query  943   DLNAWRLGLNFQLIVILLTAIFGSIIRSSVQLWCMRMKGPSFPLIFKPVGIVVASSCGCL  1122
               +AW L  N +L+ +L +A+FGS  +  V  WC+   GP F  +FKP+GIV+A+  G L
Sbjct  240   KSSAWSLKDNMRLMAVLYSAVFGSAFQVGVSTWCLHRTGPVFVSMFKPLGIVIAAVAGVL  299

Query  1123  FFADTFHYGSMFSAFICGMGYYTTIWGQLKDEEIQQ-IKGSSVSLPDEKVPLLQQSQDD  1296
             F  D F+ GS+  +    +G+Y+ +WG+ K+E+    I    V L  +KVPLLQ   ++
Sbjct  300   FLGDNFYLGSLVGSVAIAVGFYSVMWGKAKEEKKDLVISVGDVKLNKKKVPLLQTIVEE  358



>gb|KCW85792.1| hypothetical protein EUGRSUZ_B02544 [Eucalyptus grandis]
Length=422

 Score =   221 bits (564),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 124/354 (35%), Positives = 192/354 (54%), Gaps = 13/354 (4%)
 Frame = +1

Query  238   VPCMAMVMVEACTIFLTIMASTAMAKFGTNPFVFVVYTNALASIFLVPYSIIYHRRDKAQ  417
             VP + MVM E   + L I++   M+  G +  VFV Y+NA AS+ L+P S+I+HR  +  
Sbjct  70    VPVVGMVMAECAQVGLMIVSKAVMSN-GMSNLVFVFYSNAFASLILLPASLIFHRSGRPP  128

Query  418   EQlftfplllrlfflglIGVT--ISQNLAFVGLSYSSPIAACGTANIVPALSFILAIILR  591
                        +    ++G+   ++Q L + G++YSSP       N+VPA +F+LAII R
Sbjct  129   ------LTPSLVLQFFVLGLLGCLAQILGYAGINYSSPTLGSALLNLVPAFTFVLAIICR  182

Query  592   RTKIDWESGGSQARMIGALICTVGTISLIFYRGPVV---NNYSPTFLHLSTTQFVFSSST  762
               ++DW S  S A+  G ++C  G   +  Y+GP +   +  S + LH           T
Sbjct  183   LERLDWSSSSSLAKCAGTIVCIAGAFVVTLYKGPAIVTTSTSSLSNLHNEVFNLHHKLLT  242

Query  763   NQQNWVLGCLCFIAASLTLSIWNIIQVGTIRIYPQVMKIMCVYSLFGTVQSGALSLFIVR  942
              + NWVLG L  +A  +  S W I+Q   ++ YP  + I+  Y  F  +QS A+S F+ R
Sbjct  243   PESNWVLGGLFLVADCVMTSSWLIVQASVLKKYPAELIIVFFYCFFVAIQSAAISFFVER  302

Query  943   DLNAWRLGLNFQLIVILLTAIFGSIIRSSVQLWCMRMKGPSFPLIFKPVGIVVASSCGCL  1122
               +AW L  N +L+ +L +A+FGS  +  V  WC+   GP F  +FKP+GIV+A+  G L
Sbjct  303   KSSAWSLKDNMRLMAVLYSAVFGSAFQVGVSTWCLHRTGPVFVSMFKPLGIVIAAVAGVL  362

Query  1123  FFADTFHYGSMFSAFICGMGYYTTIWGQLKDEEIQQ-IKGSSVSLPDEKVPLLQ  1281
             F  D F+ GS+  +    +G+Y+ +WG+ K+E+    I    V L  +KVPLLQ
Sbjct  363   FLGDNFYLGSLVGSVAIAVGFYSVMWGKAKEEKKDLVISVGDVKLNKKKVPLLQ  416



>gb|KHG29548.1| Auxin-induced 5NG4 [Gossypium arboreum]
Length=348

 Score =   217 bits (553),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 130/364 (36%), Positives = 205/364 (56%), Gaps = 16/364 (4%)
 Frame = +1

Query  208   MEVKAAFGEVVPCMAMVMVEACTIFLTIMASTAMAKFGTNPFVFVVYTNALASIFLVPYS  387
             M+VK+   E  P  AMV VE   + L+ ++  AM+K G + FV VVY+NALAS+ L+P +
Sbjct  1     MKVKSWLVESAPFAAMVAVECLDVGLSTLSKAAMSK-GMSHFVLVVYSNALASLILLPAA  59

Query  388   IIYHRRDKAQEQlftfplllrlfflglIGVTISQNLAFVGLSYSSPIAACGTANIVPALS  567
               + R+ +      T   L ++F L + G+T+ QN    G+SYSSP  A   AN++PA +
Sbjct  60    FFFTRKKRPP---ITLSFLCKIFCLSIAGITLMQNCVITGVSYSSPTLASALANLIPAFT  116

Query  568   FILAIILRRTKIDWESGGSQARMIGALICTVGTISLIFYRGPVVNNYSPTFLHLSTTQFV  747
             F+LA+I R  K++ +S  SQ +++G L+   G + +  Y+GP V +  P   HL  +   
Sbjct  117   FLLAVIFRMEKLELKSPKSQIKVLGTLVSISGALIMTLYKGPPVLS-PPIQPHLHPSPST  175

Query  748   FSSSTNQQNWVLGCLCFIAASLTLSIWNIIQVGTIRIYPQVMKIMCVYSLFGTVQSGALS  927
               +++N  NW++G L    ASL+LS   + Q   ++ YP  + ++  Y LFGT+QS  ++
Sbjct  176   MLTTSN--NWLIGGLFIATASLSLSANIVGQAAVLKGYPSEITLVSFYCLFGTIQSALVT  233

Query  928   LFIVRDLNAWRLGLNFQLIVILLTAIFGSIIRSSVQLWCMRMKGPSFPLIFKPVGIVVAS  1107
             L   RD NAW L  + +LI ++ +A+FG+++   VQ WC+R KGP F  +FKP+ I +A+
Sbjct  234   LIFERDPNAWMLSPDIELISVVYSALFGNVVTFGVQAWCIRRKGPVFVAMFKPLSIAIAA  293

Query  1108  SCGCLFFADTFHYGSMFSAFICGMGYYTTIWGQLKDEEIQQIKGSSVSLPDEKVPLLQQS  1287
               G +F  +T + GS+  A I   G+Y  IW Q   EE+ +             PLL   
Sbjct  294   FLGFIFLGETLYIGSIVGAAIIVTGFYGVIWAQSDKEEVGK---------TTTTPLLDGH  344

Query  1288  QDDS  1299
               D+
Sbjct  345   DADA  348



>ref|XP_007036147.1| Nodulin MtN21 /EamA-like transporter family protein isoform 1 
[Theobroma cacao]
 gb|EOY20648.1| Nodulin MtN21 /EamA-like transporter family protein isoform 1 
[Theobroma cacao]
Length=379

 Score =   218 bits (554),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 133/374 (36%), Positives = 206/374 (55%), Gaps = 9/374 (2%)
 Frame = +1

Query  172   SSRRPPEKMLAAMEVKAAFGEVVPCMAMVMVEACTIFLTIMASTAMAKFGTNPFVFVVYT  351
             S  R  +  +  M V++   E+ P  AMV VE   + LT ++  AM+K G + FVFVVY+
Sbjct  14    SLERERKMRVREMRVRSWLVELAPFAAMVAVECLDVGLTTLSKAAMSK-GMSHFVFVVYS  72

Query  352   NALASIFLVPYSIIYHRRDKAQEQlftfplllrlfflglIGVTISQNLAFVGLSYSSPIA  531
             NALAS+ L+P +  + R+ +      T PLL + F L + G+T+ QN  F G+SYSSP  
Sbjct  73    NALASVILIPAAFFFTRKKRPP---ITLPLLCKFFLLSIAGITLMQNCVFTGVSYSSPTL  129

Query  532   ACGTANIVPALSFILAIILRRTKIDWESGGSQARMIGALICTVGTISLIFYRGPVVNNYS  711
             A    N+VPA +F+LA+I R  K++  S  SQ +++G L+   G + +  Y+G  V   S
Sbjct  130   ASALGNLVPAFTFLLAVIFRMEKLELTSSRSQIKILGTLVSISGALIMTLYKGSAV--LS  187

Query  712   PTFLHLSTTQFVFSSSTNQQNWVLGCLCFIAASLTLSIWNIIQVGTIRIYPQVMKIMCVY  891
             P     S    +    T   NW++G L    A L+LS   I Q   ++ YP  + ++  Y
Sbjct  188   PPAQPQSDPSAML---TTTNNWIIGGLFLATACLSLSTNIIGQAAILKGYPSEIVLVSFY  244

Query  892   SLFGTVQSGALSLFIVRDLNAWRLGLNFQLIVILLTAIFGSIIRSSVQLWCMRMKGPSFP  1071
               FGT+Q   ++L   R+ NAW+L  + +L+ ++ +A+FGS++  +V  WC+R KGP F 
Sbjct  245   CFFGTIQCALVALVAERNTNAWKLSPDIELVSVVYSALFGSVVTFAVLAWCIRRKGPVFV  304

Query  1072  LIFKPVGIVVASSCGCLFFADTFHYGSMFSAFICGMGYYTTIWGQLKDEEIQQIKGSSVS  1251
              +FKP+ I +A+  G +F  +T + GS+  A I   G+Y  IW Q K+EE +      + 
Sbjct  305   AMFKPLSIAIAAFLGFIFLGETLYVGSIVGAAIIVTGFYGVIWAQSKEEEDEVANIHKLH  364

Query  1252  LPDEKVPLLQQSQD  1293
                 K+PLL    D
Sbjct  365   SSSSKIPLLHGHLD  378



>ref|XP_007036148.1| Nodulin MtN21 /EamA-like transporter family protein isoform 2 
[Theobroma cacao]
 gb|EOY20649.1| Nodulin MtN21 /EamA-like transporter family protein isoform 2 
[Theobroma cacao]
Length=359

 Score =   217 bits (552),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 131/362 (36%), Positives = 202/362 (56%), Gaps = 9/362 (2%)
 Frame = +1

Query  208   MEVKAAFGEVVPCMAMVMVEACTIFLTIMASTAMAKFGTNPFVFVVYTNALASIFLVPYS  387
             M V++   E+ P  AMV VE   + LT ++  AM+K G + FVFVVY+NALAS+ L+P +
Sbjct  6     MRVRSWLVELAPFAAMVAVECLDVGLTTLSKAAMSK-GMSHFVFVVYSNALASVILIPAA  64

Query  388   IIYHRRDKAQEQlftfplllrlfflglIGVTISQNLAFVGLSYSSPIAACGTANIVPALS  567
               + R+ +      T PLL + F L + G+T+ QN  F G+SYSSP  A    N+VPA +
Sbjct  65    FFFTRKKRPP---ITLPLLCKFFLLSIAGITLMQNCVFTGVSYSSPTLASALGNLVPAFT  121

Query  568   FILAIILRRTKIDWESGGSQARMIGALICTVGTISLIFYRGPVVNNYSPTFLHLSTTQFV  747
             F+LA+I R  K++  S  SQ +++G L+   G + +  Y+G  V   SP     S    +
Sbjct  122   FLLAVIFRMEKLELTSSRSQIKILGTLVSISGALIMTLYKGSAV--LSPPAQPQSDPSAM  179

Query  748   FSSSTNQQNWVLGCLCFIAASLTLSIWNIIQVGTIRIYPQVMKIMCVYSLFGTVQSGALS  927
                 T   NW++G L    A L+LS   I Q   ++ YP  + ++  Y  FGT+Q   ++
Sbjct  180   L---TTTNNWIIGGLFLATACLSLSTNIIGQAAILKGYPSEIVLVSFYCFFGTIQCALVA  236

Query  928   LFIVRDLNAWRLGLNFQLIVILLTAIFGSIIRSSVQLWCMRMKGPSFPLIFKPVGIVVAS  1107
             L   R+ NAW+L  + +L+ ++ +A+FGS++  +V  WC+R KGP F  +FKP+ I +A+
Sbjct  237   LVAERNTNAWKLSPDIELVSVVYSALFGSVVTFAVLAWCIRRKGPVFVAMFKPLSIAIAA  296

Query  1108  SCGCLFFADTFHYGSMFSAFICGMGYYTTIWGQLKDEEIQQIKGSSVSLPDEKVPLLQQS  1287
               G +F  +T + GS+  A I   G+Y  IW Q K+EE +      +     K+PLL   
Sbjct  297   FLGFIFLGETLYVGSIVGAAIIVTGFYGVIWAQSKEEEDEVANIHKLHSSSSKIPLLHGH  356

Query  1288  QD  1293
              D
Sbjct  357   LD  358



>emb|CDY65646.1| BnaA09g53320D, partial [Brassica napus]
Length=306

 Score =   214 bits (545),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 116/280 (41%), Positives = 163/280 (58%), Gaps = 7/280 (3%)
 Frame = +1

Query  475   VTISQNLAFVGLSYSSPIAACGTANIVPALSFILAIILRRTKIDWESGGSQARMIGALIC  654
             V + QNLAF+GLSYSSPI  C      PA SF+L+I L    + WE   ++ R+IG LIC
Sbjct  23    VFLYQNLAFLGLSYSSPIVVCAMGLQSPAFSFLLSIALGEGGLGWECKRTRGRVIGTLIC  82

Query  655   TVGTISLIFYRGPVVNNYSPTFLH---LSTTQFVFSSSTNQQNWVLGCLCFIAASLTLSI  825
               G    + Y GP +     +  +   L+T     +   N  NW LG L    A+L++SI
Sbjct  83    FTGAFVEVIYLGPFIRPSPSSSPNSNFLTTISHYLTFFKNSDNWALGSLFLACATLSISI  142

Query  826   WNIIQVGTIRIYPQVMKIMCVYSLFGTVQSGALSLFIVRDLNAWRLGLNFQLIVILLTAI  1005
             WNIIQ+ T++ YPQVMK++  YSL GT+Q    S F+  DL+AW+L LN    +I+ T I
Sbjct  143   WNIIQLDTVQKYPQVMKVVSAYSLAGTLQCAIFSAFMEPDLSAWKLELNMDFYLIIATGI  202

Query  1006  FGSIIRSSVQLWCMRMKGPSFPLIFKPVGIVVASSCGCLFFADTFHYGSMFSAFICGMGY  1185
             FGSIIR+SVQ+ C +MKGP +  +FKP GI+ AS  G  FF ++ HYGS+  A I G GY
Sbjct  203   FGSIIRTSVQVKCSKMKGPYYVPLFKPFGILWASIFGTSFFVNSLHYGSVLGAAIAGTGY  262

Query  1186  YTTIWGQ----LKDEEIQQIKGSSVSLPDEKVPLLQQSQD  1293
                +W Q    ++ + +++     +   D+  PLL  + D
Sbjct  263   LLIMWSQVQRDVQKDMVEEKANHQLDSDDQITPLLLGNDD  302



>ref|XP_010043808.1| PREDICTED: WAT1-related protein At5g40240-like [Eucalyptus grandis]
 gb|KCW85806.1| hypothetical protein EUGRSUZ_B02552 [Eucalyptus grandis]
Length=343

 Score =   214 bits (546),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 118/349 (34%), Positives = 189/349 (54%), Gaps = 10/349 (3%)
 Frame = +1

Query  259   MVEACTIFLTIMASTAMAKFGTNPFVFVVYTNALASIFLVPYSIIYHRRDKAQEQlftfp  438
             M E   + L I++   M+  G +  VFV Y+NA AS+ L+P S+I+HR  +         
Sbjct  1     MAECAQVGLMIVSKAVMSN-GMSNLVFVFYSNAFASLILLPASLIFHRSGRPP------L  53

Query  439   lllrlfflglIGVT--ISQNLAFVGLSYSSPIAACGTANIVPALSFILAIILRRTKIDWE  612
                 +    ++G+   ++Q L + G++YSSP       N+VPA +F+LAII R  +++W 
Sbjct  54    TPSLVLQFFVLGLLGCLAQILGYAGINYSSPTLGSALLNLVPAFTFLLAIIFRLERLNWS  113

Query  613   SGGSQARMIGALICTVGTISLIFYRGPVVNNYSPTFLHLSTTQFVFSSSTNQQNWVLGCL  792
             S  S A+  G ++C  G   +  Y+GP +   S + LH           T + NWVLG L
Sbjct  114   SSSSLAKCAGTIVCVAGAFVVTLYKGPAIVTSSLSNLHNEVFNLHHKLLTPESNWVLGGL  173

Query  793   CFIAASLTLSIWNIIQVGTIRIYPQVMKIMCVYSLFGTVQSGALSLFIVRDLNAWRLGLN  972
               +A  +  S W I+Q   ++ YP  + I+  Y  F  +QS A+SLF+ R  +AW L  N
Sbjct  174   LLVADCVMASSWLIVQASVLKKYPAELIIVFFYCFFVAIQSAAISLFVERKSSAWSLKDN  233

Query  973   FQLIVILLTAIFGSIIRSSVQLWCMRMKGPSFPLIFKPVGIVVASSCGCLFFADTFHYGS  1152
              +L+ +L +A+FGS  +  V  WC+   GP F  +FKP+GIV+A+  G LF  D F+ GS
Sbjct  234   MRLMAVLYSAVFGSAFQVGVSTWCLHRTGPVFVSMFKPLGIVIAAVAGVLFLGDNFYLGS  293

Query  1153  MFSAFICGMGYYTTIWGQLKDEEIQ-QIKGSSVSLPDEKVPLLQQSQDD  1296
             +  +    +G+Y+ +WG+ K+++    I   +V    +KVPLLQ   ++
Sbjct  294   LVGSVAIVVGFYSVMWGKAKEQKKDLAISVGNVEPNKKKVPLLQTIVEE  342



>emb|CBI15069.3| unnamed protein product [Vitis vinifera]
Length=325

 Score =   214 bits (544),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 122/335 (36%), Positives = 182/335 (54%), Gaps = 27/335 (8%)
 Frame = +1

Query  325   NPFVFVVYTNALASIFLVPYSIIYHRRDKAQEQlftfplllrlfflglIGVTISQNLAFV  504
             + FVFVVY+NA AS+ L   S I+ R  +             L      G+T+ QN  F 
Sbjct  2     DRFVFVVYSNAFASLILFSISFIFLRTKRPPLSFSLLCKFFLLSLA---GITVMQNCVFT  58

Query  505   GLSYSSPIAACGTANIVPALSFILAIILRRTKIDWESGGSQARMIGALICTVGTISLIFY  684
             G+SY SP      +N++PA +F+LA+  R   +D  S  S  +++G L+   G + +  Y
Sbjct  59    GVSYGSPTLGSAMSNLIPAFTFLLAVAFRLENLDLRSSRSLIKILGTLVSISGALIVTLY  118

Query  685   RGPVVNN---YSPTFL---HLSTTQFVFSSSTNQQNWVLGCLCFIAASLTLSIWNIIQVG  846
             +GP +      SP+     HL  T           NWV+G L F  A L++S+WNI Q  
Sbjct  119   KGPPIGAGLIKSPSISSNDHLQKTA---------NNWVIGGLFFAMAGLSISVWNIFQAP  169

Query  847   TIRIYPQVMKIMCVYSLFGTVQSGALSLFIVRDLNAWRLGLNFQLIVILLTAIFGSIIRS  1026
              +R YP  + I+  ++LFG +Q  A++L  V+D NAW+L  +F+LI I+ +A+FG ++  
Sbjct  170   ILRRYPSEITIVSFFTLFGAIQCAAVALIAVKDSNAWKLRPDFELITIIYSAVFGGVVSF  229

Query  1027  SVQLWCMRMKGPSFPLIFKPVGIVVASSCGCLFFADTFHYGSMFSAFICGMGYYTTIWGQ  1206
              VQ WC++ KGP F  IFKP+GI +A+  G +F  DT + GS+  A I   G+Y  +W Q
Sbjct  230   CVQTWCIKRKGPVFVAIFKPLGIGIAAIMGVIFLGDTLYIGSVIGAIIIVTGFYGVMWAQ  289

Query  1207  LKD---EEIQQIKGSSVSLP--DEKVPLLQQSQDD  1296
              K+    E Q++ G    LP   EK PLLQ  +D+
Sbjct  290   TKEGEKGEAQEVDG----LPSTSEKAPLLQSRRDE  320



>ref|XP_002531394.1| Auxin-induced protein 5NG4, putative [Ricinus communis]
 gb|EEF30978.1| Auxin-induced protein 5NG4, putative [Ricinus communis]
Length=349

 Score =   214 bits (544),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 126/355 (35%), Positives = 201/355 (57%), Gaps = 13/355 (4%)
 Frame = +1

Query  238   VPCMAMVMVEACTIFLTIMASTAMAKFGTNPFVFVVYTNALASIFLVPYSIIYHRRDKAQ  417
             +P + MV+ E   + L I++  AM+K G + F+FV Y+NALAS+ L+P+S++ HRR    
Sbjct  7     LPFVGMVIAECAQVGLMIISKVAMSK-GMSSFIFVCYSNALASLILLPFSLL-HRR---T  61

Query  418   EQlftfplllrlfflglIGVTISQNLAFVGLSYSSPIAACGTANIVPALSFILAIILRRT  597
             E+      ++  FFL  +   ++Q   + G++ SSP       N+VP L+FILA+  R  
Sbjct  62    ERPPLTFSIVCGFFLLGLFGCLAQFFGYAGINLSSPTLGTAMLNLVPGLTFILAVAFRME  121

Query  598   KIDWESGGSQARMIGALICTVGTISLIFYRGPVVNNYSPTFLHLSTTQFVFSSSTNQQNW  777
             K+D  +  S A+ +G +I   G   L +Y+GP+V   +P+    S+ Q +    T   NW
Sbjct  122   KLDGRTSSSLAKSMGTIISVGGAFILTYYKGPLVL-LTPSLN--SSHQLL----TQPSNW  174

Query  778   VLGCLCFIAASLTLSIWNIIQVGTIRIYPQVMKIMCVYSLFGTVQSGALSLFIVRDLNAW  957
             ++G L   A  +  S W IIQ   ++IYP  + I+  Y  F T+ S  + L + RD +AW
Sbjct  175   IIGGLLLAADCVMTSAWIIIQALILKIYPAELIIVFFYCFFVTILSAIVCLVVERDPSAW  234

Query  958   RLGLNFQLIVILLTAIFGSIIRSSVQLWCMRMKGPSFPLIFKPVGIVVASSCGCLFFADT  1137
              L  N +L+ +L + +FGS ++  +  WC+R  GP F  +FKP+GI++A++ G +   DT
Sbjct  235   SLIPNIRLVSVLYSGVFGSALQVGISTWCLRQTGPVFVSMFKPLGIIIAAAVGVICLGDT  294

Query  1138  FHYGSMFSAFICGMGYYTTIWGQLKDEEIQQIKG-SSVSLPDEKVPLLQQSQDDS  1299
              + GS+    ICGMGYYT +WGQ +++  Q+          DEKVPLLQ    ++
Sbjct  295   LYLGSIIGTVICGMGYYTVMWGQAREDGKQKPHDVERADTSDEKVPLLQDQDAEA  349



>ref|XP_008356601.1| PREDICTED: WAT1-related protein At3g28050-like [Malus domestica]
Length=311

 Score =   210 bits (535),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 118/314 (38%), Positives = 176/314 (56%), Gaps = 4/314 (1%)
 Frame = +1

Query  208   MEVKAAFGEVVPCMAMVMVEACTIFLTIMASTAMAKFGTNPFVFVVYTNALASIFLVPYS  387
             M +K+   E++P  AMV+VE   + LT ++  AM+  G + FVFVVY+NALA+  L+P S
Sbjct  1     MGMKSRIWELLPFAAMVVVEILDVGLTTLSKAAMSG-GMSHFVFVVYSNALATXILLPSS  59

Query  388   IIYHRRDKAQEQlftfplllrlfflglIGVTISQNLAFVGLSYSSPIAACGTANIVPALS  567
              I HR ++             L      G+T+ QN  F G+SYSSP  A   +N++PA +
Sbjct  60    FIIHRNNRPPLTFTVLCKFFLLSLA---GITVMQNCIFTGVSYSSPTLASALSNLIPAFT  116

Query  568   FILAIILRRTKIDWESGGSQARMIGALICTVGTISLIFYRGPVVNNYSPTFLHLSTTQFV  747
             F+LA++ R  K++  S  SQ +++G L+   G + + F +GP +  +    +  S     
Sbjct  117   FLLAVVFRMEKLNLRSLRSQIKILGTLVSISGALIVTFVKGPPIVLFPIKPVDSSPLGPS  176

Query  748   FSSSTNQQNWVLGCLCFIAASLTLSIWNIIQVGTIRIYPQVMKIMCVYSLFGTVQSGALS  927
              S      NWV G L    A L+LSIWN  Q   ++ YP  M I+  Y  FGT+Q   LS
Sbjct  177   VSDVFPLNNWVTGALFITTACLSLSIWNTAQAAVLKGYPSEMTIVSFYCFFGTIQCAILS  236

Query  928   LFIVRDLNAWRLGLNFQLIVILLTAIFGSIIRSSVQLWCMRMKGPSFPLIFKPVGIVVAS  1107
              F+ R+ +AW L L+ +L  I  +A+FGS++  S Q WC+R KGP F  +FKP+GI +A+
Sbjct  237   FFVERNASAWALKLDLELAAIAYSAVFGSVVTFSTQTWCIRKKGPVFVAMFKPLGIAIAA  296

Query  1108  SCGCLFFADTFHYG  1149
               G +F  DT + G
Sbjct  297   LMGAIFLGDTLYTG  310



>ref|XP_003634251.2| PREDICTED: LOW QUALITY PROTEIN: WAT1-related protein At4g15540-like 
[Vitis vinifera]
Length=412

 Score =   212 bits (540),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 142/387 (37%), Positives = 210/387 (54%), Gaps = 20/387 (5%)
 Frame = +1

Query  145   KQHQKRNQ*SSRRPPEKMLAAMEVKAAFGEVVPCMAMVMVEACTIFLTIMASTAMAKFGT  324
             K+ +K ++    + P K+   M +KA    +VP  AMVM+E   + L  ++  AM++ G 
Sbjct  18    KELRKYHKSMESKRPAKIEREMGMKAWLSGIVPIAAMVMMECLDVGLVTLSKAAMSR-GM  76

Query  325   NPFVFVVYTNALASIFLVPYSIIYHRRDKAQEQlftfplllrlfflglIGVTISQNLAFV  504
             N FVFVVY NALAS+     S I+HR  +      TF    + F LGL G+T+ QN  F 
Sbjct  77    NHFVFVVYYNALASLIFFLLSFIFHRTKRPP---LTFSHFCKFFLLGLPGITVMQNWVFT  133

Query  505   GLSYSSPIAACGTANIVPALSFILAIILRRTKIDWESGGSQARMIGALICTVGT--ISLI  678
             G+SYSSP      +N++PA +F+LA+ +R   +D  S  SQ +++G LI   G   ++L 
Sbjct  134   GVSYSSPTLCYAMSNLIPAFTFLLAVAIRLEDLDLRSSRSQIKLLGTLISISGALIVTLX  193

Query  679   FYRGPVVNNYSPTFLHLSTTQFVFSSSTNQQNWVLGCLCFIAASLTLSIWNIIQVGTIR-  855
                  +      +  HL  T           NWV+G L F AA L+LS WN  Q   +  
Sbjct  194   XGPPIIGGGSISSNNHLLKTA---------DNWVIGGLFFAAACLSLSAWNTCQAPILSS  244

Query  856   IYPQVMKIMCVYSLFGTVQSGALSLFIVRDLNAWRLGLNFQLIVILLTAIFGSIIRSSVQ  1035
              YP  + ++   +LFG +QS A+SL  VRD NAW+L  + +LI I+ +AI G ++   VQ
Sbjct  245   CYPSNITVISFITLFGAIQSTAVSLIAVRDSNAWKLRPDIELISIIYSAIIG-VVAFFVQ  303

Query  1036  LWCMRMKGPSFPLIFKPVGIVVASSCGCLFFADTFHYGSMFSAFICGMGYYTTIWGQLKD  1215
              WC+R KGP F  +FKP+G+ +A+  G +F  +T H GS+  A I   G Y   W Q ++
Sbjct  304   NWCIRRKGPVFASMFKPLGMGIAAIIGVIFLGETLHIGSVIGAIIIATGCYVVAWLQYRE  363

Query  1216  EEIQQIKGSSVSLPD--EKVPLLQQSQ  1290
             EE  ++    V LP   EK P+L + +
Sbjct  364   EEESKV-CEVVMLPSTFEKAPMLDEPE  389



>ref|XP_006582505.1| PREDICTED: WAT1-related protein At1g70260-like [Glycine max]
Length=318

 Score =   209 bits (532),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 124/357 (35%), Positives = 197/357 (55%), Gaps = 44/357 (12%)
 Frame = +1

Query  232   EVVPCMAMVMVEACTIFLTIMASTAMAKFGTNPFVFVVYTNALASIFLVPYSIIYHRRDK  411
             EV+P + MV++E  TI LTI A TA+   G +P VF+VYTNALA+I L P S + H+ D+
Sbjct  3     EVLPFIIMVIMEGWTIGLTIFAKTAITN-GMSPLVFIVYTNALATIILFPCSFLTHQEDR  61

Query  412   AQEQlftfplllrlfflglIGVTISQNLAFVGLSYSSPIAACGTANIVPALSFILAIILR  591
              +                    T S  + F+ L +                       + 
Sbjct  62    KERP----------------SFTFSLFMRFLFLGF-----------------------IG  82

Query  592   RTKIDWESGGSQARMIGALICTVGTISLIFYRGPVVNNYSPTFLHLSTTQFVFSSSTNQQ  771
             +T+++  S G Q ++IG L+  +G +   F++GP+V   S   L  +  Q++  SST  +
Sbjct  83    KTEMNLRSPGMQVQLIGILVSIMGAVVAEFFKGPLVRPSSHDHLKHANKQYLVFSST-PE  141

Query  772   NWVLGCLCFIAASLTLSIWNIIQVGTIRIYPQVMKIMCVYSLFGTVQSGALSLFIVRDLN  951
              WVLG     A+  +LSI+N+ Q  T+  YP+ MK++   +L GT+ S  +S  + R++N
Sbjct  142   FWVLGGALLAASFFSLSIFNLFQKETVERYPEPMKVLSYSNLLGTILSAIVSWIVEREIN  201

Query  952   AWRLGLNFQLIVILLTAIFGSIIRSSVQLWCMRMKGPSFPLIFKPVGIVVASSCGCLFFA  1131
              W++  N  LI+I+LTA+ G +IR ++ +W  R+KGP +  +FKP GI  A++    FF+
Sbjct  202   VWKIKRNKDLILIVLTALVGGVIRPNIHVWFTRIKGPLYVPLFKPFGIAFATTFALCFFS  261

Query  1132  DTFHYGSMFSAFICGMGYYTTIWGQLK--DEEIQQIKGSSVSLPDEKVPLLQQSQDD  1296
             ++ HYGS+      GMGYYT ++GQ+K  +EE      SS SL D+K+PLLQ+  ++
Sbjct  262   NSLHYGSVIGTTTLGMGYYTVMYGQIKGNEEETSCDDCSSDSL-DKKIPLLQEKMEE  317



>ref|XP_010043809.1| PREDICTED: WAT1-related protein At4g15540-like isoform X1 [Eucalyptus 
grandis]
 ref|XP_010043810.1| PREDICTED: WAT1-related protein At4g15540-like isoform X1 [Eucalyptus 
grandis]
 gb|KCW85807.1| hypothetical protein EUGRSUZ_B02553 [Eucalyptus grandis]
Length=364

 Score =   210 bits (535),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 124/367 (34%), Positives = 198/367 (54%), Gaps = 12/367 (3%)
 Frame = +1

Query  208   MEVKAAFGEVVPCMAMVMVEACTIFLTIMASTAMAKFGTNPFVFVVYTNALASIFLVPYS  387
             ME++   G  +P + M+MV        ++A  AM+  G N +    Y NAL+S+ L+P  
Sbjct  1     MEMEGRAGGSLPFVGMIMVVLVQASSMVVAKMAMSD-GLNKYTLAFYCNALSSLVLLPCP  59

Query  388   IIYHRRDKAQEQlftfplllrlfflglIGVTISQNLAFVGLSYSSPIAACGTANIVPALS  567
              I  RR  +   L    L         +G + SQ   + G+ YSSP+      N++PA +
Sbjct  60    FIISRRSGSCPPLTFTVLRKIFLLAL-VG-SASQICGYAGIDYSSPVLGTAMMNLIPAFT  117

Query  568   FILAIILRRTKIDWESGGSQARMIGALICTVGTISLIFYRGPVV--NNYSPTFLHLSTTQ  741
             FILA+I R  K++W+S  SQA+++G +   +G + +  Y+GP V  +   P+F+H    +
Sbjct  118   FILAVISRMEKVNWKSSSSQAKLVGTVASILGALVITVYKGPTVLRSPSLPSFVH---PR  174

Query  742   FVFSSSTNQQNWVLGCLCFIAASLTLSIWNIIQVGTIRIYPQVMKIMCVYSLFGTVQSGA  921
              + S  + Q NWVLG     A +  LS+W I+Q   ++ YP V+ IM     F T+ SG 
Sbjct  175   HLVSLLSRQLNWVLGGFLLAAEAFLLSLWFIMQAFILKDYPVVLNIMFYLMFFATIFSGL  234

Query  922   LSLFIVRDLNAWRLGLNFQLIVILLTAIFGSIIRSSVQLWCMRMKGPSFPLIFKPVGIVV  1101
             LS+ +VR+  +W L L+  LI IL +++   + R ++  WC++  GP F  +FKP+GIV 
Sbjct  235   LSIIMVREPQSWTLKLDVGLIAILYSSLVAGVFRVTLCTWCLKKTGPVFVSMFKPLGIVF  294

Query  1102  ASSCGCLFFADTFHYGSMFSAFICGMGYYTTIWGQLKDEE--IQQIKGSSVSLP--DEKV  1269
             A   G +F  +  H GS+  A +  MG+Y  +WG+ ++EE  I+   G+  SL    +K+
Sbjct  295   AVGLGFIFLGEKLHLGSLIGAAVIAMGFYAVMWGKSREEEKIIEDSGGADGSLASSSQKI  354

Query  1270  PLLQQSQ  1290
             PLLQ   
Sbjct  355   PLLQSKS  361



>ref|XP_010111532.1| Auxin-induced protein 5NG4 [Morus notabilis]
 gb|EXC31165.1| Auxin-induced protein 5NG4 [Morus notabilis]
Length=364

 Score =   210 bits (534),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 122/368 (33%), Positives = 206/368 (56%), Gaps = 11/368 (3%)
 Frame = +1

Query  208   MEVKAAFGEVVPCMAMVMVEACTIFLTIMASTAMAKFGTNPFVFVVYTNALASIFLVPYS  387
             M + +    +VP +AMV+VE  ++ LT ++  AM+K G +P+VFVVY+NALA+   +P+ 
Sbjct  1     MGLSSWLKALVPFLAMVVVEILSVGLTTLSKAAMSK-GMSPYVFVVYSNALATPIFLPF-  58

Query  388   IIYHRRDKAQEQlftfplllrlfflglIGVTISQNLAFVGLSYSSPIAACGTANIVPALS  567
             +I+ R  +      +F LL + F L  +G+ + QN   VG++YSSP  A    ++VPA++
Sbjct  59    LIFQRTKRPP---LSFSLLCKFFLLSSVGIAMMQNCVIVGVNYSSPTLASAMCSLVPAIA  115

Query  568   FILAIILRRTKIDWESGGSQARMIGALICTVGTISLIFYRGPVVNNYSPTFLHLSTTQFV  747
             F+LA+ +R  K+D  S   Q +++G ++   G +++  Y GP +        H + +   
Sbjct  116   FVLAVFIRMEKLDLRSSKGQIKIVGTILSISGALTVTIYNGPAIVVPQSQSTHNTISAPK  175

Query  748   FSSSTN---QQNWVLGCLCFIAASLTLSIWNIIQVGTIRIYPQVMKIMCVYSLFGTVQSG  918
              SSS N     NW++G L    A L L+IWNI Q   ++ +P    I+  Y  FGT+Q  
Sbjct  176   LSSSMNPTAASNWIIGGLLLATAYLCLAIWNIAQAVVLKGFPSQKTILFFYYFFGTLQCA  235

Query  919   ALSLFIVRDLNAWRLGLNFQLIVILLTAIFGSIIRSSVQLWCMRMKGPSFPLIFKPVGIV  1098
              +   + RD +AW +  + +LI ++ +A+FG+ +  S+  WCM  KGP F ++FKP+ I 
Sbjct  236   IVGFALERDPSAWIITPDIELISVIYSAVFGNAVTYSLLTWCMHKKGPVFVVMFKPLEIA  295

Query  1099  VASSCGCLFFADTFHYGSMFSAFICGMGYYTTIWGQLKDEEIQQ---IKGSSVSLPDEKV  1269
             +A+    +F  DT + GS+  A +  +G+Y  IW Q +D +++    +  S   LP  + 
Sbjct  296   IAAFMSTIFLGDTLYTGSVIGACLIVVGFYGVIWAQSEDGKVENHGVVDESRSPLPSPRT  355

Query  1270  PLLQQSQD  1293
             PLL+    
Sbjct  356   PLLESQSH  363



>ref|XP_010682604.1| PREDICTED: WAT1-related protein At3g28050-like isoform X1 [Beta 
vulgaris subsp. vulgaris]
 ref|XP_010682605.1| PREDICTED: WAT1-related protein At3g28050-like isoform X2 [Beta 
vulgaris subsp. vulgaris]
 ref|XP_010682606.1| PREDICTED: WAT1-related protein At3g28050-like isoform X1 [Beta 
vulgaris subsp. vulgaris]
 ref|XP_010682607.1| PREDICTED: WAT1-related protein At3g28050-like isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=356

 Score =   209 bits (532),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 120/357 (34%), Positives = 195/357 (55%), Gaps = 10/357 (3%)
 Frame = +1

Query  232   EVVPCMAMVMVEACTIFLTIMASTAMAKFGTNPFVFVVYTNALASIFLVPYSIIYHRRDK  411
             E  P + M+M E C + L I++  AM+  G + FVFV Y+NA AS+ L+P+S  +HR   
Sbjct  4     EAAPYIGMLMAECCQVGLMIISKQAMSA-GMSTFVFVCYSNAFASLILLPFSFFFHR---  59

Query  412   AQEQlftfplllrlfflglIGVTISQNLAFVGLSYSSPIAACGTANIVPALSFILAIILR  591
             ++++      LL  FFL  +   ++Q   + G++YSSP       N+VP L+F+LAII R
Sbjct  60    SEQRPQLTFSLLGWFFLLALSGCLAQLFGYTGINYSSPTLGTAMLNLVPGLTFLLAIIFR  119

Query  592   RTKIDWESGGSQARMIGALICTVGTISLIFYRGPVVNNYSPTFLHLSTTQFVFSSSTNQQ  771
               K++       A+++GA++   G      Y GP + N  P  LH      +        
Sbjct  120   MEKLNIRKISCLAKLVGAMVLIAGAFVATLYEGPPLLN-RPVSLHTHQLSII----GEHT  174

Query  772   NWVLGCLCFIAASLTLSIWNIIQVGTIRIYPQVMKIMCVYSLFGTVQSGALSLFIVRDLN  951
              W+LG        +  S W IIQ   ++ YP  + ++  Y  F T+QSG +++ + R+L+
Sbjct  175   RWILGGSFLAVDCVMASSWAIIQAIILKKYPAELIVVFFYCFFITLQSGIVTVILERNLS  234

Query  952   AWRLGLNFQLIVILLTAIFGSIIRSSVQLWCMRMKGPSFPLIFKPVGIVVASSCGCLFFA  1131
             AW L    +L+ +L +A+FGS ++  +  WC+R KGP F  +FKP+GI +A+  G +FF 
Sbjct  235   AWSLKSTMRLLAVLYSAVFGSALQVGLCSWCLRKKGPVFVCMFKPLGIAIAAVAGVVFFG  294

Query  1132  DTFHYGSMFSAFICGMGYYTTIWGQLKDE-EIQQIKGSSVSLPDEKVPLLQQSQDDS  1299
             DT + GS+    I   G+Y+ +WG+ K+E +I   +  S+  P +KVPLL     ++
Sbjct  295   DTLYLGSLLGIIIIVFGFYSVMWGKAKEEKKINDSQFGSLQSPTQKVPLLANHAKET  351



>ref|XP_006579558.1| PREDICTED: WAT1-related protein At3g28050-like [Glycine max]
Length=353

 Score =   209 bits (531),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 129/366 (35%), Positives = 198/366 (54%), Gaps = 19/366 (5%)
 Frame = +1

Query  208   MEVKAAFGEVVPCMAMVMVEACTIFLTIMASTAMAKFGTNPFVFVVYTNALASIFLVPYS  387
             M VK    E  P +AM  VE   + L+ ++  AM++ G N FV V Y+NALA++ L+P  
Sbjct  1     MGVKRNLVEWTPFIAMATVECLDVELSTLSKAAMSR-GMNHFVLVGYSNALATLILLPSP  59

Query  388   IIYHRRDKAQEQlftfplllrlfflglIGVTISQNLAFVGLSYSSPIAACGTANIVPALS  567
                  R +      +F LL + F LG++G+T+ QN  F  + YSS      T+N+ PA++
Sbjct  60    FFIDSRTRPS---LSFSLLCKFFLLGILGLTVMQNCVFTAIDYSSATLGSTTSNLSPAIT  116

Query  568   FILAIILRRTKIDWESGGSQARMIGALICTVGTISLIFYRGPVVNNY--SPTFLHLSTTQ  741
             F+LA+     K+   S  S+ ++IGA++   G + +  Y+G  +  +   P+ L      
Sbjct  117   FVLAVTYMMEKLKIGSSISKIKVIGAVLSISGALVVTLYKGSFIITFRIQPSLLD-----  171

Query  742   FVFSSSTNQQNWVLGCLCFIAASLTLSIWNIIQVGTIRIYPQVMKIMCVYSLFGTVQSGA  921
                       NWV+G L F  AS++ + WNI Q   ++ Y     I+  Y LFGT+QS  
Sbjct  172   -------ETSNWVIGGLVFAIASVSFAAWNITQAVILKEYSSQSTIIAYYCLFGTIQSEI  224

Query  922   LSLFIVRDLNAWRLGLNFQLIVILLTAIFGSIIRSSVQLWCMRMKGPSFPLIFKPVGIVV  1101
             LSLF+VRD N W++  N +LI I  +AI GS +  SV  WC++ KGP F  +FKP GI +
Sbjct  225   LSLFVVRDSNVWKISPNDKLICIFYSAIAGSAVTFSVTAWCIKRKGPVFVSMFKPAGIAI  284

Query  1102  ASSCGCLFFADTFHYGSMFSAFICGMGYYTTIWGQLKDEEIQQIKGSSVSLPDEKV-PLL  1278
             A+    +F  +T H+GS+  A I  +G YT +W Q K+E  + ++    S P  +  PLL
Sbjct  285   AAFSSVVFLCETLHFGSITGAVIIAIGLYTLLWAQSKEENAEDLQVDRKSSPSAQASPLL  344

Query  1279  QQSQDD  1296
             +  Q +
Sbjct  345   ESHQRN  350



>ref|XP_010271999.1| PREDICTED: WAT1-related protein At5g40240-like isoform X1 [Nelumbo 
nucifera]
Length=386

 Score =   209 bits (532),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 139/385 (36%), Positives = 218/385 (57%), Gaps = 31/385 (8%)
 Frame = +1

Query  172   SSRRPPEKM----LAAMEVKAAFG-------EVVPCMAMVMVEACTIFLTIMASTAMAKF  318
             + ++ P+K     L+ ME K           + +P   M+MVE  ++ L  ++  +M + 
Sbjct  16    TKKKEPQKTVISALSLMETKGNMRSRSRRLWDAIPFAGMMMVECSSVGLITLSKASMLR-  74

Query  319   GTNPFVFVVYTNALASIFLVPYSIIYHRRDKAQEQlftfplllrlfflglIGVTISQNLA  498
             G + F+FV+Y+ ALA++ L+P S  + RR  A     T  LL RLF LGLIG  + Q  A
Sbjct  75    GMSNFIFVMYSYALATLLLLP-SAFFCRR--ATLPPITVSLLCRLFLLGLIGYLV-QVFA  130

Query  499   FVGLSYSSPIAACGTANIVPALSFILAIILRRTKIDWESGGSQARMIGALICTVGTISLI  678
             + G++YSSP  A   +N++PA +FILAII R  K+D  S  SQA+ +G L+   G   + 
Sbjct  131   YTGINYSSPTLASAMSNLIPAFTFILAIIFRMEKLDLRSSNSQAKSLGTLVSIAGAFVVT  190

Query  679   FYRGP-VVNNYSPT---FLHLSTTQFVFSSSTNQQNWVLGCLCFIAASLTLS-IWNIIQV  843
              Y+GP ++   SP+    LHL    F+ +S     NWV+G L F+AA   LS +W I Q 
Sbjct  191   LYKGPSILTTPSPSDSPHLHL----FLPNS-----NWVIGGL-FVAADCLLSALWYIFQA  240

Query  844   GTIRIYPQVMKIMCVYSLFGTVQSGALSLFIVRDLNAWRLGLNFQLIVILLTAIFGSIIR  1023
               ++ YPQ   ++  YS F T+QS  + L + R+ + WRL L+ +L  I+ +A+FG    
Sbjct  241   SIVKEYPQEFTLIFFYSFFATIQSAIVCLLVEREPSKWRLRLDLELFTIVYSAVFGFGFS  300

Query  1024  SSVQLWCMRMKGPSFPLIFKPVGIVVASSCGCLFFADTFHYGSMFSAFICGMGYYTTIWG  1203
               VQ WC+R KGP F  +F+P+GIV+A   G +F  D  H GS+  + I  +G+Y  +WG
Sbjct  301   VGVQTWCLRKKGPFFVAMFRPLGIVIAVVLGIIFLGDILHIGSVIGSVIIALGFYAVMWG  360

Query  1204  QLKDEEIQQIKGSSVSLPDEKVPLL  1278
             + +++++   + SS+   ++  PLL
Sbjct  361   KAQEDKLVDGEFSSLEPSNQSAPLL  385



>ref|XP_010272001.1| PREDICTED: WAT1-related protein At5g40240-like isoform X2 [Nelumbo 
nucifera]
Length=349

 Score =   207 bits (527),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 131/354 (37%), Positives = 203/354 (57%), Gaps = 20/354 (6%)
 Frame = +1

Query  232   EVVPCMAMVMVEACTIFLTIMASTAMAKFGTNPFVFVVYTNALASIFLVPYSIIYHRRDK  411
             + +P   M+MVE  ++ L  ++  +M + G + F+FV+Y+ ALA++ L+P S  + RR  
Sbjct  10    DAIPFAGMMMVECSSVGLITLSKASMLR-GMSNFIFVMYSYALATLLLLP-SAFFCRR--  65

Query  412   AQEQlftfplllrlfflglIGVTISQNLAFVGLSYSSPIAACGTANIVPALSFILAIILR  591
             A     T  LL RLF LGLIG  + Q  A+ G++YSSP  A   +N++PA +FILAII R
Sbjct  66    ATLPPITVSLLCRLFLLGLIGYLV-QVFAYTGINYSSPTLASAMSNLIPAFTFILAIIFR  124

Query  592   RTKIDWESGGSQARMIGALICTVGTISLIFYRGP-VVNNYSPT---FLHLSTTQFVFSSS  759
               K+D  S  SQA+ +G L+   G   +  Y+GP ++   SP+    LHL          
Sbjct  125   MEKLDLRSSNSQAKSLGTLVSIAGAFVVTLYKGPSILTTPSPSDSPHLHLFLPN------  178

Query  760   TNQQNWVLGCLCFIAASLTLS-IWNIIQVGTIRIYPQVMKIMCVYSLFGTVQSGALSLFI  936
                 NWV+G L F+AA   LS +W I Q   ++ YPQ   ++  YS F T+QS  + L +
Sbjct  179   ---SNWVIGGL-FVAADCLLSALWYIFQASIVKEYPQEFTLIFFYSFFATIQSAIVCLLV  234

Query  937   VRDLNAWRLGLNFQLIVILLTAIFGSIIRSSVQLWCMRMKGPSFPLIFKPVGIVVASSCG  1116
              R+ + WRL L+ +L  I+ +A+FG      VQ WC+R KGP F  +F+P+GIV+A   G
Sbjct  235   EREPSKWRLRLDLELFTIVYSAVFGFGFSVGVQTWCLRKKGPFFVAMFRPLGIVIAVVLG  294

Query  1117  CLFFADTFHYGSMFSAFICGMGYYTTIWGQLKDEEIQQIKGSSVSLPDEKVPLL  1278
              +F  D  H GS+  + I  +G+Y  +WG+ +++++   + SS+   ++  PLL
Sbjct  295   IIFLGDILHIGSVIGSVIIALGFYAVMWGKAQEDKLVDGEFSSLEPSNQSAPLL  348



>ref|XP_006470384.1| PREDICTED: WAT1-related protein At3g28050-like [Citrus sinensis]
Length=357

 Score =   207 bits (527),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 124/360 (34%), Positives = 207/360 (58%), Gaps = 10/360 (3%)
 Frame = +1

Query  208   MEVKAAFGEVVPCMAMVMVEACTIFLTIMASTAMAKFGTNPFVFVVYTNALASIFLVPYS  387
             M + +     +P +AMV VE   + L++++  A+ K G N FV VVY NAL ++ L+PY 
Sbjct  1     MALASWLQNTIPFVAMVTVECTDVGLSVISKAALTK-GMNKFVSVVYYNALGTLILLPYF  59

Query  388   IIYHRRDKAQEQlftfplllrlfflglIGVTISQNLAFVGLSYSSPIAACGTANIVPALS  567
             +   RR+K      T+ L+ R F LGLIG +  Q + F GL +SSP  +   AN++P  +
Sbjct  60    LF--RRNKGAS--LTWSLIWRFFLLGLIGSS-GQIIYFTGLKFSSPTLSSAMANLIPIYT  114

Query  568   FILAIILRRTKIDWESGGSQARMIGALICTVGTISLIFYRGPVVNNYSPTFLHLSTTQFV  747
             F+LA+I R  K+D     SQA+ +GA +   G   +  YRGP++   S T       Q +
Sbjct  115   FLLAVIFRIEKLDLRRSSSQAKTLGATVAVTGAFMITLYRGPLLLMASSTSDSPDHPQLL  174

Query  748   FSSSTNQQNWVLGCLCFIAASLTLSIWNIIQVGTIRIYPQVMKIMCVYSLFGTVQSGALS  927
             FS    Q  W++G L  +   ++ +IWN+ Q  T++ YP+ M ++  Y+ F T+Q+   S
Sbjct  175   FS---QQSEWLIGGLLLVLVCISSAIWNVAQAATVKEYPEEMTVVFFYTFFITIQALCFS  231

Query  928   LFIVRDLNAWRLGLNFQLIVILLTAIFGSIIRSSVQLWCMRMKGPSFPLIFKPVGIVVAS  1107
             + +  D++AW+L    +++ I+ TAIFGS+ R  +  WC+R KGP +  +FKP+G+ VA 
Sbjct  232   VIVENDIDAWKLTTGVEIMAIVCTAIFGSVFRIGIHTWCLRKKGPVYVAMFKPLGMAVAV  291

Query  1108  SCGCLFFADTFHYGSMFSAFICGMGYYTTIWGQLKDEE-IQQIKGSSVSLPDEKVPLLQQ  1284
                 +F     + GS+  + +  +G+YT +WGQ+K+E+ ++  +  S+    ++ PLLQ+
Sbjct  292   VLTVIFLGYNLYLGSVIGSIVIALGFYTVMWGQMKEEDLVRNNEDCSLISAGQRTPLLQR  351



>ref|XP_007222235.1| hypothetical protein PRUPE_ppa007913mg [Prunus persica]
 gb|EMJ23434.1| hypothetical protein PRUPE_ppa007913mg [Prunus persica]
Length=351

 Score =   206 bits (525),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 125/354 (35%), Positives = 198/354 (56%), Gaps = 11/354 (3%)
 Frame = +1

Query  238   VPCMAMVMVEACTIFLTIMASTAMAKFGTNPFVFVVYTNALASIFLVPYSIIYHRRDKAQ  417
             +P + MV+ E+    L I++  AM+  G +  +F+ Y+NALA++ L+P S+ +HR ++  
Sbjct  7     LPIVGMVLAESAQAGLIIVSKLAMSN-GMSNLIFLCYSNALAALILLPISLAFHRSERPP  65

Query  418   EQlftfplllrlfflglIGVTISQNLAFVGLSYSSPIAACGTANIVPALSFILAIILRRT  597
                 TF  L   F LGLIG  ++Q   + G++ SSP  +    N++PA +FILA+I R  
Sbjct  66    ---LTFSTLCWFFLLGLIGF-MAQFFGYAGINLSSPTLSTAMLNLIPAFTFILAVIFRME  121

Query  598   KIDWESGGSQARMIGALICTVGTISLIFYRGPVVNNYSPTFLHLSTTQFVFSSSTNQQNW  777
             +ID  S  S A+ +G ++   G   +  Y+GP +   S T + LS  Q        Q NW
Sbjct  122   RIDGRSSSSLAKTLGTIVSISGAFIVTLYKGPPLLMTSSTDI-LSHNQLFL----EQSNW  176

Query  778   VLGCLCFIAASLTLSIWNIIQVGTIRIYPQVMKIMCVYSLFGTVQSGALSLFIVRDLNAW  957
             VLG +C     +  S W I+Q   ++ YP  + ++  Y  F  +QS  +SL + RDL+AW
Sbjct  177   VLGGMCIALNCVLASSWLIVQASVLKKYPAELIMVFYYCFFVAIQSVVVSLTVERDLSAW  236

Query  958   RLGLNFQLIVILLTAIFGSIIRSSVQLWCMRMKGPSFPLIFKPVGIVVASSCGCLFFADT  1137
              L    +LI +L + +FGS  +  V  WC+   GP F  IFKP+GIV+    G  F  DT
Sbjct  237   ELKPKIRLIAVLYSGVFGSAFQVGVSTWCLHRTGPVFVAIFKPLGIVITVFVGATFLGDT  296

Query  1138  FHYGSMFSAFICGMGYYTTIWGQLKDEEIQQIKGS-SVSLPDEKVPLLQQSQDD  1296
             F+ GS+  A +  MG+Y+ +WG+ K+E++    G+ SV+   ++VPLLQ   ++
Sbjct  297   FYLGSLIGAIVIVMGFYSVMWGKAKEEKMDDDAGARSVASSRQRVPLLQSHIEE  350



>gb|KCW85805.1| hypothetical protein EUGRSUZ_B02552 [Eucalyptus grandis]
Length=377

 Score =   206 bits (525),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 110/323 (34%), Positives = 177/323 (55%), Gaps = 9/323 (3%)
 Frame = +1

Query  259   MVEACTIFLTIMASTAMAKFGTNPFVFVVYTNALASIFLVPYSIIYHRRDKAQEQlftfp  438
             M E   + L I++   M+  G +  VFV Y+NA AS+ L+P S+I+HR  +         
Sbjct  1     MAECAQVGLMIVSKAVMSN-GMSNLVFVFYSNAFASLILLPASLIFHRSGRPP------L  53

Query  439   lllrlfflglIGVT--ISQNLAFVGLSYSSPIAACGTANIVPALSFILAIILRRTKIDWE  612
                 +    ++G+   ++Q L + G++YSSP       N+VPA +F+LAII R  +++W 
Sbjct  54    TPSLVLQFFVLGLLGCLAQILGYAGINYSSPTLGSALLNLVPAFTFLLAIIFRLERLNWS  113

Query  613   SGGSQARMIGALICTVGTISLIFYRGPVVNNYSPTFLHLSTTQFVFSSSTNQQNWVLGCL  792
             S  S A+  G ++C  G   +  Y+GP +   S + LH           T + NWVLG L
Sbjct  114   SSSSLAKCAGTIVCVAGAFVVTLYKGPAIVTSSLSNLHNEVFNLHHKLLTPESNWVLGGL  173

Query  793   CFIAASLTLSIWNIIQVGTIRIYPQVMKIMCVYSLFGTVQSGALSLFIVRDLNAWRLGLN  972
               +A  +  S W I+Q   ++ YP  + I+  Y  F  +QS A+SLF+ R  +AW L  N
Sbjct  174   LLVADCVMASSWLIVQASVLKKYPAELIIVFFYCFFVAIQSAAISLFVERKSSAWSLKDN  233

Query  973   FQLIVILLTAIFGSIIRSSVQLWCMRMKGPSFPLIFKPVGIVVASSCGCLFFADTFHYGS  1152
              +L+ +L +A+FGS  +  V  WC+   GP F  +FKP+GIV+A+  G LF  D F+ GS
Sbjct  234   MRLMAVLYSAVFGSAFQVGVSTWCLHRTGPVFVSMFKPLGIVIAAVAGVLFLGDNFYLGS  293

Query  1153  MFSAFICGMGYYTTIWGQLKDEE  1221
             +  +    +G+Y+ +WG+ K+++
Sbjct  294   LVGSVAIVVGFYSVMWGKAKEQK  316



>ref|XP_008221761.1| PREDICTED: WAT1-related protein At3g28050-like isoform X1 [Prunus 
mume]
 ref|XP_008221762.1| PREDICTED: WAT1-related protein At3g28050-like isoform X1 [Prunus 
mume]
Length=351

 Score =   203 bits (516),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 123/354 (35%), Positives = 199/354 (56%), Gaps = 11/354 (3%)
 Frame = +1

Query  238   VPCMAMVMVEACTIFLTIMASTAMAKFGTNPFVFVVYTNALASIFLVPYSIIYHRRDKAQ  417
             +P + MV+ E+    L I++  AM+  G +  +F+ Y+NALA++ L+P S+ +HR ++  
Sbjct  7     LPIVGMVLAESAQAGLIIVSKVAMSN-GMSNLIFLCYSNALAALILLPISLAFHRSERPP  65

Query  418   EQlftfplllrlfflglIGVTISQNLAFVGLSYSSPIAACGTANIVPALSFILAIILRRT  597
                 TF  L   F LGLIG  ++Q   + G++ SSP  +    N++PA +FILA+I R  
Sbjct  66    ---LTFSTLCWFFLLGLIGF-MAQFFGYAGINLSSPTLSTAMLNLIPAFTFILAVIFRME  121

Query  598   KIDWESGGSQARMIGALICTVGTISLIFYRGPVVNNYSPTFLHLSTTQFVFSSSTNQQNW  777
             +ID  S  S A+ +G ++   G   +  Y+GP +   S T + LS  Q      + Q NW
Sbjct  122   RIDGRSSSSLAKTLGTIVSISGAFIVTLYKGPPLLMTSSTDI-LSHNQLF----SEQSNW  176

Query  778   VLGCLCFIAASLTLSIWNIIQVGTIRIYPQVMKIMCVYSLFGTVQSGALSLFIVRDLNAW  957
             VLG +C     +  S W I+Q   ++ YP  + ++  Y  F  +QS  +SL + RDL+AW
Sbjct  177   VLGGVCIALNCVLASSWLIVQASVLKKYPAELIMVFYYCFFVAIQSVVVSLTVERDLSAW  236

Query  958   RLGLNFQLIVILLTAIFGSIIRSSVQLWCMRMKGPSFPLIFKPVGIVVASSCGCLFFADT  1137
              L    +LI +L + +FGS  +  V  WC+   GP F  +FKP+GIV+    G  F  DT
Sbjct  237   ELKPKIRLIAVLYSGVFGSAFQVGVSTWCLHRTGPVFVAMFKPLGIVITVFVGVTFLGDT  296

Query  1138  FHYGSMFSAFICGMGYYTTIWGQLKDEEIQQIKGS-SVSLPDEKVPLLQQSQDD  1296
             F+ GS+  A +  +G+Y+ +WG+ K+E++    G+ SV+   ++VPLLQ   ++
Sbjct  297   FYLGSLIGAIVIVIGFYSVMWGKSKEEKMDDDTGARSVASSRQRVPLLQSHIEE  350



>ref|XP_006476741.1| PREDICTED: WAT1-related protein At5g40240-like isoform X1 [Citrus 
sinensis]
Length=364

 Score =   203 bits (516),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 127/366 (35%), Positives = 205/366 (56%), Gaps = 18/366 (5%)
 Frame = +1

Query  208   MEVKAAFGEVVPCMAMVMVEACTIFLTIMASTAMAKFGTNPFVFVVYTNALASIFLVPYS  387
             M VK     +VP  AMV V+   + +T ++  A+++ G  P +  VY +A+AS+ L+P S
Sbjct  3     MGVKQLVVGLVPYAAMVAVQCVQVGITTLSKAAISQ-GATPLILAVYADAIASLILLPLS  61

Query  388   IIYHRRDKAQEQlftfplllrlfflglIGVTISQNLAFVGLSYSSPIAACGTANIVPALS  567
                +R+++      TF LL ++F L LIG+T+ Q   + G+S+SSP     T N++PA +
Sbjct  62    FFLNRKNRPP---LTFALLCKVFILSLIGITLMQICVYTGVSFSSPTLVSATNNLIPAFT  118

Query  568   FILAIILRRTKIDWESGGSQARMIGALICTVGTISLIFYRGPVVNNYSPTFLHLSTTQ--  741
             F+LA+I R  K+D  S  SQ ++IG L+   G   +  Y+GP +   +  F H    Q  
Sbjct  119   FLLAVIFRMEKVDLRSLISQIKIIGTLVSIAGAFIITLYKGPSI--VALLFEHQPKPQPP  176

Query  742   --FVFSSSTNQQNWVLGCLCFIAASLTLSIWNIIQVGTIRIYPQVMKIMCVYSLFGTVQS  915
               F   ++T+  NWV+G +    AS +++  NI Q   ++ YP  + I+  Y LFGT+Q 
Sbjct  177   TSFTLLATTD--NWVIGGILLSIASFSIAAGNIFQAAILKSYPSEVTIVFFYILFGTIQC  234

Query  916   GALSLFIVRDLNAWRLGLNFQLIVILLTAIFGSIIRSSVQLWCMRMKGPSFPLIFKPVGI  1095
               ++L   R+ +AWR+    +LI ++ TAIFG ++   +  WC+R KGP F  +F PVGI
Sbjct  235   AIVALIAERNPDAWRIRPGIELITVMYTAIFGGLMLFGLVAWCLRRKGPVFVAMFNPVGI  294

Query  1096  VVASSCGCLFFADTFHYGSMFSAFICGMGYYTTIWGQLKDEEIQQIKGSSVSLPDEKVPL  1275
              +A+    +F  DT H GS+  A I   G+Y  +W Q K+EE  +I+ ++    D +  L
Sbjct  295   FIAALMSDIFLGDTLHLGSVIGAIIIVTGFYGVMWAQSKEEE--KIQANT----DGRSQL  348

Query  1276  LQQSQD  1293
             L  S++
Sbjct  349   LSHSRE  354



>ref|XP_004232283.1| PREDICTED: WAT1-related protein At5g40240-like [Solanum lycopersicum]
Length=355

 Score =   202 bits (513),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 123/356 (35%), Positives = 200/356 (56%), Gaps = 14/356 (4%)
 Frame = +1

Query  232   EVVPCMAMVMVEACTIFLTIMASTAMAKFGTNPFVFVVYTNALASIFLVPYSIIYHRRDK  411
             + +P +AMVMVE C + +  +   AM   G N  V+VVY NAL ++FL+P  +I+HR  +
Sbjct  9     DFLPFLAMVMVECCEMLMITLGKAAMND-GLNNLVYVVYYNALGTLFLLP-CLIFHRH-R  65

Query  412   AQEQlftfplllrlfflglIGVTISQNLAFVGLSYSSPIAACGTANIVPALSFILAIILR  591
             +     T P+L R F LGL+G+ + Q +AF G+ YS+P  A    N++P  +F+LAII R
Sbjct  66    SNMVPITLPILWRFFLLGLLGICLVQAVAFTGIKYSTPTLAAALGNLMPGFTFLLAIIFR  125

Query  592   RTKIDWESGGSQARMIGALICTVGTISLIFYRGP-VVNNYSPTFLHLSTTQFVFSSSTNQ  768
               K+D     SQA+ +G ++  +G   +  Y+GP V+ +  P+    S  + V S    +
Sbjct  126   MEKLDITKASSQAKSVGTVVAIMGASIMTLYKGPRVLGSNLPS--DSSHHELVLS---QE  180

Query  769   QNWVLGCLCFIAASLTLSIWNIIQVGTIRIYPQVMKIMCVYSLFGTVQSGALSLFIVRDL  948
              NW+LG L      +  S WNI+Q  T++ YP+ M I+     FG++Q   L+L +  + 
Sbjct  181   SNWILGGLLITTTCIMSSGWNILQTDTVKKYPEHMTIVFFTCFFGSIQCAILTLALESNP  240

Query  949   NAWRLGLNFQLIVILLTAIFGSIIRSSVQLWCMRMKGPSFPLIFKPVGIVVASSCGCLFF  1128
               W +     +I I+ +A+ GS+ R +V  WC+  KGP +  +FKP+G+V+++  G +F 
Sbjct  241   KTWMVKPGIGMIAIVFSAVSGSVFRYNVLTWCLDKKGPLYVAMFKPLGMVISAILGIIFL  300

Query  1129  ADTFHYGSMFSAFICGMGYYTTIWGQLKD----EEIQQIKGSSVSLPDEKVPLLQQ  1284
             AD  H GS+  A I   G+Y+ +WG+ K+     E++ I    +   D+  PLL +
Sbjct  301   ADPLHLGSVIGAVIITAGFYSVLWGKAKEIKSMVEVEDIV-CVIDSTDQTSPLLHK  355



>ref|XP_009761506.1| PREDICTED: WAT1-related protein At5g40240-like isoform X2 [Nicotiana 
sylvestris]
Length=358

 Score =   201 bits (512),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 126/363 (35%), Positives = 206/363 (57%), Gaps = 12/363 (3%)
 Frame = +1

Query  208   MEVKAAFGEVVPCMAMVMVEACTIFLTIMASTAMAKFGTNPFVFVVYTNALASIFLVPYS  387
             ME+++   +V P +AMV+VE C + +  +   AM   G +  V+VVY NAL +  L+P+ 
Sbjct  4     MEMQSWSKDVFPFVAMVLVECCEMGMITLGKAAMND-GMSNLVYVVYYNALGTFLLLPF-  61

Query  388   IIYHRRDKAQEQlftfplllrlfflglIGVTISQNLAFVGLSYSSPIAACGTANIVPALS  567
             +I+HR  ++   L T  +L R F LGL+G+ + Q LA+ G+ YSSP  A    N++P  +
Sbjct  62    LIFHR-CRSNMALITLSILWRFFLLGLLGICLLQVLAYTGIKYSSPTLAAALGNLLPGFT  120

Query  568   FILAIILRRTKIDWESGGSQARMIGALICTVGTISLIFYRGPVVNNYSPTFLHLSTTQFV  747
             F+L II R  K+D     SQA+ +G ++  +G   +  Y+GP V   S   LH  ++   
Sbjct  121   FLLTIIFRMEKLDIRKASSQAKSLGTIVAIIGASIMTLYKGPRVLGSSN--LHSDSSHH-  177

Query  748   FSSSTNQQNWVLGCLCFIAASLTLSIWNIIQVGTIRIYPQVMKIMCVYSLFGTVQSGALS  927
              S  + + NW+LG L      +  S WN++Q  T++ YP+ M I+     FG++Q   L+
Sbjct  178   -SLFSQESNWLLGGLLITITCIMSSGWNVLQTDTVKKYPEQMTIVFFTCCFGSIQCAILT  236

Query  928   LFIVRDLNAWRLGLNFQLIVILLTAIFGSIIRSSVQLWCMRMKGPSFPLIFKPVGIVVAS  1107
             L + R+  AW +     +I I+ +A+ GS+ R +V  WC+  KGP +  +FKP+G+V+A+
Sbjct  237   LVLERNPEAWMVKPGIGMIAIVFSAVSGSVFRYNVLTWCLDKKGPLYVAMFKPLGMVIAA  296

Query  1108  SCGCLFFADTFHYGSMFSAFICGMGYYTTIWGQLKD----EEIQQIKGSSVSLPDEKVPL  1275
               G LF  ++ H GS+  A I   G+Y+ +WG+ K+     EI+ I  S +    ++ PL
Sbjct  297   ILGILFLTESLHLGSVIGAVIISAGFYSVLWGKAKEIKSMLEIEDIV-SGIDSSSQRSPL  355

Query  1276  LQQ  1284
             LQ+
Sbjct  356   LQK  358



>ref|XP_009360476.1| PREDICTED: WAT1-related protein At5g40240-like [Pyrus x bretschneideri]
Length=354

 Score =   201 bits (511),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 118/356 (33%), Positives = 200/356 (56%), Gaps = 12/356 (3%)
 Frame = +1

Query  238   VPCMAMVMVEACTIFLTIMASTAMAKFGTNPFVFVVYTNALASIFLVPYSIIYHRRDKAQ  417
             +P + MV+ E     L I++  AM+  G +  +F+ Y+NALA++ L+P S+++HR ++  
Sbjct  7     LPIVGMVLAECAQAGLIIISKIAMSN-GMSNLIFLCYSNALAALILLPISLVFHRSERPP  65

Query  418   EQlftfplllrlfflglIGVTISQNLAFVGLSYSSPIAACGTANIVPALSFILAIILRRT  597
                 T  ++   F LGLIG  ++Q L + G++YSSP  +    N++PA +F+LA+I R  
Sbjct  66    ---LTLSIIGWFFLLGLIGF-MAQFLGYAGINYSSPTLSTAMLNLIPAFTFVLAVIFRME  121

Query  598   KIDWESGGSQARMIGALICTVGTISLIFYRGPVVNNYSPTFLH--LSTTQFVFSSSTNQQ  771
             +ID  S  S A+ +G ++   G   +  Y+GP +   S T +   LS  Q +    + + 
Sbjct  122   RIDMRSFSSLAKTLGTIVSISGAFIVTLYKGPPILKASSTVMTDVLSHKQLI----SERS  177

Query  772   NWVLGCLCFIAASLTLSIWNIIQVGTIRIYPQVMKIMCVYSLFGTVQSGALSLFIVRDLN  951
             NWVLG +C  A  +  S W I+Q   ++ Y   + ++  Y  F  +QS  +S  + RDL 
Sbjct  178   NWVLGGVCVAANCVLASAWIIVQASVLKKYRAELIMVFYYCFFVAIQSVVVSSILERDLR  237

Query  952   AWRLGLNFQLIVILLTAIFGSIIRSSVQLWCMRMKGPSFPLIFKPVGIVVASSCGCLFFA  1131
             +W L    + I +L +A+FGS  +  V  WC+R  GP F  +FKP+GI+V    G  F  
Sbjct  238   SWELTPKIRWIAVLYSAVFGSAFQVGVSTWCLRRTGPVFVAMFKPLGIIVTVFIGVTFLG  297

Query  1132  DTFHYGSMFSAFICGMGYYTTIWGQLKDEEIQQIKG-SSVSLPDEKVPLLQQSQDD  1296
             DTF+ GS+  A +  +G+Y+ +WG+  +E++ +  G  S++   ++VPLLQ   ++
Sbjct  298   DTFYLGSLIGAIVIVIGFYSVMWGKANEEKMDEDAGEESLASIKQQVPLLQSHIEE  353



>ref|XP_008221767.1| PREDICTED: WAT1-related protein At5g40210-like isoform X2 [Prunus 
mume]
Length=357

 Score =   201 bits (510),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 125/360 (35%), Positives = 198/360 (55%), Gaps = 20/360 (6%)
 Frame = +1

Query  232   EVVPCMAMVMVEACTIFLTIMASTAMAKFGTNPFVFVVYTNALASIFLVPYSIIYHRRDK  411
              ++P + MVM         I+   AM+K G+N ++ VVY N L+++ L+P ++ +H R  
Sbjct  5     SLLPFLGMVMAVLAQAANMIVNEAAMSK-GSNKYIMVVYANGLSTLILLPPALFFHHRSG  63

Query  412   AQEQlftfplllrlfflglIGVTISQNLAFVGLSYSSPIAACGTANIVPALSFILAIILR  591
                   TF +L   F L L G + +Q   +VG+ YSS        N++PA +FILAII R
Sbjct  64    --RPPLTFSILCGFFMLALFGCS-AQIFGYVGIEYSSATLGTAMLNLIPAFTFILAIIFR  120

Query  592   RTKIDWESGGSQARMIGALICTVGTISLIFYRG-PVV---NNYSPTFLHLSTTQFVFSSS  759
               ++ W S  S+A+++G +    G   + FY+G P++   +++ P          +FSS 
Sbjct  121   MEEVQWRSSSSKAKILGTIASIAGAFVVTFYKGQPIMLPPSSHPPN---------LFSS-  170

Query  760   TNQQNWVLGCLCFIAASLTLSIWNIIQVGTIRIYPQVMKIMCVYSLFGTVQSGALSLFIV  939
               + NWVLG L   A S + S+W I+Q  T++ YP V+  +C  SLF TVQS  ++L  V
Sbjct  171   --KSNWVLGGLFLAADSFSSSLWYILQASTLKKYPAVVVTVCFQSLFMTVQSALVTLIAV  228

Query  940   RDLNAWRLGLNFQLIVILLTAIFGSIIRSSVQLWCMRMKGPSFPLIFKPVGIVVASSCGC  1119
             +D +AW L L+  LI +L TAI    +R ++  WC+   G  F  +FKP+GI+     G 
Sbjct  229   KDASAWELRLDMGLIAVLYTAIVSIGLRYTLTAWCVWKAGALFCSMFKPLGIIFGVIMGA  288

Query  1120  LFFADTFHYGSMFSAFICGMGYYTTIWGQLKDEEIQQIKGSSVSLPDEKVPLLQQSQDDS  1299
             +F  D F++GS+  A I   G+Y  +WG+ K+E++ +      SL   KVPLLQ + ++ 
Sbjct  289   IFLGDPFYFGSLVGALIIVTGFYAVMWGKAKEEKLVEGGSRWESLGHNKVPLLQNNIEEK  348



>ref|XP_007044590.1| Auxin-induced protein 5NG4, putative [Theobroma cacao]
 gb|EOY00422.1| Auxin-induced protein 5NG4, putative [Theobroma cacao]
Length=354

 Score =   199 bits (507),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 126/357 (35%), Positives = 191/357 (54%), Gaps = 18/357 (5%)
 Frame = +1

Query  229   GEVVPCMAMVMVEACTIFLTIMASTAMAKFGTNPFVFVVYTNALASIFLVPYSIIYHRRD  408
             G ++P + MVMV    +   ++   AM+  G N +V +VY+N L+S+ L+P S I+HR  
Sbjct  2     GTLLPFVGMVMVILAQVSSMVLTKAAMSS-GVNKYVLIVYSNVLSSLILLPCSFIFHR--  58

Query  409   KAQEQlftfplllrlfflglIGVTISQNLAFVGLSYSSPIAACGTANIVPALSFILAIIL  588
                  L +  L   +F L LIG  + Q   + G+ YSSP  A    N+VPA +FILAII 
Sbjct  59    SMHLPLNSSNLYRLIFLLALIG-CVGQLCGYAGIQYSSPALATAMLNLVPAFTFILAIIC  117

Query  589   RRTKIDWESGGSQARMIGALICTVGTISLIFYRGPVVNNYSPTFLHLSTTQFVFSS----  756
             R  K+ W S  SQ++++G +I   G   +  Y+GP +         LST   V       
Sbjct  118   RMEKLKWRSISSQSKVLGTVISITGAFVVTLYKGPTI---------LSTQSLVVLPHQLL  168

Query  757   STNQQNWVLGCLCFIAASLTLSIWNIIQVGTIRIYPQVMKIMCVYSLFGTVQSGALSLFI  936
             S+ Q NWVLG L   A +L  S W IIQ   ++ +P V+ +M     F  + S   SL +
Sbjct  169   SSPQLNWVLGGLLLAAEALINSAWYIIQTLVLKKFPAVLTVMFYLCFFNAILSTIYSLIL  228

Query  937   VRDLNAWRLGLNFQLIVILLTAIFGSIIRSSVQLWCMRMKGPSFPLIFKPVGIVVASSCG  1116
             VRD +AW+L     L+ IL +AI  +  R S+  WC+   GP +  +FKP+ ++ A+  G
Sbjct  229   VRDPSAWKLRPGIGLVAILYSAIIATTFRISLCSWCLWKVGPLYVSMFKPLAVIFAAVTG  288

Query  1117  CLFFADTFHYGSMFSAFICGMGYYTTIWGQLKDEEIQQIKG-SSVSLPDEKVPLLQQ  1284
              +F  D    GS+  A I  +G+Y  +WG+  +E +++  G  S++ P EK+PLLQ 
Sbjct  289   IVFLGDAVSLGSLIGAVIIVIGFYAVLWGKANEENVKEDNGVESLNPPSEKLPLLQN  345



>ref|XP_010111736.1| Auxin-induced protein 5NG4 [Morus notabilis]
 gb|EXC31598.1| Auxin-induced protein 5NG4 [Morus notabilis]
Length=362

 Score =   199 bits (507),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 119/365 (33%), Positives = 205/365 (56%), Gaps = 12/365 (3%)
 Frame = +1

Query  217   KAAFGEVVPCMAMVMVEACTIFLTIMASTAMAKFGTNPFVFVVYTNALASIFLVPYSIIY  396
             +  + +V+P  AMV +E   + L  +   A  K G +  VFVVY  A+A++ L+P     
Sbjct  5     RYGYRDVLPFTAMVTMECINVGLNTLFKAATLK-GMSYHVFVVYAYAIAALVLLPAPFFS  63

Query  397   HRRDKAQEQlftfplllrlfflglIGVTISQNLAFVGLSYSSPIAACGTANIVPALSFIL  576
             HR          F +++++  LGLIG + SQ + F G++YSSP  A   +N+VPA +FIL
Sbjct  64    HRSRVLPP--LNFSIMIKMGLLGLIGCS-SQIMGFTGINYSSPTLASAISNLVPAFTFIL  120

Query  577   AIILRRTKIDWESGGSQARMIGALICTVGTISLIFYRGP--VVNNYSPTFLHLSTTQFVF  750
             AII R  K+   S  SQA+M+G ++   G      Y+GP  +   +S   LH    Q + 
Sbjct  121   AIIFRMEKLAVRSTSSQAKMLGTVVSITGAFVATLYQGPPIISTRFSTISLH---HQHLL  177

Query  751   SSSTNQQNWVLGCLCFIAASLTLSIWNIIQVGTIRIYPQVMKIMCVYSLFGTVQSGALSL  930
              + T + NWV+G L   A  + + +W I+Q   ++ YP  + ++  Y+L  ++ +  ++L
Sbjct  178   QNDT-KSNWVVGGLLLTAEYILVPLWYIVQTHIMKEYPNELSVVFFYNLSVSIMAAIVAL  236

Query  931   FIVRDLNAWRLGLNFQLIVILLTAIFGSIIRSSVQLWCMRMKGPSFPLIFKPVGIVVASS  1110
              +  D +AW+L  +  ++ ++ + +FGS + ++V  W +R+KGP +  +FKP+ I +A++
Sbjct  237   IMETDSSAWKLKSSIAIVSVVCSGVFGSFLNNTVHTWVLRVKGPVYVAMFKPLSIAIAAA  296

Query  1111  CGCLFFADTFHYGSMFSAFICGMGYYTTIWGQLKDE-EIQQIKGSSV-SLPDEKVPLLQQ  1284
              G +F  +T H GS+  A    +G+YT +WG+ K+E   +  +  S+ SLP  K PLLQ+
Sbjct  297   MGFIFLGETLHLGSLIGATTISIGFYTVMWGKAKEEINTEDSQAESMGSLPTHKTPLLQR  356

Query  1285  SQDDS  1299
              +D+ 
Sbjct  357   YKDEK  361



>ref|XP_008340346.1| PREDICTED: WAT1-related protein At4g15540-like [Malus domestica]
Length=380

 Score =   199 bits (507),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 120/371 (32%), Positives = 201/371 (54%), Gaps = 14/371 (4%)
 Frame = +1

Query  190   EKMLAAMEVKAAFGEVVPCMAMVMVEACTIFLTIMASTAMAKFGTNPFVFVVYTNALASI  369
             +KM    + K +    +P + MV+         ++   AM+K GTN ++ VVY NA++++
Sbjct  22    DKMSIEKKDKMSIEGFLPFIGMVIAMMVQTGSMVVNKAAMSK-GTNAYIIVVYANAVSAL  80

Query  370   FLVPYSIIYHRRDKAQEQlftfplllrlfflglIGVTISQNLAFVGLSYSSPIAACGTAN  549
              L+P ++I+HR     E+      +L   FL  +    SQ    +G+ YSSP  +    N
Sbjct  81    ILLPSALIFHR----SERPPLTFSILCKIFLLALFCCTSQIFGNIGIEYSSPTLSTAMLN  136

Query  550   IVPALSFILAIILRRTKIDWESGGSQARMIGALICTVGTISLIFYRG-PVVNNYSPTFLH  726
             ++PA +FILAII R  ++ W S  SQA+++G ++   G   + FY+G P++   S     
Sbjct  137   LIPAFTFILAIIFRMERVYWRSSSSQAKVLGTIVSITGAFVVTFYKGLPIIRLSSSL--A  194

Query  727   LSTTQFVFSSSTNQQNWVLGCLCFIAASLTLSIWNIIQVGTIRIYPQVMKIMCVYSLFGT  906
                 Q + SSS  + NW+LG     A +L+ S+W I+Q   ++ YP ++ I+    LF T
Sbjct  195   SLLNQLILSSS--KSNWILGGXFLAADALSTSLWYILQATIVKKYPAIVFIVFFQCLFAT  252

Query  907   VQSGALSLFIVRDLNAWRLGLNFQLIVILLTAIFGSIIRSSVQLWCMRMKGPSFPLIFKP  1086
             +QS A +L  VR  +AW + L+  +I IL T I  +++R S+  WC++  G  +  +FKP
Sbjct  253   MQSAAFTLIAVRGASAWEIRLDVGIIAILYTGIVSTVLRYSLVTWCVKKAGAFYCSMFKP  312

Query  1087  VGIVVASSCGCLFFADTFHYGSMFSAFICGMGYYTTIWGQLKDEEIQQIKGSSVSLPDEK  1266
             +GI+     G +F  D+ + GS+  A I   G+Y  +WG+ K+E++ +I+    SL   K
Sbjct  313   LGIIFGVIMGVIFLGDSVYLGSLVGAAIIVTGFYAMMWGKAKEEKLIEIE----SLDQNK  368

Query  1267  VPLLQQSQDDS  1299
             +PLLQ    + 
Sbjct  369   LPLLQNGLQEK  379



>ref|XP_004304594.1| PREDICTED: auxin-induced protein 5NG4-like [Fragaria vesca subsp. 
vesca]
Length=356

 Score =   199 bits (505),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 116/365 (32%), Positives = 201/365 (55%), Gaps = 11/365 (3%)
 Frame = +1

Query  208   MEVKAAFGEVVPCMAMVMVEACTIFLTIMASTAMAKFGTNPFVFVVYTNALASIFLVPYS  387
             M  ++ + +V+P  AMV +E+  + L  +   A  + G +  VFVVY+ ++A++ L+P  
Sbjct  1     MAGRSCYRDVLPFTAMVTMESTNVGLNTLFKAATNR-GMSYHVFVVYSYSIAALALLPAP  59

Query  388   IIYHRRDKAQEQlftfplllrlfflglIGVTISQNLAFVGLSYSSPIAACGTANIVPALS  567
              I HR  +       F ++ ++  LGLIG + SQ + + G+SYSSP  A   +N+VPA +
Sbjct  60    FISHRSRRLPP--LNFSIMSKILLLGLIGSS-SQIMGYTGISYSSPTLASAISNLVPAFT  116

Query  568   FILAIILRRTKIDWESGGSQARMIGALICTVGTISLIFYRGPVVNNYSPTFLHLSTTQFV  747
             FILAII R  ++  +S  SQA++IG ++   G   +  Y+GP ++          T   +
Sbjct  117   FILAIIFRLEEVALKSRSSQAKIIGTIVSLAGAFVVTLYKGPQIS------FTGQTQSLL  170

Query  748   FSSSTNQQNWVLGCLCFIAASLTLSIWNIIQVGTIRIYPQVMKIMCVYSLFGTVQSGALS  927
              +S  +  +WV+G L   A  + +++W I+Q   ++ YP  + ++  Y++  ++ +  + 
Sbjct  171   LNSPASNPDWVIGGLLITAEYILVTLWYIVQARIMKEYPNELTVIFFYNVIVSIVAAIVG  230

Query  928   LFIVRDLNAWRLGLNFQLIVILLTAIFGSIIRSSVQLWCMRMKGPSFPLIFKPVGIVVAS  1107
             L   RD NAWRL  +  L+ IL + +  S++ +SV  W +R+KGP +  +FKP+ I +A 
Sbjct  231   LITERDPNAWRLRPDMSLVSILCSGLLNSLLNNSVHTWTLRVKGPVYVTMFKPLSIAIAV  290

Query  1108  SCGCLFFADTFHYGSMFSAFICGMGYYTTIWGQLKDEEIQQIKGSSVSLP-DEKVPLLQQ  1284
               G  F  DT + GS+  A I  +G+YT +WG+ K+E        S+  P   K PLLQ 
Sbjct  291   VMGVTFLGDTLYLGSLLGAAIISVGFYTVLWGKAKEESGDDSGADSLESPSSNKAPLLQT  350

Query  1285  SQDDS  1299
              + ++
Sbjct  351   YKTEN  355



>ref|XP_010043799.1| PREDICTED: WAT1-related protein At5g40240-like [Eucalyptus grandis]
Length=358

 Score =   198 bits (504),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 118/353 (33%), Positives = 189/353 (54%), Gaps = 4/353 (1%)
 Frame = +1

Query  238   VPCMAMVMVEACTIFLTIMASTAMAKFGTNPFVFVVYTNALASIFLVPYSIIYHRRDKAQ  417
             +P +AM+MV        ++   AM+  G + ++ V Y + ++S+ L+P   I  RR  + 
Sbjct  9     LPFVAMIMVVLALASNMVVMKIAMSD-GISKYIMVFYCHVVSSLVLLPCPFIISRRSGSC  67

Query  418   EQlftfplllrlfflglIGVTISQNLAFVGLSYSSPIAACGTANIVPALSFILAIILRRT  597
               L    L         +G+ ++Q  A+ G+ YSSP+      N++PA +FILA+I R  
Sbjct  68    PPLTFTVLRKIFLLAL-VGL-VAQICAYAGIDYSSPVLGTAMMNLIPAFTFILAVISRME  125

Query  598   KIDWESGGSQARMIGALICTVGTISLIFYRGPVVNNYSPTFLHLSTTQFVFSSSTNQQNW  777
             K++W+S  S A+++G +   VG   +  Y+GP +    P   ++   Q +   S  Q NW
Sbjct  126   KVNWKSSSSHAKLVGTIASIVGASVVTLYKGPPILRSPPPLPYVQPRQLLLILS-RQSNW  184

Query  778   VLGCLCFIAASLTLSIWNIIQVGTIRIYPQVMKIMCVYSLFGTVQSGALSLFIVRDLNAW  957
             +LG     A +  LS+W IIQ   ++ YP V+ IM    LFGT+ +G LS   VR+  +W
Sbjct  185   ILGGFLLTADAFLLSLWYIIQTSILKDYPVVLNIMFYKVLFGTILAGLLSFITVREPRSW  244

Query  958   RLGLNFQLIVILLTAIFGSIIRSSVQLWCMRMKGPSFPLIFKPVGIVVASSCGCLFFADT  1137
              L L+  LI IL +A+  SI   ++  WC++  GP +  +FKP GIV A   G +F  +T
Sbjct  245   ILKLDRGLIAILYSAVVVSIFSLTLCTWCLKRTGPVYVAMFKPFGIVFAVGLGFIFLGET  304

Query  1138  FHYGSMFSAFICGMGYYTTIWGQLKDEEIQQIKGSSVSLPDEKVPLLQQSQDD  1296
              H GS+  A +  MG+Y  +WG+ K+EE +  +G S++    K+PLLQ     
Sbjct  305   LHLGSLIGAMVIAMGFYGVVWGKSKEEEERTTEGGSLASSSHKIPLLQNKASS  357



>ref|XP_008221765.1| PREDICTED: WAT1-related protein At5g40240-like [Prunus mume]
Length=350

 Score =   198 bits (504),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 122/354 (34%), Positives = 199/354 (56%), Gaps = 12/354 (3%)
 Frame = +1

Query  238   VPCMAMVMVEACTIFLTIMASTAMAKFGTNPFVFVVYTNALASIFLVPYSIIYHRRDKAQ  417
             +P + M+M E     + I++  AM+  G +  +FV Y+NALAS+ L+P S+ +HR     
Sbjct  7     LPIVGMMMTECAGAGVIILSKAAMST-GMSNLIFVFYSNALASLILLPTSLAFHR----S  61

Query  418   EQlftfplllrlfflglIGVTISQNLAFVGLSYSSPIAACGTANIVPALSFILAIILRRT  597
                 TF +L   F LGLIG  ++Q + + G++YSSP       N++PA +FILA+I R  
Sbjct  62    RPPLTFSVLCWFFLLGLIGF-VAQFVGYAGINYSSPTLGTAMLNLLPAFTFILAVIFRME  120

Query  598   KIDWESGGSQARMIGALICTVGTISLIFYRGPVVNNYSPTFLHLSTTQFVFSSSTNQQNW  777
              +DW S  + A+ +GA++   G   +  Y+GP +   S T + LS  Q      + Q NW
Sbjct  121   TVDWRSSSTLAKSLGAMLSISGAFIVTLYKGPALLLTSSTDI-LSHKQLF----SQQSNW  175

Query  778   VLGCLCFIAASLTLSIWNIIQVGTIRIYPQVMKIMCVYSLFGTVQSGALSLFIVRDLNAW  957
             V+G +  +   +  S   IIQ   I+ YP  + ++  Y  F  +Q+  +SL +  DL+AW
Sbjct  176   VIGGILLLVYCVLASSSYIIQASVIKKYPAELIMVFYYCFFVAIQAVVVSLIVETDLSAW  235

Query  958   RLGLNFQLIVILLTAIFGSIIRSSVQLWCMRMKGPSFPLIFKPVGIVVASSCGCLFFADT  1137
              L    +LI ++ +A+FGS     V  WC+   GP F  +FKP+GI+VA S G  F  DT
Sbjct  236   SLKPKMRLIAVVYSAVFGSTFTIGVTTWCLHRAGPVFIAMFKPLGIIVAVSIGVTFVGDT  295

Query  1138  FHYGSMFSAFICGMGYYTTIWGQLKDEEIQ-QIKGSSVSLPDEKVPLLQQSQDD  1296
             F+ GS+  A +  +G+Y+ +WG+  +E++    +  S++  +++VPLLQ + D+
Sbjct  296   FYLGSLVGAIVIVIGFYSVMWGKANEEKMDGGAETKSLATSNQRVPLLQNTLDE  349



>ref|XP_008389607.1| PREDICTED: WAT1-related protein At5g40240-like [Malus domestica]
Length=354

 Score =   198 bits (504),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 116/356 (33%), Positives = 200/356 (56%), Gaps = 12/356 (3%)
 Frame = +1

Query  238   VPCMAMVMVEACTIFLTIMASTAMAKFGTNPFVFVVYTNALASIFLVPYSIIYHRRDKAQ  417
             +P + MV+ E     L I++  AM+  G +  +F+ Y+NALA++ L+P S+++HR ++  
Sbjct  7     LPIVGMVLAECAQAGLIIISKIAMSN-GMSNLIFLCYSNALAALILLPISLVFHRSERPP  65

Query  418   EQlftfplllrlfflglIGVTISQNLAFVGLSYSSPIAACGTANIVPALSFILAIILRRT  597
                 T  ++   F LGLIG  ++Q L + G+++SSP  +    N++PA +F+LA+I R  
Sbjct  66    ---LTISIIGWFFLLGLIGF-MAQFLGYAGINFSSPTLSTAMLNLIPAFTFVLAVIFRME  121

Query  598   KIDWESGGSQARMIGALICTVGTISLIFYRGPVVNNYSPTFLH--LSTTQFVFSSSTNQQ  771
             +ID  S  S A+ +G ++   G   +  Y+GP +   S + +   LS  Q +    + + 
Sbjct  122   RIDMRSFSSLAKTVGTIVSISGAFIVTLYKGPPILKTSSSVMTDVLSHKQLI----SERS  177

Query  772   NWVLGCLCFIAASLTLSIWNIIQVGTIRIYPQVMKIMCVYSLFGTVQSGALSLFIVRDLN  951
             NWVLG +C  A  +  S W I+Q   ++ Y   + ++  Y  F  +QS  +S  + RDL 
Sbjct  178   NWVLGGVCVAANCVLASAWIIVQASVLKKYRAELIMVFYYCFFVAIQSVVVSSILERDLR  237

Query  952   AWRLGLNFQLIVILLTAIFGSIIRSSVQLWCMRMKGPSFPLIFKPVGIVVASSCGCLFFA  1131
             +W L    + I +L +A+FGS  +  V  WC+R  GP F  +FKP+GI+V    G  F  
Sbjct  238   SWELTPKIRWIAVLYSAVFGSAFQVGVSTWCLRRTGPVFVAMFKPLGIIVTVFIGVTFLG  297

Query  1132  DTFHYGSMFSAFICGMGYYTTIWGQLKDEEIQQIKG-SSVSLPDEKVPLLQQSQDD  1296
             DTF+ GS+  A +  +G+Y+ +WG+  +E++ +  G  S++   ++VPLLQ   ++
Sbjct  298   DTFYLGSLIGAIVIVIGFYSVMWGKANEEKMDEDAGEESLASIKQQVPLLQSHIEE  353



>ref|XP_002266139.1| PREDICTED: WAT1-related protein At5g40240 [Vitis vinifera]
 emb|CBI32108.3| unnamed protein product [Vitis vinifera]
Length=346

 Score =   198 bits (503),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 130/354 (37%), Positives = 197/354 (56%), Gaps = 17/354 (5%)
 Frame = +1

Query  238   VPCMAMVMVEACTIFLTIMASTAMAKFGTNPFVFVVYTNALASIFLVPYSIIYHRRDKAQ  417
             +P + MV+V    +   I++  AM+  G + FV V+Y+NA++++ L+P S+++HR  +  
Sbjct  9     LPFLGMVIVVFTQVTNMIVSKMAMSN-GLSSFVLVLYSNAISAVILLPLSLLFHRSPRPP  67

Query  418   EQlftfplllrlfflglIGVTISQNLAFVGLSYSSPIAACGTANIVPALSFILAIILRRT  597
                 TF +L R F L LIG   +Q   + G+ YSSP       N+VPA +FILA+I R  
Sbjct  68    ---LTFSILCRFFLLALIG-CFAQIFGYAGVQYSSPTLGSAMLNLVPAFTFILAVICRME  123

Query  598   KIDWESGGSQARMIGALICTVGTISLIFYRGPVVNNYSPTFLHLSTTQFVFSSSTNQQNW  777
             K++ +   S A+ +GAL+   G   + FY+GP +   S      +    +FSS   Q +W
Sbjct  124   KLELKKSSSLAKSVGALVSVAGAFVVTFYKGPPIMFSSSFSDSSNQ---IFSS---QSHW  177

Query  778   VLGCLCFIAASLTLSIWNIIQVGTIRIYPQVMKIMCVYSLFGTVQSGALSLFIVRDLNAW  957
             VLG       SL  S+W I+Q   ++ +P V+ I   Y  F ++ S A+SL   RD +AW
Sbjct  178   VLGGFLLADESLLASMWYILQATILKKHPAVLTITFFYCFFISIISLAISLVAERDPSAW  237

Query  958   RLGLNFQLIVILLTAIFGSIIRSSVQLWCMRMKGPSFPLIFKPVGIVVASSCGCLFFADT  1137
             RL L+  L+ +L +AI G++IR S+  WC+R  GP F  +FKP+GIV A   G +F  D 
Sbjct  238   RLKLDVGLLAVLYSAIVGNVIRISMCTWCVRRAGPLFCSMFKPLGIVFAFVMGVIFSGDA  297

Query  1138  FHYGSMFSAFICGMGYYTTIWGQLKDEEIQQIKGSSVSLPDEKVPLLQQSQDDS  1299
              H GS+  A I   G+Y  +WG+ K+ E  +++ S       KVPLLQ   D S
Sbjct  298   LHLGSLVGAIIIVTGFYAVMWGKAKEAEEGRLECS------RKVPLLQNQTDVS  345



>ref|XP_008341732.1| PREDICTED: WAT1-related protein At5g40240-like [Malus domestica]
Length=383

 Score =   199 bits (505),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 121/355 (34%), Positives = 195/355 (55%), Gaps = 11/355 (3%)
 Frame = +1

Query  238   VPCMAMVMVEACTIFLTIMASTAMAKFGTNPFVFVVYTNALASIFLVPYSIIYHRRDKAQ  417
             VP  AMV+VE   + ++ ++  AM+K G + FVF+VY NAL ++ L+P+  I+ R  +A 
Sbjct  11    VPFTAMVIVECAEVGVSTLSKVAMSK-GMSKFVFIVYYNALGTLLLLPF-FIFQRNRRAP  68

Query  418   EQlftfplllrlfflglIGVTISQNLAFVGLSYSSPIAACGTANIVPALSFILAIILRRT  597
                        L  +G  G    + L F G+  SS + A   AN+ P  +F+LA+I R  
Sbjct  69    LTFRLICQFFLLGLIGSAG----KILFFAGVKNSSALLASAMANLTPIFTFLLALIFRME  124

Query  598   KIDWESGGSQARMIGALICTVGTISLIFYRGPVVNNYSPTFLHLSTTQFVFSSSTNQQNW  777
             K+D     S A+ +GA+I   G + +  Y GP + N S +     +T   F S ++   W
Sbjct  125   KLDLRKATSYAKSLGAIISVGGALVVTLYNGPALLNSSSSSGSSHSTHRSFVSQSS--TW  182

Query  778   VLGCLCFIAASLTLSIWNIIQVGTIRIYPQVMKIMCVYSLFGTVQSGALSLFIVRD-LNA  954
             + G L      L  S WNI Q  T++ YP+ M I+  Y++F T+Q   +SL + R+ LNA
Sbjct  183   IFGGLLLAIQCLVASGWNIAQAATVKDYPEEMTIVFFYTMFLTIQCTVISLIVERNNLNA  242

Query  955   WRLGLNFQLIVILLTAIFGSIIRSSVQLWCMRMKGPSFPLIFKPVGIVVASSCGCLFFAD  1134
             W+L L  ++I I+  AI  S+ R SV +WC+  KGP +  +F P+GI +A+    +F  D
Sbjct  243   WKLELPIEIITIVYAAICVSVFRISVHVWCLHKKGPVYVAMFSPLGIAIAAVLVVVFLGD  302

Query  1135  TFHYGSMFSAFICGMGYYTTIWGQLKDEEIQQIKGSSVSLP--DEKVPLLQQSQD  1293
             TF+ GS+  + +  +G+YT I+ ++K++ +   +G  +S P  DE   LL+ + D
Sbjct  303   TFYLGSLIGSIVISVGFYTVIYAKMKEKAMADDEGVQLSKPADDEGAQLLKPADD  357



>ref|XP_004304597.1| PREDICTED: auxin-induced protein 5NG4-like [Fragaria vesca subsp. 
vesca]
Length=356

 Score =   198 bits (503),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 117/367 (32%), Positives = 191/367 (52%), Gaps = 20/367 (5%)
 Frame = +1

Query  208   MEVKAAFGEVVPCMAMVMVEACTIFLTIMASTAMAKFGTNPFVFVVYTNALASIFLVPYS  387
             M V++     VP  AMV+VE   I ++ ++  AM+K G + FVF+VY NAL ++ L PY 
Sbjct  1     MAVESRIWGAVPFAAMVLVEIAEIGVSTISKAAMSK-GMSHFVFIVYYNALGTLLLFPY-  58

Query  388   IIYHRRDKAQEQlftfplllrlfflglIGVTISQNLAFVGLSYSSPIAACGTANIVPALS  567
              I+ R  +A            L  +G  G    + L F G+ YSSP  +   AN+ P  +
Sbjct  59    FIFQRNKRAPLSFKLIYRFFLLGLIGSSG----KILFFAGVKYSSPTLSAALANLTPIFT  114

Query  568   FILAIILRRTKIDWESGGSQARMIGALICTVGTISLIFYRGPVVNNYSPTFLHLSTTQFV  747
             F+LA+I R  K++      QA+ +G +I   G + + FY+GP V   S            
Sbjct  115   FLLAVIFRMEKLNLRQTSGQAKSLGTIISVGGALIVTFYKGPAVLMASLKHAGFKNQHI-  173

Query  748   FSSSTNQQNWVLGCLCFIAASLTLSIWNIIQVGTIRIYPQVMKIMCVYSLFGTVQSGALS  927
                 +    WV G L      +  S WNI Q  T++ YP+ M I+  Y+LF T+Q   +S
Sbjct  174   ---HSQHSAWVFGGLLLAIQCVVSSSWNIAQAATVKDYPEKMTIVFFYTLFLTIQCSVIS  230

Query  928   LFIV-RDLNAWRLGLNFQLIVILLTAIFGSIIRSSVQLWCMRMKGPSFPLIFKPVGIVVA  1104
             LF+  ++ +AW+L    +++ I+  AIF S+ R  V +WC+  KGP +  +FKP+GI +A
Sbjct  231   LFVEWKNPSAWKLEPGIEMVAIVYAAIFVSVFRIGVHVWCLHKKGPVYVAMFKPLGIAIA  290

Query  1105  SSCGCLFFADTFHYGSMFSAFICGMGYYTTIWGQLKDEEIQQIKGSSVSLPDEKVPLLQQ  1284
              +   +F  DT + GS+  + +  +G+YT IW Q+K+++         ++PD ++   + 
Sbjct  291   VAMVVIFLGDTLYLGSVIGSVVISLGFYTVIWAQIKEKK---------AVPDNEIQRSES  341

Query  1285  SQDDSPV  1305
             S   +P+
Sbjct  342   SIQRAPL  348



>ref|XP_006483801.1| PREDICTED: WAT1-related protein At3g28050-like isoform X2 [Citrus 
sinensis]
Length=349

 Score =   197 bits (502),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 121/356 (34%), Positives = 193/356 (54%), Gaps = 16/356 (4%)
 Frame = +1

Query  235   VVPCMAMVMVEACTIFLTIMASTAMAKFGTNPFVFVVYTNALASIFLVPYSIIYHRRDKA  414
             + P + MVM E   + L      AM+  G +  VFV Y+ A AS+ L+P S+++HR   +
Sbjct  6     LAPVIGMVMAECAQVGLMFAGKAAMSD-GMSNLVFVFYSKAFASLVLLPASLLFHR---S  61

Query  415   QEQlftfplllrlfflglIGVTISQNLAFVGLSYSSPIAACGTANIVPALSFILAIILRR  594
             +    T P+L   F LG +G T SQ     G+ YSSP  +    N+VP  +FILAII R 
Sbjct  62    RIPPLTLPILSAFFLLGFLG-TSSQFFGNAGIYYSSPTLSTAMLNLVPGFTFILAIIFRM  120

Query  595   TKIDWESGGSQARMIGALICTVGTISLIFYRGP--VVNNYSPTFLHLSTTQFVFSSSTNQ  768
              K+DW S  S A+ +G ++   G   + +Y+G   ++ +  P   +LS   FV      Q
Sbjct  121   EKLDWRSSSSLAKSVGTIVLITGAFIMTYYKGTHLLMTSLPP---NLSLQFFV-----PQ  172

Query  769   QNWVLGCLCFIAASLTLSIWNIIQVGTIRIYPQVMKIMCVYSLFGTVQSGALSLFIVRDL  948
              NWV+G L      +  S W I+Q   ++ +     ++  Y  F  +QS    L + RDL
Sbjct  173   TNWVVGGLLLAVDCVFTSAWLIVQASILKKFSAEFIVVFFYCFFVAIQSAIFCLVMERDL  232

Query  949   NAWRLGLNFQLIVILLTAIFGSIIRSSVQLWCMRMKGPSFPLIFKPVGIVVASSCGCLFF  1128
             ++W L    +L+ +L +A+FGS  +  V  WC+   GP F  +FKP+G++++++ G +F 
Sbjct  233   SSWSLKPGVRLVAVLYSAVFGSAFQVGVCTWCLHRTGPVFVAMFKPLGVIISAAVGTIFL  292

Query  1129  ADTFHYGSMFSAFICGMGYYTTIWGQLKDEE-IQQIKGSSVSLPDEKVPLLQQSQD  1293
              +T + GS+  A I GMGYYT  WG ++++E +++   S  +  D+KVPLLQ+   
Sbjct  293   GETVYLGSVIGAVITGMGYYTVTWGNIREDELLRKGHNSKDAADDQKVPLLQEDSQ  348



>ref|XP_007224712.1| hypothetical protein PRUPE_ppa025053mg [Prunus persica]
 gb|EMJ25911.1| hypothetical protein PRUPE_ppa025053mg [Prunus persica]
Length=350

 Score =   197 bits (501),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 124/357 (35%), Positives = 193/357 (54%), Gaps = 17/357 (5%)
 Frame = +1

Query  232   EVVPCMAMVMVEACTIFLTIMASTAMAKFGTNPFVFVVYTNALASIFLVPYSIIYHRRDK  411
              ++P + MVM         I+   AM+K G+N ++ VVY N L+++ L+P ++ +H R  
Sbjct  3     SILPFLGMVMAILAQAANMIVNKAAMSK-GSNKYIMVVYANGLSTLILLPPALFFHYR--  59

Query  412   AQEQlftfplllrlfflglIGVTISQNLAFVGLSYSSPIAACGTANIVPALSFILAIILR  591
             +     TF +L R F L L G+       +VG+ YSS        N++PA +F LAII R
Sbjct  60    SGRPPLTFSILCRFFMLALFGLI----FGYVGIEYSSATLGTAMLNLIPAFTFTLAIIFR  115

Query  592   RTKIDWESGGSQARMIGALICTVGTISLIFYRG-PVVNNYSPTFLHLSTTQFVFSSSTNQ  768
               K+ W S  S+A+++G      G   + FY+G P++       L  S    +FSS   +
Sbjct  116   MEKVQWRSSSSKAKILGTTASIAGAFVVTFYKGQPIM------LLPSSHPPNLFSS---K  166

Query  769   QNWVLGCLCFIAASLTLSIWNIIQVGTIRIYPQVMKIMCVYSLFGTVQSGALSLFIVRDL  948
              NWVLG L   A S + S+W I+Q  T++ YP V+ I+C  SLF T+QS   +L  V+D 
Sbjct  167   SNWVLGGLFLAADSFSSSLWYILQASTLKKYPAVVVIVCFQSLFTTIQSALFTLIAVKDA  226

Query  949   NAWRLGLNFQLIVILLTAIFGSIIRSSVQLWCMRMKGPSFPLIFKPVGIVVASSCGCLFF  1128
             +AW L L+  LI +L TAI   ++R ++  WC+   G  F  +FKP+GI+     G +F 
Sbjct  227   SAWELRLDMGLIAVLYTAIVSIVLRYTLTTWCVWKAGALFCSMFKPLGIIFGVIMGAIFL  286

Query  1129  ADTFHYGSMFSAFICGMGYYTTIWGQLKDEEIQQIKGSSVSLPDEKVPLLQQSQDDS  1299
              D F++GS+  A +   G+Y  +WG+ K+E++ +      SL    VPLLQ +  + 
Sbjct  287   GDPFYFGSLVGALMIVTGFYAVMWGKAKEEKLVEGGSRWESLGQNNVPLLQNNIQEK  343



>ref|XP_006338541.1| PREDICTED: WAT1-related protein At5g40240-like [Solanum tuberosum]
Length=352

 Score =   197 bits (501),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 115/329 (35%), Positives = 188/329 (57%), Gaps = 9/329 (3%)
 Frame = +1

Query  232   EVVPCMAMVMVEACTIFLTIMASTAMAKFGTNPFVFVVYTNALASIFLVPYSIIYHRRDK  411
             + +P +AMVMVE C + +  +   AM   G N  V+VVY NAL ++FL+P  +I+HR  +
Sbjct  6     DFLPFLAMVMVECCEMLMITLGKAAMND-GLNNLVYVVYYNALGTLFLLP-CLIFHRL-R  62

Query  412   AQEQlftfplllrlfflglIGVTISQNLAFVGLSYSSPIAACGTANIVPALSFILAIILR  591
             +     T P+L R F LGL+G+ + Q +AF G+ YS+P  A    N++P  +F+LAII R
Sbjct  63    SNMVPITLPILWRFFLLGLLGICLVQAVAFTGIKYSTPTLAAALGNLMPGFTFLLAIIFR  122

Query  592   RTKIDWESGGSQARMIGALICTVGTISLIFYRGP-VVNNYSPTFLHLSTTQFVFSSSTNQ  768
               K+D     SQA+ +G ++  +G   +  Y+GP V+ +  P+    S  + V      +
Sbjct  123   MEKLDIRKASSQAKSVGTIVAIIGASIMTLYKGPRVLGSNLPS--DSSHHELVLP---QE  177

Query  769   QNWVLGCLCFIAASLTLSIWNIIQVGTIRIYPQVMKIMCVYSLFGTVQSGALSLFIVRDL  948
              NW+LG L      +  S WNI+Q  T++ YP+ M I+     FG++Q   L+L +  + 
Sbjct  178   SNWILGGLLITTTCIMSSGWNILQTDTVKKYPEHMTIVFFTCFFGSIQCAILTLALESNP  237

Query  949   NAWRLGLNFQLIVILLTAIFGSIIRSSVQLWCMRMKGPSFPLIFKPVGIVVASSCGCLFF  1128
               W +     +I I+ +A+ G++ R +V  WC+  KGP +  +FKP+G+V+++  G +F 
Sbjct  238   KTWMVKPGIGMIAIVFSAVSGNVFRYNVLTWCLDKKGPLYVAMFKPLGMVISAILGIIFL  297

Query  1129  ADTFHYGSMFSAFICGMGYYTTIWGQLKD  1215
             AD  H GS+  A I   G+Y+ +WG+ K+
Sbjct  298   ADPLHLGSVIGAVIISAGFYSVLWGKAKE  326



>ref|XP_008353406.1| PREDICTED: WAT1-related protein At5g40240-like [Malus domestica]
Length=383

 Score =   197 bits (502),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 120/355 (34%), Positives = 195/355 (55%), Gaps = 10/355 (3%)
 Frame = +1

Query  238   VPCMAMVMVEACTIFLTIMASTAMAKFGTNPFVFVVYTNALASIFLVPYSIIYHRRDKAQ  417
             VP  AMV+VE   + ++ ++  AM+K G + FVF+VY NAL ++ L+P+  I+ R  +A 
Sbjct  11    VPFTAMVIVECAEVGVSTLSKVAMSK-GMSKFVFIVYYNALGTLLLLPF-FIFQRNRRAP  68

Query  418   EQlftfplllrlfflglIGVTISQNLAFVGLSYSSPIAACGTANIVPALSFILAIILRRT  597
                        L  +G  G    + L F G+  SS + A   AN+ P  +F+LA+I R  
Sbjct  69    LTFRLICQFFLLGLIGSAG----KILFFAGVKNSSALLASAMANLTPIFTFLLALIFRME  124

Query  598   KIDWESGGSQARMIGALICTVGTISLIFYRGPVVNNYSPTFLHLSTTQFVFSSSTNQQNW  777
             K+D     S A+ +GA+I   G + +  Y GP + N S +     +T   F S ++   W
Sbjct  125   KLDLRKATSYAKSLGAIISVGGALVVTLYNGPALLNSSSSSGSSHSTHRSFVSQSS--TW  182

Query  778   VLGCLCFIAASLTLSIWNIIQVGTIRIYPQVMKIMCVYSLFGTVQSGALSLFIVRD-LNA  954
             + G L      L  S WNI Q  T++ YP+ M I+  Y++F T+Q   +SL + R+ LNA
Sbjct  183   IFGGLLLAIQCLVASGWNIAQAATVKDYPEEMTIVFFYTMFLTIQCTVISLIVERNNLNA  242

Query  955   WRLGLNFQLIVILLTAIFGSIIRSSVQLWCMRMKGPSFPLIFKPVGIVVASSCGCLFFAD  1134
             W+L L  ++I I+  AI  S+ R SV +WC+  KGP +  +F P+GI +A+    +F  D
Sbjct  243   WKLELPIEIITIVYAAICVSVFRISVHVWCLHKKGPVYVAMFSPLGIAIAAVLVVVFLGD  302

Query  1135  TFHYGSMFSAFICGMGYYTTIWGQLKDEEIQQIKGSSVSLP-DEKVPLLQQSQDD  1296
             TF+ GS+  + +  +G+YT I+ ++K++ +   +G  +S P D++   L +  DD
Sbjct  303   TFYLGSLIGSIVISVGFYTVIYAKMKEKAMADDEGVQLSKPADDEGAQLSKPADD  357



>ref|XP_002266096.1| PREDICTED: WAT1-related protein At5g40240 [Vitis vinifera]
 emb|CBI32110.3| unnamed protein product [Vitis vinifera]
Length=351

 Score =   197 bits (500),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 113/349 (32%), Positives = 185/349 (53%), Gaps = 10/349 (3%)
 Frame = +1

Query  253   MVMVEACTIFLTIMASTAMAKFGTNPFVFVVYTNALASIFLVPYSIIYHRRDKAQEQlft  432
             ++ +E   + L  ++  AM + G + +VFVVY+NALA   L   S+++HRR        +
Sbjct  11    LLTIECLDVGLITLSKAAMRR-GMSDYVFVVYSNALAVPVLFLCSLLFHRRRSPPPLTPS  69

Query  433   fplllrlfflglIGVTISQNLAFVGLSYSSPIAACGTANIVPALSFILAIILRRTKIDWE  612
                 + L  L    +   Q L F+G+ YSSP  A    N++PA +++LAI+ R  K+D +
Sbjct  70    ILCRIFLLGLVSCSL---QMLKFIGIGYSSPTLASAMTNLIPAFTYVLAIVTRMEKLDLK  126

Query  613   SGGSQARMIGALICTVGTISLIFYRGPVVNNYSPTFLHLSTTQFVFSSSTNQQNWVLGCL  792
                S+A+ +G L+   G + +  Y+GP +   S T   L+    +      + NW++G  
Sbjct  127   VKSSRAKCLGTLVSVAGALLITIYKGPGIEFASTTPSMLNHNLLL-----PRSNWIIGGF  181

Query  793   CFIAASLTLSIWNIIQVGTIRIYPQVMKIMCVYSLFGTVQSGALSLFIVRDLNAWRLGLN  972
                AA+  +++  + Q   IR YP  + +  +  +F T+QS  +SL   RD +AWRL L+
Sbjct  182   LTAAAAFMVAVLLVFQTSIIRDYPAELIVTLISHIFATMQSSLVSLIAERDPSAWRLRLD  241

Query  973   FQLIVILLTAIFGSIIRSSVQLWCMRMKGPSFPLIFKPVGIVVASSCGCLFFADTFHYGS  1152
              +LI +  + IF   +R +V  W +  KGP F  +FKP GIV+A   G  F  D  H GS
Sbjct  242   MELIAVGYSGIFVVALRGAVYAWVLHQKGPVFVAMFKPAGIVIAVIMGVTFLGDKLHLGS  301

Query  1153  MFSAFICGMGYYTTIWGQLKDEEI-QQIKGSSVSLPDEKVPLLQQSQDD  1296
             +  A I  +G+YT +WG+ K+E++ + I    V+    +VPLLQ    +
Sbjct  302   VIGAAIIALGFYTVVWGKAKEEKMAEDIAACGVNTSSHRVPLLQNKSTE  350



>gb|KHN01750.1| Auxin-induced protein 5NG4 [Glycine soja]
Length=371

 Score =   196 bits (499),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 117/360 (33%), Positives = 206/360 (57%), Gaps = 7/360 (2%)
 Frame = +1

Query  226   FGEVVPCMAMVMVEACTIFLTIMASTAMAKFGTNPFVFVVYTNALASIFLVPYSIIYHRR  405
             + ++VP  AMV +E   + L  +   A  + G +  VFVVY  A+A+I L+P   I  R 
Sbjct  8     YKDLVPFGAMVTMECLNVALNTLFKAATLR-GMSYHVFVVYAYAVAAIVLIPGPFISQRC  66

Query  406   DKAQEQlftfplllrlfflglIGVTISQNLAFVGLSYSSPIAACGTANIVPALSFILAII  585
                     +FPLL ++  LGLIG   SQ + + G+S+SSP  +   +N+VPA +F+LAII
Sbjct  67    RSRVLPPLSFPLLRKIGLLGLIGCA-SQIVGYTGISFSSPTLSSAISNLVPAFTFLLAII  125

Query  586   LRRTKIDWESGGSQARMIGALICTVGTISLIFYRGP-VVNNYSPTFLHLSTTQFVFSSST  762
              R  K+   +   QA+++G ++   G   + FY+GP ++  ++P+   LS  Q + + ++
Sbjct  126   FRMEKVIVRNTTCQAKVLGTIVSITGAFVVTFYKGPPIIIVHTPS---LSLHQPINTLNS  182

Query  763   NQQNWVLGCLCFIAASLTLSIWNIIQVGTIRIYPQVMKIMCVYSLFGTVQSGALSLFIVR  942
               ++W +G L   A  + + +W I+QV  +++YP  + ++  Y+L  T+ +  +++F   
Sbjct  183   VDRSWAIGGLLLTAEYILVPLWYIVQVQIMKVYPNELTVIFFYNLCVTIMAAIVAIFTET  242

Query  943   DLNAWRLGLNFQLIVILLTAIFGSIIRSSVQLWCMRMKGPSFPLIFKPVGIVVASSCGCL  1122
             +  AW++GL+  L  I+ + IFGS + ++V  W +R+KGP +  +FKP+ I +A + G +
Sbjct  243   NAGAWKIGLDTALASIVCSGIFGSFVNNAVHTWVLRIKGPVYVAMFKPLSIAIAVALGVM  302

Query  1123  FFADTFHYGSMFSAFICGMGYYTTIWGQLKDEEI-QQIKGSSVSLPDEKVPLLQQSQDDS  1299
             F  DT H GS+  A +  +G+YT +WG+  +E + + + G       E VPLLQ  + D+
Sbjct  303   FLGDTLHLGSLVGATVISIGFYTVMWGKATEENVDEDVPGQQSPPTTENVPLLQSYKTDT  362



>ref|XP_007044594.1| Nodulin MtN21 /EamA-like transporter family protein isoform 2 
[Theobroma cacao]
 ref|XP_007044596.1| Nodulin MtN21 /EamA-like transporter family protein isoform 2 
[Theobroma cacao]
 gb|EOY00426.1| Nodulin MtN21 /EamA-like transporter family protein isoform 2 
[Theobroma cacao]
 gb|EOY00428.1| Nodulin MtN21 /EamA-like transporter family protein isoform 2 
[Theobroma cacao]
Length=350

 Score =   196 bits (498),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 114/357 (32%), Positives = 189/357 (53%), Gaps = 16/357 (4%)
 Frame = +1

Query  238   VPCMAMVMVEACTIFLTIMASTAMAKFGTNPFVFVVYTNALASIFLVPYSIIYHRRDKAQ  417
             +P + MV+ E   + L IM   AM+  G + FVFV Y+NALAS+ L+P S ++HR ++  
Sbjct  7     LPLVGMVLAECAQVGLMIMGKAAMSH-GMSNFVFVFYSNALASLILLPSSFLFHRSERPP  65

Query  418   EQlftfplllrlfflglIGVT--ISQNLAFVGLSYSSPIAACGTANIVPALSFILAIILR  591
                        L +  L+G+    +Q   + G+ YSSP       N++P L+F+ A+  R
Sbjct  66    ------LTFSILCWFFLLGLLGCFAQIFGYAGIYYSSPTLGTAMLNLIPGLTFLFAVAFR  119

Query  592   RTKIDWESGGSQARMIGALICTVGTISLIFYRGPVVNNYSPTFLHLSTTQFVFSSSTNQQ  771
               K+   S  SQA+ +G ++   G   + FY+GP +     +    S+ QF+      Q 
Sbjct  120   MEKLHLGSSSSQAKSLGTIVSIAGAFVVTFYKGPSI--LMSSSRASSSHQFLL----QQS  173

Query  772   NWVLGCLCFIAASLTLSIWNIIQVGTIRIYPQVMKIMCVYSLFGTVQSGALSLFIVRDLN  951
             NWV G     A  L  S W I+Q   ++ +P  + ++  Y  F T+QS  + L + RDL+
Sbjct  174   NWVFGGFLLAADCLFASAWLIVQASVLKKFPAELIVVFYYCFFVTLQSAIVCLVMERDLS  233

Query  952   AWRLGLNFQLIVILLTAIFGSIIRSSVQLWCMRMKGPSFPLIFKPVGIVVASSCGCLFFA  1131
             +W    + +L+ +L +A+FGS  +  V  WC+   GP F  +FKP+GIV++   G +F  
Sbjct  234   SWSFKPDVRLVAVLYSAVFGSAFQLGVSTWCLHRTGPVFVAMFKPLGIVISVIMGVIFLG  293

Query  1132  DTFHYGSMFSAFICGMGYYTTIWGQLKDEEIQ-QIKGSSVSLPDEKVPLLQQSQDDS  1299
             DTF+ GS+  A +   G+Y+ +WG+ K+ +I    +G  +    +KVPLL  +  ++
Sbjct  294   DTFYLGSLLGAIVIVAGFYSVMWGKAKEGKIDVYAQGMRLESSSQKVPLLPNNTGET  350



>ref|XP_002517371.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF44913.1| conserved hypothetical protein [Ricinus communis]
Length=358

 Score =   196 bits (497),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 124/367 (34%), Positives = 204/367 (56%), Gaps = 12/367 (3%)
 Frame = +1

Query  208   MEVKAAFGEVVPCMAMVMVEACTIFLTIMASTAMAKFGTNPFVFVVYTNALASIFLVPYS  387
             ME+ +    +VP  AM+ VE   + ++ ++  A+AK G + +V VVY NALA++ L+PY 
Sbjct  1     MELTSWLWNLVPFAAMIAVECTDVGVSTISKAALAK-GMSKYVSVVYYNALATLILLPY-  58

Query  388   IIYHRRDKAQEQlftfplllrlfflglIGVTISQNLAFVGLSYSSPIAACGTANIVPALS  567
              I+HRR +A     T  LL R F LGLIG T  Q L    +  SSP  +   AN++P  +
Sbjct  59    FIFHRRKQAP---VTHSLLFRFFLLGLIGST-GQILFLAAVKLSSPTLSSALANLIPIFT  114

Query  568   FILAIILRRTKIDWESGGSQARMIGALICTVGTISLIFYRGPVVNNYSPTFLHLSTTQFV  747
             F+LA+I R   +D     SQA+ +GA++   G   +  Y+GP V   + T       Q +
Sbjct  115   FLLAVITRMETLDIRRSSSQAKSLGAIVSVAGAFVVTLYKGPAVLMTTQTSNFHHHHQLL  174

Query  748   FSSSTNQQNWVLGCLCFIAASLTLSIWNIIQVGTIRIYPQVMKIMCVYSLFGTVQSGALS  927
             FS    +  W+ G    +   L  + WN+ Q  T++ Y + M I+  ++ F T+QS   S
Sbjct  175   FS---QKPEWIFGGFLLLIVCLLSATWNVAQGATVKEYQEPMTIVFFFTFFITIQSAVFS  231

Query  928   LFIVRDLNAWRLGLNFQLIVILLTAIFGSIIRSSVQLWCMRMKGPSFPLIFKPVGIVVAS  1107
             L + R+ NAW L  + ++I I+ TA+FGSI R ++  WC+R KGP +  +FKP+GI +A 
Sbjct  232   LILERNPNAWILKSSIEIIAIVFTAVFGSIFRIAIHTWCLRKKGPVYVAMFKPLGIAIAV  291

Query  1108  SCGCLFFADTFHYGSMFSAFICGMGYYTTIWGQLKDEEIQQIKGSSVSLPDE---KVPLL  1278
                 +F  DT + GS+  + I  +G+Y+ +WGQ+K++++   K +     +      PL+
Sbjct  292   FMTVVFLGDTLYLGSVIGSIIIALGFYSVMWGQMKEKKMGLNKNNEACCSNSSSLNAPLI  351

Query  1279  QQSQDDS  1299
             +++  ++
Sbjct  352   RRTASEA  358



>ref|XP_009761505.1| PREDICTED: WAT1-related protein At5g40240-like isoform X1 [Nicotiana 
sylvestris]
Length=364

 Score =   195 bits (496),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 126/369 (34%), Positives = 206/369 (56%), Gaps = 18/369 (5%)
 Frame = +1

Query  208   MEVKAAFGEVVPCMAMVMVEACTIFLTIMASTAMAKFGTNPFVFVVYTNALASIFLVPYS  387
             ME+++   +V P +AMV+VE C + +  +   AM   G +  V+VVY NAL +  L+P+ 
Sbjct  4     MEMQSWSKDVFPFVAMVLVECCEMGMITLGKAAMND-GMSNLVYVVYYNALGTFLLLPF-  61

Query  388   IIYHRRDKAQEQlftfplllrlfflglIGVTISQNLAFVGLSYSSPIAACGTANIVPALS  567
             +I+HR  ++   L T  +L R F LGL+G+ + Q LA+ G+ YSSP  A    N++P  +
Sbjct  62    LIFHR-CRSNMALITLSILWRFFLLGLLGICLLQVLAYTGIKYSSPTLAAALGNLLPGFT  120

Query  568   FILAIIL------RRTKIDWESGGSQARMIGALICTVGTISLIFYRGPVVNNYSPTFLHL  729
             F+L II       R  K+D     SQA+ +G ++  +G   +  Y+GP V   S   LH 
Sbjct  121   FLLTIIFSLFAIFRMEKLDIRKASSQAKSLGTIVAIIGASIMTLYKGPRVLGSSN--LHS  178

Query  730   STTQFVFSSSTNQQNWVLGCLCFIAASLTLSIWNIIQVGTIRIYPQVMKIMCVYSLFGTV  909
              ++    S  + + NW+LG L      +  S WN++Q  T++ YP+ M I+     FG++
Sbjct  179   DSSHH--SLFSQESNWLLGGLLITITCIMSSGWNVLQTDTVKKYPEQMTIVFFTCCFGSI  236

Query  910   QSGALSLFIVRDLNAWRLGLNFQLIVILLTAIFGSIIRSSVQLWCMRMKGPSFPLIFKPV  1089
             Q   L+L + R+  AW +     +I I+ +A+ GS+ R +V  WC+  KGP +  +FKP+
Sbjct  237   QCAILTLVLERNPEAWMVKPGIGMIAIVFSAVSGSVFRYNVLTWCLDKKGPLYVAMFKPL  296

Query  1090  GIVVASSCGCLFFADTFHYGSMFSAFICGMGYYTTIWGQLKD----EEIQQIKGSSVSLP  1257
             G+V+A+  G LF  ++ H GS+  A I   G+Y+ +WG+ K+     EI+ I  S +   
Sbjct  297   GMVIAAILGILFLTESLHLGSVIGAVIISAGFYSVLWGKAKEIKSMLEIEDIV-SGIDSS  355

Query  1258  DEKVPLLQQ  1284
              ++ PLLQ+
Sbjct  356   SQRSPLLQK  364



>ref|XP_010028080.1| PREDICTED: WAT1-related protein At3g28050-like [Eucalyptus grandis]
 ref|XP_010028088.1| PREDICTED: WAT1-related protein At3g28050-like [Eucalyptus grandis]
 ref|XP_010028096.1| PREDICTED: WAT1-related protein At3g28050-like [Eucalyptus grandis]
 ref|XP_010028103.1| PREDICTED: WAT1-related protein At3g28050-like [Eucalyptus grandis]
 gb|KCW83427.1| hypothetical protein EUGRSUZ_B00351 [Eucalyptus grandis]
 gb|KCW83428.1| hypothetical protein EUGRSUZ_B00351 [Eucalyptus grandis]
Length=364

 Score =   195 bits (495),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 132/364 (36%), Positives = 206/364 (57%), Gaps = 10/364 (3%)
 Frame = +1

Query  208   MEVKAAFGEVVPCMAMVMVEACTIFLTIMASTAMAKFGTNPFVFVVYTNALASIFLVPYS  387
             ME +      +P  AMV +E   + LT ++  AM++ G + FVF+VY+NALAS+ L+P S
Sbjct  1     MEARPWLLRSLPVAAMVAIECLDVGLTTLSKAAMSR-GMSRFVFLVYSNALASLLLLPVS  59

Query  388   IIYHRRDKAQEQlftfplllrlfflglIGVTISQNLAFVGLSYSSPIAACGTANIVPALS  567
              I  +R+K      TF +L + FFL L+G+T  QN  F G+SYSSP  A    N+VPA +
Sbjct  60    FI--QREK--RPPLTFSVLCKFFFLALVGITTMQNCVFAGVSYSSPTLASAMGNLVPAFT  115

Query  568   FILAIILRRTKIDWESGGSQARMIGALICTVGTISLIFYRGPVVNNYSPTFLH----LST  735
             F+LA+  R  K++  S  SQ +++G ++   G + +  Y+GPV+        +    L T
Sbjct  116   FLLAVSFRIEKLNLRSSRSQIKILGTMVSICGALIVTLYKGPVIGGGISAIPYPDESLPT  175

Query  736   TQFVFSSSTNQQNWVLGCLCFIAASLTLSIWNIIQVGTIRIYPQVMKIMCVYSLFGTVQS  915
             TQ   +      NWV+G +   AASL+L+ WN  Q   ++ YP  + ++     FGT+QS
Sbjct  176   TQPSKALLAGVPNWVIGGMFLAAASLSLATWNTAQAAVLKSYPSEVTLVSFCCFFGTLQS  235

Query  916   GALSLFIVRDLNAWRLGLNFQLIVILLTAIFGSIIRSSVQLWCMRMKGPSFPLIFKPVGI  1095
               ++L   RDL AW+LGL+ ++I ++ TAI G+++   V  WC+  KGP+F  +FKP+ I
Sbjct  236   AVVALIAERDLKAWKLGLSIEVIAVIYTAIVGNVVTFCVCSWCIHKKGPTFVAMFKPLSI  295

Query  1096  VVASSCGCLFFADTFHYGSMFSAFICGMGYYTTIWGQLKDEEI-QQIKGSSVSLPDEKVP  1272
              +A+  G +F  D  H GS+  A +   G+Y  IW   ++EE  +      +  P +K P
Sbjct  296   GIAAIMGAIFLGDALHVGSVVGAVVIVAGFYGVIWAMSQEEEDGRNCTSGELQSPSQKTP  355

Query  1273  LLQQ  1284
             LL+ 
Sbjct  356   LLES  359



>ref|XP_004142351.1| PREDICTED: auxin-induced protein 5NG4-like [Cucumis sativus]
Length=377

 Score =   195 bits (496),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 128/373 (34%), Positives = 207/373 (55%), Gaps = 27/373 (7%)
 Frame = +1

Query  235   VVPCMAMVMVEACTIFLTIMASTAMAKFGTNPFVFVVYTNALASIFLVPYSIIYHRRDKA  414
             V+P  AM+ +E   + L  +   A A  G +  VFVVY+ + A++ L+P   I   R   
Sbjct  12    VLPFPAMMAMECINVGLNTLFKAATAA-GMSHHVFVVYSYSFAALLLLPSPFI--SRTST  68

Query  415   QEQlftfplllrlfflglIGVTISQNLAFVGLSYSSPIAACGTANIVPALSFILAIILRR  594
             +     F +  ++  LGLIG + SQ + + G++YSSP  A   +N+VPA +FILAII R 
Sbjct  69    RLPPLNFSITSKIALLGLIG-SCSQIMGYTGINYSSPTLASAISNLVPAFTFILAIIFRM  127

Query  595   TKIDWESGGSQARMIGALICTVGTISLIFYRGP-VVNNYSPTF---LHLSTTQFVFSSST  762
              K+  +S  SQA+++G +I   G   + FY+GP ++ + SPT    LH ++ Q     S+
Sbjct  128   EKVVLKSNSSQAKVMGTIISISGAFVVTFYKGPRIIFSSSPTISLSLHHNSQQL----SS  183

Query  763   NQQNWVLGCLCFIAASLTLSIWNIIQVGTIRIYPQVMKIMCVYSLFGTVQSGALSLFIVR  942
             +  NWV+G L   A  + + +W I+Q   ++ YP+   ++  Y+L   + +  + L + +
Sbjct  184   SDSNWVIGSLLLTAEYILVPLWYIVQTKIMKEYPEEATVVFFYNLTVAIIAAFVGLILEK  243

Query  943   DLNAWRLGLNFQLIVILLTAIFGSIIRSSVQLWCMRMKGPSFPLIFKPVGIVVASSCGCL  1122
             D +AW L  N  L  IL + +FGS + ++V  W +R+KGP F  +FKP+ IVVA   G L
Sbjct  244   DPSAWILRQNTALASILCSGLFGSCLNNTVHTWALRLKGPVFVAMFKPLSIVVAIVMGVL  303

Query  1123  FFADTFHYGSMFSAFICGMGYYTTIWGQLKD-----EEIQQ------IKGSSVSLPDEKV  1269
             F  D+ + GS+  A I  +G+YT +WG+ K+     EE Q+      + G+  S  D++V
Sbjct  304   FLGDSLYLGSLIGASIISIGFYTVMWGKAKEEMGVGEEKQEGHSHNNLDGNKESNEDQRV  363

Query  1270  PLL----QQSQDD  1296
             PLL    + S+D 
Sbjct  364   PLLGSYNRYSEDH  376



>ref|XP_003553929.1| PREDICTED: WAT1-related protein At3g28050-like [Glycine max]
 gb|KHN23568.1| Auxin-induced protein 5NG4 [Glycine soja]
Length=366

 Score =   195 bits (495),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 115/327 (35%), Positives = 186/327 (57%), Gaps = 3/327 (1%)
 Frame = +1

Query  319   GTNPFVFVVYTNALASIFLVPYSIIYHRRDKAQEQlftfplllrlfflglIGVTISQNLA  498
             G N  VF+ Y  ALA+I L+P +    R         +F ++ ++  LG+IG + SQ L 
Sbjct  38    GMNNHVFLAYAYALATIILIPITFFSRRSRVVPVPPLSFSIVSKIVLLGVIGSS-SQVLG  96

Query  499   FVGLSYSSPIAACGTANIVPALSFILAIILRRTKIDWESGGSQARMIGALICTVGTISLI  678
             + G+SYSSP  A    N+VPA +FILA+I R  K+  +S  SQA++IG++I   G   L 
Sbjct  97    YAGISYSSPALASSIGNLVPAFTFILAVICRMEKLAAKSRSSQAKVIGSIISIAGAFVLT  156

Query  679   FYRGPVVNNYSPTFLHLSTTQFVFSSSTNQQNWVLGCLCFIAASLTLSIWNIIQVGTIRI  858
             FY+GP + N + T L L   Q +    +  ++W +  +  IA     S+W I+QV  +++
Sbjct  157   FYKGPSIIN-ALTHLPLLLQQPINFLKSEDESWAIAGILLIADYFLASVWYIVQVDILKV  215

Query  859   YPQVMKIMCVYSLFGTVQSGALSLFIVRDLNAWRLGLNFQLIVILLTAIFGSIIRSSVQL  1038
             +P  +  +  Y++  T+ S  +  F V + +AW++GL+  LI I+ + IFG ++ + V  
Sbjct  216   FPDELTTVFFYNVTATILSTTVGFFAVPNASAWKIGLDISLISIVCSGIFGKLMSNVVYA  275

Query  1039  WCMRMKGPSFPLIFKPVGIVVASSCGCLFFADTFHYGSMFSAFICGMGYYTTIWGQLKDE  1218
             W + +KGP +   FKP+ IV+A + G +F  D+ + GS+  A I  +G Y  +WG+ K E
Sbjct  276   WALYLKGPVYVTSFKPLQIVIAVAMGVMFLDDSLYIGSVVGATIVSIGLYAVLWGKAK-E  334

Query  1219  EIQQIKGSSVSLPDEKVPLLQQSQDDS  1299
             EI++  GS  S   E VPLLQ  + ++
Sbjct  335   EIEEDVGSQESPTIENVPLLQSHRTET  361



>ref|NP_001239940.1| uncharacterized protein LOC100814137 [Glycine max]
 gb|ACU20859.1| unknown [Glycine max]
Length=371

 Score =   195 bits (495),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 116/360 (32%), Positives = 206/360 (57%), Gaps = 7/360 (2%)
 Frame = +1

Query  226   FGEVVPCMAMVMVEACTIFLTIMASTAMAKFGTNPFVFVVYTNALASIFLVPYSIIYHRR  405
             + ++VP  AMV +E   + L  +   A  + G +  VFVVY  A+A+I L+P   I  R 
Sbjct  8     YKDLVPFGAMVTMECLNVALNTLFKAATLR-GMSYHVFVVYAYAVAAIVLIPGPFISQRC  66

Query  406   DKAQEQlftfplllrlfflglIGVTISQNLAFVGLSYSSPIAACGTANIVPALSFILAII  585
                     +FPLL ++  LGLIG   SQ + + G+S+SSP  +   +N+VPA +F+LAII
Sbjct  67    RSRVLPPLSFPLLRKIGLLGLIGCA-SQIVGYTGISFSSPTLSSAISNLVPAFTFLLAII  125

Query  586   LRRTKIDWESGGSQARMIGALICTVGTISLIFYRGP-VVNNYSPTFLHLSTTQFVFSSST  762
              R  K+   +   QA+++G ++   G   + FY+GP ++  ++P+   LS  Q + + ++
Sbjct  126   FRMEKVIVRNTTCQAKVLGTIVSITGAFVVTFYKGPPIIIVHTPS---LSLHQPINTLNS  182

Query  763   NQQNWVLGCLCFIAASLTLSIWNIIQVGTIRIYPQVMKIMCVYSLFGTVQSGALSLFIVR  942
               ++W +G L   A  + + +W I+QV  +++YP  + ++  Y+L  ++ +  +++F   
Sbjct  183   VDRSWAIGGLLLTAEYILVPLWYIVQVQIMKVYPNELTVIFFYNLCVSIMAAIVAIFTET  242

Query  943   DLNAWRLGLNFQLIVILLTAIFGSIIRSSVQLWCMRMKGPSFPLIFKPVGIVVASSCGCL  1122
             +  AW++GL+  L  I+ + IFGS + ++V  W +R+KGP +  +FKP+ I +A + G +
Sbjct  243   NAGAWKIGLDTALASIVCSGIFGSFVNNAVHTWVLRIKGPVYVAMFKPLSIAIAVALGVM  302

Query  1123  FFADTFHYGSMFSAFICGMGYYTTIWGQLKDEEI-QQIKGSSVSLPDEKVPLLQQSQDDS  1299
             F  DT H GS+  A +  +G+YT +WG+  +E + + + G       E VPLLQ  + D+
Sbjct  303   FLGDTLHLGSLVGATVISIGFYTVMWGKATEENVDEDVPGQQSPPTTENVPLLQSYKTDT  362



>ref|XP_006476742.1| PREDICTED: WAT1-related protein At5g40240-like isoform X2 [Citrus 
sinensis]
Length=343

 Score =   194 bits (493),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 118/366 (32%), Positives = 191/366 (52%), Gaps = 39/366 (11%)
 Frame = +1

Query  208   MEVKAAFGEVVPCMAMVMVEACTIFLTIMASTAMAKFGTNPFVFVVYTNALASIFLVPYS  387
             M VK     +VP  AMV V+   + +T ++  A+++ G  P +  VY +A+AS+ L+P S
Sbjct  3     MGVKQLVVGLVPYAAMVAVQCVQVGITTLSKAAISQ-GATPLILAVYADAIASLILLPLS  61

Query  388   IIYHRRDKAQEQlftfplllrlfflglIGVTISQNLAFVGLSYSSPIAACGTANIVPALS  567
                +R                        +T+ Q   + G+S+SSP     T N++PA +
Sbjct  62    FFLNR------------------------ITLMQICVYTGVSFSSPTLVSATNNLIPAFT  97

Query  568   FILAIILRRTKIDWESGGSQARMIGALICTVGTISLIFYRGPVVNNYSPTFLHLSTTQ--  741
             F+LA+I R  K+D  S  SQ ++IG L+   G   +  Y+GP +   +  F H    Q  
Sbjct  98    FLLAVIFRMEKVDLRSLISQIKIIGTLVSIAGAFIITLYKGPSI--VALLFEHQPKPQPP  155

Query  742   --FVFSSSTNQQNWVLGCLCFIAASLTLSIWNIIQVGTIRIYPQVMKIMCVYSLFGTVQS  915
               F   ++T+  NWV+G +    AS +++  NI Q   ++ YP  + I+  Y LFGT+Q 
Sbjct  156   TSFTLLATTD--NWVIGGILLSIASFSIAAGNIFQAAILKSYPSEVTIVFFYILFGTIQC  213

Query  916   GALSLFIVRDLNAWRLGLNFQLIVILLTAIFGSIIRSSVQLWCMRMKGPSFPLIFKPVGI  1095
               ++L   R+ +AWR+    +LI ++ TAIFG ++   +  WC+R KGP F  +F PVGI
Sbjct  214   AIVALIAERNPDAWRIRPGIELITVMYTAIFGGLMLFGLVAWCLRRKGPVFVAMFNPVGI  273

Query  1096  VVASSCGCLFFADTFHYGSMFSAFICGMGYYTTIWGQLKDEEIQQIKGSSVSLPDEKVPL  1275
              +A+    +F  DT H GS+  A I   G+Y  +W Q K+EE  +I+ ++    D +  L
Sbjct  274   FIAALMSDIFLGDTLHLGSVIGAIIIVTGFYGVMWAQSKEEE--KIQANT----DGRSQL  327

Query  1276  LQQSQD  1293
             L  S++
Sbjct  328   LSHSRE  333



>ref|XP_002322156.2| hypothetical protein POPTR_0015s08450g [Populus trichocarpa]
 gb|EEF06283.2| hypothetical protein POPTR_0015s08450g [Populus trichocarpa]
Length=268

 Score =   192 bits (487),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 96/270 (36%), Positives = 153/270 (57%), Gaps = 5/270 (2%)
 Frame = +1

Query  487   QNLAFVGLSYSSPIAACGTANIVPALSFILAIILRRTKIDWESGGSQARMIGALICTVGT  666
             QN  F G+SYSSP  A     ++PA +F+LA+I R  K+DW S  S+ +++G L+   G 
Sbjct  2     QNCVFTGVSYSSPTLASAMGQLIPAFTFLLAVIFRMEKLDWRSSRSRIKIMGTLVSVSGA  61

Query  667   ISLIFYRGPVVNNYSPTFLHLSTTQFVFSSSTNQQNWVLGCLCFIAASLTLSIWNIIQVG  846
             +++  Y+GP +   +      S    + S  +   +W++G L  + A L +SI+  +Q  
Sbjct  62    LTITLYKGPAIGAITTQ----SNPDPIPSIMSTANSWIIGGLFLVTADLCVSIFTTLQAA  117

Query  847   TIRIYPQVMKIMCVYSLFGTVQSGALSLFIVRDLNAWRLGLNFQLIVILLTAIFGSIIRS  1026
              ++ YP  M ++    LFGT+QS  +SL   R+ NAW+L  + +LI I+ +A+ GS++  
Sbjct  118   ILKEYPSEMAMVSFLCLFGTIQSSIVSLIAERNPNAWKLRPDIELISIIYSAVVGSVVTF  177

Query  1027  SVQLWCMRMKGPSFPLIFKPVGIVVASSCGCLFFADTFHYGSMFSAFICGMGYYTTIWGQ  1206
              V  WC+R KGP F  IFKPVGI  A+  G +F  DT H GS+  A I   G+Y  IW Q
Sbjct  178   GVTAWCIRKKGPVFVAIFKPVGIATAAFLGVIFLGDTLHVGSIVGAIIIVAGFYGVIWAQ  237

Query  1207  LKDEEIQQI-KGSSVSLPDEKVPLLQQSQD  1293
              K++E  ++ +  ++    +K PLL+   +
Sbjct  238   SKEDEHSKVNRPRNLQSLSQKTPLLESHMN  267



>ref|XP_010029213.1| PREDICTED: WAT1-related protein At3g28050-like [Eucalyptus grandis]
 gb|KCW56072.1| hypothetical protein EUGRSUZ_I01830 [Eucalyptus grandis]
Length=356

 Score =   194 bits (494),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 120/362 (33%), Positives = 202/362 (56%), Gaps = 17/362 (5%)
 Frame = +1

Query  226   FGEVVPCMAMVMVEACTIFLTIMASTAMAKFGTNPFVFVVYTNALASIFLVPYSIIYHRR  405
             + +V+P  AMV +E   + L  +   A  + G N  VF+VY  A+A++ L+P ++I   R
Sbjct  7     YRDVLPFSAMVSMECMNVALNTLYKAATLR-GMNYHVFIVYAYAIAALVLLPAAVI--SR  63

Query  406   DKAQEQlftfplllrlfflglIGVTISQNLAFVGLSYSSPIAACGTANIVPALSFILAII  585
                     + P+L ++  LGL+G + SQ L + G+++SSP  A   +N+ PA +FILAI+
Sbjct  64    KSRTLPPLSRPILAKIVLLGLVGSS-SQILGYTGINFSSPTLASAISNLTPAFTFILAIL  122

Query  586   LRRTKIDWESGGSQARMIGALICTVGTISLIFYRGPVV---NNYSPTFLHLSTTQFVFSS  756
              R   I  +   SQA++IG ++   G   +  Y GP +      SP+ LH +        
Sbjct  123   FRMEYISLKRRSSQAKIIGTIVSISGAFVVTLYIGPPIIIGTKPSPS-LHQNL------H  175

Query  757   STNQQNWVLGCLCFIAASLTLSIWNIIQVGTIRIYPQVMKIMCVYSLFGTVQSGALSLFI  936
             STN   W++G     A  + +++W I+Q   ++ YP  + ++ +Y+L  +  +  ++L  
Sbjct  176   STNM-GWIIGGSLLTAEYVLVTLWYIVQAQIMKEYPDELTVVFLYNLIVSFVAATVALIT  234

Query  937   VRDLNAWRLGLNFQLIVILLTAIFGSIIRSSVQLWCMRMKGPSFPLIFKPVGIVVASSCG  1116
              RDLNAWR+  +  L+ ++ + +FGS + +SV  W +R+KGP +  +FKP+ I +A + G
Sbjct  235   ERDLNAWRVR-DIGLVSVICSGVFGSGLNNSVHAWAIRLKGPFYAALFKPLSIAIAVAMG  293

Query  1117  CLFFADTFHYGSMFSAFICGMGYYTTIWGQLKDEEIQQI-KGSSVSLPDEKVPLLQQSQD  1293
               F  DT H GS+    I   G+YT +WG+ K++ I++  +   VS+P EKVPLLQ  + 
Sbjct  294   VFFLGDTLHLGSLIGVTIISFGFYTVMWGKAKEQNIEEAGENRPVSIPSEKVPLLQNHKV  353

Query  1294  DS  1299
             D 
Sbjct  354   DE  355



>ref|XP_010100500.1| Auxin-induced protein 5NG4 [Morus notabilis]
 gb|EXB82634.1| Auxin-induced protein 5NG4 [Morus notabilis]
Length=354

 Score =   194 bits (493),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 118/355 (33%), Positives = 186/355 (52%), Gaps = 12/355 (3%)
 Frame = +1

Query  232   EVVPCMAMVMVEACTIFLTIMASTAMAKFGTNPFVFVVYTNALASIFLVPYSIIYHRRDK  411
              +VP + MV+         ++A TAM+  GTN F+ VVY+N ++S+ L+P S  YHR ++
Sbjct  7     NLVPFVGMVLAILAQTSNMVIAKTAMSH-GTNKFIMVVYSNTISSLILLPCSFFYHRSNR  65

Query  412   AQEQlftfplllrlfflglIGVTISQNLAFVGLSYSSPIAACGTANIVPALSFILAIILR  591
                    F     L   G  G    Q   +VG+ YSSP       N++PA +FILA+I R
Sbjct  66    PSMTSSLFGRFFLLALFGCSG----QIFGYVGIEYSSPTLGTTMFNLIPAFTFILAVIFR  121

Query  592   RTKIDWESGGSQARMIGALICTVGTISLIFYRGPVVNNYSPTFLHLSTTQFVFSSSTNQQ  771
                + W S  SQA+++G ++  +G   +IFY+GP V    P  +   + Q +FSS     
Sbjct  122   METLYWRSSSSQAKILGTIMSMIGAFVVIFYKGPPVVKRLP--ISNLSNQLLFSS---HS  176

Query  772   NWVLGCLCFIAASLTLSIWNIIQVGTIRIYPQVMKIMCVYSLFGTVQSGALSLFIVRDLN  951
             +W+LG     +     S+W I+Q  T + YP V+  +        V S   +L +V+D +
Sbjct  177   HWILGGFFLASDCFVSSLWYIVQASTQKKYPAVLLAVLYQISLSAVMSAIFALIVVKDAS  236

Query  952   AWRLGLNFQLIVILLTAIFGSIIRSSVQLWCMRMKGPSFPLIFKPVGIVVASSCGCLFFA  1131
             AW+L L+  L+ IL TAI  ++IR S+  WC+   G  +  +FKP+GI+     G +F  
Sbjct  237   AWKLKLDMGLVSILHTAIVSTVIRYSLITWCVSKAGAFYCAMFKPLGIIFTVFMGAIFLG  296

Query  1132  DTFHYGSMFSAFICGMGYYTTIWGQLKDEEIQQIKGSSVSLPDEKVPLLQQSQDD  1296
             ++F+ GS+  A I   G+Y  + G+ KD+E  ++  S  SL      LL ++QD 
Sbjct  297   ESFYLGSLIGATIIVTGFYVVMRGKAKDQE--KVDSSESSLDHNSPLLLNKAQDK  349



>gb|KDP21318.1| hypothetical protein JCGZ_21789 [Jatropha curcas]
Length=336

 Score =   193 bits (491),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 113/347 (33%), Positives = 191/347 (55%), Gaps = 13/347 (4%)
 Frame = +1

Query  259   MVEACTIFLTIMASTAMAKFGTNPFVFVVYTNALASIFLVPYSIIYHRRDKAQEQlftfp  438
             M E   + L I++  AM+K G + F+FV Y+NALAS+ L+P S+++HR     E+     
Sbjct  1     MAECAQVGLLIISKIAMSK-GMSSFIFVFYSNALASVILLPSSLLFHR----SERPPLTF  55

Query  439   lllrlfflglIGVTISQNLAFVGLSYSSPIAACGTANIVPALSFILAIILRRTKIDWESG  618
              ++  FF+  +   ++    + G++ SSP       N+VP L+FILA+  R  K++W + 
Sbjct  56    PIICGFFVLGLSGCLANFFGYAGINLSSPTLGTAMLNLVPGLTFILAVAFRMEKLNWRTS  115

Query  619   GSQARMIGALICTVGTISLIFYRGPVVNNYSPTFLHLSTTQFVFSSSTNQQNWVLGCLCF  798
              + A+ IG ++   G   L +Y+GP V    P    L+T+  +        NWV+G L  
Sbjct  116   STLAKSIGTIVSVGGAFILTYYKGPPVLMTPP----LNTSHGLL---VQLSNWVIGGLLL  168

Query  799   IAASLTLSIWNIIQVGTIRIYPQVMKIMCVYSLFGTVQSGALSLFIVRDLNAWRLGLNFQ  978
                 +  S W IIQ   ++ YP  + ++  Y  F T+QS  + L I RD +AW L  N +
Sbjct  169   AVDCVMTSSWVIIQAFILKKYPAELIVVFFYCFFVTIQSAIVCLIIERDPSAWSLRPNIR  228

Query  979   LIVILLTAIFGSIIRSSVQLWCMRMKGPSFPLIFKPVGIVVASSCGCLFFADTFHYGSMF  1158
             L+ +L + +FGS  +  +  WC+R  GP F  +FKP+GIV+A++ G LF  DT + G + 
Sbjct  229   LVAVLYSGVFGSAFQVGICSWCLRQTGPVFISMFKPLGIVIAAAVGILFLGDTLYLGCLA  288

Query  1159  SAFICGMGYYTTIWGQLKDEEIQQIKGS-SVSLPDEKVPLLQQSQDD  1296
              A +  +G+Y+ +WG+  ++++    G+ ++    +KVPLLQ   ++
Sbjct  289   GATVIVIGFYSVLWGKANEQKMGIDAGAKTIESSSQKVPLLQGYIEE  335



>ref|XP_004297653.1| PREDICTED: auxin-induced protein 5NG4-like [Fragaria vesca subsp. 
vesca]
Length=352

 Score =   194 bits (492),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 116/354 (33%), Positives = 191/354 (54%), Gaps = 10/354 (3%)
 Frame = +1

Query  238   VPCMAMVMVEACTIFLTIMASTAMAKFGTNPFVFVVYTNALASIFLVPYSIIYHRRDKAQ  417
             +P + MV+ E     L I++  AM+  G N  +FV Y+NALA+  L+P S+++HR   + 
Sbjct  7     LPIVGMVLAECAQAGLMIVSKAAMST-GMNMLIFVCYSNALAAFVLLPTSLLFHR---ST  62

Query  418   EQlftfplllrlfflglIGVTISQNLAFVGLSYSSPIAACGTANIVPALSFILAIILRRT  597
             E+      +L  FFL  +   ++Q + + G++YSSP       N++PA +F+LA+I R  
Sbjct  63    ERPPITFSILCWFFLLGLLGFMAQLIGYAGINYSSPTLGTAMLNLIPAFTFVLAVIFRME  122

Query  598   KIDWESGGSQARMIGALICTVGTISLIFYRGPVVNNYSPTFLHLSTTQFVFSSSTNQQNW  777
             KID  S  + A+ +G ++   G   +  Y+GP +   + +   LS  Q        Q NW
Sbjct  123   KIDGRSCSTLAKTLGTIVSISGAFIVTLYKGPPLL-MTASVDMLSHNQLFLP----QSNW  177

Query  778   VLGCLCFIAASLTLSIWNIIQVGTIRIYPQVMKIMCVYSLFGTVQSGALSLFIVRDLNAW  957
             V+G +      +  + W IIQ   ++ YP  + I+  Y  F  +QS  +  F+ RDL+AW
Sbjct  178   VIGGMLLGLHCVVAAAWLIIQASVLKKYPAELIIVFYYCFFVAIQSVVVLWFVERDLSAW  237

Query  958   RLGLNFQLIVILLTAIFGSIIRSSVQLWCMRMKGPSFPLIFKPVGIVVASSCGCLFFADT  1137
              L    +   +L + +FGS  +  V  WC+   GP F  +FKP+GIVVA + G +F  DT
Sbjct  238   ALNSRLRFFAVLYSGVFGSAFQVGVSTWCLNRTGPVFVSMFKPLGIVVAVAIGVIFLGDT  297

Query  1138  FHYGSMFSAFICGMGYYTTIWGQLKDEEIQQIKGS-SVSLPDEKVPLLQQSQDD  1296
             F+ GS+  A +   G+Y+ IWG+  +E++    G+ S++   ++VPLL    D+
Sbjct  298   FYLGSLIGASVIVTGFYSVIWGKANEEKMNDEAGAGSLTSKKQRVPLLHNIIDE  351



>ref|XP_009363570.1| PREDICTED: uncharacterized protein LOC103953544 [Pyrus x bretschneideri]
Length=742

 Score =   201 bits (511),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 118/356 (33%), Positives = 200/356 (56%), Gaps = 12/356 (3%)
 Frame = +1

Query  238   VPCMAMVMVEACTIFLTIMASTAMAKFGTNPFVFVVYTNALASIFLVPYSIIYHRRDKAQ  417
             +P + MV+ E     L I++  AM+  G +  +F+ Y+NALA++ L+P S+++HR ++  
Sbjct  395   LPIVGMVLAECAQAGLIIISKIAMSN-GMSNLIFLCYSNALAALILLPISLVFHRSERPP  453

Query  418   EQlftfplllrlfflglIGVTISQNLAFVGLSYSSPIAACGTANIVPALSFILAIILRRT  597
                 T  ++   F LGLIG  ++Q L + G++YSSP  +    N++PA +F+LA+I R  
Sbjct  454   ---LTLSIIGWFFLLGLIGF-MAQFLGYAGINYSSPTLSTAMLNLIPAFTFVLAVIFRME  509

Query  598   KIDWESGGSQARMIGALICTVGTISLIFYRGPVVNNYSPTFLH--LSTTQFVFSSSTNQQ  771
             +ID  S  S A+ +G ++   G   +  Y+GP +   S T +   LS  Q +    + + 
Sbjct  510   RIDMRSFSSLAKTLGTIVSISGAFIVTLYKGPPILKASSTVMTDVLSHKQLI----SERS  565

Query  772   NWVLGCLCFIAASLTLSIWNIIQVGTIRIYPQVMKIMCVYSLFGTVQSGALSLFIVRDLN  951
             NWVLG +C  A  +  S W I+Q   ++ Y   + ++  Y  F  +QS  +S  + RDL 
Sbjct  566   NWVLGGVCVAANCVLASAWIIVQASVLKKYRAELIMVFYYCFFVAIQSVVVSSILERDLR  625

Query  952   AWRLGLNFQLIVILLTAIFGSIIRSSVQLWCMRMKGPSFPLIFKPVGIVVASSCGCLFFA  1131
             +W L    + I +L +A+FGS  +  V  WC+R  GP F  +FKP+GI+V    G  F  
Sbjct  626   SWELTPKIRWIAVLYSAVFGSAFQVGVSTWCLRRTGPVFVAMFKPLGIIVTVFIGVTFLG  685

Query  1132  DTFHYGSMFSAFICGMGYYTTIWGQLKDEEIQQIKG-SSVSLPDEKVPLLQQSQDD  1296
             DTF+ GS+  A +  +G+Y+ +WG+  +E++ +  G  S++   ++VPLLQ   ++
Sbjct  686   DTFYLGSLIGAIVIVIGFYSVMWGKANEEKMDEDAGEESLASIKQQVPLLQSHIEE  741


 Score =   187 bits (474),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 116/358 (32%), Positives = 192/358 (54%), Gaps = 19/358 (5%)
 Frame = +1

Query  235   VVPCMAMVMVEACTIFLTIMASTAMAKFGTNPFVFVVYTNALASIFLVPYSIIYHRRDKA  414
             ++P + MVM         ++   AM+  GTN ++ VVY N +A++ L+P ++I+HR    
Sbjct  8     LLPFIGMVMAIMAQTGSVVVNKAAMST-GTNAYIIVVYGNTIAALILLPSALIFHR----  62

Query  415   QEQlftfplllrlfflglIGVTISQNLAFVGLSYSSPIAACGTANIVPALSFILAIILRR  594
              E+      +L   FL  +    +Q    +G+ YSSP  +    N++PA +FILAII R 
Sbjct  63    SERPPLTFSILCRIFLLGLFCCSAQIFGNIGIEYSSPTLSTAMLNLIPAFTFILAIIFRM  122

Query  595   TKIDWESGGSQARMIGALICTVGTISLIFYRG-PVVNNYS--PTFLHLSTTQFVFSSSTN  765
               ++W S  SQA++ G ++   G   + FY+G P++   S  P  L+      +FSSS  
Sbjct  123   ETVNWRSSSSQAKVFGTVMSIGGAFVVTFYKGLPIIRLSSSLPNSLYQ-----IFSSS--  175

Query  766   QQNWVLGCLCFIAASLTLSIWNIIQVGTIRIYPQVMKIMCVYSLFGTVQSGALSLFIVRD  945
             + NW+LG L     + ++S+W I+Q   ++ YP ++  +    LF T+QS   +L  VRD
Sbjct  176   RSNWILGGLFLAVHAFSISLWYILQATVVKKYPAILLSVFFQCLFATIQSAIFALIAVRD  235

Query  946   LNAWRLGLNFQLIVILLTAIFGSIIRSSVQLWCMRMKGPSFPLIFKPVGIVVASSCGCLF  1125
              +AW + L+  LI  L T I  +++  SV +WC+   G  +  +FKP+GI+     G +F
Sbjct  236   ASAWEIRLDVGLIAALYTGIVATVLYFSVIVWCVEKVGAFYCSMFKPIGIIFGVIMGAIF  295

Query  1126  FADTFHYGSMFSAFICGMGYYTTIWGQLKDEEIQQIKGSSVSLPDEKVPLLQQSQDDS  1299
               D+ + GS+  A I   G+Y  +WG+  +E++ +I+    SL   K+PLLQ    D 
Sbjct  296   LGDSVYIGSLVGAAIIVTGFYAMMWGKATEEKLIEIE----SLDQNKLPLLQNGIQDK  349



>ref|XP_008230645.1| PREDICTED: WAT1-related protein At3g28050-like [Prunus mume]
Length=363

 Score =   194 bits (492),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 115/365 (32%), Positives = 200/365 (55%), Gaps = 15/365 (4%)
 Frame = +1

Query  208   MEVKAAFGEVVPCMAMVMVEACTIFLTIMASTAMAKFGTNPFVFVVYTNALASIFLVPYS  387
             M  ++ + + +P MAMV +E   + L  +   A  + G +  VFVVY+ ++A++FL+P  
Sbjct  1     MAGRSCYRDALPFMAMVTMECANVGLNTLFKAATLR-GMSYHVFVVYSYSVAALFLLPAP  59

Query  388   IIYHRRDKAQEQlftfplllrlfflglIGV--TISQNLAFVGLSYSSPIAACGTANIVPA  561
              I +R      ++        +  + L+G+  + SQ + + G+++SSP  A   +N+VPA
Sbjct  60    FISNR-----SRVLPPLNFSIMSKVLLLGIIGSSSQIMGYTGINFSSPTLASAISNLVPA  114

Query  562   LSFILAIILRRTKIDWESGGSQARMIGALICTVGTISLIFYRGP--VVNNYSPTF-LHLS  732
              +FILAII R       S  SQA+++G ++   G   +  Y+GP  V  + SP+  LH  
Sbjct  115   FTFILAIIFRMESAALRSRSSQAKILGTIVSLAGAFVVTLYKGPPIVFPHQSPSISLH--  172

Query  733   TTQFVFSSSTNQQNWVLGCLCFIAASLTLSIWNIIQVGTIRIYPQVMKIMCVYSLFGTVQ  912
                 + S+     NWVLG L   A  + + +W I+Q   ++ YP  + ++  Y++   V 
Sbjct  173   -QPLLNSTPPTNSNWVLGGLLLTAEYILVPLWYIVQAQIMKEYPNELTVIFFYNVCVGVV  231

Query  913   SGALSLFIVRDLNAWRLGLNFQLIVILLTAIFGSIIRSSVQLWCMRMKGPSFPLIFKPVG  1092
             +G ++L    + +AW+L  N  L+ IL + +FGS + ++V  W +R+KGP +  +FKP+ 
Sbjct  232   AGVVALITEPNSSAWKLRPNVALVSILCSGLFGSFLNNTVHTWALRLKGPVYVTMFKPLS  291

Query  1093  IVVASSCGCLFFADTFHYGSMFSAFICGMGYYTTIWGQLKDEEIQQIKGSSVSLPD-EKV  1269
             + +A + G +F  DT H GS+  A I  +G+YT +WG+ K+E ++     S+  P   K 
Sbjct  292   MAIAVAMGVIFLGDTLHLGSLVGATIISIGFYTVLWGKAKEEAVEDSVADSLEAPSAHKA  351

Query  1270  PLLQQ  1284
             PLLQ+
Sbjct  352   PLLQK  356



>ref|XP_007215585.1| hypothetical protein PRUPE_ppa007567mg [Prunus persica]
 gb|EMJ16784.1| hypothetical protein PRUPE_ppa007567mg [Prunus persica]
Length=363

 Score =   194 bits (492),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 115/365 (32%), Positives = 203/365 (56%), Gaps = 15/365 (4%)
 Frame = +1

Query  208   MEVKAAFGEVVPCMAMVMVEACTIFLTIMASTAMAKFGTNPFVFVVYTNALASIFLVPYS  387
             M  ++ + +V+P MAMV +E   + L  +   A  + G +  VFVVY+ ++A++FL+P  
Sbjct  1     MAGRSCYTDVLPFMAMVTMECTNVGLNTLFKAATLR-GMSYHVFVVYSYSVAALFLLPAP  59

Query  388   IIYHRRDKAQEQlftfplllrlfflglIGV--TISQNLAFVGLSYSSPIAACGTANIVPA  561
              I +R      ++        +  + L+G+  + SQ + + G+++SSP  A   +N+VPA
Sbjct  60    FISNR-----SRVLPPLNFSIMSKVLLLGLIGSSSQIMGYTGINFSSPTLASAISNLVPA  114

Query  562   LSFILAIILRRTKIDWESGGSQARMIGALICTVGTISLIFYRGP--VVNNYSPTFLHLST  735
              +FILA+I R       S  SQA+++G ++   G   +  Y+GP  V  + SP+   +S 
Sbjct  115   FTFILAVIFRMESAALRSRSSQAKILGTIVSLAGAFVVTLYKGPPLVFPHQSPS---ISL  171

Query  736   TQFVFSSST-NQQNWVLGCLCFIAASLTLSIWNIIQVGTIRIYPQVMKIMCVYSLFGTVQ  912
              Q + + +T    NWVLG L   A  + + +W I+Q   ++ YP  + ++  Y++   V 
Sbjct  172   HQPLLNPTTPTNSNWVLGGLLLTAEYILVPLWYIVQAQIMKEYPNELTVIFFYNVCVGVV  231

Query  913   SGALSLFIVRDLNAWRLGLNFQLIVILLTAIFGSIIRSSVQLWCMRMKGPSFPLIFKPVG  1092
             +G ++L    + +AW+L  N  L+ IL + +FGS + ++V  W +R+KGP +  +FKP+ 
Sbjct  232   AGVVALITEPNSSAWKLRPNVALVSILCSGLFGSFLNNTVHTWALRLKGPVYVTMFKPLS  291

Query  1093  IVVASSCGCLFFADTFHYGSMFSAFICGMGYYTTIWGQLKDEEIQQIKGSSVSLPD-EKV  1269
             + +A + G +F  DT H GS+  A I  +G+YT +WG+ K+E ++     S+  P   K 
Sbjct  292   MAIAVAMGVIFLGDTLHLGSLVGATIISIGFYTVLWGKAKEEAVEDSVADSLEAPSAHKA  351

Query  1270  PLLQQ  1284
             PLLQ+
Sbjct  352   PLLQK  356



>ref|XP_007031406.1| Nodulin MtN21 /EamA transporter family protein [Theobroma cacao]
 gb|EOY02332.1| Nodulin MtN21 /EamA transporter family protein [Theobroma cacao]
Length=350

 Score =   193 bits (490),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 122/356 (34%), Positives = 200/356 (56%), Gaps = 24/356 (7%)
 Frame = +1

Query  241   PCMAMVMVEACTIFLTIMASTAMAKFGTNPFVFVVYTNALASIFLVPYSIIYHRRDKAQE  420
             P +AM+ VE   + +++++  A+ K G +  V VVY NAL ++ L+PY +I+ R    ++
Sbjct  12    PFVAMITVECTDVGISVISKAALTK-GMSNIVSVVYYNALGTLILLPY-LIFCRN---KQ  66

Query  421   QlftfplllrlfflglIGVTISQNLAFVGLSYSSPIAACGTANIVPALSFILAIILRRTK  600
                TF LL R F LGLIG +  Q +   G+ YSSP  +    N++P  +F+LA I R  K
Sbjct  67    LPLTFSLLWRFFLLGLIGSS-GQIVYLTGVKYSSPTLSSALVNLIPIFTFLLAAIFRMEK  125

Query  601   IDWESGGSQARMIGALICTVGTISLIFYRGPVV------NNYSPTFLHLSTTQFVFSSST  762
             ++     SQA+ +GA++   G   +  Y+GP V      +N+ P  LHLS          
Sbjct  126   LELRRSSSQAKALGAVVAVTGAFVVTLYKGPSVLMASSPSNF-PQNLHLS----------  174

Query  763   NQQNWVLGCLCFIAASLTLSIWNIIQVGTIRIYPQVMKIMCVYSLFGTVQSGALSLFIVR  942
             +Q  W++G    +   L+ + WN++Q  T++ YP  M  +  Y+ F T+QS   SL + R
Sbjct  175   DQSKWIIGGFLIVLVCLSSATWNVVQAATVKEYPDKMTTVFFYTFFITIQSLVFSLILER  234

Query  943   DLNAWRLGLNFQLIVILLTAIFGSIIRSSVQLWCMRMKGPSFPLIFKPVGIVVASSCGCL  1122
             +  AW+L  N ++  I+ TAIFGS+ R ++  WC++ KGP +  +FKP+GIVVA     +
Sbjct  235   NPTAWKLKSNVEVAAIVCTAIFGSVFRIAIHTWCLQKKGPVYVSMFKPLGIVVAVVLTVI  294

Query  1123  FFADTFHYGSMFSAFICGMGYYTTIWGQLKDEE-IQQIKGSSVSLPDEKVPLLQQS  1287
             F  DT + GS+  + I  +G+YT +WG+ K++  + + + S +    +K PL+  S
Sbjct  295   FLGDTLYLGSVIGSVIIAIGFYTVMWGRAKEKNMVLENEVSRLESSGQKDPLIPSS  350



>ref|XP_008221766.1| PREDICTED: WAT1-related protein At5g40210-like isoform X1 [Prunus 
mume]
Length=361

 Score =   193 bits (491),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 124/364 (34%), Positives = 197/364 (54%), Gaps = 24/364 (7%)
 Frame = +1

Query  232   EVVPCMAMVMVEACTIFLTIMASTAMAKFGTNPFVFVVYTNALASIFLVPYSIIYHRRDK  411
              ++P + MVM         I+   AM+K G+N ++ VVY N L+++ L+P ++ +H R  
Sbjct  5     SLLPFLGMVMAVLAQAANMIVNEAAMSK-GSNKYIMVVYANGLSTLILLPPALFFHHRSG  63

Query  412   AQEQlftfplllrlfflglIGVTISQNLAFVGLSYSSPIAACGTANIVPALSFILAIILR  591
                   TF +L   F L L G + +Q   +VG+ YSS        N++PA +FILAII R
Sbjct  64    --RPPLTFSILCGFFMLALFGCS-AQIFGYVGIEYSSATLGTAMLNLIPAFTFILAIIFR  120

Query  592   RTKIDWESGGSQARMIGALICTVGTISLIFYRG-PVV---NNYSPTFLHLSTTQFVFSSS  759
               ++ W S  S+A+++G +    G   + FY+G P++   +++ P          +FSS 
Sbjct  121   MEEVQWRSSSSKAKILGTIASIAGAFVVTFYKGQPIMLPPSSHPPN---------LFSS-  170

Query  760   TNQQNWVLGCLCFIAASLTLSIWNIIQVGTIRIYPQVMKIMCVYSLFGTVQSGALSLFIV  939
               + NWVLG L   A S + S+W I+Q  T++ YP V+  +C  SLF TVQS  ++L  V
Sbjct  171   --KSNWVLGGLFLAADSFSSSLWYILQASTLKKYPAVVVTVCFQSLFMTVQSALVTLIAV  228

Query  940   RDLNAWRLGLNFQLIVILLTAIFGSIIRSSVQLWCMRMKGPSFPLIFKPVGIVVASSCGC  1119
             +D +AW L L+  LI +L TAI    +R ++  WC+   G  F  +FKP+GI+     G 
Sbjct  229   KDASAWELRLDMGLIAVLYTAIVSIGLRYTLTAWCVWKAGALFCSMFKPLGIIFGVIMGA  288

Query  1120  LFFADTFHYGS----MFSAFICGMGYYTTIWGQLKDEEIQQIKGSSVSLPDEKVPLLQQS  1287
             +F  D F++G     +  A I   G+Y  +WG+ K+E++ +      SL   KVPLLQ +
Sbjct  289   IFLGDPFYFGRYAQFLVGALIIVTGFYAVMWGKAKEEKLVEGGSRWESLGHNKVPLLQNN  348

Query  1288  QDDS  1299
              ++ 
Sbjct  349   IEEK  352



>ref|XP_007155399.1| hypothetical protein PHAVU_003G198100g [Phaseolus vulgaris]
 gb|ESW27393.1| hypothetical protein PHAVU_003G198100g [Phaseolus vulgaris]
Length=364

 Score =   193 bits (491),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 119/354 (34%), Positives = 199/354 (56%), Gaps = 8/354 (2%)
 Frame = +1

Query  241   PCMAMVMVEACTIFLTIMASTAMAKFGTNPFVFVVYTNALASIFLVPYSIIYHRRDKAQE  420
             P  AM+MVE   + L+ +   AM + G N FVFV+Y+NA+A++ L+P +   +R  +   
Sbjct  15    PFAAMIMVECLDVGLSTLGKAAMNR-GMNHFVFVLYSNAIATLILLPLAFFINRTTRPP-  72

Query  421   QlftfplllrlfflglIGVTISQNLAFVGLSYSSPIAACGTANIVPALSFILAIILRRTK  600
                +  LL + F +G + +T+ QN  F  + YSSP      +N+ PA +F+LA+I    K
Sbjct  73    --LSLALLCKFFLVGALCITVMQNCVFTAIDYSSPTLGSAMSNLSPAATFVLAVIFGMEK  130

Query  601   IDWESGGSQARMIGALICTVGTISLIFYRGPVVNNYSPTFLHLSTTQFVFSSSTNQQNWV  780
             ++  S  SQ ++ G L+   G + +  Y+G  + ++    +  S +Q + S      NW 
Sbjct  131   LNIGSSISQIKVTGTLLSISGALLVTLYKGFPITSFR---IQHSPSQPLSSLLAQTSNWT  187

Query  781   LGCLCFIAASLTLSIWNIIQVGTIRIYPQVMKIMCVYSLFGTVQSGALSLFIVRDLNAWR  960
             +G L F AASL+L++ NI Q   ++ Y     ++  Y +FGT+Q+  LSL +VRD N W+
Sbjct  188   IGGLFFAAASLSLALSNITQASILKGYSSQSTVVAFYCMFGTIQTAILSLIVVRDPNDWK  247

Query  961   LGLNFQLIVILLTAIFGSIIRSSVQLWCMRMKGPSFPLIFKPVGIVVASSCGCLFFADTF  1140
             +    +L+ I  +AI G+++  SV  WC++ KGP F  +FKPVGI +A     +F  +T 
Sbjct  248   ISPGIELVSIFYSAIIGNVVTFSVLTWCIKRKGPVFVSLFKPVGIAIADFSSVIFLGETL  307

Query  1141  HYGSMFSAFICGMGYYTTIWGQLKDEEIQQIKGSSVSLP-DEKVPLLQQSQDDS  1299
             H GS+  A I  +G+YT +W Q K+E  + ++    S P  ++ PLL+  ++ +
Sbjct  308   HVGSVLGAVIIAIGFYTVLWAQSKEENAKGLQVDGQSFPSSQESPLLETIRESN  361



>ref|XP_008348035.1| PREDICTED: WAT1-related protein At5g40240-like isoform X1 [Malus 
domestica]
Length=359

 Score =   193 bits (490),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 114/359 (32%), Positives = 202/359 (56%), Gaps = 12/359 (3%)
 Frame = +1

Query  208   MEVKAAFGEVVPCMAMVMVEACTIFLTIMASTAMAKFGTNPFVFVVYTNALASIFLVPYS  387
             M+V   +G ++P +AMV VE   + +T ++  AM++ G + +VFVVY+NALA+IFL+P  
Sbjct  3     MQVGCRWGVLLPVVAMVTVEFTDVGVTTVSKAAMSR-GMSSYVFVVYSNALAAIFLLPCF  61

Query  388   IIYHRRDKAQEQlftfplllrlfflglIGVTISQNLAFVGLSYSSPIAACGTANIVPALS  567
             I+     + +        LL   FL  +  + S  LA+ G++YSSP  +    N++P  +
Sbjct  62    IL-----QKKPATSLPLSLLCGLFLLGLIGSSSLILAYNGINYSSPTVSSAMGNLIPIFT  116

Query  568   FILAIILRRTKIDWESGGSQARMIGALICTVGTISLIFYRGPVVNNYSPTFLHLSTTQFV  747
             F LA+I R  K +     ++A+++G ++   G   +I Y+G  +      F  LS   F 
Sbjct  117   FALAVIFRIEKPNLRKSSTRAKLLGTIVSVSGAFIVILYKGSAILK----FQGLSPPNFS  172

Query  748   FSSSTNQQ-NWVLGCLCFIAASLTLSIWNIIQVGTIRIYPQVMKIMCVYSLFGTVQSGAL  924
             +    +Q+ NWV G      + L  +IWNI+Q   +  +P    I+  Y  F T+Q+   
Sbjct  173   YQHFVSQRTNWVFGGFLLALSCLLAAIWNIVQAPIVNNFPSKETIVFFYIFFVTIQTTIY  232

Query  925   SLFIVRDLNAWRLGLNFQLIVILLTAIFGSIIRSSVQLWCMRMKGPSFPLIFKPVGIVVA  1104
             SL + R+ N+W L  + ++I I+ +A+FGS+ R++V +WC++  GP F  +F+P+G+ +A
Sbjct  233   SLIVERNPNSWVLRPDIEMIAIVCSAMFGSVFRTAVHVWCLQQNGPIFVTMFRPLGVAIA  292

Query  1105  SSCGCLFFADTFHYGSMFSAFICGMGYYTTIWGQLKDEEI-QQIKGSSVSLPDEKVPLL  1278
             ++   +F  ++ H GS+  + I  +G+Y  IWGQ+K+ +I  + +  S +   ++ PLL
Sbjct  293   AAMVVIFLGESLHLGSVIGSIIIAIGFYAMIWGQIKEHKIAMENEVHSSASATQQAPLL  351



>ref|XP_010653186.1| PREDICTED: WAT1-related protein At3g28050 [Vitis vinifera]
 ref|XP_010653192.1| PREDICTED: WAT1-related protein At3g28050 [Vitis vinifera]
 emb|CBI32107.3| unnamed protein product [Vitis vinifera]
Length=356

 Score =   192 bits (489),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 121/347 (35%), Positives = 183/347 (53%), Gaps = 14/347 (4%)
 Frame = +1

Query  250   AMVMVEACTIFLTIMASTAMAKFGTNPFVFVVYTNALASIFLVPYSIIYHRRDKAQEQlf  429
              MVM E   + L I AS A    G    VF++Y+N LAS+ L+P  +++HR  + Q    
Sbjct  11    GMVMAEFAQVGLMI-ASKAAISSGMPNLVFILYSNTLASLILLPSCLLFHRSPRPQ----  65

Query  430   tfplllrlfflglIGVTISQNLAFVGLSYSSPIAACGTANIVPALSFILAIILRRTKIDW  609
                 LL  FFL  +    +Q   + G+ YSS        N+VP  +FILAII R  ++DW
Sbjct  66    LTFSLLSGFFLLALLGFFAQIFGYAGIQYSSATLGTAMLNLVPGFTFILAIIFRMERLDW  125

Query  610   ESGGSQARMIGALICTVGTISLIFYRG-PVVNNYSPTFLHLSTTQFVFSSSTNQQNWVLG  786
               G S A+ +G ++   G   + FY+G P++   SP+  +     F+    + Q NWV G
Sbjct  126   R-GSSMAKSMGTVVSIAGAFIVTFYKGSPILMTPSPS--NFPDQLFL----SQQSNWVFG  178

Query  787   CLCFIAASLTLSIWNIIQVGTIRIYPQVMKIMCVYSLFGTVQSGALSLFIVRDLNAWRLG  966
              L   A  +  S W I+Q   ++ YP  + I   Y  F  +QS A SL + R   AW L 
Sbjct  179   GLLLAADCVMSSAWLILQASILKKYPAELIINFYYCFFVAIQSAAASLIMERGPGAWSLK  238

Query  967   LNFQLIVILLTAIFGSIIRSSVQLWCMRMKGPSFPLIFKPVGIVVASSCGCLFFADTFHY  1146
              + + I ++ + +FG + +     WC+  KGP F  +FKPVGIVVA + G +F  DTF+ 
Sbjct  239   PSTRFIAVMYSGVFGYVFQVGAITWCVHQKGPVFVAMFKPVGIVVAVAMGVIFLGDTFYM  298

Query  1147  GSMFSAFICGMGYYTTIWGQLKDEEIQQIKG-SSVSLPDEKVPLLQQ  1284
             GS+  A +  +G+Y+ +WG+ K+E+I +  G  S+    +K PLLQ 
Sbjct  299   GSLIGATVIVIGFYSVMWGKAKEEKIDEDIGMRSLESTSQKAPLLQN  345



>ref|XP_008230953.1| PREDICTED: uncharacterized protein LOC103330182 [Prunus mume]
Length=721

 Score =   200 bits (508),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 132/418 (32%), Positives = 206/418 (49%), Gaps = 35/418 (8%)
 Frame = +1

Query  223   AFGEVVPCMAMVMVEACTIFLTIMASTAMAKFGTNPFVFVVYTNALASIFLVPYSIIYHR  402
             A+   +P  AMVMVE   + ++ ++  AM++ G + FVF+VY NAL ++ L+PY  I+ R
Sbjct  7     AWRSALPFAAMVMVECAEVGVSTISKVAMSR-GMSHFVFIVYYNALGTLMLLPY-FIFQR  64

Query  403   RDKAQEQlftfplllrlfflglIGVTISQNLAFVGLSYSSPIAACGTANIVPALSFILAI  582
               +A            L  +G  G    + L F G+  SSP  A   AN+ P  +F+LAI
Sbjct  65    NKRAPLSFKLICRFFLLGLIGSSG----KILFFAGVKSSSPSLAAAMANLTPIFTFLLAI  120

Query  583   ILRRTKIDWESGGSQARMIGALICTVGTISLIFYRGPVVNNYSPTFLHLSTTQFVFSSS-  759
             I R  K+D     S A+ +G ++  +G + +  Y+GP +   S +   L+  Q   S   
Sbjct  121   IFRMEKLDLRKPTSHAKSLGTIVSVLGALIVTLYKGPALLKPSSSPSGLTHHQPRLSQQH  180

Query  760   -----TNQQNWVLGCLCFIAASLTLSIWNIIQVGTIRIYPQVMKIMCVYSLFGTVQSGAL  924
                  + + NW+ G L      L  S WNI Q   ++ YP+ M I+  Y+LF T Q   +
Sbjct  181   YQPLLSQRSNWIFGGLLLAIQCLVSSTWNIAQADAVKDYPEEMTIVFFYTLFLTCQCSVI  240

Query  925   SLFIVRDLNAWRLGLNFQLIVILLTAIFGSIIRSSVQLWCMRMKGPSFPLIFKPVGIVVA  1104
             SL + R+ NAW+L    ++I I   A F S+ R  V +WC+  KGP +  +FKP+GI +A
Sbjct  241   SLIVERNPNAWKLKPGIEMIAIAYAAFFVSVFRIGVHVWCLHKKGPVYVAMFKPLGIAIA  300

Query  1105  SSCGCLFFADTFHYGSMFSAFICGMGYYTTIWGQLKDEEIQQIKGSSVSLPD-EKVPLLQ  1281
              +   LF  D  + GS+  +F+  +G+YT I  Q+K++ +    G+ +  P  +  PLLQ
Sbjct  301   VAMVVLFLGDALYLGSVIGSFVIALGFYTVICAQIKEKRMALDNGAQILEPSTQTTPLLQ  360

Query  1282  Q-------------SQDDSPV*GCMILKTLNCDFFFLYIN*EMGVIFKALNPMHVEQY  1416
                            QD  PV   M+  T+ C       N  + V+FKA     +  Y
Sbjct  361   SCSINQREMAWRFIHQDALPV-AAMV--TVECT------NVGLNVLFKAATSKGLSYY  409


 Score =   183 bits (465),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 113/358 (32%), Positives = 190/358 (53%), Gaps = 16/358 (4%)
 Frame = +1

Query  232   EVVPCMAMVMVEACTIFLTIMASTAMAKFGTNPFVFVVYTNALASIFLVPYSIIYHRRDK  411
             + +P  AMV VE   + L ++   A +K G + +VF+VY+NA+A++ L+P   I+ R   
Sbjct  377   DALPVAAMVTVECTNVGLNVLFKAATSK-GLSYYVFIVYSNAIATLVLLPLFFIFRRTGL  435

Query  412   AQEQlftfplllrlfflglIGVTISQNLAFVGLSYSSPIAACGTANIVPALSFILAIILR  591
                 L     +  L     IG  ++    + GL+YSSP  +   +N+ PA +FILA+  R
Sbjct  436   PSFNLSLLSKVFLLGL---IGF-LADICGYKGLNYSSPTLSSAMSNLTPAFTFILAVFFR  491

Query  592   RTKIDWESGGSQARMIGALICTVGTISLIFYRGPVVNNYSPTFLHLSTTQFVFSSSTNQQ  771
               K+   S  +QA+++G L+   G + ++ Y+GP + +  PT L   +        T+++
Sbjct  492   MEKLALRSSSTQAKIMGTLVSISGALVVVLYKGPPILSTPPTVLSPPSAVL----GTSEK  547

Query  772   NWVLGCLCFIAASLTLSIWNIIQVGTIRIYPQVMKIMCVYSLFGTVQSGALSLFIVRDLN  951
             NWV+G L      L  S W I+Q   ++ YP  + ++ +++L GT+ S  + L    +L+
Sbjct  548   NWVIGGLLLAVQYLLSSTWYILQTHVMKTYPAEIVLVFLFNLCGTIISAPVCLIAESNLS  607

Query  952   AWRLGLNFQLIVILLTAIFGSIIRSSVQLWCMRMKGPSFPLIFKPVGIVVASSCGCLFFA  1131
             AWRL     L+ I+ +   GS   S V  W + +KGP F  IFKP+ I +A++   +F  
Sbjct  608   AWRLRPGIALVAIICSGCLGSSFGSLVHTWGLHLKGPVFISIFKPLSIAIAAAFSVIFLG  667

Query  1132  DTFHYGSMFSAFICGMGYYTTIWGQLKDEEIQQIKGSSVSLPDE--KVPLLQQSQDDS  1299
             D    GS+  A I  +G+Y  IWG+ K++E+     SS +LP    K PLL+  + ++
Sbjct  668   DALSLGSVVGAIILSVGFYAVIWGKAKEDEM-----SSRALPIAIGKTPLLESHKVEN  720



>ref|XP_010111531.1| Auxin-induced protein 5NG4 [Morus notabilis]
 gb|EXC31164.1| Auxin-induced protein 5NG4 [Morus notabilis]
Length=343

 Score =   192 bits (488),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 110/346 (32%), Positives = 184/346 (53%), Gaps = 33/346 (10%)
 Frame = +1

Query  208   MEVKAAFGEVVPCMAMVMVEACTIFLTIMASTAMAKFGTNPFVFVVYTNALASIFLVPYS  387
             M V +    + P + MV+VEA  + L  +   AM+K G NPFV+ VY+NAL ++  +P+ 
Sbjct  1     MGVTSWLKGLAPFLGMVIVEALIVGLNTLCKAAMSK-GMNPFVYNVYSNALGTLIFLPF-  58

Query  388   IIYHRRDKAQEQlftfplllrlfflglIGVTISQNLAFVGLSYSSPIAACGTANIVPALS  567
              I+ R                         T+ Q+  F G++YSSP  A    N VPA++
Sbjct  59    FIFQR------------------------TTVMQSCLFTGVNYSSPTLASALNNQVPAIT  94

Query  568   FILAIILRRTKIDWESGGSQARMIGALICTVGTISLIFYRGPVVNNYSPTF---LHLSTT  738
             F+LA+  R  K+D  +  SQ +++G L+   G + +  Y+GP + +  P F   L+ S +
Sbjct  95    FVLAVFFRMEKLDLRNSKSQIKIMGTLVSIAGALIVTIYKGPAIVD--PQFQSTLNTSPS  152

Query  739   QFVFS--SSTNQQNWVLGCLCFIAASLTLSIWNIIQVGTIRIYPQVMKIMCVYSLFGTVQ  912
               + S  + T   NW++G +    A+L+ +IW+  Q   ++ YP    I+     FGT+Q
Sbjct  153   PKLSSHMNLTAANNWIIGGIFLTCANLSFAIWSTAQAAILKEYPSQRTILFFLYFFGTLQ  212

Query  913   SGALSLFIVRDLNAWRLGLNFQLIVILLTAIFGSIIRSSVQLWCMRMKGPSFPLIFKPVG  1092
                L+L + RD +AW +  + +LI +L TA FG ++  S+  WC+  KGP F ++FKPVG
Sbjct  213   CAILALAMERDPSAWIITPDIELISVLYTAFFGCVVAYSIMTWCIDKKGPVFAVMFKPVG  272

Query  1093  IVVASSCGCLFFADTFHYGSMFSAFICGMGYYTTIWGQLKDEEIQQ  1230
             + +A+    LF  D  + GS+  AF+  +G+Y  +W Q  + +++ 
Sbjct  273   VAIAAFMSTLFLGDALYSGSIIGAFVIVIGFYGVVWAQSMEGKVEN  318



>ref|XP_008458740.1| PREDICTED: WAT1-related protein At3g28050-like [Cucumis melo]
Length=377

 Score =   193 bits (490),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 126/373 (34%), Positives = 207/373 (55%), Gaps = 27/373 (7%)
 Frame = +1

Query  235   VVPCMAMVMVEACTIFLTIMASTAMAKFGTNPFVFVVYTNALASIFLVPYSIIYHRRDKA  414
             V+P  AM+ +E   + L  +   A A  G +  VFVVY+ + A++ L+P   I  R  + 
Sbjct  12    VLPFPAMMAMECINVGLNTLFKAATAT-GMSHHVFVVYSYSFAALLLLPSPFISRRSTRL  70

Query  415   QEQlftfplllrlfflglIGVTISQNLAFVGLSYSSPIAACGTANIVPALSFILAIILRR  594
                   F ++ ++  LGLIG + SQ + + G++YSSP  A   +N+VPA +FILAII R 
Sbjct  71    PP--LNFSVISKIALLGLIG-SCSQIMGYTGINYSSPTLASAISNLVPAFTFILAIIFRM  127

Query  595   TKIDWESGGSQARMIGALICTVGTISLIFYRGP-VVNNYSPTF---LHLSTTQFVFSSST  762
              K+  +S  SQA+++G +I   G   + FY+GP ++ + SPT    LH ++ Q     S+
Sbjct  128   EKVVLKSNSSQAKVMGTIISISGAFVVTFYKGPRIIFSSSPTISLSLHHNSQQL----SS  183

Query  763   NQQNWVLGCLCFIAASLTLSIWNIIQVGTIRIYPQVMKIMCVYSLFGTVQSGALSLFIVR  942
             +  NWV+G L   A  + + +W I+Q   ++ YP+   ++  Y+L   + +  +   + +
Sbjct  184   SDSNWVIGSLLLTAEYILVPLWYIVQTKIMKEYPEEATVVFFYNLTVGIIAAFVGFILEK  243

Query  943   DLNAWRLGLNFQLIVILLTAIFGSIIRSSVQLWCMRMKGPSFPLIFKPVGIVVASSCGCL  1122
             D +AW L  N  L  +L + +FGS + ++V  W +R+KGP F  +FKP+ IVVA   G L
Sbjct  244   DPSAWILRQNTALASVLCSGLFGSCLNNTVHTWALRLKGPVFVAMFKPLSIVVAIVMGVL  303

Query  1123  FFADTFHYGSMFSAFICGMGYYTTIWGQLKD-----EEIQQ------IKGSSVSLPDEKV  1269
             F  D+ + GS+  A I  +G+YT +WG+ K+     EE Q+      + G+  S  D++V
Sbjct  304   FLGDSLYLGSLIGASIISIGFYTVMWGKAKEEMGVGEEKQEGHSHNNLDGNKESNEDQRV  363

Query  1270  PLL----QQSQDD  1296
             PLL    + S+D 
Sbjct  364   PLLGSYNRYSEDH  376



>ref|XP_008230644.1| PREDICTED: WAT1-related protein At5g40240-like [Prunus mume]
Length=360

 Score =   192 bits (489),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 121/360 (34%), Positives = 202/360 (56%), Gaps = 17/360 (5%)
 Frame = +1

Query  235   VVPCMAMVMVEACTIFLTIMASTAMAKFGTNPFVFVVYTNALASIFLVPYSIIYHRRDKA  414
             V+P  AMVMVE   + ++ +   AM++ G + +VFVVY+NALA++ L+P   I+ ++  +
Sbjct  12    VLPFAAMVMVEFADVGVSTITKAAMSR-GMSTYVFVVYSNALATLLLLP-CFIFQKKPVS  69

Query  415   QEQlftfplllrlfflglIGVTISQNLAFVGLSYSSPIAACGTANIVPALSFILAIILRR  594
                  T  LL   F LGLIG + S  LA+ G++YSSP  A    N++P  +F+LAII R 
Sbjct  70    ----LTLSLLSGFFLLGLIGSS-SLILAYNGINYSSPTVASAMGNLIPIYTFVLAIIFRM  124

Query  595   TKIDWESGGSQARMIGALICTVGTISLIFYRG-PVVNNYSPTFLHLSTTQFVFSSS---T  762
              K+D     SQA+++G ++   G   +I Y+G P++      F  LS + F    +   +
Sbjct  125   EKLDLWRSSSQAKLLGTIVSVSGAFVVILYKGSPILK-----FKALSPSNFPPHQNLIIS  179

Query  763   NQQNWVLGCLCFIAASLTLSIWNIIQVGTIRIYPQVMKIMCVYSLFGTVQSGALSLFIVR  942
                 W+ G L    + L  +IWNI+Q   +   P  + I+  Y+ F T+Q    SL + R
Sbjct  180   QHTKWIFGGLFLALSCLLAAIWNIVQASIVNNCPSKVTIVFFYTFFVTIQCTIFSLIVER  239

Query  943   DLNAWRLGLNFQLIVILLTAIFGSIIRSSVQLWCMRMKGPSFPLIFKPVGIVVASSCGCL  1122
             + N+W L  N ++I I+ +A+FGS+ R  V  WC+  KGP F  +F+P+G+ +A+    +
Sbjct  240   NPNSWTLRPNIEMIAIVCSAVFGSVFRIGVHTWCLHQKGPIFVAMFRPLGVAIAAVMVVI  299

Query  1123  FFADTFHYGSMFSAFICGMGYYTTIWGQLKDEEI-QQIKGSSVSLPDEKVPLLQQSQDDS  1299
             F  +  H GS+  + I  +G+Y  +WGQ+K++ I  + +  S++   ++ PLLQ    ++
Sbjct  300   FLGEALHLGSVIGSVIVAIGFYAMMWGQIKEKSIVMENEVHSLASSTQQTPLLQCRTSEN  359



>ref|XP_007216831.1| hypothetical protein PRUPE_ppa022659mg [Prunus persica]
 gb|EMJ18030.1| hypothetical protein PRUPE_ppa022659mg [Prunus persica]
Length=343

 Score =   192 bits (487),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 118/353 (33%), Positives = 197/353 (56%), Gaps = 15/353 (4%)
 Frame = +1

Query  253   MVMVEACTIFLTIMASTAMAKFGTNPFVFVVYTNALASIFLVPYSIIYHRRDKAQEQlft  432
             MVMVE   + ++ ++  AM++ G + +VFVVY+NALA++ L+P   I+ ++  +     T
Sbjct  1     MVMVEFADVGISTISKAAMSR-GMSTYVFVVYSNALATLLLLP-CFIFQKKPVS----LT  54

Query  433   fplllrlfflglIGVTISQNLAFVGLSYSSPIAACGTANIVPALSFILAIILRRTKIDWE  612
               LL   F LGLIG + S  LA+ G++YSSP  A    N++P  +F+LAII R  K+D  
Sbjct  55    LSLLSGFFLLGLIGSS-SLILAYNGINYSSPTVASAMGNLIPIYTFVLAIIFRMEKLDLR  113

Query  613   SGGSQARMIGALICTVGTISLIFYRGPVVNNYSPTFLHLSTTQFVFSSS---TNQQNWVL  783
                SQA+++G ++   G   +I Y+G  +      F  LS + F    +   T    W+ 
Sbjct  114   RSSSQAKLLGTIVSVSGAFVVILYKGSAI----LLFKALSPSNFPPHQNLIITQHSKWIF  169

Query  784   GCLCFIAASLTLSIWNIIQVGTIRIYPQVMKIMCVYSLFGTVQSGALSLFIVRDLNAWRL  963
             G L    + L  +IWNI+Q   +   P  + I+  Y+ F T+Q    SL + R+ N+W L
Sbjct  170   GGLFLALSCLLAAIWNIVQASIVNNCPSKVTIVFFYTFFVTIQCTIFSLIVERNPNSWTL  229

Query  964   GLNFQLIVILLTAIFGSIIRSSVQLWCMRMKGPSFPLIFKPVGIVVASSCGCLFFADTFH  1143
               N ++I I+ +A+FGS+ R  V  WC+  KGP F  +F+P+G+ +A+    +F  +  H
Sbjct  230   RPNIEMIAIVCSAVFGSVFRIGVHTWCLHQKGPIFVAMFRPLGVAIAAVMVVIFLGEALH  289

Query  1144  YGSMFSAFICGMGYYTTIWGQLKDEEI-QQIKGSSVSLPDEKVPLLQQSQDDS  1299
              GS+  + I  +G+Y  +WGQ+K++ I  + +  S++   ++ PLLQ    ++
Sbjct  290   LGSVIGSVIVAIGFYAMMWGQIKEKSIVMENEVHSLASSTQQTPLLQCRTSEN  342



>ref|XP_002266639.2| PREDICTED: WAT1-related protein At5g40210-like [Vitis vinifera]
 emb|CBI32109.3| unnamed protein product [Vitis vinifera]
Length=350

 Score =   191 bits (485),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 113/348 (32%), Positives = 184/348 (53%), Gaps = 10/348 (3%)
 Frame = +1

Query  247   MAMVMVEACTIFLTIMASTAMAKFGTNPFVFVVYTNALASIFLVPYSIIYHRRDKAQEQl  426
             + M+++E+  + L  ++  AM++ G + FVFVVY+N  A  FL+   +++HRR       
Sbjct  8     LVMLVIESLEMGLNTISKAAMSR-GMSNFVFVVYSNTFAIPFLLLSCLLFHRRKTPPPLT  66

Query  427   ftfplllrlfflglIGVTISQNLAFVGLSYSSPIAACGTANIVPALSFILAIILRRTKID  606
              +    + +  L    +   Q   +VG+ YSSP  A    ++VPA +FILAII R   +D
Sbjct  67    TSILCRIFVLGLISCSI---QMFMYVGIRYSSPTLASAMTDLVPAFTFILAIITRMENLD  123

Query  607   WESGGSQARMIGALICTVGTISLIFYRGPVVNNYSPTFLHLSTTQFVFSSSTNQQNWVLG  786
                  S+A+ IG ++   G +++  Y GP V      F  L++T+   + +  Q NWV+G
Sbjct  124   LRVRSSRAKSIGTIMSITGALTMTMYEGPPV-----AFTSLTSTKLNGNVTLPQSNWVIG  178

Query  787   CLCFIAASLTLSIWNIIQVGTIRIYPQVMKIMCVYSLFGTVQSGALSLFIVRDLNAWRLG  966
              +    A+  L++  + Q   IR YP  + +  +   F  +QS  +SL   R+ +AWRL 
Sbjct  179   GILSAIAAFMLAVLFVFQTSIIRAYPAELMVTLICCTFVAMQSSIVSLMAERNPSAWRLR  238

Query  967   LNFQLIVILLTAIFGSIIRSSVQLWCMRMKGPSFPLIFKPVGIVVASSCGCLFFADTFHY  1146
              + +LI I+ +A+    +RS    W MR KGP F  +FKPVGI++A   G  F  DT + 
Sbjct  239   PDIELIAIVYSAVLVVGLRSVASAWVMRRKGPFFAAMFKPVGIIIAVVMGVTFLGDTLYL  298

Query  1147  GSMFSAFICGMGYYTTIWGQLKDEE-IQQIKGSSVSLPDEKVPLLQQS  1287
             GS+  A I  +G+YT +WG+ K+E  ++ +    +      VPLLQ  
Sbjct  299   GSVVGAAIIAIGFYTVMWGKDKEETLLEDVPAHGMESSSHNVPLLQNK  346



>gb|KCW85790.1| hypothetical protein EUGRSUZ_B02542 [Eucalyptus grandis]
Length=318

 Score =   190 bits (483),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 110/319 (34%), Positives = 172/319 (54%), Gaps = 3/319 (1%)
 Frame = +1

Query  340   VVYTNALASIFLVPYSIIYHRRDKAQEQlftfplllrlfflglIGVTISQNLAFVGLSYS  519
             V Y + ++S+ L+P   I  RR  +   L    L         +G+ ++Q  A+ G+ YS
Sbjct  2     VFYCHVVSSLVLLPCPFIISRRSGSCPPLTFTVLRKIFLLAL-VGL-VAQICAYAGIDYS  59

Query  520   SPIAACGTANIVPALSFILAIILRRTKIDWESGGSQARMIGALICTVGTISLIFYRGPVV  699
             SP+      N++PA +FILA+I R  K++W+S  S A+++G +   VG   +  Y+GP +
Sbjct  60    SPVLGTAMMNLIPAFTFILAVISRMEKVNWKSSSSHAKLVGTIASIVGASVVTLYKGPPI  119

Query  700   NNYSPTFLHLSTTQFVFSSSTNQQNWVLGCLCFIAASLTLSIWNIIQVGTIRIYPQVMKI  879
                 P   ++   Q +   S  Q NW+LG     A +  LS+W IIQ   ++ YP V+ I
Sbjct  120   LRSPPPLPYVQPRQLLLILS-RQSNWILGGFLLTADAFLLSLWYIIQTSILKDYPVVLNI  178

Query  880   MCVYSLFGTVQSGALSLFIVRDLNAWRLGLNFQLIVILLTAIFGSIIRSSVQLWCMRMKG  1059
             M    LFGT+ +G LS   VR+  +W L L+  LI IL +A+  SI   ++  WC++  G
Sbjct  179   MFYKVLFGTILAGLLSFITVREPRSWILKLDRGLIAILYSAVVVSIFSLTLCTWCLKRTG  238

Query  1060  PSFPLIFKPVGIVVASSCGCLFFADTFHYGSMFSAFICGMGYYTTIWGQLKDEEIQQIKG  1239
             P +  +FKP GIV A   G +F  +T H GS+  A +  MG+Y  +WG+ K+EE +  +G
Sbjct  239   PVYVAMFKPFGIVFAVGLGFIFLGETLHLGSLIGAMVIAMGFYGVVWGKSKEEEERTTEG  298

Query  1240  SSVSLPDEKVPLLQQSQDD  1296
              S++    K+PLLQ     
Sbjct  299   GSLASSSHKIPLLQNKASS  317



>ref|XP_011025524.1| PREDICTED: WAT1-related protein At3g28050-like isoform X2 [Populus 
euphratica]
 ref|XP_011025530.1| PREDICTED: WAT1-related protein At3g28050-like isoform X2 [Populus 
euphratica]
Length=351

 Score =   191 bits (484),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 115/367 (31%), Positives = 190/367 (52%), Gaps = 20/367 (5%)
 Frame = +1

Query  208   MEVKAAFGEVVPCMAMVMVEACTIFLTIMASTAMAKFGTNPFVFVVYTNALASIFLVPYS  387
             M +KAA    VP + MVM E   + L I++  AM+   TN F+FV+Y+NALAS+ L+P S
Sbjct  1     MGLKAA----VPFVGMVMAECAQVGLMILSKAAMSDGMTN-FIFVLYSNALASLILLPSS  55

Query  388   IIYHRRDKAQEQlftfplllrlfflglIGV--TISQNLAFVGLSYSSPIAACGTANIVPA  561
                HR ++             L    L+G+   ++Q   + G++ SS        N++P 
Sbjct  56    FFLHRSERPP------LTFPILCGFFLLGLFGWLAQIFGYAGINLSSATLGTAMLNLIPG  109

Query  562   LSFILAIILRRTKIDWESGGSQARMIGALICTVGTISLIFYRGPVVNNYSPTFLHLSTTQ  741
             L+FILA+  R  K+DW S  +  +  G ++   G   + +Y+GP      P  +  ST+ 
Sbjct  110   LTFILAVAFRMEKLDWRSSSALVKSTGTVVSVAGAFIVCYYKGP------PLLMAPSTSN  163

Query  742   FVFSSSTNQQNWVLGCLCFIAASLTLSIWNIIQVGTIRIYPQVMKIMCVYSLFGTVQSGA  921
                   + QQNW++G L      +  S W IIQ   ++ YP  + ++  Y    T+ S  
Sbjct  164   LPHELLSQQQNWIIGGLLLAVDCVMASAWLIIQALILKKYPAELIVVFFYCFSVTILSTI  223

Query  922   LSLFIVRDLNAWRLGLNFQLIVILLTAIFGSIIRSSVQLWCMRMKGPSFPLIFKPVGIVV  1101
             + LF+ RD  AW L    + I ++ + +FGS  +  +  WC+   GP F  +FKP+GIV+
Sbjct  224   VCLFMERDPGAWSLKPTVRWIAVVYSGVFGSAFQVGISTWCLHKTGPVFVAMFKPLGIVI  283

Query  1102  ASSCGCLFFADTFHYGSMFSAFICGMGYYTTIWGQLKDEEIQQIKG-SSVSLPDEKVPLL  1278
             A++   +   DT + GS+  A +  +G+Y+ +WG+ K+E++    G  S     +KVPLL
Sbjct  284   AAAVSTICLRDTLYLGSLVGATVIVIGFYSVMWGKAKEEKVGVDDGVRSFESSSQKVPLL  343

Query  1279  QQSQDDS  1299
             Q   +++
Sbjct  344   QSHTEET  350



>gb|KHG27655.1| Auxin-induced 5NG4 [Gossypium arboreum]
Length=350

 Score =   191 bits (484),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 119/360 (33%), Positives = 182/360 (51%), Gaps = 24/360 (7%)
 Frame = +1

Query  220   AAFGEVVPCMAMVMVEACTIFLTIMASTAMAKFGTNPFVFVVYTNALASIFLVPYSIIYH  399
             A  G +VP + MVMV    +   ++   AM+  G + +V +VY+NAL+S+ L+P S ++H
Sbjct  11    AKMGNLVPFVGMVMVILAQVSSMVITKAAMSS-GVDKYVLIVYSNALSSLILLPCSFVFH  69

Query  400   RRDKAQEQlftfplllrlfflglIGVTISQNLAFVGLSYSSPIAACGTANIVPALSFILA  579
             R         +  L + +F L LIG  I Q   + G+ YSSP  A    N+VPA +FILA
Sbjct  70    R--SVHLPWNSSNLCILIFLLSLIG-CIGQLCGYAGIEYSSPAMATAMLNLVPAFTFILA  126

Query  580   IILRRTKIDWESGGSQARMIGALICTVGTISLIFYRGPVVNNYSPTFLHLSTTQFVFSSS  759
             I+ R  K  W S  SQA+++G  I   G   + FY+GP +       L           S
Sbjct  127   IVCRMEKHKWRSTSSQAKVLGTTISIAGAFVVTFYKGPTILRLPHQLL-----------S  175

Query  760   TNQQNWVLGCLCFIAASLTLSIWNIIQVGTIRIYPQVMKIMCVYSLFGTVQSGALSLFIV  939
             + Q NW+LG L     +   S W +IQ   ++ +P V+ +M     F  + S   SLF+V
Sbjct  176   SPQINWILGGLLLAVEAFINSAWYVIQTMVLKKFPAVLTVMFYLCFFNAILSAIYSLFLV  235

Query  940   RDLNAWRLGLNFQLIVILLTAIFGSIIRSSVQLWCMRMKGPSFPLIFKPVGIVVASSCGC  1119
             +DL+AW+L  N  L+ IL +AI  +  R S+  WC+   GP +  +FKP+  + A+  G 
Sbjct  236   KDLSAWKLKPNIGLVAILYSAIVATTFRISLCSWCLWKVGPLYVSMFKPLATIFAAVMGI  295

Query  1120  LFFADTFHYGSMFSAFICGMGYYTTIWGQLKDEEIQQIKGSSVSLPDEKVPLLQQSQDDS  1299
             +F  D    G +  A I   G+Y  +WG+ K+E  ++           + PLLQ   +D 
Sbjct  296   VFLGDDLSLGRVIGAIIIVSGFYGVLWGKAKEESGEE---------SLRSPLLQNRTEDK  346



>ref|XP_002265468.2| PREDICTED: WAT1-related protein At5g40240-like isoform X1 [Vitis 
vinifera]
Length=348

 Score =   190 bits (483),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 112/346 (32%), Positives = 182/346 (53%), Gaps = 10/346 (3%)
 Frame = +1

Query  253   MVMVEACTIFLTIMASTAMAKFGTNPFVFVVYTNALASIFLVPYSIIYHRRDKAQEQlft  432
             M+++E   + L+ ++  AM + G + FVFVVY+NAL+   L+   +++HRR        +
Sbjct  10    MLIIECLEVGLSTLSKAAMRR-GMSDFVFVVYSNALSVPILLFCCLLFHRRRFPPPLTLS  68

Query  433   fplllrlfflglIGVTISQNLAFVGLSYSSPIAACGTANIVPALSFILAIILRRTKIDWE  612
                 + +          +Q   FVG+ YSSP  A    ++VPA +FILAII R  K+D +
Sbjct  69    ILCRIFILGFISCS---TQMFLFVGIRYSSPTLASAMTDLVPAFTFILAIISRMEKLDLK  125

Query  613   SGGSQARMIGALICTVGTISLIFYRGPVVNNYSPTFLHLSTTQFVFSSSTNQQNWVLGCL  792
             +G  +A+ IG ++  +G + +  Y+GP +   S TF  L          +   NWV+G  
Sbjct  126   AGSCRAKCIGTIVSIIGALIVTIYKGPQIAFASSTFKILDENL-----RSQISNWVIGGF  180

Query  793   CFIAASLTLSIWNIIQVGTIRIYPQVMKIMCVYSLFGTVQSGALSLFIVRDLNAWRLGLN  972
                 ++++++++ ++Q   IR YP  + +  +  +F T+QS  +SL   RD +AWRL  +
Sbjct  181   LLAISAVSIALFYVVQTSIIRDYPAELMLTFICHIFVTMQSSIVSLIAERDPSAWRLKPD  240

Query  973   FQLIVILLTAIFGSIIRSSVQLWCMRMKGPSFPLIFKPVGIVVASSCGCLFFADTFHYGS  1152
              +LI +  +A+     R +   W +  KGP F  +FKPV IV+A   G  F  D  H GS
Sbjct  241   VELIAVGYSAVLVLAFRGTAHAWVLHKKGPVFVAMFKPVAIVIAVVMGVTFLGDVLHLGS  300

Query  1153  MFSAFICGMGYYTTIWGQLKDEEIQQIKGSSVSLPDEKVPLLQQSQ  1290
             +  A I   G+YT +WG+ K EEI+ +  S +     K PLLQ   
Sbjct  301   VIGAAIIAFGFYTVMWGKAK-EEIEDMTTSGIDSSSHKDPLLQNKS  345



>ref|XP_004239354.1| PREDICTED: WAT1-related protein At3g28050-like isoform X1 [Solanum 
lycopersicum]
Length=345

 Score =   190 bits (482),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 120/353 (34%), Positives = 191/353 (54%), Gaps = 20/353 (6%)
 Frame = +1

Query  235   VVPCMAMVMVEACTIFLTIMASTAMAKFGTNPFVFVVYTNALASIFLVPYSI-IYHRRDK  411
             ++P + MV+     +   I++  AM+K G + F+ VVY+NA+A++ L P SI I+  R +
Sbjct  10    LMPSVGMVITIIAIVTSMIISKIAMSK-GLSSFIIVVYSNAVATLILFPPSIFIFITRSR  68

Query  412   AQEQlftfplllrlfflglIGVTISQNLAFVGLSYSSPIAACGTANIVPALSFILAIILR  591
             +          +    +  +     Q   +VG+SYSSP  A    N++P  +FILAI  R
Sbjct  69    SHP---LTFSAIWRILMLALNGCFGQICDYVGISYSSPTLATAMLNLIPGFTFILAITFR  125

Query  592   RTKIDWESGGSQARMIGALICTVGTISLIFYRGPVVNNYSPTFLHLSTTQFVFSSSTNQQ  771
                I+W+S  S A+  G  +   G   L FY+GP + N      HL++T   FSS   QQ
Sbjct  126   MEVINWKSWSSYAKAFGTFVSIGGAFVLTFYKGPPIINQ-----HLTST---FSS---QQ  174

Query  772   NWVLGCLCFIAASLTLSIWNIIQVGTIRIYPQVMKIMCVYSLFGTVQSGALSLFIVRDLN  951
             NW+LG +     S++ S+W IIQ   ++IY + M I+C+Y  F T+ S  +SL + R+ N
Sbjct  175   NWILGGVILACESMSTSLWYIIQASILKIYQEEMVIVCLYCFFVTIISTLISLVVERNTN  234

Query  952   AWRLGLNFQLIVILLTAIFGSIIRSSVQLWCMRMKGPSFPLIFKPVGIVVASSCGCLFFA  1131
             AW + L+ +LI IL + I G   RS +  WC++   P F  +FKP  IV A   G   F 
Sbjct  235   AWIIYLDIRLIAILYSGIIGIAFRSCMTTWCLKKTDPLFVSMFKPFAIVFAILIGTFCFR  294

Query  1132  DTFHYGSMFSAFICGMGYYTTIWGQLKDEEIQQIKGSSV-SLPDEKVPLLQQS  1287
             D F+ GS+  +    +G+Y  +WG+ +++  +   G+++ +L +  VPLLQ  
Sbjct  295   DAFYLGSLVGSVTTVIGFYAVMWGKTQEKYYE---GNNLETLAENNVPLLQNE  344



>gb|ABK93545.1| unknown [Populus trichocarpa]
Length=265

 Score =   187 bits (476),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 92/250 (37%), Positives = 143/250 (57%), Gaps = 4/250 (2%)
 Frame = +1

Query  487   QNLAFVGLSYSSPIAACGTANIVPALSFILAIILRRTKIDWESGGSQARMIGALICTVGT  666
             QN  F G+SYSSP  A     ++PA +F+LA+I R  K+DW S  S+ +++G L+   G 
Sbjct  2     QNCVFTGVSYSSPTLASAMGQLIPAFTFLLAVIFRMEKLDWRSSRSRIKIMGTLVSVSGA  61

Query  667   ISLIFYRGPVVNNYSPTFLHLSTTQFVFSSSTNQQNWVLGCLCFIAASLTLSIWNIIQVG  846
             +++  Y+GP +   +      S    + S  +   +W++G L  + A L +SI+  +Q  
Sbjct  62    LTITLYKGPAIGAITTQ----SNPDPIPSIMSTANSWIIGGLFLVTADLCVSIFTTLQAA  117

Query  847   TIRIYPQVMKIMCVYSLFGTVQSGALSLFIVRDLNAWRLGLNFQLIVILLTAIFGSIIRS  1026
              ++ YP  M ++    LFGT+QS  +SL   R+ NAW+L  + +LI I+ +A+ GS++  
Sbjct  118   ILKEYPSEMAMVSFLCLFGTIQSSIVSLIAERNPNAWKLRPDIELISIIYSAVVGSVVTF  177

Query  1027  SVQLWCMRMKGPSFPLIFKPVGIVVASSCGCLFFADTFHYGSMFSAFICGMGYYTTIWGQ  1206
              V  WC+R KGP F  IFKPVGI  A+  G +F  DT H GS+  A I   G+Y  IW Q
Sbjct  178   GVTAWCIRKKGPVFVAIFKPVGIATAAFLGVIFLGDTLHVGSIVGAIIIVAGFYGVIWAQ  237

Query  1207  LKDEEIQQIK  1236
              K++E  ++ 
Sbjct  238   SKEDEHSKVN  247



>ref|XP_004304599.1| PREDICTED: auxin-induced protein 5NG4-like [Fragaria vesca subsp. 
vesca]
Length=390

 Score =   191 bits (484),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 115/361 (32%), Positives = 193/361 (53%), Gaps = 21/361 (6%)
 Frame = +1

Query  214   VKAAFGEVVPCMAMVMVEACTIFLTIMASTAMAKFGTNPFVFVVYTNALASIFLVPYSII  393
             V   + +V+P  AMVMV+   I  + +   AM+K G + +V V Y+NAL +IFL+P  I+
Sbjct  38    VTCTWSDVLPFAAMVMVQFTDIGQSTINKAAMSK-GVSSYVLVAYSNALGTIFLLPCFIL  96

Query  394   YHRRDKAQEQlftfplllrlfflglIGVTISQNL--AFVGLSYSSPIAACGTANIVPALS  567
              ++                L    L+G+  S +L  A+ G++YSSP  A   AN++P  +
Sbjct  97    LNK---------VSLTFSLLGGQFLLGIIGSSSLLLAYNGVNYSSPTLASAMANLIPIFT  147

Query  568   FILAIILRRTKIDWESGGSQARMIGALICTVGTISLIFYRGPVVNNYSPTFLHLSTTQFV  747
             FILA+I R  K+D      QA+++G ++   G   +I Y+G V+  +SP+    ++    
Sbjct  148   FILAVIFRMEKLDLRRSSCQAKVLGTIVSVSGAFVIILYKGSVI--FSPS----NSPDQN  201

Query  748   FSSSTNQQNWVLGCLCFIAASLTLSIWNIIQVGTIRIYPQVMKIMCVYSLFGTVQSGALS  927
             F   + Q  W LG L      L  + W I+Q   ++  P ++ I+  Y+ F T+Q    S
Sbjct  202   FMMISQQLKWGLGGLMLAMVCLLNATWGILQTEMVKNCPSMITILFFYNFFVTIQCTIFS  261

Query  928   LFIVRDLNAWRLGLNFQLIVILLTAIFGSIIRSSVQLWCMRMKGPSFPLIFKPVGIVVAS  1107
             LF+ R+ NAW +  + +++ I+ +A+FGS+    VQ WC+  KGP F  +F+P+G+ +A+
Sbjct  262   LFMERNRNAWIIRPDIEMVSIVFSALFGSLFHVGVQTWCLHQKGPIFVAMFRPLGVAIAA  321

Query  1108  SCGCLFFADTFHYGSMFSAFICGMGYYTTIWGQLKDEEIQQIKGSSVSLP---DEKVPLL  1278
                 +F  +  H GS+  + I  +G+Y  +W Q+K++    +K    SL     +K PLL
Sbjct  322   VMVVIFLGEALHLGSVIGSIIIAVGFYAMMWAQIKEKNTTLMKDEVQSLAPSSTQKTPLL  381

Query  1279  Q  1281
             Q
Sbjct  382   Q  382



>ref|XP_004304595.1| PREDICTED: auxin-induced protein 5NG4-like [Fragaria vesca subsp. 
vesca]
Length=348

 Score =   189 bits (480),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 117/368 (32%), Positives = 200/368 (54%), Gaps = 25/368 (7%)
 Frame = +1

Query  208   MEVKAAFGEVVPCMAMVMVEACTIFLTIMASTAMAKFGTNPFVFVVYTNALASIFLVPYS  387
             M  ++ + +V+P +AMV VE+  + L I+  +A ++ G + +VF+VY+ A A++ L+P  
Sbjct  1     MAGRSCYRDVLPFVAMVTVESTNVGLNILFKSATSR-GMSNYVFIVYSYAFATVLLLPLP  59

Query  388   IIYHRRDKAQEQlftfplllrlfflglIGVTISQNLAFVGLSYSSPIAACGTANIVPALS  567
              ++  R +     F   L+++ F LG IG  ++   A+ G+ YSSP  A   +N+ PA +
Sbjct  60    FVFPSRTRLPP--FELSLIVKAFILGFIGF-MANICAYKGIDYSSPTLASAISNLTPAFT  116

Query  568   FILAIILRRTKIDWESGGSQARMIGALICTVGTISLIFYRGPVVNNYSPTFLHLSTTQFV  747
             FILAII R   +   S  +QA++IG L+   G + ++ YRGP+V                
Sbjct  117   FILAIIFRMEMLSMRSTSTQAKVIGTLVSISGALVVVLYRGPIV----------------  160

Query  748   FSSSTNQQNWVLGCLCFIAASLTLSIWNIIQVGTIRIYPQVMKIMCVYSLFGTVQSGALS  927
               S+ ++++WV G L      L  S W+I+Q   ++ YP  + +  +Y+LFGT+ S    
Sbjct  161   -LSTASEKDWVKGGLLLTVGYLLFSTWSILQTHIMKTYPAELVLALLYNLFGTIVSAPFC  219

Query  928   LFIVR-DLNAWRLGLNFQLIVILLTAIFGSIIRSSVQLWCMRMKGPSFPLIFKPVGIVVA  1104
             + I   +L+AWRL     L  I+ + IF S + + V+ W + +KGP +  IFKP+ IV+A
Sbjct  220   VLIAETNLSAWRLRPGVALAAIIYSGIFSSALSTVVKTWSLNLKGPVYVSIFKPLSIVIA  279

Query  1105  SSCGCLFFADTFHYGSMFSAFICGMGYYTTIWGQLKDEEIQQIKGSSVSLPDE---KVPL  1275
             ++   +F  D    GS+  A +  +G+Y  IWG+ K+EE    +    SL +    + PL
Sbjct  280   AASSVIFLGDDLFLGSIIGAVMISIGFYGVIWGKTKEEEKMDQEYGFDSLRESHSCEAPL  339

Query  1276  LQQSQDDS  1299
             L+  + +S
Sbjct  340   LETYKAES  347



>gb|KCW87483.1| hypothetical protein EUGRSUZ_B03945 [Eucalyptus grandis]
Length=349

 Score =   189 bits (480),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 120/354 (34%), Positives = 183/354 (52%), Gaps = 10/354 (3%)
 Frame = +1

Query  247   MAMVMVEACTIFLTIMASTAMAKFGTNPFVFVVYTNALASIFLVPYSIIYHRRDKAQEQl  426
             M M+MV        ++   AM++ G N +  V Y+NAL+S+ L+P  +I  RR  +   L
Sbjct  1     MGMIMVVLVQTSNMVVTKMAMSE-GMNKYTMVFYSNALSSLVLLPCPLIISRRPGSCPPL  59

Query  427   ftfplllrlfflglIGVTISQNLAFVGLSYSSPIAACGTANIVPALSFILAIILRRTKID  606
                 L         IG+   Q   +VG+ YSSP+      N++PA +FILAII R  K++
Sbjct  60    TFSVLRKIFLIAL-IGLA-CQMCEYVGMDYSSPVLGMAMMNLIPAFTFILAIISRMEKVN  117

Query  607   WESGGSQARMIGALICTVGTISLIFYRGPVVNNYSPTFLHLSTTQFVFSSSTNQQNWVLG  786
             W+S  SQA+++G +   +G   +  Y+GP +                  S   Q NW+LG
Sbjct  118   WKSSSSQAKLVGTITSILGAFVVTLYKGPPILLSPSPPPVQPRHPPFLLS--RQSNWILG  175

Query  787   CLCFIAASLTLSIWNIIQVGTIRIYPQVMKIMCVYSLFGTVQSGALSLFIVRDLNAWRLG  966
                 +A +  +S+W I Q   ++ YP VM +M   + F TV SG LS   VR+   W L 
Sbjct  176   GFLLVAEAFLISLWFIGQAFILKDYPVVMNLMFYSTFFSTVLSGLLSFVTVREPQFWILK  235

Query  967   LNFQLIVILLTAIFGSIIRSSVQLWCMRMKGPSFPLIFKPVGIVVASSCGCLFFADTFHY  1146
             +N  LI IL +A+   + R+S+  WC++  GP +  +FKP+G+V A+  G +F  +  + 
Sbjct  236   VNIGLISILYSALVSGVFRASLCTWCLKKTGPVYVSMFKPLGVVFAAGLGFIFLGEMLYL  295

Query  1147  GSMFSAFICGMGYYTTIWGQLKDEEIQQIKGSSV--SLPD--EKVPLLQQSQDD  1296
             GS+  A +  MG+Y  +WG+ K+EE   I+GS V  SL     K PLLQ     
Sbjct  296   GSIIGAIVIVMGFYGVMWGKSKEEE-TTIEGSGVGESLASSVHKTPLLQNKASS  348



>ref|XP_007224400.1| hypothetical protein PRUPE_ppa021705mg [Prunus persica]
 gb|EMJ25599.1| hypothetical protein PRUPE_ppa021705mg [Prunus persica]
Length=350

 Score =   189 bits (480),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 119/354 (34%), Positives = 198/354 (56%), Gaps = 12/354 (3%)
 Frame = +1

Query  238   VPCMAMVMVEACTIFLTIMASTAMAKFGTNPFVFVVYTNALASIFLVPYSIIYHRRDKAQ  417
             +P + M+M E     + I++  AM+  G +  +FV Y+NALA++ L+P S+ +HR     
Sbjct  7     LPIVGMMMTECAGAGVIILSKAAMST-GMSNLIFVFYSNALAALILLPTSLAFHR----S  61

Query  418   EQlftfplllrlfflglIGVTISQNLAFVGLSYSSPIAACGTANIVPALSFILAIILRRT  597
                 TFP+L   F LGLIG  ++Q + + G++YSSP       N++PA + ILA+I R  
Sbjct  62    RPPLTFPVLCWFFLLGLIGF-VAQFVGYAGINYSSPTLGTAMLNLLPAFTCILAVIFRME  120

Query  598   KIDWESGGSQARMIGALICTVGTISLIFYRGPVVNNYSPTFLHLSTTQFVFSSSTNQQNW  777
              +DW S  + A+ +G ++   G   +  Y+GP +   S T + LS  Q      + Q NW
Sbjct  121   TVDWRSSSTLAKSLGTMLSISGAFIVTLYKGPALLLTSSTDI-LSYKQLF----SQQSNW  175

Query  778   VLGCLCFIAASLTLSIWNIIQVGTIRIYPQVMKIMCVYSLFGTVQSGALSLFIVRDLNAW  957
             V+G +  +   +  S   IIQ   I+ YP  + ++  Y  F  +Q+  +SL +  DL+AW
Sbjct  176   VIGGILLLVYCVLASSSYIIQASVIKKYPAELIMVFYYCFFVAIQAVVVSLIVETDLSAW  235

Query  958   RLGLNFQLIVILLTAIFGSIIRSSVQLWCMRMKGPSFPLIFKPVGIVVASSCGCLFFADT  1137
              L    +LI ++ +A+FGS     V  WC+   GP F  +FKP+GI+VA S G  F  DT
Sbjct  236   SLKPKMRLIAVVYSAVFGSTFTIGVTTWCLHRAGPVFIAMFKPLGIIVAVSIGVTFVGDT  295

Query  1138  FHYGSMFSAFICGMGYYTTIWGQLKDEEIQ-QIKGSSVSLPDEKVPLLQQSQDD  1296
             F+ GS+  A +  +G+Y+ +WG+  +E++    +  S++  +++VPLLQ + ++
Sbjct  296   FYLGSLVGAIVIVIGFYSVMWGKANEEKMDGGAETKSLATSNQRVPLLQNTLEE  349



>gb|KGN52391.1| hypothetical protein Csa_5G630930 [Cucumis sativus]
Length=338

 Score =   187 bits (476),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 117/330 (35%), Positives = 188/330 (57%), Gaps = 22/330 (7%)
 Frame = +1

Query  334   VFVVYTNALASIFLVPYSIIYHRRDKAQEQlftfplllrlfflglIGVTISQNLAFVGLS  513
             VFVVY+ + A++ L+P   I   R   +     F +  ++  LGLIG + SQ + + G++
Sbjct  5     VFVVYSYSFAALLLLPSPFI--SRTSTRLPPLNFSITSKIALLGLIG-SCSQIMGYTGIN  61

Query  514   YSSPIAACGTANIVPALSFILAIILRRTKIDWESGGSQARMIGALICTVGTISLIFYRGP  693
             YSSP  A   +N+VPA +FILAII R  K+  +S  SQA+++G +I   G   + FY+GP
Sbjct  62    YSSPTLASAISNLVPAFTFILAIIFRMEKVVLKSNSSQAKVMGTIISISGAFVVTFYKGP  121

Query  694   -VVNNYSPTF---LHLSTTQFVFSSSTNQQNWVLGCLCFIAASLTLSIWNIIQVGTIRIY  861
              ++ + SPT    LH ++ Q     S++  NWV+G L   A  + + +W I+Q   ++ Y
Sbjct  122   RIIFSSSPTISLSLHHNSQQL----SSSDSNWVIGSLLLTAEYILVPLWYIVQTKIMKEY  177

Query  862   PQVMKIMCVYSLFGTVQSGALSLFIVRDLNAWRLGLNFQLIVILLTAIFGSIIRSSVQLW  1041
             P+   ++  Y+L   + +  + L + +D +AW L  N  L  IL + +FGS + ++V  W
Sbjct  178   PEEATVVFFYNLTVAIIAAFVGLILEKDPSAWILRQNTALASILCSGLFGSCLNNTVHTW  237

Query  1042  CMRMKGPSFPLIFKPVGIVVASSCGCLFFADTFHYGSMFSAFICGMGYYTTIWGQLKD--  1215
              +R+KGP F  +FKP+ IVVA   G LF  D+ + GS+  A I  +G+YT +WG+ K+  
Sbjct  238   ALRLKGPVFVAMFKPLSIVVAIVMGVLFLGDSLYLGSLIGASIISIGFYTVMWGKAKEEM  297

Query  1216  ---EEIQQ------IKGSSVSLPDEKVPLL  1278
                EE Q+      + G+  S  D++VPLL
Sbjct  298   GVGEEKQEGHSHNNLDGNKESNEDQRVPLL  327



>ref|XP_007151109.1| hypothetical protein PHAVU_004G018600g [Phaseolus vulgaris]
 gb|ESW23103.1| hypothetical protein PHAVU_004G018600g [Phaseolus vulgaris]
Length=364

 Score =   188 bits (478),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 116/354 (33%), Positives = 191/354 (54%), Gaps = 6/354 (2%)
 Frame = +1

Query  238   VPCMAMVMVEACTIFLTIMASTAMAKFGTNPFVFVVYTNALASIFLVPYSIIYHRRDKAQ  417
             +P + ++ +E   + L  +   A  + G N  VFV Y  A+A+  L+P +  +HRR +  
Sbjct  12    LPILVLLGIECNDMALLTLFKVASLQ-GMNSHVFVAYAYAVATTVLLPVTF-FHRRSRGV  69

Query  418   EQlftfplllrlfflglIGVTISQNLAFVGLSYSSPIAACGTANIVPALSFILAIILRRT  597
               +    L   +     IG + SQ L + G+SYSSP  A     +VPA +FILA++ R  
Sbjct  70    PPISFSILSKIVLLGV-IGSS-SQILGYAGISYSSPALASSIGILVPAFTFILAVLCRME  127

Query  598   KIDWESGGSQARMIGALICTVGTISLIFYRGPVVNNYSPTFLHLSTTQFVFSSSTNQQNW  777
             K+  +S  SQA+++G++I   G   L FY+GP + N +   L LS  Q +    +   +W
Sbjct  128   KLAAKSRSSQAKVMGSIISISGAFVLTFYKGPSILN-AHKHLSLSLQQPMNFLKSEDASW  186

Query  778   VLGCLCFIAASLTLSIWNIIQVGTIRIYPQVMKIMCVYSLFGTVQSGALSLFIVRDLNAW  957
               G +  I   +  S+W I++   +R++P  + ++  YS+  T+ +  + LF V D +AW
Sbjct  187   ATGGILLIGDYILTSVWYILEEDILRVFPDELTLVFFYSVTATIFTTTVGLFGVPDASAW  246

Query  958   RLGLNFQLIVILLTAIFGSIIRSSVQLWCMRMKGPSFPLIFKPVGIVVASSCGCLFFADT  1137
             ++GLN  LI I+ + IFG ++ + V  W + +KG  F   F+P  IV+A   G +F  DT
Sbjct  247   KIGLNVSLISIVCSGIFGKLMSNVVYAWALNLKGSVFVTSFRPFQIVIAVGMGVMFLDDT  306

Query  1138  FHYGSMFSAFICGMGYYTTIWGQLKDEEIQQIKGSSVSLPDEKVPLLQQSQDDS  1299
              + GS+  A I  +G Y  +WG+   EEI+++ GS  S   E VPLLQ  + ++
Sbjct  307   LYIGSVVGAIIVSIGLYVVLWGK-ATEEIEEVVGSLESPTTENVPLLQSQRTET  359



>ref|XP_006355963.1| PREDICTED: WAT1-related protein At3g28050-like [Solanum tuberosum]
Length=345

 Score =   187 bits (476),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 124/352 (35%), Positives = 197/352 (56%), Gaps = 18/352 (5%)
 Frame = +1

Query  235   VVPCMAMVMVEACTIFLTIMASTAMAKFGTNPFVFVVYTNALASIFLVPYSIIYHRRDKA  414
             ++P + M+      +   I++  AM+K G + F+ VVY+NA+A++ L P SI +    ++
Sbjct  10    LMPSVGMIFAIIAIVISMIISKIAMSK-GLSSFIIVVYSNAIATLILFPPSI-FIFITRS  67

Query  415   QEQlftfplllrlfflglIGVTISQNLAFVGLSYSSPIAACGTANIVPALSFILAIILRR  594
             + +  TF +  R+  L LIG    Q   +VG+SYSSP  A    N++P  +FILAI  R 
Sbjct  68    RRRPLTFSVFWRILLLALIGY-FGQICDYVGISYSSPTLATAMLNLIPGFTFILAITFRM  126

Query  595   TKIDWESGGSQARMIGALICTVGTISLIFYRGPVVNNYSPTFLHLSTTQFVFSSSTNQQN  774
               I+W+S  S A++ G  +   G   L FY+GP + N      HL++T   FSS   QQN
Sbjct  127   EVINWKSWSSYAKVFGTFVLIGGAFVLTFYKGPPIINQ-----HLTST---FSS---QQN  175

Query  775   WVLGCLCFIAASLTLSIWNIIQVGTIRIYPQVMKIMCVYSLFGTVQSGALSLFIVRDLNA  954
             W+LG +     S++ S+W IIQ   ++IY + M I+C+YS F T+ S  +SL + R+ NA
Sbjct  176   WILGGVILACESMSASLWYIIQASILKIYQEEMIIVCLYSFFVTIISALISLLVERNPNA  235

Query  955   WRLGLNFQLIVILLTAIFGSIIRSSVQLWCMRMKGPSFPLIFKPVGIVVASSCGCLFFAD  1134
             W +  + +LI IL + I G   RS +  WC++   P F  +FKP  IV A   G   F D
Sbjct  236   WMIYPDIRLIAILYSGIVGIAFRSCMTTWCLKKTDPLFVSMFKPFAIVFALLIGTFCFRD  295

Query  1135  TFHYGSMFSAFICGMGYYTTIWGQLKDEEIQQIKGSSV-SLPDEKVPLLQQS  1287
              F+ GS+  +    +G+Y  +WG+ +++  +   G+++ +L +  VPLLQ  
Sbjct  296   VFYLGSLVGSVTTVIGFYGVMWGKTQEKYYE---GNNLETLAENNVPLLQNE  344



>ref|XP_002311582.1| hypothetical protein POPTR_0008s14510g [Populus trichocarpa]
 gb|EEE88949.1| hypothetical protein POPTR_0008s14510g [Populus trichocarpa]
Length=355

 Score =   187 bits (476),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 114/366 (31%), Positives = 186/366 (51%), Gaps = 13/366 (4%)
 Frame = +1

Query  208   MEVKAAFGEVVPCMAMVMVEACTIFLTIMASTAMAKFGTNPFVFVVYTNALASIFLVPYS  387
             M +KAA     P + MVM E   + L I++  AM+   TN F+FV+Y+NALAS+ L+P S
Sbjct  1     MGLKAA----APFVGMVMAECAQVGLMILSKAAMSDGMTN-FIFVLYSNALASLILLPSS  55

Query  388   IIYHRRDKAQEQlftf-plllrlfflglIGVTISQNLAFVGLSYSSPIAACGTANIVPAL  564
                HR ++            L   F   I +       + G++ SS        N++P L
Sbjct  56    FFLHRSERPPLTFPILCGFFLLGLFGYAILIYFDFIFGYAGINLSSATLGTAMLNLIPGL  115

Query  565   SFILAIILRRTKIDWESGGSQARMIGALICTVGTISLIFYRGPVVNNYSPTFLHLSTTQF  744
             +FILA+  R  K+DW+S  +  +  G ++   G   + +Y+GP      P  +  ST+  
Sbjct  116   TFILAVAFRMEKLDWKSSSALVKSTGTIVSVAGAFIVCYYKGP------PLLMAPSTSNL  169

Query  745   VFSSSTNQQNWVLGCLCFIAASLTLSIWNIIQVGTIRIYPQVMKIMCVYSLFGTVQSGAL  924
                  + QQNW++G L      +  S W IIQ   ++ YP  + ++  Y    T+ S  +
Sbjct  170   PHELLSQQQNWIIGGLLLAVDCVMASAWLIIQALILKKYPAELIVVFFYCFSVTILSTIV  229

Query  925   SLFIVRDLNAWRLGLNFQLIVILLTAIFGSIIRSSVQLWCMRMKGPSFPLIFKPVGIVVA  1104
              LF+ RD  AW L    + I ++ + +FGS  +  V  WC+   GP F  +FKP+GIV+A
Sbjct  230   CLFMERDPGAWSLKPTVRWIAVVYSGVFGSAFQVGVSTWCLHKTGPVFVAMFKPLGIVIA  289

Query  1105  SSCGCLFFADTFHYGSMFSAFICGMGYYTTIWGQLKDEEIQQIKG-SSVSLPDEKVPLLQ  1281
             ++   +   DT + GS+  A +  +G+Y+ +WG+ K+E++    G  S     +KVPLLQ
Sbjct  290   AAVSIICLRDTLYLGSLVGATVIVIGFYSVMWGKAKEEKVGVDDGVRSFESSSQKVPLLQ  349

Query  1282  QSQDDS  1299
                +++
Sbjct  350   SHTEET  355



>gb|KCW85789.1| hypothetical protein EUGRSUZ_B02542 [Eucalyptus grandis]
Length=357

 Score =   187 bits (476),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 99/272 (36%), Positives = 153/272 (56%), Gaps = 1/272 (0%)
 Frame = +1

Query  481   ISQNLAFVGLSYSSPIAACGTANIVPALSFILAIILRRTKIDWESGGSQARMIGALICTV  660
             ++Q  A+ G+ YSSP+      N++PA +FILA+I R  K++W+S  S A+++G +   V
Sbjct  86    VAQICAYAGIDYSSPVLGTAMMNLIPAFTFILAVISRMEKVNWKSSSSHAKLVGTIASIV  145

Query  661   GTISLIFYRGPVVNNYSPTFLHLSTTQFVFSSSTNQQNWVLGCLCFIAASLTLSIWNIIQ  840
             G   +  Y+GP +    P   ++   Q +   S  Q NW+LG     A +  LS+W IIQ
Sbjct  146   GASVVTLYKGPPILRSPPPLPYVQPRQLLLILS-RQSNWILGGFLLTADAFLLSLWYIIQ  204

Query  841   VGTIRIYPQVMKIMCVYSLFGTVQSGALSLFIVRDLNAWRLGLNFQLIVILLTAIFGSII  1020
                ++ YP V+ IM    LFGT+ +G LS   VR+  +W L L+  LI IL +A+  SI 
Sbjct  205   TSILKDYPVVLNIMFYKVLFGTILAGLLSFITVREPRSWILKLDRGLIAILYSAVVVSIF  264

Query  1021  RSSVQLWCMRMKGPSFPLIFKPVGIVVASSCGCLFFADTFHYGSMFSAFICGMGYYTTIW  1200
               ++  WC++  GP +  +FKP GIV A   G +F  +T H GS+  A +  MG+Y  +W
Sbjct  265   SLTLCTWCLKRTGPVYVAMFKPFGIVFAVGLGFIFLGETLHLGSLIGAMVIAMGFYGVVW  324

Query  1201  GQLKDEEIQQIKGSSVSLPDEKVPLLQQSQDD  1296
             G+ K+EE +  +G S++    K+PLLQ     
Sbjct  325   GKSKEEEERTTEGGSLASSSHKIPLLQNKASS  356



>ref|XP_009360510.1| PREDICTED: LOW QUALITY PROTEIN: WAT1-related protein At1g70260-like 
[Pyrus x bretschneideri]
 ref|XP_009363569.1| PREDICTED: LOW QUALITY PROTEIN: WAT1-related protein At1g70260 
[Pyrus x bretschneideri]
Length=243

 Score =   184 bits (467),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 98/238 (41%), Positives = 150/238 (63%), Gaps = 24/238 (10%)
 Frame = +1

Query  595   TKIDWESGGSQARMIGALICTVGTISLIFYRGPVVNNYSPTFLHLSTTQFVFSSSTNQQN  774
             TK++W S   QA++ G LI  +G I +  Y+G                +++  SS +  +
Sbjct  21    TKLNWRSSSFQAKVSGTLISIIGAIVVELYKG----------------EYIRKSSVSSSH  64

Query  775   WVLGCLCFIAASLTLSIWNIIQVGTIRIYPQV--MKIMCVYSLFGTVQSGALSLFIVRDL  948
             W +  L  +A++L++S+WNIIQ+GT+++YPQV  M+++  YSL GT QS  LSLF+ R+ 
Sbjct  65    WNILQL-LVASTLSVSVWNIIQMGTMKLYPQVEVMEVVTFYSLLGTTQSAILSLFLERNP  123

Query  949   NAWRLGLNFQLIVILLTAIFGSIIRSSVQLWCMRMKGPSFPLIFKPVGIVVASSCGCLFF  1128
             +A +L LN +L++I+LTAIFG ++RS VQ WCM MKGP +  +FKP+GIV A+  G    
Sbjct  124   SAGKLKLNRELLLIVLTAIFGGLVRSRVQHWCMNMKGPYYVPLFKPLGIVFATIFGVSLS  183

Query  1129  ADTFHYGSMFSAFICGMGYYTTIWGQLKDEEI-----QQIKGSSVSLPDEKVPLLQQS  1287
             A++  YGS+  A I GMGY+  IWG ++++EI     Q +  +  S  + KVPLLQ+ 
Sbjct  184   ANSLSYGSVMGAVITGMGYFIIIWGXIREDEILDQDQQCVDENLESSSERKVPLLQEE  241



>ref|XP_002303950.2| hypothetical protein POPTR_0003s19220g [Populus trichocarpa]
 gb|EEE78929.2| hypothetical protein POPTR_0003s19220g [Populus trichocarpa]
Length=355

 Score =   187 bits (476),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 117/364 (32%), Positives = 191/364 (52%), Gaps = 14/364 (4%)
 Frame = +1

Query  208   MEVKAAFGEVVPCMAMVMVEACTIFLTIMASTAMAKFGTNPFVFVVYTNALASIFLVPYS  387
             M VK A   V+P + M+M E       I    AM+  G + FVFV+Y+N +ASI L+P S
Sbjct  1     MGVKVA---VLPIVGMIMAECAQAGRMIAGKAAMSN-GMSSFVFVLYSNTIASIILLPSS  56

Query  388   IIYHRRDKAQEQlftfplllrlfflglIGVTISQNLAFVGLSYSSPIAACGTANIVPALS  567
             +I+HR    QE+      ++  FFL  +   + Q+  + G++ SSP       N VP L+
Sbjct  57    LIFHR---PQERPPLTLSIVFGFFLLGLFGCLGQSFGYAGINLSSPALGTAMLNTVPGLT  113

Query  568   FILAIILRRTKIDWESGGSQARMIGALICTVGTISLIFYRGPVVNNYSPTFLHLSTTQFV  747
             F+LA+I R  K+D  S  + A+ +G +I   G   + +Y+GP++    P+  + S+ Q +
Sbjct  114   FVLAVIFRMEKVDCRSYSTLAKSMGTIISMGGAFVVTYYKGPLLLKALPSASN-SSHQVL  172

Query  748   FSSSTNQQNWVLGCLCFIAASLTLSIWNIIQVGTIRIYPQVMKIMCVYSLFGTVQSGALS  927
                 +   NWVLG L         S W I+Q   ++ YP  + ++  Y  F TV S  + 
Sbjct  173   ----SQHSNWVLGGLLLAVDCTMASSWLIVQALILKKYPAKLIVVFFYFFFSTVLSSIVC  228

Query  928   LFIVRDLNAWRLGLNFQLIVILLTAIFGSIIRSSVQLWCMRMKGPSFPLIFKPVGIVVAS  1107
             L +V+D +AW L  N +L+ +L + I G   +  V  WC++  GP F  IF P+GIV+ +
Sbjct  229   LVMVKDPSAWSLKSNTRLVSVLFSGILGHAFQVGVTTWCLQKTGPVFVSIFAPLGIVITA  288

Query  1108  SCGCLFFADTFHYGSMFSAFICGMGYYTTIWGQLKD--EEIQQIKGSSVSLPDEKVPLLQ  1281
             +   +FF D  + G +  A I   G+Y  IWG+ ++  ++++  +    +   +KVPLLQ
Sbjct  289   TASVVFFGDALNLGIVIGAVIIASGFYAVIWGKAQEATKKVEDEESFGPASSSQKVPLLQ  348

Query  1282  QSQD  1293
                +
Sbjct  349   NRSN  352



>ref|XP_007031395.1| Nodulin MtN21 /EamA-like transporter family protein isoform 1 
[Theobroma cacao]
 gb|EOY02321.1| Nodulin MtN21 /EamA-like transporter family protein isoform 1 
[Theobroma cacao]
Length=374

 Score =   187 bits (476),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 115/370 (31%), Positives = 200/370 (54%), Gaps = 19/370 (5%)
 Frame = +1

Query  226   FGEVVPCMAMVMVEACTIFLTIMASTAMAKFGTNPFVFVVYTNALASIFLVPYSIIYHRR  405
             + +V+P  AMV +E   + L  +   A  K G +  VFVVY  A+A++ L+P     +R 
Sbjct  9     YKDVLPFSAMVTMECANVGLNTLFKAATLK-GMSYHVFVVYAYAIAALVLLPAPFFSYR-  66

Query  406   DKAQEQlftfplllrlfflglIGV--TISQNLAFVGLSYSSPIAACGTANIVPALSFILA  579
                  ++        L  +GL+G+  + SQ + + G++YSSP  A   +N+ PA +F+LA
Sbjct  67    ----SRVLPPLSFPILCKIGLLGLIGSSSQIMGYTGINYSSPTLASAISNLTPAFTFVLA  122

Query  580   IILRRTKIDWESGGSQARMIGALICTVGTISLIFYRGP-VVNNYSPTF-----LHLSTTQ  741
             II R  K+ W+   S A+++G +I   G   +  Y+GP +V   +P+      L+ S + 
Sbjct  123   IIFRMEKLVWKRTSSAAKVMGTIISVTGAFVVTLYKGPAIVIASTPSMSLQQPLNPSKSN  182

Query  742   FVFSS-STNQQNWVLGCLCFIAASLTLSIWNIIQVGTIRIYPQVMKIMCVYSLFGTVQSG  918
              VF    +   NWV+G +   A  + + +W I+Q   ++ YP  + ++  Y+L  +  + 
Sbjct  183   LVFGGLHSANPNWVIGGVFLTAEYILVPLWYIVQTQIMKEYPAELTVVFFYNLCVSFIAA  242

Query  919   ALSLFIVRDLNAWRLGLNFQLIVILLTAIFGSIIRSSVQLWCMRMKGPSFPLIFKPVGIV  1098
              + L   R+ +AWR+  +  L  ++ + +FGS + ++V  W +R+KGP F  +FKP+ I 
Sbjct  243   IVGLASERNASAWRIRPDIALASVVCSGLFGSCLNNTVHTWALRLKGPVFVAMFKPLSIA  302

Query  1099  VASSCGCLFFADTFHYGSMFSAFICGMGYYTTIWGQLKDEEIQQ----IKGSSVSLPDEK  1266
             +A++ G +F  DT H GS+  A I  +G+YT +WG+ K+E  ++       S VS    K
Sbjct  303   IAAAMGVMFLGDTLHLGSLIGATIISIGFYTVMWGKAKEEMAEEYVSATDSSRVSPSAHK  362

Query  1267  VPLLQQSQDD  1296
             VPLLQ  +++
Sbjct  363   VPLLQSYKNE  372



>ref|XP_009360473.1| PREDICTED: WAT1-related protein At5g40240-like isoform X1 [Pyrus 
x bretschneideri]
Length=356

 Score =   187 bits (475),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 116/357 (32%), Positives = 192/357 (54%), Gaps = 19/357 (5%)
 Frame = +1

Query  235   VVPCMAMVMVEACTIFLTIMASTAMAKFGTNPFVFVVYTNALASIFLVPYSIIYHRRDKA  414
             ++P + MVM         ++   AM+  GTN ++ VVY N +A++ L+P ++I+HR    
Sbjct  8     LLPFIGMVMAIMAQTGSVVVNKAAMST-GTNAYIIVVYGNTIAALILLPSALIFHR----  62

Query  415   QEQlftfplllrlfflglIGVTISQNLAFVGLSYSSPIAACGTANIVPALSFILAIILRR  594
              E+      +L   FL  +    +Q    +G+ YSSP  +    N++PA +FILAII R 
Sbjct  63    SERPPLTFSILCRIFLLGLFCCSAQIFGNIGIEYSSPTLSTAMLNLIPAFTFILAIIFRM  122

Query  595   TKIDWESGGSQARMIGALICTVGTISLIFYRG-PVVNNYS--PTFLHLSTTQFVFSSSTN  765
               ++W S  SQA++ G ++   G   + FY+G P++   S  P  L+      +FSSS  
Sbjct  123   ETVNWRSSSSQAKVFGTVMSIGGAFVVTFYKGLPIIRLSSSLPNSLYQ-----IFSSS--  175

Query  766   QQNWVLGCLCFIAASLTLSIWNIIQVGTIRIYPQVMKIMCVYSLFGTVQSGALSLFIVRD  945
             + NW+LG L     + ++S+W I+Q   ++ YP ++  +    LF T+QS   +L  VRD
Sbjct  176   RSNWILGGLFLAVHAFSISLWYILQATVVKKYPAILLSVFFQCLFATIQSAIFALIAVRD  235

Query  946   LNAWRLGLNFQLIVILLTAIFGSIIRSSVQLWCMRMKGPSFPLIFKPVGIVVASSCGCLF  1125
              +AW + L+  LI  L T I  +++  SV +WC+   G  +  +FKP+GI+     G +F
Sbjct  236   ASAWEIRLDVGLIAALYTGIVATVLYFSVIVWCVEKVGAFYCSMFKPIGIIFGVIMGAIF  295

Query  1126  FADTFHYGSMFSAFICGMGYYTTIWGQLKDEEIQQIKGSSVSLPDEKVPLLQQSQDD  1296
               D+ + GS+  A I   G+Y  +WG+  +E++ +I+    SL   K+PLLQ    D
Sbjct  296   LGDSVYIGSLVGAAIIVTGFYAMMWGKATEEKLIEIE----SLDQNKLPLLQNGIQD  348



>ref|XP_011034696.1| PREDICTED: WAT1-related protein At3g28050-like isoform X1 [Populus 
euphratica]
 ref|XP_011034697.1| PREDICTED: WAT1-related protein At3g28050-like isoform X1 [Populus 
euphratica]
 ref|XP_011034698.1| PREDICTED: WAT1-related protein At3g28050-like isoform X1 [Populus 
euphratica]
Length=355

 Score =   187 bits (474),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 118/359 (33%), Positives = 189/359 (53%), Gaps = 18/359 (5%)
 Frame = +1

Query  235   VVPCMAMVMVEACTIFLTIMASTAMAKFGTNPFVFVVYTNALASIFLVPYSIIYHRRDKA  414
             V+P + MVM E       I+   AM+  G + FVFV+Y+NA+AS+ L+P S ++HR   +
Sbjct  8     VLPIVGMVMAECAQAGRMILGKAAMSN-GMSSFVFVLYSNAIASLILLP-SFLFHR---S  62

Query  415   QEQlftfplllrlfflglIGVTISQNLAFVGLSYSSPIAACGTANIVPALSFILAIILRR  594
              E+      ++  FFL  +   + Q+  + G++ SSP       N+VP L+F+LAII R 
Sbjct  63    SERPPLTLSIVSGFFLLGLFGCLGQSFCYAGINLSSPTLGTAMLNLVPGLTFMLAIIFRM  122

Query  595   TKIDWESGGSQARMIGALICTVGTISLIFYRGPVVNNYSPTFLHLSTTQFVFSSSTNQQN  774
               +DW+S  + A+ +G ++   G   +  Y+GP++    P     S T+        Q N
Sbjct  123   ENVDWKSYSTLAKSMGTVVSIGGAFIVTCYKGPLLLKARP-----SVTKSSHQVLLQQSN  177

Query  775   WVLGCLCFIAASLTLSIWNIIQVGTIRIYPQVMKIMCVYSLFGTVQSGALSLFIVRDLNA  954
             WVLG L  +    T S W I+Q   ++ Y   + ++  +  F T+ S  +S+ + RD +A
Sbjct  178   WVLGGLLMVVDCATASSWLIVQALILKKYSAKLIVVFFHFFFSTILSSIVSVVMERDPSA  237

Query  955   WRLGLNFQLIVILLTAIFGSIIRSSVQLWCMRMKGPSFPLIFKPVGIVVASSCGCLFFAD  1134
             W L  N +LI +L + I G+     V  WC+   GP F  IF P+GIV+A++   + F D
Sbjct  238   WSLNSNIRLIAVLFSGILGNAFEIGVTAWCLHKTGPVFVAIFAPLGIVIAAAASVICFGD  297

Query  1135  TFHYGSMFSAFICGMGYYTTIWGQLKDEEIQQIK-----GSSVSLPDEKVPLLQQSQDD  1296
                 G +  A I  +G+Y  IWG+   EEI++++     GS+ S   +KVP LQ   +D
Sbjct  298   ALDLGIVVGAAIIAIGFYAVIWGK-AQEEIKKVEDKENCGSASS--SQKVPFLQNRSND  353



>gb|KEH16737.1| nodulin MtN21/EamA-like transporter family protein [Medicago 
truncatula]
Length=364

 Score =   187 bits (475),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 116/365 (32%), Positives = 204/365 (56%), Gaps = 13/365 (4%)
 Frame = +1

Query  208   MEVKAAFGEVVPCMAMVMVEACTIFLTIMASTAMAKFGTNPFVFVVYTNALASIFLVPYS  387
             M ++  + ++VP  AMV +E   + L  +   A  K G +  VFVVY  A+A+  L+P  
Sbjct  1     MALRYCYKDLVPFGAMVTMECINVALNTLFKAATVK-GMSYHVFVVYAYAVAAFVLLPAP  59

Query  388   IIYHRRDKAQEQlftfplllrlfflglIGVTISQNLAFVGLSYSSPIAACGTANIVPALS  567
              I  R         + P+L ++  LGLIG + SQ + + G+S+SSP  +   +N+VPA +
Sbjct  60    FISIRSRVLPP--LSKPILCKIGLLGLIGSS-SQIMGYTGISFSSPTLSSAISNLVPAFT  116

Query  568   FILAIILRRTKIDWESGGSQARMIGALICTVGTISLIFYRGPVVNNYSPTFLHLSTTQFV  747
             F+LAII R  K+  +S  SQA+++G ++   G   +  Y GP      P  + L ++  +
Sbjct  117   FLLAIIFRMEKVAIKSLSSQAKVVGTIVSISGAFIVTLYIGP------PIMIALRSSNSL  170

Query  748   FSS--STNQQNWVLGCLCFIAASLTLSIWNIIQVGTIRIYPQVMKIMCVYSLFGTVQSGA  921
               +  S++ Q+W +G L   A  + + +W I+QV  +++YP  + ++  Y+L  ++ +G 
Sbjct  171   HQTLKSSSDQSWAIGGLLLTAEYILVPLWYIVQVQIMKVYPNELTVIFYYNLCVSIIAGI  230

Query  922   LSLFIVRDLNAWRLGLNFQLIVILLTAIFGSIIRSSVQLWCMRMKGPSFPLIFKPVGIVV  1101
             + +    + +AW++G +  L  IL + IFGS + ++V  + +R+KG  +  +FKP+ IV+
Sbjct  231   VGVISEPNASAWKIGFDTSLASILCSGIFGSFLNNTVHAYVLRIKGAVYVAMFKPLSIVI  290

Query  1102  ASSCGCLFFADTFHYGSMFSAFICGMGYYTTIWGQLKDEEIQQIKGSSVSLPDEKVPLLQ  1281
             A + G +F  DT H GS+  A I  +G+YT +WG+ K+E ++ + G       + VPLLQ
Sbjct  291   AVAMGVVFLGDTLHLGSLIGATIISIGFYTVMWGKAKEEVVEDVSGHETQ-TTQNVPLLQ  349

Query  1282  QSQDD  1296
               + D
Sbjct  350   SYETD  354



>ref|XP_006470389.1| PREDICTED: WAT1-related protein At3g28050-like [Citrus sinensis]
Length=359

 Score =   187 bits (474),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 112/359 (31%), Positives = 195/359 (54%), Gaps = 16/359 (4%)
 Frame = +1

Query  232   EVVPCMAMVMVEACTIFLTIMASTAMAKFGTNPFVFVVYTNALASIFLVPYSIIYHRRDK  411
             +V+P  AMV +E   + L  +   A +K G + FVFVVY+  +A++ L+P     +R   
Sbjct  11    DVLPFTAMVAMECINVGLNTLFKAATSK-GMSHFVFVVYSYGVAALVLLPAPFFSYR---  66

Query  412   AQEQlftfplllrlfflglIGV--TISQNLAFVGLSYSSPIAACGTANIVPALSFILAII  585
                ++        L  +GL+G+  + SQ + + G++YSSP  A   +N+ PA +F+LAII
Sbjct  67    --SRVLPPFTFSILCKIGLLGLIGSSSQIMGYTGINYSSPTLASAISNLTPAFTFVLAII  124

Query  586   LRRTKIDWESGGSQARMIGALICTVGTISLIFYRGPVVNNYSPTFLHLSTTQFVFSSSTN  765
              R  K+      SQA+++G ++   G   +  Y+GP +   +   + LS      +  ++
Sbjct  125   FRMEKVACRKASSQAKVLGTIVSIAGAFIVTLYKGPRITTIASPKVSLS-----HALRSS  179

Query  766   QQNWVLGCLCFIAASLTLSIWNIIQVGTIRIYPQVMKIMCVYSLFGTVQSGALSLFIVRD  945
               NW +G L   A  + + +W I+Q   ++ YP  + ++ +Y+L  +  +  + L   RD
Sbjct  180   NSNWAVGGLFLTAEYILVPLWYIVQTQIMKEYPAELTVVFLYNLCVSFVAAIVGLITERD  239

Query  946   LNAWRLGLNFQLIVILLTAIFGSIIRSSVQLWCMRMKGPSFPLIFKPVGIVVASSCGCLF  1125
               AW++G    L  ++ + +FGS + +SV  W +R+KGP F  +FKP+ I +A + G +F
Sbjct  240   SMAWKVGPGIALASVMCSGLFGSCMNNSVHTWALRLKGPVFVAMFKPLSIAIAVAMGVIF  299

Query  1126  FADTFHYGSMFSAFICGMGYYTTIWGQLKDEEIQQIKG--SSVSLPDEKVPLLQQSQDD  1296
               DT + GS+  A I  +G+YT +WG+ K EE+ +  G  S  S   +KVPLLQ  +++
Sbjct  300   LGDTLYLGSLVGATIISLGFYTVMWGKAK-EEVSEDPGVDSQESAAAQKVPLLQSRKNE  357



>ref|XP_002299184.1| hypothetical protein POPTR_0001s06940g [Populus trichocarpa]
 gb|EEE83989.1| hypothetical protein POPTR_0001s06940g [Populus trichocarpa]
Length=355

 Score =   187 bits (474),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 117/359 (33%), Positives = 187/359 (52%), Gaps = 17/359 (5%)
 Frame = +1

Query  235   VVPCMAMVMVEACTIFLTIMASTAMAKFGTNPFVFVVYTNALASIFLVPYSIIYHRRDKA  414
             V+P + MVM E       I+   AM+  G + FVFV+Y+NA+A + L+P S ++HR   +
Sbjct  7     VLPIVGMVMAECAQAGRMILGKAAMSN-GMSSFVFVLYSNAIACLILLPSSFLFHR---S  62

Query  415   QEQlftfplllrlfflglIGVTISQNLAFVGLSYSSPIAACGTANIVPALSFILAIILRR  594
              E+      ++  FFL  +   + Q+  + G++ SSP       N+VP L+FILAII R 
Sbjct  63    SERPPLTLSIVSGFFLLGLFGCLGQSFCYAGINLSSPTLGTAMLNLVPGLTFILAIIFRM  122

Query  595   TKIDWESGGSQARMIGALICTVGTISLIFYRGPVVNNYSPTFLHLSTTQFVFSSSTNQQN  774
               +DW+S  + A+ +G ++   G   +  Y+GP++    P     S T+        Q N
Sbjct  123   ENVDWKSYSTLAKSMGTIVSIGGAFIVTCYKGPLLLKALP-----SVTKSSHQVLLQQSN  177

Query  775   WVLGCLCFIAASLTLSIWNIIQVGTIRIYPQVMKIMCVYSLFGTVQSGALSLFIVRDLNA  954
             WVLG L       T S W I+Q   ++ Y   + ++  +  F T+ S  +S+ + RD +A
Sbjct  178   WVLGGLLMAVDCATASSWLIVQALILKKYSAKLIVVFFHFFFSTILSSIVSVVMERDPSA  237

Query  955   WRLGLNFQLIVILLTAIFGSIIRSSVQLWCMRMKGPSFPLIFKPVGIVVASSCGCLFFAD  1134
             W L  N +LI +L + I G+     V  WC+   GP F  IF P+GIV+A++   + F D
Sbjct  238   WSLNSNIRLIAVLFSGILGNAFEIGVTAWCVHKTGPVFVAIFAPLGIVIAAAASVICFGD  297

Query  1135  TFHYGSMFSAFICGMGYYTTIWGQLKDEEIQQIK-----GSSVSLPDEKVPLLQQSQDD  1296
                 G +  A +  +G+Y  IWG+   EEI++++     GS+ S   +KVP LQ   +D
Sbjct  298   ALDLGIVIGAAVIAIGFYAVIWGK-AQEEIKKVEDKENCGSASS--SQKVPFLQNRSND  353



>ref|XP_008341477.1| PREDICTED: WAT1-related protein At5g40240-like [Malus domestica]
 ref|XP_008341478.1| PREDICTED: WAT1-related protein At5g40240-like [Malus domestica]
Length=361

 Score =   187 bits (474),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 114/358 (32%), Positives = 194/358 (54%), Gaps = 12/358 (3%)
 Frame = +1

Query  238   VPCMAMVMVEACTIFLTIMASTAMAKFGTNPFVFVVYTNALASIFLVPYSIIYHRRDKAQ  417
             VP  AMV+VE   + ++ ++  AM+K G + FVF+VY NAL ++ L+P+  I+ R+ +A 
Sbjct  11    VPFTAMVIVECAEVGVSTISKVAMSK-GMSHFVFIVYYNALGTLLLLPF-FIFRRKKRAP  68

Query  418   EQlftfplllrlfflglIGVTISQNLAFVGLSYSSPIAACGTANIVPALSFILAIILRRT  597
                        L  +G  G    + L F G+  SS + A   AN+ P  +F+LA+I R  
Sbjct  69    LTFRLICQFFLLGLIGSSG----KILFFAGVKNSSALLASAMANLTPIFTFLLALIFRME  124

Query  598   KIDWESGGSQARMIGALICTVGTISLIFYRGPVVNNYSPTFLHLSTTQFVFSSSTNQQNW  777
             K+D     S A+ +GA+I   G + +  Y GP + N S +     +    F S ++   W
Sbjct  125   KLDLRKATSYAKSLGAIISVGGALIVTLYDGPALLNSSSSSGSSHSXHGSFVSRSS--TW  182

Query  778   VLGCLCFIAASLTLSIWNIIQVGTIRIYPQVMKIMCVYSLFGTVQSGALSLFIVRD-LNA  954
             + G L      L  S WNI Q  T++ YP+ M I+  Y++F T+Q   +SL + R+ ++A
Sbjct  183   IFGGLLLAIQCLVASGWNIAQAATVKDYPEEMTIVFFYTMFLTIQCTVISLIVERNNMSA  242

Query  955   WRLGLNFQLIVILLTAIFGSIIRSSVQLWCMRMKGPSFPLIFKPVGIVVASSCGCLFFAD  1134
             W+L L  ++I ++  AI  S+ R SV +WC+  KGP +  +FKP+GI +A+    +F  +
Sbjct  243   WKLELPIEIIAVVYAAICVSVFRISVHVWCLHKKGPVYVAMFKPLGIAIAALLVVVFLGE  302

Query  1135  TFHYGSMFSAFICGMGYYTTIWGQLKDEEIQQIKGSSVSLPDEKV---PLLQQSQDDS  1299
             TF+ GS+  + +  +G+YT I+ ++K++ +   +      P +++   PLL  S  + 
Sbjct  303   TFYLGSLIGSIVISVGFYTVIYAKMKEKAMADNEAVQPLKPSDQIQMAPLLPSSISNE  360



>emb|CAN71719.1| hypothetical protein VITISV_034106 [Vitis vinifera]
Length=335

 Score =   186 bits (471),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 114/347 (33%), Positives = 174/347 (50%), Gaps = 35/347 (10%)
 Frame = +1

Query  250   AMVMVEACTIFLTIMASTAMAKFGTNPFVFVVYTNALASIFLVPYSIIYHRRDKAQEQlf  429
              MVM E   + L I AS A    G    VF++Y+N LAS+ L+P  +++H          
Sbjct  11    GMVMAEFAQVGLMI-ASKAAISSGMPNLVFILYSNTLASLILLPSCLLFHS---------  60

Query  430   tfplllrlfflglIGVTISQNLAFVGLSYSSPIAACGTANIVPALSFILAIILRRTKIDW  609
                               +Q   + G+ YSS        N+VP  +FILAII R  ++DW
Sbjct  61    ----------------FFAQIFGYAGIQYSSATLGTAMLNLVPGFTFILAIIFRMERLDW  104

Query  610   ESGGSQARMIGALICTVGTISLIFYRG-PVVNNYSPTFLHLSTTQFVFSSSTNQQNWVLG  786
               G S A+ +G ++   G   + FY+G P++   SP+  +     F+    + Q NWV G
Sbjct  105   R-GSSMAKSMGTVVSIAGAFIVTFYKGSPILMTPSPS--NFPDQLFL----SQQSNWVFG  157

Query  787   CLCFIAASLTLSIWNIIQVGTIRIYPQVMKIMCVYSLFGTVQSGALSLFIVRDLNAWRLG  966
              L   A  +  S W I+Q   ++ YP  + I   Y  F  +QS A SL + R   AW L 
Sbjct  158   GLLLAADCVMSSAWLILQASILKKYPAELIINFYYCFFVAIQSAAASLIMERGPGAWSLK  217

Query  967   LNFQLIVILLTAIFGSIIRSSVQLWCMRMKGPSFPLIFKPVGIVVASSCGCLFFADTFHY  1146
              + + I ++ + +FG + +     WC+  KGP F  +FKPVGIVVA + G +F  DTF+ 
Sbjct  218   PSTRFIAVMYSGVFGYVFQVGAITWCVHQKGPVFVAMFKPVGIVVAIAMGVIFLGDTFYM  277

Query  1147  GSMFSAFICGMGYYTTIWGQLKDEEIQQIKG-SSVSLPDEKVPLLQQ  1284
             GS+  A +  +G+Y+ +WG+ K+E+I +  G  S+    +K PLLQ 
Sbjct  278   GSLIGATVIVIGFYSVMWGKAKEEKIDEDIGVRSLESTSQKAPLLQN  324



>ref|XP_008348038.1| PREDICTED: WAT1-related protein At3g28050-like [Malus domestica]
Length=363

 Score =   186 bits (473),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 112/366 (31%), Positives = 197/366 (54%), Gaps = 15/366 (4%)
 Frame = +1

Query  217   KAAFGEVVPCMAMVMVEACTIFLTIMASTAMAKFGTNPFVFVVYTNALASIFLVPYSIIY  396
             ++ + +V+P  AMV +E   + L  +   A    G +  VFVVY+ ++A+  L+P   I 
Sbjct  6     RSFYRDVLPFTAMVTMECVNVGLNTLFKAATLN-GMSYHVFVVYSYSIAAFVLIPAPFIS  64

Query  397   HRRDKAQEQlftfplllrlfflglIGV--TISQNLAFVGLSYSSPIAACGTANIVPALSF  570
             HR      ++        +  + L+G+  + SQ + + G++YSSP  A   +N+VPA +F
Sbjct  65    HR-----SRVLPPLNFSIMSKVLLLGLIGSSSQIMGYTGINYSSPTLASAISNLVPAFTF  119

Query  571   ILAIILRRTKIDWESGGSQARMIGALICTVGTISLIFYRGP--VVNNYSPTFLHLSTTQF  744
             ILAII R          SQA+++G ++   G   +  Y+GP  V  N S +   LS  Q 
Sbjct  120   ILAIIFRLESAALRKRSSQAKILGTVVSLAGAFVVTLYKGPPIVFANQSQS---LSLHQP  176

Query  745   VFSSSTNQQNWVLGCLCFIAASLTLSIWNIIQVGTIRIYPQVMKIMCVYSLFGTVQSGAL  924
             + +S+    NW++G L   A  + + +W I+Q   ++ YP  + ++  Y++     S A+
Sbjct  177   LLNSTPTNPNWIVGGLLLTAEYILVPLWYIVQAQIMKEYPNELTVIFFYNVCVVAVSAAV  236

Query  925   SLFIVRDLNAWRLGLNFQLIVILLTAIFGSIIRSSVQLWCMRMKGPSFPLIFKPVGIVVA  1104
             +L    + +AW+L  +  L+ +L + +FGS + ++V  W +R+KGP F  +FKP+ + +A
Sbjct  237   ALITEPNSSAWKLRPDIALLSVLCSGLFGSFLNNAVHTWVLRLKGPVFVTMFKPLSMAIA  296

Query  1105  SSCGCLFFADTFHYGSMFSAFICGMGYYTTIWGQLKDEEIQQIKGSSVSLPD--EKVPLL  1278
              + G  F  DT H GS+  A I  +G+YT +WG+ K+E  ++   +S+  P    K PLL
Sbjct  297   VAMGVAFLRDTLHLGSLVGATIISIGFYTVLWGKTKEEAGEESVPASLESPSTTHKAPLL  356

Query  1279  QQSQDD  1296
             Q  +++
Sbjct  357   QNYKNE  362



>gb|KHN09903.1| Auxin-induced protein 5NG4-like protein [Glycine soja]
Length=351

 Score =   186 bits (472),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 119/354 (34%), Positives = 183/354 (52%), Gaps = 15/354 (4%)
 Frame = +1

Query  229   GEVVPCMAMVMVEACTIFLTIMASTAMAKFGTNPFVFVVYTNALASIFLVPYSIIYHRRD  408
             G + P + MVM         ++   AM   G N +V VVY+ AL++I L+P+++  HR +
Sbjct  9     GNIFPFLGMVMAMLAQSGSMVVIKVAMTD-GINKYVMVVYSLALSTILLLPFALFLHRSE  67

Query  409   KAQEQlftfplllrlfflglIGVTISQNLAFVGLSYSSPIAACGTANIVPALSFILAIIL  588
             +             L F G  G    Q +A+VG+  SSP  A    N++PA +FILA+I 
Sbjct  68    RPPLTFSALCSFFLLAFFGSSG----QIMAYVGIDLSSPTLASAMLNLIPAFTFILALIF  123

Query  589   RRTKIDWESGGSQARMIGALICTVGTISLIFYRGPVVNNYSPTFLHLSTTQFVFSSSTNQ  768
             R  ++ W+   SQA+ +G ++   G   +I Y+GP +     T L  S+ +F+FS    Q
Sbjct  124   RMEEVHWKHSSSQAKFLGTIVSIAGAFVVILYKGPPIFK---THLSNSSNKFLFS---QQ  177

Query  769   QNWVLGCLCFIAASLTLSIWNIIQVGTIRIYPQVMKIMCVYSLFGTVQSGALSLFIVRDL  948
              NW+LG +     S+  S+W I Q      YP V  I+    LF T+Q G  +L +V+D 
Sbjct  178   LNWILGGMFCAGDSIVCSLWYIYQASVAYKYPAVTTIVFFQLLFSTIQCGVFALIVVQDQ  237

Query  949   NAWRLGLNFQLIVILLTAIFGSIIRSSVQLWCMRMKGPSFPLIFKPVGIVVASSCGCLFF  1128
               W L L+  LI I+  AI  ++IR  +  WC+   GP F  +FKPV I+ +   G +F 
Sbjct  238   TEWELKLDIGLIGIVYQAIAATLIRYILCTWCVLKAGPLFCSMFKPVAIIFSVFMGAIFL  297

Query  1129  ADTFHYGSMFSAFICGMGYYTTIWGQ-LKDEEIQQIKG-SSVSLPDEKVPLLQQ  1284
              D    GS+  A I  +G+Y  +WG+ ++D +I+  KG  ++      VPLLQ 
Sbjct  298   GDDLSLGSLIGAVIIVIGFYAVLWGKSIEDNKIE--KGVENLESSCHNVPLLQN  349



>ref|XP_004489873.1| PREDICTED: WAT1-related protein At3g28070-like isoform X1 [Cicer 
arietinum]
Length=343

 Score =   186 bits (471),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 118/352 (34%), Positives = 178/352 (51%), Gaps = 16/352 (5%)
 Frame = +1

Query  232   EVVPCMAMVMVEACTIFLTIMASTAMAKFGTNPFVFVVYTNALASIFLVPYSIIYHRRDK  411
             +++P M M++         ++   AM K G N +V VVY+ AL+SI L+P +   HR D+
Sbjct  7     KLLPFMGMIVAVLTQSGSMVVIKVAM-KDGMNKYVMVVYSMALSSIMLLPLAFFIHRTDR  65

Query  412   AQEQlftfplllrlfflglIGVTISQNLAFVGLSYSSPIAACGTANIVPALSFILAIILR  591
                   +      L   G  G    Q + + G+  SS   A    N++PA +F++A+I R
Sbjct  66    PPLTFSSLCSFFLLALFGTSG----QIMTYAGIELSSATLASAMLNLIPAFTFVIALIFR  121

Query  592   RTKIDWESGGSQARMIGALICTVGTISLIFYRGPVVNNYSPTFLHLSTTQFVFSSSTNQQ  771
                ++W    SQA++IG ++   G   +IFY+GP      P F   S+  F     + Q 
Sbjct  122   MEILNWRHCSSQAKVIGTIVSMAGAFVVIFYKGP------PIFKIHSSNSFNTLQFSPQL  175

Query  772   NWVLGCLCFIAASLTLSIWNIIQVGTIRIYPQVMKIMCVYSLFGTVQSGALSLFIVRDLN  951
             NW++G L     SL  +IW I QV   + YP V+ I+     F  +QSG  +L +VRD +
Sbjct  176   NWIMGGLLCAGDSLFSAIWYIYQVSVTKKYPAVIVIVFFQVFFIAIQSGVFALIVVRDPS  235

Query  952   AWRLGLNFQLIVILLTAIFGSIIRSSVQLWCMRMKGPSFPLIFKPVGIVVASSCGCLFFA  1131
             AW L L+ +LIVI   AI    IR  +Q WC++  GP F  +FKPVGI+     G +F  
Sbjct  236   AWELKLDMRLIVIFYQAIAAIGIRYLLQTWCVQRAGPLFCAMFKPVGIIFTVIMGSIFLG  295

Query  1132  DTFHYGSMFSAFICGMGYYTTIWGQLKDEEIQQIKGSSVSLPDEKVPLLQQS  1287
             + F+ GS+  A I  +G+Y   WG+  +++      SS       VPLLQ  
Sbjct  296   EVFNLGSLIGAVIIVVGFYAVQWGKASEQKSHNFDTSS-----NVVPLLQNK  342



>ref|XP_010667883.1| PREDICTED: WAT1-related protein At3g28050-like [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010667884.1| PREDICTED: WAT1-related protein At3g28050-like [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010667885.1| PREDICTED: WAT1-related protein At3g28050-like [Beta vulgaris 
subsp. vulgaris]
Length=360

 Score =   186 bits (471),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 125/355 (35%), Positives = 199/355 (56%), Gaps = 13/355 (4%)
 Frame = +1

Query  241   PCMAMVMVEACTIFLTIMASTAMAKFGTNPFVFVVYTNALASIFLVPYSIIYHRRDKAQE  420
             P M M++VE   + L+ ++  AM K G + FVF+VY NAL ++ L+P  I ++   + + 
Sbjct  12    PFMVMIIVECVEVGLSTLSKAAMLK-GMSNFVFIVYYNALGTLILLP--IFFYNNFRGKG  68

Query  421   QlftfplllrlfflglIGVTISQNLAFVGLSYSSPIAACGTANIVPALSFILAIILRRTK  600
                TF LL + F LGLIG+ + Q  A+ G++YSSP  A    N++P  +FILA+ LR  +
Sbjct  69    VRITFSLLYKFFLLGLIGICLLQICAYTGINYSSPTLAAAIGNLIPVFTFILAVTLRMER  128

Query  601   IDWESGGSQARMIGALICTVGTISLIFYRGPVVNNYSPTFLHLSTTQFVFSSSTNQQNWV  780
             +D  +  SQA+ +G ++   G + +  Y+GP +   +P+      +  + S+ +N   W 
Sbjct  129   LDLRNPSSQAKCLGTIVAISGAMVVTLYKGPSLITQTPS----DASNKLLSAPSN---WT  181

Query  781   LGCLCFIAASLTLSIWNIIQVGTIRIYPQVMKIMCVYSLFGTVQSGALSLFIVRDLNAWR  960
             LG L     SL  SI NI+Q  T +  P  + ++  YSLFGTV S   S+F+  D NAW 
Sbjct  182   LGGLLLAITSLLSSIGNILQAATAKECPDEVTLVFFYSLFGTVLSAVFSIFLESDPNAWM  241

Query  961   LGLNFQLIVILLTAIFGSIIRSSVQLWCMRMKGPSFPLIFKPVGIVVASSCGCLFFADTF  1140
             L    ++I I+  A+  ++ R++V  WC+R KGP + + +KP+ IV+A   G  F  D  
Sbjct  242   LHHRIEIIAIIYAAVSTTVFRNTVITWCLREKGPVYVVTYKPLAIVIAMIMGLTFLGDNL  301

Query  1141  HYGSMFSAFICGMGYYTTIWGQLKDEEIQQIKGSSV--SLPDEKVPLLQQSQDDS  1299
             + GS+  +     G+Y+ IWGQ ++++    K  S   S  D+  PLL +S DDS
Sbjct  302   YLGSVIGSAAITAGFYSVIWGQAREKDDLAAKSVSKFESTYDQNAPLL-KSTDDS  355



>ref|XP_003516812.1| PREDICTED: WAT1-related protein At3g28050-like [Glycine max]
 gb|KHN18316.1| Auxin-induced protein 5NG4 [Glycine soja]
Length=367

 Score =   186 bits (471),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 115/365 (32%), Positives = 202/365 (55%), Gaps = 8/365 (2%)
 Frame = +1

Query  208   MEVKAAFGEVVPCMAMVMVEACTIFLTIMASTAMAKFGTNPFVFVVYTNALASIFLVPYS  387
             M  +  + ++VP  AMV  E   + L  +   A  + G +  VFVVY  A+A+I L+P  
Sbjct  1     MAKRVLYKDLVPFGAMVATECLNVALNTLFKAATLR-GMSYHVFVVYAYAVAAIVLIPAP  59

Query  388   IIYHRRDKAQEQlftfplllrlfflglIGVTISQNLAFVGLSYSSPIAACGTANIVPALS  567
              I  R         +FPLL ++  LGLIG   SQ + + G+++SSP  +   +N+VPA +
Sbjct  60    FISQRSRVLPP--LSFPLLRKIGLLGLIGCA-SQIVGYTGINFSSPTLSSAISNLVPAFT  116

Query  568   FILAIILRRTKIDWESGGSQARMIGALICTVGTISLIFYRGP-VVNNYSPTFLHLSTTQF  744
             F+LAII R  K+   +   QA+++G ++   G   +  Y+GP ++  ++P+   LS  Q 
Sbjct  117   FLLAIIFRMEKVIVRNTSCQAKVLGTIVSITGAFVVTLYKGPPIIIVHTPS---LSLHQP  173

Query  745   VFSSSTNQQNWVLGCLCFIAASLTLSIWNIIQVGTIRIYPQVMKIMCVYSLFGTVQSGAL  924
             + + +    +W +G L   A  + + +W I+QV  +++YP  + ++  Y+L  ++ +  +
Sbjct  174   INTLNLVDPSWAIGGLLLTAEYILVPLWYIVQVQIMKVYPNELIVIFFYNLCVSIMAAIV  233

Query  925   SLFIVRDLNAWRLGLNFQLIVILLTAIFGSIIRSSVQLWCMRMKGPSFPLIFKPVGIVVA  1104
             ++F   +  AW++G++  L  I+ + IFGS + + V  W +R+KGP +  +FKP+ I +A
Sbjct  234   AIFTETNAGAWKIGVDTALASIVCSGIFGSFVNNVVHTWVLRIKGPVYVAMFKPLSIAIA  293

Query  1105  SSCGCLFFADTFHYGSMFSAFICGMGYYTTIWGQLKDEEIQQIKGSSVSLPDEKVPLLQQ  1284
              + G +F  DT H GS+  A I  +G+YT +WG+  +E + +      S   E VPLLQ 
Sbjct  294   VALGVMFLGDTLHLGSIVGATIISIGFYTVMWGKATEENVGEDVPGQQSPTTENVPLLQS  353

Query  1285  SQDDS  1299
              + D+
Sbjct  354   CKTDT  358



>ref|XP_010111739.1| Auxin-induced protein 5NG4 [Morus notabilis]
 gb|EXC31601.1| Auxin-induced protein 5NG4 [Morus notabilis]
Length=535

 Score =   189 bits (481),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 115/365 (32%), Positives = 192/365 (53%), Gaps = 17/365 (5%)
 Frame = +1

Query  154   QKRNQ*SSRRPPEKMLAAMEVKAAFGEVVPCMAMVMVEACTIFLTIMASTAMAKFGTNPF  333
              +R++ + RR   KM A ++ K    EVVP  AM  VE  ++ L  +   A AK G + F
Sbjct  172   HRRSEITGRRKEGKM-ARLDCKK---EVVPFTAMASVECISVILNTLYKAAAAK-GLSYF  226

Query  334   VFVVYTNALASIFLVPYSIIYHRRDKAQEQlftfplllrlfflglIGVTISQNLA-FVGL  510
             V+V Y+ AL ++  +P   I+ R      +      +L L  +G  G     N+  F G+
Sbjct  227   VYVTYSYALGALVYLPLLFIFPRTGLPPLKPSILYRILLLSVIGYAG-----NICIFKGI  281

Query  511   SYSSPIAACGTANIVPALSFILAIILRRTKIDWESGGSQARMIGALICTVGTISLIFYRG  690
              YSSP  A   +N+ PA +F+LA+I R  K+D  S  ++A+ IG ++   G +  I Y G
Sbjct  282   EYSSPTLASAISNLQPAFTFVLAVIFRMEKLDLGSSSTRAKTIGTILSVSGALIAILYDG  341

Query  691   PVVNNYSPTFLHLSTTQFVFSSSTNQQNWVLGCLCFIAASLTLSIWNIIQVGTIRIYPQV  870
             PV+          S +   +   T + NW+LG L  +A  + +S+W I+Q   I++YP  
Sbjct  342   PVI------LSSSSPSSLEYPLQTPETNWILGGLLLVAFCILVSVWYILQTHVIKLYPAE  395

Query  871   MKIMCVYSLFGTVQSGALSLFIVRDLNAWRLGLNFQLIVILLTAIFGSIIRSSVQLWCMR  1050
             + ++ ++SL  ++ + A+   +  D +AWRL  +  L  I+L  +FG    ++V  W + 
Sbjct  396   VTVVVLFSLCTSIIAAAVCFIVETDTSAWRLRTDLALPTIVLYGLFGPTFTATVHTWGLH  455

Query  1051  MKGPSFPLIFKPVGIVVASSCGCLFFADTFHYGSMFSAFICGMGYYTTIWGQLKDEEIQQ  1230
             +KGP +  IF+P+ IV+A++ G +F  D  H GS   A I  +G+Y  IWG+  +E + +
Sbjct  456   LKGPVYVTIFRPIAIVIAAAMGVMFLGDVLHLGSAIGAMILLVGFYGVIWGKANEETMSK  515

Query  1231  IKGSS  1245
                S+
Sbjct  516   DSASA  520



>ref|XP_009349859.1| PREDICTED: WAT1-related protein At5g40240-like [Pyrus x bretschneideri]
Length=383

 Score =   186 bits (472),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 117/355 (33%), Positives = 191/355 (54%), Gaps = 11/355 (3%)
 Frame = +1

Query  238   VPCMAMVMVEACTIFLTIMASTAMAKFGTNPFVFVVYTNALASIFLVPYSIIYHRRDKAQ  417
             VP  AMV+VE   + ++ ++  AM+K G + FVF+VY NA+ ++ L+P   I+ R  +A 
Sbjct  11    VPFTAMVIVECAEVGVSTLSKVAMSK-GMSKFVFIVYYNAIGTLLLLPI-FIFQRNRRAP  68

Query  418   EQlftfplllrlfflglIGVTISQNLAFVGLSYSSPIAACGTANIVPALSFILAIILRRT  597
                        L  +G  G    + L F G+  SS + A    N+ P  +F+LA+I R  
Sbjct  69    LTFRLICQFFLLGLIGSAG----KILFFAGVKNSSALLASAMGNLTPIFTFLLALIFRME  124

Query  598   KIDWESGGSQARMIGALICTVGTISLIFYRGPVVNNYSPTFLHLSTTQFVFSSSTNQQNW  777
             K+D     S A+ +GA+I   G + +  Y GP + N S +     +T     S ++   W
Sbjct  125   KLDLRKATSYAKSLGAIISVGGALVVTLYNGPALLNSSSSSGSSHSTHRSSVSQSS--TW  182

Query  778   VLGCLCFIAASLTLSIWNIIQVGTIRIYPQVMKIMCVYSLFGTVQSGALSLFIVRD-LNA  954
             + G L      L  S WNI Q  T++ YP+ M I+  Y++F T+Q   +SL + R+ LN+
Sbjct  183   MFGGLLLAIQCLVASGWNIAQAATVKDYPEEMTIVFFYTMFLTIQCTVISLIVERNNLNS  242

Query  955   WRLGLNFQLIVILLTAIFGSIIRSSVQLWCMRMKGPSFPLIFKPVGIVVASSCGCLFFAD  1134
             W+L L  ++I I+  AI  S+ R SV +WC+  KGP +  +F P+GI +A+    +F  D
Sbjct  243   WKLELPIEIIAIVYAAICVSVFRISVHVWCLHKKGPVYVAMFSPLGIAIAAVLVVVFLGD  302

Query  1135  TFHYGSMFSAFICGMGYYTTIWGQLKDEEIQQIKGSSVSLP--DEKVPLLQQSQD  1293
             TF+ GS+    +  +G+YT I+ ++K++ +   +G  +S P  DE V L + + D
Sbjct  303   TFYLGSLIGCIVISVGFYTVIYAKMKEKAMADDEGVQLSKPADDEGVQLSKPADD  357



>ref|XP_006573058.1| PREDICTED: WAT1-related protein At5g40240 isoform X2 [Glycine 
max]
Length=348

 Score =   185 bits (470),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 117/358 (33%), Positives = 186/358 (52%), Gaps = 24/358 (7%)
 Frame = +1

Query  226   FGEVVPCMAMVMVEACTIFLTIMASTAMAKF----GTNPFVFVVYTNALASIFLVPYSII  393
             +G+++P + M+M       LT   S  + KF    G N +V VVY+ AL+S  L+P+ + 
Sbjct  8     WGKLLPFLGMLMA-----MLTQSGSMVVIKFAMTDGMNKYVMVVYSMALSSSILLPFVLF  62

Query  394   YHRRDKAQEQlftfplllrlfflglIGVTISQNLAFVGLSYSSPIAACGTANIVPALSFI  573
              H R    E        L  FFL  +  + +  +A+VG+  SSP  A    N++PA +F+
Sbjct  63    LHSRS---ELPLLTVPALGSFFLLALFASSAHIMAYVGIELSSPTLASAILNVIPAFTFV  119

Query  574   LAIILRRTKIDWESGGSQARMIGALICTVGTISLIFYRGPVVNNYSPTFLHLSTTQFVFS  753
             LA+I R  ++ W    SQA+++G ++   G   +I Y+GP +     ++   ++ +  FS
Sbjct  120   LALIFRMEEVHWRYFSSQAKVLGTIVSIGGAFVVILYKGPPIFRTHSSY---TSNKLQFS  176

Query  754   SSTNQQNWVLGCLCFIAASLTLSIWNIIQVGTIRIYPQVMKIMCVYSLFGTVQSGALSLF  933
             +   Q NW+LG +  +A S   S+W I Q    + YP V  I+    LF T+Q G  +L 
Sbjct  177   A---QPNWILGGIFLVADSFLSSMWYIYQASVAKKYPAVTVIVFFQFLFSTIQCGVFALI  233

Query  934   IVRDLNAWRLGLNFQLIVILLTAIFGSIIRSSVQLWCMRMKGPSFPLIFKPVGIVVASSC  1113
              VRD   W L  +  L VIL  AI  +++R ++  WC+   GP F  +FKPVGI+   S 
Sbjct  234   AVRDPTEWELKFDRGLSVILYQAIVATMLRYTLTTWCVHRAGPLFCAMFKPVGIIFTVSM  293

Query  1114  GCLFFADTFHYGSMFSAFICGMGYYTTIWGQLKDE-EIQQIKGSSVSLPDEKVPLLQQ  1284
               +F  + F  GS+  A I  +G+Y  +WG  ++E +I+ ++ SS        PLLQ 
Sbjct  294   SAIFLGENFGLGSLIGAVIIVIGFYAVLWGNSREENKIENLESSS-----HNAPLLQD  346



>ref|XP_003517737.1| PREDICTED: WAT1-related protein At5g40240 isoform X1 [Glycine 
max]
 gb|KHN09902.1| Auxin-induced protein 5NG4-like protein [Glycine soja]
Length=347

 Score =   184 bits (468),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 117/358 (33%), Positives = 186/358 (52%), Gaps = 25/358 (7%)
 Frame = +1

Query  226   FGEVVPCMAMVMVEACTIFLTIMASTAMAKF----GTNPFVFVVYTNALASIFLVPYSII  393
             +G+++P + M+M       LT   S  + KF    G N +V VVY+ AL+S  L+P+ + 
Sbjct  8     WGKLLPFLGMLMA-----MLTQSGSMVVIKFAMTDGMNKYVMVVYSMALSSSILLPFVLF  62

Query  394   YHRRDKAQEQlftfplllrlfflglIGVTISQNLAFVGLSYSSPIAACGTANIVPALSFI  573
              HR     E        L  FFL  +  + +  +A+VG+  SSP  A    N++PA +F+
Sbjct  63    LHR----SELPLLTVPALGSFFLLALFASSAHIMAYVGIELSSPTLASAILNVIPAFTFV  118

Query  574   LAIILRRTKIDWESGGSQARMIGALICTVGTISLIFYRGPVVNNYSPTFLHLSTTQFVFS  753
             LA+I R  ++ W    SQA+++G ++   G   +I Y+GP +     ++   ++ +  FS
Sbjct  119   LALIFRMEEVHWRYFSSQAKVLGTIVSIGGAFVVILYKGPPIFRTHSSY---TSNKLQFS  175

Query  754   SSTNQQNWVLGCLCFIAASLTLSIWNIIQVGTIRIYPQVMKIMCVYSLFGTVQSGALSLF  933
             +   Q NW+LG +  +A S   S+W I Q    + YP V  I+    LF T+Q G  +L 
Sbjct  176   A---QPNWILGGIFLVADSFLSSMWYIYQASVAKKYPAVTVIVFFQFLFSTIQCGVFALI  232

Query  934   IVRDLNAWRLGLNFQLIVILLTAIFGSIIRSSVQLWCMRMKGPSFPLIFKPVGIVVASSC  1113
              VRD   W L  +  L VIL  AI  +++R ++  WC+   GP F  +FKPVGI+   S 
Sbjct  233   AVRDPTEWELKFDRGLSVILYQAIVATMLRYTLTTWCVHRAGPLFCAMFKPVGIIFTVSM  292

Query  1114  GCLFFADTFHYGSMFSAFICGMGYYTTIWGQLKDE-EIQQIKGSSVSLPDEKVPLLQQ  1284
               +F  + F  GS+  A I  +G+Y  +WG  ++E +I+ ++ SS        PLLQ 
Sbjct  293   SAIFLGENFGLGSLIGAVIIVIGFYAVLWGNSREENKIENLESSS-----HNAPLLQD  345



>ref|XP_009111588.1| PREDICTED: WAT1-related protein At3g28050-like [Brassica rapa]
Length=368

 Score =   185 bits (469),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 114/371 (31%), Positives = 192/371 (52%), Gaps = 24/371 (6%)
 Frame = +1

Query  232   EVVPCMAMVMVEACTIFLTIMASTAMAKFGTNPFVFVVYTNALASIFLVPYSIIYHRRDK  411
             EV+P MA+V++E   + L  +   A  + G +  VF+VY+  LA++ L+P SI +  R +
Sbjct  9     EVLPVMALVIMECANVGLNTLFKAATLQ-GMSFHVFIVYSYGLAALLLLP-SIFFSSRSR  66

Query  412   AQEQlftfplllrlfflglIGVTISQNLAFVGLSYSSPIAACGTANIVPALSFILAIILR  591
                 +    L   +     IG   S  + + G++YSSP  A   +N+ PA +F+LAI+ R
Sbjct  67    TLPPMNFSILYKIVVLGL-IGCC-SNIMGYTGINYSSPTLASAISNLTPAFTFLLAILFR  124

Query  592   RTKIDWESGGSQARMIGALICTVGTISLIFYRGPVVNNYSPTFLHLSTTQFVFSSSTNQQ  771
                + ++   S A+M+G ++   G   +  Y GP+V + SP  + L       S STN  
Sbjct  125   MESVSFKRISSVAKMLGTVVSIGGAFIVTLYNGPLVISMSPPSVSLR------SQSTNH-  177

Query  772   NWVLGCLCFIAASLTLSIWNIIQVGTIRIYPQVMKIMCVYSLFGTVQSGALSLFIV-RDL  948
             NW++G          + +W I+Q   +R YP    ++C YSL  +  +G ++LF    DL
Sbjct  178   NWIIGAAFLSVEYFMVPLWYIVQTQIMREYPSEFTVVCYYSLGVSFWTGLVTLFTEGSDL  237

Query  949   NAWRLGLNFQLIVILLTAIFGSIIRSSVQLWCMRMKGPSFPLIFKPVGIVVASSCGCLFF  1128
             NAW++  N  L+ I+ + +FGS I +++  W +R+KGP F  +FKP+ I +A + G +F 
Sbjct  238   NAWKIKPNIALVSIVCSGVFGSCINNTIHTWALRIKGPLFVAMFKPLSIAIAVAMGVIFL  297

Query  1129  ADTFHYGSMFSAFICGMGYYTTIWGQLKD------------EEIQQIKGSSVSLPDEKVP  1272
              D+ + GS+  A +   G+YT +WG+ K+            E+          L  +K P
Sbjct  298   HDSLYIGSLIGATVITTGFYTVMWGKAKEAAMVEDDNKANNEDATNEADHDSPLASQKAP  357

Query  1273  LLQQSQDDSPV  1305
             LL+  ++D  V
Sbjct  358   LLESYKNDEHV  368



>gb|KHG04184.1| Auxin-induced 5NG4 [Gossypium arboreum]
Length=360

 Score =   185 bits (469),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 118/366 (32%), Positives = 205/366 (56%), Gaps = 12/366 (3%)
 Frame = +1

Query  208   MEVKAAFGEVVPCMAMVMVEACTIFLTIMASTAMAKFGTNPFVFVVYTNALASIFLVPYS  387
             M + +     +P MAM+ VE   + +++++  A++K G +  V V Y NAL ++ L+PY 
Sbjct  1     MGLSSYLWNALPFMAMITVECTDVGISVISKAALSK-GMSNVVSVTYFNALGTLILLPYF  59

Query  388   IIYHRRDKAQEQlftfplllrlfflglIGVTISQNLAFVGLSYSSPIAACGTANIVPALS  567
             I    RDK  +   TF LL R F LGLIG +  Q +   G+ +SSP  +    N++P  +
Sbjct  60    IFC--RDK--QAPLTFSLLWRFFLLGLIGSS-GQIIFLTGVKFSSPTLSSALVNLIPIFT  114

Query  568   FILAIILRRTKIDWESGGSQARMIGALICTVGTISLIFYRGP-VVNNYSPT-FLHL----  729
             F+LA+I R  K++     SQA+++GA++   G   +  Y+GP V+ + SP+ FLH     
Sbjct  115   FLLAVIFRMEKLEMRKSSSQAKLLGAIVAVTGAFVVTLYKGPPVLMSSSPSDFLHHPFDS  174

Query  730   STTQFVFSSSTNQQNWVLGCLCFIAASLTLSIWNIIQVGTIRIYPQVMKIMCVYSLFGTV  909
               ++++    + Q  W++G    +   L+ + WN++Q  T++ Y   M I+  ++ F  +
Sbjct  175   KQSKWIIGGLSEQSKWIIGGFLLLLVCLSSATWNVLQAATVKEYTDKMTIVFFFTFFIAI  234

Query  910   QSGALSLFIVRDLNAWRLGLNFQLIVILLTAIFGSIIRSSVQLWCMRMKGPSFPLIFKPV  1089
             QS   S+ + R+  AWRL  N ++  IL +A+FGS+ R S+  WC+  KGP +  +FKP+
Sbjct  235   QSLVFSVILERNPTAWRLKSNEEVAAILCSALFGSLYRISIHTWCLEKKGPVYVSMFKPL  294

Query  1090  GIVVASSCGCLFFADTFHYGSMFSAFICGMGYYTTIWGQLKDEEIQQIKGSSVSLPDEKV  1269
             GI VA +   +F  ++   GS+  + I  +G+YT IWGQ  ++ + + +   +    +K 
Sbjct  295   GIAVAVALTVIFLGESLFLGSVIGSTIILVGFYTVIWGQANEKNMLENEVCGLESSHQKT  354

Query  1270  PLLQQS  1287
             PL++ S
Sbjct  355   PLIRNS  360



>ref|XP_009797459.1| PREDICTED: WAT1-related protein At4g15540-like isoform X1 [Nicotiana 
sylvestris]
Length=356

 Score =   184 bits (468),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 112/356 (31%), Positives = 188/356 (53%), Gaps = 14/356 (4%)
 Frame = +1

Query  238   VPCMAMVMVEACTIFLTIMASTAMAKFGTNPFVFVVYTNALASIFLVPYSIIYHRRDKAQ  417
             VP MAMV+ +   +   + A  AM+  G  PF F  Y++A +++ L+P S + HR     
Sbjct  5     VPLMAMVVQQLAQVGSMVAAKVAMST-GMTPFTFTFYSSAFSTLILIPLSFLLHR-----  58

Query  418   EQlftfplllrlfflglIGVT--ISQNLAFVGLSYSSPIAACGTANIVPALSFILAIILR  591
                        L+   L+G+   + Q +  +GL YSSP+ +     ++P  +FILA+ILR
Sbjct  59    -SALPPLWPTFLYGFFLLGLMGFLMQVVGILGLQYSSPLLSTAILQLIPGFTFILAVILR  117

Query  592   RTKIDWESGGSQARMIGALICTVGTISLIFYRGPVVNNYSPTFLHLSTTQFVFSSSTNQQ  771
                 D++S  + A+ +G L+  +G +    Y+GP V       +  + + F+ + S+   
Sbjct  118   MENFDYKSLNTVAKSVGTLVSIIGALVATLYKGPQVFGNHLNSILTAPSHFLLNQSSA--  175

Query  772   NWVLGCLCFIAASLTLSIWNIIQVGTIRIYPQVMKIMCVYSLFGTVQSGALSLFIVRDLN  951
              WV+G L  +  SL  S++ I Q   ++ YP  + +M  YS   T+   A SL   RDLN
Sbjct  176   -WVIGGLLMMITSLIASVFIISQAFVLKKYPTELIVMLFYSSCTTILCAAFSLITERDLN  234

Query  952   AWRLGLNFQLIVILLTAIFGSIIRSSVQLWCMRMKGPSFPLIFKPVGIVVASSCGCLFFA  1131
             AW L    +L  ++ +  FG++ + S+  WC+R +GP F ++F P+GIV+A +   +F  
Sbjct  235   AWSLSPQRRLKALIYSGFFGNVFQVSIGSWCVRKRGPLFVVMFHPIGIVIAMAA-SIFLG  293

Query  1132  DTFHYGSMFSAFICGMGYYTTIWGQLKDEEIQQIKG-SSVSLPDEKVPLLQQSQDD  1296
             +T H GS+  + I  +G+Y+ IWG+ K+ ++ +  G  S+      VPLLQ   DD
Sbjct  294   ETIHIGSLLGSIIILLGFYSVIWGKAKEWKMGENNGWKSLESNSNNVPLLQNKVDD  349



>ref|XP_008221768.1| PREDICTED: WAT1-related protein At3g28050-like [Prunus mume]
Length=350

 Score =   184 bits (467),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 113/357 (32%), Positives = 185/357 (52%), Gaps = 13/357 (4%)
 Frame = +1

Query  223   AFGEVVPCMAMVMVEACTIFLTIMASTAMAKFGTNPFVFVVYTNALASIFLVPYSIIYHR  402
             A G  +P + MVMV    +   I+   AMA  G + +V  VY+ ALA++ L+P+   ++R
Sbjct  2     AMGISMPFVGMVMVILAQVTSLILNKEAMAS-GLSEYVLAVYSFALAALILLPFCFFFNR  60

Query  403   RDKAQEQlftfplllrlfflglIGVTISQNLAFVGLSYSSPIAACGTANIVPALSFILAI  582
              ++          L  L  +G  G+     +   GL+Y+S        N++PA +FILA+
Sbjct  61    SERPPLSFSIILRLFLLSLIGSSGLL----MGLAGLNYASATLNTAMLNLIPAFTFILAL  116

Query  583   ILRRTKIDWESGGSQARMIGALICTVGTISLIFYRGPVV--NNYSPTFLHLSTTQFVFSS  756
             + R  K++W+S  SQA+ IG ++   G   + FY+GP V     S     L +  F+FS 
Sbjct  117   LFRMEKLNWKSSSSQAKTIGTVVSITGAFVVTFYKGPAVVHARLSSAGTGLFSNLFLFS-  175

Query  757   STNQQNWVLGCLCFIAASLTLSIWNIIQVGTIRIYPQVMKIMCVYSLFGTVQSGALSLFI  936
                + +WVLG L   A S + S+W I+Q   ++ YP V+  +  Y  F  +Q   +SL +
Sbjct  176   --EKSHWVLGGLLLAADSFSTSLWFIVQASILKKYPAVLITVFFYCFFVCIQCALVSLIL  233

Query  937   VRDLNAWRLGLNFQLIVILLTAIFGSIIRSSVQLWCMRMKGPSFPLIFKPVGIVVASSCG  1116
             V+DL+AWRL  N  L+ +L   I G   R+++  WC++  GP +  +FKP+ +V A    
Sbjct  234   VQDLSAWRLKSNIALLAVLYYGIVGISFRTNMCTWCLQRTGPVYVSMFKPLAVVFADVID  293

Query  1117  CLFFADTFHYGSMFSAFICGMGYYTTIWGQLKDEEIQQIKGSS---VSLPDEKVPLL  1278
              +F     + GS+  A +   G Y  IWG+ ++E++ +  G     +    E+VPLL
Sbjct  294   VIFLGQALYLGSLIGAAVIISGLYVVIWGKAREEKLHENSGEGQNCLESSTERVPLL  350



>ref|XP_010046740.1| PREDICTED: uncharacterized protein LOC104435740 [Eucalyptus grandis]
Length=747

 Score =   191 bits (485),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 121/357 (34%), Positives = 185/357 (52%), Gaps = 10/357 (3%)
 Frame = +1

Query  238   VPCMAMVMVEACTIFLTIMASTAMAKFGTNPFVFVVYTNALASIFLVPYSIIYHRRDKAQ  417
             +P M M+MV        ++   AM++ G N +  V Y+NAL+S+ L+P  +I  RR  + 
Sbjct  396   LPFMGMIMVVLVQTSNMVVTKMAMSE-GMNKYTMVFYSNALSSLVLLPCPLIISRRPGSC  454

Query  418   EQlftfplllrlfflglIGVTISQNLAFVGLSYSSPIAACGTANIVPALSFILAIILRRT  597
               L    L         IG+   Q   +VG+ YSSP+      N++PA +FILAII R  
Sbjct  455   PPLTFSVLRKIFLIAL-IGLA-CQMCEYVGMDYSSPVLGMAMMNLIPAFTFILAIISRME  512

Query  598   KIDWESGGSQARMIGALICTVGTISLIFYRGPVVNNYSPTFLHLSTTQFVFSSSTNQQNW  777
             K++W+S  SQA+++G +   +G   +  Y+GP +                  S   Q NW
Sbjct  513   KVNWKSSSSQAKLVGTITSILGAFVVTLYKGPPILLSPSPPPVQPRHPPFLLS--RQSNW  570

Query  778   VLGCLCFIAASLTLSIWNIIQVGTIRIYPQVMKIMCVYSLFGTVQSGALSLFIVRDLNAW  957
             +LG    +A +  +S+W I Q   ++ YP VM +M   + F TV SG LS   VR+   W
Sbjct  571   ILGGFLLVAEAFLISLWFIGQAFILKDYPVVMNLMFYSTFFSTVLSGLLSFVTVREPQFW  630

Query  958   RLGLNFQLIVILLTAIFGSIIRSSVQLWCMRMKGPSFPLIFKPVGIVVASSCGCLFFADT  1137
              L +N  LI IL +A+   + R+S+  WC++  GP +  +FKP+G+V A+  G +F  + 
Sbjct  631   ILKVNIGLISILYSALVSGVFRASLCTWCLKKTGPVYVSMFKPLGVVFAAGLGFIFLGEM  690

Query  1138  FHYGSMFSAFICGMGYYTTIWGQLKDEEIQQIKGSSV--SLPD--EKVPLLQQSQDD  1296
              + GS+  A +  MG+Y  +WG+ K+EE   I+GS V  SL     K PLLQ     
Sbjct  691   LYLGSIIGAIVIVMGFYGVMWGKSKEEE-TTIEGSGVGESLASSVHKTPLLQNKASS  746


 Score =   184 bits (467),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 112/356 (31%), Positives = 185/356 (52%), Gaps = 13/356 (4%)
 Frame = +1

Query  238   VPCMAMVMVEACTIFLTIMASTAMAKFGTNPFVFVVYTNALASIFLVPYSIIYHRRDKAQ  417
             +P   M+MV        ++   AM+  G N +    Y N L+S+ L+P   I  RR  + 
Sbjct  9     LPFAGMIMVVLAQAGNMVVMKMAMSD-GINKYTMAFYCNVLSSLVLLPCPFIISRRSGSC  67

Query  418   EQlftfplllrlfflglIGVTISQNLAFVGLSYSSPIAACGTANIVPALSFILAIILRRT  597
               L    L         +G   SQ   +VG+ YSSP+      N++PA +FILA+I R  
Sbjct  68    PPLAFPVLRKIFLLAL-VGCA-SQTSGYVGIEYSSPVLGTAMMNLIPAFTFILAVISRME  125

Query  598   KIDWESGGSQARMIGALICTVGTISLIFYRGPVVNNYSPTFLHLSTTQFVFSSSTNQQNW  777
             K++W+S  SQA+++G +   +G   +  Y+GP++  +SP+    S    + S    Q NW
Sbjct  126   KVNWKSSSSQAKLVGTIASILGAFVVTLYKGPLI--FSPSSPPASVQPGLLS---QQSNW  180

Query  778   VLGCLCFIAASLTLSIWNIIQVGTIRIYPQVMKIMCVYSLFGTVQSGALSLFIVRDLNAW  957
             +LG     A +  +S+  I+Q   ++ YP V+ IM     F T+ SG LS   VR+  +W
Sbjct  181   ILGGFLLAAEAFLISLAYIVQAIILKDYPVVLNIMFYGMFFQTIFSGLLSFVTVREPQSW  240

Query  958   RLGLNFQLIVILLTAIFGSIIRSSVQLWCMRMKGPSFPLIFKPVGIVVASSCGCLFFADT  1137
              L ++  LI IL +A+  ++ R ++  WC++  GP +  +F+P+G V A   G +F  + 
Sbjct  241   ILKVDLGLIAILYSALVANVFRITLSTWCLKRTGPVYVSMFQPLGTVFAVGLGFIFLGEK  300

Query  1138  FHYGSMFSAFICGMGYYTTIWGQLKDEEIQQIKGS----SVSLPDEKVPLLQQSQD  1293
              H GS+  A +  MG+Y  +W + K+EE + I+GS    S++   +K+PLL+    
Sbjct  301   LHIGSLIGAIVIVMGFYGVVWAKSKEEE-KTIEGSGVEESLASSSDKIPLLRNKAS  355



>gb|KCW87484.1| hypothetical protein EUGRSUZ_B03946 [Eucalyptus grandis]
Length=357

 Score =   184 bits (467),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 112/356 (31%), Positives = 185/356 (52%), Gaps = 13/356 (4%)
 Frame = +1

Query  238   VPCMAMVMVEACTIFLTIMASTAMAKFGTNPFVFVVYTNALASIFLVPYSIIYHRRDKAQ  417
             +P   M+MV        ++   AM+  G N +    Y N L+S+ L+P   I  RR  + 
Sbjct  9     LPFAGMIMVVLAQAGNMVVMKMAMSD-GINKYTMAFYCNVLSSLVLLPCPFIISRRSGSC  67

Query  418   EQlftfplllrlfflglIGVTISQNLAFVGLSYSSPIAACGTANIVPALSFILAIILRRT  597
               L    L         +G   SQ   +VG+ YSSP+      N++PA +FILA+I R  
Sbjct  68    PPLAFPVLRKIFLLAL-VGCA-SQTSGYVGIEYSSPVLGTAMMNLIPAFTFILAVISRME  125

Query  598   KIDWESGGSQARMIGALICTVGTISLIFYRGPVVNNYSPTFLHLSTTQFVFSSSTNQQNW  777
             K++W+S  SQA+++G +   +G   +  Y+GP++  +SP+    S    + S    Q NW
Sbjct  126   KVNWKSSSSQAKLVGTIASILGAFVVTLYKGPLI--FSPSSPPASVQPGLLS---QQSNW  180

Query  778   VLGCLCFIAASLTLSIWNIIQVGTIRIYPQVMKIMCVYSLFGTVQSGALSLFIVRDLNAW  957
             +LG     A +  +S+  I+Q   ++ YP V+ IM     F T+ SG LS   VR+  +W
Sbjct  181   ILGGFLLAAEAFLISLAYIVQAIILKDYPVVLNIMFYGMFFQTIFSGLLSFVTVREPQSW  240

Query  958   RLGLNFQLIVILLTAIFGSIIRSSVQLWCMRMKGPSFPLIFKPVGIVVASSCGCLFFADT  1137
              L ++  LI IL +A+  ++ R ++  WC++  GP +  +F+P+G V A   G +F  + 
Sbjct  241   ILKVDLGLIAILYSALVANVFRITLSTWCLKRTGPVYVSMFQPLGTVFAVGLGFIFLGEK  300

Query  1138  FHYGSMFSAFICGMGYYTTIWGQLKDEEIQQIKGS----SVSLPDEKVPLLQQSQD  1293
              H GS+  A +  MG+Y  +W + K+EE + I+GS    S++   +K+PLL+    
Sbjct  301   LHIGSLIGAIVIVMGFYGVVWAKSKEEE-KTIEGSGVEESLASSSDKIPLLRNKAS  355



>ref|XP_002279776.1| PREDICTED: WAT1-related protein At5g40230 [Vitis vinifera]
Length=359

 Score =   184 bits (467),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 115/356 (32%), Positives = 201/356 (56%), Gaps = 7/356 (2%)
 Frame = +1

Query  232   EVVPCMAMVMVEACTIFLTIMASTAMAKFGTNPFVFVVYTNALASIFLVPYSIIYHRRDK  411
             ++VP + MV VEA  + L ++  +A ++ G + +VF+VY+ A+A++ L P   I++ + +
Sbjct  9     DMVPFLGMVTVEATNVVLNVLFKSATSR-GMSVYVFIVYSYAVATLILFPLLFIFNGK-R  66

Query  412   AQEQlftfplllrlfflglIGVTISQNLAFVGLSYSSPIAACGTANIVPALSFILAIILR  591
                  F F LL ++  LG IG  +++ +A+ G+ YSSP  A    N+ PAL+F+LAI  R
Sbjct  67    LLLPPFKFSLLCKICSLGFIGF-LAEIVAYKGIDYSSPTLASVIGNLTPALTFMLAIFFR  125

Query  592   RTKIDWESGGSQARMIGALICTVGTISLIFYRGPVVNNYSPTFLHLSTTQFVFSSSTNQQ  771
               K+   S  S A++ G +    G + ++ Y+G  + + S     +S  Q     ++ Q 
Sbjct  126   MEKLALRSLSSWAKITGTIASISGALIVVLYKGLQLTSTSSPLQFISLHQ---PLNSQQM  182

Query  772   NWVLGCLCFIAASLTLSIWNIIQVGTIRIYPQVMKIMCVYSLFGTVQSGALSLFIVRDLN  951
              WV+G L  +A  L +SIW I+Q   + +YP+ + ++ + +L  T+ S  + L   ++L+
Sbjct  183   KWVIGGLLLVAEDLLVSIWYIVQAQVMEVYPEELVVVFLSNLCLTIISAPVCLIAEKNLS  242

Query  952   AWRLGLNFQLIVILLTAIFGSIIRSSVQLWCMRMKGPSFPLIFKPVGIVVASSCGCLFFA  1131
              WR+ L+  L  I+ +A +GS     V  W +R+KGP +  +F P+ IV+A++ G +F  
Sbjct  243   VWRVELDIALAAIVFSAFWGSAFGMVVPTWVVRLKGPVYVAMFNPLSIVIATAMGVMFLG  302

Query  1132  DTFHYGSMFSAFICGMGYYTTIWGQLKDEEIQQIK-GSSVSLPDEKVPLLQQSQDD  1296
             DT + GS+  A +  +G+Y   WG+ K+E I+    GS  SL + K+PLL   Q +
Sbjct  303   DTLYLGSIIGAIVISIGFYIVTWGKAKEETIEDFGVGSLESLSNPKIPLLLSCQSE  358



>ref|XP_006446450.1| hypothetical protein CICLE_v10017903mg [Citrus clementina]
 gb|ESR59690.1| hypothetical protein CICLE_v10017903mg [Citrus clementina]
Length=414

 Score =   186 bits (471),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 110/355 (31%), Positives = 186/355 (52%), Gaps = 14/355 (4%)
 Frame = +1

Query  232   EVVPCMAMVMVEACTIFLTIMASTAMAKFGTNPFVFVVYTNALASIFLVPYSIIYHRRDK  411
             +  P +AM +VE   + +  +   AM+  G + FV+VVY NAL +  L+ Y I    R K
Sbjct  71    DTAPFVAMALVEIGEVGMITLGKAAMSS-GMSNFVYVVYYNALGTFILLHYFIYNTYRSK  129

Query  412   AQEQlftfplllrlfflglIGVTISQNLAFVGLSYSSPIAACGTANIVPALSFILAIILR  591
                 + TF LL + F LG++G+ + Q  A  G+ YSSP  A    N++P ++F+LA+  R
Sbjct  130   GP--VLTFSLLCKFFMLGVLGICLVQIFAITGIKYSSPTLASAMGNLIPGITFLLAVFFR  187

Query  592   RTKIDWESGGSQARMIGALICTVGTISLIFYRGPVVNNYSP---TFLHLSTTQFVFSSST  762
               K+   S  SQA+++G ++   G   +  Y+GP +  +S    + + L  +++      
Sbjct  188   MEKVAIRSRSSQAKILGTVVSIAGAFIVSLYKGPPLLGFSSPSNSNIQLPVSEY------  241

Query  763   NQQNWVLGCLCFIAASLTLSIWNIIQVGTIRIYPQVMKIMCVYSLFGTVQSGALSLFIVR  942
                NW LG L       + + W I Q   ++ YP  + ++     FGT+Q   +S+ + R
Sbjct  242   --SNWALGGLLLTVTCFSSATWKIFQAAVLKEYPDKINLVFFSCFFGTIQCAVVSIIVER  299

Query  943   DLNAWRLGLNFQLIVILLTAIFGSIIRSSVQLWCMRMKGPSFPLIFKPVGIVVASSCGCL  1122
             + +AW+L    Q   ++  AI G++IRSS+  WC++ KGP F  +FKP+G  +A     +
Sbjct  300   NPSAWKLQPGIQRTAVIYAAIVGTVIRSSIIAWCLQKKGPVFVALFKPLGTAIAVFMAVM  359

Query  1123  FFADTFHYGSMFSAFICGMGYYTTIWGQLKDEEIQQIKGSSVSLPDEKVPLLQQS  1287
             F  +T H GS+  A +   G+Y  IW Q K+  +      S+  P++K+P L+ +
Sbjct  360   FLGETPHLGSLIGAVVIAFGFYAVIWAQGKESNMTTGNVGSLESPNQKIPPLKNT  414



>gb|KDP45389.1| hypothetical protein JCGZ_09638 [Jatropha curcas]
Length=353

 Score =   184 bits (466),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 115/360 (32%), Positives = 187/360 (52%), Gaps = 14/360 (4%)
 Frame = +1

Query  208   MEVKAAFGEVVPCMAMVMVEACTIFLTIMASTAMAKFGTNPFVFVVYTNALASIFLVPYS  387
             ME  +   ++     MV VE   + +  ++  A+++ G + +V VVY+NAL ++ L+PY 
Sbjct  1     MEASSWIWDLACFAGMVSVECTDVGIATISKAALSQ-GMSKYVSVVYSNALGTLILLPYF  59

Query  388   IIYHRRDKAQEQlftfplllrlfflglIGVTISQNLAFVGLSYSSPIAACGTANIVPALS  567
             I Y +R           LL R F LGLIG T  Q +    +  SSP  +   AN++P  +
Sbjct  60    IFYRKRRAP----INPSLLFRFFLLGLIGST-GQIIYLAAVKLSSPTLSSAMANLIPIFT  114

Query  568   FILAIILRRTKIDWESGGSQARMIGALICTVGTISLIFYRGPVVNNYSPTFLHLSTTQFV  747
             F+LA+I R   +D     SQA++ GA++   G   +  Y+GP +        H    Q  
Sbjct  115   FLLAVITRMETLDLRRSSSQAKLSGAIVSVTGASIVTLYKGPAIFMIQSLTSHSHHLQLQ  174

Query  748   FSSSTNQQNWVLGCLCFIAASLTLSIWNIIQVGTIRIYPQVMKIMCVYSLFGTVQSGALS  927
                 + +  W+ G    +   L  + W I Q  T++ YP+ M I+  ++LF T+QS   S
Sbjct  175   -PLHSQKPEWIFGGFLLVIVCLLSATWTIAQGATVKQYPEEMTILFFFTLFITIQSAFFS  233

Query  928   LFIVRDLNAWRLGLNFQLIVILLTAIFGSIIRSSVQLWCMRMKGPSFPLIFKPVGIVVAS  1107
             L + R+ NAWRL    ++I I+ TA+FGS+ R     WC+  KGP +  +FKP+GI +A 
Sbjct  234   LILERNPNAWRLKSAIEIIAIVFTAVFGSLFRIGFHTWCLGKKGPLYVAMFKPLGIAIAV  293

Query  1108  SCGCLFFADTFHYGSMFSAFICGMGYYTTIWGQLKDEEIQQIKGSSVSLPDEKVPLLQQS  1287
                  F  +T   GS+  + I  +G+Y+ +WGQ+K++  +       +   +KVPLLQ++
Sbjct  294   FMTVTFLGETLCLGSVIGSIIIALGFYSVMWGQMKEKNNE-------AFSSQKVPLLQRN  346



>ref|XP_006581027.1| PREDICTED: uncharacterized protein LOC100804032 isoform X1 [Glycine 
max]
Length=348

 Score =   183 bits (465),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 112/348 (32%), Positives = 181/348 (52%), Gaps = 14/348 (4%)
 Frame = +1

Query  262   VEACTIFLTIMASTAMAKFGTNPFVFVVYTNALASIFLVPYSIIYHRRDKAQEQlftfpl  441
             +E   + +  ++  AM K G N FVFV+Y+NA A+  L+P +  ++R+       +    
Sbjct  13    IEFLDVIVYTVSKAAMKK-GMNDFVFVMYSNAFATCLLLPITFFFYRKRPLPPLTYFIVA  71

Query  442   llrlfflglIGVTISQNLAFVGLSYSSPIAACGTANIVPALSFILAIILRRTKIDWESGG  621
              L +      G    Q L F G+ YSSP  A   ++++PA +FILAI+ R  K+DW++  
Sbjct  72    QLFIN-----GFLSVQMLRFFGIGYSSPTLATAMSDLIPAFTFILAIVFRMEKLDWKTNS  126

Query  622   SQARMIGALICTVGTISLIFYRG-PVVNNYSPTFLHLSTTQFVFS-SSTNQQNWVLGCLC  795
             ++A+ IG L+   G + +  Y+G  ++NN      H S   F  + +S+ Q +WV+G + 
Sbjct  127   TRAKSIGTLVSITGALIITLYKGQAIINN------HPSNKLFPKNLNSSEQFDWVVGAVL  180

Query  796   FIAASLTLSIWNIIQVGTIRIYPQVMKIMCVYSLFGTVQSGALSLFIVRDLNAWRLGLNF  975
                 S  LS+  I+Q   IR YP  + I+    +   + S   SL  V D    RLG + 
Sbjct  181   LAGHSFVLSLLFIVQTWIIRNYPAELVIVVTRGILVAMLSIPPSLISVTDPKDLRLGFDV  240

Query  976   QLIVILLTAIFGSIIRSSVQLWCMRMKGPSFPLIFKPVGIVVASSCGCLFFADTFHYGSM  1155
              LI I L AIFG  +RS V +W M  KGP +  +FKP+GI+ A   G  F  D+ + GS+
Sbjct  241   HLIAIALQAIFGVSLRSIVHIWVMSKKGPLYVAMFKPIGIIFAVIMGIAFLGDSIYLGSV  300

Query  1156  FSAFICGMGYYTTIWGQLKDEEIQQIKGSSVSLPDEKVPLLQQSQDDS  1299
               A I  +G+Y  IWG+ +++  ++ +          VPLL++ + + 
Sbjct  301   LGAAIVVIGFYAVIWGKSQEQAKEECEVYDSESYSPVVPLLKKKKMEE  348



>emb|CBI32117.3| unnamed protein product [Vitis vinifera]
Length=317

 Score =   182 bits (462),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 106/322 (33%), Positives = 168/322 (52%), Gaps = 9/322 (3%)
 Frame = +1

Query  325   NPFVFVVYTNALASIFLVPYSIIYHRRDKAQEQlftfplllrlfflglIGVTISQNLAFV  504
             + FVFVVY+NAL+   L+   +++HRR        +    + +          +Q   FV
Sbjct  2     SDFVFVVYSNALSVPILLFCCLLFHRRRFPPPLTLSILCRIFILGFISCS---TQMFLFV  58

Query  505   GLSYSSPIAACGTANIVPALSFILAIILRRTKIDWESGGSQARMIGALICTVGTISLIFY  684
             G+ YSSP  A    ++VPA +FILAII R  K+D ++G  +A+ IG ++  +G + +  Y
Sbjct  59    GIRYSSPTLASAMTDLVPAFTFILAIISRMEKLDLKAGSCRAKCIGTIVSIIGALIVTIY  118

Query  685   RGPVVNNYSPTFLHLSTTQFVFSSSTNQQNWVLGCLCFIAASLTLSIWNIIQVGTIRIYP  864
             +GP +   S TF  L          +   NWV+G      ++++++++ ++Q   IR YP
Sbjct  119   KGPQIAFASSTFKILDENL-----RSQISNWVIGGFLLAISAVSIALFYVVQTSIIRDYP  173

Query  865   QVMKIMCVYSLFGTVQSGALSLFIVRDLNAWRLGLNFQLIVILLTAIFGSIIRSSVQLWC  1044
               + +  +  +F T+QS  +SL   RD +AWRL  + +LI +  +A+     R +   W 
Sbjct  174   AELMLTFICHIFVTMQSSIVSLIAERDPSAWRLKPDVELIAVGYSAVLVLAFRGTAHAWV  233

Query  1045  MRMKGPSFPLIFKPVGIVVASSCGCLFFADTFHYGSMFSAFICGMGYYTTIWGQLKDEEI  1224
             +  KGP F  +FKPV IV+A   G  F  D  H GS+  A I   G+YT +WG+ K EEI
Sbjct  234   LHKKGPVFVAMFKPVAIVIAVVMGVTFLGDVLHLGSVIGAAIIAFGFYTVMWGKAK-EEI  292

Query  1225  QQIKGSSVSLPDEKVPLLQQSQ  1290
             + +  S +     K PLLQ   
Sbjct  293   EDMTTSGIDSSSHKDPLLQNKS  314



>ref|XP_009599993.1| PREDICTED: WAT1-related protein At3g28050-like [Nicotiana tomentosiformis]
Length=359

 Score =   183 bits (465),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 121/362 (33%), Positives = 205/362 (57%), Gaps = 9/362 (2%)
 Frame = +1

Query  208   MEVKAAFGEVVPCMAMVMVEACTIFLTIMASTAMAKFGTNPFVFVVYTNALASIFLVPYS  387
             ME+++   +V P +AMV+VE C + +  +   AM   G +  V+VVY NAL ++ L+   
Sbjct  4     MEMQSWSKDVFPFVAMVLVECCEMGMITLGKAAMND-GMSNLVYVVYYNALGTLLLL-PF  61

Query  388   IIYHRRDKAQEQlftfplllrlfflglIGVTISQNLAFVGLSYSSPIAACGTANIVPALS  567
             +I+HR  ++     T  +L R F LGL+G+ + Q LA+ G+ YSSP  A    N++P  +
Sbjct  62    LIFHR-CRSNMAPITLSILWRFFLLGLLGICLLQVLAYTGIKYSSPTLAAALGNLMPGFT  120

Query  568   FILAIILRRTKIDWESGGSQARMIGALICTVGTISLIFYRGPVVNNYSPTFLHLSTTQFV  747
             F+LAII R  K+D     SQA+ +G ++  +G   +  Y+GP +     +    S +   
Sbjct  121   FLLAIIFRMEKLDIRKASSQAKSLGTIVAIIGASIMTLYKGPKLLG---SSTLPSHSSHH  177

Query  748   FSSSTNQQNWVLGCLCFIAASLTLSIWNIIQVGTIRIYPQVMKIMCVYSLFGTVQSGALS  927
              S  + + NW+LG L      +  S WNI+Q  T++ YP+ M I+     FG++Q   L+
Sbjct  178   HSLLSQESNWLLGGLLITITCIMSSGWNILQTDTVKKYPEQMTIVFFTCCFGSIQCAILT  237

Query  928   LFIVRDLNAWRLGLNFQLIVILLTAIFGSIIRSSVQLWCMRMKGPSFPLIFKPVGIVVAS  1107
             L + R+  AW +     +I I+ +A+ GS+ R +V  WC+  KGP +  +FKP+G+V+A+
Sbjct  238   LVLERNPEAWMVKPGIGIIAIVFSAVSGSVFRYNVLTWCLDKKGPLYVAMFKPLGMVIAA  297

Query  1108  SCGCLFFADTFHYGSMFSAFICGMGYYTTIWGQLKD-EEIQQIKGSS--VSLPDEKVPLL  1278
               G LF A++ H GS+  A I   G+Y+ +WG+ K+ + + +I+ +   +    ++ PLL
Sbjct  298   ILGILFLAESLHLGSVIGAVIISAGFYSVLWGKAKEIKSMLEIEDTVCIIDSSSQRSPLL  357

Query  1279  QQ  1284
             Q+
Sbjct  358   QK  359



>ref|NP_001241291.1| uncharacterized protein LOC100804032 [Glycine max]
 gb|ACU22695.1| unknown [Glycine max]
 gb|KHN23419.1| Auxin-induced protein 5NG4 [Glycine soja]
Length=350

 Score =   183 bits (464),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 110/347 (32%), Positives = 179/347 (52%), Gaps = 10/347 (3%)
 Frame = +1

Query  262   VEACTIFLTIMASTAMAKFGTNPFVFVVYTNALASIFLVPYSIIYHRRDKAQEQlftfpl  441
             +E   + +  ++  AM K G N FVFV+Y+NA A+  L+P +  ++R+       +    
Sbjct  13    IEFLDVIVYTVSKAAMKK-GMNDFVFVMYSNAFATCLLLPITFFFYRKRPLPPLTYFIVA  71

Query  442   llrlfflglIGVTISQNLAFVGLSYSSPIAACGTANIVPALSFILAIILRRTKIDWESGG  621
              L +       V   Q L F G+ YSSP  A   ++++PA +FILAI+ R  K+DW++  
Sbjct  72    QLFINGFLSCSV---QMLRFFGIGYSSPTLATAMSDLIPAFTFILAIVFRMEKLDWKTNS  128

Query  622   SQARMIGALICTVGTISLIFYRG-PVVNNYSPTFLHLSTTQFVFSSSTNQQNWVLGCLCF  798
             ++A+ IG L+   G + +  Y+G  ++NN+    L          +S+ Q +WV+G +  
Sbjct  129   TRAKSIGTLVSITGALIITLYKGQAIINNHPSNKLFPKNL-----NSSEQFDWVVGAVLL  183

Query  799   IAASLTLSIWNIIQVGTIRIYPQVMKIMCVYSLFGTVQSGALSLFIVRDLNAWRLGLNFQ  978
                S  LS+  I+Q   IR YP  + I+    +   + S   SL  V D    RLG +  
Sbjct  184   AGHSFVLSLLFIVQTWIIRNYPAELVIVVTRGILVAMLSIPPSLISVTDPKDLRLGFDVH  243

Query  979   LIVILLTAIFGSIIRSSVQLWCMRMKGPSFPLIFKPVGIVVASSCGCLFFADTFHYGSMF  1158
             LI I L AIFG  +RS V +W M  KGP +  +FKP+GI+ A   G  F  D+ + GS+ 
Sbjct  244   LIAIALQAIFGVSLRSIVHIWVMSKKGPLYVAMFKPIGIIFAVIMGIAFLGDSIYLGSVL  303

Query  1159  SAFICGMGYYTTIWGQLKDEEIQQIKGSSVSLPDEKVPLLQQSQDDS  1299
              A I  +G+Y  IWG+ +++  ++ +          VPLL++ + + 
Sbjct  304   GAAIVVIGFYAVIWGKSQEQAKEECEVYDSESYSPVVPLLKKKKMEE  350



>ref|XP_002517375.1| Auxin-induced protein 5NG4, putative [Ricinus communis]
 gb|EEF44917.1| Auxin-induced protein 5NG4, putative [Ricinus communis]
Length=419

 Score =   184 bits (468),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 111/360 (31%), Positives = 191/360 (53%), Gaps = 14/360 (4%)
 Frame = +1

Query  226   FGEVVPCMAMVMVEACTIFLTIMASTAMAKFGTNPFVFVVYTNALASIFLVPYSIIYHRR  405
             + +V+P   +V +E   + L  +   A  + G N  VF+VY  A+A++ L+P   I  R 
Sbjct  69    YEDVLPFTTLVTMECVNVGLNTLYKAATLE-GMNYHVFIVYAYAIAALVLLPAPFISSR-  126

Query  406   DKAQEQlftfplllrlfflglIGV--TISQNLAFVGLSYSSPIAACGTANIVPALSFILA  579
                  ++        L  +GL+GV  + SQ L + G++YSSP  +   +N+ PA +FILA
Sbjct  127   ----SRMLPPLSFSILCKIGLLGVIGSSSQILGYTGINYSSPTLSSAISNLTPAFTFILA  182

Query  580   IILRRTKIDWESGGSQARMIGALICTVGTISLIFYRGPVVNNYSPTFLHLSTTQFVFSSS  759
             II R  ++      SQA+++G ++   G   +  Y+GP++   S  F+ L          
Sbjct  183   IIFRMERVSLRKRSSQAKVLGTIVSIAGAFVVTLYKGPLIFIASSPFIALDQPP-----R  237

Query  760   TNQQNWVLGCLCFIAASLTLSIWNIIQVGTIRIYPQVMKIMCVYSLFGTVQSGALSLFIV  939
             ++  NW+LG +   A  + + +W I+Q   ++ YP  M ++  Y+L  +  +  ++L   
Sbjct  238   SSNPNWILGGIFLTAEYILVPLWYIVQTQIMKEYPAEMTVVFFYNLTVSFIAAVVALISE  297

Query  940   RDLNAWRLGLNFQLIVILLTAIFGSIIRSSVQLWCMRMKGPSFPLIFKPVGIVVASSCGC  1119
                +AW +     L  I+ + +FGS + ++V  W + +KGP F  +FKP+ I +A + G 
Sbjct  298   GPSSAWVVRPGIALASIVCSGLFGSCLNNTVHTWALHLKGPVFVAMFKPLSIAIAVAMGV  357

Query  1120  LFFADTFHYGSMFSAFICGMGYYTTIWGQLKDEEIQQIKGSSVSLPD-EKVPLLQQSQDD  1296
             +F  D  H GS+  A I  +G+YT +WG+ K+E I+   GSS+  P  +KVPLLQ  +D+
Sbjct  358   MFLGDALHLGSLIGATIISIGFYTVMWGKAKEEVIEDYGGSSLQSPSAQKVPLLQSYKDE  417



>ref|XP_007227338.1| hypothetical protein PRUPE_ppa015719mg [Prunus persica]
 gb|EMJ28537.1| hypothetical protein PRUPE_ppa015719mg [Prunus persica]
Length=350

 Score =   182 bits (461),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 112/357 (31%), Positives = 184/357 (52%), Gaps = 13/357 (4%)
 Frame = +1

Query  223   AFGEVVPCMAMVMVEACTIFLTIMASTAMAKFGTNPFVFVVYTNALASIFLVPYSIIYHR  402
             A G  +P + MVMV    +   I+   AMA  G + +V  VY+ ALA++ ++P+   ++R
Sbjct  2     AMGISMPFVGMVMVILAQVTSLILNKEAMAS-GLSEYVLAVYSFALAALIILPFCFFFNR  60

Query  403   RDKAQEQlftfplllrlfflglIGVTISQNLAFVGLSYSSPIAACGTANIVPALSFILAI  582
              ++          L  L  +G  G+     +   GL+Y+S        N++PA +FILA+
Sbjct  61    SERPPLSFSIISRLFLLSLIGSSGLL----MGLAGLNYASATLNTAMLNLIPAFTFILAL  116

Query  583   ILRRTKIDWESGGSQARMIGALICTVGTISLIFYRGPVV--NNYSPTFLHLSTTQFVFSS  756
             + R  K++W S  SQA+ IG ++   G   + FY+GP V     S     L +  F+FS 
Sbjct  117   LFRMEKLNWRSSSSQAKTIGTVVSITGAFVVTFYKGPAVIHARLSSAGTGLFSNLFLFS-  175

Query  757   STNQQNWVLGCLCFIAASLTLSIWNIIQVGTIRIYPQVMKIMCVYSLFGTVQSGALSLFI  936
                + +WVLG L   A S + S+W I+Q   ++ YP V+  +  Y  F  +Q   +SL +
Sbjct  176   --EKSHWVLGGLLLAADSFSTSLWFIVQASILKKYPAVLITVFFYCFFVCIQCALVSLIL  233

Query  937   VRDLNAWRLGLNFQLIVILLTAIFGSIIRSSVQLWCMRMKGPSFPLIFKPVGIVVASSCG  1116
             V+DL+AWRL  N  L+ +L   I G   R+++  WC++  GP +  +FKP+ +V A    
Sbjct  234   VQDLSAWRLKPNIGLLAVLYYGIVGISFRTNMCTWCLQRTGPVYVSMFKPLAVVFADVID  293

Query  1117  CLFFADTFHYGSMFSAFICGMGYYTTIWGQLKDEEIQQIKGSS---VSLPDEKVPLL  1278
              +F     + GS+  A +   G Y  IWG+ ++E++ +  G     +    E+VPLL
Sbjct  294   VIFLGQALYLGSLIGAAVIISGLYVVIWGKSREEKLHENSGEGQNCLESSTERVPLL  350



>ref|XP_007031402.1| Nodulin MtN21 /EamA-like transporter family protein, putative 
isoform 1 [Theobroma cacao]
 gb|EOY02328.1| Nodulin MtN21 /EamA-like transporter family protein, putative 
isoform 1 [Theobroma cacao]
Length=361

 Score =   182 bits (462),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 120/361 (33%), Positives = 200/361 (55%), Gaps = 10/361 (3%)
 Frame = +1

Query  226   FGEVVPCMAMVMVEACTIFLTIMASTAMAKFGTNPFVFVVYTNALASIFLVPYSIIYHRR  405
             + +V+P  AMV +E+  + L I+   A  K G + ++F+ Y+ A+ +I  +P S I+  R
Sbjct  7     YNDVLPFTAMVALESANVGLNILFKAATLK-GMSYYIFIAYSYAVGTILFLPLSFIFPSR  65

Query  406   DKAQEQlftfplllrlfflglIGVTISQNLAFVGLSYSSPIAACGTANIVPALSFILAII  585
               A      F ++ R+F LGLIG + +Q  A+ G+ YSSP  A   +N+ PA++FILA++
Sbjct  66    --AVLPRLKFHVVSRIFLLGLIGFS-AQICAYKGIEYSSPTMASAVSNLTPAITFILAVL  122

Query  586   LRRTKIDWESGGSQARMIGALICTVGTISLIFYRGPVVNNYSPTFLHLSTTQFVFSSSTN  765
              R  ++   S  SQA+++G +    G + ++ Y+GP V  +S      S+    +   + 
Sbjct  123   SRLERVALRSSSSQAKVLGTIASISGALVVVLYKGPKV--FSSPRGTSSSVLLEWPLESP  180

Query  766   QQNWVLGCLCFIAASLTLSIWNIIQVGTIRIYPQVMKIMCVYSLFGTVQSGALSLFIVRD  945
             + NWV+G +    A L  S W IIQ   + IYP  + +  +Y+L GT+ S  + L    +
Sbjct  181   ESNWVIGGILLAVAYLLFSFWYIIQAQVMVIYPAEIIVAFLYNLCGTIVSAPVCLIAEPN  240

Query  946   LNAWRLGLNFQLIVILLTAIFGSIIRSSVQLWCMRMKGPSFPLIFKPVGIVVASSCGCLF  1125
             L++WRL  +  +I +L + IF ++  S V +W + +KGP + +IFKP+ I +A+    +F
Sbjct  241   LSSWRLRPSVAVIAVLYSGIFQTV-SSLVVIWGLHLKGPVYIVIFKPLSIAIAAFMSAVF  299

Query  1126  FADTFHYGSMFSAFICGMGYYTTIWGQLKDEE-IQQIKGSSVSLPDE--KVPLLQQSQDD  1296
               D+ H GS+  A I  MG+Y  IWG+ K+E+ I    G +   P    KVPLLQ  + +
Sbjct  300   LGDSLHVGSIVGAVIISMGFYAVIWGKAKEEQRIHDDSGINSLEPSSSGKVPLLQSHKLE  359

Query  1297  S  1299
              
Sbjct  360   D  360



>ref|XP_006483805.1| PREDICTED: WAT1-related protein At3g28050-like isoform X1 [Citrus 
sinensis]
Length=352

 Score =   182 bits (461),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 117/350 (33%), Positives = 180/350 (51%), Gaps = 22/350 (6%)
 Frame = +1

Query  253   MVMVEACTIFLTIMASTAMAKFGTNPFVFVVYTNALASIF-LVPYSIIYHRRDKAQEQlf  429
             MV VE   +  + +   AM K GT+ FV +VY+NA A+IF L+P + IY+R         
Sbjct  10    MVAVECLEVGSSTLNKAAMNK-GTSDFVLIVYSNAFAAIFILLPSTFIYYRNRTRPPLTV  68

Query  430   tfplllrlfflglIGVTISQNLAFVGLSYSSPIAACGTANIVPALSFILAIILRRTKIDW  609
             +    +    L    V   Q   +VG+ YSSP  +    ++ PA +FILA+I R  K+D 
Sbjct  69    SIICKIFGLGLISCCV---QTCLYVGIGYSSPTLSSAIVDLTPAFTFILALISRMEKLDL  125

Query  610   ESGGSQARMIGALICTVGTISLIFYRGPVVNNYSPTFLHLSTTQFVFSSSTNQQNWVLGC  789
                 S A+ IG ++   G +++  Y+GP + + S      S++       + Q+NW++G 
Sbjct  126   RVQSSLAKSIGTMVSIAGALTVTLYKGPALVSMS------SSSNLHNELRSPQKNWIIGG  179

Query  790   LCFIAASLTLSIWNIIQVGTIRIYPQVMKIMCVYSLFGTVQSGALSLFIVRDLNAWRLGL  969
             L   A+S  LS+  I+Q   IR YP+ +    +  +F T+QS  ++L   R+ N+WRL  
Sbjct  180   LVLAASSFFLSLLYIVQTSIIREYPEELMATFICCVFVTIQSTVVALIAERNPNSWRLKP  239

Query  970   NFQLIVILLTAIFGSIIRSSVQLWCMRMKGPSFPLIFKPVGIVVASSCGCLFFADTFHYG  1149
             + +LI I  +A F   +RS    W    KGP +  ++KP+GIV A   G     DT + G
Sbjct  240   DMELIAIGCSAFFAVALRSLAHTWACHKKGPVYVSMYKPLGIVFAIIMGVTLLGDTLYLG  299

Query  1150  SMFSAFICGMGYYTTIWGQ------LKDEEIQQIKGSSVSLPDEKVPLLQ  1281
             S+  A I   G+Y+ IWGQ      + D++I  +K SS      K PLLQ
Sbjct  300   SVVGATIVAFGFYSVIWGQSEEEKMIDDKDIDSLKSSS-----PKAPLLQ  344



>ref|XP_007224366.1| hypothetical protein PRUPE_ppa020906mg [Prunus persica]
 gb|EMJ25565.1| hypothetical protein PRUPE_ppa020906mg [Prunus persica]
Length=360

 Score =   182 bits (462),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 119/348 (34%), Positives = 184/348 (53%), Gaps = 11/348 (3%)
 Frame = +1

Query  253   MVMVEACTIFLTIMASTAMAKFGTNPFVFVVYTNALASIFLVPYSIIYHRRDKAQEQlft  432
             MVMVE   + L I++  AM K G + FVFVVY NALA   L+P S  ++RR       ++
Sbjct  1     MVMVEFLDVGLNILSKAAMKK-GMSNFVFVVYANALALFVLLPSSFFFYRRRTYPPLSWS  59

Query  433   fplllrlfflglIGVTISQNLAFVGLSYSSPIAACGTANIVPALSFILAIILRRTKIDWE  612
                 L L      G   +Q L F+G++YSSP  A    +++PA +FILA+I     +D  
Sbjct  60    LICKLFLVSFMSSG---AQLLKFIGINYSSPTMASAMIDLMPAFTFILAVITGMEILDLR  116

Query  613   SGGSQARMIGALICTVGTISLIFYRGPVVNNYSPTFLHLSTTQFVFSSSTNQQNWVLGCL  792
                 QA+ IG ++   G + L  Y+G  +     +   L + Q + SS TN   W +G +
Sbjct  117   ITSRQAKCIGTVVSISGALMLTLYKGLPLIRADASHSKLISLQLLLSSQTN---WFIGGI  173

Query  793   CFIAASLTLSIWNIIQVGTIRIYPQVMKIMCVYSLFGTVQSGALSLFIVRDLNAWRLGLN  972
                  S  L++ +I +   IR YP V+ +  +  +F T+QS A+SL  V+ LNAW+L  +
Sbjct  174   VLAFQSFLLAMMHIAETWVIRDYPAVLMVTTIRCIFVTIQSAAISLIAVKGLNAWKLKPD  233

Query  973   FQLIVILLTAIFGSIIRSSVQLWCMRMKGPSFPLIFKPVGIVVASSCGCLFFADTFHYGS  1152
              +LI I   A F  ++R+ + LW M +KGP +  +FKP+G+V+A   G  F  DT + G 
Sbjct  234   IELIAIGYNATFEVMLRTGIHLWAMNIKGPVYVAMFKPLGLVMALFVGVAFLGDTLYLGR  293

Query  1153  MFSAFICGMGYYTTIWGQLKDEEIQQIKGSSVSLP----DEKVPLLQQ  1284
             +  A I  +G+Y  IWG+ ++E+ +     + S       E  PLL +
Sbjct  294   LLGAAITVVGFYAVIWGKAQEEKEKAQNDQTRSFESFPQSEAEPLLPK  341



>ref|XP_007137544.1| hypothetical protein PHAVU_009G135600g [Phaseolus vulgaris]
 gb|ESW09538.1| hypothetical protein PHAVU_009G135600g [Phaseolus vulgaris]
Length=350

 Score =   182 bits (461),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 108/346 (31%), Positives = 180/346 (52%), Gaps = 10/346 (3%)
 Frame = +1

Query  253   MVMVEACTIFLTIMASTAMAKFGTNPFVFVVYTNALASIFLVPYSIIYHRRDKAQEQlft  432
             ++ +E   + +  ++  AM K G N FVFV+Y+NA AS  L+P ++ +HR+       + 
Sbjct  10    LLAIEFLDVIVYTVSKAAMTK-GMNDFVFVMYSNAFASFLLLPLTVFFHRKRDLPPLTYC  68

Query  433   fplllrlfflglIGVTISQNLAFVGLSYSSPIAACGTANIVPALSFILAIILRRTKIDWE  612
                 +    L    V   Q L F G+ +SSP  A   ++++PA +FILAI+ R  K+DW+
Sbjct  69    IVAQIFFNGLLSCSV---QMLRFFGIGFSSPTLATAMSDLIPAFTFILAILFRMEKLDWK  125

Query  613   SGGSQARMIGALICTVGTISLIFYRG-PVVNNYSPTFLHLSTTQFVFSSSTNQQNWVLGC  789
             +  ++A+ IG  +  +G + +  Y+G  ++ N+    L+          S+ Q +WV+G 
Sbjct  126   TNSTRAKSIGTFLSIIGALIITLYKGQAIIQNHPSNKLYPKNL-----VSSEQFDWVVGA  180

Query  790   LCFIAASLTLSIWNIIQVGTIRIYPQVMKIMCVYSLFGTVQSGALSLFIVRDLNAWRLGL  969
             +     S+ LS+  I+Q   IR YP  + ++    +   + S   SL  V D  A RLG 
Sbjct  181   VLLAGHSIVLSLLFIVQTWIIRNYPAELVVVLTRGVLVALLSVPASLISVEDPKALRLGF  240

Query  970   NFQLIVILLTAIFGSIIRSSVQLWCMRMKGPSFPLIFKPVGIVVASSCGCLFFADTFHYG  1149
             + QLI I   AIF    RS V +W M  KGP +  ++KP+GIV A+  G  F  D+ + G
Sbjct  241   DVQLIAIGCQAIFSVSFRSVVHIWVMGKKGPLYVAMYKPIGIVFAAIMGISFLGDSLYLG  300

Query  1150  SMFSAFICGMGYYTTIWGQLKDEEIQQIKGSSVSLPDEKVPLLQQS  1287
             S+  A I  +G+Y  +WG+ ++   ++ +  ++      VPLLQ  
Sbjct  301   SVLGAAIVVIGFYAVLWGKSQERTKEESEVQTLESYSPVVPLLQNK  346



>ref|XP_007157481.1| hypothetical protein PHAVU_002G073200g [Phaseolus vulgaris]
 gb|ESW29475.1| hypothetical protein PHAVU_002G073200g [Phaseolus vulgaris]
Length=357

 Score =   182 bits (461),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 116/330 (35%), Positives = 176/330 (53%), Gaps = 20/330 (6%)
 Frame = +1

Query  325   NPFVFVVYTNALASIFLVPYSIIYHRRDKAQEQlftfplllrlfflglIGVTISQNLAFV  504
             N +V VVYT  L +I L+PY++  HRR  +Q     F +L R F L   G ++   +A+V
Sbjct  39    NKYVMVVYTFVLCTILLLPYALFLHRR--SQGPPLNFIVLCRFFLLASFG-SLGTVVAYV  95

Query  505   GLSYSSPIAACGTANIVPALSFILAIILRRTKIDWESGGSQARMIGALICTVGTISLIFY  684
             G+  SSP       N++PA +F+LA+  R  ++ W S  SQA+++G ++   G   +I Y
Sbjct  96    GIDLSSPSLLSAILNLLPAFTFVLALAFRMEEVHWRSSSSQAKVLGTIVSIAGAFVVILY  155

Query  685   RGP-VVNNYSPTFLHLSTTQFVFSSSTNQQNWVLGCLCFIAASLTLSIWNIIQVGTIRIY  861
             +GP +   +SP F   S     FS    Q NW++G +  +A +L  S+W I Q      Y
Sbjct  156   KGPSIFKTHSPNF---SNQMLQFSP---QLNWIMGGIACVADALFTSMWYIYQASVGETY  209

Query  862   PQVMKIMCVY--SLFGTVQSGALSLFIVRDLNAWRLGLNFQLIVILLTAIFGSIIRSSVQ  1035
             P +   + V+   LF TVQ G  +LF VRDL  W+L ++  LI IL  AI  +++R  + 
Sbjct  210   PDIDVTVIVFFQLLFSTVQCGVFALFSVRDLAEWKLKMDIGLIGILYQAIIATLLRYILC  269

Query  1036  LWCMRMKGPSFPLIFKPVGIVVASSCGCLFFADTFHYGSMFSAFICGMGYYTTIWGQLKD  1215
             +WC+   GP F  +F+PV I+     G +F  D F  GS+  A +  +G+Y   WG+ K+
Sbjct  270   MWCIIKAGPLFCAMFQPVAIIFTVWMGAIFLGDDFTLGSLIGALVIVIGFYAVQWGKSKE  329

Query  1216  EE-----IQQIKGSSVSLPDEKVPLLQQSQ  1290
             E      +Q +   S+S     VPLLQ S 
Sbjct  330   EYEIAKGVQHLDSESLS---HGVPLLQDSN  356



>emb|CDY00140.1| BnaC09g01610D [Brassica napus]
Length=369

 Score =   182 bits (462),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 116/372 (31%), Positives = 195/372 (52%), Gaps = 25/372 (7%)
 Frame = +1

Query  232   EVVPCMAMVMVEACTIFLTIMASTAMAKFGTNPFVFVVYTNALASIFLVPYSIIYHRRDK  411
             EV+P MA+V++E   + L  +   A  + G +  VF+VY+  LA++ L+P SI +  R +
Sbjct  9     EVLPVMALVIMECANVGLNTLFKAATLQ-GMSFHVFIVYSYGLAALLLLP-SIFFSSRSR  66

Query  412   AQEQlftfplllrlfflglIGVTISQNLAFVGLSYSSPIAACGTANIVPALSFILAIILR  591
                 +    L   L     IG   S  + + G++YSSP  A   +N+ PA +F+LAI+ R
Sbjct  67    TLPPMNFSILYKILVLGL-IGCC-SNIMGYTGINYSSPTLASAISNLTPAFTFLLAILFR  124

Query  592   RTK-IDWESGGSQARMIGALICTVGTISLIFYRGPVVNNYSPTFLHLSTTQFVFSSSTNQ  768
               + + ++   S A+M+G ++   G   +  Y GPVV + SP  + L       S STN 
Sbjct  125   LMESVSFKRTSSVAKMLGTVVSIGGAFIVTLYNGPVVISMSPPSVSLR------SQSTNH  178

Query  769   QNWVLGCLCFIAASLTLSIWNIIQVGTIRIYPQVMKIMCVYSLFGTVQSGALSLFIV-RD  945
              NW++G          + +W I+Q   +R YP    ++C YSL  +  +G ++LF    D
Sbjct  179   -NWIIGAAFLSVEYFMVPLWYIVQTQIMREYPSEFTVVCYYSLGVSFWTGLVTLFTEGSD  237

Query  946   LNAWRLGLNFQLIVILLTAIFGSIIRSSVQLWCMRMKGPSFPLIFKPVGIVVASSCGCLF  1125
             LNAW++  N  L+ I+ + +FGS I +++  W +R+KGP F  +FKP+ I +A + G +F
Sbjct  238   LNAWKIKPNIALVSIVCSGVFGSCINNTIHTWALRIKGPLFVAMFKPLSIAIAVAMGVIF  297

Query  1126  FADTFHYGSMFSAFICGMGYYTTIWGQLKD----EEIQQIKGSSVS--------LPDEKV  1269
               D+ + GS+  A +   G+YT +WG+ K+    E+  +      +        L  +K 
Sbjct  298   LHDSLYIGSLIGATVITTGFYTVMWGKAKEAAMVEDDNKANNEDATNEADLDSPLASQKA  357

Query  1270  PLLQQSQDDSPV  1305
             PLL+  ++D  V
Sbjct  358   PLLESYKNDEHV  369



>ref|XP_007031403.1| Nodulin MtN21 /EamA-like transporter family protein, putative 
isoform 2 [Theobroma cacao]
 gb|EOY02329.1| Nodulin MtN21 /EamA-like transporter family protein, putative 
isoform 2 [Theobroma cacao]
Length=362

 Score =   182 bits (461),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 119/361 (33%), Positives = 200/361 (55%), Gaps = 9/361 (2%)
 Frame = +1

Query  226   FGEVVPCMAMVMVEACTIFLTIMASTAMAKFGTNPFVFVVYTNALASIFLVPYSIIYHRR  405
             + +V+P  AMV +E+  + L I+   A  K G + ++F+ Y+ A+ +I  +P S I+   
Sbjct  7     YNDVLPFTAMVALESANVGLNILFKAATLK-GMSYYIFIAYSYAVGTILFLPLSFIF-PS  64

Query  406   DKAQEQlftfplllrlfflglIGVTISQNLAFVGLSYSSPIAACGTANIVPALSFILAII  585
              +A      F ++ R+F LGLIG + +Q  A+ G+ YSSP  A   +N+ PA++FILA++
Sbjct  65    SRAVLPRLKFHVVSRIFLLGLIGFS-AQICAYKGIEYSSPTMASAVSNLTPAITFILAVL  123

Query  586   LRRTKIDWESGGSQARMIGALICTVGTISLIFYRGPVVNNYSPTFLHLSTTQFVFSSSTN  765
              R  ++   S  SQA+++G +    G + ++ Y+GP V  +S      S+    +   + 
Sbjct  124   SRLERVALRSSSSQAKVLGTIASISGALVVVLYKGPKV--FSSPRGTSSSVLLEWPLESP  181

Query  766   QQNWVLGCLCFIAASLTLSIWNIIQVGTIRIYPQVMKIMCVYSLFGTVQSGALSLFIVRD  945
             + NWV+G +    A L  S W IIQ   + IYP  + +  +Y+L GT+ S  + L    +
Sbjct  182   ESNWVIGGILLAVAYLLFSFWYIIQAQVMVIYPAEIIVAFLYNLCGTIVSAPVCLIAEPN  241

Query  946   LNAWRLGLNFQLIVILLTAIFGSIIRSSVQLWCMRMKGPSFPLIFKPVGIVVASSCGCLF  1125
             L++WRL  +  +I +L + IF ++  S V +W + +KGP + +IFKP+ I +A+    +F
Sbjct  242   LSSWRLRPSVAVIAVLYSGIFQTV-SSLVVIWGLHLKGPVYIVIFKPLSIAIAAFMSAVF  300

Query  1126  FADTFHYGSMFSAFICGMGYYTTIWGQLKDEE-IQQIKGSSVSLPDE--KVPLLQQSQDD  1296
               D+ H GS+  A I  MG+Y  IWG+ K+E+ I    G +   P    KVPLLQ  + +
Sbjct  301   LGDSLHVGSIVGAVIISMGFYAVIWGKAKEEQRIHDDSGINSLEPSSSGKVPLLQSHKLE  360

Query  1297  S  1299
              
Sbjct  361   D  361



>ref|XP_008221764.1| PREDICTED: WAT1-related protein At5g40240-like [Prunus mume]
Length=372

 Score =   182 bits (461),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 118/356 (33%), Positives = 192/356 (54%), Gaps = 11/356 (3%)
 Frame = +1

Query  229   GEVVPCMAMVMVEACTIFLTIMASTAMAKFGTNPFVFVVYTNALASIFLVPYSIIYHRRD  408
             G  V  +A+VM     +   I+   AM+  G + +  VVY+NAL+++ L P S I+HR +
Sbjct  26    GISVAFVALVMAVLAQVTSMILNKEAMSS-GLSEYTLVVYSNALSTLILTPSSFIFHRLE  84

Query  409   KAQEQlftfplllrlfflglIGVTISQNLAFVGLSYSSPIAACGTANIVPALSFILAIIL  588
             +      +F ++   F LG IG T +Q +   GL+Y+S        N++PA +FILA+I 
Sbjct  85    RPP---LSFYIIFSFFLLGFIG-TSAQLMGLAGLNYASASLNTAMLNLIPAFTFILALIF  140

Query  589   RRTKIDWESGGSQARMIGALICTVGTISLIFYRGPVVNNYSPTFLHLSTTQFVFSSSTNQ  768
             R  K++W S  SQA+ +GA++   G   + FY+GP V +   +   LS   F+FS    +
Sbjct  141   RMEKLNWRSSSSQAKSVGAVVSITGAFVVTFYKGPAVIHQRLSSDPLSG-PFLFSP---K  196

Query  769   QNWVLGCLCFIAASLTLSIWNIIQVGTIRIYPQVMKIMCVYSLFGTVQSGALSLFIVRDL  948
              NWVLG     A +   S+W I+Q   ++ YP V+ ++  Y  F T+QS   SL +V+DL
Sbjct  197   SNWVLGGSLLAAEAFMSSLWIILQALILKKYPAVLILVSFYCFFVTIQSALASLILVKDL  256

Query  949   NAWRLGLNFQLIVILLTAIFGSIIRSSVQLWCMRMKGPSFPLIFKPVGIVVASSCGCLFF  1128
             +AW L  +  L  +L +A+ G+ +R+    WC++  G  +  +FKP+ +VVA     +F 
Sbjct  257   SAWSLKPDIGLFAVLYSAVVGTALRTCAVAWCLQRTGAVYVSMFKPLAVVVADVIDVIFL  316

Query  1129  ADTFHYGSMFSAFICGMGYYTTIWGQLKDEEIQQIKGSS--VSLPDEKVPLLQQSQ  1290
                 H GS+  A +   G+Y  IWG+ ++E++ +  G         E  PLLQ ++
Sbjct  317   GQALHLGSLVGAAVIITGFYAVIWGKAREEKLHEDSGEGQWSESSSESTPLLQSAK  372



>ref|XP_009344537.1| PREDICTED: WAT1-related protein At5g40210-like [Pyrus x bretschneideri]
 ref|XP_009344562.1| PREDICTED: WAT1-related protein At5g40210-like [Pyrus x bretschneideri]
Length=359

 Score =   181 bits (460),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 128/358 (36%), Positives = 200/358 (56%), Gaps = 14/358 (4%)
 Frame = +1

Query  238   VPCMAMVMVEACTIFLTIMASTAMAKFGTNPFVFVVYTNALASIFLVPYSIIYHRRDKAQ  417
             VP  AM +VE   + ++ ++  AMA+ G + FVF+VY NAL ++ L+P+ I  +RR+K  
Sbjct  11    VPFTAMAIVECAEVGVSTISKVAMAE-GMSHFVFIVYYNALGTLLLLPFFI--YRRNK--  65

Query  418   EQlftfplllrlfflglIGVTISQNLAFVGLSYSSPIAACGTANIVPALSFILAIILRRT  597
                 TF L+ + F LGLIG +  + L F G+  SS I A   AN+ P  +F+LAII R  
Sbjct  66    RPPLTFRLICQFFLLGLIGSS-GKILFFAGVKNSSAILAAAMANLTPIFTFLLAIIFRME  124

Query  598   KIDWESGGSQARMIGALICTVGTISLIFYRGPVVNNYSPTFL--HLSTTQFVFSSSTNQQ  771
             K+D       A+ +GA+I   G   +  Y GP + N S +    H +   FV  SST   
Sbjct  125   KLDLRKATGYAKSLGAIIAVGGASIVTLYDGPALLNSSLSSGLNHSAHRSFVSQSST---  181

Query  772   NWVLGCLCFIAASLTLSIWNIIQVGTIRIYPQVMKIMCVYSLFGTVQSGALSLFIVRD-L  948
              W+ G +      L  S WNI Q  T++ YP+ M I+  Y++F T+Q   +SL + R+ L
Sbjct  182   -WIFGGMLLAIQCLVASTWNIAQAATVKDYPEEMTIVFFYTMFLTIQCTVISLIVERNNL  240

Query  949   NAWRLGLNFQLIVILLTAIFGSIIRSSVQLWCMRMKGPSFPLIFKPVGIVVASSCGCLFF  1128
             +AW++ L  ++I IL  AI  S+ R SV +WC+  KGP +  +FKP+GI +A+    +F 
Sbjct  241   SAWKMELPIEIIGILYAAICVSVFRISVHVWCLHKKGPVYVAMFKPLGIAIAAVVVVVFL  300

Query  1129  ADTFHYGSMFSAFICGMGYYTTIWGQLKDEEIQQIKGSSVSLPD-EKVPLLQQSQDDS  1299
              +TF+ GS+  + +  +G+YT  + QLK++ ++       S P  +  PLL+ S  + 
Sbjct  301   GNTFYLGSLIGSIVISLGFYTVTYAQLKEKVMEVDNAVQRSEPSTQTTPLLRSSISNE  358



>gb|KDO82537.1| hypothetical protein CISIN_1g018663mg [Citrus sinensis]
Length=352

 Score =   181 bits (458),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 117/350 (33%), Positives = 179/350 (51%), Gaps = 22/350 (6%)
 Frame = +1

Query  253   MVMVEACTIFLTIMASTAMAKFGTNPFVFVVYTNALASIF-LVPYSIIYHRRDKAQEQlf  429
             MV VE   +  + +   AM K GT+ FV +VY+NA A+IF L+P + IY+R         
Sbjct  10    MVAVECLEVGSSTLNKAAMNK-GTSDFVLIVYSNAFAAIFILLPSTFIYYRNRTRPPLTV  68

Query  430   tfplllrlfflglIGVTISQNLAFVGLSYSSPIAACGTANIVPALSFILAIILRRTKIDW  609
             +    +    L    V   Q   +VG+ YSSP  +    ++ PA +FILA+I R  K+D 
Sbjct  69    SIICKIFGLGLISCCV---QTCLYVGIGYSSPTLSSAIVDLTPAFTFILALISRMEKLDL  125

Query  610   ESGGSQARMIGALICTVGTISLIFYRGPVVNNYSPTFLHLSTTQFVFSSSTNQQNWVLGC  789
                 S A+ IG ++   G +++  Y+GP + + S      S++       + Q+NW++G 
Sbjct  126   RVQSSLAKSIGTMVSIAGALTVTLYKGPALVSMS------SSSNLHNELRSPQKNWIIGG  179

Query  790   LCFIAASLTLSIWNIIQVGTIRIYPQVMKIMCVYSLFGTVQSGALSLFIVRDLNAWRLGL  969
             L   A S  LS+  I+Q   IR YP+ +    +  +F T+QS  ++L   R+ N+WRL  
Sbjct  180   LVLAAGSFFLSLLYIVQTSIIREYPEELMATFICCVFVTIQSTVVALIAERNPNSWRLKP  239

Query  970   NFQLIVILLTAIFGSIIRSSVQLWCMRMKGPSFPLIFKPVGIVVASSCGCLFFADTFHYG  1149
             + +LI I  +A F   +RS    W    KGP +  ++KP+GIV A   G     DT + G
Sbjct  240   DTELIAIGCSAFFAVALRSLAHTWACHKKGPVYVSMYKPLGIVFAIIMGVTLLGDTLYLG  299

Query  1150  SMFSAFICGMGYYTTIWGQ------LKDEEIQQIKGSSVSLPDEKVPLLQ  1281
             S+  A I   G+Y+ IWGQ      + D++I  +K SS      K PLLQ
Sbjct  300   SVVGATIVAFGFYSVIWGQSEEEKMIDDKDIDSLKSSS-----PKAPLLQ  344



>ref|XP_010441137.1| PREDICTED: WAT1-related protein At5g40240-like [Camelina sativa]
 ref|XP_010441138.1| PREDICTED: WAT1-related protein At5g40240-like [Camelina sativa]
 ref|XP_010441139.1| PREDICTED: WAT1-related protein At5g40240-like [Camelina sativa]
Length=368

 Score =   181 bits (459),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 109/358 (30%), Positives = 189/358 (53%), Gaps = 17/358 (5%)
 Frame = +1

Query  232   EVVPCMAMVMVEACTIFLTIMASTAMAKFGTNPFVFVVYTNALASIFLVPYSIIYHRRDK  411
             +VVP  AM  VE  T+    +   A  + G N +VFV Y+  +++  L+P S ++ R   
Sbjct  17    DVVPFAAMFAVECTTVGSNTLYKAATLR-GLNFYVFVFYSYVVSTTLLLPLSFVFGRSRS  75

Query  412   AQEQlftfplllrlfflglIGVTISQNLAFVGLSYSSPIAACGTANIVPALSFILAIILR  591
                        + L  L  IG  +SQ +   G+ YSSP  A   +N+ PA +F LA+I R
Sbjct  76    LPSAKSPLFFKIFLLGL--IGF-MSQIVGCKGIVYSSPTLASAISNLTPAFTFTLAVIFR  132

Query  592   RTKIDWESGGSQARMIGALICTVGTISLIFYRGP---VVNNYSPTFLHLSTTQFVFSSST  762
               ++   S  +QA++IGA++   G + ++ Y+GP    V + +P+ L +S+ Q +   ++
Sbjct  133   MERVMLSSSATQAKIIGAILSISGALVIVLYKGPKVLAVASSTPSSLTISSHQHL---TS  189

Query  763   NQQNWVLGCLCFIAASLTLSIWNIIQVGTIRIYPQVMKIMCVYSLFGTVQSGALSLFIVR  942
                +W+LG L   +    +S+W IIQ   + +YP+ + ++  Y+LF T+ S  + LF   
Sbjct  190   VDSSWILGGLLLASQYFLISVWYIIQTRVMEVYPEEITVVFFYNLFATLISAPVCLFAES  249

Query  943   DLNAWRLGLNFQLIVILLTAIFGSIIRSSVQLWCMRMKGPSFPLIFKPVGIVVASSCGCL  1122
             +L +W L  +  L  I+ + +F S+  +    W + +KGP +  +F+P+ I +A + G +
Sbjct  250   NLTSWVLKPDITLTAIIYSGVFVSLFSALTHTWGLHLKGPVYISLFRPLSIAIAVAMGAI  309

Query  1123  FFADTFHYGSMFSAFICGMGYYTTIWGQLKDEEIQQIKGSSVS-------LPDEKVPL  1275
             F  D+ H GS+  + I   G+YT IWG+ +++ I+ I GS  S       + DE  PL
Sbjct  310   FLGDSLHLGSIIGSIILCFGFYTVIWGKAREDTIKTIAGSEQSPLLITHIIEDEAFPL  367



>ref|XP_011020453.1| PREDICTED: WAT1-related protein At3g28050-like [Populus euphratica]
Length=355

 Score =   181 bits (458),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 110/355 (31%), Positives = 185/355 (52%), Gaps = 11/355 (3%)
 Frame = +1

Query  235   VVPCMAMVMVEACTIFLTIMASTAMAKFGTNPFVFVVYTNALASIFLVPYSIIYHRRDKA  414
             V+P + M+M E       I    AM+  G + FVFV+Y+N +ASI L+P S+I+HR    
Sbjct  7     VLPIVGMIMAECAQAGRMIAGKAAMSN-GMSSFVFVLYSNTIASIILLPSSLIFHR---P  62

Query  415   QEQlftfplllrlfflglIGVTISQNLAFVGLSYSSPIAACGTANIVPALSFILAIILRR  594
             QE+      ++  FFL  +   + Q+  + G++ SSP       N VP L+F+LA+I R 
Sbjct  63    QERPPLNLSIVFGFFLLGLFGCLGQSFGYAGINLSSPALGTAMLNTVPGLTFVLAVIFRM  122

Query  595   TKIDWESGGSQARMIGALICTVGTISLIFYRGPVVNNYSPTFLHLSTTQFVFSSSTNQQN  774
              K+D  S  + A+ +G +I   G   + +Y+GP++    P+  + S+ Q +    +   N
Sbjct  123   EKVDCRSYSTLAKSMGTIISMGGAFVVTYYKGPLLLKALPSASN-SSHQVL----SQHSN  177

Query  775   WVLGCLCFIAASLTLSIWNIIQVGTIRIYPQVMKIMCVYSLFGTVQSGALSLFIVRDLNA  954
             WVLG           S W I+Q   ++ YP  +  +  Y  F TV +  + L +V+D +A
Sbjct  178   WVLGGSLLAVDCTMASSWLIVQALILKKYPAKLIAVFFYFFFSTVLTSIVCLVMVKDPSA  237

Query  955   WRLGLNFQLIVILLTAIFGSIIRSSVQLWCMRMKGPSFPLIFKPVGIVVASSCGCLFFAD  1134
             W L  N +L+ +L + I G   +  V  WC++  GP F  +F P+GIV+ ++   +FF D
Sbjct  238   WSLKSNTRLVSVLFSGILGHAFQVGVTTWCLQKTGPVFVSVFAPLGIVITATASVVFFGD  297

Query  1135  TFHYGSMFSAFICGMGYYTTIWGQLKD--EEIQQIKGSSVSLPDEKVPLLQQSQD  1293
               + G +  A I   G+Y  IWG+ ++  ++++  +    +   +KVPLLQ   +
Sbjct  298   ALNLGIVIGAVIIASGFYAVIWGKAQEATKKVEDEESFGPASSSQKVPLLQNRSN  352



>ref|XP_008221769.1| PREDICTED: WAT1-related protein At4g15540-like [Prunus mume]
Length=370

 Score =   181 bits (459),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 117/349 (34%), Positives = 186/349 (53%), Gaps = 13/349 (4%)
 Frame = +1

Query  253   MVMVEACTIFLTIMASTAMAKFGTNPFVFVVYTNALASIFLVPYSIIYHRRDKAQEQlft  432
             MVMVE   + L I++  AM K G + FVFVVY NALA   L+P S  ++RR   +     
Sbjct  11    MVMVEFLDVGLNILSKAAMKK-GMSDFVFVVYANALALFVLLPSSFFFYRR---RTYPPL  66

Query  433   fplllrlfflglIGVTISQNLAFVGLSYSSPIAACGTANIVPALSFILAIILRRTKIDWE  612
                 +   FL     + +Q L F+G++YSSP  A    +++PA +FILA+I     +D  
Sbjct  67    SWSFICKLFLVSFMSSSAQLLRFIGINYSSPTMASAMIDLMPAFTFILAVITGMEILDLR  126

Query  613   SGGSQARMIGALICTVGTISLIFYRG-PVVNNYSPTFLHLSTTQFVFSSSTNQQNWVLGC  789
                 QA+ IG ++   G + L  Y+G P++   +      +    +    ++Q NW +G 
Sbjct  127   ITSRQAKCIGTVVSISGALMLTLYKGLPLIRADASH----NKLISLQLLLSSQTNWFIGG  182

Query  790   LCFIAASLTLSIWNIIQVGTIRIYPQVMKIMCVYSLFGTVQSGALSLFIVRDLNAWRLGL  969
             +     S  L++ +I +   IR YP V+ +  +  +F T+QS A+SL  V+ LNAW+L  
Sbjct  183   IVLAFQSFLLAMMHITETWVIRDYPAVLMVTTIRCIFVTIQSAAISLITVKGLNAWKLKP  242

Query  970   NFQLIVILLTAIFGSIIRSSVQLWCMRMKGPSFPLIFKPVGIVVASSCGCLFFADTFHYG  1149
             + +LI I   A F  ++R+ + LW + +KGP +  +FKP+G+V+A   G  F  DT + G
Sbjct  243   DIELIAIGYNATFEVMLRAGIHLWALNIKGPVYVAMFKPLGLVMALFVGVAFLGDTLYLG  302

Query  1150  SMFSAFICGMGYYTTIWGQLKDEEIQ---QIKGSSVSLPD-EKVPLLQQ  1284
              +  A I  +G+Y  IWG+ ++E+ +      GS  S P  E  PLL +
Sbjct  303   RLLGAAITVVGFYAVIWGKAQEEKEKAQNDQTGSFESFPQSEAEPLLPK  351



>gb|KHG19083.1| Auxin-induced protein 5NG4 [Gossypium arboreum]
Length=351

 Score =   180 bits (457),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 122/354 (34%), Positives = 192/354 (54%), Gaps = 12/354 (3%)
 Frame = +1

Query  238   VPCMAMVMVEACTIFLTIMASTAMAKFGTNPFVFVVYTNALASIFLVPYSIIYHRRDKAQ  417
             +P + MVM E   + L IM   AM+  G   FVFV Y+NALAS+ L+P S ++HR   + 
Sbjct  8     LPIVGMVMAEVAQVGLMIMGKAAMSH-GMPNFVFVFYSNALASLILLPASFLFHR---SH  63

Query  418   EQlftfplllrlfflglIGVTISQNLAFVGLSYSSPIAACGTANIVPALSFILAIILRRT  597
                 TF +L   F LGL+G   +Q   + G+ YSSP  A    N++P L+FILA+  R  
Sbjct  64    LPPLTFSILCWFFLLGLLG-CFAQISGYAGIYYSSPTLATAMLNLIPGLTFILAVAFRME  122

Query  598   KIDWESGGSQARMIGALICTVGTISLIFYRGPVVNNYSPTFLHLSTTQFVFSSSTNQQNW  777
              ++  S  SQA+ +G ++   G   + FY+GP +   +P+  H S+   +      Q NW
Sbjct  123   TLNLRSSTSQAKSLGTIVSIAGAFIVTFYKGPSLL-MAPS--HSSSPHLLLG---QQSNW  176

Query  778   VLGCLCFIAASLTLSIWNIIQVGTIRIYPQVMKIMCVYSLFGTVQSGALSLFIVRDLNAW  957
             V+G     A  +  S W I+Q   ++ +P  + ++  Y  F T+QSG + L +  DL+AW
Sbjct  177   VIGGFLLAADCVFASAWLIVQASVLKKFPAELFVVFYYCFFVTLQSGIICLIMGGDLSAW  236

Query  958   RLGLNFQLIVILLTAIFGSIIRSSVQLWCMRMKGPSFPLIFKPVGIVVASSCGCLFFADT  1137
                 + +L+ ++ +A+FGS  +  V  WCM   GP F  +FKP+GIVV+   G +F  DT
Sbjct  237   SFKPDVRLVAVIYSAVFGSAFQLGVSTWCMHRTGPVFVSMFKPLGIVVSVVIGVIFLGDT  296

Query  1138  FHYGSMFSAFICGMGYYTTIWGQLKDEEIQ-QIKGSSVSLPDEKVPLLQQSQDD  1296
             F  GS+  A +   G+Y+ +WG+ K+ ++  Q +G       +KV LL  +  +
Sbjct  297   FFLGSLVGAIVIVTGFYSVMWGKAKEGKLDVQTQGMMSESSSQKVALLSNNTGE  350



>ref|XP_008379799.1| PREDICTED: WAT1-related protein At5g40240-like [Malus domestica]
Length=651

 Score =   186 bits (472),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 122/358 (34%), Positives = 191/358 (53%), Gaps = 14/358 (4%)
 Frame = +1

Query  238   VPCMAMVMVEACTIFLTIMASTAMAKFGTNPFVFVVYTNALASIFLVPYSIIYHRRDKAQ  417
             VP  AMV+VE   + ++ ++  AMA+ G + FVF+VY NAL ++ L+P+  I+ R  +A 
Sbjct  11    VPFTAMVIVECAEVGVSTISKVAMAE-GMSHFVFIVYYNALGTLLLLPF-FIFRRNRRAP  68

Query  418   EQlftfplllrlfflglIGVTISQNLAFVGLSYSSPIAACGTANIVPALSFILAIILRRT  597
                        L  +G  G    + L F G+  SS I A   AN+ P  +F+LAII R  
Sbjct  69    LTFRLJCQFFLLGLIGSSG----KILFFAGVKNSSAILAAAMANLTPIFTFLLAIIFRME  124

Query  598   KIDWESGGSQARMIGALICTVGTISLIFYRGPVVNN--YSPTFLHLSTTQFVFSSSTNQQ  771
             K+D       A+ +GA+I   G + +  Y GP + N  +S    H +    V  SST   
Sbjct  125   KLDLRKATGYAKSLGAIIAVGGALIVTLYDGPALLNSSWSSRLNHSTHRSXVSQSST---  181

Query  772   NWVLGCLCFIAASLTLSIWNIIQVGTIRIYPQVMKIMCVYSLFGTVQSGALSLFIVRD-L  948
              W+ G +      L  S WNI Q  T++ YP+ M I+  Y++F T+Q   +SL + R+ L
Sbjct  182   -WIFGGMLLAIQCLVASTWNIAQAATVKDYPEEMTIVFFYTMFLTIQCTVISLIVERNNL  240

Query  949   NAWRLGLNFQLIVILLTAIFGSIIRSSVQLWCMRMKGPSFPLIFKPVGIVVASSCGCLFF  1128
             +AW++ L  ++I IL  AI  S+ R SV +WC+  KGP +  +FKP+GI +A+    +F 
Sbjct  241   SAWKMELPIEIIAILYAAICVSVFRISVHVWCLHKKGPVYVAMFKPLGIAIAAVVVVVFL  300

Query  1129  ADTFHYGSMFSAFICGMGYYTTIWGQLKDEEIQQIKGSSVSLPD-EKVPLLQQSQDDS  1299
              +TF+ GS+  + +  +G+YT  + QLK++ I        S P  +  PLL+ S  + 
Sbjct  301   GNTFYLGSLIGSIVISLGFYTVTYAQLKEKVIDIDNSVQRSEPSTQTTPLLRSSISNE  358


 Score =   144 bits (363),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 80/268 (30%), Positives = 142/268 (53%), Gaps = 11/268 (4%)
 Frame = +1

Query  496   AFVGLSYSSPIAACGTANIVPALSFILAIILRRTKIDWESGGSQARMIGALICTVGTISL  675
              ++G++YSSP      +N+ PA +FILA+  R   +   S  +QA+++G L+   G + +
Sbjct  394   GYIGINYSSPTLDSAMSNLTPAFTFILAVFFRMESLALRSYSTQAKIMGTLVSISGALVV  453

Query  676   IFYRGPVVNNYSPTFLHLSTTQFVFSSSTNQQNWVLGCLCFIAASLTLSIWNIIQVGTIR  855
             + Y+GP + + +P+  + S         T   NWV+G L      L  S W I+Q   ++
Sbjct  454   VLYKGPTILS-TPSDPNPSPMX-----GTPPTNWVIGGLLCALQFLLNSTWYILQTHVMK  507

Query  856   IYPQVMKIMCVYSLFGTVQSGALSLFIVRDLNAWRLGLNFQLIVILLTAIFGSIIRSSVQ  1035
              YP  + ++ +Y+L GT+ S  +      +L+AWRL  +  L+ I+ +   GS   S V 
Sbjct  508   AYPAEIVLVFLYNLCGTIISAPVCFIAETNLSAWRLRPDIALVAIIYSGCLGSSFGSLVH  567

Query  1036  LWCMRMKGPSFPLIFKPVGIVVASSCGCLFFADTFHYGSMFSAFICGMGYYTTIWGQLKD  1215
              W + +KGP +  IFKP+ I +A++   +F  D    GS+  A I  +G+Y  IWG+ K+
Sbjct  568   TWALHLKGPVYISIFKPLSIAIAAALSVIFLGDALSLGSVVGAIILSVGFYAVIWGKSKE  627

Query  1216  EEIQQIKGSSVSLPDEKVPLLQQSQDDS  1299
             E+++ +      +   K PLL+  + ++
Sbjct  628   EQMKPLP-----IGMGKAPLLESYKVEN  650



>gb|KCW85808.1| hypothetical protein EUGRSUZ_B02553 [Eucalyptus grandis]
Length=256

 Score =   177 bits (450),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 92/253 (36%), Positives = 148/253 (58%), Gaps = 9/253 (4%)
 Frame = +1

Query  547   NIVPALSFILAIILRRTKIDWESGGSQARMIGALICTVGTISLIFYRGPVV--NNYSPTF  720
             N++PA +FILA+I R  K++W+S  SQA+++G +   +G + +  Y+GP V  +   P+F
Sbjct  3     NLIPAFTFILAVISRMEKVNWKSSSSQAKLVGTVASILGALVITVYKGPTVLRSPSLPSF  62

Query  721   LHLSTTQFVFSSSTNQQNWVLGCLCFIAASLTLSIWNIIQVGTIRIYPQVMKIMCVYSLF  900
             +H    + + S  + Q NWVLG     A +  LS+W I+Q   ++ YP V+ IM     F
Sbjct  63    VH---PRHLVSLLSRQLNWVLGGFLLAAEAFLLSLWFIMQAFILKDYPVVLNIMFYLMFF  119

Query  901   GTVQSGALSLFIVRDLNAWRLGLNFQLIVILLTAIFGSIIRSSVQLWCMRMKGPSFPLIF  1080
              T+ SG LS+ +VR+  +W L L+  LI IL +++   + R ++  WC++  GP F  +F
Sbjct  120   ATIFSGLLSIIMVREPQSWTLKLDVGLIAILYSSLVAGVFRVTLCTWCLKKTGPVFVSMF  179

Query  1081  KPVGIVVASSCGCLFFADTFHYGSMFSAFICGMGYYTTIWGQLKDEE--IQQIKGSSVSL  1254
             KP+GIV A   G +F  +  H GS+  A +  MG+Y  +WG+ ++EE  I+   G+  SL
Sbjct  180   KPLGIVFAVGLGFIFLGEKLHLGSLIGAAVIAMGFYAVMWGKSREEEKIIEDSGGADGSL  239

Query  1255  P--DEKVPLLQQS  1287
                 +K+PLLQ  
Sbjct  240   ASSSQKIPLLQSK  252



>ref|XP_008443486.1| PREDICTED: WAT1-related protein At5g40230-like isoform X1 [Cucumis 
melo]
 ref|XP_008443487.1| PREDICTED: WAT1-related protein At5g40230-like isoform X1 [Cucumis 
melo]
 ref|XP_008443488.1| PREDICTED: WAT1-related protein At5g40230-like isoform X1 [Cucumis 
melo]
Length=362

 Score =   181 bits (458),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 106/366 (29%), Positives = 198/366 (54%), Gaps = 13/366 (4%)
 Frame = +1

Query  208   MEVKAAFGEVVPCMAMVMVEACTIFLTIMASTAMAKFGTNPFVFVVYTNALASIFLVPYS  387
             M+    + E  P   M+  E  T+    +   A++    + +VF  YT   A++ L+P++
Sbjct  1     MDRSFLYKEFAPLAGMIAAECATVGSNTVYK-AISGHQISFYVFTFYTCLAAALVLLPFA  59

Query  388   IIYHRRDKAQEQlftfplllrlfflglIGVTISQNLAFVGLSYSSPIAACGTANIVPALS  567
             +I+ R      +  +F L L       +G    Q  ++ GL YSSP  A   +N++PAL+
Sbjct  60    LIFRRSGVFPSEKLSFLLRLISLSAMGVGC---QLFSYKGLEYSSPTLASAISNLIPALT  116

Query  568   FILAIILRRTKIDWESGGSQARMIGALICTVGTISLIFYRGPVV--NNYS-PTFLHLSTT  738
             FILA++    K+   S  S A+++G+ +   G + ++ Y+GP++  N +S PT L+L   
Sbjct  117   FILAVLFGMEKVALRSSSSIAKIVGSTVSITGALVVVLYKGPIILPNLFSSPTRLNLPPP  176

Query  739   QFVFSSSTNQQNWVLGCLCFIAASLTLSIWNIIQVGTIRIYPQVMKIMCVYSLFGTVQSG  918
                    ++Q NW+LG LCF    L  S W I+   T+ +YP  + ++C++ +F  + + 
Sbjct  177   PL----GSSQPNWILGGLCFFVQYLLNSFWYIVLTQTLNMYPDELVVVCLFYVFEVIIAA  232

Query  919   ALSLFIVRDLNAWRLGLNFQLIVILLTAIFGSIIRSSVQLWCMRMKGPSFPLIFKPVGIV  1098
              + L   R+++AW+L  + +++ +L +   G    S++  W + +KGP +   F+P+ I 
Sbjct  233   PICLLAERNMSAWKLKNSMEVVAVLNSGCVGQSFVSAIHTWGVHVKGPVYVSSFRPLSIA  292

Query  1099  VASSCGCLFFADTFHYGSMFSAFICGMGYYTTIWGQLKDEEIQ-QIKGSSV-SLPDEKVP  1272
             +A++ G +F  D  H GS+  A I   G+Y+ +WG++K+E+++ Q   S++ S   +KVP
Sbjct  293   IAAATGVIFLGDDLHLGSIIGATIIASGFYSIMWGKIKEEDLKGQDDFSNLESSSKDKVP  352

Query  1273  LLQQSQ  1290
             LL+  +
Sbjct  353   LLKSCK  358



>emb|CAN67884.1| hypothetical protein VITISV_015327 [Vitis vinifera]
Length=336

 Score =   180 bits (456),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 92/271 (34%), Positives = 148/271 (55%), Gaps = 6/271 (2%)
 Frame = +1

Query  487   QNLAFVGLSYSSPIAACGTANIVPALSFILAIILRRTKIDWESGGSQARMIGALICTVGT  666
             Q L F+G+ YSSP  A    N++PA +++LAI+ R  K+D +   S+A+ +G L+   G 
Sbjct  70    QMLKFIGIGYSSPTLASAMTNLIPAFTYVLAIVTRMEKLDLKVKSSRAKCLGTLVSVAGA  129

Query  667   ISLIFYRGPVVNNYSPTFLHLSTTQFVFSSSTNQQNWVLGCLCFIAASLTLSIWNIIQVG  846
             + +  Y+GP +   S T   L+    +      + NW++G     AA+  +++  + Q  
Sbjct  130   LLITIYKGPGIEFASTTPSMLNHNLLL-----PRSNWIIGGFLTAAAAFMVAVLLVFQTS  184

Query  847   TIRIYPQVMKIMCVYSLFGTVQSGALSLFIVRDLNAWRLGLNFQLIVILLTAIFGSIIRS  1026
              IR YP  + +  +  +F T+QS  +SL   RD +AWRL L+ +LI +  + IF   +R 
Sbjct  185   IIRDYPAELIVTLISHIFATMQSSLVSLIAERDPSAWRLRLDMELIAVGYSGIFVVALRG  244

Query  1027  SVQLWCMRMKGPSFPLIFKPVGIVVASSCGCLFFADTFHYGSMFSAFICGMGYYTTIWGQ  1206
             +V  W +  KGP F  +FKP GIV+A   G  F  D  H GS+  A I  +G+YT +WG+
Sbjct  245   AVYAWVLHQKGPVFVAMFKPAGIVIAVIMGVTFLGDKLHLGSVIGAAIIALGFYTVVWGK  304

Query  1207  LKDEEI-QQIKGSSVSLPDEKVPLLQQSQDD  1296
              K+E++ + I    V+    +VPLLQ    +
Sbjct  305   AKEEKMAEDIAACGVNTSSHRVPLLQNKSTE  335



>ref|XP_006483798.1| PREDICTED: WAT1-related protein At3g28050-like isoform X1 [Citrus 
sinensis]
Length=350

 Score =   180 bits (457),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 118/357 (33%), Positives = 189/357 (53%), Gaps = 14/357 (4%)
 Frame = +1

Query  235   VVPCMAMVMVEACTIFLTIMASTAMAKFGTNPFVFVVYTNALASIFLVPYSIIYHRRDKA  414
             + P + M+M E   + L      AM+  G +  VFV Y+NA AS+ L+P S+++HR   +
Sbjct  6     LAPVIGMMMAECAQVGLMFAGKAAMSD-GMSNLVFVFYSNAFASLVLLPASLLFHR---S  61

Query  415   QEQlftfplllrlfflglIGVTISQNLAFVGLSYSSPIAACGTANIVPALSFILAIILRR  594
             Q    T P+L   F LG +G T SQ   + G+ YSSP  +    N+VP  +FILAII   
Sbjct  62    QIPPLTLPILSAFFLLGFLG-TSSQFFGYAGIYYSSPTLSTAMLNLVPGFTFILAIIFGM  120

Query  595   TKIDWESGGSQARMIGALICTVGTISLIFYRGP-VVNNYSPTFLHLSTTQFVFSSSTNQQ  771
              K+DW+S  S A+ +G ++   G   + + +GP ++   SP  L L   QF       Q 
Sbjct  121   EKLDWKSSSSLAKSVGTIVLITGAFIMAYCKGPHLLMTSSPPNLSL---QFF----VPQT  173

Query  772   NWVLGCLCFIAASLTLSIWNIIQVGTIRIYPQVMKIMCVYSLFGTVQSGALSLFIVRDLN  951
             NWV+G L      +  S W I+Q   ++ +   + ++  Y  F  +QS  L L + RDL+
Sbjct  174   NWVIGGLLLAIDCVFTSAWLIVQASILKKFSAELIVVFFYCFFVAIQSAILCLVMERDLS  233

Query  952   AWRLGLNFQLIVILLTAIFGSIIRSSVQLWCMRMKGPSFPLIFKPVGIVVASSCGCLFFA  1131
             +W L    +L+ +L +A+FGS  +  V  WC+   GP F  +FKP+GIV+++  G +F  
Sbjct  234   SWSLKPGVRLVAVLYSAVFGSAFQVGVCTWCLHRTGPVFVAMFKPLGIVISAVVGTIFLG  293

Query  1132  DTFHYGSMFSAFICGMGYYTTIWGQLKDEEIQQIKG-SSVSLPDEKVPLLQQSQDDS  1299
             +T + G    A +   G+Y+ +WG+ K+       G  S+    +K PLLQ + +++
Sbjct  294   ETVYLGRFIGAAVIVTGFYSVMWGKAKEGNSGVETGVRSLESSSQKDPLLQNNFEET  350



>emb|CDY20031.1| BnaA09g02200D [Brassica napus]
Length=369

 Score =   181 bits (458),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 114/372 (31%), Positives = 193/372 (52%), Gaps = 25/372 (7%)
 Frame = +1

Query  232   EVVPCMAMVMVEACTIFLTIMASTAMAKFGTNPFVFVVYTNALASIFLVPYSIIYHRRDK  411
             EV+P MA+V++E   + L  +   A  + G +  VF+VY+  LA++ L+P SI +  R +
Sbjct  9     EVLPVMALVIMECANVGLNTLFKAATLQ-GMSFHVFIVYSYGLAALLLLP-SIFFSSRSR  66

Query  412   AQEQlftfplllrlfflglIGVTISQNLAFVGLSYSSPIAACGTANIVPALSFILAIILR  591
                 +    L   +     IG   S  + + G++YSSP  A   +N+ PA +F+LAI+ R
Sbjct  67    TLPPMNFSILYKIVVLGL-IGCC-SNIMGYTGINYSSPTLASAISNLTPAFTFLLAILFR  124

Query  592   RTK-IDWESGGSQARMIGALICTVGTISLIFYRGPVVNNYSPTFLHLSTTQFVFSSSTNQ  768
               + + ++   S A+M+G ++   G   +  Y GP+V + SP  + L       S STN 
Sbjct  125   LMESVSFKRISSVAKMLGTVVSIGGAFIVTLYNGPLVISMSPPSVSLR------SQSTNH  178

Query  769   QNWVLGCLCFIAASLTLSIWNIIQVGTIRIYPQVMKIMCVYSLFGTVQSGALSLFIV-RD  945
              NW++G          + +W I+Q   +R YP    ++C YSL  +  +G ++LF    D
Sbjct  179   -NWIIGAAFLSVEYFMVPLWYIVQTQIMREYPSEFTVVCYYSLGVSFWTGLVTLFTEGSD  237

Query  946   LNAWRLGLNFQLIVILLTAIFGSIIRSSVQLWCMRMKGPSFPLIFKPVGIVVASSCGCLF  1125
             LNAW++  N  L+ I+ + +FGS I +++  W +R+KGP F  +FKP+ I +A + G +F
Sbjct  238   LNAWKIKPNIALVSIVCSGVFGSCINNTIHTWALRIKGPLFVAMFKPLSIAIAVAMGVIF  297

Query  1126  FADTFHYGSMFSAFICGMGYYTTIWGQLKD------------EEIQQIKGSSVSLPDEKV  1269
               D+ + GS+  A +   G+YT +WG+ K+            E+          L  +K 
Sbjct  298   LHDSLYIGSLIGATVITTGFYTVMWGKAKEAAMVEDDNKANNEDATNEADHDSPLASQKA  357

Query  1270  PLLQQSQDDSPV  1305
             PLL+  ++D  V
Sbjct  358   PLLESYKNDEHV  369



>gb|KHG19084.1| Auxin-induced protein 5NG4 [Gossypium arboreum]
Length=359

 Score =   180 bits (457),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 122/354 (34%), Positives = 192/354 (54%), Gaps = 12/354 (3%)
 Frame = +1

Query  238   VPCMAMVMVEACTIFLTIMASTAMAKFGTNPFVFVVYTNALASIFLVPYSIIYHRRDKAQ  417
             +P + MVM E   + L IM   AM+  G   FVFV Y+NALAS+ L+P S ++HR   + 
Sbjct  8     LPIVGMVMAEVAQVGLMIMGKAAMSH-GMPNFVFVFYSNALASLILLPASFLFHR---SH  63

Query  418   EQlftfplllrlfflglIGVTISQNLAFVGLSYSSPIAACGTANIVPALSFILAIILRRT  597
                 TF +L   F LGL+G   +Q   + G+ YSSP  A    N++P L+FILA+  R  
Sbjct  64    LPPLTFSILCWFFLLGLLG-CFAQISGYAGIYYSSPTLATAMLNLIPGLTFILAVAFRME  122

Query  598   KIDWESGGSQARMIGALICTVGTISLIFYRGPVVNNYSPTFLHLSTTQFVFSSSTNQQNW  777
              ++  S  SQA+ +G ++   G   + FY+GP +   +P+  H S+   +      Q NW
Sbjct  123   TLNLRSSTSQAKSLGTIVSIAGAFIVTFYKGPSLL-MAPS--HSSSPHLLLG---QQSNW  176

Query  778   VLGCLCFIAASLTLSIWNIIQVGTIRIYPQVMKIMCVYSLFGTVQSGALSLFIVRDLNAW  957
             V+G     A  +  S W I+Q   ++ +P  + ++  Y  F T+QSG + L +  DL+AW
Sbjct  177   VIGGFLLAADCVFASAWLIVQASVLKKFPAELFVVFYYCFFVTLQSGIICLIMGGDLSAW  236

Query  958   RLGLNFQLIVILLTAIFGSIIRSSVQLWCMRMKGPSFPLIFKPVGIVVASSCGCLFFADT  1137
                 + +L+ ++ +A+FGS  +  V  WCM   GP F  +FKP+GIVV+   G +F  DT
Sbjct  237   SFKPDVRLVAVIYSAVFGSAFQLGVSTWCMHRTGPVFVSMFKPLGIVVSVVIGVIFLGDT  296

Query  1138  FHYGSMFSAFICGMGYYTTIWGQLKDEEIQ-QIKGSSVSLPDEKVPLLQQSQDD  1296
             F  GS+  A +   G+Y+ +WG+ K+ ++  Q +G       +KV LL  +  +
Sbjct  297   FFLGSLVGAIVIVTGFYSVMWGKAKEGKLDVQTQGMMSESSSQKVALLSNNTGE  350



>ref|XP_007157479.1| hypothetical protein PHAVU_002G073100g [Phaseolus vulgaris]
 ref|XP_007157480.1| hypothetical protein PHAVU_002G073100g [Phaseolus vulgaris]
 gb|ESW29473.1| hypothetical protein PHAVU_002G073100g [Phaseolus vulgaris]
 gb|ESW29474.1| hypothetical protein PHAVU_002G073100g [Phaseolus vulgaris]
Length=353

 Score =   180 bits (456),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 114/328 (35%), Positives = 174/328 (53%), Gaps = 21/328 (6%)
 Frame = +1

Query  325   NPFVFVVYTNALASIFLVPYSIIYHRRDKAQEQlftfplllrlfflglIGVTISQNLAFV  504
             N +V VVYT AL++I L+P+++  HR ++             L F G  G TI+   A+V
Sbjct  40    NKYVMVVYTFALSTILLLPFALFLHRSERPPLTFSALCSFFLLAFFGSSG-TIT---AYV  95

Query  505   GLSYSSPIAACGTANIVPALSFILAIILRRTKIDWESGGSQARMIGALICTVGTISLIFY  684
             G+  SSP  A    N+VPA++F+LA+I R  ++ W +  SQA+++G ++   G + +I Y
Sbjct  96    GIELSSPTLASALLNLVPAITFVLALIFRMEEVHWRNSSSQAKVLGTIVSVTGALVVILY  155

Query  685   RGPVV-----NNYSPTFLHLSTTQFVFSSSTNQQNWVLGCLCFIAASLTLSIWNIIQVGT  849
             +GP++     +N+S   L +S           Q NW+LG +  +A SL  S+W I Q   
Sbjct  156   KGPLIFKAYWSNFSSHILKVSP----------QLNWILGGIFCVADSLFTSMWYIYQSSV  205

Query  850   IRIYPQVMKIMCVYSLFGTVQSGALSLFIVRDLNAWRLGLNFQLIVILLTAIFGSIIRSS  1029
              + YP V  I+    L  T+  G  +L  VRD   W+L  +  LI IL  AI  ++IR  
Sbjct  206   SKKYPAVTVIVFFQLLSSTMLCGVFALIAVRDPTEWKLNFDIGLIGILYQAIVATVIRYL  265

Query  1030  VQLWCMRMKGPSFPLIFKPVGIVVASSCGCLFFADTFHYGSMFSAFICGMGYYTTIWGQL  1209
             +  WC+   GP F  +FKPVGI+     G +F AD F  GS+  A I  +G+Y  +WG+ 
Sbjct  266   LCTWCVLKAGPLFCAMFKPVGIIFTVFMGAIFLADDFSLGSLIGAVIIVVGFYGVLWGKS  325

Query  1210  KDEEIQQIKG-SSVSLPDEKVPLLQQSQ  1290
             ++E  +  KG  ++      VPLLQ   
Sbjct  326   REEN-EIAKGVENLESSCHNVPLLQNRN  352



>ref|XP_010435926.1| PREDICTED: WAT1-related protein At5g40240 isoform X1 [Camelina 
sativa]
 ref|XP_010435927.1| PREDICTED: WAT1-related protein At5g40240 isoform X1 [Camelina 
sativa]
 ref|XP_010435928.1| PREDICTED: WAT1-related protein At5g40240 isoform X1 [Camelina 
sativa]
 ref|XP_010435929.1| PREDICTED: WAT1-related protein At5g40240 isoform X1 [Camelina 
sativa]
Length=368

 Score =   180 bits (457),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 105/358 (29%), Positives = 189/358 (53%), Gaps = 17/358 (5%)
 Frame = +1

Query  232   EVVPCMAMVMVEACTIFLTIMASTAMAKFGTNPFVFVVYTNALASIFLVPYSIIYHRRDK  411
             +VVP  AM  VE  T+    +   A  + G N +VFV Y+  +++  L+P S ++ R  +
Sbjct  17    DVVPFAAMFAVECTTVGSNTLYKAATLR-GLNFYVFVFYSYVVSTTLLLPLSFVFGRSRR  75

Query  412   AQEQlftfplllrlfflglIGVTISQNLAFVGLSYSSPIAACGTANIVPALSFILAIILR  591
                        + L  L      +SQ +   G+ YSSP  A   +N+ PA +F LA++ R
Sbjct  76    LPSAKSPLFFKIFLLGLVGF---MSQIVGCKGIVYSSPTLASAISNLTPAFTFTLAVVFR  132

Query  592   RTKIDWESGGSQARMIGALICTVGTISLIFYRGPVV---NNYSPTFLHLSTTQFVFSSST  762
               ++   S  +QA++IGA++   G + ++ Y+GP V    + +P+ L +S+ Q +   ++
Sbjct  133   MERVMLSSSATQAKIIGAILSISGALVIVLYKGPKVLAATSSTPSSLTISSHQPL---TS  189

Query  763   NQQNWVLGCLCFIAASLTLSIWNIIQVGTIRIYPQVMKIMCVYSLFGTVQSGALSLFIVR  942
              + +W+LG L   +    +S+W IIQ   + +YP+ + ++  Y+LF T+ S  + LF   
Sbjct  190   VESSWILGGLLLASQYFLISVWYIIQTRVMEVYPEEITVVFFYNLFATLISAPVCLFAES  249

Query  943   DLNAWRLGLNFQLIVILLTAIFGSIIRSSVQLWCMRMKGPSFPLIFKPVGIVVASSCGCL  1122
             +L +W L  +  L  I+ + +F S+  +    W + +KGP +  +F+P+ I +A + G +
Sbjct  250   NLTSWVLKPDITLTAIIYSGVFVSLFSALTHTWGLHLKGPVYISLFRPLSIAIAVTMGAI  309

Query  1123  FFADTFHYGSMFSAFICGMGYYTTIWGQLKDEEIQQIKGSSVS-------LPDEKVPL  1275
             F  D+ H GS+  + I   G+YT IWG+ +++ I+ + GS  S       + DE  PL
Sbjct  310   FLGDSLHLGSVIGSIILCFGFYTVIWGKAREDTIKTVAGSDQSPLLLTHIIEDEAFPL  367



>ref|XP_003523396.1| PREDICTED: WAT1-related protein At3g28050-like [Glycine max]
Length=351

 Score =   179 bits (454),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 116/342 (34%), Positives = 174/342 (51%), Gaps = 22/342 (6%)
 Frame = +1

Query  298   STAMAKFGTNPFVFVVYTNALASIFLVPYSIIYHRRDKAQEQlftfplllrlfflglIGV  477
             S A  K G N FVFV+Y+NA A+  L+P + I++R+       +     L +       V
Sbjct  24    SKAAMKKGMNDFVFVMYSNAFATCLLLPITFIFYRKRALPPLTYFIVGQLFINGFLSCSV  83

Query  478   TISQNLAFVGLSYSSPIAACGTANIVPALSFILAIILRRTKIDWESGGSQARMIGALICT  657
                Q L F G+ Y SP  A   ++++PA +FILAI+ R   +DW++  ++A+ IG L+  
Sbjct  84    ---QMLRFFGIGYGSPTLATAMSDLIPAFTFILAIVFRMEILDWKTNSTRAKSIGTLVSI  140

Query  658   VGTISLIFYRG-PVVNNYSPTFL----HLSTTQFVFSSSTNQQNWVLGCLCFIAASLTLS  822
              G + +  Y+G  V+NN+    L    H+S+ QF         +WV+G +     S  LS
Sbjct  141   AGALIITLYKGQAVINNHPSNKLFPKKHVSSEQF---------DWVIGAVLLAGHSFVLS  191

Query  823   IWNIIQVGTIRIYPQVMKIMCVYSLFGTVQSGALSLFIVRDLNAWRLGLNFQLIVILLTA  1002
             +  I+Q   IR YP  + I+        + S   SL  V D  A RLG +  LI I L A
Sbjct  192   LLFIVQTWIIRNYPAELVIVLTRGTLVAMLSIPPSLISVTDPKALRLGFDVNLIAIALQA  251

Query  1003  IFGSIIRSSVQLWCMRMKGPSFPLIFKPVGIVVASSCGCLFFADTFHYGSMFSAFICGMG  1182
             IFG  +RS V +W M  KGP +  +FKP+GI+ A   G  F  D+ + GS+  A I  +G
Sbjct  252   IFGVSLRSIVHIWVMSKKGPLYVAMFKPIGIIFAVIMGIAFLGDSIYLGSVLGAAIVVIG  311

Query  1183  YYTTIWGQLKD---EEIQQIKGSSVSLPDEKVPLLQQSQDDS  1299
             +Y  IWG+ ++   EE +    S    P   VPLL+  + + 
Sbjct  312   FYAVIWGKSQEQAKEECEVYDDSESYSP--VVPLLKNKRMEE  351



>gb|KDO82559.1| hypothetical protein CISIN_1g022220mg [Citrus sinensis]
Length=300

 Score =   177 bits (450),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 91/269 (34%), Positives = 149/269 (55%), Gaps = 7/269 (3%)
 Frame = +1

Query  496   AFVGLSYSSPIAACGTANIVPALSFILAIILRRTKIDWESGGSQARMIGALICTVGTISL  675
             +++GL YSSP       N++PA +FILAII R  K+ W S  SQA+ +G ++   G   +
Sbjct  32    SYIGLQYSSPTLNTAMLNLIPAFTFILAIIFRMEKLKWRSKSSQAKSLGTIVSIAGAFVV  91

Query  676   IFYRGPVVNNYSPTFLHLSTTQFVFSSSTNQQNWVLGCLCFIAASLTLSIWNIIQVGTIR  855
              FY+GP +         L   Q +      Q NW+LG     A ++ +S W I+Q  T++
Sbjct  92    TFYKGPPIVRPRLDIASLDQIQPL------QSNWILGGFYLAAQAILISAWYILQAITLK  145

Query  856   IYPQVMKIMCVYSLFGTVQSGALSLFIVRDLNAWRLGLNFQLIVILLTAIFGSIIRSSVQ  1035
              +P ++ ++C    F T+ +   SL +V +L+AW+L L+  L  I  +A+ G+   +++ 
Sbjct  146   EFPALIVMLCYQYFFSTILAAMFSLTVVTELSAWKLRLDVGLFAIAYSAVIGAAFLTTLL  205

Query  1036  LWCMRMKGPSFPLIFKPVGIVVASSCGCLFFADTFHYGSMFSAFICGMGYYTTIWGQLKD  1215
             LWC+   GP +  +FKP+ I+ ++  G + F D    GS+  A I  +G+Y  +WG+ K+
Sbjct  206   LWCLMRAGPLYVSMFKPLAILFSTVMGVIIFGDGLFLGSLVGAVIIVIGFYVVMWGKAKE  265

Query  1216  EEIQQIKGS-SVSLPDEKVPLLQQSQDDS  1299
             E     +G+ S  L  EKVPLLQ S +D+
Sbjct  266   ENTIDDRGTWSSELSSEKVPLLQNSTEDT  294



>emb|CBI34954.3| unnamed protein product [Vitis vinifera]
Length=344

 Score =   179 bits (454),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 113/349 (32%), Positives = 196/349 (56%), Gaps = 7/349 (2%)
 Frame = +1

Query  253   MVMVEACTIFLTIMASTAMAKFGTNPFVFVVYTNALASIFLVPYSIIYHRRDKAQEQlft  432
             MV VEA  + L ++  +A ++ G + +VF+VY+ A+A++ L P   I++ + +     F 
Sbjct  1     MVTVEATNVVLNVLFKSATSR-GMSVYVFIVYSYAVATLILFPLLFIFNGK-RLLLPPFK  58

Query  433   fplllrlfflglIGVTISQNLAFVGLSYSSPIAACGTANIVPALSFILAIILRRTKIDWE  612
             F LL ++  LG IG  +++ +A+ G+ YSSP  A    N+ PAL+F+LAI  R  K+   
Sbjct  59    FSLLCKICSLGFIGF-LAEIVAYKGIDYSSPTLASVIGNLTPALTFMLAIFFRMEKLALR  117

Query  613   SGGSQARMIGALICTVGTISLIFYRGPVVNNYSPTFLHLSTTQFVFSSSTNQQNWVLGCL  792
             S  S A++ G +    G + ++ Y+G  + + S     +S  Q     ++ Q  WV+G L
Sbjct  118   SLSSWAKITGTIASISGALIVVLYKGLQLTSTSSPLQFISLHQ---PLNSQQMKWVIGGL  174

Query  793   CFIAASLTLSIWNIIQVGTIRIYPQVMKIMCVYSLFGTVQSGALSLFIVRDLNAWRLGLN  972
               +A  L +SIW I+Q   + +YP+ + ++ + +L  T+ S  + L   ++L+ WR+ L+
Sbjct  175   LLVAEDLLVSIWYIVQAQVMEVYPEELVVVFLSNLCLTIISAPVCLIAEKNLSVWRVELD  234

Query  973   FQLIVILLTAIFGSIIRSSVQLWCMRMKGPSFPLIFKPVGIVVASSCGCLFFADTFHYGS  1152
               L  I+ +A +GS     V  W +R+KGP +  +F P+ IV+A++ G +F  DT + GS
Sbjct  235   IALAAIVFSAFWGSAFGMVVPTWVVRLKGPVYVAMFNPLSIVIATAMGVMFLGDTLYLGS  294

Query  1153  MFSAFICGMGYYTTIWGQLKDEEIQQIK-GSSVSLPDEKVPLLQQSQDD  1296
             +  A +  +G+Y   WG+ K+E I+    GS  SL + K+PLL   Q +
Sbjct  295   IIGAIVISIGFYIVTWGKAKEETIEDFGVGSLESLSNPKIPLLLSCQSE  343



>ref|XP_007217782.1| hypothetical protein PRUPE_ppa020036mg [Prunus persica]
 gb|EMJ18981.1| hypothetical protein PRUPE_ppa020036mg [Prunus persica]
Length=360

 Score =   179 bits (454),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 111/360 (31%), Positives = 189/360 (53%), Gaps = 13/360 (4%)
 Frame = +1

Query  232   EVVPCMAMVMVEACTIFLTIMASTAMAKFGTNPFVFVVYTNALASIFLVPYSIIYHRRDK  411
             + +P  AM+ VE   + L ++   A +K G + +VF+VY+N +A++ L+P   I+ R   
Sbjct  9     DALPVAAMLTVECTNVGLNVLFKAATSK-GLSYYVFIVYSNIIATLVLLPLFFIFRRTGL  67

Query  412   AQEQlftfplllrlfflglIGVTISQNLAFVGLSYSSPIAACGTANIVPALSFILAIILR  591
                 L     +  L     IG  ++    + GL+YSSP  +   +N+ PA +FILA+  R
Sbjct  68    PSFNLSLLSKIFLLGL---IGF-LADICGYKGLNYSSPTLSSAMSNLTPAFTFILAVFFR  123

Query  592   RTKIDWESGGSQARMIGALICTVGTISLIFYRGPVVNNYSPTFLHLSTTQFVFSSSTNQQ  771
               K+   S  +QA+++G L+   G + ++ Y+GP + + + T L   +        T+++
Sbjct  124   MEKLALRSSSTQAKIMGTLVSISGALVVVLYKGPTILSTASTVLSPPSAVL----GTSEK  179

Query  772   NWVLGCLCFIAASLTLSIWNIIQVGTIRIYPQVMKIMCVYSLFGTVQSGALSLFIVRDLN  951
             NWV+G L      L  S W I+Q   ++ YP  + ++ +++L GT+ S  + L    +L+
Sbjct  180   NWVVGGLLLAVQYLLSSTWYILQTHVMKTYPAEIVLVFLFNLCGTIISAPVCLIAETNLS  239

Query  952   AWRLGLNFQLIVILLTAIFGSIIRSSVQLWCMRMKGPSFPLIFKPVGIVVASSCGCLFFA  1131
             AWRL     L+ I+ +   GS   S V  W + +KGP F  IFKP+ I +A++   +F  
Sbjct  240   AWRLRPGIALVAIICSGCLGSSFSSLVHTWGLHLKGPVFISIFKPLSIAIAAAFSVIFLG  299

Query  1132  DTFHYGSMFSAFICGMGYYTTIWGQLKDEEIQQI--KGSSVSLPDE--KVPLLQQSQDDS  1299
             D    GS+  A I  MG+Y  IWG+ K++E  +     SS +LP    K PLL+  + ++
Sbjct  300   DALSLGSVVGAIILSMGFYAVIWGKAKEDETSEDCRFESSRALPIALGKTPLLESHKVEN  359



>ref|XP_010254351.1| PREDICTED: WAT1-related protein At4g15540-like [Nelumbo nucifera]
Length=551

 Score =   182 bits (463),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 122/368 (33%), Positives = 188/368 (51%), Gaps = 10/368 (3%)
 Frame = +1

Query  190   EKMLAAMEVKAAFGEVVPCMAMVMVEACTIFLTIMASTAMAKFGTNPFVFVVYTNALASI  369
             E+  A M +K++    +P  AMV VE   I L+ ++  AM + G + FVF++Y+  LA++
Sbjct  189   EERKAEMGLKSSLWSAMPFAAMVTVECAMIGLSTLSKAAMRR-GMSNFVFILYSYILATL  247

Query  370   FLVPYSIIYHRRDKAQEQlftfplllrlfflglIGVTISQNLAFVGLSYSSPIAACGTAN  549
              L+  S+    R +A         +L   FL  +    +Q L F G+  SSP  +    N
Sbjct  248   LLLLPSVFVICRHRATHAAPLTFSILCKIFLLGLAGCTAQILQFEGIRSSSPTLSSAVDN  307

Query  550   IVPALSFILAIILRRTKIDWESGGSQARMIGALICTVGTISLIFYRGPVVNNYSPTF---  720
              +PA  FILA+I R  ++  +S   QA+++G L+   G   + FYRGP +   S T    
Sbjct  308   TLPAFVFILALIFRMERLSLKSSYGQAKLLGTLVSVTGAFVVTFYRGPSIIRTSSTSNSS  367

Query  721   -LHLSTTQFVFSSSTNQQNWVLGCLCFIAASLTLSIWNIIQVGTIRIYPQVMKIMCVYSL  897
               H      +F  S+    WV G       +L ++  +IIQ   +  Y     I   Y  
Sbjct  368   DHHHHQQLLLFPKSS----WVFGGFLLSLHTLVVAFLHIIQASIVNDYQAEFPIAFFYCF  423

Query  898   FGTVQSGALSLFIVRDLNAWRLGLNFQLIVILLTAIFGSIIRSSVQLWCMRMKGPSFPLI  1077
             F ++Q+  +SL   RD +AWRL  N +LI I+  AIFG  IRS V LWC+   GP +  +
Sbjct  424   FASIQTTLISLVAERDPSAWRLRPNLELIAIIYAAIFGCAIRSLVNLWCLGKNGPVYVAM  483

Query  1078  FKPVGIVVASSCGCLFFADTFHYGSMFSAFICGMGYYTTIWGQLKDEEI-QQIKGSSVSL  1254
             FKP GIV+A      F  D+ + GS+  + I  +G+Y  +WG+ K+ +I + I+  S+  
Sbjct  484   FKPFGIVIAVVTSSTFLRDSLYLGSVVGSAIISVGFYAVMWGKAKEWKIAKDIEEYSLMS  543

Query  1255  PDEKVPLL  1278
               E+VPLL
Sbjct  544   TTERVPLL  551


 Score = 55.8 bits (133),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 34/128 (27%), Positives = 62/128 (48%), Gaps = 3/128 (2%)
 Frame = +1

Query  610  ESGGSQARMIGALICTVGTISLIFYRGPVVNNYSPTFLHLSTTQFVFSSSTNQQNWVLGC  789
            +S   +A+++G L+   G   +  Y+GP +   + +  +L+  +F+ S    + NWV G 
Sbjct  7    KSSYGRAKLLGTLVSITGAFVVTLYKGPSIFISNSSASNLAHQRFLLSP---KSNWVFGG  63

Query  790  LCFIAASLTLSIWNIIQVGTIRIYPQVMKIMCVYSLFGTVQSGALSLFIVRDLNAWRLGL  969
                   L L+   IIQ   ++ Y     I   Y  FG++ +  +S+   +D +AW L  
Sbjct  64   FLLSLHILALAFLFIIQASIVKDYQAEFSITFFYCFFGSIPTAFISVIAEKDPSAWILRP  123

Query  970  NFQLIVIL  993
            N +LI I+
Sbjct  124  NLELIAII  131



>ref|XP_008443490.1| PREDICTED: WAT1-related protein At5g40230-like isoform X2 [Cucumis 
melo]
Length=347

 Score =   178 bits (451),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 99/325 (30%), Positives = 183/325 (56%), Gaps = 12/325 (4%)
 Frame = +1

Query  331   FVFVVYTNALASIFLVPYSIIYHRRDKAQEQlftfplllrlfflglIGVTISQNLAFVGL  510
             +VF  YT   A++ L+P+++I+ R      +  +F L L       +G    Q  ++ GL
Sbjct  26    YVFTFYTCLAAALVLLPFALIFRRSGVFPSEKLSFLLRLISLSAMGVGC---QLFSYKGL  82

Query  511   SYSSPIAACGTANIVPALSFILAIILRRTKIDWESGGSQARMIGALICTVGTISLIFYRG  690
              YSSP  A   +N++PAL+FILA++    K+   S  S A+++G+ +   G + ++ Y+G
Sbjct  83    EYSSPTLASAISNLIPALTFILAVLFGMEKVALRSSSSIAKIVGSTVSITGALVVVLYKG  142

Query  691   PVV--NNYS-PTFLHLSTTQFVFSSSTNQQNWVLGCLCFIAASLTLSIWNIIQVGTIRIY  861
             P++  N +S PT L+L          ++Q NW+LG LCF    L  S W I+   T+ +Y
Sbjct  143   PIILPNLFSSPTRLNLPPPPL----GSSQPNWILGGLCFFVQYLLNSFWYIVLTQTLNMY  198

Query  862   PQVMKIMCVYSLFGTVQSGALSLFIVRDLNAWRLGLNFQLIVILLTAIFGSIIRSSVQLW  1041
             P  + ++C++ +F  + +  + L   R+++AW+L  + +++ +L +   G    S++  W
Sbjct  199   PDELVVVCLFYVFEVIIAAPICLLAERNMSAWKLKNSMEVVAVLNSGCVGQSFVSAIHTW  258

Query  1042  CMRMKGPSFPLIFKPVGIVVASSCGCLFFADTFHYGSMFSAFICGMGYYTTIWGQLKDEE  1221
              + +KGP +   F+P+ I +A++ G +F  D  H GS+  A I   G+Y+ +WG++K+E+
Sbjct  259   GVHVKGPVYVSSFRPLSIAIAAATGVIFLGDDLHLGSIIGATIIASGFYSIMWGKIKEED  318

Query  1222  IQ-QIKGSSV-SLPDEKVPLLQQSQ  1290
             ++ Q   S++ S   +KVPLL+  +
Sbjct  319   LKGQDDFSNLESSSKDKVPLLKSCK  343



>ref|XP_009344542.1| PREDICTED: WAT1-related protein At3g28050-like [Pyrus x bretschneideri]
 ref|XP_009344560.1| PREDICTED: WAT1-related protein At3g28050-like [Pyrus x bretschneideri]
Length=363

 Score =   178 bits (452),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 110/366 (30%), Positives = 196/366 (54%), Gaps = 15/366 (4%)
 Frame = +1

Query  217   KAAFGEVVPCMAMVMVEACTIFLTIMASTAMAKFGTNPFVFVVYTNALASIFLVPYSIIY  396
             ++ + +V+P  AMV +E   + L  +   A    G +  VFVVY+ ++A+  L+P   + 
Sbjct  6     RSCYTDVLPFTAMVTMECMNVGLNTLFKAATLN-GMSYHVFVVYSYSVAAFVLIPAPFVS  64

Query  397   HRRDKAQEQlftfplllrlfflglIGV--TISQNLAFVGLSYSSPIAACGTANIVPALSF  570
             HR      ++        +  + L+G+  + SQ + + G++YSSP  A   +N+VPA +F
Sbjct  65    HR-----SRVLPPLNFSIMSKVLLLGLIGSSSQIMGYTGINYSSPTLASAISNLVPAFTF  119

Query  571   ILAIILRRTKIDWESGGSQARMIGALICTVGTISLIFYRGP--VVNNYSPTFLHLSTTQF  744
             ILAII R          SQA+++G ++   G   +  Y+GP  V  N S +   LS  Q 
Sbjct  120   ILAIIFRLESAALRKRSSQAKILGTIVSLAGAFVVTLYKGPSIVFANRSQS---LSLHQP  176

Query  745   VFSSSTNQQNWVLGCLCFIAASLTLSIWNIIQVGTIRIYPQVMKIMCVYSLFGTVQSGAL  924
             + +S+    NW++G L   A  + + +W I+Q   ++ YP  + ++  Y++     S A+
Sbjct  177   LLNSTPTNPNWIVGGLLLTAEYILVPLWYIVQAQIMKEYPNELTVIFFYNVCVVAVSAAV  236

Query  925   SLFIVRDLNAWRLGLNFQLIVILLTAIFGSIIRSSVQLWCMRMKGPSFPLIFKPVGIVVA  1104
             +L    + +AW+L  +  L+ IL + +FGS + ++V  W +R+KGP F  +FKP+ + +A
Sbjct  237   ALVTEPNSSAWKLRPDIALLSILCSGLFGSCLNNAVHTWVLRLKGPVFVTMFKPLSMAIA  296

Query  1105  SSCGCLFFADTFHYGSMFSAFICGMGYYTTIWGQLKDEEIQQIKGSSVSLPD--EKVPLL  1278
              + G  F  DT + GS+  A I  +G+YT +WG+ K++  ++   +S+  P    K PLL
Sbjct  297   VAMGVAFLRDTLYLGSLVGATIISIGFYTVLWGKTKEDAGEESVAASLESPSTTHKAPLL  356

Query  1279  QQSQDD  1296
             Q   ++
Sbjct  357   QNYINE  362



>ref|XP_004309502.1| PREDICTED: auxin-induced protein 5NG4-like [Fragaria vesca subsp. 
vesca]
Length=352

 Score =   177 bits (450),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 99/367 (27%), Positives = 187/367 (51%), Gaps = 36/367 (10%)
 Frame = +1

Query  262   VEACTIFLTIMA-------STAMAKF----GTNPFVFVVYTNALASIFLVPYSIIYHRRD  408
             +E C  +L ++        ++ + KF    G +P VFVVY + LA + L P++    R+ 
Sbjct  1     MEGCNYYLAMVVAQVSFGVTSILTKFSLLQGLDPVVFVVYRHVLAMLLLAPFAYFIERKQ  60

Query  409   KAQEQlftfplllrlfflglIGVTISQNLAFVGLSYSSPIAACGTANIVPALSFILAIIL  588
             + +    +  +  ++F L L G TI  N+ + GLSY  P  AC   N+VP+L+F++A++L
Sbjct  61    RPE---LSISVAAKIFLLALFGTTIHLNVYYAGLSYIPPTVACALGNVVPSLTFVMAVLL  117

Query  589   RRTKIDWESGGSQARMIGALICTVGTISLIFYR----------GPVVNNYSPTFLHLSTT  738
             R  K+  +S   +A++ G LIC +G++   F++           P++  Y+    H    
Sbjct  118   RMEKLKIKSRRGKAKVFGTLICVIGSLIFTFWKEGYLFKAFVEKPLIKAYNSEMKH----  173

Query  739   QFVFSSSTNQQNWVLGCLCFIAASLTLSIWNIIQVGTIRIYPQVMKIMCVYSLFGTVQSG  918
                      ++NW+ G    + + +  S W I+Q    + YP  + +  +   F ++QS 
Sbjct  174   --------GKENWIKGSALILTSHIAWSSWLILQAIVSKAYPAPLSLTTLICFFASLQSS  225

Query  919   ALSLFIVRDLNAWRLGLNFQLIVILLTAIFGSIIRSSVQLWCMRMKGPSFPLIFKPVGIV  1098
              ++LF  RD  +WRL  + +L+ I+ + +  S +   +Q WC+R KGP F  +F P+ ++
Sbjct  226   FVALFFSRDQASWRLEWDLKLLTIVYSGVVVSALVYYLQTWCIRHKGPVFAAMFSPLQVI  285

Query  1099  VASSCGCLFFADTFHYGSMFSAFICGMGYYTTIWGQLKDEEIQQIKGSSVSLPDEKVPLL  1278
             + +    + FA+  H GS+  AF+  +G Y  +WG+ KD  I  +  +   +P+  + + 
Sbjct  286   IVAIFSAIAFAERLHLGSLIGAFLIIVGLYCVLWGKNKDNAIADLNLNGKGVPNGGISVN  345

Query  1279  QQSQDDS  1299
              +  D++
Sbjct  346   GRYSDEA  352



>ref|XP_007226752.1| hypothetical protein PRUPE_ppa018854mg [Prunus persica]
 gb|EMJ27951.1| hypothetical protein PRUPE_ppa018854mg [Prunus persica]
Length=350

 Score =   177 bits (450),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 114/359 (32%), Positives = 188/359 (52%), Gaps = 17/359 (5%)
 Frame = +1

Query  229   GEVVPCMAMVMVEACTIFLTIMASTAMAKFGTNPFVFVVYTNALASIFLVPYSIIYHRRD  408
             G  V  +A+VM     +   I+   AM+  G + +  VVY+NAL+++ L P S I+HR +
Sbjct  4     GISVAFVALVMAVLAQVTSMILTKEAMS-IGLSEYTLVVYSNALSTLILTPSSFIFHRLE  62

Query  409   KAQEQlftfplllrlfflglIGVTISQNLAFVGLSYSSPIAACGTANIVPALSFILAIIL  588
             +      +F ++   F LG IG T +Q +   GL+Y+S        N++PA +FILA++ 
Sbjct  63    RPP---LSFYIVFSFFLLGFIG-TSAQLMGLAGLNYASATLNTTMLNLIPAFTFILALLF  118

Query  589   RRTKIDWESGGSQARMIGALICTVGTISLIFYRGPVVNNYSPTFLHLSTTQFVFSSS---  759
             R  K++W S  SQA+  GA++   G   + FY+GP V       +H   +    S     
Sbjct  119   RMEKLNWRSSSSQAKSFGAVVSITGAFVVTFYKGPAV-------IHQRLSSDPLSGPCLF  171

Query  760   TNQQNWVLGCLCFIAASLTLSIWNIIQVGTIRIYPQVMKIMCVYSLFGTVQSGALSLFIV  939
             + + +WVLG     A +   S+W I+Q   ++ YP V+ +   Y  F T+Q+   SL +V
Sbjct  172   SPKSHWVLGGSLLAAEAFMSSLWIILQALILKKYPAVLILASFYCFFVTIQAALASLILV  231

Query  940   RDLNAWRLGLNFQLIVILLTAIFGSIIRSSVQLWCMRMKGPSFPLIFKPVGIVVASSCGC  1119
             +D +AW L  N  L  +L +A+ G+ +R+S   WC++  GP +  +FKP+ +VVA     
Sbjct  232   KDPSAWSLKPNIGLFAVLYSAVVGTALRTSAVAWCLQRTGPLYVSMFKPLAVVVADVIDV  291

Query  1120  LFFADTFHYGSMFSAFICGMGYYTTIWGQLKDEEIQQIKGSS--VSLPDEKVPLLQQSQ  1290
             +F     H GS+  A +   G+Y  IWG+ ++E++ +  G         E  PLLQ ++
Sbjct  292   IFLGQALHLGSLVGAAVIITGFYAVIWGKAREEKLHEDSGEGQWSESSSESTPLLQSAK  350



>gb|ABK25095.1| unknown [Picea sitchensis]
Length=392

 Score =   178 bits (452),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 105/354 (30%), Positives = 193/354 (55%), Gaps = 8/354 (2%)
 Frame = +1

Query  241   PCMAMVMVEACTIFLTIMASTAMAKFGTNPFVFVVYTNALASIFLVPYSIIYHRRDKAQE  420
             P +AM+ ++     + I+   ++ + G N FV VVY +A A++ L P++    R+ + + 
Sbjct  10    PYVAMISLQFGYAGMNIITKVSLNR-GMNHFVLVVYRHAAATVVLAPFAFFIERKVRPK-  67

Query  421   QlftfplllrlfflglIGVTISQNLAFVGLSYSSPIAACGTANIVPALSFILAIILRRTK  600
                TF +  ++F LGL+G  I QN  ++GL  +SP  AC  +N++PA++F++A++ R   
Sbjct  68    --LTFSIFCQIFVLGLLGPVIDQNFYYLGLKLTSPTYACALSNVLPAMTFVIALLFRMEN  125

Query  601   IDWESGGSQARMIGALICTVGTISLIFYRGPVVNNYSPTFLHLSTTQFVFSSSTNQQNWV  780
             ++ +   SQA+++G ++C  G + +  Y+GP+V        H  + Q   +++ + +NW+
Sbjct  126   VNIKKLRSQAKIVGTIVCVGGAMLMTLYKGPIVKMVWSA--HHQSPQTSAAAAIDNKNWI  183

Query  781   LGCLCFIAASLTLSIWNIIQVGTIRIYPQVMKIMCVYSLFGTVQSGALSLFIVRDLNAWR  960
             +G +  IAA+L  S   I+Q   ++ Y   + +  +    GT+Q+  LSL +VRD + W 
Sbjct  184   IGSVLIIAATLAWSGLFILQAAVLKKYSAQLSLATLICFLGTLQATVLSLAVVRDPSQWA  243

Query  961   LGLNFQLIVILLTAIFGSIIRSSVQLWCMRMKGPSFPLIFKPVGIVVASSCGCLFFADTF  1140
             LG +  L+  + + +  S I   VQ  CMR+KGP F   F P+ +++ +    +  A+  
Sbjct  244   LGWDLNLLTAVYSGVVASAIAYYVQGLCMRVKGPVFATAFSPLMMIIVAIMASIILAENI  303

Query  1141  HYGSMFSAFICGMGYYTTIWGQLKDEEIQQIKGSSVSLPDEKV--PLLQQSQDD  1296
               GS+    +  +G Y  +WG++KD +I   K S+  L + +V  P  Q   DD
Sbjct  304   FLGSVLGGVLIVIGLYAVLWGKVKDSKILTDKNSTEVLSNSQVMLPENQNKADD  357



>ref|XP_009349860.1| PREDICTED: WAT1-related protein At3g28050-like [Pyrus x bretschneideri]
Length=364

 Score =   177 bits (450),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 110/365 (30%), Positives = 190/365 (52%), Gaps = 12/365 (3%)
 Frame = +1

Query  217   KAAFGEVVPCMAMVMVEACTIFLTIMASTAMAKFGTNPFVFVVYTNALASIFLVPYSIIY  396
             ++ + +V+P  AMV +E   + L  +   A    G +  VFVVY+ ++A+  L+P   + 
Sbjct  6     RSCYRDVLPFTAMVTMECMNVGLNTLFKAATLN-GMSYHVFVVYSYSVAAFVLIPAPFV-  63

Query  397   HRRDKAQEQlftfplllrlfflglIGVTISQNLAFVGLSYSSPIAACGTANIVPALSFIL  576
              RR +    L    +   L     IG + SQ + + G++YSSP  A   +N+VPA +FIL
Sbjct  64    SRRSRVLPPLNFSIMSKILLLGL-IGSS-SQIMGYTGINYSSPTLASAISNLVPAFTFIL  121

Query  577   AIILRRTKIDWESGGSQARMIGALICTVGTISLIFYRGPVV---NNYSPTFLHLSTTQFV  747
             AII+R       S  SQA+++G ++   G   +  Y+GP +   N      LH      +
Sbjct  122   AIIVRLESTALRSRSSQAKILGTIVSLAGAFVVTLYKGPPIVFANQSQSISLH---QPLL  178

Query  748   FSSSTNQQNWVLGCLCFIAASLTLSIWNIIQVGTIRIYPQVMKIMCVYSLFGTVQSGALS  927
              S      NW++G L   A  + + +W I+Q   ++ YP  + ++  Y++     S A++
Sbjct  179   NSPPPTNSNWIIGGLLLTAEYILVPLWYIVQAQIMKDYPNELTVIFFYNVCVVAVSAAVA  238

Query  928   LFIVRDLNAWRLGLNFQLIVILLTAIFGSIIRSSVQLWCMRMKGPSFPLIFKPVGIVVAS  1107
             L    + +AW+L  +  L+ IL + +FGS + ++V  W +R+KGP +  +FKP+ + +A 
Sbjct  239   LITEPNSSAWKLRPDIALLSILCSGLFGSFLNNAVHTWVLRLKGPVYVTMFKPLSMAIAV  298

Query  1108  SCGCLFFADTFHYGSMFSAFICGMGYYTTIWGQLKDEEIQQIKGSSVSLPD--EKVPLLQ  1281
               G +F  DT H GS+  A I   G+Y  +WG+ K+E  ++   +S+  P    K PLLQ
Sbjct  299   VLGVVFLHDTLHLGSLVGATIISFGFYAVLWGKTKEEVGEEPVATSLESPSTTHKAPLLQ  358

Query  1282  QSQDD  1296
               +++
Sbjct  359   NYKNE  363



>gb|KEH24884.1| nodulin MtN21/EamA-like transporter family protein [Medicago 
truncatula]
Length=363

 Score =   177 bits (448),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 108/327 (33%), Positives = 181/327 (55%), Gaps = 10/327 (3%)
 Frame = +1

Query  319   GTNPFVFVVYTNALASIFLVPYSIIYHRRDKAQEQlftfplllrlfflglIGVTISQNLA  498
             G N  VFV Y  A+A+ FL+P  I + RR        +F ++ ++  LG IG +  Q + 
Sbjct  38    GMNNHVFVAYAYAVATSFLLP--ITFFRRRSRVVHPLSFSIICKIVLLGAIGSS-CQIMG  94

Query  499   FVGLSYSSPIAACGTANIVPALSFILAIILRRTKIDWESGGSQARMIGALICTVGTISLI  678
             ++ ++YSSP  +    N+VPA +F+LA+I R  K+  +S  S A+++G++I  VG   L 
Sbjct  95    YIAINYSSPTLSAAIGNLVPAFTFMLAVIFRMEKLAAKSRSSNAKILGSIISIVGAFVLT  154

Query  679   FYRGPVVNNYSPTFLHLSTTQFVFSSSTNQQNWVLGCLCFIAASLTLSIWNIIQVGTIRI  858
             FY+GP + + S      S  Q +    +   +WV+  +      L  S+W I+ V  ++ 
Sbjct  155   FYKGPSIMHSS------SLHQPIGFLKSVDSSWVIAGILLTVEYLMFSLWYILLVHVLKE  208

Query  859   YPQVMKIMCVYSLFGTVQSGALSLFIVRDLNAWRLGLNFQLIVILLTAIFGSIIRSSVQL  1038
             +P    ++ +YS+  T+ S  ++L  V + +AW++GLN  LI I+ + I G +I + V  
Sbjct  209   FPDEPTLVLLYSITATILSTVVALLSVPNASAWKIGLNLSLISIVSSGILGKLIGNIVYA  268

Query  1039  WCMRMKGPSFPLIFKPVGIVVASSCGCLFFADTFHYGSMFSAFICGMGYYTTIWGQLKDE  1218
             W MR+KG  +   FKP+ IV++ +   +F  DT H GS+  A I  +G Y  +WG+ + E
Sbjct  269   WSMRLKGAVYVTSFKPLQIVISVALSVIFLGDTLHVGSIIGALIISIGLYAVMWGKSR-E  327

Query  1219  EIQQIKGSSVSLPDEKVPLLQQSQDDS  1299
             EI++  GSS S   +  PLLQ  + ++
Sbjct  328   EIEEDVGSSESPSTDNAPLLQSCRIET  354



>ref|XP_006355962.1| PREDICTED: WAT1-related protein At3g28050-like [Solanum tuberosum]
Length=349

 Score =   176 bits (447),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 109/371 (29%), Positives = 193/371 (52%), Gaps = 27/371 (7%)
 Frame = +1

Query  205   AMEVKAAFGEVVPCMAMVMVEACTIFLTIMASTAMAKFGTNPFVFVVYTNALASIFLVPY  384
             AME+K A    +P + M   +   + L I+   AM+   TN F FV Y+N LA++ L+P 
Sbjct  2     AMEMKVA----LPYIGMASTQFAQVGLMIVGKKAMSAGMTN-FTFVFYSNTLAALILLP-  55

Query  385   SIIYHRRDKAQEQlftfplllrlfflglIGVTISQNLAFVGLSYSSPIAACGTANIVPAL  564
             S+ ++R  +             L     +G + +Q   + G++Y+S   A    N++P  
Sbjct  56    SLFFYRSTRPPLNFSLICWFFLLGV---LGCS-AQLTGYTGINYTSASFASAMLNLIPGF  111

Query  565   SFILAIILRRTKIDWESGGSQARMIGALICTVGTISLIFYRGPVV----NNYSPTFLHLS  732
             +FILA+I R  K+D  S  +  + IG ++   G  +   Y+GP +    ++    +LH  
Sbjct  112   TFILAVIFRMEKLDCRSTSTLIKSIGTIVSIAGAFTATLYKGPQILLTSSSKPQNYLHFQ  171

Query  733   TTQFVFSSSTNQQNWVLGCLCFIAASLTLSIWNIIQVGTIRIYPQVMKIMCVYSLFGTVQ  912
              T           +W++G L  +   +  S++ I+Q   ++ YP  + ++  Y  F ++ 
Sbjct  172   ET-----------DWIIGGLYLVVDCVVSSLYLIVQASVLQKYPVELIVVFFYCFFASII  220

Query  913   SGALSLFIVRDLNAWRLGLNFQLIVILLTAIFGSIIRSSVQLWCMRMKGPSFPLIFKPVG  1092
             S  +SLF+ R+LNAW L    +L  +L + IFGS  + SV  WC+R KGP F  +F P+G
Sbjct  221   SAIVSLFMDRNLNAWLLQPGTRLFAVLYSGIFGSAFQVSVMFWCIRRKGPLFVAMFHPLG  280

Query  1093  IVVASSCGCLFFADTFHYGSMFSAFICGMGYYTTIWGQLKDEEIQQIKGSSVSLPDEKVP  1272
             IV+A++ G +F  D F+ GS+  + I  +G+Y  +WG+ K++++ + K +     + K P
Sbjct  281   IVIAAALGIIFLGDIFYLGSLMGSIIIVVGFYAVMWGKTKEDKVDEDKLTRNI--NSKSP  338

Query  1273  LLQQSQDDSPV  1305
             LL+    ++ +
Sbjct  339   LLEIKDAETKI  349



>ref|XP_010653215.1| PREDICTED: WAT1-related protein At5g40240-like isoform X2 [Vitis 
vinifera]
Length=264

 Score =   174 bits (440),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 92/263 (35%), Positives = 143/263 (54%), Gaps = 6/263 (2%)
 Frame = +1

Query  499   FVGLSYSSPIAACGTANIVPALSFILAIILRRTKIDWESGGSQARMIGALICTVGTISLI  678
             FVG+ YSSP  A    ++VPA +FILAII R  K+D ++G  +A+ IG ++  +G + + 
Sbjct  4     FVGIRYSSPTLASAMTDLVPAFTFILAIISRMEKLDLKAGSCRAKCIGTIVSIIGALIVT  63

Query  679   FYRGPVVNNYSPTFLHLSTTQFVFSSSTNQQNWVLGCLCFIAASLTLSIWNIIQVGTIRI  858
              Y+GP +   S TF  L          +   NWV+G      ++++++++ ++Q   IR 
Sbjct  64    IYKGPQIAFASSTFKILDENL-----RSQISNWVIGGFLLAISAVSIALFYVVQTSIIRD  118

Query  859   YPQVMKIMCVYSLFGTVQSGALSLFIVRDLNAWRLGLNFQLIVILLTAIFGSIIRSSVQL  1038
             YP  + +  +  +F T+QS  +SL   RD +AWRL  + +LI +  +A+     R +   
Sbjct  119   YPAELMLTFICHIFVTMQSSIVSLIAERDPSAWRLKPDVELIAVGYSAVLVLAFRGTAHA  178

Query  1039  WCMRMKGPSFPLIFKPVGIVVASSCGCLFFADTFHYGSMFSAFICGMGYYTTIWGQLKDE  1218
             W +  KGP F  +FKPV IV+A   G  F  D  H GS+  A I   G+YT +WG+ K E
Sbjct  179   WVLHKKGPVFVAMFKPVAIVIAVVMGVTFLGDVLHLGSVIGAAIIAFGFYTVMWGKAK-E  237

Query  1219  EIQQIKGSSVSLPDEKVPLLQQS  1287
             EI+ +  S +     K PLLQ  
Sbjct  238   EIEDMTTSGIDSSSHKDPLLQNK  260



>ref|XP_006586196.1| PREDICTED: WAT1-related protein At5g40240-like isoform X1 [Glycine 
max]
 gb|KHN01840.1| Auxin-induced protein 5NG4 [Glycine soja]
Length=367

 Score =   176 bits (447),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 111/361 (31%), Positives = 193/361 (53%), Gaps = 12/361 (3%)
 Frame = +1

Query  232   EVVPCMAMVMVEACTIFLTIMASTAMAKFGTNPFVFVVYTNALASIFLVPYSIIYHRRDK  411
             EV+P  AMV VE   + + ++   A  K G + + F+ Y+ A++++FL+       R  +
Sbjct  10    EVLPFTAMVAVECTNVGVNVLFKAATEK-GLSYYAFIAYSFAVSTLFLLLPLPFVFRWSR  68

Query  412   AQEQlftfplllrlfflglIGVTISQNLAFVGLSYSSPIAACGTANIVPALSFILAIILR  591
                 L    +         IG+T +Q   + GL Y+SP  A   +N++PA +FILAII R
Sbjct  69    GLPPLNLSLIFRIFLLGV-IGLT-AQLCGYKGLKYTSPTLASALSNLIPAFTFILAIIFR  126

Query  592   RTKIDWESGGSQARMIGALICTVGTISLIFYRGPVV-NNYSPTFLHLSTTQFVFSSSTNQ  768
               K+   S  + A+++G+L+   G + ++ Y+GP++ +  SP     S T      ST+Q
Sbjct  127   MEKVALRSPSTMAKILGSLVSISGALIVVLYKGPIILSTSSP---QPSPTTDSPMDSTSQ  183

Query  769   QNWVLGCLCFIAASLTLSIWNIIQVGTIRIYPQVMKIMCVYSLFGTVQSGALSLFIVRDL  948
              NWVLG        L + IW I+Q   ++ YP    ++ +Y+L GT+ S  + L +  +L
Sbjct  184   TNWVLGGSLLAIEFLLVPIWYIVQTNIMKQYPAEFIVVFLYNLTGTLISTPICLLLEANL  243

Query  949   NAWRLGLNFQLIVILLTAIFGSIIRSSVQLWCMRMKGPSFPLIFKPVGIVVASSCGCLFF  1128
             ++W++  +  LI I+ +  F + + S V  W + +KGP +  IFKP+ IVVA++   +F 
Sbjct  244   SSWKINCDITLIAIIYSGFFSTGLSSLVHTWGLHLKGPVYISIFKPLSIVVAAALSVIFL  303

Query  1129  ADTFHYGSMFSAFICGMGYYTTIWGQLKDEEIQQIKGSSVSLP-DEKVPLLQ----QSQD  1293
              D  ++G++  A I   G+Y  +WG+ K+EE+  +    +  P + K PLLQ    + +D
Sbjct  304   GDALYFGTVVGAVILSFGFYAVLWGKAKEEELTVVDFDDIRPPSNTKSPLLQSYKVKDED  363

Query  1294  D  1296
             +
Sbjct  364   N  364



>ref|XP_004309501.1| PREDICTED: auxin-induced protein 5NG4-like [Fragaria vesca subsp. 
vesca]
Length=352

 Score =   176 bits (446),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 98/327 (30%), Positives = 171/327 (52%), Gaps = 25/327 (8%)
 Frame = +1

Query  319   GTNPFVFVVYTNALASIFLVPYSIIYHRRDKAQEQlftfplllrlfflglIGVTISQNLA  498
             G  P VFVVY + +A   L P++ +  R+   Q    TF +  ++F L L G TI  N+ 
Sbjct  22    GLKPVVFVVYRHVMAMFLLAPFAYVLERK---QRPSLTFSIAAKVFVLTLFGTTIHLNVY  78

Query  499   FVGLSYSSPIAACGTANIVPALSFILAIILRRTKIDWESGGSQARMIGALICTVGTISLI  678
             + GL+Y+SP  AC  +NIVP L+F++A++LR   ++ +S   QA+++G L+C  G++   
Sbjct  79    YTGLAYTSPTVACALSNIVPTLTFLMAVLLRMENLNIKSVRGQAKVVGTLLCICGSLIFT  138

Query  679   FYRG---------PVVNNYSPTFLHLSTTQFVFSSSTNQQNWVLGCLCFIAASLTLSIWN  831
             F++G         P++  YS    H              +NW+ G    + + +    W 
Sbjct  139   FWKGYLFKGLVERPLLTIYSTELKH------------GSENWIKGSALILISQIVWCSWL  186

Query  832   IIQVGTIRIYPQVMKIMCVYSLFGTVQSGALSLFIVRDLNAWRLGLNFQLIVILLTAIFG  1011
             I+Q    R+YP  + +  +   F ++QS  +++F  RD  +WR+  N QL+ I+ + +  
Sbjct  187   ILQAVVTRVYPAPLSLTTLICFFASLQSSIVAMFFARDQASWRIDTNVQLLTIVYSGVVS  246

Query  1012  SIIRSSVQLWCMRMKGPSFPLIFKPVGIVVASSCGCLFFADTFHYGSMFSAFICGMGYYT  1191
             S +   +Q WC+  KGP F  +F P+ +++ +      FA+ FH GS+  AF+  +G Y+
Sbjct  247   SALVYYLQTWCISYKGPVFTAMFSPLQVIIVALFSAFAFAERFHVGSLIGAFLIIVGLYS  306

Query  1192  TIWGQLKDEEIQQI-KGSSVSLPDEKV  1269
              +WG+  D  +  + +     L D+KV
Sbjct  307   FLWGKKTDGLVAAVTENEKGVLNDDKV  333



>ref|XP_006483800.1| PREDICTED: WAT1-related protein At3g28050-like isoform X1 [Citrus 
sinensis]
Length=350

 Score =   176 bits (446),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 114/358 (32%), Positives = 187/358 (52%), Gaps = 16/358 (4%)
 Frame = +1

Query  235   VVPCMAMVMVEACTIFLTIMASTAMAKFGTNPFVFVVYTNALASIFLVPYSIIYHRRDKA  414
             + P + MVM E   + L      AM+  G +  VFV Y+ A AS+ L+P S+++HR   +
Sbjct  6     LAPVIGMVMAECAQVGLMFAGKAAMSD-GMSNLVFVFYSKAFASLVLLPASLLFHR---S  61

Query  415   QEQlftfplllrlfflglIGVTISQNLAFVGLSYSSPIAACGTANIVPALSFILAIILRR  594
             +    T P+L   F LG +G T SQ     G+ YSSP  +    N+VP  +FILAII R 
Sbjct  62    RIPPLTLPILSAFFLLGFLG-TSSQFFGNAGIYYSSPTLSTAMLNLVPGFTFILAIIFRM  120

Query  595   TKIDWESGGSQARMIGALICTVGTISLIFYRGP--VVNNYSPTFLHLSTTQFVFSSSTNQ  768
              K+DW S  S A+ +G ++   G   + +Y+G   ++ +  P   +LS   FV      Q
Sbjct  121   EKLDWRSSSSLAKSVGTIVLITGAFIMTYYKGTHLLMTSLPP---NLSLQFFV-----PQ  172

Query  769   QNWVLGCLCFIAASLTLSIWNIIQVGTIRIYPQVMKIMCVYSLFGTVQSGALSLFIVRDL  948
              NWV+G L      +  S W I+Q   ++ +     ++  Y  F  +QS    L + RDL
Sbjct  173   TNWVVGGLLLAVDCVFTSAWLIVQASILKKFSAEFIVVFFYCFFVAIQSAIFCLVMERDL  232

Query  949   NAWRLGLNFQLIVILLTAIFGSIIRSSVQLWCMRMKGPSFPLIFKPVGIVVASSCGCLFF  1128
             ++W L    +L+ +L +A+FGS  +  V  WC+   GP F  +FKP+G++++++ G +F 
Sbjct  233   SSWSLKPGVRLVAVLYSAVFGSAFQVGVCTWCLHRTGPVFVAMFKPLGVIISAAVGTIFL  292

Query  1129  ADTFHYGSMFSAFICGMGYYTTIWGQLKDEEIQQIKG-SSVSLPDEKVPLLQQSQDDS  1299
              +T + G    A +   G+Y+ +WG+ K+       G  S+    +K PLLQ + +++
Sbjct  293   GETVYLGRFIGAAVIVTGFYSVMWGKAKEGNSGVETGVRSLESSSQKDPLLQNNFEET  350



>ref|XP_003602166.1| Auxin-induced protein 5NG4 [Medicago truncatula]
 gb|AES72417.1| nodulin MtN21/EamA-like transporter family protein [Medicago 
truncatula]
Length=345

 Score =   176 bits (445),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 109/355 (31%), Positives = 187/355 (53%), Gaps = 17/355 (5%)
 Frame = +1

Query  238   VPCMAMVMVEACTIFLTIMASTAMAKFGTNPFVFVVYTNALASIFLVPYSIIYHRRDKAQ  417
             VP + M++ E   + L I++   M++ G   F+F+ Y+N +A++ L+P S   HR    Q
Sbjct  6     VPFVGMIIAECIQVALIILSKQVMSQ-GMTSFIFIFYSNTIAALVLLPSSFFIHRF---Q  61

Query  418   EQlftfplllrlfflglIGVTISQNLAFVGLSYSSPIAACGTANIVPALSFILAIILRRT  597
                 TF  L   F LGL+G  ++Q   + G++YSS   A    N+VP  +FILA++ R  
Sbjct  62    RPPITFSTLSGFFILGLLGY-LAQVFGYAGINYSSSTLATAMLNLVPGFTFILAVLFRME  120

Query  598   KIDWESGGSQARMIGALICTVGTISLIFYRGP-VVNNYSPTFLHLSTTQFVFSSSTNQQN  774
             ++DW S  S A+ +G ++   G      Y+G  ++   SP      + Q +FS      +
Sbjct  121   ELDWRSPSSLAKSLGTIVSIAGAFIATLYKGAALLKGPSPANF---SQQPLFS---QDSD  174

Query  775   WVLGCLCFIAASLTLSIWNIIQVGTIRIYPQVMKIMCVYSLFGTVQSGALSLFIVRDLNA  954
             W+LG L   A  +  S + I+Q   ++ YP  + ++  Y  F  + S    L + RD++A
Sbjct  175   WILGGLFLAADCVMASSFTIVQASILKKYPAGLIVVFFYCFFVAILSAVTCLAVERDISA  234

Query  955   WRLGLNFQLIVILLTAIFGSIIRSSVQLWCMRMKGPSFPLIFKPVGIVVASSCGCLFFAD  1134
             W L    +L+ +L + +FGS  +  V  WC+   GP F  +FKP+GIV++   G LF  D
Sbjct  235   WSLEPKLRLLSVLYSGVFGSAFQVGVTTWCLHQTGPVFVSMFKPIGIVISVVIGVLFLGD  294

Query  1135  TFHYGSMFSAFICGMGYYTTIWGQLKDEEIQQIKGSSVSLPDEKVPLLQQSQDDS  1299
              F+ GS+  A +  +G+Y+ +WG+ KD E + ++        ++ PLL+++  + 
Sbjct  295   AFYLGSLIGATVIVIGFYSVLWGKSKDIEARSLESRG-----KQTPLLKENSSED  344



>gb|KDO66260.1| hypothetical protein CISIN_1g019712mg [Citrus sinensis]
Length=337

 Score =   175 bits (444),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 106/348 (30%), Positives = 180/348 (52%), Gaps = 14/348 (4%)
 Frame = +1

Query  253   MVMVEACTIFLTIMASTAMAKFGTNPFVFVVYTNALASIFLVPYSIIYHRRDKAQEQlft  432
             M +VE   + +  +   AM+  G + FV+VVY NAL +  L+ Y I    R K    + T
Sbjct  1     MALVEIGEVGMITLGKAAMSS-GMSNFVYVVYYNALGTFILLHYFIYNTYRSKGP--VLT  57

Query  433   fplllrlfflglIGVTISQNLAFVGLSYSSPIAACGTANIVPALSFILAIILRRTKIDWE  612
             F LL + F LG++G+ + Q  A  G+ YSSP  A    N++P ++F+LA+  R  K+   
Sbjct  58    FSLLCKFFMLGVLGICLVQIFAITGIKYSSPTLASAMGNLIPGITFLLAVFFRMEKVAIR  117

Query  613   SGGSQARMIGALICTVGTISLIFYRGPVVNNYSP---TFLHLSTTQFVFSSSTNQQNWVL  783
             S  SQA+++G ++   G   +  Y+GP +  +S    + + L  +++         NW L
Sbjct  118   SRSSQAKILGTVVSIAGAFIVSLYKGPPLLGFSSPSNSNIQLPVSEY--------SNWAL  169

Query  784   GCLCFIAASLTLSIWNIIQVGTIRIYPQVMKIMCVYSLFGTVQSGALSLFIVRDLNAWRL  963
             G L       + + W I Q   ++ YP  + ++     FGT+Q   +S+ + R+ +AW+L
Sbjct  170   GGLLLTVTCFSSATWKIFQAAVLKEYPDKINLVFFSCFFGTIQCAVVSIIVERNPSAWKL  229

Query  964   GLNFQLIVILLTAIFGSIIRSSVQLWCMRMKGPSFPLIFKPVGIVVASSCGCLFFADTFH  1143
                 Q   ++  AI G++IRSS+  WC++ KGP F  +FKP+G  +A     +F  +T H
Sbjct  230   QPGIQRTAVIYAAIVGTVIRSSIIAWCLQKKGPVFVALFKPLGTAIAVFMAVMFLGETPH  289

Query  1144  YGSMFSAFICGMGYYTTIWGQLKDEEIQQIKGSSVSLPDEKVPLLQQS  1287
              GS+    +   G+Y  IW Q K+  +      S+   ++K+P L+ +
Sbjct  290   LGSLIGTVVIAFGFYAVIWAQGKESNMTTGNVGSLESLNQKIPPLKNT  337



>gb|KHN48611.1| Auxin-induced protein 5NG4 [Glycine soja]
Length=281

 Score =   173 bits (439),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 106/316 (34%), Positives = 160/316 (51%), Gaps = 38/316 (12%)
 Frame = +1

Query  208   MEVKAAFGEVVPCMAMVMVEACTIFLTIMASTAMAKFGTNPFVFVVYTNALASIFLVPYS  387
             M VK    E  P +AM  VE   + L+ ++  AM++ G N FV V Y+NALA++ L+P  
Sbjct  1     MGVKRNLVEWTPFIAMATVECLDVELSTLSKAAMSR-GMNHFVLVGYSNALATLILLPSP  59

Query  388   IIYHRRDKAQEQlftfplllrlfflglIGVTISQNLAFVGLSYSSPIAACGTANIVPALS  567
                                          +T+ QN  F  + YSS      T+N+ PA++
Sbjct  60    FFIDSY-----------------------LTVMQNCVFTAIDYSSATLGSTTSNLSPAIT  96

Query  568   FILAIILRRTKIDWESGGSQARMIGALICTVGTISLIFYRGPVVNNY--SPTFLHLSTTQ  741
             F+LA+  R  K+   S  S+ ++IGA++   G + +  Y+G  +  +   P+ L      
Sbjct  97    FVLAVTPRMEKLKIGSSISKIKVIGAVLSISGALVVTLYKGSFIITFRIQPSLLD-----  151

Query  742   FVFSSSTNQQNWVLGCLCFIAASLTLSIWNIIQVGTIRIYPQVMKIMCVYSLFGTVQSGA  921
                       NWV+G L F  AS++ + WNI Q   ++ Y     I+  Y LFGT+QS  
Sbjct  152   -------ETSNWVIGGLVFAIASVSFAAWNITQAVILKEYSSQSTIIAYYCLFGTIQSEI  204

Query  922   LSLFIVRDLNAWRLGLNFQLIVILLTAIFGSIIRSSVQLWCMRMKGPSFPLIFKPVGIVV  1101
             LSLF+VRD N W++  N +LI I  +AI GS +  SV  WC++ KGP F  +FKP GI +
Sbjct  205   LSLFVVRDSNVWKISPNDKLICIFYSAIAGSAVTFSVTAWCIKRKGPVFVSMFKPAGIAI  264

Query  1102  ASSCGCLFFADTFHYG  1149
             A+    +F  +T H+G
Sbjct  265   AAFSSVVFLCETLHFG  280



>gb|AFK39191.1| unknown [Medicago truncatula]
Length=352

 Score =   176 bits (445),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 117/326 (36%), Positives = 177/326 (54%), Gaps = 13/326 (4%)
 Frame = +1

Query  313   KFGTNPFVFVVYTNALASIFLVPYSIIYHRRDKAQEQlftfplllrlfflglIGVTISQN  492
             K G N +V VVY+  L+SI L+P ++  +R   +Q    TF  L   F L LIG + +Q 
Sbjct  38    KDGMNKYVMVVYSMGLSSILLLPLALFINR---SQRPPLTFSALWSFFLLALIGSS-AQI  93

Query  493   LAFVGLSYSSPIAACGTANIVPALSFILAIILRRTKIDWESGGSQARMIGALICTVGTIS  672
             + + G+  SSP  A    N++PA +F+LA+I R  +I W    SQA+ IG ++   G   
Sbjct  94    MTYGGIELSSPTLASAMLNLIPAFTFVLALIFRMERIYWRHFSSQAKAIGTIVSMAGAFV  153

Query  673   LIFYRGPVVNNYSPTFLHLSTTQFVFSSSTNQQNWVLGCLCFIAASLTLSIWNIIQVGTI  852
             +I Y+GP +     + +  +T QF     +   NW+LG       SL  S+W I QV   
Sbjct  154   VILYKGPPILKIHSS-ISYNTLQF-----SPNLNWILGGFLCAGDSLLSSMWYIYQVSVT  207

Query  853   RIYPQVMKIMCVYSLFGTVQSGALSLFIVRDLNAWRLGLNFQLIVILLTAIFGSIIRSSV  1032
             + YP V+ I+    +F T+Q+G  +L +VRD +AW L L+  LIVIL  A+    IR  +
Sbjct  208   KKYPAVIVIVFFQVVFITIQTGVYALIVVRDPSAWELKLDMGLIVILYQAVAAIGIRYFL  267

Query  1033  QLWCMRMKGPSFPLIFKPVGIVVASSCGCLFFADTFHYGSMFSAFICGMGYYTTIWGQLK  1212
             Q W ++  GP F  +FKP+GI+     G +FF D F+ GS+  A I  +G+Y   WG+  
Sbjct  268   QTWSVQRAGPLFCAMFKPIGIIFTVFLGSIFFGDDFYLGSLIGAVIIVVGFYAVQWGKAS  327

Query  1213  DEEIQQIKG-SSVSLPDEKVPLLQQS  1287
             +E+++  KG  ++      VPLLQ  
Sbjct  328   EEKVE--KGIENLETQSNVVPLLQNK  351



>ref|XP_009348031.1| PREDICTED: WAT1-related protein At3g28050-like [Pyrus x bretschneideri]
Length=364

 Score =   176 bits (445),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 110/365 (30%), Positives = 190/365 (52%), Gaps = 12/365 (3%)
 Frame = +1

Query  217   KAAFGEVVPCMAMVMVEACTIFLTIMASTAMAKFGTNPFVFVVYTNALASIFLVPYSIIY  396
             ++ + +V+P  AMV +E   + L  +   A    G +  VFVVY+ ++A+  L+P   + 
Sbjct  6     RSCYRDVLPFTAMVTMECMNVGLNTLFKAATLN-GMSYHVFVVYSYSVAAFVLIPAPFV-  63

Query  397   HRRDKAQEQlftfplllrlfflglIGVTISQNLAFVGLSYSSPIAACGTANIVPALSFIL  576
              RR +    L    +   L     IG + SQ + + G++YSSP  A   +N+VPA +FIL
Sbjct  64    SRRSRVLPPLNFSIMSKILLLGL-IGSS-SQIMGYTGINYSSPTLASAISNLVPAFTFIL  121

Query  577   AIILRRTKIDWESGGSQARMIGALICTVGTISLIFYRGPVV---NNYSPTFLHLSTTQFV  747
             AII+R       S  SQA+++G ++   G   +  Y+GP +   N      LH      +
Sbjct  122   AIIVRLESTALRSRSSQAKILGTIVSLAGAFVVTLYKGPPIVFANQSQSISLH---QPLL  178

Query  748   FSSSTNQQNWVLGCLCFIAASLTLSIWNIIQVGTIRIYPQVMKIMCVYSLFGTVQSGALS  927
              S      NW++G L   A  + + +W I+Q   ++ YP  + ++  Y++     S A++
Sbjct  179   NSPPPTNSNWIIGGLLLTAEYILVPLWYIVQAQIMKDYPNELTVIFFYNVCVVAVSAAVA  238

Query  928   LFIVRDLNAWRLGLNFQLIVILLTAIFGSIIRSSVQLWCMRMKGPSFPLIFKPVGIVVAS  1107
             L    + +AW+L  +  L+ IL + +FGS + ++V  W +R+KGP +  +FKP+ + +A 
Sbjct  239   LITEPNSSAWKLRPDIALLSILCSGLFGSFLNNAVHTWVLRLKGPVYVTMFKPLSMAIAV  298

Query  1108  SCGCLFFADTFHYGSMFSAFICGMGYYTTIWGQLKDEEIQQIKGSSVSLPD--EKVPLLQ  1281
               G +F   T H GS+  A I   G+YT +WG+ K+E  ++   +S+  P    K PLLQ
Sbjct  299   VLGVVFLHATLHLGSLVGATIISFGFYTVLWGKTKEEVGEEPVANSLESPSTTHKAPLLQ  358

Query  1282  QSQDD  1296
               +++
Sbjct  359   NYKNE  363



>ref|XP_010320601.1| PREDICTED: WAT1-related protein At3g28050-like isoform X4 [Solanum 
lycopersicum]
Length=262

 Score =   172 bits (437),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 98/264 (37%), Positives = 149/264 (56%), Gaps = 15/264 (6%)
 Frame = +1

Query  499   FVGLSYSSPIAACGTANIVPALSFILAIILRRTKIDWESGGSQARMIGALICTVGTISLI  678
             +VG+SYSSP  A    N++P  +FILAI  R   I+W+S  S A+  G  +   G   L 
Sbjct  12    YVGISYSSPTLATAMLNLIPGFTFILAITFRMEVINWKSWSSYAKAFGTFVSIGGAFVLT  71

Query  679   FYRGPVVNNYSPTFLHLSTTQFVFSSSTNQQNWVLGCLCFIAASLTLSIWNIIQVGTIRI  858
             FY+GP + N      HL++T   FSS   QQNW+LG +     S++ S+W IIQ   ++I
Sbjct  72    FYKGPPIINQ-----HLTST---FSS---QQNWILGGVILACESMSTSLWYIIQASILKI  120

Query  859   YPQVMKIMCVYSLFGTVQSGALSLFIVRDLNAWRLGLNFQLIVILLTAIFGSIIRSSVQL  1038
             Y + M I+C+Y  F T+ S  +SL + R+ NAW + L+ +LI IL + I G   RS +  
Sbjct  121   YQEEMVIVCLYCFFVTIISTLISLVVERNTNAWIIYLDIRLIAILYSGIIGIAFRSCMTT  180

Query  1039  WCMRMKGPSFPLIFKPVGIVVASSCGCLFFADTFHYGSMFSAFICGMGYYTTIWGQLKDE  1218
             WC++   P F  +FKP  IV A   G   F D F+ GS+  +    +G+Y  +WG+ ++ 
Sbjct  181   WCLKKTDPLFVSMFKPFAIVFAILIGTFCFRDAFYLGSLVGSVTTVIGFYAVMWGKTQE-  239

Query  1219  EIQQIKGSSV-SLPDEKVPLLQQS  1287
               +  +G+++ +L +  VPLLQ  
Sbjct  240   --KYYEGNNLETLAENNVPLLQNE  261



>ref|XP_010528268.1| PREDICTED: WAT1-related protein At3g28050 [Tarenaya hassleriana]
Length=364

 Score =   176 bits (445),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 114/369 (31%), Positives = 197/369 (53%), Gaps = 13/369 (4%)
 Frame = +1

Query  208   MEVKAAFGEVVPCMAMVMVEACTIFLTIMASTAMAKFGTNPFVFVVYTNALASIFLVPYS  387
             ME K    EV+P  A+V++E   + L  +   A  + G +  VF+VY+ ALA++ L+P S
Sbjct  1     MERKYLKREVLPITALVIMECANVGLNTLFKAATLQ-GMDFHVFIVYSYALAALLLLP-S  58

Query  388   IIYHRRDKAQEQlftfplllrlfflglIGVTISQNLAFVGLSYSSPIAACGTANIVPALS  567
             I +  R +A   L    L   L     IG   S  + + G++YSSP  A   +N+ PA +
Sbjct  59    IFFSSRSRALPPLRFSILRKILLLGL-IGCC-SNMMGYTGINYSSPTLASAISNLTPAFT  116

Query  568   FILAIILRRTKIDWESGGSQARMIGALICTVGTISLIFYRGPVVNNYSPTFLHLSTTQFV  747
             F+LA++ R  ++ ++   S A+M+G  +   G   +  Y+GPVV   SP  + L  ++  
Sbjct  117   FLLAVLFRMEEVSFKRSSSVAKMLGTAVSITGAFVVTLYKGPVVIALSPPSISLRLSRL-  175

Query  748   FSSSTNQQNWVLGCLCFIAASLTLSIWNIIQVGTIRIYPQVMKIMCVYSLFGTVQSGALS  927
                 +   NW LG          + +W I+Q   +R YP  + ++C+YS   ++ +  ++
Sbjct  176   ---QSPNANWTLGAAFLTVEYFLVPLWYIVQTQIMREYPAELTVVCLYSSCVSLFTAIVT  232

Query  928   LFIVRDLNAWRLGL---NFQLIVILLTAIFGSIIRSSVQLWCMRMKGPSFPLIFKPVGIV  1098
             LF   + N+W + +   +  L  I+ + +FGS I +S+  W +R+KGP F  +FKP+ I 
Sbjct  233   LFTEGNNNSWSMWMLKPDIALASIICSGLFGSCINNSIHTWALRIKGPLFVAMFKPLSIA  292

Query  1099  VASSCGCLFFADTFHYGSMFSAFICGMGYYTTIWGQLKDEEIQQIKGSSVSLPD--EKVP  1272
             +A + G +F +D+ + GS+  A I  MG+YT +WG+ K+ E+ +   ++    D  +KVP
Sbjct  293   IAVAMGVIFLSDSLYLGSLVGATIITMGFYTVMWGKAKEAEMAEGCNNNEGCLDSSQKVP  352

Query  1273  LLQQSQDDS  1299
             LL+  + D 
Sbjct  353   LLRSCKSDD  361



>ref|XP_004238690.2| PREDICTED: WAT1-related protein At1g21890-like [Solanum lycopersicum]
Length=707

 Score =   181 bits (459),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 111/395 (28%), Positives = 196/395 (50%), Gaps = 31/395 (8%)
 Frame = +1

Query  145   KQHQKRNQ*SSRRPPEKMLAAMEVKAAFGEVVPCMAMVMVEACTIFLTIMASTAMAKFGT  324
              ++    + SS       +AAME+K    E +P + M   +   + L I+   AM+   T
Sbjct  336   DKNDDDPESSSSETRHSKMAAMEMKVKMKEALPYIGMASTQFAQVGLMIVGKKAMSAGMT  395

Query  325   NPFVFVVYTNALASIFLVPYSIIYHRRDKAQEQlftfplllrlfflglIGVTISQNLAFV  504
             N F FV Y+N LA++ L+P S  ++R  +             L     +G + +Q   + 
Sbjct  396   N-FTFVFYSNTLAALILLP-SFFFYRSTRPPLNFSLISEFFLLGV---LGCS-AQLTGYT  449

Query  505   GLSYSSPIAACGTANIVPALSFILAIILRRTKIDWESGGSQARMIGALICTVGTISLIFY  684
             G++Y+S   A    N++P  +FILA+I R  K+D  S  +  + IG ++   G  +   Y
Sbjct  450   GINYTSASFASAMLNLIPGFTFILAVIFRMEKLDCRSTSTLIKSIGTIVSIAGAFTATLY  509

Query  685   RGPVVNNYSPTFLHLSTTQFVFSSSTNQQN--------WVLGCLCFIAASLTLSIWNIIQ  840
             +GP               Q + +SS+  QN        W++G L  +   +  S++ I+Q
Sbjct  510   KGP---------------QILLTSSSKPQNYLHFQETDWIIGGLYLVVDCVVSSLYLIVQ  554

Query  841   VGTIRIYPQVMKIMCVYSLFGTVQSGALSLFIVRDLNAWRLGLNFQLIVILLTAIFGSII  1020
                ++ YP  + ++  Y  F ++ S  +SLF+  + NAW L    +L  +L + IFGS  
Sbjct  555   ASVLKKYPVELIVVFFYCFFASILSVTVSLFMDNNSNAWLLQPGTRLFAVLYSGIFGSAF  614

Query  1021  RSSVQLWCMRMKGPSFPLIFKPVGIVVASSCGCLFFADTFHYGSMFSAFICGMGYYTTIW  1200
             + SV  WC+R KGP F  +F P+GIV+A++ G +F  D F+ GS+  + +  +G+Y  +W
Sbjct  615   QVSVMFWCIRRKGPLFVAMFHPLGIVIAAALGIIFLGDIFYLGSLVGSIVIVVGFYAVMW  674

Query  1201  GQLKDEEIQQIKGSSVSLPDEKVPLLQQSQDDSPV  1305
             G+ K++ + + K +     + K PLL+    ++ +
Sbjct  675   GKTKEDMVDEDKLTRNI--NSKAPLLEIKDAETKI  707


 Score =   170 bits (431),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 106/358 (30%), Positives = 185/358 (52%), Gaps = 23/358 (6%)
 Frame = +1

Query  235   VVPCMAMVMVEACTIFLTIMASTAMAKFGTNPFVFVVYTNALASIFLVPYSIIYHRRDKA  414
             VVP +AM++ +   + L ++A  AM+  G   F +  Y++A +++ L+P S   HR    
Sbjct  6     VVPFIAMIVQQLAQVGLAVVAKGAMST-GMTTFTYTFYSSAFSTLLLIPISFFLHR----  60

Query  415   QEQlftfplllrlfflglIGVT--ISQNLAFVGLSYSSPIAACGTANIVPALSFILAIIL  588
                         L+   L+G+   + Q L  +GL YSSP+ +     + P  +FILA+IL
Sbjct  61    --SAIPPLWPTFLYGFFLLGILGFLMQVLGLLGLQYSSPLLSTAILQLCPGFTFILAVIL  118

Query  589   RRTKIDWESGGSQARMIGALICTVGTISLIFYRGPVVNNYSPTFLHLSTTQFVFSSSTNQ  768
             R    +++S  + A+ IG L+  +G      Y+GP V   +P    L+T        T  
Sbjct  119   RMETFEYKSLSTMAKTIGTLVAIIGAFVATLYKGPQVFGINP----LNTIL------TTP  168

Query  769   QNWVLGCLCFIAASLTLSIWNIIQVGTIRIYPQVMKIMCVYSLFGTVQSGALSLFIVRDL  948
               W +G L  +  S+  S++ I Q   ++ YP  + +M  YS   T+     SL + RDL
Sbjct  169   SAWAIGGLLTMICSIIASLFIISQAFVLKKYPAELILMLFYSCCVTILCAVFSLIVERDL  228

Query  949   NAWRLGLNFQLIVILLTAIFGSIIRSSVQLWCMRMKGPSFPLIFKPVGIVVASSCGCLFF  1128
             N+W L  + +L+ ++ + +FG++ +  +  WC+R KGP F ++F P+GIV+A +   +F 
Sbjct  229   NSWSLSPHSRLMAVVYSGLFGNVFQVCIGSWCVRRKGPLFVVMFHPLGIVIAMAAS-IFM  287

Query  1129  ADTFHYGSMFSAFICGMGYYTTIWGQLKDEEIQQIKGSSVSLPDEKVPLLQQSQDDSP  1302
              +  H GS+  + I  +G+Y+ +WGQ K+   ++    ++   + K+P LQ   DD P
Sbjct  288   GEIIHVGSLVGSIIIVIGFYSVMWGQSKEWTKKE---KNLRSNNNKIPFLQDKNDDDP  342



>gb|KEH16738.1| nodulin MtN21/EamA-like transporter family protein [Medicago 
truncatula]
Length=273

 Score =   172 bits (436),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 85/270 (31%), Positives = 156/270 (58%), Gaps = 9/270 (3%)
 Frame = +1

Query  493   LAFVGLSYSSPIAACGTANIVPALSFILAIILRRTKIDWESGGSQARMIGALICTVGTIS  672
             + + G+S+SSP  +   +N+VPA +F+LAII R  K+  +S  SQA+++G ++   G   
Sbjct  1     MGYTGISFSSPTLSSAISNLVPAFTFLLAIIFRMEKVAIKSLSSQAKVVGTIVSISGAFI  60

Query  673   LIFYRGPVVNNYSPTFLHLSTTQFVFSS--STNQQNWVLGCLCFIAASLTLSIWNIIQVG  846
             +  Y GP      P  + L ++  +  +  S++ Q+W +G L   A  + + +W I+QV 
Sbjct  61    VTLYIGP------PIMIALRSSNSLHQTLKSSSDQSWAIGGLLLTAEYILVPLWYIVQVQ  114

Query  847   TIRIYPQVMKIMCVYSLFGTVQSGALSLFIVRDLNAWRLGLNFQLIVILLTAIFGSIIRS  1026
              +++YP  + ++  Y+L  ++ +G + +    + +AW++G +  L  IL + IFGS + +
Sbjct  115   IMKVYPNELTVIFYYNLCVSIIAGIVGVISEPNASAWKIGFDTSLASILCSGIFGSFLNN  174

Query  1027  SVQLWCMRMKGPSFPLIFKPVGIVVASSCGCLFFADTFHYGSMFSAFICGMGYYTTIWGQ  1206
             +V  + +R+KG  +  +FKP+ IV+A + G +F  DT H GS+  A I  +G+YT +WG+
Sbjct  175   TVHAYVLRIKGAVYVAMFKPLSIVIAVAMGVVFLGDTLHLGSLIGATIISIGFYTVMWGK  234

Query  1207  LKDEEIQQIKGSSVSLPDEKVPLLQQSQDD  1296
              K+E ++ + G       + VPLLQ  + D
Sbjct  235   AKEEVVEDVSGHETQ-TTQNVPLLQSYETD  263



>ref|XP_004304598.1| PREDICTED: auxin-induced protein 5NG4-like [Fragaria vesca subsp. 
vesca]
Length=320

 Score =   173 bits (439),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 100/322 (31%), Positives = 174/322 (54%), Gaps = 13/322 (4%)
 Frame = +1

Query  319   GTNPFVFVVYTNALASIFLVPYSIIYHRRDKAQEQlftfplllrlfflglIGVTISQNLA  498
             G + +V VVY+ ALA++FL+P  I        Q+++     LL   FL  +  + +  LA
Sbjct  4     GMSSYVLVVYSTALATVFLLPCFIF-------QKKISLALSLLGGQFLLGLIGSSNMLLA  56

Query  499   FVGLSYSSPIAACGTANIVPALSFILAIILRRTKIDWESGGSQARMIGALICTVGTISLI  678
             + G+++SSP  A    N +P  +FILAI+ R  K+D      QA+++G ++   G   +I
Sbjct  57    YNGINFSSPTVASAMGNCIPIFTFILAIVFRMEKLDLRRSSCQAKVLGTIVSVSGAFVVI  116

Query  679   FYRGPVVNNYSPTFLHLSTTQFVFSSSTNQQNWVLGCLCFIAASLTLSIWNIIQVGTIRI  858
              Y+G V+  +SP+         +   S     WV+G L    AS+  S WNI+Q   ++ 
Sbjct  117   LYKGSVI--FSPSNSPHQNLMMILQQS---NKWVIGGLMLAMASILKSSWNILQTSIVKN  171

Query  859   YPQVMKIMCVYSLFGTVQSGALSLFIVRDLNAWRLGLNFQLIVILLTAIFGSIIRSSVQL  1038
              P ++ ++  Y+ F T+QS  +SLF+  + NAW L  + ++I I+ +AIFGS+    ++ 
Sbjct  172   CPSMITVLFFYTFFVTLQSTVISLFLESNPNAWVLRPDIEMISIVFSAIFGSLFHIGIET  231

Query  1039  WCMRMKGPSFPLIFKPVGIVVASSCGCLFFADTFHYGSMFSAFICGMGYYTTIWGQLKDE  1218
             WC+  KGP F  +F+P+ + +++    +F  +  H GS+  + +  +G+Y  +W Q+K+ 
Sbjct  232   WCLHQKGPVFVAMFRPLAVPISAVMVVIFLGEALHLGSVIGSVMIAIGFYAMMWAQVKES  291

Query  1219  EIQQIKGSSVSL-PDEKVPLLQ  1281
                 I+    +L   +K PLLQ
Sbjct  292   SSSAIENEVPNLAATQKTPLLQ  313



>ref|XP_003588861.1| Auxin-induced protein 5NG4 [Medicago truncatula]
Length=361

 Score =   174 bits (442),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 104/366 (28%), Positives = 195/366 (53%), Gaps = 13/366 (4%)
 Frame = +1

Query  208   MEVKAAFGEVVPCMAMVMVEACTIFLTIMASTAMAKFGTNPFVFVVYTNALASIFLVPYS  387
             M  +  + +V+P  AMV +E   + ++++   A  K G + +VF+ Y+  ++++ L+   
Sbjct  1     MAGRHCYKDVLPFTAMVAIECTNVGVSVLFKAATQK-GLSYYVFIAYSFVVSTLVLLLPL  59

Query  388   IIYHRRDKAQEQlftfplllrlfflglIGVTISQNLAFVGLSYSSPIAACGTANIVPALS  567
               + +  +    L    +         +GV ++Q   + GL Y++P  A   +N++PA +
Sbjct  60    PFFIKWSRGLPPLNMSLIFRIFLLGV-LGV-VAQLFGYKGLEYTTPTLASSLSNLIPAFT  117

Query  568   FILAIILRRTKIDWESGGSQARMIGALICTVGTISLIFYRGPVV----NNYSPTFLHLST  735
             FILAII R  K+      SQA+++G+ +  +G ++++ Y+GP++    +  SP  +H   
Sbjct  118   FILAIIFRMEKVKLRWKSSQAKILGSTVSILGALTVVLYKGPIIIPSPSTQSPPIIHSPI  177

Query  736   TQFVFSSSTNQQNWVLGCLCFIAASLTLSIWNIIQVGTIRIYPQVMKIMCVYSLFGTVQS  915
             T     SST + NW+LG    +   L + IW IIQ   I+ YP  + ++ +Y+L G + S
Sbjct  178   T-----SSTTESNWILGGSLLVIEFLIVPIWYIIQTTVIKEYPAEIIVVFLYNLCGVLVS  232

Query  916   GALSLFIVRDLNAWRLGLNFQLIVILLTAIFGSIIRSSVQLWCMRMKGPSFPLIFKPVGI  1095
               + L +  +L+AW++  +  +I I+ +  F + +   V  W + +KGP +  +FKP+ I
Sbjct  233   IPICLLLEPNLSAWKINPDITMISIICSGFFSTGLSCLVHTWGLHIKGPVYISLFKPLSI  292

Query  1096  VVASSCGCLFFADTFHYGSMFSAFICGMGYYTTIWGQLKDEEIQQIKGSSVSLP-DEKVP  1272
              +A+S   +F  D  H+G++  A I  +G+Y  +WG+ K+E   +     V LP + K P
Sbjct  293   AIAASFSAIFLGDALHFGTVVGAVIISIGFYAVLWGKSKEESNDEFDIGRVPLPSNSKTP  352

Query  1273  LLQQSQ  1290
             LL+ S 
Sbjct  353   LLKVSN  358



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4661811919380