BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c9908_g2_i1 len=229 path=[817:0-228]

Length=229
                                                                      Score     E

ref|XP_002510336.1|  transferase, transferring glycosyl groups, p...    117   1e-29   Ricinus communis
ref|XP_009785169.1|  PREDICTED: probable galacturonosyltransferas...    117   2e-29   
ref|XP_009595248.1|  PREDICTED: probable galacturonosyltransferas...    117   2e-29   
gb|ACW83060.1|  glycosyltransferase family GT8 protein                  114   2e-28   Populus deltoides
ref|XP_002302469.1|  glycosyl transferase family 8 family protein       114   2e-28   Populus trichocarpa [western balsam poplar]
ref|XP_011017288.1|  PREDICTED: probable galacturonosyltransferas...    114   2e-28   
gb|AFM77986.1|  glycosyltransferase 8F                                  114   2e-28   
ref|XP_004238218.1|  PREDICTED: probable galacturonosyltransferas...    114   2e-28   
ref|XP_007017450.1|  Nucleotide-diphospho-sugar transferases supe...    114   3e-28   
ref|XP_006366462.1|  PREDICTED: probable galacturonosyltransferas...    114   3e-28   
gb|KDP38459.1|  hypothetical protein JCGZ_04384                         113   5e-28   
ref|XP_006375055.1|  glycosyl transferase family 8 family protein       112   8e-28   
ref|XP_006434923.1|  hypothetical protein CICLE_v10001658mg             111   3e-27   
ref|XP_006473446.1|  PREDICTED: probable galacturonosyltransferas...    111   3e-27   
emb|CAN66819.1|  hypothetical protein VITISV_004777                     111   3e-27   Vitis vinifera
ref|XP_002281848.2|  PREDICTED: probable galacturonosyltransferas...    110   4e-27   Vitis vinifera
ref|XP_010498344.1|  PREDICTED: probable galacturonosyltransferas...    110   4e-27   
ref|XP_008444675.1|  PREDICTED: probable galacturonosyltransferas...    110   4e-27   
ref|XP_010459593.1|  PREDICTED: probable galacturonosyltransferas...    110   4e-27   
ref|XP_010477136.1|  PREDICTED: probable galacturonosyltransferas...    110   5e-27   
gb|KGN62567.1|  hypothetical protein Csa_2G360840                       110   6e-27   
ref|XP_009374216.1|  PREDICTED: probable galacturonosyltransferas...    110   6e-27   
ref|XP_004152786.1|  PREDICTED: probable galacturonosyltransferas...    110   7e-27   
ref|XP_010026048.1|  PREDICTED: probable galacturonosyltransferas...    109   9e-27   
ref|XP_010529742.1|  PREDICTED: probable galacturonosyltransferas...    108   3e-26   
ref|XP_007223317.1|  hypothetical protein PRUPE_ppa007313mg             108   3e-26   
ref|XP_011031298.1|  PREDICTED: probable galacturonosyltransferas...    108   3e-26   
ref|XP_010106045.1|  putative galacturonosyltransferase-like 1          107   6e-26   
ref|XP_008466622.1|  PREDICTED: probable galacturonosyltransferas...    107   6e-26   
ref|XP_002269182.1|  PREDICTED: probable galacturonosyltransferas...    107   6e-26   Vitis vinifera
ref|XP_004147816.1|  PREDICTED: probable galacturonosyltransferas...    107   8e-26   
ref|XP_008377352.1|  PREDICTED: probable galacturonosyltransferas...    107   9e-26   
gb|KCW67801.1|  hypothetical protein EUGRSUZ_F01531                     107   1e-25   
ref|XP_009364319.1|  PREDICTED: probable galacturonosyltransferas...    106   1e-25   
ref|XP_008440161.1|  PREDICTED: probable galacturonosyltransferas...    106   1e-25   
gb|KGN48449.1|  Glycosyltransferase family GT8 protein                  106   2e-25   
ref|XP_004141952.1|  PREDICTED: LOW QUALITY PROTEIN: probable gal...    106   2e-25   
ref|XP_004157857.1|  PREDICTED: probable galacturonosyltransferas...    106   2e-25   
ref|XP_008347395.1|  PREDICTED: probable galacturonosyltransferas...    105   3e-25   
ref|XP_004291912.1|  PREDICTED: probable galacturonosyltransferas...    104   6e-25   
ref|XP_008338895.1|  PREDICTED: probable galacturonosyltransferas...    103   1e-24   
ref|XP_009365616.1|  PREDICTED: probable galacturonosyltransferas...    103   2e-24   
emb|CDP07571.1|  unnamed protein product                                103   2e-24   
ref|XP_010099353.1|  putative galacturonosyltransferase-like 2          103   2e-24   
ref|XP_010254968.1|  PREDICTED: probable galacturonosyltransferas...    103   2e-24   
gb|EYU44308.1|  hypothetical protein MIMGU_mgv1a019931mg                102   5e-24   
ref|XP_010412709.1|  PREDICTED: probable galacturonosyltransferas...    101   6e-24   
ref|XP_011099276.1|  PREDICTED: probable galacturonosyltransferas...    101   7e-24   
ref|XP_010246976.1|  PREDICTED: probable galacturonosyltransferas...    101   9e-24   
ref|XP_009589817.1|  PREDICTED: probable galacturonosyltransferas...    100   1e-23   
ref|XP_011074484.1|  PREDICTED: probable galacturonosyltransferas...    100   2e-23   
ref|XP_004300591.1|  PREDICTED: probable galacturonosyltransferas...    100   2e-23   
ref|XP_009379176.1|  PREDICTED: probable galacturonosyltransferas...    100   2e-23   
gb|KEH40084.1|  CAZy family GT8 glycosyltransferase                     100   3e-23   
ref|XP_009762034.1|  PREDICTED: probable galacturonosyltransferas...  99.8    4e-23   
ref|XP_010426618.1|  PREDICTED: probable galacturonosyltransferas...  99.4    4e-23   
ref|XP_003528195.1|  PREDICTED: probable galacturonosyltransferas...  99.4    6e-23   
ref|XP_003523583.1|  PREDICTED: probable galacturonosyltransferas...  99.0    8e-23   
ref|XP_004499118.1|  PREDICTED: probable galacturonosyltransferas...  98.6    9e-23   
gb|EPS69893.1|  hypothetical protein M569_04868                       98.2    1e-22   
ref|XP_007136565.1|  hypothetical protein PHAVU_009G055600g           98.6    1e-22   
ref|XP_007202265.1|  hypothetical protein PRUPE_ppa007777mg           98.6    1e-22   
ref|XP_004501044.1|  PREDICTED: probable galacturonosyltransferas...  98.6    1e-22   
emb|CDP02412.1|  unnamed protein product                              97.4    1e-22   
gb|KHN22277.1|  Putative galacturonosyltransferase-like 1             98.2    1e-22   
ref|XP_006292628.1|  hypothetical protein CARUB_v10018870mg           97.8    2e-22   
ref|XP_006425750.1|  hypothetical protein CICLE_v10025952mg           97.8    2e-22   
gb|KDO79458.1|  hypothetical protein CISIN_1g018567mg                 97.8    2e-22   
ref|XP_002876047.1|  hypothetical protein ARALYDRAFT_906411           97.8    2e-22   
ref|XP_010507379.1|  PREDICTED: probable galacturonosyltransferas...  97.4    2e-22   
ref|XP_006404004.1|  hypothetical protein EUTSA_v10010596mg           97.1    2e-22   
ref|NP_190645.3|  putative galacturonosyltransferase-like 2           97.4    2e-22   Arabidopsis thaliana [mouse-ear cress]
gb|KHN04544.1|  Putative galacturonosyltransferase-like 2             97.4    2e-22   
ref|XP_010503742.1|  PREDICTED: probable galacturonosyltransferas...  97.4    3e-22   
emb|CDY64370.1|  BnaC07g49990D                                        97.1    4e-22   
gb|EYU45105.1|  hypothetical protein MIMGU_mgv1a0211151mg             95.5    5e-22   
ref|XP_007160791.1|  hypothetical protein PHAVU_001G016900g           96.7    5e-22   
gb|KFK34323.1|  hypothetical protein AALP_AA5G130000                  96.3    6e-22   
gb|KEH36132.1|  CAZy family GT8 glycosyltransferase                   95.9    6e-22   
ref|XP_009764844.1|  PREDICTED: probable galacturonosyltransferas...  95.9    8e-22   
ref|XP_009621505.1|  PREDICTED: probable galacturonosyltransferas...  95.9    8e-22   
ref|XP_010317141.1|  PREDICTED: probable galacturonosyltransferas...  95.9    1e-21   
ref|XP_003549420.1|  PREDICTED: probable galacturonosyltransferas...  95.9    1e-21   
ref|XP_007156012.1|  hypothetical protein PHAVU_003G251200g           95.5    1e-21   
ref|XP_003545290.1|  PREDICTED: probable galacturonosyltransferas...  95.5    1e-21   
gb|KHN21004.1|  Putative galacturonosyltransferase-like 2             95.5    1e-21   
ref|XP_009136558.1|  PREDICTED: probable galacturonosyltransferas...  95.5    1e-21   
emb|CDX90688.1|  BnaA03g40930D                                        95.1    2e-21   
ref|XP_006338275.1|  PREDICTED: probable galacturonosyltransferas...  94.7    2e-21   
ref|XP_007047036.1|  Nucleotide-diphospho-sugar transferases supe...  95.1    2e-21   
ref|XP_003519906.2|  PREDICTED: probable galacturonosyltransferas...  94.4    4e-21   
ref|XP_003629503.1|  Glycosyltransferase family GT8 protein           94.0    5e-21   
ref|XP_010527644.1|  PREDICTED: probable galacturonosyltransferas...  93.6    5e-21   
ref|XP_006344827.1|  PREDICTED: probable galacturonosyltransferas...  92.4    1e-20   
ref|XP_004232091.2|  PREDICTED: probable galacturonosyltransferas...  92.8    1e-20   
ref|XP_004509235.1|  PREDICTED: probable galacturonosyltransferas...  92.8    1e-20   
ref|XP_010670763.1|  PREDICTED: probable galacturonosyltransferas...  92.4    1e-20   
ref|XP_003516580.1|  PREDICTED: probable galacturonosyltransferas...  92.0    2e-20   
ref|XP_006383257.1|  hypothetical protein POPTR_0005s12920g           92.0    2e-20   
emb|CDX83774.1|  BnaC08g18710D                                        92.0    2e-20   
ref|XP_009110284.1|  PREDICTED: probable galacturonosyltransferas...  91.7    3e-20   
ref|XP_004512004.1|  PREDICTED: probable galacturonosyltransferas...  91.3    4e-20   
ref|XP_010547489.1|  PREDICTED: probable galacturonosyltransferas...  90.9    5e-20   
ref|XP_004247487.1|  PREDICTED: probable galacturonosyltransferas...  90.9    6e-20   
ref|XP_010999942.1|  PREDICTED: probable galacturonosyltransferas...  90.9    6e-20   
ref|XP_006358435.1|  PREDICTED: probable galacturonosyltransferas...  90.9    6e-20   
ref|XP_010941962.1|  PREDICTED: probable galacturonosyltransferas...  90.5    6e-20   
emb|CDX96667.1|  BnaA08g22100D                                        90.5    9e-20   
gb|EPS67668.1|  hypothetical protein M569_07107                       90.1    9e-20   
ref|XP_010539932.1|  PREDICTED: probable galacturonosyltransferas...  90.1    1e-19   
ref|XP_010667970.1|  PREDICTED: probable galacturonosyltransferas...  90.1    1e-19   
ref|XP_007156891.1|  hypothetical protein PHAVU_002G026000g           89.7    1e-19   
ref|XP_010070454.1|  PREDICTED: probable galacturonosyltransferas...  89.7    1e-19   
ref|XP_011082537.1|  PREDICTED: probable galacturonosyltransferas...  89.4    2e-19   
emb|CDY26684.1|  BnaA06g13380D                                        89.4    2e-19   
ref|XP_009149405.1|  PREDICTED: probable galacturonosyltransferas...  89.4    2e-19   
ref|XP_010105689.1|  putative galacturonosyltransferase-like 4        89.0    3e-19   
ref|XP_002310780.1|  hypothetical protein POPTR_0007s12270g           88.6    3e-19   Populus trichocarpa [western balsam poplar]
gb|AFM77985.1|  glycosyltransferase 8E                                88.6    4e-19   
ref|XP_008808884.1|  PREDICTED: probable galacturonosyltransferas...  88.6    4e-19   
ref|XP_002277334.1|  PREDICTED: probable galacturonosyltransferas...  88.6    4e-19   Vitis vinifera
gb|AES94863.2|  CAZy family GT8 glycosyltransferase                   88.2    5e-19   
ref|XP_003611905.1|  Glycosyltransferase family GT8 protein           88.2    5e-19   
ref|XP_006416520.1|  hypothetical protein EUTSA_v10008059mg           87.8    6e-19   
ref|XP_008796999.1|  PREDICTED: probable galacturonosyltransferas...  87.8    8e-19   
ref|XP_002893040.1|  hypothetical protein ARALYDRAFT_472152           87.8    8e-19   
ref|NP_564077.1|  putative galacturonosyltransferase-like 1           87.4    9e-19   Arabidopsis thaliana [mouse-ear cress]
gb|KDP31814.1|  hypothetical protein JCGZ_12275                       87.4    9e-19   
gb|AAM61534.1|  Avr9/Cf-9 rapidly elicited protein 231                87.4    9e-19   Arabidopsis thaliana [mouse-ear cress]
emb|CDY41036.1|  BnaC05g14940D                                        87.4    9e-19   
gb|KFK44065.1|  hypothetical protein AALP_AA1G211600                  87.4    1e-18   
emb|CBI19635.3|  unnamed protein product                              86.3    1e-18   
ref|XP_007050698.1|  Galacturonosyltransferase-like 4                 87.8    1e-18   
gb|EPS62323.1|  hypothetical protein M569_12469                       86.7    1e-18   
ref|XP_006856128.1|  hypothetical protein AMTR_s00059p00154780        86.7    2e-18   
ref|XP_007144593.1|  hypothetical protein PHAVU_007G168700g           86.3    2e-18   
ref|XP_004148897.1|  PREDICTED: probable galacturonosyltransferas...  86.3    2e-18   
ref|XP_010255819.1|  PREDICTED: probable galacturonosyltransferas...  86.3    2e-18   
ref|XP_006355791.1|  PREDICTED: probable galacturonosyltransferas...  86.3    3e-18   
ref|XP_010907223.1|  PREDICTED: probable galacturonosyltransferas...  86.3    3e-18   
ref|XP_002516817.1|  transferase, transferring glycosyl groups, p...  86.3    3e-18   Ricinus communis
ref|XP_011025701.1|  PREDICTED: probable galacturonosyltransferas...  86.3    3e-18   
ref|XP_010038136.1|  PREDICTED: probable galacturonosyltransferas...  86.3    3e-18   
ref|XP_004240529.1|  PREDICTED: probable galacturonosyltransferas...  86.3    3e-18   
ref|XP_009406593.1|  PREDICTED: probable galacturonosyltransferas...  86.3    3e-18   
ref|XP_009797127.1|  PREDICTED: probable galacturonosyltransferas...  86.3    3e-18   
ref|XP_003528664.2|  PREDICTED: probable galacturonosyltransferas...  85.5    3e-18   
gb|EYU28550.1|  hypothetical protein MIMGU_mgv1a022129mg              85.9    3e-18   
gb|AAM20647.1|  unknown protein                                       85.9    3e-18   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011077263.1|  PREDICTED: probable galacturonosyltransferas...  86.3    4e-18   
ref|XP_009789670.1|  PREDICTED: probable galacturonosyltransferas...  85.9    4e-18   
ref|XP_009412175.1|  PREDICTED: probable galacturonosyltransferas...  85.9    4e-18   
ref|XP_008451402.1|  PREDICTED: probable galacturonosyltransferas...  86.3    4e-18   
gb|EPS64908.1|  hypothetical protein M569_09869                       85.5    5e-18   
ref|XP_001770768.1|  predicted protein                                84.7    5e-18   
gb|AAO72395.1|  putative glycosyl transferase                         85.5    6e-18   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001050893.2|  Os03g0678800                                     85.5    6e-18   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006484411.1|  PREDICTED: probable galacturonosyltransferas...  85.1    7e-18   
ref|XP_009622633.1|  PREDICTED: probable galacturonosyltransferas...  85.1    7e-18   
ref|XP_002524800.1|  transferase, transferring glycosyl groups, p...  85.1    8e-18   Ricinus communis
ref|XP_004496068.1|  PREDICTED: probable galacturonosyltransferas...  85.1    8e-18   
gb|KGN44858.1|  hypothetical protein Csa_7G392310                     85.1    8e-18   
ref|XP_010941934.1|  PREDICTED: probable galacturonosyltransferas...  85.1    8e-18   
ref|XP_004502731.1|  PREDICTED: probable galacturonosyltransferas...  84.7    9e-18   
gb|EPS67852.1|  hypothetical protein M569_06922                       84.3    9e-18   
ref|XP_009384986.1|  PREDICTED: probable galacturonosyltransferas...  84.7    1e-17   
ref|XP_003564007.1|  PREDICTED: probable galacturonosyltransferas...  84.7    1e-17   
ref|XP_011079796.1|  PREDICTED: probable galacturonosyltransferas...  84.3    1e-17   
gb|EMT30165.1|  hypothetical protein F775_52051                       84.3    1e-17   
ref|XP_009599214.1|  PREDICTED: probable galacturonosyltransferas...  84.3    1e-17   
ref|XP_004986312.1|  PREDICTED: probable galacturonosyltransferas...  84.7    1e-17   
ref|NP_001130472.1|  hypothetical protein precursor                   84.3    2e-17   Zea mays [maize]
ref|XP_004953906.1|  PREDICTED: probable galacturonosyltransferas...  84.3    2e-17   
ref|XP_003591617.1|  Glycosyltransferase CAZy family GT8              84.0    2e-17   
ref|XP_002452580.1|  hypothetical protein SORBIDRAFT_04g028460        84.3    2e-17   Sorghum bicolor [broomcorn]
ref|XP_009419038.1|  PREDICTED: probable galacturonosyltransferas...  84.0    2e-17   
gb|AES61868.2|  CAZy family GT8 glycosyltransferase                   84.0    2e-17   
ref|XP_011032903.1|  PREDICTED: probable galacturonosyltransferas...  83.6    2e-17   
gb|EYU40859.1|  hypothetical protein MIMGU_mgv1a006996mg              84.3    3e-17   
ref|XP_002311936.1|  hypothetical protein POPTR_0008s01900g           83.6    3e-17   Populus trichocarpa [western balsam poplar]
ref|XP_004493636.1|  PREDICTED: probable galacturonosyltransferas...  83.6    3e-17   
ref|XP_006437736.1|  hypothetical protein CICLE_v10031574mg           84.3    3e-17   
tpg|DAA45468.1|  TPA: hypothetical protein ZEAMMB73_402418            82.8    3e-17   
ref|XP_004292605.1|  PREDICTED: probable galacturonosyltransferas...  83.2    3e-17   
ref|XP_010918506.1|  PREDICTED: probable galacturonosyltransferas...  82.8    4e-17   
ref|XP_006444151.1|  hypothetical protein CICLE_v10020857mg           83.2    4e-17   
ref|XP_009630076.1|  PREDICTED: probable galacturonosyltransferas...  83.2    4e-17   
gb|KCW58913.1|  hypothetical protein EUGRSUZ_H01534                   82.8    4e-17   
gb|ACF82776.1|  unknown                                               82.8    4e-17   Zea mays [maize]
ref|XP_010680924.1|  PREDICTED: probable galacturonosyltransferas...  82.8    4e-17   
ref|NP_001149414.1|  transferase, transferring glycosyl groups pr...  82.8    5e-17   Zea mays [maize]
ref|XP_010070259.1|  PREDICTED: probable galacturonosyltransferas...  82.8    5e-17   
ref|XP_002436791.1|  hypothetical protein SORBIDRAFT_10g008830        82.8    5e-17   Sorghum bicolor [broomcorn]
gb|KDP40068.1|  hypothetical protein JCGZ_02066                       82.8    5e-17   
gb|EAY78759.1|  hypothetical protein OsI_33861                        80.9    5e-17   Oryza sativa Indica Group [Indian rice]
ref|XP_001752454.1|  predicted protein                                82.0    5e-17   
gb|EAZ16294.1|  hypothetical protein OsJ_31754                        80.9    5e-17   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010546900.1|  PREDICTED: probable galacturonosyltransferas...  82.8    6e-17   
ref|NP_001141620.1|  uncharacterized protein LOC100273739 precursor   82.4    6e-17   Zea mays [maize]
ref|XP_009407434.1|  PREDICTED: probable galacturonosyltransferas...  82.4    7e-17   
dbj|BAK04626.1|  predicted protein                                    82.4    7e-17   
ref|XP_010041540.1|  PREDICTED: probable galacturonosyltransferas...  82.0    7e-17   
ref|XP_008796730.1|  PREDICTED: probable galacturonosyltransferas...  82.0    8e-17   
gb|AAP54070.1|  glycosyl transferase family 8 protein, putative       81.6    8e-17   Oryza sativa Japonica Group [Japonica rice]
gb|EYU25700.1|  hypothetical protein MIMGU_mgv1a023917mg              81.3    9e-17   
ref|XP_010279126.1|  PREDICTED: probable galacturonosyltransferas...  82.0    9e-17   
ref|XP_002465236.1|  hypothetical protein SORBIDRAFT_01g034770        82.0    9e-17   Sorghum bicolor [broomcorn]
ref|XP_007154192.1|  hypothetical protein PHAVU_003G097800g           82.0    9e-17   
ref|XP_002533272.1|  transferase, transferring glycosyl groups, p...  82.4    1e-16   Ricinus communis
emb|CDY18846.1|  BnaAnng03110D                                        82.0    1e-16   
ref|XP_010265254.1|  PREDICTED: probable galacturonosyltransferas...  82.0    1e-16   
ref|XP_002271296.1|  PREDICTED: probable galacturonosyltransferas...  82.0    1e-16   Vitis vinifera
gb|KEH23701.1|  CAZy family GT8 glycosyltransferase                   82.0    1e-16   
ref|XP_004986977.1|  PREDICTED: probable galacturonosyltransferas...  81.6    1e-16   
ref|XP_007035367.1|  Galacturonosyltransferase-like 4                 81.6    1e-16   
gb|KDP29364.1|  hypothetical protein JCGZ_18285                       81.6    1e-16   
ref|XP_006850846.1|  hypothetical protein AMTR_s00025p00136940        81.6    1e-16   
ref|NP_001137113.1|  hypothetical protein precursor                   82.0    1e-16   Zea mays [maize]
ref|XP_007016224.1|  Galacturonosyltransferase-like 3                 81.6    1e-16   
ref|XP_009124935.1|  PREDICTED: probable galacturonosyltransferas...  81.6    1e-16   
dbj|BAK07300.1|  predicted protein                                    81.6    1e-16   
gb|ACJ85290.1|  unknown                                               80.5    1e-16   Medicago truncatula
ref|XP_002281658.1|  PREDICTED: probable galacturonosyltransferas...  81.6    1e-16   Vitis vinifera
ref|XP_010262920.1|  PREDICTED: probable galacturonosyltransferas...  82.0    1e-16   
ref|XP_006843824.1|  hypothetical protein AMTR_s00007p00258170        81.6    1e-16   
emb|CDX85191.1|  BnaC07g25020D                                        81.6    1e-16   
gb|AAG43554.1|AF211536_1  Avr9/Cf-9 rapidly elicited protein 231      81.6    1e-16   Nicotiana tabacum [American tobacco]
ref|XP_003602336.1|  Glycosyltransferase CAZy family GT8              81.3    2e-16   
ref|XP_009771460.1|  PREDICTED: probable galacturonosyltransferas...  81.6    2e-16   
ref|XP_002466674.1|  hypothetical protein SORBIDRAFT_01g012060        81.3    2e-16   Sorghum bicolor [broomcorn]
ref|XP_008223046.1|  PREDICTED: probable galacturonosyltransferas...  81.3    2e-16   
ref|XP_001777911.1|  predicted protein                                80.5    2e-16   
ref|XP_008775723.1|  PREDICTED: LOW QUALITY PROTEIN: probable gal...  81.3    2e-16   
emb|CDY69900.1|  BnaA06g38050D                                        81.3    2e-16   
ref|XP_010486120.1|  PREDICTED: probable galacturonosyltransferas...  81.3    2e-16   
ref|XP_004965127.1|  PREDICTED: probable galacturonosyltransferas...  81.6    2e-16   
ref|XP_010029247.1|  PREDICTED: probable galacturonosyltransferas...  81.3    2e-16   
ref|XP_008234923.1|  PREDICTED: probable galacturonosyltransferas...  80.9    2e-16   
gb|AFW85173.1|  hypothetical protein ZEAMMB73_350653                  79.0    2e-16   
ref|XP_009148532.1|  PREDICTED: probable galacturonosyltransferas...  80.9    2e-16   
ref|XP_004232258.1|  PREDICTED: probable galacturonosyltransferas...  81.3    2e-16   
ref|XP_004238964.1|  PREDICTED: probable galacturonosyltransferas...  80.9    2e-16   
gb|KDP21514.1|  hypothetical protein JCGZ_21985                       80.9    2e-16   
ref|NP_001168674.1|  uncharacterized protein LOC100382462 precursor   81.3    2e-16   Zea mays [maize]
ref|XP_009406013.1|  PREDICTED: probable galacturonosyltransferas...  80.5    3e-16   
ref|NP_001050151.1|  Os03g0359600                                     80.9    3e-16   Oryza sativa Japonica Group [Japonica rice]
gb|EMS59063.1|  putative galacturonosyltransferase-like 4             80.5    3e-16   
ref|XP_007224926.1|  hypothetical protein PRUPE_ppa021809mg           80.9    3e-16   
ref|XP_003518684.1|  PREDICTED: probable galacturonosyltransferas...  80.5    3e-16   
gb|ABD96888.1|  hypothetical protein                                  80.9    3e-16   Tarenaya spinosa
ref|XP_002877098.1|  hypothetical protein ARALYDRAFT_905093           80.9    3e-16   
ref|XP_004135114.1|  PREDICTED: probable galacturonosyltransferas...  80.5    3e-16   
ref|XP_010523971.1|  PREDICTED: probable galacturonosyltransferas...  80.9    3e-16   
ref|XP_006338507.1|  PREDICTED: probable galacturonosyltransferas...  80.9    3e-16   
ref|XP_010558511.1|  PREDICTED: probable galacturonosyltransferas...  80.5    3e-16   
ref|XP_006407966.1|  hypothetical protein EUTSA_v10021020mg           80.5    3e-16   
ref|XP_008223045.1|  PREDICTED: probable galacturonosyltransferas...  80.9    3e-16   
gb|KFK33730.1|  hypothetical protein AALP_AA5G052400                  80.5    3e-16   
ref|XP_008368880.1|  PREDICTED: probable galacturonosyltransferas...  80.5    3e-16   
ref|XP_002884565.1|  hypothetical protein ARALYDRAFT_477926           80.5    4e-16   
ref|XP_003550517.2|  PREDICTED: probable galacturonosyltransferas...  79.7    4e-16   
ref|XP_008446556.1|  PREDICTED: probable galacturonosyltransferas...  80.1    4e-16   
ref|XP_010464196.1|  PREDICTED: probable galacturonosyltransferas...  80.5    4e-16   
gb|KFK38064.1|  hypothetical protein AALP_AA3G065300                  80.5    4e-16   
ref|XP_010556385.1|  PREDICTED: probable galacturonosyltransferas...  80.5    4e-16   
ref|XP_002524407.1|  transferase, transferring glycosyl groups, p...  80.1    4e-16   Ricinus communis
ref|XP_009129654.1|  PREDICTED: probable galacturonosyltransferas...  80.1    4e-16   
ref|XP_009134880.1|  PREDICTED: probable galacturonosyltransferas...  80.1    4e-16   
emb|CDY08061.1|  BnaC03g34620D                                        80.1    4e-16   
gb|AFW64532.1|  hypothetical protein ZEAMMB73_103948                  80.9    4e-16   
ref|XP_004297141.1|  PREDICTED: probable galacturonosyltransferas...  80.1    4e-16   
ref|XP_007200334.1|  hypothetical protein PRUPE_ppa008099mg           80.1    4e-16   
ref|XP_006296751.1|  hypothetical protein CARUB_v10015151mg           80.1    5e-16   
ref|XP_009356219.1|  PREDICTED: probable galacturonosyltransferas...  80.1    5e-16   
ref|XP_008361737.1|  PREDICTED: probable galacturonosyltransferas...  80.1    5e-16   
ref|NP_187277.1|  putative galacturonosyltransferase-like 4           80.1    5e-16   Arabidopsis thaliana [mouse-ear cress]
gb|EYU43859.1|  hypothetical protein MIMGU_mgv1a0124281mg             79.3    5e-16   
ref|XP_011083911.1|  PREDICTED: probable galacturonosyltransferas...  79.3    5e-16   
ref|XP_006305868.1|  hypothetical protein CARUB_v10010952mg           79.7    6e-16   
dbj|BAK03494.1|  predicted protein                                    81.3    6e-16   
dbj|BAK04158.1|  predicted protein                                    80.9    6e-16   
ref|XP_009352147.1|  PREDICTED: probable galacturonosyltransferas...  79.7    6e-16   
ref|XP_006362533.1|  PREDICTED: probable galacturonosyltransferas...  79.7    7e-16   
ref|XP_010044297.1|  PREDICTED: probable galacturonosyltransferas...  79.7    8e-16   
dbj|BAC43692.1|  unknown protein                                      79.0    8e-16   
ref|XP_006395371.1|  hypothetical protein EUTSA_v10004449mg           79.7    8e-16   
ref|XP_003557847.1|  PREDICTED: probable galacturonosyltransferas...  79.7    8e-16   
ref|XP_002314884.1|  hypothetical protein POPTR_0010s13960g           79.3    8e-16   
dbj|BAD45664.1|  putative Avr9/Cf-9 rapidly elicited protein 231      79.7    8e-16   
ref|XP_002892735.1|  hypothetical protein ARALYDRAFT_471480           79.3    1e-15   
ref|NP_001048067.1|  Os02g0739400                                     79.7    1e-15   
ref|XP_011008545.1|  PREDICTED: probable galacturonosyltransferas...  79.0    1e-15   
emb|CDP00576.1|  unnamed protein product                              79.3    1e-15   
ref|XP_010476320.1|  PREDICTED: probable galacturonosyltransferas...  79.0    1e-15   
gb|KHN03416.1|  Putative galacturonosyltransferase-like 4             79.0    1e-15   
ref|XP_006444439.1|  hypothetical protein CICLE_v10020715mg           79.3    1e-15   
ref|XP_010495147.1|  PREDICTED: probable galacturonosyltransferas...  79.0    1e-15   
ref|NP_563925.1|  putative galacturonosyltransferase-like 3           79.0    1e-15   
gb|AAM61338.1|  putative glycosyl transferase                         79.0    1e-15   
ref|XP_010514535.1|  PREDICTED: probable galacturonosyltransferas...  79.0    1e-15   
gb|AAG09558.1|AC011810_17  Unknown Protein                            79.0    1e-15   
ref|XP_006292731.1|  hypothetical protein CARUB_v10018975mg           79.0    1e-15   
ref|XP_006417141.1|  hypothetical protein EUTSA_v10007975mg           79.0    1e-15   
ref|XP_009151890.1|  PREDICTED: probable galacturonosyltransferas...  79.0    2e-15   
ref|NP_189474.2|  putative galacturonosyltransferase-like 10          79.0    2e-15   
ref|XP_004159321.1|  PREDICTED: probable galacturonosyltransferas...  79.3    2e-15   
ref|XP_004302382.1|  PREDICTED: probable galacturonosyltransferas...  79.0    2e-15   
gb|KHN31809.1|  Putative galacturonosyltransferase-like 4             76.6    2e-15   
ref|XP_010425611.1|  PREDICTED: probable galacturonosyltransferas...  78.6    2e-15   
ref|XP_002312381.1|  hypothetical protein POPTR_0008s11570g           78.2    2e-15   
ref|XP_010322853.1|  PREDICTED: probable galacturonosyltransferas...  78.6    2e-15   
ref|XP_011021687.1|  PREDICTED: probable galacturonosyltransferas...  78.2    2e-15   
ref|XP_007153344.1|  hypothetical protein PHAVU_003G027400g           78.6    2e-15   
ref|XP_008340887.1|  PREDICTED: probable galacturonosyltransferas...  78.2    2e-15   
ref|XP_003516853.1|  PREDICTED: probable galacturonosyltransferas...  77.8    3e-15   
emb|CBI32320.3|  unnamed protein product                              77.0    3e-15   
ref|XP_010522685.1|  PREDICTED: probable galacturonosyltransferas...  78.2    3e-15   
emb|CDX67897.1|  BnaA07g19370D                                        78.2    3e-15   
ref|XP_002315420.1|  galactinol synthase family protein               77.8    3e-15   
ref|XP_011024154.1|  PREDICTED: probable galacturonosyltransferas...  77.8    3e-15   
ref|XP_009786939.1|  PREDICTED: probable galacturonosyltransferas...  77.8    3e-15   
ref|XP_009800582.1|  PREDICTED: probable galacturonosyltransferas...  78.2    3e-15   
ref|XP_009625345.1|  PREDICTED: probable galacturonosyltransferas...  77.8    3e-15   
gb|AED99881.1|  glycosyltransferase                                   77.8    3e-15   
ref|XP_009615086.1|  PREDICTED: probable galacturonosyltransferas...  77.8    4e-15   
ref|XP_009786938.1|  PREDICTED: probable galacturonosyltransferas...  77.8    4e-15   
ref|XP_009592341.1|  PREDICTED: probable galacturonosyltransferas...  77.8    4e-15   
ref|XP_003625940.1|  Transferase transferring glycosyl groups         77.8    4e-15   
ref|XP_009615085.1|  PREDICTED: probable galacturonosyltransferas...  77.4    4e-15   
ref|XP_002302739.1|  glycosyl transferase family 8 family protein     77.8    4e-15   
ref|XP_009774681.1|  PREDICTED: probable galacturonosyltransferas...  77.8    5e-15   
ref|XP_002271160.1|  PREDICTED: probable galacturonosyltransferas...  77.8    5e-15   
ref|XP_010502828.1|  PREDICTED: probable galacturonosyltransferas...  77.4    6e-15   
emb|CDO98961.1|  unnamed protein product                              77.4    6e-15   
gb|AFW73330.1|  hypothetical protein ZEAMMB73_320909                  77.0    6e-15   
gb|EAZ24557.1|  hypothetical protein OsJ_08319                        77.4    6e-15   
gb|EAY87464.1|  hypothetical protein OsI_08873                        77.4    6e-15   
ref|XP_006574538.1|  PREDICTED: probable galacturonosyltransferas...  77.0    7e-15   
emb|CBI32072.3|  unnamed protein product                              78.2    7e-15   
ref|XP_008350074.1|  PREDICTED: probable galacturonosyltransferas...  77.0    8e-15   
ref|XP_003536003.1|  PREDICTED: probable galacturonosyltransferas...  77.0    8e-15   
ref|XP_007145178.1|  hypothetical protein PHAVU_007G217100g           77.0    9e-15   
ref|XP_008243171.1|  PREDICTED: probable galacturonosyltransferas...  77.4    9e-15   
ref|XP_010544987.1|  PREDICTED: probable galacturonosyltransferas...  76.6    9e-15   
ref|XP_010093401.1|  putative galacturonosyltransferase-like 3        76.6    1e-14   
emb|CDP00233.1|  unnamed protein product                              77.0    1e-14   
gb|KHN14266.1|  Putative galacturonosyltransferase-like 4             73.9    1e-14   
ref|XP_009115870.1|  PREDICTED: probable galacturonosyltransferas...  76.6    1e-14   
ref|XP_009356723.1|  PREDICTED: probable galacturonosyltransferas...  76.6    1e-14   
ref|XP_007051037.1|  Galacturonosyltransferase-like 7 isoform 1       76.6    1e-14   
ref|XP_002523144.1|  transferase, transferring glycosyl groups, p...  76.3    1e-14   
emb|CDY20026.1|  BnaA09g02250D                                        76.3    1e-14   
ref|XP_011007808.1|  PREDICTED: probable galacturonosyltransferas...  76.6    1e-14   
emb|CAN62993.1|  hypothetical protein VITISV_021618                   76.6    1e-14   
emb|CBI36914.3|  unnamed protein product                              76.3    1e-14   
ref|XP_011090840.1|  PREDICTED: probable galacturonosyltransferas...  76.3    1e-14   
ref|XP_010468932.1|  PREDICTED: probable galacturonosyltransferas...  76.3    1e-14   
emb|CDY00135.1|  BnaC09g01660D                                        76.3    2e-14   
gb|KDO66287.1|  hypothetical protein CISIN_1g023261mg                 75.1    2e-14   
gb|KHG03917.1|  putative galacturonosyltransferase-like 7             76.3    2e-14   
ref|XP_010512662.1|  PREDICTED: probable galacturonosyltransferas...  76.3    2e-14   
ref|XP_008230687.1|  PREDICTED: probable galacturonosyltransferas...  76.3    2e-14   
gb|EYU46773.1|  hypothetical protein MIMGU_mgv1a025873mg              75.9    2e-14   
ref|XP_009397941.1|  PREDICTED: LOW QUALITY PROTEIN: probable gal...  75.1    2e-14   
ref|XP_009115465.1|  PREDICTED: probable galacturonosyltransferas...  76.3    2e-14   
ref|XP_003561312.1|  PREDICTED: probable galacturonosyltransferas...  75.9    2e-14   
ref|XP_009104390.1|  PREDICTED: probable galacturonosyltransferas...  75.9    2e-14   
gb|KDP28214.1|  hypothetical protein JCGZ_13985                       75.5    2e-14   
ref|XP_003570682.1|  PREDICTED: probable galacturonosyltransferas...  75.9    2e-14   
gb|KDP21279.1|  hypothetical protein JCGZ_21750                       75.9    2e-14   
ref|XP_004297045.1|  PREDICTED: probable galacturonosyltransferas...  75.5    3e-14   
ref|XP_002274175.1|  PREDICTED: probable galacturonosyltransferas...  76.3    3e-14   
ref|XP_006402358.1|  hypothetical protein EUTSA_v10006055mg           75.5    3e-14   
ref|XP_006291385.1|  hypothetical protein CARUB_v10017523mg           75.5    3e-14   
ref|XP_003613432.1|  Glycosyltransferase CAZy family GT8              75.9    3e-14   
emb|CDX76651.1|  BnaC08g32370D                                        75.5    3e-14   
ref|XP_002520205.1|  transferase, transferring glycosyl groups, p...  75.9    3e-14   
ref|XP_006855363.1|  hypothetical protein AMTR_s00057p00117230        75.5    3e-14   
ref|XP_007163157.1|  hypothetical protein PHAVU_001G211100g           75.1    3e-14   
emb|CDY11436.1|  BnaA09g40020D                                        75.5    3e-14   
ref|XP_006584154.1|  PREDICTED: probable galacturonosyltransferas...  73.6    3e-14   
ref|XP_008793777.1|  PREDICTED: probable galacturonosyltransferas...  75.5    4e-14   
emb|CDP17093.1|  unnamed protein product                              75.5    4e-14   
ref|XP_006577717.1|  PREDICTED: probable galacturonosyltransferas...  73.6    4e-14   
emb|CDY25112.1|  BnaC06g18540D                                        75.1    4e-14   
ref|XP_004504493.1|  PREDICTED: probable galacturonosyltransferas...  75.5    4e-14   
gb|KFK37526.1|  hypothetical protein AALP_AA4G268500                  74.7    4e-14   
gb|EYU22458.1|  hypothetical protein MIMGU_mgv1a027115mg              75.5    4e-14   
ref|XP_007222178.1|  hypothetical protein PRUPE_ppa007794mg           75.1    4e-14   
ref|XP_011071054.1|  PREDICTED: probable galacturonosyltransferas...  75.1    4e-14   
ref|XP_009111592.1|  PREDICTED: probable galacturonosyltransferas...  74.7    4e-14   
emb|CDP03588.1|  unnamed protein product                              73.9    4e-14   
ref|XP_011082434.1|  PREDICTED: probable galacturonosyltransferas...  74.7    5e-14   
ref|XP_009339799.1|  PREDICTED: probable galacturonosyltransferas...  74.7    5e-14   
ref|XP_006416019.1|  hypothetical protein EUTSA_v10007867mg           75.1    5e-14   
ref|XP_010683334.1|  PREDICTED: probable galacturonosyltransferas...  75.1    5e-14   
ref|XP_010911177.1|  PREDICTED: probable galacturonosyltransferas...  74.7    5e-14   
ref|XP_008386739.1|  PREDICTED: probable galacturonosyltransferas...  74.7    5e-14   
ref|XP_006658897.1|  PREDICTED: uncharacterized protein LOC102710515  76.6    5e-14   
ref|XP_010938334.1|  PREDICTED: probable galacturonosyltransferas...  74.7    6e-14   
gb|KDP45426.1|  hypothetical protein JCGZ_09675                       74.7    6e-14   
gb|KFK35435.1|  hypothetical protein AALP_AA5G284000                  74.3    6e-14   
ref|XP_006304867.1|  hypothetical protein CARUB_v10012618mg           74.3    6e-14   
ref|XP_008353413.1|  PREDICTED: probable galacturonosyltransferas...  74.7    6e-14   
gb|KHN39285.1|  Putative galacturonosyltransferase-like 4             72.8    7e-14   
ref|XP_010528281.1|  PREDICTED: probable galacturonosyltransferas...  74.7    7e-14   
ref|XP_009400280.1|  PREDICTED: probable galacturonosyltransferas...  74.3    7e-14   
ref|XP_002985526.1|  galacturonosyltransferase-like protein           74.3    8e-14   
ref|XP_003517873.1|  PREDICTED: probable galacturonosyltransferas...  74.3    8e-14   
gb|EYU28658.1|  hypothetical protein MIMGU_mgv1a009253mg              73.9    8e-14   
ref|XP_007199892.1|  hypothetical protein PRUPE_ppa007216mg           74.3    9e-14   
ref|XP_006359884.1|  PREDICTED: probable galacturonosyltransferas...  74.3    9e-14   
ref|XP_010326564.1|  PREDICTED: probable galacturonosyltransferas...  74.3    9e-14   
ref|XP_010922260.1|  PREDICTED: probable galacturonosyltransferas...  74.3    9e-14   
emb|CDY14673.1|  BnaC05g19300D                                        74.7    9e-14   
ref|XP_010913423.1|  PREDICTED: probable galacturonosyltransferas...  73.9    9e-14   
ref|XP_008813712.1|  PREDICTED: probable galacturonosyltransferas...  73.9    1e-13   
ref|XP_003519792.1|  PREDICTED: probable galacturonosyltransferas...  73.9    1e-13   
ref|XP_010477742.1|  PREDICTED: probable galacturonosyltransferas...  74.3    1e-13   
ref|XP_011086460.1|  PREDICTED: probable galacturonosyltransferas...  73.9    1e-13   
gb|KHG10472.1|  putative galacturonosyltransferase-like 7             73.9    1e-13   
ref|XP_002461136.1|  hypothetical protein SORBIDRAFT_02g041310        73.6    1e-13   
ref|XP_011079603.1|  PREDICTED: LOW QUALITY PROTEIN: probable gal...  73.9    1e-13   
ref|XP_008790856.1|  PREDICTED: probable galacturonosyltransferas...  73.6    1e-13   
ref|XP_010100534.1|  putative galacturonosyltransferase-like 9        73.9    1e-13   
ref|XP_008653412.1|  PREDICTED: probable galacturonosyltransferas...  73.6    2e-13   
ref|XP_010684588.1|  PREDICTED: probable galacturonosyltransferas...  73.2    2e-13   
emb|CAB83116.1|  putative protein                                     73.2    2e-13   
ref|NP_191825.2|  putative galacturonosyltransferase-like 7           73.2    2e-13   
ref|XP_010038253.1|  PREDICTED: probable galacturonosyltransferas...  73.2    2e-13   
ref|XP_008451519.1|  PREDICTED: probable galacturonosyltransferas...  73.2    2e-13   
ref|XP_010268078.1|  PREDICTED: probable galacturonosyltransferas...  73.2    2e-13   
ref|XP_009621654.1|  PREDICTED: probable galacturonosyltransferas...  72.8    2e-13   
ref|XP_004136007.1|  PREDICTED: probable galacturonosyltransferas...  73.2    2e-13   
ref|XP_007214854.1|  hypothetical protein PRUPE_ppa007162mg           73.2    2e-13   
emb|CDY16237.1|  BnaA09g29710D                                        73.2    2e-13   
ref|XP_002468004.1|  hypothetical protein SORBIDRAFT_01g037870        73.2    2e-13   
ref|XP_004984662.1|  PREDICTED: probable galacturonosyltransferas...  73.2    3e-13   
ref|XP_010272110.1|  PREDICTED: probable galacturonosyltransferas...  72.8    3e-13   
ref|XP_009799047.1|  PREDICTED: probable galacturonosyltransferas...  72.8    3e-13   
ref|NP_001130810.1|  hypothetical protein precursor                   72.8    3e-13   
ref|XP_009602693.1|  PREDICTED: probable galacturonosyltransferas...  72.8    3e-13   
ref|XP_003550971.1|  PREDICTED: probable galacturonosyltransferas...  71.6    3e-13   
ref|XP_010091941.1|  putative galacturonosyltransferase-like 10       72.8    3e-13   
ref|XP_002876684.1|  hypothetical protein ARALYDRAFT_486764           72.4    3e-13   
ref|XP_009623986.1|  PREDICTED: probable galacturonosyltransferas...  72.8    3e-13   
ref|XP_003607050.1|  Glycosyltransferase CAZy family GT8              72.8    3e-13   
ref|XP_006438508.1|  hypothetical protein CICLE_v10031831mg           72.8    3e-13   
ref|XP_006446435.1|  hypothetical protein CICLE_v10015791mg           72.4    3e-13   
gb|KDO82650.1|  hypothetical protein CISIN_1g047424mg                 72.8    3e-13   
ref|XP_004297681.1|  PREDICTED: probable galacturonosyltransferas...  72.8    3e-13   
ref|XP_006357215.1|  PREDICTED: probable galacturonosyltransferas...  72.8    4e-13   
ref|XP_009800665.1|  PREDICTED: probable galacturonosyltransferas...  72.4    4e-13   
ref|XP_006470399.1|  PREDICTED: probable galacturonosyltransferas...  72.4    4e-13   
ref|XP_002281766.1|  PREDICTED: probable galacturonosyltransferas...  72.4    4e-13   
gb|EMS56477.1|  putative galacturonosyltransferase-like 7             71.2    4e-13   
ref|XP_004508341.1|  PREDICTED: probable galacturonosyltransferas...  72.0    5e-13   
ref|XP_010103398.1|  putative galacturonosyltransferase-like 7        72.0    5e-13   
emb|CDY01922.1|  BnaC02g28050D                                        72.0    5e-13   
gb|KFK44480.1|  hypothetical protein AALP_AA1G261800                  72.4    5e-13   
emb|CDX97256.1|  BnaA02g20470D                                        72.0    5e-13   
ref|NP_001049861.1|  Os03g0300900                                     72.0    6e-13   
gb|KHN43481.1|  Putative galacturonosyltransferase-like 7             70.5    6e-13   
ref|XP_004238733.1|  PREDICTED: probable galacturonosyltransferas...  72.0    6e-13   
ref|XP_006396418.1|  hypothetical protein EUTSA_v10028760mg           72.0    6e-13   
ref|XP_010522810.1|  PREDICTED: probable galacturonosyltransferas...  72.0    6e-13   
ref|XP_006304530.1|  hypothetical protein CARUB_v10011392mg           72.0    7e-13   
ref|XP_002893329.1|  hypothetical protein ARALYDRAFT_472678           72.0    7e-13   
ref|XP_003558105.1|  PREDICTED: probable galacturonosyltransferas...  71.6    7e-13   
ref|XP_007157528.1|  hypothetical protein PHAVU_002G077400g           72.0    7e-13   
ref|XP_008235167.1|  PREDICTED: probable galacturonosyltransferas...  71.6    8e-13   
gb|KEH32259.1|  CAZy family GT8 glycosyltransferase                   71.2    8e-13   
gb|EPS68368.1|  hypothetical protein M569_06403                       71.6    8e-13   
ref|NP_173827.1|  putative galacturonosyltransferase-like 8           72.0    8e-13   
ref|NP_001060465.1|  Os07g0646800                                     71.6    8e-13   
ref|XP_010498944.1|  PREDICTED: probable galacturonosyltransferas...  71.6    9e-13   
ref|XP_011041756.1|  PREDICTED: probable galacturonosyltransferas...  71.6    9e-13   
ref|XP_002320324.1|  glycosyl transferase family 8 family protein     71.6    9e-13   
ref|XP_009782978.1|  PREDICTED: probable galacturonosyltransferas...  71.2    9e-13   
ref|XP_006390926.1|  hypothetical protein EUTSA_v10018687mg           71.6    1e-12   
ref|XP_010459954.1|  PREDICTED: probable galacturonosyltransferas...  70.9    1e-12   
ref|XP_007223040.1|  hypothetical protein PRUPE_ppa006911mg           71.6    1e-12   
emb|CDY40294.1|  BnaA07g09060D                                        71.2    1e-12   
emb|CDY28459.1|  BnaC07g12870D                                        71.2    1e-12   
ref|XP_008221480.1|  PREDICTED: probable galacturonosyltransferas...  71.2    1e-12   
ref|XP_009103133.1|  PREDICTED: probable galacturonosyltransferas...  71.2    1e-12   
ref|XP_011098541.1|  PREDICTED: probable galacturonosyltransferas...  70.9    1e-12   
gb|ACU19924.1|  unknown                                               70.1    1e-12   
ref|XP_003554536.1|  PREDICTED: probable galacturonosyltransferas...  70.9    1e-12   
ref|XP_010552615.1|  PREDICTED: probable galacturonosyltransferas...  71.2    1e-12   
gb|KHN23255.1|  Putative galacturonosyltransferase-like 4             68.6    1e-12   
ref|XP_006651295.1|  PREDICTED: probable galacturonosyltransferas...  70.9    1e-12   
ref|NP_001130691.1|  uncharacterized protein LOC100191794 precursor   70.9    1e-12   
ref|XP_010460195.1|  PREDICTED: probable galacturonosyltransferas...  71.2    1e-12   
ref|XP_008446274.1|  PREDICTED: probable galacturonosyltransferas...  70.9    1e-12   
ref|XP_008454308.1|  PREDICTED: probable galacturonosyltransferas...  70.9    2e-12   
ref|XP_006302365.1|  hypothetical protein CARUB_v10020432mg           71.2    2e-12   
ref|XP_004135219.1|  PREDICTED: probable galacturonosyltransferas...  70.9    2e-12   
ref|XP_008389313.1|  PREDICTED: probable galacturonosyltransferas...  70.9    2e-12   
ref|XP_009105687.1|  PREDICTED: probable galacturonosyltransferas...  70.9    2e-12   



>ref|XP_002510336.1| transferase, transferring glycosyl groups, putative [Ricinus 
communis]
 gb|EEF52523.1| transferase, transferring glycosyl groups, putative [Ricinus 
communis]
Length=356

 Score =   117 bits (294),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 63/76 (83%), Positives = 72/76 (95%), Gaps = 0/76 (0%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFVasasanaSLLRATIAASFPFLRFRVYR  49
            MTLD AYIRGSMAA+LS+LQHSSCPQNT FHFVASASANA+LLRATI++SFP+L+F+VY 
Sbjct  74   MTLDTAYIRGSMAAILSVLQHSSCPQNTAFHFVASASANATLLRATISSSFPYLKFKVYT  133

Query  48   FDVSSVARLISTSIRS  1
            FD SSV+RLISTSIRS
Sbjct  134  FDDSSVSRLISTSIRS  149



>ref|XP_009785169.1| PREDICTED: probable galacturonosyltransferase-like 1 [Nicotiana 
sylvestris]
Length=360

 Score =   117 bits (292),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 64/76 (84%), Positives = 71/76 (93%), Gaps = 0/76 (0%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFVasasanaSLLRATIAASFPFLRFRVYR  49
            MTLD+AYIRGSMAA+LSILQHSSCPQNT+FHFV SASANASLLRATI ASFP+L+F+VY+
Sbjct  78   MTLDSAYIRGSMAAILSILQHSSCPQNTIFHFVTSASANASLLRATILASFPYLKFQVYQ  137

Query  48   FDVSSVARLISTSIRS  1
            FD S VA LISTSIRS
Sbjct  138  FDDSYVAGLISTSIRS  153



>ref|XP_009595248.1| PREDICTED: probable galacturonosyltransferase-like 1 [Nicotiana 
tomentosiformis]
Length=359

 Score =   117 bits (292),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 65/76 (86%), Positives = 72/76 (95%), Gaps = 0/76 (0%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFVasasanaSLLRATIAASFPFLRFRVYR  49
            MTLD+AYIRGSMAA+LSILQHSSCPQNT+FHFVASASANASLLRATI ASFP+L+F+VY+
Sbjct  77   MTLDSAYIRGSMAAILSILQHSSCPQNTIFHFVASASANASLLRATILASFPYLKFQVYQ  136

Query  48   FDVSSVARLISTSIRS  1
            FD S VA LISTSIRS
Sbjct  137  FDDSYVAGLISTSIRS  152



>gb|ACW83060.1| glycosyltransferase family GT8 protein [Populus deltoides]
Length=362

 Score =   114 bits (285),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 63/76 (83%), Positives = 71/76 (93%), Gaps = 0/76 (0%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFVasasanaSLLRATIAASFPFLRFRVYR  49
            MTLDAAYIRGSMAA+LS+LQH+SCPQN  FHFVASASANASLLRATI++SFP+L+FRVY 
Sbjct  80   MTLDAAYIRGSMAAILSVLQHTSCPQNIAFHFVASASANASLLRATISSSFPYLKFRVYT  139

Query  48   FDVSSVARLISTSIRS  1
            FD SSV+ LISTSIRS
Sbjct  140  FDDSSVSGLISTSIRS  155



>ref|XP_002302469.1| glycosyl transferase family 8 family protein [Populus trichocarpa]
 gb|EEE81742.1| glycosyl transferase family 8 family protein [Populus trichocarpa]
 gb|ACW83061.1| glycosyltransferase family GT8 protein [Populus deltoides]
Length=353

 Score =   114 bits (285),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 62/76 (82%), Positives = 69/76 (91%), Gaps = 0/76 (0%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFVasasanaSLLRATIAASFPFLRFRVYR  49
            MTLD AYIRGSMAA+LS+LQH+SCPQN  FHFVASASAN SLLRATI++SFP+L FRVY 
Sbjct  71   MTLDTAYIRGSMAAILSVLQHTSCPQNIAFHFVASASANTSLLRATISSSFPYLNFRVYT  130

Query  48   FDVSSVARLISTSIRS  1
            FD SSV+RLISTSIRS
Sbjct  131  FDDSSVSRLISTSIRS  146



>ref|XP_011017288.1| PREDICTED: probable galacturonosyltransferase-like 1 [Populus 
euphratica]
Length=353

 Score =   114 bits (285),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 63/76 (83%), Positives = 68/76 (89%), Gaps = 0/76 (0%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFVasasanaSLLRATIAASFPFLRFRVYR  49
            MTLD AYIRGSMAA+LS+LQHSSCPQN  FHFVASASAN SLLRATI +SFP+L FRVY 
Sbjct  71   MTLDTAYIRGSMAAILSVLQHSSCPQNIAFHFVASASANTSLLRATILSSFPYLNFRVYT  130

Query  48   FDVSSVARLISTSIRS  1
            FD SSV+RLISTSIRS
Sbjct  131  FDDSSVSRLISTSIRS  146



>gb|AFM77986.1| glycosyltransferase 8F [Populus tremula x Populus alba]
Length=362

 Score =   114 bits (285),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 63/76 (83%), Positives = 71/76 (93%), Gaps = 0/76 (0%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFVasasanaSLLRATIAASFPFLRFRVYR  49
            MTLDAAYIRGSMAA+LS+LQH+SCPQN  FHFVASASANASLLRATI++SFP+L+FRVY 
Sbjct  80   MTLDAAYIRGSMAAILSVLQHTSCPQNIAFHFVASASANASLLRATISSSFPYLKFRVYT  139

Query  48   FDVSSVARLISTSIRS  1
            FD SSV+ LISTSIRS
Sbjct  140  FDDSSVSGLISTSIRS  155



>ref|XP_004238218.1| PREDICTED: probable galacturonosyltransferase-like 1 [Solanum 
lycopersicum]
Length=343

 Score =   114 bits (284),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 63/76 (83%), Positives = 70/76 (92%), Gaps = 0/76 (0%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFVasasanaSLLRATIAASFPFLRFRVYR  49
            MTLD+AYIRGSMAA+LSILQHSSCPQN +FHFVASASA+AS LRATI ASFP+L+F VYR
Sbjct  61   MTLDSAYIRGSMAAILSILQHSSCPQNIIFHFVASASADASHLRATILASFPYLKFEVYR  120

Query  48   FDVSSVARLISTSIRS  1
            FD SSV+ LISTSIRS
Sbjct  121  FDDSSVSGLISTSIRS  136



>ref|XP_007017450.1| Nucleotide-diphospho-sugar transferases superfamily protein [Theobroma 
cacao]
 gb|EOY14675.1| Nucleotide-diphospho-sugar transferases superfamily protein [Theobroma 
cacao]
Length=353

 Score =   114 bits (284),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 62/76 (82%), Positives = 70/76 (92%), Gaps = 0/76 (0%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFVasasanaSLLRATIAASFPFLRFRVYR  49
            MTLD AYIRGSMAA+LS+LQHSSCPQN  FHFVASA+ANASLLRATI++SFP+L F+VY 
Sbjct  71   MTLDKAYIRGSMAAILSVLQHSSCPQNIAFHFVASATANASLLRATISSSFPYLNFQVYP  130

Query  48   FDVSSVARLISTSIRS  1
            FD SSV+RLISTSIRS
Sbjct  131  FDDSSVSRLISTSIRS  146



>ref|XP_006366462.1| PREDICTED: probable galacturonosyltransferase-like 1-like [Solanum 
tuberosum]
Length=351

 Score =   114 bits (284),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 63/76 (83%), Positives = 70/76 (92%), Gaps = 0/76 (0%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFVasasanaSLLRATIAASFPFLRFRVYR  49
            MTLD+AYIRGSMAA+LSILQHSSCPQN +FHFVASASA+AS LRATI ASFP+L+F VYR
Sbjct  69   MTLDSAYIRGSMAAILSILQHSSCPQNIIFHFVASASADASHLRATILASFPYLKFEVYR  128

Query  48   FDVSSVARLISTSIRS  1
            FD SSV+ LISTSIRS
Sbjct  129  FDDSSVSGLISTSIRS  144



>gb|KDP38459.1| hypothetical protein JCGZ_04384 [Jatropha curcas]
Length=365

 Score =   113 bits (283),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 62/76 (82%), Positives = 71/76 (93%), Gaps = 0/76 (0%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFVasasanaSLLRATIAASFPFLRFRVYR  49
            MTLD AYIRGSMAA+LS+LQHSSCPQN  FHFVASASANASLLR+TI++SFP+L+F+VY 
Sbjct  83   MTLDTAYIRGSMAAILSVLQHSSCPQNIAFHFVASASANASLLRSTISSSFPYLKFQVYT  142

Query  48   FDVSSVARLISTSIRS  1
            FD SSV+RLISTSIRS
Sbjct  143  FDDSSVSRLISTSIRS  158



>ref|XP_006375055.1| glycosyl transferase family 8 family protein [Populus trichocarpa]
 gb|ABK94510.1| unknown [Populus trichocarpa]
 gb|ERP52852.1| glycosyl transferase family 8 family protein [Populus trichocarpa]
Length=362

 Score =   112 bits (281),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 62/76 (82%), Positives = 70/76 (92%), Gaps = 0/76 (0%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFVasasanaSLLRATIAASFPFLRFRVYR  49
            MTLDAAYIRGSMAA+LS+LQH+SCPQN  FHFVASASANASLLRATI++SFP+L+FR Y 
Sbjct  80   MTLDAAYIRGSMAAILSVLQHTSCPQNIAFHFVASASANASLLRATISSSFPYLKFRAYT  139

Query  48   FDVSSVARLISTSIRS  1
            FD SSV+ LISTSIRS
Sbjct  140  FDDSSVSGLISTSIRS  155



>ref|XP_006434923.1| hypothetical protein CICLE_v10001658mg [Citrus clementina]
 gb|ESR48163.1| hypothetical protein CICLE_v10001658mg [Citrus clementina]
Length=354

 Score =   111 bits (277),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 60/76 (79%), Positives = 68/76 (89%), Gaps = 0/76 (0%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFVasasanaSLLRATIAASFPFLRFRVYR  49
            MTLD+AYIRGSMAA+LS+LQHSSCPQN  FHFV SA ANASLLRATI+ SFP+L+FRV+ 
Sbjct  73   MTLDSAYIRGSMAAILSVLQHSSCPQNIAFHFVTSAKANASLLRATISTSFPYLKFRVHP  132

Query  48   FDVSSVARLISTSIRS  1
            FD SSV+ LISTSIRS
Sbjct  133  FDDSSVSGLISTSIRS  148



>ref|XP_006473446.1| PREDICTED: probable galacturonosyltransferase-like 1-like [Citrus 
sinensis]
Length=354

 Score =   111 bits (277),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 61/76 (80%), Positives = 69/76 (91%), Gaps = 0/76 (0%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFVasasanaSLLRATIAASFPFLRFRVYR  49
            MTLD+AYIRGSMAA+LS+LQHSSCPQN  FHFVASA ANASLLRATI+ SFP+L+FRV+ 
Sbjct  73   MTLDSAYIRGSMAAILSVLQHSSCPQNIAFHFVASAKANASLLRATISTSFPYLKFRVHP  132

Query  48   FDVSSVARLISTSIRS  1
            FD SSV+ LISTSIRS
Sbjct  133  FDDSSVSGLISTSIRS  148



>emb|CAN66819.1| hypothetical protein VITISV_004777 [Vitis vinifera]
Length=364

 Score =   111 bits (277),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 61/76 (80%), Positives = 70/76 (92%), Gaps = 0/76 (0%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFVasasanaSLLRATIAASFPFLRFRVYR  49
            MTLD AYIRGS+AA+LS+LQHSSCPQN VFHFVASAS+NASLLRATI+ +FP+LRF+VY 
Sbjct  82   MTLDTAYIRGSVAAILSVLQHSSCPQNVVFHFVASASSNASLLRATISTTFPYLRFQVYS  141

Query  48   FDVSSVARLISTSIRS  1
            FD S+VA LISTSIRS
Sbjct  142  FDDSAVAGLISTSIRS  157



>ref|XP_002281848.2| PREDICTED: probable galacturonosyltransferase-like 1 [Vitis vinifera]
Length=388

 Score =   110 bits (276),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 61/76 (80%), Positives = 70/76 (92%), Gaps = 0/76 (0%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFVasasanaSLLRATIAASFPFLRFRVYR  49
            MTLD AYIRGS+AA+LS+LQHSSCPQN VFHFVASAS+NASLLRATI+ +FP+LRF+VY 
Sbjct  106  MTLDTAYIRGSVAAILSVLQHSSCPQNVVFHFVASASSNASLLRATISTTFPYLRFQVYS  165

Query  48   FDVSSVARLISTSIRS  1
            FD S+VA LISTSIRS
Sbjct  166  FDDSAVAGLISTSIRS  181



>ref|XP_010498344.1| PREDICTED: probable galacturonosyltransferase-like 1 [Camelina 
sativa]
Length=351

 Score =   110 bits (276),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 62/76 (82%), Positives = 72/76 (95%), Gaps = 0/76 (0%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFVasasanaSLLRATIAASFPFLRFRVYR  49
            MTLDAAYIRGS+AAVLS+LQHSSCP+N VFHFVASASA+AS LRATI++SFP+L F+VY 
Sbjct  69   MTLDAAYIRGSVAAVLSVLQHSSCPENIVFHFVASASADASSLRATISSSFPYLDFKVYV  128

Query  48   FDVSSVARLISTSIRS  1
            F+VSSV+RLISTSIRS
Sbjct  129  FNVSSVSRLISTSIRS  144



>ref|XP_008444675.1| PREDICTED: probable galacturonosyltransferase-like 1 [Cucumis 
melo]
Length=349

 Score =   110 bits (276),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 57/76 (75%), Positives = 69/76 (91%), Gaps = 0/76 (0%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFVasasanaSLLRATIAASFPFLRFRVYR  49
            MTLD AYIRGSMAA+LS+LQHSSCPQN +FHFV+SASAN S LRATI++SFP+L+F++Y 
Sbjct  68   MTLDTAYIRGSMAAILSVLQHSSCPQNVIFHFVSSASANVSALRATISSSFPYLKFQIYP  127

Query  48   FDVSSVARLISTSIRS  1
            FD  +V+RLISTSIRS
Sbjct  128  FDDGAVSRLISTSIRS  143



>ref|XP_010459593.1| PREDICTED: probable galacturonosyltransferase-like 1 [Camelina 
sativa]
Length=350

 Score =   110 bits (275),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 62/76 (82%), Positives = 72/76 (95%), Gaps = 0/76 (0%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFVasasanaSLLRATIAASFPFLRFRVYR  49
            MTLDAAYIRGS+AAVLS+LQHSSCP+N VFHFVASASA+AS LRATI++SFP+L F+VY 
Sbjct  68   MTLDAAYIRGSVAAVLSVLQHSSCPENIVFHFVASASADASSLRATISSSFPYLDFKVYV  127

Query  48   FDVSSVARLISTSIRS  1
            F+VSSV+RLISTSIRS
Sbjct  128  FNVSSVSRLISTSIRS  143



>ref|XP_010477136.1| PREDICTED: probable galacturonosyltransferase-like 1 [Camelina 
sativa]
Length=346

 Score =   110 bits (275),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 62/76 (82%), Positives = 72/76 (95%), Gaps = 0/76 (0%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFVasasanaSLLRATIAASFPFLRFRVYR  49
            MTLDAAYIRGS+AAVLS+LQHSSCP+N VFHFVASASA+AS LRATI++SFP+L F+VY 
Sbjct  64   MTLDAAYIRGSVAAVLSVLQHSSCPENIVFHFVASASADASSLRATISSSFPYLDFKVYV  123

Query  48   FDVSSVARLISTSIRS  1
            F+VSSV+RLISTSIRS
Sbjct  124  FNVSSVSRLISTSIRS  139



>gb|KGN62567.1| hypothetical protein Csa_2G360840 [Cucumis sativus]
Length=347

 Score =   110 bits (275),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 58/76 (76%), Positives = 70/76 (92%), Gaps = 0/76 (0%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFVasasanaSLLRATIAASFPFLRFRVYR  49
            MTLD AYIRGSMAA+LS+LQHSSCPQN +FHFV+SASANAS LRATI++SFP+L+F++Y 
Sbjct  66   MTLDTAYIRGSMAAILSVLQHSSCPQNVIFHFVSSASANASALRATISSSFPYLKFQIYP  125

Query  48   FDVSSVARLISTSIRS  1
            FD  +V+RLISTSIRS
Sbjct  126  FDDGAVSRLISTSIRS  141



>ref|XP_009374216.1| PREDICTED: probable galacturonosyltransferase-like 1 [Pyrus x 
bretschneideri]
Length=354

 Score =   110 bits (274),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 54/76 (71%), Positives = 68/76 (89%), Gaps = 0/76 (0%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFVasasanaSLLRATIAASFPFLRFRVYR  49
            MTLDA Y+RGSMAA+LS+LQHSSCP+N +FHFV+S+++N+ LL+ TIA SFP+L+FRVY 
Sbjct  72   MTLDAVYLRGSMAAILSVLQHSSCPENVIFHFVSSSTSNSQLLQQTIAKSFPYLKFRVYP  131

Query  48   FDVSSVARLISTSIRS  1
            FD S+VA LISTSIRS
Sbjct  132  FDDSAVAGLISTSIRS  147



>ref|XP_004152786.1| PREDICTED: probable galacturonosyltransferase-like 1-like [Cucumis 
sativus]
 ref|XP_004160051.1| PREDICTED: probable galacturonosyltransferase-like 1-like [Cucumis 
sativus]
Length=347

 Score =   110 bits (274),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 58/76 (76%), Positives = 70/76 (92%), Gaps = 0/76 (0%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFVasasanaSLLRATIAASFPFLRFRVYR  49
            MTLD AYIRGSMAA+LS+LQHSSCPQN +FHFV+SASANAS LRATI++SFP+L+F++Y 
Sbjct  66   MTLDTAYIRGSMAAILSVLQHSSCPQNVIFHFVSSASANASALRATISSSFPYLKFQIYP  125

Query  48   FDVSSVARLISTSIRS  1
            FD  +V+RLISTSIRS
Sbjct  126  FDDGAVSRLISTSIRS  141



>ref|XP_010026048.1| PREDICTED: probable galacturonosyltransferase-like 1 [Eucalyptus 
grandis]
 gb|KCW88065.1| hypothetical protein EUGRSUZ_A00485 [Eucalyptus grandis]
Length=363

 Score =   109 bits (273),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 61/76 (80%), Positives = 68/76 (89%), Gaps = 0/76 (0%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFVasasanaSLLRATIAASFPFLRFRVYR  49
            MTLD AYIRGSMAA+LSILQHSSCPQN VFHFVASASA+A  LRATI+ASFP+LRF +YR
Sbjct  81   MTLDTAYIRGSMAAILSILQHSSCPQNVVFHFVASASADAPHLRATISASFPYLRFWLYR  140

Query  48   FDVSSVARLISTSIRS  1
            F  S+V+ LISTSIRS
Sbjct  141  FHDSAVSGLISTSIRS  156



>ref|XP_010529742.1| PREDICTED: probable galacturonosyltransferase-like 1 [Tarenaya 
hassleriana]
Length=360

 Score =   108 bits (270),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 56/77 (73%), Positives = 69/77 (90%), Gaps = 1/77 (1%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFVasasanaSL-LRATIAASFPFLRFRVY  52
            MTLD AYIRGSMAA+LS+LQHSSCP+N VFHF+ASAS + +  LRAT++ASFP+L+F+VY
Sbjct  73   MTLDGAYIRGSMAAILSVLQHSSCPENVVFHFIASASNDGAWNLRATVSASFPYLKFKVY  132

Query  51   RFDVSSVARLISTSIRS  1
             FD S+V+RLISTSIRS
Sbjct  133  VFDDSAVSRLISTSIRS  149



>ref|XP_007223317.1| hypothetical protein PRUPE_ppa007313mg [Prunus persica]
 gb|EMJ24516.1| hypothetical protein PRUPE_ppa007313mg [Prunus persica]
Length=373

 Score =   108 bits (270),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 58/76 (76%), Positives = 68/76 (89%), Gaps = 0/76 (0%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFVasasanaSLLRATIAASFPFLRFRVYR  49
            MTLD AYIRGSMAA+LS+LQHSSCPQN VFHFVASA++NASLLR TI++SFP+L+FR+Y 
Sbjct  91   MTLDTAYIRGSMAAILSVLQHSSCPQNAVFHFVASATSNASLLRDTISSSFPYLKFRIYP  150

Query  48   FDVSSVARLISTSIRS  1
            FD S V+ LIS SIRS
Sbjct  151  FDDSHVSGLISISIRS  166



>ref|XP_011031298.1| PREDICTED: probable galacturonosyltransferase-like 1 [Populus 
euphratica]
Length=364

 Score =   108 bits (270),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 63/78 (81%), Positives = 71/78 (91%), Gaps = 2/78 (3%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFV--asasanaSLLRATIAASFPFLRFRV  55
            MTLDAAYIRGSMAA+LS+LQH+SCPQN  FHFV  ASASANASLLRATI++SFP+L+FRV
Sbjct  80   MTLDAAYIRGSMAAILSVLQHTSCPQNIAFHFVASASASANASLLRATISSSFPYLKFRV  139

Query  54   YRFDVSSVARLISTSIRS  1
            Y FD SSV+ LISTSIRS
Sbjct  140  YTFDDSSVSGLISTSIRS  157



>ref|XP_010106045.1| putative galacturonosyltransferase-like 1 [Morus notabilis]
 gb|EXC07315.1| putative galacturonosyltransferase-like 1 [Morus notabilis]
Length=357

 Score =   107 bits (267),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 57/76 (75%), Positives = 70/76 (92%), Gaps = 0/76 (0%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFVasasanaSLLRATIAASFPFLRFRVYR  49
            MTLD AYIRGSMAA+LS+LQHSSCPQN + HFVASASA+ASLLRAT+++SFP+L+F++Y 
Sbjct  75   MTLDTAYIRGSMAAILSVLQHSSCPQNVLIHFVASASADASLLRATLSSSFPYLKFQIYP  134

Query  48   FDVSSVARLISTSIRS  1
            FD S+V+ LISTSIRS
Sbjct  135  FDDSAVSGLISTSIRS  150



>ref|XP_008466622.1| PREDICTED: probable galacturonosyltransferase-like 1 [Cucumis 
melo]
Length=342

 Score =   107 bits (267),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 56/76 (74%), Positives = 67/76 (88%), Gaps = 0/76 (0%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFVasasanaSLLRATIAASFPFLRFRVYR  49
            MTLD AYIRGSMAAVLS+LQHSSCPQN +FHFV SASAN+S LR T++ SFP+L+F++Y 
Sbjct  60   MTLDTAYIRGSMAAVLSVLQHSSCPQNVIFHFVYSASANSSFLRTTLSHSFPYLKFQLYP  119

Query  48   FDVSSVARLISTSIRS  1
            FD  +V+RLISTSIRS
Sbjct  120  FDDEAVSRLISTSIRS  135



>ref|XP_002269182.1| PREDICTED: probable galacturonosyltransferase-like 1 [Vitis vinifera]
Length=351

 Score =   107 bits (267),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 58/76 (76%), Positives = 68/76 (89%), Gaps = 0/76 (0%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFVasasanaSLLRATIAASFPFLRFRVYR  49
            MTLDAAYIRGSMAA+LS+LQH++CP+N  FHFVASASA+A  LR TIA SFP+LRFRVYR
Sbjct  69   MTLDAAYIRGSMAAILSVLQHATCPENVNFHFVASASADAHHLRRTIANSFPYLRFRVYR  128

Query  48   FDVSSVARLISTSIRS  1
            FD S+V+ LISTSIR+
Sbjct  129  FDDSAVSGLISTSIRA  144



>ref|XP_004147816.1| PREDICTED: probable galacturonosyltransferase-like 1-like [Cucumis 
sativus]
 ref|XP_004154902.1| PREDICTED: probable galacturonosyltransferase-like 1-like [Cucumis 
sativus]
 gb|KGN59931.1| hypothetical protein Csa_3G854760 [Cucumis sativus]
Length=342

 Score =   107 bits (266),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 56/76 (74%), Positives = 68/76 (89%), Gaps = 0/76 (0%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFVasasanaSLLRATIAASFPFLRFRVYR  49
            MTLD AY+RGSMAAVLS+LQHSSCPQN +FHFV SASAN+S LRAT++ SFP+L+F++Y 
Sbjct  60   MTLDTAYLRGSMAAVLSVLQHSSCPQNVIFHFVHSASANSSSLRATLSHSFPYLKFQLYP  119

Query  48   FDVSSVARLISTSIRS  1
            FD  +V+RLISTSIRS
Sbjct  120  FDDEAVSRLISTSIRS  135



>ref|XP_008377352.1| PREDICTED: probable galacturonosyltransferase-like 1 [Malus domestica]
Length=358

 Score =   107 bits (266),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 61/76 (80%), Positives = 69/76 (91%), Gaps = 0/76 (0%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFVasasanaSLLRATIAASFPFLRFRVYR  49
            MTLD AYIRGSMAA+LSILQHSSCPQN VFHFVASA+ANASLLR TI+ASFP+L+FR+Y 
Sbjct  76   MTLDTAYIRGSMAAILSILQHSSCPQNAVFHFVASAAANASLLRQTISASFPYLKFRIYS  135

Query  48   FDVSSVARLISTSIRS  1
            FD S V+ LI+TSIRS
Sbjct  136  FDDSHVSGLITTSIRS  151



>gb|KCW67801.1| hypothetical protein EUGRSUZ_F01531 [Eucalyptus grandis]
Length=426

 Score =   107 bits (266),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 55/77 (71%), Positives = 72/77 (94%), Gaps = 1/77 (1%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFV-asasanaSLLRATIAASFPFLRFRVY  52
            MTLDAAYIRGSMAA+LS+LQHS+CPQN +FHFV ++A+A+ASLLRAT+++SFP+LRF+++
Sbjct  89   MTLDAAYIRGSMAAILSVLQHSTCPQNVIFHFVYSAATADASLLRATVSSSFPYLRFQLH  148

Query  51   RFDVSSVARLISTSIRS  1
             FD S+V+ LISTSIRS
Sbjct  149  PFDASAVSGLISTSIRS  165



>ref|XP_009364319.1| PREDICTED: probable galacturonosyltransferase-like 1 [Pyrus x 
bretschneideri]
Length=361

 Score =   106 bits (265),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 59/76 (78%), Positives = 66/76 (87%), Gaps = 0/76 (0%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFVasasanaSLLRATIAASFPFLRFRVYR  49
            MTLD AYIRGSMAA+LSILQHSSCPQN VFHFVASA+ANAS LR TI+ SFP+L+FR+Y 
Sbjct  79   MTLDTAYIRGSMAAILSILQHSSCPQNAVFHFVASAAANASHLRQTISTSFPYLKFRIYS  138

Query  48   FDVSSVARLISTSIRS  1
            FD S V+ LIS SIRS
Sbjct  139  FDDSHVSGLISISIRS  154



>ref|XP_008440161.1| PREDICTED: probable galacturonosyltransferase-like 1 [Cucumis 
melo]
Length=346

 Score =   106 bits (264),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 54/76 (71%), Positives = 65/76 (86%), Gaps = 0/76 (0%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFVasasanaSLLRATIAASFPFLRFRVYR  49
            MTLDAAY+RGSMAA+LS+LQHSSCPQN +FHF++SAS +   LR TIA SFP+L+F VY 
Sbjct  64   MTLDAAYLRGSMAAILSVLQHSSCPQNIIFHFLSSASTDTHSLRFTIANSFPYLKFHVYP  123

Query  48   FDVSSVARLISTSIRS  1
            FD ++VA LISTSIRS
Sbjct  124  FDAAAVAGLISTSIRS  139



>gb|KGN48449.1| Glycosyltransferase family GT8 protein [Cucumis sativus]
Length=351

 Score =   106 bits (264),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 54/76 (71%), Positives = 65/76 (86%), Gaps = 0/76 (0%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFVasasanaSLLRATIAASFPFLRFRVYR  49
            MTLDAAY+RGSMAA+LS+LQHSSCPQN +FHF++SAS +   LR TIA SFP+L+F VY 
Sbjct  69   MTLDAAYLRGSMAAILSVLQHSSCPQNIIFHFLSSASTDTHSLRFTIANSFPYLKFHVYP  128

Query  48   FDVSSVARLISTSIRS  1
            FD ++VA LISTSIRS
Sbjct  129  FDAAAVAGLISTSIRS  144



>ref|XP_004141952.1| PREDICTED: LOW QUALITY PROTEIN: probable galacturonosyltransferase-like 
2-like [Cucumis sativus]
Length=352

 Score =   106 bits (264),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 54/76 (71%), Positives = 65/76 (86%), Gaps = 0/76 (0%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFVasasanaSLLRATIAASFPFLRFRVYR  49
            MTLDAAY+RGSMAA+LS+LQHSSCPQN +FHF++SAS +   LR TIA SFP+L+F VY 
Sbjct  70   MTLDAAYLRGSMAAILSVLQHSSCPQNIIFHFLSSASTDTHSLRFTIANSFPYLKFHVYP  129

Query  48   FDVSSVARLISTSIRS  1
            FD ++VA LISTSIRS
Sbjct  130  FDAAAVAGLISTSIRS  145



>ref|XP_004157857.1| PREDICTED: probable galacturonosyltransferase-like 2-like, partial 
[Cucumis sativus]
Length=363

 Score =   106 bits (264),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 54/76 (71%), Positives = 65/76 (86%), Gaps = 0/76 (0%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFVasasanaSLLRATIAASFPFLRFRVYR  49
            MTLDAAY+RGSMAA+LS+LQHSSCPQN +FHF++SAS +   LR TIA SFP+L+F VY 
Sbjct  81   MTLDAAYLRGSMAAILSVLQHSSCPQNIIFHFLSSASTDTHSLRFTIANSFPYLKFHVYP  140

Query  48   FDVSSVARLISTSIRS  1
            FD ++VA LISTSIRS
Sbjct  141  FDAAAVAGLISTSIRS  156



>ref|XP_008347395.1| PREDICTED: probable galacturonosyltransferase-like 1 [Malus domestica]
 ref|XP_008357167.1| PREDICTED: probable galacturonosyltransferase-like 1 [Malus domestica]
Length=361

 Score =   105 bits (262),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 60/76 (79%), Positives = 68/76 (89%), Gaps = 0/76 (0%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFVasasanaSLLRATIAASFPFLRFRVYR  49
            MTLD AYIRGSMAA+LS+LQHSSCPQN VFHFVASA+ANASLLR TI+ SFP+L+FR+Y 
Sbjct  79   MTLDTAYIRGSMAAILSVLQHSSCPQNAVFHFVASAAANASLLRQTISTSFPYLKFRIYA  138

Query  48   FDVSSVARLISTSIRS  1
            FD S V+ LISTSIRS
Sbjct  139  FDDSHVSGLISTSIRS  154



>ref|XP_004291912.1| PREDICTED: probable galacturonosyltransferase-like 1-like [Fragaria 
vesca subsp. vesca]
Length=373

 Score =   104 bits (260),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 57/76 (75%), Positives = 65/76 (86%), Gaps = 0/76 (0%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFVasasanaSLLRATIAASFPFLRFRVYR  49
            MTLD AYIRGSMAA+LS+LQHSSCPQN  FHFV SA+ANAS LR+TIA+SFP+L F++Y 
Sbjct  90   MTLDTAYIRGSMAAILSVLQHSSCPQNVAFHFVTSAAANASHLRSTIASSFPYLTFQIYP  149

Query  48   FDVSSVARLISTSIRS  1
            FD S V  LISTSIRS
Sbjct  150  FDDSHVTGLISTSIRS  165



>ref|XP_008338895.1| PREDICTED: probable galacturonosyltransferase-like 1 [Malus domestica]
Length=367

 Score =   103 bits (258),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 54/77 (70%), Positives = 68/77 (88%), Gaps = 1/77 (1%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFV-asasanaSLLRATIAASFPFLRFRVY  52
            MTLDAAY+RGSMAA+LS+LQHSSCP+N +FHFV +S+++N+ LL+  IA SFP+L+FRVY
Sbjct  84   MTLDAAYLRGSMAAILSVLQHSSCPENVIFHFVSSSSTSNSQLLQQIIATSFPYLKFRVY  143

Query  51   RFDVSSVARLISTSIRS  1
             FD S+VA LISTSIRS
Sbjct  144  PFDDSAVAGLISTSIRS  160



>ref|XP_009365616.1| PREDICTED: probable galacturonosyltransferase-like 1 [Pyrus x 
bretschneideri]
Length=360

 Score =   103 bits (257),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 59/76 (78%), Positives = 67/76 (88%), Gaps = 0/76 (0%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFVasasanaSLLRATIAASFPFLRFRVYR  49
            MTLD AYIRGSMAA+LS+LQHSSCPQN VFHFVASA+ANASLLR TI+ SFP+L+FR+Y 
Sbjct  78   MTLDTAYIRGSMAAILSVLQHSSCPQNAVFHFVASAAANASLLRQTISTSFPYLKFRIYA  137

Query  48   FDVSSVARLISTSIRS  1
            FD   V+ LISTSIRS
Sbjct  138  FDDYHVSGLISTSIRS  153



>emb|CDP07571.1| unnamed protein product [Coffea canephora]
Length=393

 Score =   103 bits (257),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 58/76 (76%), Positives = 69/76 (91%), Gaps = 0/76 (0%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFVasasanaSLLRATIAASFPFLRFRVYR  49
            MTLDAAYIRGS+AA+LSILQHSSCPQN +FHFV SAS+NASLL  T+A+SFP+L+F+VYR
Sbjct  111  MTLDAAYIRGSLAAILSILQHSSCPQNVIFHFVTSASSNASLLSTTVASSFPYLKFQVYR  170

Query  48   FDVSSVARLISTSIRS  1
            F  ++VA LISTSIRS
Sbjct  171  FADAAVAGLISTSIRS  186



>ref|XP_010099353.1| putative galacturonosyltransferase-like 2 [Morus notabilis]
 gb|EXB77874.1| putative galacturonosyltransferase-like 2 [Morus notabilis]
Length=366

 Score =   103 bits (256),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 50/76 (66%), Positives = 67/76 (88%), Gaps = 0/76 (0%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFVasasanaSLLRATIAASFPFLRFRVYR  49
            MTLDAAY+RGSMAA+LS+LQHSSCP+N  FHFVAS++A+   LR+T++ SFP+L+F++Y 
Sbjct  84   MTLDAAYLRGSMAAILSVLQHSSCPENIRFHFVASSAADRDSLRSTLSGSFPYLKFQIYP  143

Query  48   FDVSSVARLISTSIRS  1
            FD ++VA LISTSIR+
Sbjct  144  FDAAAVAGLISTSIRA  159



>ref|XP_010254968.1| PREDICTED: probable galacturonosyltransferase-like 1 [Nelumbo 
nucifera]
Length=351

 Score =   103 bits (256),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 54/76 (71%), Positives = 63/76 (83%), Gaps = 0/76 (0%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFVasasanaSLLRATIAASFPFLRFRVYR  49
            MTLDAAY+RGSMAA+LS+LQHSSCPQN  FHFV SASA+   LR TIA SFP+LRF +Y 
Sbjct  69   MTLDAAYLRGSMAAILSVLQHSSCPQNVDFHFVTSASADTDYLRRTIANSFPYLRFHLYH  128

Query  48   FDVSSVARLISTSIRS  1
             D S+V+ LISTSIR+
Sbjct  129  IDDSAVSGLISTSIRA  144



>gb|EYU44308.1| hypothetical protein MIMGU_mgv1a019931mg [Erythranthe guttata]
Length=336

 Score =   102 bits (253),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 52/76 (68%), Positives = 66/76 (87%), Gaps = 0/76 (0%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFVasasanaSLLRATIAASFPFLRFRVYR  49
            MTLDAAY+RGS+AAVLS+LQHSSCP+N VFHF AS+ A+ ++L  TI+ SFP+L+FR+Y 
Sbjct  54   MTLDAAYLRGSLAAVLSVLQHSSCPENIVFHFAASSVADTAVLSRTISRSFPYLQFRMYP  113

Query  48   FDVSSVARLISTSIRS  1
            FDVS+ A LISTSIR+
Sbjct  114  FDVSAAAGLISTSIRA  129



>ref|XP_010412709.1| PREDICTED: probable galacturonosyltransferase-like 2, partial 
[Camelina sativa]
Length=285

 Score =   101 bits (251),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 49/76 (64%), Positives = 65/76 (86%), Gaps = 2/76 (3%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFVasasanaSLLRATIAASFPFLRFRVYR  49
            MTLDAAY+RGSMAA+LS+LQHSSCPQN VFHFV S  ++   L+  +A+SFP+L+FR+Y 
Sbjct  58   MTLDAAYLRGSMAAILSVLQHSSCPQNIVFHFVTSKQSHR--LQNYVASSFPYLKFRIYP  115

Query  48   FDVSSVARLISTSIRS  1
            +DV++++ LISTSIRS
Sbjct  116  YDVAAISGLISTSIRS  131



>ref|XP_011099276.1| PREDICTED: probable galacturonosyltransferase-like 1 [Sesamum 
indicum]
Length=351

 Score =   101 bits (252),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 53/76 (70%), Positives = 67/76 (88%), Gaps = 0/76 (0%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFVasasanaSLLRATIAASFPFLRFRVYR  49
            MTLDAAY+RGSMAA+LS+LQHSSCP+N +FHFVAS+SAN+S L  TI+ SFP+L+F++Y 
Sbjct  69   MTLDAAYLRGSMAAILSVLQHSSCPENIIFHFVASSSANSSDLHRTISTSFPYLQFKIYP  128

Query  48   FDVSSVARLISTSIRS  1
            FD S+ A LISTSIR+
Sbjct  129  FDDSAAAGLISTSIRA  144



>ref|XP_010246976.1| PREDICTED: probable galacturonosyltransferase-like 1 [Nelumbo 
nucifera]
Length=356

 Score =   101 bits (252),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 53/76 (70%), Positives = 64/76 (84%), Gaps = 0/76 (0%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFVasasanaSLLRATIAASFPFLRFRVYR  49
            MTLDAAY+RGS+AA+LS+LQHSSCPQN  FHFV SASA+   LR TIA SFP+LRF +YR
Sbjct  74   MTLDAAYLRGSVAAILSVLQHSSCPQNIDFHFVTSASADTDYLRRTIANSFPYLRFHLYR  133

Query  48   FDVSSVARLISTSIRS  1
             D ++V+ LISTSIR+
Sbjct  134  IDDAAVSGLISTSIRA  149



>ref|XP_009589817.1| PREDICTED: probable galacturonosyltransferase-like 1 [Nicotiana 
tomentosiformis]
Length=369

 Score =   100 bits (250),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 52/76 (68%), Positives = 63/76 (83%), Gaps = 0/76 (0%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFVasasanaSLLRATIAASFPFLRFRVYR  49
            MTLDAAY+RGSMAA+LS+LQHSSCP+N +FHFVAS+SA+ + L  TIA SFP+L F +Y 
Sbjct  87   MTLDAAYLRGSMAAILSVLQHSSCPENVIFHFVASSSADTNYLNITIANSFPYLHFTIYP  146

Query  48   FDVSSVARLISTSIRS  1
            F  S VA LISTSIR+
Sbjct  147  FQDSGVAGLISTSIRA  162



>ref|XP_011074484.1| PREDICTED: probable galacturonosyltransferase-like 1 [Sesamum 
indicum]
Length=356

 Score =   100 bits (250),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 60/76 (79%), Positives = 66/76 (87%), Gaps = 0/76 (0%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFVasasanaSLLRATIAASFPFLRFRVYR  49
            MTLDAAYIRGSMAAVLSILQH+SCPQN  FHFVASASA+AS LR TI+ASFP L F++Y 
Sbjct  74   MTLDAAYIRGSMAAVLSILQHASCPQNVFFHFVASASADASALRDTISASFPDLIFQIYP  133

Query  48   FDVSSVARLISTSIRS  1
            F  S+VA LISTSIRS
Sbjct  134  FRDSAVAGLISTSIRS  149



>ref|XP_004300591.1| PREDICTED: probable galacturonosyltransferase-like 2-like [Fragaria 
vesca subsp. vesca]
Length=348

 Score =   100 bits (250),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 54/77 (70%), Positives = 65/77 (84%), Gaps = 1/77 (1%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFVasasanaS-LLRATIAASFPFLRFRVY  52
            MTLDAAY+RGSMAA+LS+LQHSSCP+N +FHFVA+AS + S LL  T+  SFP+L+FRVY
Sbjct  65   MTLDAAYLRGSMAAILSVLQHSSCPENVIFHFVAAASTSNSILLTQTLTTSFPYLKFRVY  124

Query  51   RFDVSSVARLISTSIRS  1
             F  S+VA LISTSIRS
Sbjct  125  PFGDSAVAGLISTSIRS  141



>ref|XP_009379176.1| PREDICTED: probable galacturonosyltransferase-like 1 [Pyrus x 
bretschneideri]
Length=356

 Score =   100 bits (249),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 52/77 (68%), Positives = 67/77 (87%), Gaps = 1/77 (1%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFV-asasanaSLLRATIAASFPFLRFRVY  52
            MTLDAAY+RGSMAA+LS+LQHSSCP+N +FHFV +S+++N+ LL+  I  SFP+L+FRV+
Sbjct  73   MTLDAAYLRGSMAAILSVLQHSSCPENVIFHFVSSSSTSNSQLLQQIIETSFPYLKFRVH  132

Query  51   RFDVSSVARLISTSIRS  1
             FD S+VA LISTSIRS
Sbjct  133  PFDDSAVAGLISTSIRS  149



>gb|KEH40084.1| CAZy family GT8 glycosyltransferase [Medicago truncatula]
Length=367

 Score =   100 bits (248),  Expect = 3e-23, Method: Composition-based stats.
 Identities = 52/76 (68%), Positives = 62/76 (82%), Gaps = 2/76 (3%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFVasasanaSLLRATIAASFPFLRFRVYR  49
            MTLD  YIRGSMAA+LS+LQHSSCPQN +FHFV   S+N SLL + I+ SFP+L+F+VY 
Sbjct  86   MTLDTTYIRGSMAAILSVLQHSSCPQNIIFHFV--CSSNTSLLHSIISKSFPYLKFQVYN  143

Query  48   FDVSSVARLISTSIRS  1
            FD S V+ LISTSIRS
Sbjct  144  FDDSIVSGLISTSIRS  159



>ref|XP_009762034.1| PREDICTED: probable galacturonosyltransferase-like 1 [Nicotiana 
sylvestris]
Length=362

 Score = 99.8 bits (247),  Expect = 4e-23, Method: Composition-based stats.
 Identities = 52/76 (68%), Positives = 63/76 (83%), Gaps = 0/76 (0%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFVasasanaSLLRATIAASFPFLRFRVYR  49
            MTLDAAY+RGSMAA+LS+LQHSSCP+N +FHFVAS+SA+ + L  TIA SFP+L F +Y 
Sbjct  80   MTLDAAYLRGSMAAILSVLQHSSCPENVIFHFVASSSADTNYLNITIANSFPYLHFTIYP  139

Query  48   FDVSSVARLISTSIRS  1
            F  S VA LISTSIR+
Sbjct  140  FQDSGVAGLISTSIRA  155



>ref|XP_010426618.1| PREDICTED: probable galacturonosyltransferase-like 2 [Camelina 
sativa]
Length=342

 Score = 99.4 bits (246),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 48/76 (63%), Positives = 64/76 (84%), Gaps = 2/76 (3%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFVasasanaSLLRATIAASFPFLRFRVYR  49
            MTLDAAY+RGSMA +LS+LQHSSCPQN VFHFV S  ++   L+  +A+SFP+L+FR+Y 
Sbjct  58   MTLDAAYLRGSMAVILSVLQHSSCPQNIVFHFVTSKQSHR--LQNYVASSFPYLKFRIYP  115

Query  48   FDVSSVARLISTSIRS  1
            +DV++++ LISTSIRS
Sbjct  116  YDVAAISGLISTSIRS  131



>ref|XP_003528195.1| PREDICTED: probable galacturonosyltransferase-like 1-like [Glycine 
max]
Length=366

 Score = 99.4 bits (246),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 53/76 (70%), Positives = 63/76 (83%), Gaps = 2/76 (3%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFVasasanaSLLRATIAASFPFLRFRVYR  49
            MTLD  YIRGSMAA+LS+LQHSSCPQNT FHFV   S++ASLLRA I+ SFP+L F++Y 
Sbjct  86   MTLDTTYIRGSMAAILSVLQHSSCPQNTFFHFV--CSSSASLLRAAISHSFPYLNFQLYT  143

Query  48   FDVSSVARLISTSIRS  1
            FD S V+ LIS+SIRS
Sbjct  144  FDDSQVSGLISSSIRS  159



>ref|XP_003523583.1| PREDICTED: probable galacturonosyltransferase-like 1-like [Glycine 
max]
Length=353

 Score = 99.0 bits (245),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 53/76 (70%), Positives = 62/76 (82%), Gaps = 2/76 (3%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFVasasanaSLLRATIAASFPFLRFRVYR  49
            MTLD  YIRGSMAA+LS++QHSSCPQNT FHFV   S++ASLLRA I+ SFP+L F +Y 
Sbjct  73   MTLDTTYIRGSMAAILSVIQHSSCPQNTFFHFV--CSSSASLLRAAISHSFPYLNFHLYT  130

Query  48   FDVSSVARLISTSIRS  1
            FD S V+ LISTSIRS
Sbjct  131  FDDSQVSGLISTSIRS  146



>ref|XP_004499118.1| PREDICTED: probable galacturonosyltransferase-like 1-like [Cicer 
arietinum]
Length=365

 Score = 98.6 bits (244),  Expect = 9e-23, Method: Composition-based stats.
 Identities = 53/76 (70%), Positives = 61/76 (80%), Gaps = 2/76 (3%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFVasasanaSLLRATIAASFPFLRFRVYR  49
            MTLD  YIRGSMAA+LS+LQHSSCPQN  FHFV   S+N SLL +TI  SFP+L+F+VY 
Sbjct  85   MTLDTTYIRGSMAAILSVLQHSSCPQNIFFHFV--CSSNTSLLNSTIFKSFPYLKFQVYN  142

Query  48   FDVSSVARLISTSIRS  1
            FD S V+ LISTSIRS
Sbjct  143  FDDSIVSGLISTSIRS  158



>gb|EPS69893.1| hypothetical protein M569_04868, partial [Genlisea aurea]
Length=314

 Score = 98.2 bits (243),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 53/76 (70%), Positives = 57/76 (75%), Gaps = 1/76 (1%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFVasasanaSLLRATIAASFPFLRFRVYR  49
            MTLD AYIRGSMAAVLSILQH+SCPQN  FHFVA     A  L  TI  SFP+L + +YR
Sbjct  33   MTLDMAYIRGSMAAVLSILQHTSCPQNVFFHFVAGGGGGAE-LDETIVGSFPYLSYGIYR  91

Query  48   FDVSSVARLISTSIRS  1
            FD S VA LISTSIRS
Sbjct  92   FDDSRVAGLISTSIRS  107



>ref|XP_007136565.1| hypothetical protein PHAVU_009G055600g [Phaseolus vulgaris]
 gb|ESW08559.1| hypothetical protein PHAVU_009G055600g [Phaseolus vulgaris]
Length=366

 Score = 98.6 bits (244),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 54/76 (71%), Positives = 61/76 (80%), Gaps = 2/76 (3%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFVasasanaSLLRATIAASFPFLRFRVYR  49
            MTLD  YIRGSMAA+LS+LQHSSCPQN  FHFV   S+NASLLRA I+ SFP+L F +Y 
Sbjct  86   MTLDTTYIRGSMAAILSVLQHSSCPQNIFFHFV--CSSNASLLRAAISNSFPYLNFHLYT  143

Query  48   FDVSSVARLISTSIRS  1
            FD S V+ LISTSIRS
Sbjct  144  FDDSQVSGLISTSIRS  159



>ref|XP_007202265.1| hypothetical protein PRUPE_ppa007777mg [Prunus persica]
 ref|XP_008241617.1| PREDICTED: probable galacturonosyltransferase-like 1 [Prunus 
mume]
 gb|EMJ03464.1| hypothetical protein PRUPE_ppa007777mg [Prunus persica]
Length=356

 Score = 98.6 bits (244),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 53/77 (69%), Positives = 66/77 (86%), Gaps = 1/77 (1%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFV-asasanaSLLRATIAASFPFLRFRVY  52
            MTLDAAY+RGSMAA+LS+LQHSSCP+N +FHFV +S+S+N+  L  TIA SFP+L+FRVY
Sbjct  73   MTLDAAYLRGSMAAILSVLQHSSCPENIIFHFVSSSSSSNSQALTQTIATSFPYLKFRVY  132

Query  51   RFDVSSVARLISTSIRS  1
             F+ S+V  LISTSIRS
Sbjct  133  PFNDSAVLGLISTSIRS  149



>ref|XP_004501044.1| PREDICTED: probable galacturonosyltransferase-like 1-like [Cicer 
arietinum]
Length=357

 Score = 98.6 bits (244),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 54/76 (71%), Positives = 62/76 (82%), Gaps = 2/76 (3%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFVasasanaSLLRATIAASFPFLRFRVYR  49
            MTLD  YIRGSMAA+LSILQHSSCPQN  FHFV   S+NASLLRA I  SFP+L+F +Y 
Sbjct  77   MTLDTTYIRGSMAAILSILQHSSCPQNIFFHFV--CSSNASLLRAAITTSFPYLKFHLYT  134

Query  48   FDVSSVARLISTSIRS  1
            F+ S+V+ LISTSIRS
Sbjct  135  FNDSTVSGLISTSIRS  150



>emb|CDP02412.1| unnamed protein product [Coffea canephora]
Length=283

 Score = 97.4 bits (241),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 52/76 (68%), Positives = 63/76 (83%), Gaps = 0/76 (0%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFVasasanaSLLRATIAASFPFLRFRVYR  49
            MTLD AY+RGSMA +LS+LQH+SCP+N +FHFVASASA+ S L  TIA SFP+L F +Y 
Sbjct  1    MTLDVAYLRGSMAVILSVLQHTSCPENVIFHFVASASADISHLNLTIAESFPYLSFTIYP  60

Query  48   FDVSSVARLISTSIRS  1
            FD S+VA LISTSIR+
Sbjct  61   FDDSAVAGLISTSIRA  76



>gb|KHN22277.1| Putative galacturonosyltransferase-like 1 [Glycine soja]
Length=369

 Score = 98.2 bits (243),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 52/76 (68%), Positives = 63/76 (83%), Gaps = 2/76 (3%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFVasasanaSLLRATIAASFPFLRFRVYR  49
            MTLD  YIRGSMAA+LS++QHSSCPQNT FHFV   S++ASLLRA I+ SFP+L F++Y 
Sbjct  89   MTLDTTYIRGSMAAILSVIQHSSCPQNTFFHFV--CSSSASLLRAAISHSFPYLNFQLYT  146

Query  48   FDVSSVARLISTSIRS  1
            FD S V+ LIS+SIRS
Sbjct  147  FDDSQVSGLISSSIRS  162



>ref|XP_006292628.1| hypothetical protein CARUB_v10018870mg [Capsella rubella]
 gb|EOA25526.1| hypothetical protein CARUB_v10018870mg [Capsella rubella]
Length=342

 Score = 97.8 bits (242),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 47/76 (62%), Positives = 62/76 (82%), Gaps = 2/76 (3%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFVasasanaSLLRATIAASFPFLRFRVYR  49
            MTLDAAY+RGSMA +LS+LQHSSCPQN VFHFV S   +   L+  + +SFP+L+FR+Y 
Sbjct  58   MTLDAAYLRGSMAVILSVLQHSSCPQNIVFHFVTSKQTHR--LQNYVVSSFPYLKFRIYP  115

Query  48   FDVSSVARLISTSIRS  1
            +DV++++ LISTSIRS
Sbjct  116  YDVAAISGLISTSIRS  131



>ref|XP_006425750.1| hypothetical protein CICLE_v10025952mg [Citrus clementina]
 ref|XP_006466710.1| PREDICTED: probable galacturonosyltransferase-like 1-like [Citrus 
sinensis]
 gb|ESR38990.1| hypothetical protein CICLE_v10025952mg [Citrus clementina]
Length=356

 Score = 97.8 bits (242),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 48/76 (63%), Positives = 60/76 (79%), Gaps = 0/76 (0%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFVasasanaSLLRATIAASFPFLRFRVYR  49
            MTLDA Y+RGSMAA+ S+LQHSSCPQN +FHFV+S     +LL  TI+ SFP L F++Y 
Sbjct  74   MTLDAPYLRGSMAAIHSVLQHSSCPQNVLFHFVSSDKDANNLLHETISHSFPSLSFQIYP  133

Query  48   FDVSSVARLISTSIRS  1
            FD ++V+ LISTSIRS
Sbjct  134  FDDTAVSGLISTSIRS  149



>gb|KDO79458.1| hypothetical protein CISIN_1g018567mg [Citrus sinensis]
Length=354

 Score = 97.8 bits (242),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 48/76 (63%), Positives = 60/76 (79%), Gaps = 0/76 (0%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFVasasanaSLLRATIAASFPFLRFRVYR  49
            MTLDA Y+RGSMAA+ S+LQHSSCPQN +FHFV+S     +LL  TI+ SFP L F++Y 
Sbjct  72   MTLDAPYLRGSMAAIHSVLQHSSCPQNVLFHFVSSDKDANNLLHETISHSFPSLSFQIYP  131

Query  48   FDVSSVARLISTSIRS  1
            FD ++V+ LISTSIRS
Sbjct  132  FDDTAVSGLISTSIRS  147



>ref|XP_002876047.1| hypothetical protein ARALYDRAFT_906411 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH52306.1| hypothetical protein ARALYDRAFT_906411 [Arabidopsis lyrata subsp. 
lyrata]
Length=341

 Score = 97.8 bits (242),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 47/76 (62%), Positives = 62/76 (82%), Gaps = 2/76 (3%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFVasasanaSLLRATIAASFPFLRFRVYR  49
            MTLDAAY+RGSMA +LS+LQHSSCPQN VFHFV S   +   L+  + +SFP+L+FR+Y 
Sbjct  57   MTLDAAYLRGSMAVILSVLQHSSCPQNIVFHFVTSKQTHR--LQNYVVSSFPYLKFRIYP  114

Query  48   FDVSSVARLISTSIRS  1
            +DV++++ LISTSIRS
Sbjct  115  YDVAAISGLISTSIRS  130



>ref|XP_010507379.1| PREDICTED: probable galacturonosyltransferase-like 2 [Camelina 
sativa]
Length=313

 Score = 97.4 bits (241),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 47/76 (62%), Positives = 63/76 (83%), Gaps = 2/76 (3%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFVasasanaSLLRATIAASFPFLRFRVYR  49
            MTLDAAY+RGSMA +LS+LQHSSCPQN VFHFV S  ++    +  +A+SFP+L+FR+Y 
Sbjct  58   MTLDAAYLRGSMAVILSVLQHSSCPQNIVFHFVTSKQSHRH--QNYVASSFPYLKFRIYP  115

Query  48   FDVSSVARLISTSIRS  1
            +DV++++ LISTSIRS
Sbjct  116  YDVAAISGLISTSIRS  131



>ref|XP_006404004.1| hypothetical protein EUTSA_v10010596mg [Eutrema salsugineum]
 gb|ESQ45457.1| hypothetical protein EUTSA_v10010596mg [Eutrema salsugineum]
Length=289

 Score = 97.1 bits (240),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 46/76 (61%), Positives = 62/76 (82%), Gaps = 2/76 (3%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFVasasanaSLLRATIAASFPFLRFRVYR  49
            MTLDAAY+RGSMA +LS+LQHSSCPQN VFHFV S   +   L+  + +SFP+L++R+Y 
Sbjct  1    MTLDAAYLRGSMAVILSVLQHSSCPQNIVFHFVTSKQTHR--LQNYVVSSFPYLKYRIYP  58

Query  48   FDVSSVARLISTSIRS  1
            +DV++++ LISTSIRS
Sbjct  59   YDVAAISGLISTSIRS  74



>ref|NP_190645.3| putative galacturonosyltransferase-like 2 [Arabidopsis thaliana]
 sp|Q9S7G2.1|GATL2_ARATH RecName: Full=Probable galacturonosyltransferase-like 2 [Arabidopsis 
thaliana]
 emb|CAB42905.1| glycosyltransferase-like protein [Arabidopsis thaliana]
 emb|CAB62445.1| putative protein [Arabidopsis thaliana]
 gb|AAS49105.1| At3g50760 [Arabidopsis thaliana]
 dbj|BAD94712.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE78706.1| putative galacturonosyltransferase-like 2 [Arabidopsis thaliana]
 gb|AHL38733.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=341

 Score = 97.4 bits (241),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 47/76 (62%), Positives = 62/76 (82%), Gaps = 2/76 (3%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFVasasanaSLLRATIAASFPFLRFRVYR  49
            MTLD AY+RGSMA +LS+LQHSSCPQN VFHFV S  ++   L+  + ASFP+L+FR+Y 
Sbjct  57   MTLDTAYLRGSMAVILSVLQHSSCPQNIVFHFVTSKQSHR--LQNYVVASFPYLKFRIYP  114

Query  48   FDVSSVARLISTSIRS  1
            +DV++++ LISTSIRS
Sbjct  115  YDVAAISGLISTSIRS  130



>gb|KHN04544.1| Putative galacturonosyltransferase-like 2 [Glycine soja]
Length=353

 Score = 97.4 bits (241),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 52/76 (68%), Positives = 62/76 (82%), Gaps = 2/76 (3%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFVasasanaSLLRATIAASFPFLRFRVYR  49
            MTLD  YIRGSMAA+LS++QHSSCPQNT FHFV   S++ASLLRA I+ SFP+L F +Y 
Sbjct  73   MTLDTTYIRGSMAAILSVIQHSSCPQNTFFHFV--CSSSASLLRAAISHSFPYLNFHLYT  130

Query  48   FDVSSVARLISTSIRS  1
            FD S V+ LIS+SIRS
Sbjct  131  FDDSQVSGLISSSIRS  146



>ref|XP_010503742.1| PREDICTED: probable galacturonosyltransferase-like 2 [Camelina 
sativa]
 ref|XP_010503743.1| PREDICTED: probable galacturonosyltransferase-like 2 [Camelina 
sativa]
Length=342

 Score = 97.4 bits (241),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 47/76 (62%), Positives = 63/76 (83%), Gaps = 2/76 (3%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFVasasanaSLLRATIAASFPFLRFRVYR  49
            MTLDAAY+RGSMA +LS+LQHSSCPQN VFHFV S  ++    +  +A+SFP+L+FR+Y 
Sbjct  58   MTLDAAYLRGSMAVILSVLQHSSCPQNIVFHFVTSKQSHRH--QNYVASSFPYLKFRIYP  115

Query  48   FDVSSVARLISTSIRS  1
            +DV++++ LISTSIRS
Sbjct  116  YDVAAISGLISTSIRS  131



>emb|CDY64370.1| BnaC07g49990D [Brassica napus]
Length=338

 Score = 97.1 bits (240),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 46/76 (61%), Positives = 61/76 (80%), Gaps = 2/76 (3%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFVasasanaSLLRATIAASFPFLRFRVYR  49
            MTLD AY+RGSMA +LS+LQHSSCPQN VFHFV S   +   LR  + +SFP+L+F++Y 
Sbjct  53   MTLDTAYLRGSMAVILSVLQHSSCPQNIVFHFVTSKQTHR--LRNYVVSSFPYLKFKIYP  110

Query  48   FDVSSVARLISTSIRS  1
            +DV++++ LISTSIRS
Sbjct  111  YDVAAISGLISTSIRS  126



>gb|EYU45105.1| hypothetical protein MIMGU_mgv1a0211151mg, partial [Erythranthe 
guttata]
Length=225

 Score = 95.5 bits (236),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 55/80 (69%), Positives = 63/80 (79%), Gaps = 4/80 (5%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFVasasan----aSLLRATIAASFPFLRF  61
            MTLD+AY+RGSMAA+LSILQH+SCPQN  FHFVASASA      S L   +AASFP+L F
Sbjct  92   MTLDSAYLRGSMAAILSILQHTSCPQNVFFHFVASASAADGGGESALGGALAASFPYLNF  151

Query  60   RVYRFDVSSVARLISTSIRS  1
            R+Y F  S+VA LISTSIRS
Sbjct  152  RIYSFRDSAVAGLISTSIRS  171



>ref|XP_007160791.1| hypothetical protein PHAVU_001G016900g [Phaseolus vulgaris]
 gb|ESW32785.1| hypothetical protein PHAVU_001G016900g [Phaseolus vulgaris]
Length=350

 Score = 96.7 bits (239),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 52/76 (68%), Positives = 61/76 (80%), Gaps = 2/76 (3%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFVasasanaSLLRATIAASFPFLRFRVYR  49
            MTLD  YIRGSMAA+LS+LQHSSCPQN  FHFV   S++ASLLRATIA SFP+L F++Y 
Sbjct  70   MTLDTTYIRGSMAAILSVLQHSSCPQNVFFHFV--CSSSASLLRATIATSFPYLNFQIYP  127

Query  48   FDVSSVARLISTSIRS  1
            F    V+ LISTSIR+
Sbjct  128  FHDGVVSGLISTSIRA  143



>gb|KFK34323.1| hypothetical protein AALP_AA5G130000 [Arabis alpina]
Length=340

 Score = 96.3 bits (238),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 47/76 (62%), Positives = 61/76 (80%), Gaps = 2/76 (3%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFVasasanaSLLRATIAASFPFLRFRVYR  49
            MTLDAAY+RGSMA +LS+LQHSSCPQN VFHFV S   +   L+  + +SFP+L+FR+Y 
Sbjct  56   MTLDAAYLRGSMAVILSVLQHSSCPQNIVFHFVTSKQTHR--LQNYVVSSFPYLKFRIYP  113

Query  48   FDVSSVARLISTSIRS  1
             DV++++ LISTSIRS
Sbjct  114  HDVAAISGLISTSIRS  129



>gb|KEH36132.1| CAZy family GT8 glycosyltransferase [Medicago truncatula]
Length=281

 Score = 95.9 bits (237),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 51/76 (67%), Positives = 59/76 (78%), Gaps = 2/76 (3%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFVasasanaSLLRATIAASFPFLRFRVYR  49
            MTLD  YIRGSMAA+LSILQHSSCPQN  FHFV S++A    LRA I  SFP+L+F +Y 
Sbjct  1    MTLDTTYIRGSMAAILSILQHSSCPQNIFFHFVCSSNAFN--LRAAIITSFPYLKFHLYT  58

Query  48   FDVSSVARLISTSIRS  1
            FD ++V  LISTSIRS
Sbjct  59   FDDTTVTGLISTSIRS  74



>ref|XP_009764844.1| PREDICTED: probable galacturonosyltransferase-like 1 [Nicotiana 
sylvestris]
Length=346

 Score = 95.9 bits (237),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 51/77 (66%), Positives = 63/77 (82%), Gaps = 1/77 (1%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFVasasanaSLLRATIAASFPFLRFRVYR  49
            MTLD AY+RGSMAA+LS+LQHSSCP+N +FHFVAS+SA  + L  TIA SFP+L F +Y 
Sbjct  61   MTLDIAYLRGSMAAILSVLQHSSCPENIIFHFVASSSAETTHLNLTIAKSFPYLHFTIYP  120

Query  48   F-DVSSVARLISTSIRS  1
              D+++VA LISTSIRS
Sbjct  121  IQDIAAVAGLISTSIRS  137



>ref|XP_009621505.1| PREDICTED: probable galacturonosyltransferase-like 1 [Nicotiana 
tomentosiformis]
Length=351

 Score = 95.9 bits (237),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 51/77 (66%), Positives = 63/77 (82%), Gaps = 1/77 (1%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFVasasanaSLLRATIAASFPFLRFRVYR  49
            MTLD AY+RGSMAA+LS+LQHSSCP+N +FHFVAS+SA  + L  TIA SFP+L F +Y 
Sbjct  66   MTLDIAYLRGSMAAILSVLQHSSCPENIIFHFVASSSAETTHLNLTIAKSFPYLHFTIYP  125

Query  48   F-DVSSVARLISTSIRS  1
              D+++VA LISTSIRS
Sbjct  126  IQDIAAVAGLISTSIRS  142



>ref|XP_010317141.1| PREDICTED: probable galacturonosyltransferase-like 1 [Solanum 
lycopersicum]
Length=357

 Score = 95.9 bits (237),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 50/76 (66%), Positives = 61/76 (80%), Gaps = 0/76 (0%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFVasasanaSLLRATIAASFPFLRFRVYR  49
            MTLDAAY+RGSMAA+LS+LQHSSCP+N +FHF+AS+SAN   L   +A SFP+L F +Y 
Sbjct  75   MTLDAAYLRGSMAAILSVLQHSSCPENVIFHFIASSSANIHYLNLKLATSFPYLHFTIYP  134

Query  48   FDVSSVARLISTSIRS  1
            F  S VA LISTSIR+
Sbjct  135  FRDSPVAGLISTSIRA  150



>ref|XP_003549420.1| PREDICTED: probable galacturonosyltransferase-like 1-like [Glycine 
max]
Length=352

 Score = 95.9 bits (237),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 51/78 (65%), Positives = 64/78 (82%), Gaps = 2/78 (3%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFV--asasanaSLLRATIAASFPFLRFRV  55
            MTLD  YIRGSMAA+LS+LQHSSCPQNT FHFV  ++ + NASLLRATI+ +FP+L F++
Sbjct  65   MTLDTTYIRGSMAAILSVLQHSSCPQNTFFHFVCSSNDNTNASLLRATISNTFPYLNFQL  124

Query  54   YRFDVSSVARLISTSIRS  1
            Y F  + V+ LISTSIR+
Sbjct  125  YPFHDAVVSGLISTSIRA  142



>ref|XP_007156012.1| hypothetical protein PHAVU_003G251200g [Phaseolus vulgaris]
 gb|ESW28006.1| hypothetical protein PHAVU_003G251200g [Phaseolus vulgaris]
Length=350

 Score = 95.5 bits (236),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 48/78 (62%), Positives = 62/78 (79%), Gaps = 2/78 (3%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFVasasanaSL--LRATIAASFPFLRFRV  55
            MTLD AY+RGSMAA+ S+LQHSSCP+N +FHFV++AS  +S   L  T+  SFP+L FR+
Sbjct  65   MTLDVAYLRGSMAAIFSVLQHSSCPENVIFHFVSAASQPSSFATLNQTLTISFPYLNFRI  124

Query  54   YRFDVSSVARLISTSIRS  1
            Y FD  +V+RL+STSIRS
Sbjct  125  YPFDDDAVSRLVSTSIRS  142



>ref|XP_003545290.1| PREDICTED: probable galacturonosyltransferase-like 1-like [Glycine 
max]
Length=361

 Score = 95.5 bits (236),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 53/84 (63%), Positives = 65/84 (77%), Gaps = 8/84 (10%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFV--------asasanaSLLRATIAASFP  73
            MTLD  YIRGSMAA+LS+LQHSSCPQNT FHFV        A+ + NASLLRATI+ +FP
Sbjct  69   MTLDTTYIRGSMAAILSVLQHSSCPQNTFFHFVCSSNANANANTNTNASLLRATISNAFP  128

Query  72   FLRFRVYRFDVSSVARLISTSIRS  1
            +L F++Y FD + V+ LISTSIR+
Sbjct  129  YLNFQLYPFDDAVVSNLISTSIRA  152



>gb|KHN21004.1| Putative galacturonosyltransferase-like 2 [Glycine soja]
Length=365

 Score = 95.5 bits (236),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 55/88 (63%), Positives = 64/88 (73%), Gaps = 12/88 (14%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFVasa------------sanaSLLRATIA  85
            MTLD  YIRGSMAA+LS+LQHSSCPQNT FHFV S+            S++ASLLRA I+
Sbjct  69   MTLDTTYIRGSMAAILSVLQHSSCPQNTFFHFVCSSNANANANTNTNGSSSASLLRAAIS  128

Query  84   ASFPFLRFRVYRFDVSSVARLISTSIRS  1
             SFP+L F +Y FD S V+ LISTSIRS
Sbjct  129  HSFPYLNFHLYTFDDSQVSGLISTSIRS  156



>ref|XP_009136558.1| PREDICTED: probable galacturonosyltransferase-like 2 [Brassica 
rapa]
Length=338

 Score = 95.5 bits (236),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 45/76 (59%), Positives = 61/76 (80%), Gaps = 2/76 (3%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFVasasanaSLLRATIAASFPFLRFRVYR  49
            MTLD AY+RGSMA +LS+LQHSSCPQN VFHFV S   +   L+  + +SFP+L+F++Y 
Sbjct  53   MTLDTAYLRGSMAVILSVLQHSSCPQNIVFHFVTSKQTHR--LQNYVVSSFPYLKFKIYP  110

Query  48   FDVSSVARLISTSIRS  1
            +DV++++ LISTSIRS
Sbjct  111  YDVAAISGLISTSIRS  126



>emb|CDX90688.1| BnaA03g40930D [Brassica napus]
Length=338

 Score = 95.1 bits (235),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 45/76 (59%), Positives = 60/76 (79%), Gaps = 2/76 (3%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFVasasanaSLLRATIAASFPFLRFRVYR  49
            MTLD AY+RGSMA +LS+LQHSSCPQN VFHFV S       L+  + +SFP+L+F++Y 
Sbjct  53   MTLDTAYLRGSMAVILSVLQHSSCPQNIVFHFVTSKQTRR--LQNYVVSSFPYLKFKIYP  110

Query  48   FDVSSVARLISTSIRS  1
            +DV++++ LISTSIRS
Sbjct  111  YDVAAISGLISTSIRS  126



>ref|XP_006338275.1| PREDICTED: probable galacturonosyltransferase-like 1-like [Solanum 
tuberosum]
Length=355

 Score = 94.7 bits (234),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 52/77 (68%), Positives = 63/77 (82%), Gaps = 1/77 (1%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFVasasanaSLLRATIAASFPFLRFRVYR  49
            MTLD AY+RGSMAA+LS+LQHSSCP+N VFHFVAS+SA ++ L  TI  SFP+L F +Y 
Sbjct  70   MTLDIAYLRGSMAAILSVLQHSSCPENIVFHFVASSSAESTHLNLTITKSFPYLHFTIYP  129

Query  48   F-DVSSVARLISTSIRS  1
              DV++VA LISTSIRS
Sbjct  130  IQDVAAVAGLISTSIRS  146



>ref|XP_007047036.1| Nucleotide-diphospho-sugar transferases superfamily protein [Theobroma 
cacao]
 gb|EOX91193.1| Nucleotide-diphospho-sugar transferases superfamily protein [Theobroma 
cacao]
Length=415

 Score = 95.1 bits (235),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 50/76 (66%), Positives = 64/76 (84%), Gaps = 0/76 (0%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFVasasanaSLLRATIAASFPFLRFRVYR  49
            MTLDAAY+RGSMAA+LS+LQHSSCPQN +FHF+AS++AN   LR  I+ SFP L+F++Y 
Sbjct  75   MTLDAAYLRGSMAAILSVLQHSSCPQNILFHFIASSTANHHHLRHKISHSFPSLKFQIYP  134

Query  48   FDVSSVARLISTSIRS  1
            +  S+V+ LISTSIRS
Sbjct  135  YASSAVSGLISTSIRS  150



>ref|XP_003519906.2| PREDICTED: probable galacturonosyltransferase-like 2-like [Glycine 
max]
Length=388

 Score = 94.4 bits (233),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 47/78 (60%), Positives = 63/78 (81%), Gaps = 2/78 (3%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFVa--sasanaSLLRATIAASFPFLRFRV  55
            MTLD +Y+RGSMAA+LS+LQH+SCP+N +FHFV   S S++A+ L  T+  SFP+L F++
Sbjct  101  MTLDVSYLRGSMAAILSVLQHTSCPENVIFHFVTAASKSSSAAKLNQTLTTSFPYLNFQI  160

Query  54   YRFDVSSVARLISTSIRS  1
            Y FD  +V+RLISTSIRS
Sbjct  161  YPFDDDAVSRLISTSIRS  178



>ref|XP_003629503.1| Glycosyltransferase family GT8 protein [Medicago truncatula]
 gb|AET03979.1| CAZy family GT8 glycosyltransferase [Medicago truncatula]
Length=345

 Score = 94.0 bits (232),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 48/76 (63%), Positives = 61/76 (80%), Gaps = 2/76 (3%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFVasasanaSLLRATIAASFPFLRFRVYR  49
            MTLD +YIRGSMAA+LSILQH+SCP+N VFHF+   SA+ S+L  TI  SFP+L++++Y 
Sbjct  63   MTLDVSYIRGSMAAILSILQHTSCPENIVFHFI--TSASVSILNRTINNSFPYLKYQIYP  120

Query  48   FDVSSVARLISTSIRS  1
            F+   VA LISTSIRS
Sbjct  121  FNDGPVAGLISTSIRS  136



>ref|XP_010527644.1| PREDICTED: probable galacturonosyltransferase-like 2 [Tarenaya 
hassleriana]
Length=343

 Score = 93.6 bits (231),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 49/79 (62%), Positives = 63/79 (80%), Gaps = 4/79 (5%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFVasasan---aSLLRATIAASFPFLRFR  58
            MTLDAAY+RGSMA +LS LQHSSCPQN VFHF+ S  ++     ++RA I  SFP+L+FR
Sbjct  55   MTLDAAYLRGSMAVILSALQHSSCPQNVVFHFIISKQSHRRRNDVVRA-ITQSFPYLKFR  113

Query  57   VYRFDVSSVARLISTSIRS  1
            +Y FDV++V+ LIS+SIRS
Sbjct  114  IYPFDVAAVSGLISSSIRS  132



>ref|XP_006344827.1| PREDICTED: probable galacturonosyltransferase-like 1-like [Solanum 
tuberosum]
Length=285

 Score = 92.4 bits (228),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 50/78 (64%), Positives = 64/78 (82%), Gaps = 2/78 (3%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFVasasanaSL--LRATIAASFPFLRFRV  55
            MTLDAAY+RGSMAA+LS+LQHSSCP+N +FHFVAS+S++A++  L   +A SFP+L F +
Sbjct  1    MTLDAAYLRGSMAAILSVLQHSSCPENVIFHFVASSSSSANIDYLNLKLATSFPYLHFTI  60

Query  54   YRFDVSSVARLISTSIRS  1
            Y F  S VA LISTSIR+
Sbjct  61   YPFRDSPVAGLISTSIRA  78



>ref|XP_004232091.2| PREDICTED: probable galacturonosyltransferase-like 1 [Solanum 
lycopersicum]
Length=346

 Score = 92.8 bits (229),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 50/77 (65%), Positives = 63/77 (82%), Gaps = 1/77 (1%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFVasasanaSLLRATIAASFPFLRFRVYR  49
            MTLD AY+RGSMAA+LS+LQHSSCP+N VFHFV+S+SA ++ L  TI  SFP+L+F +Y 
Sbjct  61   MTLDIAYLRGSMAAILSVLQHSSCPENIVFHFVSSSSAESTHLNLTITKSFPYLQFTIYP  120

Query  48   FD-VSSVARLISTSIRS  1
               V++VA LISTSIRS
Sbjct  121  IQHVAAVAGLISTSIRS  137



>ref|XP_004509235.1| PREDICTED: probable galacturonosyltransferase-like 1-like [Cicer 
arietinum]
Length=377

 Score = 92.8 bits (229),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 47/78 (60%), Positives = 61/78 (78%), Gaps = 2/78 (3%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFVasasa--naSLLRATIAASFPFLRFRV  55
            MTLD +YIRGSMAA+LS+LQHSSCP+N VFHF+ ++S   + ++L  TI  SFP+L+F++
Sbjct  93   MTLDVSYIRGSMAAILSVLQHSSCPENIVFHFITASSKPSSTTVLNRTITNSFPYLKFQI  152

Query  54   YRFDVSSVARLISTSIRS  1
            Y F    VA LISTSIRS
Sbjct  153  YPFHDGPVAGLISTSIRS  170



>ref|XP_010670763.1| PREDICTED: probable galacturonosyltransferase-like 1 [Beta vulgaris 
subsp. vulgaris]
Length=355

 Score = 92.4 bits (228),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 50/78 (64%), Positives = 63/78 (81%), Gaps = 2/78 (3%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFVasasanaSLLRATIAASFPFL--RFRV  55
            MTLD  YIRGSMAA+LS+LQHS+CP+N  FHF+ S+++N+S L +TI +SFP+L   F +
Sbjct  71   MTLDLTYIRGSMAAILSVLQHSACPENIFFHFIISSTSNSSELHSTIISSFPYLHKHFEL  130

Query  54   YRFDVSSVARLISTSIRS  1
            Y FD SSVA LISTSIRS
Sbjct  131  YPFDDSSVAALISTSIRS  148



>ref|XP_003516580.1| PREDICTED: probable galacturonosyltransferase-like 1-like isoform 
X1 [Glycine max]
Length=351

 Score = 92.0 bits (227),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 47/77 (61%), Positives = 64/77 (83%), Gaps = 3/77 (4%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFVasasanaSLLRATIAASFPFLRFRVYR  49
            MTLD  Y+RGSMAA+LS+LQHSSCP+N +FHFV   +A++SLL  T++ SFP+L+F++Y 
Sbjct  68   MTLDVTYLRGSMAAILSVLQHSSCPENIIFHFV--TAASSSLLNRTLSTSFPYLKFQIYP  125

Query  48   F-DVSSVARLISTSIRS  1
            F D ++V+ LISTSIRS
Sbjct  126  FDDAAAVSGLISTSIRS  142



>ref|XP_006383257.1| hypothetical protein POPTR_0005s12920g [Populus trichocarpa]
 gb|ERP61054.1| hypothetical protein POPTR_0005s12920g [Populus trichocarpa]
Length=352

 Score = 92.0 bits (227),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 46/76 (61%), Positives = 62/76 (82%), Gaps = 2/76 (3%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFVasasanaSLLRATIAASFPFLRFRVYR  49
            MTLD  Y+RG+MAA+LSILQHSSCP+NT FHF+  +S +++ L  TI +SFP+LR +++ 
Sbjct  72   MTLDFPYLRGTMAAILSILQHSSCPENTRFHFI--SSPSSTYLHETITSSFPYLRSQIHP  129

Query  48   FDVSSVARLISTSIRS  1
            FD +SV+ LISTSIRS
Sbjct  130  FDTNSVSGLISTSIRS  145



>emb|CDX83774.1| BnaC08g18710D [Brassica napus]
Length=351

 Score = 92.0 bits (227),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 51/66 (77%), Positives = 61/66 (92%), Gaps = 0/66 (0%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFVasasanaSLLRATIAASFPFLRFRVYR  49
            MTLDAAYIRGS+AAVLS+LQHSSCP+N VFHFVASASA+AS LR+T++ASFP+L F VY 
Sbjct  69   MTLDAAYIRGSVAAVLSVLQHSSCPENIVFHFVASASADASSLRSTVSASFPYLDFTVYV  128

Query  48   FDVSSV  31
            F+VS+V
Sbjct  129  FNVSTV  134



>ref|XP_009110284.1| PREDICTED: probable galacturonosyltransferase-like 1 [Brassica 
rapa]
Length=351

 Score = 91.7 bits (226),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 51/66 (77%), Positives = 61/66 (92%), Gaps = 0/66 (0%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFVasasanaSLLRATIAASFPFLRFRVYR  49
            MTLDAAYIRGS+AAVLS+LQHSSCP+N VFHFVASASA+AS LR+T++ASFP+L F VY 
Sbjct  69   MTLDAAYIRGSVAAVLSVLQHSSCPENIVFHFVASASADASSLRSTVSASFPYLAFTVYV  128

Query  48   FDVSSV  31
            F+VS+V
Sbjct  129  FNVSTV  134



>ref|XP_004512004.1| PREDICTED: probable galacturonosyltransferase-like 1-like [Cicer 
arietinum]
Length=357

 Score = 91.3 bits (225),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 45/79 (57%), Positives = 61/79 (77%), Gaps = 3/79 (4%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFVasasa---naSLLRATIAASFPFLRFR  58
            MTLD  Y+RGSMAA+LS+LQHSSCP+NT+FHFV +AS    +   L  T++ SFP+L+F+
Sbjct  72   MTLDIKYLRGSMAAILSVLQHSSCPENTIFHFVTAASKSYSSTVTLNNTLSNSFPYLKFQ  131

Query  57   VYRFDVSSVARLISTSIRS  1
            +Y F+  +V+  ISTSIRS
Sbjct  132  IYPFNDDAVSGFISTSIRS  150



>ref|XP_010547489.1| PREDICTED: probable galacturonosyltransferase-like 2 [Tarenaya 
hassleriana]
Length=350

 Score = 90.9 bits (224),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 48/79 (61%), Positives = 62/79 (78%), Gaps = 4/79 (5%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFVasasan---aSLLRATIAASFPFLRFR  58
            MTLDA Y+RGSMA +LS LQHSSCPQN VFHFV S  ++     ++R +IA SFP+L+FR
Sbjct  62   MTLDATYLRGSMAVILSALQHSSCPQNIVFHFVISKQSHRRRNDVVR-SIAQSFPYLKFR  120

Query  57   VYRFDVSSVARLISTSIRS  1
            +Y +D ++V+ LISTSIRS
Sbjct  121  IYPYDGAAVSGLISTSIRS  139



>ref|XP_004247487.1| PREDICTED: probable galacturonosyltransferase-like 4 [Solanum 
lycopersicum]
Length=354

 Score = 90.9 bits (224),  Expect = 6e-20, Method: Composition-based stats.
 Identities = 43/75 (57%), Positives = 55/75 (73%), Gaps = 2/75 (3%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFVasasanaSLLRATIAASFPFLRFRVYR  49
            MTLDA Y+RG+MAAVLSILQHS+CP++  FHF+     +     ++I A+FP+L F+VYR
Sbjct  74   MTLDANYLRGTMAAVLSILQHSTCPEDVTFHFLWVRHEHEVF--SSIKATFPYLNFKVYR  131

Query  48   FDVSSVARLISTSIR  4
            FDV  V  LIS SIR
Sbjct  132  FDVHRVRGLISKSIR  146



>ref|XP_010999942.1| PREDICTED: probable galacturonosyltransferase-like 1 [Populus 
euphratica]
Length=352

 Score = 90.9 bits (224),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 45/76 (59%), Positives = 62/76 (82%), Gaps = 2/76 (3%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFVasasanaSLLRATIAASFPFLRFRVYR  49
            MTLD  Y+RG+MAA+LSILQH+SCP+NT FHF+  +S +++ L  TI +SFP+LR +++ 
Sbjct  72   MTLDFPYLRGTMAAILSILQHTSCPENTRFHFI--SSPSSTYLHETITSSFPYLRSQIHP  129

Query  48   FDVSSVARLISTSIRS  1
            FD +SV+ LISTSIRS
Sbjct  130  FDTNSVSGLISTSIRS  145



>ref|XP_006358435.1| PREDICTED: probable galacturonosyltransferase-like 4-like [Solanum 
tuberosum]
Length=356

 Score = 90.9 bits (224),  Expect = 6e-20, Method: Composition-based stats.
 Identities = 43/75 (57%), Positives = 55/75 (73%), Gaps = 2/75 (3%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFVasasanaSLLRATIAASFPFLRFRVYR  49
            MTLDA Y+RG+MAAVLSILQHS+CP++  FHF+     +     ++I A+FP+L F+VYR
Sbjct  76   MTLDANYLRGTMAAVLSILQHSTCPEDVTFHFLWVRHEHEVF--SSIKATFPYLNFKVYR  133

Query  48   FDVSSVARLISTSIR  4
            FDV  V  LIS SIR
Sbjct  134  FDVHRVRGLISKSIR  148



>ref|XP_010941962.1| PREDICTED: probable galacturonosyltransferase-like 1 [Elaeis 
guineensis]
Length=346

 Score = 90.5 bits (223),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 50/76 (66%), Positives = 59/76 (78%), Gaps = 2/76 (3%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFVasasanaSLLRATIAASFPFLRFRVYR  49
            MTLD AY+RGS+AA+LS+LQH+SCPQ+  FH VAS+S     L ATIA SFP L FR+Y 
Sbjct  65   MTLDVAYLRGSLAAILSVLQHTSCPQSVQFHLVASSSIAE--LNATIATSFPSLSFRIYP  122

Query  48   FDVSSVARLISTSIRS  1
            FD S V+ LISTSIRS
Sbjct  123  FDDSHVSGLISTSIRS  138



>emb|CDX96667.1| BnaA08g22100D [Brassica napus]
Length=351

 Score = 90.5 bits (223),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 50/66 (76%), Positives = 60/66 (91%), Gaps = 0/66 (0%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFVasasanaSLLRATIAASFPFLRFRVYR  49
            MTLD AYIRGS+AAVLS+LQHSSCP+N VFHFVASASA+AS LR+T++ASFP+L F VY 
Sbjct  69   MTLDTAYIRGSVAAVLSVLQHSSCPENIVFHFVASASADASSLRSTVSASFPYLDFTVYV  128

Query  48   FDVSSV  31
            F+VS+V
Sbjct  129  FNVSTV  134



>gb|EPS67668.1| hypothetical protein M569_07107, partial [Genlisea aurea]
Length=310

 Score = 90.1 bits (222),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 44/78 (56%), Positives = 64/78 (82%), Gaps = 3/78 (4%)
 Frame = -2

Query  228  MTLD--AAYIRGSMAAVLSILQHSSCPQNTVFHFVasasanaSLLRATIAASFPFLRFRV  55
            MTLD    Y+RG++AAVLS+LQHS+CP+N+VFHF+ +   +  LLR+TIA++FP+LRF +
Sbjct  29   MTLDYSTPYLRGTIAAVLSVLQHSTCPENSVFHFL-AVPRHRILLRSTIASTFPYLRFHI  87

Query  54   YRFDVSSVARLISTSIRS  1
            Y F+ ++VA LIS+S+RS
Sbjct  88   YDFNPAAVAHLISSSVRS  105



>ref|XP_010539932.1| PREDICTED: probable galacturonosyltransferase-like 1 [Tarenaya 
hassleriana]
Length=365

 Score = 90.1 bits (222),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 47/67 (70%), Positives = 58/67 (87%), Gaps = 1/67 (1%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFVasasanaSL-LRATIAASFPFLRFRVY  52
            MTLDAAYIRGSMAA+LSILQHSSCP+N VFHF+ SAS++ +  LRAT+++SFP+L FRVY
Sbjct  81   MTLDAAYIRGSMAAILSILQHSSCPENIVFHFITSASSDGAWSLRATVSSSFPYLNFRVY  140

Query  51   RFDVSSV  31
             F  S+V
Sbjct  141  VFKDSTV  147



>ref|XP_010667970.1| PREDICTED: probable galacturonosyltransferase-like 4 [Beta vulgaris 
subsp. vulgaris]
Length=354

 Score = 90.1 bits (222),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 43/75 (57%), Positives = 57/75 (76%), Gaps = 2/75 (3%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFVasasanaSLLRATIAASFPFLRFRVYR  49
            MTLDA Y+RG+MAAVLSILQHS+CP+N VFHF+++       +  +IA++FP+L FR+YR
Sbjct  73   MTLDANYLRGTMAAVLSILQHSTCPENFVFHFLSARHEPE--IYTSIASTFPYLNFRIYR  130

Query  48   FDVSSVARLISTSIR  4
            FD + V   IS SIR
Sbjct  131  FDSNRVRGKISKSIR  145



>ref|XP_007156891.1| hypothetical protein PHAVU_002G026000g [Phaseolus vulgaris]
 gb|ESW28885.1| hypothetical protein PHAVU_002G026000g [Phaseolus vulgaris]
Length=355

 Score = 89.7 bits (221),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 46/78 (59%), Positives = 61/78 (78%), Gaps = 2/78 (3%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFVasa--sanaSLLRATIAASFPFLRFRV  55
            MTLD  Y+RGSMAA+ S+LQHSSCP+N VFHFV +A  ++++ LL  T++ SFP+L F++
Sbjct  68   MTLDITYLRGSMAAIFSVLQHSSCPENVVFHFVTAASRASSSLLLNRTLSNSFPYLNFQI  127

Query  54   YRFDVSSVARLISTSIRS  1
            Y F+   VA LISTSIRS
Sbjct  128  YPFNDLQVAGLISTSIRS  145



>ref|XP_010070454.1| PREDICTED: probable galacturonosyltransferase-like 1 [Eucalyptus 
grandis]
 gb|KCW59246.1| hypothetical protein EUGRSUZ_H01923 [Eucalyptus grandis]
Length=353

 Score = 89.7 bits (221),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 51/79 (65%), Positives = 60/79 (76%), Gaps = 3/79 (4%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFVasasana---SLLRATIAASFPFLRFR  58
            MTLDAAY+RGSMAA+LS LQHSSCP+N  FHF  +ASA A     LR  + A+FP+L F 
Sbjct  68   MTLDAAYLRGSMAAILSALQHSSCPENLCFHFAVAASAAAADLDYLRRAVTATFPYLCFG  127

Query  57   VYRFDVSSVARLISTSIRS  1
            VY FD ++VA LISTSIRS
Sbjct  128  VYTFDDAAVAGLISTSIRS  146



>ref|XP_011082537.1| PREDICTED: probable galacturonosyltransferase-like 4 [Sesamum 
indicum]
Length=344

 Score = 89.4 bits (220),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 42/75 (56%), Positives = 56/75 (75%), Gaps = 2/75 (3%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFVasasanaSLLRATIAASFPFLRFRVYR  49
            MTLDA Y+RG+MAAVLSILQHS+CP+N VFHF+ +         ++I ++FP+L F+VY 
Sbjct  64   MTLDANYLRGTMAAVLSILQHSTCPENVVFHFLWARQEPEVF--SSIRSTFPYLNFKVYH  121

Query  48   FDVSSVARLISTSIR  4
            FD++ V  LIS SIR
Sbjct  122  FDITRVRGLISKSIR  136



>emb|CDY26684.1| BnaA06g13380D [Brassica napus]
Length=352

 Score = 89.4 bits (220),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 48/62 (77%), Positives = 58/62 (94%), Gaps = 0/62 (0%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFVasasanaSLLRATIAASFPFLRFRVYR  49
            MTLDAAYIRGS+AAVLS+LQHSSCP+N VFHFVASASA+AS LR+T++ASFP+L F+VY 
Sbjct  70   MTLDAAYIRGSVAAVLSVLQHSSCPENIVFHFVASASADASSLRSTVSASFPYLEFKVYV  129

Query  48   FD  43
            F+
Sbjct  130  FN  131



>ref|XP_009149405.1| PREDICTED: probable galacturonosyltransferase-like 1 [Brassica 
rapa]
Length=352

 Score = 89.4 bits (220),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 48/62 (77%), Positives = 58/62 (94%), Gaps = 0/62 (0%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFVasasanaSLLRATIAASFPFLRFRVYR  49
            MTLDAAYIRGS+AAVLS+LQHSSCP+N VFHFVASASA+AS LR+T++ASFP+L F+VY 
Sbjct  70   MTLDAAYIRGSVAAVLSVLQHSSCPENIVFHFVASASADASSLRSTVSASFPYLEFKVYV  129

Query  48   FD  43
            F+
Sbjct  130  FN  131



>ref|XP_010105689.1| putative galacturonosyltransferase-like 4 [Morus notabilis]
 gb|EXC05720.1| putative galacturonosyltransferase-like 4 [Morus notabilis]
Length=366

 Score = 89.0 bits (219),  Expect = 3e-19, Method: Composition-based stats.
 Identities = 42/75 (56%), Positives = 60/75 (80%), Gaps = 0/75 (0%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFVasasanaSLLRATIAASFPFLRFRVYR  49
            MTLDA Y+RG+MAAVLSILQHS+CP+N  FHF+++A+A+   LR++I ++FP+L F +YR
Sbjct  84   MTLDANYLRGTMAAVLSILQHSTCPENLSFHFLSAAAADERHLRSSINSTFPYLNFAIYR  143

Query  48   FDVSSVARLISTSIR  4
            F+ + +   IS SIR
Sbjct  144  FNAARIRSKISKSIR  158



>ref|XP_002310780.1| hypothetical protein POPTR_0007s12270g [Populus trichocarpa]
 gb|EEE91230.1| hypothetical protein POPTR_0007s12270g [Populus trichocarpa]
Length=352

 Score = 88.6 bits (218),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 45/76 (59%), Positives = 58/76 (76%), Gaps = 2/76 (3%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFVasasanaSLLRATIAASFPFLRFRVYR  49
            MTLD  Y+RG+MAA+ SILQHSSCP+N  FHF++S S+    L  TI +SFP+LR ++Y 
Sbjct  72   MTLDFPYLRGTMAAIFSILQHSSCPENIRFHFISSPSSTH--LHETITSSFPYLRSQIYS  129

Query  48   FDVSSVARLISTSIRS  1
            FD + V+ LISTSIRS
Sbjct  130  FDTNPVSGLISTSIRS  145



>gb|AFM77985.1| glycosyltransferase 8E [Populus tremula x Populus alba]
Length=354

 Score = 88.6 bits (218),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 45/76 (59%), Positives = 58/76 (76%), Gaps = 2/76 (3%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFVasasanaSLLRATIAASFPFLRFRVYR  49
            MTLD  Y+RG+MAA+ SILQHSSCP+N  FHF++S S+    L  TI +SFP+LR ++Y 
Sbjct  74   MTLDFPYLRGTMAAIFSILQHSSCPENIRFHFISSPSSTH--LHETITSSFPYLRSQIYS  131

Query  48   FDVSSVARLISTSIRS  1
            FD + V+ LISTSIRS
Sbjct  132  FDTNPVSGLISTSIRS  147



>ref|XP_008808884.1| PREDICTED: probable galacturonosyltransferase-like 1 [Phoenix 
dactylifera]
Length=346

 Score = 88.6 bits (218),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 48/76 (63%), Positives = 59/76 (78%), Gaps = 2/76 (3%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFVasasanaSLLRATIAASFPFLRFRVYR  49
            MTLD AY+RGS+AA+LS+LQH+SCPQ+  FH V  AS++ + L ATIA SFP L FR+Y 
Sbjct  65   MTLDVAYLRGSLAAILSVLQHTSCPQSVQFHLV--ASSSIAYLNATIATSFPSLSFRIYP  122

Query  48   FDVSSVARLISTSIRS  1
            FD S V+ LISTSIR 
Sbjct  123  FDDSHVSGLISTSIRE  138



>ref|XP_002277334.1| PREDICTED: probable galacturonosyltransferase-like 4 [Vitis vinifera]
Length=352

 Score = 88.6 bits (218),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 44/75 (59%), Positives = 56/75 (75%), Gaps = 2/75 (3%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFVasasanaSLLRATIAASFPFLRFRVYR  49
            MTLDA Y+RG+MAAVLSILQHS+CP+N  FHF+++      +  +TI A+FP+L FRVYR
Sbjct  72   MTLDANYLRGTMAAVLSILQHSTCPENLSFHFLSAQHVPEIV--STIQATFPYLNFRVYR  129

Query  48   FDVSSVARLISTSIR  4
            FD + V   IS SIR
Sbjct  130  FDSNRVRGKISKSIR  144



>gb|AES94863.2| CAZy family GT8 glycosyltransferase [Medicago truncatula]
Length=367

 Score = 88.2 bits (217),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 44/78 (56%), Positives = 61/78 (78%), Gaps = 2/78 (3%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFVasasa--naSLLRATIAASFPFLRFRV  55
            MTLD  Y+RGSMAA+LS+LQHSSCP+NT+FHF+ +AS   +   L  T+  SFP+L+F++
Sbjct  83   MTLDIKYLRGSMAAILSVLQHSSCPENTIFHFITAASKTTSTVTLNTTLLNSFPYLKFQI  142

Query  54   YRFDVSSVARLISTSIRS  1
            Y F+  +++ LISTSIRS
Sbjct  143  YPFNTETISGLISTSIRS  160



>ref|XP_003611905.1| Glycosyltransferase family GT8 protein [Medicago truncatula]
Length=361

 Score = 88.2 bits (217),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 44/78 (56%), Positives = 61/78 (78%), Gaps = 2/78 (3%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFVasasa--naSLLRATIAASFPFLRFRV  55
            MTLD  Y+RGSMAA+LS+LQHSSCP+NT+FHF+ +AS   +   L  T+  SFP+L+F++
Sbjct  77   MTLDIKYLRGSMAAILSVLQHSSCPENTIFHFITAASKTTSTVTLNTTLLNSFPYLKFQI  136

Query  54   YRFDVSSVARLISTSIRS  1
            Y F+  +++ LISTSIRS
Sbjct  137  YPFNTETISGLISTSIRS  154



>ref|XP_006416520.1| hypothetical protein EUTSA_v10008059mg [Eutrema salsugineum]
 gb|ESQ34873.1| hypothetical protein EUTSA_v10008059mg [Eutrema salsugineum]
Length=352

 Score = 87.8 bits (216),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 49/62 (79%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFVasasanaSLLRATIAASFPFLRFRVYR  49
            MTLDAAYIRGS+AAVLS+LQHSSCP+N VFHFVASASA+AS LRATI+ SFP+L F VY 
Sbjct  70   MTLDAAYIRGSIAAVLSVLQHSSCPENIVFHFVASASADASSLRATISGSFPYLDFTVYV  129

Query  48   FD  43
            F+
Sbjct  130  FN  131



>ref|XP_008796999.1| PREDICTED: probable galacturonosyltransferase-like 1 [Phoenix 
dactylifera]
Length=352

 Score = 87.8 bits (216),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 48/76 (63%), Positives = 58/76 (76%), Gaps = 2/76 (3%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFVasasanaSLLRATIAASFPFLRFRVYR  49
            MTLD AY+RGSMAA+LS+LQH+SCPQ+  FHFV  AS++   L  TI+ SFP L FR+Y 
Sbjct  71   MTLDIAYLRGSMAAILSVLQHTSCPQSIQFHFV--ASSSIDYLNTTISTSFPSLSFRIYP  128

Query  48   FDVSSVARLISTSIRS  1
            FD S V+ LISTSIR 
Sbjct  129  FDDSLVSGLISTSIRK  144



>ref|XP_002893040.1| hypothetical protein ARALYDRAFT_472152 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69299.1| hypothetical protein ARALYDRAFT_472152 [Arabidopsis lyrata subsp. 
lyrata]
Length=350

 Score = 87.8 bits (216),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 49/62 (79%), Positives = 57/62 (92%), Gaps = 0/62 (0%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFVasasanaSLLRATIAASFPFLRFRVYR  49
            MTLDAAYIRGS+AAVLS+LQHSSCP+N VFHFVASASA+AS LRATI++SFP+L F VY 
Sbjct  68   MTLDAAYIRGSVAAVLSVLQHSSCPENIVFHFVASASADASSLRATISSSFPYLDFTVYV  127

Query  48   FD  43
            F+
Sbjct  128  FN  129



>ref|NP_564077.1| putative galacturonosyltransferase-like 1 [Arabidopsis thaliana]
 sp|Q9LN68.1|GATL1_ARATH RecName: Full=Probable galacturonosyltransferase-like 1; AltName: 
Full=Protein GAOLAOZHUANGREN 1; AltName: Full=Protein PARVUS 
[Arabidopsis thaliana]
 gb|AAF79456.1|AC025808_38 F18O14.2 [Arabidopsis thaliana]
 gb|AAL11594.1|AF424600_1 At1g19300/F18O14_13 [Arabidopsis thaliana]
 gb|ABF19010.1| At1g19300 [Arabidopsis thaliana]
 gb|AEE29827.1| putative galacturonosyltransferase-like 1 [Arabidopsis thaliana]
 gb|AHL38940.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=351

 Score = 87.4 bits (215),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 49/62 (79%), Positives = 57/62 (92%), Gaps = 0/62 (0%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFVasasanaSLLRATIAASFPFLRFRVYR  49
            MTLDAAYIRGS+AAVLS+LQHSSCP+N VFHFVASASA+AS LRATI++SFP+L F VY 
Sbjct  69   MTLDAAYIRGSVAAVLSVLQHSSCPENIVFHFVASASADASSLRATISSSFPYLDFTVYV  128

Query  48   FD  43
            F+
Sbjct  129  FN  130



>gb|KDP31814.1| hypothetical protein JCGZ_12275 [Jatropha curcas]
Length=356

 Score = 87.4 bits (215),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 47/76 (62%), Positives = 59/76 (78%), Gaps = 2/76 (3%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFVasasanaSLLRATIAASFPFLRFRVYR  49
            MTLD  Y+RG+MAA+LSILQHSSCP+N  FHF++S SA +  L  TI +SFP+L  ++Y 
Sbjct  76   MTLDLHYLRGTMAAILSILQHSSCPENLRFHFISSPSATS--LHTTITSSFPYLHSQIYT  133

Query  48   FDVSSVARLISTSIRS  1
            FD S+VA  ISTSIRS
Sbjct  134  FDTSAVAGHISTSIRS  149



>gb|AAM61534.1| Avr9/Cf-9 rapidly elicited protein 231 [Arabidopsis thaliana]
Length=351

 Score = 87.4 bits (215),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 49/62 (79%), Positives = 57/62 (92%), Gaps = 0/62 (0%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFVasasanaSLLRATIAASFPFLRFRVYR  49
            MTLDAAYIRGS+AAVLS+LQHSSCP+N VFHFVASASA+AS LRATI++SFP+L F VY 
Sbjct  69   MTLDAAYIRGSVAAVLSVLQHSSCPENIVFHFVASASADASSLRATISSSFPYLDFTVYV  128

Query  48   FD  43
            F+
Sbjct  129  FN  130



>emb|CDY41036.1| BnaC05g14940D [Brassica napus]
Length=352

 Score = 87.4 bits (215),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 47/62 (76%), Positives = 57/62 (92%), Gaps = 0/62 (0%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFVasasanaSLLRATIAASFPFLRFRVYR  49
            MTLD AYIRGS+AAVLS+LQHSSCP+N VFHFVASASA+AS LR+T++ASFP+L F+VY 
Sbjct  70   MTLDTAYIRGSVAAVLSVLQHSSCPENIVFHFVASASADASSLRSTVSASFPYLEFKVYV  129

Query  48   FD  43
            F+
Sbjct  130  FN  131



>gb|KFK44065.1| hypothetical protein AALP_AA1G211600 [Arabis alpina]
Length=357

 Score = 87.4 bits (215),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 60/76 (79%), Positives = 70/76 (92%), Gaps = 0/76 (0%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFVasasanaSLLRATIAASFPFLRFRVYR  49
            MTLDAAYIRGS+AAVLS+LQHSSCP+N VFHFVASASA+AS LRATI++SFP+L F VY 
Sbjct  75   MTLDAAYIRGSVAAVLSVLQHSSCPENIVFHFVASASADASSLRATISSSFPYLDFAVYV  134

Query  48   FDVSSVARLISTSIRS  1
            F+VSSV+ LIS+SIRS
Sbjct  135  FNVSSVSGLISSSIRS  150



>emb|CBI19635.3| unnamed protein product [Vitis vinifera]
Length=209

 Score = 86.3 bits (212),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 46/57 (81%), Positives = 54/57 (95%), Gaps = 0/57 (0%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFVasasanaSLLRATIAASFPFLRFR  58
            MTLD AYIRGS+AA+LS+LQHSSCPQN VFHFVASAS+NASLLRATI+ +FP+LRF+
Sbjct  1    MTLDTAYIRGSVAAILSVLQHSSCPQNVVFHFVASASSNASLLRATISTTFPYLRFQ  57



>ref|XP_007050698.1| Galacturonosyltransferase-like 4 [Theobroma cacao]
 gb|EOX94855.1| Galacturonosyltransferase-like 4 [Theobroma cacao]
Length=408

 Score = 87.8 bits (216),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 43/75 (57%), Positives = 54/75 (72%), Gaps = 2/75 (3%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFVasasanaSLLRATIAASFPFLRFRVYR  49
            MTLDA Y+RG+MAAVLSILQHS+CP+N  FHF+        L+  +I ++FP+L FRVYR
Sbjct  128  MTLDANYLRGTMAAVLSILQHSTCPENVEFHFLWGKYEPEVLV--SINSTFPYLNFRVYR  185

Query  48   FDVSSVARLISTSIR  4
            FD + V   IS SIR
Sbjct  186  FDPNRVRDKISKSIR  200



>gb|EPS62323.1| hypothetical protein M569_12469, partial [Genlisea aurea]
Length=310

 Score = 86.7 bits (213),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 44/77 (57%), Positives = 58/77 (75%), Gaps = 3/77 (4%)
 Frame = -2

Query  228  MTLD--AAYIRGSMAAVLSILQHSSCPQNTVFHFVasasanaSLLRATIAASFPFLRFRV  55
            MTLD    Y+RGS+AAVLS+LQHS+CP+NTVFHF+ +   +  LL  TI+ +FP+LRF +
Sbjct  32   MTLDYSTPYLRGSVAAVLSVLQHSTCPENTVFHFL-AVPHHRILLHRTISTTFPYLRFDI  90

Query  54   YRFDVSSVARLISTSIR  4
            Y FD  +V  LIS+SIR
Sbjct  91   YDFDPGAVTHLISSSIR  107



>ref|XP_006856128.1| hypothetical protein AMTR_s00059p00154780 [Amborella trichopoda]
 gb|ERN17595.1| hypothetical protein AMTR_s00059p00154780 [Amborella trichopoda]
Length=342

 Score = 86.7 bits (213),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 48/76 (63%), Positives = 61/76 (80%), Gaps = 1/76 (1%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFVasasanaSLLRATIAASFPFLRFRVYR  49
            MTLD  Y+RG+MAA+LSI+ HSSCP+N  FHF+AS+S +AS LR +I++SFP+LRF VY 
Sbjct  61   MTLDKVYLRGTMAAILSIVLHSSCPENIAFHFIASSSDSAS-LRQSISSSFPYLRFSVYD  119

Query  48   FDVSSVARLISTSIRS  1
            FD S V   ISTSIR+
Sbjct  120  FDDSLVESKISTSIRA  135



>ref|XP_007144593.1| hypothetical protein PHAVU_007G168700g [Phaseolus vulgaris]
 gb|ESW16587.1| hypothetical protein PHAVU_007G168700g [Phaseolus vulgaris]
Length=349

 Score = 86.3 bits (212),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 41/75 (55%), Positives = 54/75 (72%), Gaps = 2/75 (3%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFVasasanaSLLRATIAASFPFLRFRVYR  49
            MTLD+ Y+RG+MAAVLSILQHSSCP+N  FHF+++          TI ++FP+L+F +YR
Sbjct  69   MTLDSNYLRGTMAAVLSILQHSSCPENAEFHFLSARFEPQVF--TTIRSTFPYLKFNIYR  126

Query  48   FDVSSVARLISTSIR  4
            F+ S V   IS SIR
Sbjct  127  FESSRVRGKISKSIR  141



>ref|XP_004148897.1| PREDICTED: probable galacturonosyltransferase-like 4-like, partial 
[Cucumis sativus]
 ref|XP_004158951.1| PREDICTED: probable galacturonosyltransferase-like 4-like, partial 
[Cucumis sativus]
Length=341

 Score = 86.3 bits (212),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 40/75 (53%), Positives = 53/75 (71%), Gaps = 2/75 (3%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFVasasanaSLLRATIAASFPFLRFRVYR  49
            MTLD+ Y+RG+MAAVLSILQHS+CP+N  FHF+ +         + I ++FP+L+FR+YR
Sbjct  61   MTLDSNYLRGTMAAVLSILQHSTCPENVEFHFLWARFEGEVF--SCIKSTFPYLKFRIYR  118

Query  48   FDVSSVARLISTSIR  4
            FD   V   IS SIR
Sbjct  119  FDAGRVRGKISKSIR  133



>ref|XP_010255819.1| PREDICTED: probable galacturonosyltransferase-like 4 [Nelumbo 
nucifera]
Length=352

 Score = 86.3 bits (212),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 43/75 (57%), Positives = 56/75 (75%), Gaps = 2/75 (3%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFVasasanaSLLRATIAASFPFLRFRVYR  49
            MTLDA Y+RG+MAAVLSILQHSSCP+N  FHF+++ S    +  A+I ++FP+L F+VY 
Sbjct  73   MTLDANYLRGTMAAVLSILQHSSCPENVAFHFLSARSEPDII--ASIRSTFPYLNFKVYH  130

Query  48   FDVSSVARLISTSIR  4
            FD + V   IS SIR
Sbjct  131  FDSNRVRGKISKSIR  145



>ref|XP_006355791.1| PREDICTED: probable galacturonosyltransferase-like 4-like [Solanum 
tuberosum]
Length=350

 Score = 86.3 bits (212),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 40/75 (53%), Positives = 55/75 (73%), Gaps = 2/75 (3%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFVasasanaSLLRATIAASFPFLRFRVYR  49
            MTLDA Y+RG+MAAVLSILQHS+CP++ +FHF+           ++I ++FP+L F++Y+
Sbjct  70   MTLDANYLRGTMAAVLSILQHSTCPEDVMFHFLCVRHEPVVF--SSIKSTFPYLNFKLYK  127

Query  48   FDVSSVARLISTSIR  4
            FDV  V  LIS SIR
Sbjct  128  FDVHRVRGLISKSIR  142



>ref|XP_010907223.1| PREDICTED: probable galacturonosyltransferase-like 4 [Elaeis 
guineensis]
Length=350

 Score = 86.3 bits (212),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 45/75 (60%), Positives = 57/75 (76%), Gaps = 2/75 (3%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFVasasanaSLLRATIAASFPFLRFRVYR  49
            MTLDA Y+RG+MAAVLSILQH+SCP++ VFHF+A+      L  A+I ++FP+L FRVYR
Sbjct  70   MTLDANYLRGTMAAVLSILQHTSCPESVVFHFLAARPELDIL--ASIRSTFPYLDFRVYR  127

Query  48   FDVSSVARLISTSIR  4
            FD + V   IS SIR
Sbjct  128  FDSNRVRGRISRSIR  142



>ref|XP_002516817.1| transferase, transferring glycosyl groups, putative [Ricinus 
communis]
 gb|EEF45431.1| transferase, transferring glycosyl groups, putative [Ricinus 
communis]
Length=353

 Score = 86.3 bits (212),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 41/75 (55%), Positives = 55/75 (73%), Gaps = 2/75 (3%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFVasasanaSLLRATIAASFPFLRFRVYR  49
            MTLD  Y+RG+MAAVLS+LQH++CP+N  FHF++        L ++I ++FPFL+F+VYR
Sbjct  73   MTLDVNYLRGTMAAVLSMLQHTTCPENLSFHFLSVHYEPE--LHSSINSTFPFLKFKVYR  130

Query  48   FDVSSVARLISTSIR  4
            FD S V   IS SIR
Sbjct  131  FDSSRVRGKISRSIR  145



>ref|XP_011025701.1| PREDICTED: probable galacturonosyltransferase-like 1 [Populus 
euphratica]
Length=356

 Score = 86.3 bits (212),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 44/76 (58%), Positives = 58/76 (76%), Gaps = 2/76 (3%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFVasasanaSLLRATIAASFPFLRFRVYR  49
            MTLD  Y+RG+MAA+ SILQHSSCP+N  FHF++S S+    L  TI +SFP+LR +++ 
Sbjct  76   MTLDFPYLRGTMAAIFSILQHSSCPENIRFHFISSPSSTR--LHETITSSFPYLRSQIHS  133

Query  48   FDVSSVARLISTSIRS  1
            FD + V+ LISTSIRS
Sbjct  134  FDTNPVSGLISTSIRS  149



>ref|XP_010038136.1| PREDICTED: probable galacturonosyltransferase-like 4 [Eucalyptus 
grandis]
 gb|KCW49948.1| hypothetical protein EUGRSUZ_K03408 [Eucalyptus grandis]
Length=356

 Score = 86.3 bits (212),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 43/75 (57%), Positives = 54/75 (72%), Gaps = 2/75 (3%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFVasasanaSLLRATIAASFPFLRFRVYR  49
            MTLDA Y+RG+MAAVLSILQHS+CP+N  FHF+        L  ++I ++FP+LRF VYR
Sbjct  76   MTLDANYLRGTMAAVLSILQHSTCPENFEFHFLFVQLEPEVL--SSINSTFPYLRFGVYR  133

Query  48   FDVSSVARLISTSIR  4
            FD + V   IS SIR
Sbjct  134  FDPNRVRGKISKSIR  148



>ref|XP_004240529.1| PREDICTED: probable galacturonosyltransferase-like 4 [Solanum 
lycopersicum]
Length=351

 Score = 86.3 bits (212),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 40/75 (53%), Positives = 55/75 (73%), Gaps = 2/75 (3%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFVasasanaSLLRATIAASFPFLRFRVYR  49
            MTLDA Y+RG+MAAVLSILQHS+CP++ +FHF+           ++I ++FP+L F++Y+
Sbjct  71   MTLDANYLRGTMAAVLSILQHSTCPEDVMFHFLCVRHEPVVF--SSIKSTFPYLNFKLYK  128

Query  48   FDVSSVARLISTSIR  4
            FDV  V  LIS SIR
Sbjct  129  FDVHRVRGLISKSIR  143



>ref|XP_009406593.1| PREDICTED: probable galacturonosyltransferase-like 1 [Musa acuminata 
subsp. malaccensis]
Length=358

 Score = 86.3 bits (212),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 49/77 (64%), Positives = 59/77 (77%), Gaps = 3/77 (4%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFVasasanaSLLRATIAASFPFLRFRVYR  49
            MTLD AY+RGSMAAVLS+L+H+ CPQ+  FHFV  AS+ A  LRAT+A SFP L F++Y 
Sbjct  75   MTLDVAYLRGSMAAVLSVLRHTGCPQSVFFHFV--ASSAADYLRATVAGSFPSLGFQIYP  132

Query  48   F-DVSSVARLISTSIRS  1
            F D   VA LISTSIR+
Sbjct  133  FADEPRVAGLISTSIRA  149



>ref|XP_009797127.1| PREDICTED: probable galacturonosyltransferase-like 4 [Nicotiana 
sylvestris]
Length=362

 Score = 86.3 bits (212),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 41/75 (55%), Positives = 54/75 (72%), Gaps = 2/75 (3%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFVasasanaSLLRATIAASFPFLRFRVYR  49
            MTLDA Y+RG+MAA+LSILQHS+CP+N  FHF+     +     ++I ++FP+L F+VY 
Sbjct  82   MTLDANYLRGTMAALLSILQHSTCPENVTFHFLWVRHEHEVF--SSIKSTFPYLSFKVYI  139

Query  48   FDVSSVARLISTSIR  4
            FDV  V  LIS SIR
Sbjct  140  FDVHRVRGLISKSIR  154



>ref|XP_003528664.2| PREDICTED: probable galacturonosyltransferase-like 4-like [Glycine 
max]
Length=283

 Score = 85.5 bits (210),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 40/75 (53%), Positives = 55/75 (73%), Gaps = 1/75 (1%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFVasasanaSLLRATIAASFPFLRFRVYR  49
            MTLDA Y+RG+MAAVLSILQHS+CP+N  FHF+++      L  ++I ++FP+L  ++YR
Sbjct  1    MTLDANYLRGTMAAVLSILQHSTCPENLAFHFLSAHDDAPELF-SSIRSTFPYLNMKIYR  59

Query  48   FDVSSVARLISTSIR  4
            FD + V   IS SIR
Sbjct  60   FDSNRVRGKISKSIR  74



>gb|EYU28550.1| hypothetical protein MIMGU_mgv1a022129mg [Erythranthe guttata]
Length=353

 Score = 85.9 bits (211),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 40/75 (53%), Positives = 54/75 (72%), Gaps = 2/75 (3%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFVasasanaSLLRATIAASFPFLRFRVYR  49
            MTLDA Y+RG++AAVLSILQHS+CP+N VFHF+           ++I ++FP+L F+ Y+
Sbjct  73   MTLDANYLRGTVAAVLSILQHSTCPENVVFHFLWVRHEPHVF--SSIKSTFPYLNFKFYQ  130

Query  48   FDVSSVARLISTSIR  4
            FD + V  LIS SIR
Sbjct  131  FDTTRVRGLISKSIR  145



>gb|AAM20647.1| unknown protein [Arabidopsis thaliana]
Length=351

 Score = 85.9 bits (211),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 48/62 (77%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFVasasanaSLLRATIAASFPFLRFRVYR  49
            MTLD AYIRGS+AAVLS+LQHSSCP+N VFHFVASASA+AS LRATI++SFP+L F VY 
Sbjct  69   MTLDTAYIRGSVAAVLSVLQHSSCPENIVFHFVASASADASSLRATISSSFPYLDFTVYV  128

Query  48   FD  43
            F+
Sbjct  129  FN  130



>ref|XP_011077263.1| PREDICTED: probable galacturonosyltransferase-like 3 [Sesamum 
indicum]
Length=388

 Score = 86.3 bits (212),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 44/77 (57%), Positives = 60/77 (78%), Gaps = 3/77 (4%)
 Frame = -2

Query  228  MTLD--AAYIRGSMAAVLSILQHSSCPQNTVFHFVasasanaSLLRATIAASFPFLRFRV  55
            MTLD  + Y+RGS+AAVLS+LQHS+CP+NTVFHF+A    +   LR TI ++FP+LRF +
Sbjct  105  MTLDYSSPYLRGSIAAVLSVLQHSTCPENTVFHFLADPHHHPH-LRKTIISTFPYLRFHL  163

Query  54   YRFDVSSVARLISTSIR  4
            Y F+ ++V  LIS+SIR
Sbjct  164  YTFNPATVNHLISSSIR  180



>ref|XP_009789670.1| PREDICTED: probable galacturonosyltransferase-like 4 [Nicotiana 
sylvestris]
Length=360

 Score = 85.9 bits (211),  Expect = 4e-18, Method: Composition-based stats.
 Identities = 40/75 (53%), Positives = 54/75 (72%), Gaps = 2/75 (3%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFVasasanaSLLRATIAASFPFLRFRVYR  49
            MTLDA Y+RG+MAAVLSILQHS+CP++ +FHF+           ++I ++FP+L FR+Y+
Sbjct  80   MTLDANYLRGTMAAVLSILQHSTCPEDVMFHFLCVRHEPVVF--SSIKSTFPYLNFRLYK  137

Query  48   FDVSSVARLISTSIR  4
            FD   V  LIS SIR
Sbjct  138  FDAHRVRGLISKSIR  152



>ref|XP_009412175.1| PREDICTED: probable galacturonosyltransferase-like 4 [Musa acuminata 
subsp. malaccensis]
Length=353

 Score = 85.9 bits (211),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 45/75 (60%), Positives = 55/75 (73%), Gaps = 2/75 (3%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFVasasanaSLLRATIAASFPFLRFRVYR  49
            MTLDA Y+RG+MAAVLSILQH+SCP++  FHF+A+      L  A+I A+FP+L FRVYR
Sbjct  73   MTLDANYLRGTMAAVLSILQHTSCPESVTFHFLAAQFEPDVL--ASIRAAFPYLDFRVYR  130

Query  48   FDVSSVARLISTSIR  4
            FD   V   IS SIR
Sbjct  131  FDSGRVRGRISRSIR  145



>ref|XP_008451402.1| PREDICTED: probable galacturonosyltransferase-like 4 [Cucumis 
melo]
Length=403

 Score = 86.3 bits (212),  Expect = 4e-18, Method: Composition-based stats.
 Identities = 42/75 (56%), Positives = 53/75 (71%), Gaps = 2/75 (3%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFVasasanaSLLRATIAASFPFLRFRVYR  49
            MTLD+ Y+RG+MAAVLSILQHS+CP+N  FHF+ +         + I A+FP+L+FRVYR
Sbjct  123  MTLDSNYLRGTMAAVLSILQHSTCPENVEFHFLWARFEGEVF--SCIKATFPYLKFRVYR  180

Query  48   FDVSSVARLISTSIR  4
            FD   V   IS SIR
Sbjct  181  FDAGRVRGKISKSIR  195



>gb|EPS64908.1| hypothetical protein M569_09869 [Genlisea aurea]
Length=342

 Score = 85.5 bits (210),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 46/78 (59%), Positives = 62/78 (79%), Gaps = 3/78 (4%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFVasasanaS--LLRATIAASFPFLRFRV  55
            MTLD AY+RG+MAA+ SIL+H SCP+N VFHFVA+AS++ +  LLR  +  SFP+L+FR 
Sbjct  57   MTLDEAYLRGTMAAIYSILRHCSCPENVVFHFVAAASSSETRDLLR-VVEESFPYLQFRN  115

Query  54   YRFDVSSVARLISTSIRS  1
            Y FD ++VA L+S SIR+
Sbjct  116  YAFDDAAVAGLVSNSIRA  133



>ref|XP_001770768.1| predicted protein [Physcomitrella patens]
 gb|EDQ64450.1| predicted protein [Physcomitrella patens]
Length=280

 Score = 84.7 bits (208),  Expect = 5e-18, Method: Composition-based stats.
 Identities = 41/75 (55%), Positives = 54/75 (72%), Gaps = 2/75 (3%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFVasasanaSLLRATIAASFPFLRFRVYR  49
            MTLD  Y+RGSMAAV SIL+H++CP+N +FHF A+       LR+ I ++FPFLRF+VY 
Sbjct  1    MTLDVKYLRGSMAAVFSILKHTACPENVIFHFFAADRDEQ--LRSLIFSTFPFLRFKVYH  58

Query  48   FDVSSVARLISTSIR  4
            FD + V   IS S+R
Sbjct  59   FDEALVNLRISPSVR  73



>gb|AAO72395.1| putative glycosyl transferase [Oryza sativa Japonica Group]
 gb|AAT85268.1| Glycosyl transferase family 8 protein [Oryza sativa Japonica 
Group]
Length=357

 Score = 85.5 bits (210),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 49/82 (60%), Positives = 61/82 (74%), Gaps = 6/82 (7%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFVasasanaSL------LRATIAASFPFL  67
            MTLDA Y+RG+MAAVLS+L+H+SCP++  FHF+AS+S++         LR T+ ASFP L
Sbjct  67   MTLDAPYLRGTMAAVLSVLRHASCPESVHFHFLASSSSSPEAAAAVRELRDTVRASFPSL  126

Query  66   RFRVYRFDVSSVARLISTSIRS  1
             FRVY FD S VA LISTSIR 
Sbjct  127  AFRVYPFDESRVAGLISTSIRG  148



>ref|NP_001050893.2| Os03g0678800 [Oryza sativa Japonica Group]
 gb|ABF98189.1| Glycosyl transferase family 8 protein, expressed [Oryza sativa 
Japonica Group]
 gb|EEE59683.1| hypothetical protein OsJ_12101 [Oryza sativa Japonica Group]
 dbj|BAF12807.2| Os03g0678800 [Oryza sativa Japonica Group]
Length=360

 Score = 85.5 bits (210),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 49/82 (60%), Positives = 61/82 (74%), Gaps = 6/82 (7%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFVasasanaSL------LRATIAASFPFL  67
            MTLDA Y+RG+MAAVLS+L+H+SCP++  FHF+AS+S++         LR T+ ASFP L
Sbjct  70   MTLDAPYLRGTMAAVLSVLRHASCPESVHFHFLASSSSSPEAAAAVRELRDTVRASFPSL  129

Query  66   RFRVYRFDVSSVARLISTSIRS  1
             FRVY FD S VA LISTSIR 
Sbjct  130  AFRVYPFDESRVAGLISTSIRG  151



>ref|XP_006484411.1| PREDICTED: probable galacturonosyltransferase-like 3-like [Citrus 
sinensis]
 gb|KDO70097.1| hypothetical protein CISIN_1g042515mg [Citrus sinensis]
Length=342

 Score = 85.1 bits (209),  Expect = 7e-18, Method: Composition-based stats.
 Identities = 40/75 (53%), Positives = 54/75 (72%), Gaps = 1/75 (1%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFVasasanaSLLRATIAASFPFLRFRVYR  49
            MTLD+ Y+RGS+A V S+LQH++CP+N VFHF+++      L R TI A+FP+L F +YR
Sbjct  61   MTLDSTYLRGSVAGVFSVLQHATCPENIVFHFISTQRQRLELSR-TITATFPYLNFEIYR  119

Query  48   FDVSSVARLISTSIR  4
            FD + V   IS SIR
Sbjct  120  FDTNLVKGKISYSIR  134



>ref|XP_009622633.1| PREDICTED: probable galacturonosyltransferase-like 4 [Nicotiana 
tomentosiformis]
Length=357

 Score = 85.1 bits (209),  Expect = 7e-18, Method: Composition-based stats.
 Identities = 39/75 (52%), Positives = 54/75 (72%), Gaps = 2/75 (3%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFVasasanaSLLRATIAASFPFLRFRVYR  49
            MTLDA Y+RG+MAAVLSILQHS+CP++ +FHF+           ++I ++FP+L F++Y+
Sbjct  77   MTLDANYLRGTMAAVLSILQHSTCPEDVMFHFLCVRHEPVVF--SSIKSTFPYLNFKLYK  134

Query  48   FDVSSVARLISTSIR  4
            FD   V  LIS SIR
Sbjct  135  FDAHRVRGLISKSIR  149



>ref|XP_002524800.1| transferase, transferring glycosyl groups, putative [Ricinus 
communis]
 gb|EEF37643.1| transferase, transferring glycosyl groups, putative [Ricinus 
communis]
Length=350

 Score = 85.1 bits (209),  Expect = 8e-18, Method: Composition-based stats.
 Identities = 40/75 (53%), Positives = 53/75 (71%), Gaps = 2/75 (3%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFVasasanaSLLRATIAASFPFLRFRVYR  49
            MTLDA Y+RG+MAAVLSILQHS+CP+N  FHF+ +         + I ++FP+L F++YR
Sbjct  70   MTLDANYLRGTMAAVLSILQHSTCPENVEFHFLWAHFEPEVF--SNIKSTFPYLNFKIYR  127

Query  48   FDVSSVARLISTSIR  4
            FD + V   IS SIR
Sbjct  128  FDSNRVRGKISKSIR  142



>ref|XP_004496068.1| PREDICTED: probable galacturonosyltransferase-like 4-like [Cicer 
arietinum]
Length=357

 Score = 85.1 bits (209),  Expect = 8e-18, Method: Composition-based stats.
 Identities = 40/75 (53%), Positives = 55/75 (73%), Gaps = 2/75 (3%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFVasasanaSLLRATIAASFPFLRFRVYR  49
            MTLD+ Y+RG+MAAVLSILQHSSCP+N  FHF+ +       L  +I ++FP+L+F++YR
Sbjct  77   MTLDSNYLRGTMAAVLSILQHSSCPENFEFHFLWARFEPQVFL--SIRSTFPYLKFKIYR  134

Query  48   FDVSSVARLISTSIR  4
            F+ + V   IS SIR
Sbjct  135  FESNRVRGKISKSIR  149



>gb|KGN44858.1| hypothetical protein Csa_7G392310 [Cucumis sativus]
Length=365

 Score = 85.1 bits (209),  Expect = 8e-18, Method: Composition-based stats.
 Identities = 40/75 (53%), Positives = 53/75 (71%), Gaps = 2/75 (3%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFVasasanaSLLRATIAASFPFLRFRVYR  49
            MTLD+ Y+RG+MAAVLSILQHS+CP+N  FHF+ +         + I ++FP+L+FR+YR
Sbjct  85   MTLDSNYLRGTMAAVLSILQHSTCPENVEFHFLWARFEGEVF--SCIKSTFPYLKFRIYR  142

Query  48   FDVSSVARLISTSIR  4
            FD   V   IS SIR
Sbjct  143  FDAGRVRGKISKSIR  157



>ref|XP_010941934.1| PREDICTED: probable galacturonosyltransferase-like 1 [Elaeis 
guineensis]
Length=352

 Score = 85.1 bits (209),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 47/75 (63%), Positives = 56/75 (75%), Gaps = 2/75 (3%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFVasasanaSLLRATIAASFPFLRFRVYR  49
            MTLD AY+RGSMAA+ S+LQH+SCPQ+  FHFV  AS+    L  TI+ SFP L FR+Y 
Sbjct  71   MTLDIAYLRGSMAAIHSVLQHTSCPQSIQFHFV--ASSAIDYLNTTISNSFPSLSFRIYP  128

Query  48   FDVSSVARLISTSIR  4
            FD S V+ LISTSIR
Sbjct  129  FDDSLVSGLISTSIR  143



>ref|XP_004502731.1| PREDICTED: probable galacturonosyltransferase-like 3-like isoform 
X1 [Cicer arietinum]
 ref|XP_004502732.1| PREDICTED: probable galacturonosyltransferase-like 3-like isoform 
X2 [Cicer arietinum]
 ref|XP_004502733.1| PREDICTED: probable galacturonosyltransferase-like 3-like isoform 
X3 [Cicer arietinum]
 ref|XP_004502734.1| PREDICTED: probable galacturonosyltransferase-like 3-like isoform 
X4 [Cicer arietinum]
 ref|XP_004502735.1| PREDICTED: probable galacturonosyltransferase-like 3-like isoform 
X5 [Cicer arietinum]
 ref|XP_004502736.1| PREDICTED: probable galacturonosyltransferase-like 3-like isoform 
X6 [Cicer arietinum]
Length=341

 Score = 84.7 bits (208),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 41/75 (55%), Positives = 53/75 (71%), Gaps = 0/75 (0%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFVasasanaSLLRATIAASFPFLRFRVYR  49
            MTLDA Y+RGS+A V S+LQH+SCP+N VFHFVA+       LR  I ++FP+L+F +Y 
Sbjct  58   MTLDATYLRGSVAGVFSVLQHASCPENVVFHFVATTHRRRQELRRIIISTFPYLKFHIYH  117

Query  48   FDVSSVARLISTSIR  4
            FD + V   IS SIR
Sbjct  118  FDSNLVRGKISYSIR  132



>gb|EPS67852.1| hypothetical protein M569_06922, partial [Genlisea aurea]
Length=306

 Score = 84.3 bits (207),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 44/76 (58%), Positives = 53/76 (70%), Gaps = 2/76 (3%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFVasasanaSLLRATIAASFPFLRFRVYR  49
            M LDA YIRG+MAAVLSILQHS+CP+N  FHF+   ++   L  A I A+FP+L F V+R
Sbjct  26   MPLDANYIRGTMAAVLSILQHSTCPENVSFHFLTVHTSPEFL--APIQATFPYLNFTVHR  83

Query  48   FDVSSVARLISTSIRS  1
            FD S V   IS SIR 
Sbjct  84   FDSSRVHGKISKSIRQ  99



>ref|XP_009384986.1| PREDICTED: probable galacturonosyltransferase-like 4 [Musa acuminata 
subsp. malaccensis]
Length=352

 Score = 84.7 bits (208),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 44/75 (59%), Positives = 56/75 (75%), Gaps = 2/75 (3%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFVasasanaSLLRATIAASFPFLRFRVYR  49
            MTLDA Y+RG+MAAVLSILQH+SCP++  FHF+A+      L  A+I ++FP+L FRVYR
Sbjct  72   MTLDANYLRGTMAAVLSILQHTSCPESVTFHFLAARLEAEVL--ASIRSAFPYLDFRVYR  129

Query  48   FDVSSVARLISTSIR  4
            FD + V   IS SIR
Sbjct  130  FDSARVRGRISRSIR  144



>ref|XP_003564007.1| PREDICTED: probable galacturonosyltransferase-like 9 [Brachypodium 
distachyon]
Length=357

 Score = 84.7 bits (208),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 44/76 (58%), Positives = 59/76 (78%), Gaps = 1/76 (1%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFVasasanaSLLRATIAASFPFLRFRVYR  49
            MTLDA Y+RGSMAA+ S+L+H+SCP++  FHF+A+A  +A L RA +AASFP LRF +Y 
Sbjct  61   MTLDAHYLRGSMAAIYSLLKHASCPESLFFHFMAAAPGDAELRRA-VAASFPSLRFEIYP  119

Query  48   FDVSSVARLISTSIRS  1
            F   +VA LIS S+R+
Sbjct  120  FRAEAVAGLISASVRA  135



>ref|XP_011079796.1| PREDICTED: probable galacturonosyltransferase-like 4 [Sesamum 
indicum]
Length=358

 Score = 84.3 bits (207),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 40/75 (53%), Positives = 51/75 (68%), Gaps = 2/75 (3%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFVasasanaSLLRATIAASFPFLRFRVYR  49
            MTLD  Y+RG+MAAVLSIL+HS+CP+N  FHF+        L R  + ++FP+L F+VY 
Sbjct  78   MTLDGNYLRGTMAAVLSILRHSTCPENVAFHFLWVRHEAEVLSR--LKSTFPYLSFKVYT  135

Query  48   FDVSSVARLISTSIR  4
            FD   V  LIS SIR
Sbjct  136  FDAKRVRGLISKSIR  150



>gb|EMT30165.1| hypothetical protein F775_52051 [Aegilops tauschii]
Length=354

 Score = 84.3 bits (207),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 44/75 (59%), Positives = 55/75 (73%), Gaps = 2/75 (3%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFVasasanaSLLRATIAASFPFLRFRVYR  49
            MTLDA Y+RG+MA VLSILQH++CP+N VFHF+A+ +     L A + A+FP+L  RVYR
Sbjct  66   MTLDANYLRGTMAGVLSILQHTACPENVVFHFLAARTDGD--LVAMLRATFPYLDLRVYR  123

Query  48   FDVSSVARLISTSIR  4
            FD S V   IS SIR
Sbjct  124  FDPSRVRGRISRSIR  138



>ref|XP_009599214.1| PREDICTED: probable galacturonosyltransferase-like 4 [Nicotiana 
tomentosiformis]
Length=362

 Score = 84.3 bits (207),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 40/75 (53%), Positives = 54/75 (72%), Gaps = 2/75 (3%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFVasasanaSLLRATIAASFPFLRFRVYR  49
            MTLDA Y+RG+MAA+LSILQHS+CP+N  FHF+     +     ++I ++FP+L F+VY 
Sbjct  82   MTLDANYLRGTMAALLSILQHSTCPENVTFHFLWVRHEHEVF--SSIKSTFPYLNFKVYI  139

Query  48   FDVSSVARLISTSIR  4
            F+V  V  LIS SIR
Sbjct  140  FNVHRVRGLISKSIR  154



>ref|XP_004986312.1| PREDICTED: probable galacturonosyltransferase-like 1-like [Setaria 
italica]
Length=403

 Score = 84.7 bits (208),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 50/80 (63%), Positives = 63/80 (79%), Gaps = 4/80 (5%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFVasasanaSL---LRATIAASFPFLRFR  58
            MTLDA+Y+RG+MAAVLS+L+H+SCP++  FHF+ASA+A  +    LRAT+ ASFP L FR
Sbjct  115  MTLDASYLRGTMAAVLSVLRHASCPESIYFHFIASATATKATAEELRATVRASFPSLAFR  174

Query  57   VYRF-DVSSVARLISTSIRS  1
            VY F D + VA LISTSIR 
Sbjct  175  VYPFADEARVAGLISTSIRG  194



>ref|NP_001130472.1| hypothetical protein precursor [Zea mays]
 gb|ACF78694.1| unknown [Zea mays]
 gb|ACF84696.1| unknown [Zea mays]
 gb|ACR37945.1| unknown [Zea mays]
 gb|ACR38473.1| unknown [Zea mays]
 gb|AFW73329.1| hypothetical protein ZEAMMB73_320909 [Zea mays]
Length=365

 Score = 84.3 bits (207),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 42/79 (53%), Positives = 58/79 (73%), Gaps = 3/79 (4%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFVasa---sanaSLLRATIAASFPFLRFR  58
            MTLDA Y+RGSMAA+ S+L+H+SCP++  FHF+A+    +   + LRA +AASFP LRF 
Sbjct  62   MTLDAHYLRGSMAAIYSLLKHASCPESIFFHFLAAEGGGAPAVAELRAAVAASFPSLRFE  121

Query  57   VYRFDVSSVARLISTSIRS  1
            +Y F   +VA LIS S+R+
Sbjct  122  IYPFRADAVAGLISASVRA  140



>ref|XP_004953906.1| PREDICTED: probable galacturonosyltransferase-like 9-like [Setaria 
italica]
Length=374

 Score = 84.3 bits (207),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 42/79 (53%), Positives = 58/79 (73%), Gaps = 3/79 (4%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFVasa---sanaSLLRATIAASFPFLRFR  58
            MTLDA Y+RGSMAA+ S+L+H+SCP++  FHF+A+    +   + LRA +AASFP LRF 
Sbjct  65   MTLDAHYLRGSMAAIYSLLKHASCPESLFFHFLAAEGGGAPPVADLRAAVAASFPSLRFE  124

Query  57   VYRFDVSSVARLISTSIRS  1
            +Y F   +VA LIS S+R+
Sbjct  125  IYPFRADAVAGLISASVRA  143



>ref|XP_003591617.1| Glycosyltransferase CAZy family GT8 [Medicago truncatula]
Length=342

 Score = 84.0 bits (206),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 39/75 (52%), Positives = 54/75 (72%), Gaps = 2/75 (3%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFVasasanaSLLRATIAASFPFLRFRVYR  49
            MTLD+ Y+RG+MAAVLSILQHS+CP+N  FHF+ +       L   I ++FP+L+F++YR
Sbjct  75   MTLDSNYLRGTMAAVLSILQHSTCPENVEFHFLWARFEPQVFL--IIRSTFPYLKFKIYR  132

Query  48   FDVSSVARLISTSIR  4
            F+ + V   IS SIR
Sbjct  133  FESNRVHGKISKSIR  147



>ref|XP_002452580.1| hypothetical protein SORBIDRAFT_04g028460 [Sorghum bicolor]
 gb|EES05556.1| hypothetical protein SORBIDRAFT_04g028460 [Sorghum bicolor]
Length=368

 Score = 84.3 bits (207),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 41/79 (52%), Positives = 58/79 (73%), Gaps = 3/79 (4%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFVasa---sanaSLLRATIAASFPFLRFR  58
            MTLDA Y+RGSMAA+ S+L+H+SCP++  FHF+A+    +   + LRA ++ASFP LRF 
Sbjct  65   MTLDAHYLRGSMAAIYSLLKHASCPESLFFHFLAAEGGGAPAVADLRAAVSASFPSLRFE  124

Query  57   VYRFDVSSVARLISTSIRS  1
            +Y F   +VA LIS S+R+
Sbjct  125  IYPFRADAVAGLISASVRA  143



>ref|XP_009419038.1| PREDICTED: probable galacturonosyltransferase-like 1 [Musa acuminata 
subsp. malaccensis]
Length=358

 Score = 84.0 bits (206),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 48/77 (62%), Positives = 59/77 (77%), Gaps = 3/77 (4%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFVasasanaSLLRATIAASFPFLRFRVYR  49
            MTLD AY+RGSMAA+LS+LQH++CPQ+  FHFV  AS+ A  L ATIA +FP L F++Y 
Sbjct  75   MTLDVAYLRGSMAAILSVLQHTACPQSVFFHFV--ASSAAGYLDATIADAFPSLAFQIYP  132

Query  48   F-DVSSVARLISTSIRS  1
            F D   VA LISTSIR+
Sbjct  133  FADEQRVAGLISTSIRA  149



>gb|AES61868.2| CAZy family GT8 glycosyltransferase [Medicago truncatula]
Length=355

 Score = 84.0 bits (206),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 39/75 (52%), Positives = 54/75 (72%), Gaps = 2/75 (3%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFVasasanaSLLRATIAASFPFLRFRVYR  49
            MTLD+ Y+RG+MAAVLSILQHS+CP+N  FHF+ +       L   I ++FP+L+F++YR
Sbjct  75   MTLDSNYLRGTMAAVLSILQHSTCPENVEFHFLWARFEPQVFL--IIRSTFPYLKFKIYR  132

Query  48   FDVSSVARLISTSIR  4
            F+ + V   IS SIR
Sbjct  133  FESNRVHGKISKSIR  147



>ref|XP_011032903.1| PREDICTED: probable galacturonosyltransferase-like 4 [Populus 
euphratica]
Length=346

 Score = 83.6 bits (205),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 41/75 (55%), Positives = 53/75 (71%), Gaps = 2/75 (3%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFVasasanaSLLRATIAASFPFLRFRVYR  49
            MTLDA Y+RG+MAAVLSILQHS+CP+N  FHF+ S         ++I ++FP+L F+ YR
Sbjct  66   MTLDANYLRGTMAAVLSILQHSTCPENMEFHFLWSRFEREVF--SSIKSTFPYLNFKFYR  123

Query  48   FDVSSVARLISTSIR  4
            FD + V   IS SIR
Sbjct  124  FDSNRVRGKISKSIR  138



>gb|EYU40859.1| hypothetical protein MIMGU_mgv1a006996mg [Erythranthe guttata]
Length=423

 Score = 84.3 bits (207),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 44/77 (57%), Positives = 60/77 (78%), Gaps = 3/77 (4%)
 Frame = -2

Query  228  MTLD--AAYIRGSMAAVLSILQHSSCPQNTVFHFVasasanaSLLRATIAASFPFLRFRV  55
            MTLD  + Y+RGS+AAVLS+LQHS+CP+NTVFHF+A+ + +  LL  TI  +FP+L F +
Sbjct  138  MTLDYSSPYLRGSIAAVLSVLQHSTCPENTVFHFLATPNHHPQLL-TTITTTFPYLNFHL  196

Query  54   YRFDVSSVARLISTSIR  4
            Y F+ ++V  LISTSIR
Sbjct  197  YSFNPATVNHLISTSIR  213



>ref|XP_002311936.1| hypothetical protein POPTR_0008s01900g [Populus trichocarpa]
 gb|EEE89303.1| hypothetical protein POPTR_0008s01900g [Populus trichocarpa]
Length=347

 Score = 83.6 bits (205),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 41/75 (55%), Positives = 53/75 (71%), Gaps = 2/75 (3%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFVasasanaSLLRATIAASFPFLRFRVYR  49
            MTLDA Y+RG+MAAVLSILQHS+CP+N  FHF+ S         ++I ++FP+L F+ YR
Sbjct  67   MTLDANYLRGTMAAVLSILQHSTCPENMEFHFLWSRFEREVF--SSIKSTFPYLNFKFYR  124

Query  48   FDVSSVARLISTSIR  4
            FD + V   IS SIR
Sbjct  125  FDSNRVRGKISKSIR  139



>ref|XP_004493636.1| PREDICTED: probable galacturonosyltransferase-like 4-like [Cicer 
arietinum]
Length=347

 Score = 83.6 bits (205),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 38/75 (51%), Positives = 53/75 (71%), Gaps = 2/75 (3%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFVasasanaSLLRATIAASFPFLRFRVYR  49
            MTLD+ Y+RG+M A+LSILQHS+CP+N  FHF+ +          TI ++FP+L+F++YR
Sbjct  67   MTLDSNYLRGTMGAILSILQHSTCPENVEFHFLWARFEPEVFY--TIKSTFPYLKFKIYR  124

Query  48   FDVSSVARLISTSIR  4
            F+ S V   IS SIR
Sbjct  125  FESSRVYGKISKSIR  139



>ref|XP_006437736.1| hypothetical protein CICLE_v10031574mg [Citrus clementina]
 gb|ESR50976.1| hypothetical protein CICLE_v10031574mg [Citrus clementina]
Length=436

 Score = 84.3 bits (207),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 40/76 (53%), Positives = 54/76 (71%), Gaps = 1/76 (1%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFVasasanaSLLRATIAASFPFLRFRVYR  49
            MTLD+ Y+RGS+A V S+LQH++CP+N VFHF+++      L R TI A+FP+L F +YR
Sbjct  155  MTLDSTYLRGSVAGVFSVLQHATCPENIVFHFISTQRQRLELSR-TITATFPYLNFEIYR  213

Query  48   FDVSSVARLISTSIRS  1
            FD + V   IS SIR 
Sbjct  214  FDTNLVKGKISYSIRQ  229



>tpg|DAA45468.1| TPA: hypothetical protein ZEAMMB73_402418 [Zea mays]
Length=285

 Score = 82.8 bits (203),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 43/77 (56%), Positives = 54/77 (70%), Gaps = 1/77 (1%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFVasasanaSL-LRATIAASFPFLRFRVY  52
            MTLDA Y+RG+MAAVLSILQH++CP++  FHF+ + +      L A + ASFPFL  RVY
Sbjct  1    MTLDANYLRGTMAAVLSILQHTACPESVAFHFLTADADADGHGLSAALRASFPFLDLRVY  60

Query  51   RFDVSSVARLISTSIRS  1
            RFD S V   IS S+R 
Sbjct  61   RFDPSRVRDRISRSVRQ  77



>ref|XP_004292605.1| PREDICTED: probable galacturonosyltransferase-like 4-like [Fragaria 
vesca subsp. vesca]
Length=355

 Score = 83.2 bits (204),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 41/75 (55%), Positives = 54/75 (72%), Gaps = 2/75 (3%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFVasasanaSLLRATIAASFPFLRFRVYR  49
            MTLD+ Y+RG+MAAVLSILQHS+CP+   FHF+++      L  + I A+FP+L+F VYR
Sbjct  75   MTLDSNYLRGTMAAVLSILQHSTCPEMVEFHFLSARFEPDVL--SNIKATFPYLKFNVYR  132

Query  48   FDVSSVARLISTSIR  4
            FD + V   IS SIR
Sbjct  133  FDSNKVRGKISKSIR  147



>ref|XP_010918506.1| PREDICTED: probable galacturonosyltransferase-like 3 [Elaeis 
guineensis]
Length=339

 Score = 82.8 bits (203),  Expect = 4e-17, Method: Composition-based stats.
 Identities = 42/75 (56%), Positives = 54/75 (72%), Gaps = 3/75 (4%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFVasasanaSLLRATIAASFPFLRFRVYR  49
            MTLDA Y+RGS+A V S+LQH+SCP+N VFHF+A+A      LR  + A+FP L F +YR
Sbjct  55   MTLDATYLRGSLAGVHSVLQHASCPENVVFHFLATAPRR---LRRAVVAAFPGLPFHIYR  111

Query  48   FDVSSVARLISTSIR  4
            FD + V   ISTS+R
Sbjct  112  FDAALVRGKISTSVR  126



>ref|XP_006444151.1| hypothetical protein CICLE_v10020857mg [Citrus clementina]
 ref|XP_006479783.1| PREDICTED: probable galacturonosyltransferase-like 4-like [Citrus 
sinensis]
 gb|ESR57391.1| hypothetical protein CICLE_v10020857mg [Citrus clementina]
 gb|KDO68842.1| hypothetical protein CISIN_1g018535mg [Citrus sinensis]
Length=354

 Score = 83.2 bits (204),  Expect = 4e-17, Method: Composition-based stats.
 Identities = 41/75 (55%), Positives = 54/75 (72%), Gaps = 2/75 (3%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFVasasanaSLLRATIAASFPFLRFRVYR  49
            MTLDA Y+RG+MAAVLSILQHS+CPQN  FHF+ S       + ++I ++FP+L  +VY+
Sbjct  70   MTLDANYLRGTMAAVLSILQHSTCPQNIEFHFLYSNFEPD--VYSSINSTFPYLNLKVYK  127

Query  48   FDVSSVARLISTSIR  4
            FD + V   IS SIR
Sbjct  128  FDSNRVRGKISKSIR  142



>ref|XP_009630076.1| PREDICTED: probable galacturonosyltransferase-like 10 [Nicotiana 
tomentosiformis]
Length=358

 Score = 83.2 bits (204),  Expect = 4e-17, Method: Composition-based stats.
 Identities = 40/75 (53%), Positives = 54/75 (72%), Gaps = 0/75 (0%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFVasasanaSLLRATIAASFPFLRFRVYR  49
            MTLD+ Y RGS+AAV S+L+H+SCP+N  FHFV S +++   L  T+ + FP L F+VY 
Sbjct  73   MTLDSHYFRGSIAAVHSVLKHASCPENIYFHFVTSKNSDFQQLTQTVNSIFPSLSFKVYS  132

Query  48   FDVSSVARLISTSIR  4
            FD + V  LIS+SIR
Sbjct  133  FDENRVKNLISSSIR  147



>gb|KCW58913.1| hypothetical protein EUGRSUZ_H01534, partial [Eucalyptus grandis]
Length=344

 Score = 82.8 bits (203),  Expect = 4e-17, Method: Composition-based stats.
 Identities = 41/75 (55%), Positives = 53/75 (71%), Gaps = 2/75 (3%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFVasasanaSLLRATIAASFPFLRFRVYR  49
            MTLD+ Y+RG+MAAVLSILQHS CP+N  FHF+ +         ++I ++FP+LRF+VYR
Sbjct  72   MTLDSNYLRGTMAAVLSILQHSMCPENFEFHFLWARFEPEVF--SSIRSTFPYLRFKVYR  129

Query  48   FDVSSVARLISTSIR  4
            FD   V   IS SIR
Sbjct  130  FDSGRVRGKISKSIR  144



>gb|ACF82776.1| unknown [Zea mays]
 tpg|DAA50512.1| TPA: transferase [Zea mays]
Length=351

 Score = 82.8 bits (203),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 49/81 (60%), Positives = 62/81 (77%), Gaps = 5/81 (6%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFV----asasanaSLLRATIAASFPFLRF  61
            MTLDA+Y+RG+MAAVLS+L+H+SCP++  FHF+    + +SA A  LRAT+ ASFP L F
Sbjct  62   MTLDASYLRGTMAAVLSVLRHASCPESIHFHFIASASSGSSATAEALRATVRASFPSLAF  121

Query  60   RVYRF-DVSSVARLISTSIRS  1
            RVY F D + VA LISTSIR 
Sbjct  122  RVYPFADEARVAGLISTSIRG  142



>ref|XP_010680924.1| PREDICTED: probable galacturonosyltransferase-like 1 [Beta vulgaris 
subsp. vulgaris]
Length=337

 Score = 82.8 bits (203),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 45/77 (58%), Positives = 57/77 (74%), Gaps = 1/77 (1%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFVasasanaSL-LRATIAASFPFLRFRVY  52
            MTLDAAY+RGSMAA+LSIL HSSCP +  FHF+ +AS      L  T+++SFP+L + +Y
Sbjct  54   MTLDAAYLRGSMAAILSILHHSSCPTHLQFHFITAASTTTHRDLNHTMSSSFPYLTYHMY  113

Query  51   RFDVSSVARLISTSIRS  1
              + S VA LISTSIRS
Sbjct  114  SLNDSRVAGLISTSIRS  130



>ref|NP_001149414.1| transferase, transferring glycosyl groups precursor [Zea mays]
 gb|ACG35367.1| transferase, transferring glycosyl groups [Zea mays]
Length=352

 Score = 82.8 bits (203),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 49/81 (60%), Positives = 62/81 (77%), Gaps = 5/81 (6%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFV----asasanaSLLRATIAASFPFLRF  61
            MTLDA+Y+RG+MAAVLS+L+H+SCP++  FHF+    + +SA A  LRAT+ ASFP L F
Sbjct  62   MTLDASYLRGTMAAVLSVLRHASCPESIHFHFIASASSGSSATAEALRATVRASFPSLAF  121

Query  60   RVYRF-DVSSVARLISTSIRS  1
            RVY F D + VA LISTSIR 
Sbjct  122  RVYPFADEARVAGLISTSIRG  142



>ref|XP_010070259.1| PREDICTED: probable galacturonosyltransferase-like 4 [Eucalyptus 
grandis]
Length=352

 Score = 82.8 bits (203),  Expect = 5e-17, Method: Composition-based stats.
 Identities = 41/75 (55%), Positives = 53/75 (71%), Gaps = 2/75 (3%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFVasasanaSLLRATIAASFPFLRFRVYR  49
            MTLD+ Y+RG+MAAVLSILQHS CP+N  FHF+ +         ++I ++FP+LRF+VYR
Sbjct  72   MTLDSNYLRGTMAAVLSILQHSMCPENFEFHFLWARFEPEVF--SSIRSTFPYLRFKVYR  129

Query  48   FDVSSVARLISTSIR  4
            FD   V   IS SIR
Sbjct  130  FDSGRVRGKISKSIR  144



>ref|XP_002436791.1| hypothetical protein SORBIDRAFT_10g008830 [Sorghum bicolor]
 gb|EER88158.1| hypothetical protein SORBIDRAFT_10g008830 [Sorghum bicolor]
Length=367

 Score = 82.8 bits (203),  Expect = 5e-17, Method: Composition-based stats.
 Identities = 43/81 (53%), Positives = 57/81 (70%), Gaps = 5/81 (6%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFVasas-----anaSLLRATIAASFPFLR  64
            MTLDA Y+RGSMAAV S+L+H+SCP++  FHF+A+ +         LLR  +AASFP LR
Sbjct  61   MTLDAHYLRGSMAAVYSLLKHASCPESIFFHFLAAEADGEEDPEPELLRRAVAASFPSLR  120

Query  63   FRVYRFDVSSVARLISTSIRS  1
            F +Y F   +VA LIS S+R+
Sbjct  121  FEIYPFRAEAVAGLISASVRA  141



>gb|KDP40068.1| hypothetical protein JCGZ_02066 [Jatropha curcas]
Length=350

 Score = 82.8 bits (203),  Expect = 5e-17, Method: Composition-based stats.
 Identities = 39/75 (52%), Positives = 53/75 (71%), Gaps = 2/75 (3%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFVasasanaSLLRATIAASFPFLRFRVYR  49
            MTLD  Y+RG+MAAVLS+LQHS+CP+N  FHF++        L +TI ++FPFL F++Y+
Sbjct  70   MTLDVNYLRGTMAAVLSMLQHSTCPENLSFHFLSVHHEPE--LYSTINSTFPFLNFKIYQ  127

Query  48   FDVSSVARLISTSIR  4
            +D   V   IS SIR
Sbjct  128  YDSGRVQGKISKSIR  142



>gb|EAY78759.1| hypothetical protein OsI_33861 [Oryza sativa Indica Group]
Length=178

 Score = 80.9 bits (198),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 47/77 (61%), Positives = 58/77 (75%), Gaps = 1/77 (1%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFVasasanaS-LLRATIAASFPFLRFRVY  52
            MTLDA+Y+RG++AAVLS+L+H+SCP +  FHF+A +S  A   LR T+ ASFP L FRVY
Sbjct  13   MTLDASYLRGTIAAVLSVLRHASCPGSVHFHFLAVSSEAAVRELRDTVRASFPSLVFRVY  72

Query  51   RFDVSSVARLISTSIRS  1
             FD S VA LI TSIR 
Sbjct  73   PFDESCVAGLIFTSIRG  89



>ref|XP_001752454.1| predicted protein [Physcomitrella patens]
 gb|EDQ82693.1| predicted protein [Physcomitrella patens]
Length=280

 Score = 82.0 bits (201),  Expect = 5e-17, Method: Composition-based stats.
 Identities = 39/75 (52%), Positives = 54/75 (72%), Gaps = 2/75 (3%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFVasasanaSLLRATIAASFPFLRFRVYR  49
            MTLD  Y+RGSMAAV SIL+H++CP+N +FHF A+       LR+ + ++FPFLRF+VY 
Sbjct  1    MTLDVKYLRGSMAAVFSILKHTACPENVIFHFFAADRDEQ--LRSLVFSTFPFLRFKVYH  58

Query  48   FDVSSVARLISTSIR  4
            F+ + V   IS S+R
Sbjct  59   FNDALVNSRISPSVR  73



>gb|EAZ16294.1| hypothetical protein OsJ_31754 [Oryza sativa Japonica Group]
Length=178

 Score = 80.9 bits (198),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 47/77 (61%), Positives = 58/77 (75%), Gaps = 1/77 (1%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFVasasanaS-LLRATIAASFPFLRFRVY  52
            MTLDA+Y+RG++AAVLS+L+H+SCP +  FHF+A +S  A   LR T+ ASFP L FRVY
Sbjct  13   MTLDASYLRGTIAAVLSVLRHASCPGSVHFHFLAVSSEAAVRELRDTVRASFPSLVFRVY  72

Query  51   RFDVSSVARLISTSIRS  1
             FD S VA LI TSIR 
Sbjct  73   PFDESCVAGLIFTSIRG  89



>ref|XP_010546900.1| PREDICTED: probable galacturonosyltransferase-like 4 [Tarenaya 
hassleriana]
Length=355

 Score = 82.8 bits (203),  Expect = 6e-17, Method: Composition-based stats.
 Identities = 38/75 (51%), Positives = 53/75 (71%), Gaps = 1/75 (1%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFVasasanaSLLRATIAASFPFLRFRVYR  49
            MTLD  Y+RG+MAAVLS+LQHS+CP+N  FHF++       L   +I ++FP+L F++Y+
Sbjct  74   MTLDTNYLRGTMAAVLSLLQHSTCPENLSFHFLSLPHLETELF-TSIKSTFPYLNFKIYQ  132

Query  48   FDVSSVARLISTSIR  4
            FD + V   IS SIR
Sbjct  133  FDSNLVRSKISKSIR  147



>ref|NP_001141620.1| uncharacterized protein LOC100273739 precursor [Zea mays]
 gb|ACF86735.1| unknown [Zea mays]
 tpg|DAA45469.1| TPA: hypothetical protein ZEAMMB73_402418 [Zea mays]
Length=353

 Score = 82.4 bits (202),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 43/77 (56%), Positives = 54/77 (70%), Gaps = 1/77 (1%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFVasasanaS-LLRATIAASFPFLRFRVY  52
            MTLDA Y+RG+MAAVLSILQH++CP++  FHF+ + +      L A + ASFPFL  RVY
Sbjct  69   MTLDANYLRGTMAAVLSILQHTACPESVAFHFLTADADADGHGLSAALRASFPFLDLRVY  128

Query  51   RFDVSSVARLISTSIRS  1
            RFD S V   IS S+R 
Sbjct  129  RFDPSRVRDRISRSVRQ  145



>ref|XP_009407434.1| PREDICTED: probable galacturonosyltransferase-like 2 [Musa acuminata 
subsp. malaccensis]
Length=354

 Score = 82.4 bits (202),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 45/77 (58%), Positives = 59/77 (77%), Gaps = 3/77 (4%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFVasasanaSLLRATIAASFPFLRFRVYR  49
            MTLD  Y+RGSMAAVLS+LQH++CPQ+  FHFV  A++ A  L AT+A SFP L F+++ 
Sbjct  71   MTLDVTYLRGSMAAVLSVLQHTACPQSIFFHFV--ATSAAGYLSATVAGSFPSLAFQIHP  128

Query  48   F-DVSSVARLISTSIRS  1
            F D  +VA LISTS+R+
Sbjct  129  FADEPTVAGLISTSVRA  145



>dbj|BAK04626.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=343

 Score = 82.4 bits (202),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 43/75 (57%), Positives = 53/75 (71%), Gaps = 2/75 (3%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFVasasanaSLLRATIAASFPFLRFRVYR  49
            MTLDA Y+RG+MA VLSILQH++CP+N VFHF+A+       L A +  +FP+L  RVYR
Sbjct  63   MTLDANYLRGTMAGVLSILQHTACPENVVFHFLAARMDGD--LVAMLRVTFPYLDLRVYR  120

Query  48   FDVSSVARLISTSIR  4
            FD S V   IS SIR
Sbjct  121  FDPSRVRGRISRSIR  135



>ref|XP_010041540.1| PREDICTED: probable galacturonosyltransferase-like 4, partial 
[Eucalyptus grandis]
Length=305

 Score = 82.0 bits (201),  Expect = 7e-17, Method: Composition-based stats.
 Identities = 41/75 (55%), Positives = 53/75 (71%), Gaps = 2/75 (3%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFVasasanaSLLRATIAASFPFLRFRVYR  49
            MTLD+ Y+RG+MAAVLSILQHS CP+N  FHF+ +         ++I ++FP+LRF+VYR
Sbjct  72   MTLDSNYLRGTMAAVLSILQHSMCPENFEFHFLWARFEPEVF--SSIRSTFPYLRFKVYR  129

Query  48   FDVSSVARLISTSIR  4
            FD   V   IS SIR
Sbjct  130  FDSGRVRGKISKSIR  144



>ref|XP_008796730.1| PREDICTED: probable galacturonosyltransferase-like 3 [Phoenix 
dactylifera]
Length=339

 Score = 82.0 bits (201),  Expect = 8e-17, Method: Composition-based stats.
 Identities = 42/75 (56%), Positives = 53/75 (71%), Gaps = 3/75 (4%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFVasasanaSLLRATIAASFPFLRFRVYR  49
            MTLDA Y+RGS+A V S+LQH+SCP+N VFHF+A+A       R  + A+FP L FR+YR
Sbjct  55   MTLDATYLRGSLAGVHSVLQHASCPENVVFHFLATAPRR---FRRAVVAAFPGLPFRIYR  111

Query  48   FDVSSVARLISTSIR  4
            FD   V   ISTS+R
Sbjct  112  FDAGLVRGKISTSVR  126



>gb|AAP54070.1| glycosyl transferase family 8 protein, putative [Oryza sativa 
Japonica Group]
Length=264

 Score = 81.6 bits (200),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 47/77 (61%), Positives = 58/77 (75%), Gaps = 1/77 (1%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFVasasanaS-LLRATIAASFPFLRFRVY  52
            MTLDA+Y+RG++AAVLS+L+H+SCP +  FHF+A +S  A   LR T+ ASFP L FRVY
Sbjct  13   MTLDASYLRGTIAAVLSVLRHASCPGSVHFHFLAVSSEAAVRELRDTVRASFPSLVFRVY  72

Query  51   RFDVSSVARLISTSIRS  1
             FD S VA LI TSIR 
Sbjct  73   PFDESCVAGLIFTSIRG  89



>gb|EYU25700.1| hypothetical protein MIMGU_mgv1a023917mg, partial [Erythranthe 
guttata]
Length=218

 Score = 81.3 bits (199),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 40/75 (53%), Positives = 51/75 (68%), Gaps = 2/75 (3%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFVasasanaSLLRATIAASFPFLRFRVYR  49
            M LD  YIRG+MAAVLSILQHS+CP+N  FHF++        + + I ++FPFL+FR Y 
Sbjct  77   MPLDGNYIRGTMAAVLSILQHSTCPENVSFHFLSVHLDPE--ISSLINSTFPFLKFRAYE  134

Query  48   FDVSSVARLISTSIR  4
            FD + V   IS SIR
Sbjct  135  FDPTRVRDKISKSIR  149



>ref|XP_010279126.1| PREDICTED: probable galacturonosyltransferase-like 4 [Nelumbo 
nucifera]
Length=355

 Score = 82.0 bits (201),  Expect = 9e-17, Method: Composition-based stats.
 Identities = 41/75 (55%), Positives = 52/75 (69%), Gaps = 2/75 (3%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFVasasanaSLLRATIAASFPFLRFRVYR  49
            MTLDA Y+RG+MAA+LS+LQHS+CP+N  FHF+A    +   L  TI ++FP+L F VY 
Sbjct  75   MTLDANYLRGTMAAILSMLQHSTCPENVDFHFLAGDFDSDIFL--TINSTFPYLNFNVYH  132

Query  48   FDVSSVARLISTSIR  4
            FD   V   IS SIR
Sbjct  133  FDFKRVHGKISKSIR  147



>ref|XP_002465236.1| hypothetical protein SORBIDRAFT_01g034770 [Sorghum bicolor]
 gb|EER92234.1| hypothetical protein SORBIDRAFT_01g034770 [Sorghum bicolor]
Length=353

 Score = 82.0 bits (201),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 43/78 (55%), Positives = 54/78 (69%), Gaps = 2/78 (3%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFVasasanaS--LLRATIAASFPFLRFRV  55
            MTLDA Y+RG+MAAVLSILQH++CP++  FHF+ + +       L A + ASFPFL  RV
Sbjct  68   MTLDANYLRGTMAAVLSILQHTACPESVAFHFLTADADADDHVGLAAALRASFPFLDLRV  127

Query  54   YRFDVSSVARLISTSIRS  1
            YRFD S V   IS S+R 
Sbjct  128  YRFDPSRVRDRISRSVRQ  145



>ref|XP_007154192.1| hypothetical protein PHAVU_003G097800g [Phaseolus vulgaris]
 gb|ESW26186.1| hypothetical protein PHAVU_003G097800g [Phaseolus vulgaris]
Length=348

 Score = 82.0 bits (201),  Expect = 9e-17, Method: Composition-based stats.
 Identities = 38/75 (51%), Positives = 55/75 (73%), Gaps = 1/75 (1%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFVasasanaSLLRATIAASFPFLRFRVYR  49
            MTLDA Y+RG+MAAVLS+LQHS+CP+N  FHF+ +      L  ++I ++FP+L+ ++YR
Sbjct  66   MTLDANYLRGTMAAVLSMLQHSACPENLSFHFLTAHDDAPELF-SSIKSTFPYLKMKIYR  124

Query  48   FDVSSVARLISTSIR  4
            F+ + V   IS SIR
Sbjct  125  FECNRVRGKISKSIR  139



>ref|XP_002533272.1| transferase, transferring glycosyl groups, putative [Ricinus 
communis]
 gb|EEF29104.1| transferase, transferring glycosyl groups, putative [Ricinus 
communis]
Length=375

 Score = 82.4 bits (202),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 43/76 (57%), Positives = 59/76 (78%), Gaps = 2/76 (3%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFVasasanaSLLRATIAASFPFLRFRVYR  49
            MTLD  Y+RG+MAA+LSI+QHSSCP+N  FHF+  +S ++  L +TI +SFP+LR ++Y 
Sbjct  95   MTLDFPYLRGTMAAILSIIQHSSCPENLRFHFI--SSPSSISLHSTITSSFPYLRSQIYT  152

Query  48   FDVSSVARLISTSIRS  1
            F  S V+ LISTSIR+
Sbjct  153  FHTSPVSGLISTSIRA  168



>emb|CDY18846.1| BnaAnng03110D [Brassica napus]
Length=351

 Score = 82.0 bits (201),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 40/75 (53%), Positives = 54/75 (72%), Gaps = 1/75 (1%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFVasasanaSLLRATIAASFPFLRFRVYR  49
            MTLD  Y+RG+MAAVLS+LQHSSCP+N  FHF++ A     L   +I ++FP+L F++Y+
Sbjct  70   MTLDTNYLRGTMAAVLSLLQHSSCPENLSFHFLSLAHFENDLF-TSIKSTFPYLNFKIYQ  128

Query  48   FDVSSVARLISTSIR  4
            FD + V   IS SIR
Sbjct  129  FDPNLVRSKISKSIR  143



>ref|XP_010265254.1| PREDICTED: probable galacturonosyltransferase-like 3 [Nelumbo 
nucifera]
Length=356

 Score = 82.0 bits (201),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 42/75 (56%), Positives = 53/75 (71%), Gaps = 2/75 (3%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFVasasanaSLLRATIAASFPFLRFRVYR  49
            MTLD  Y+RGS+A VLS+LQH+SCP+N VFHF+AS       LR TI  +FP+L F +Y 
Sbjct  76   MTLDTTYLRGSVAGVLSVLQHASCPENIVFHFLASHRRAE--LRRTILTTFPYLNFHLYH  133

Query  48   FDVSSVARLISTSIR  4
            FD + V   IS+SIR
Sbjct  134  FDTNLVKGKISSSIR  148



>ref|XP_002271296.1| PREDICTED: probable galacturonosyltransferase-like 4 [Vitis vinifera]
Length=356

 Score = 82.0 bits (201),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 41/75 (55%), Positives = 55/75 (73%), Gaps = 2/75 (3%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFVasasanaSLLRATIAASFPFLRFRVYR  49
            MTLDA Y+RG++AA+LSILQHS+CP+N  FHF+ S   +     ++I ++FPFL F+VYR
Sbjct  76   MTLDANYLRGTIAALLSILQHSTCPENIDFHFLWSHFESDIF--SSINSTFPFLNFKVYR  133

Query  48   FDVSSVARLISTSIR  4
            FD + V   IS SIR
Sbjct  134  FDSNRVRGKISKSIR  148



>gb|KEH23701.1| CAZy family GT8 glycosyltransferase [Medicago truncatula]
Length=352

 Score = 82.0 bits (201),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 37/75 (49%), Positives = 52/75 (69%), Gaps = 2/75 (3%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFVasasanaSLLRATIAASFPFLRFRVYR  49
            MTLD+ Y+RG+M A+LSILQHS+CP+N  FHF+ +           I ++FP+L+F++YR
Sbjct  72   MTLDSNYLRGTMGAILSILQHSTCPENVDFHFLWATFEPEVYY--AIKSTFPYLKFKIYR  129

Query  48   FDVSSVARLISTSIR  4
            F+ S V   IS SIR
Sbjct  130  FESSRVREKISKSIR  144



>ref|XP_004986977.1| PREDICTED: probable galacturonosyltransferase-like 4-like [Setaria 
italica]
Length=347

 Score = 81.6 bits (200),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 43/76 (57%), Positives = 55/76 (72%), Gaps = 1/76 (1%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFVasasanaSLLRATIAASFPFLRFRVYR  49
            MTLDA Y+RG+MAAVLSILQH++CP++ VFHF+ + + +  L  A + ASFP L  RVYR
Sbjct  65   MTLDANYLRGTMAAVLSILQHTACPESMVFHFLTAEADDRGLA-AALRASFPSLDLRVYR  123

Query  48   FDVSSVARLISTSIRS  1
            FD S V   IS S+R 
Sbjct  124  FDPSRVRDRISRSVRQ  139



>ref|XP_007035367.1| Galacturonosyltransferase-like 4 [Theobroma cacao]
 gb|EOY06293.1| Galacturonosyltransferase-like 4 [Theobroma cacao]
Length=352

 Score = 81.6 bits (200),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 41/75 (55%), Positives = 56/75 (75%), Gaps = 2/75 (3%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFVasasanaSLLRATIAASFPFLRFRVYR  49
            MTLDA Y+RG+MAAVLS+LQHS+CP+N  FHF+ + S +   L ++I ++FP+L F +YR
Sbjct  72   MTLDANYLRGTMAAVLSMLQHSTCPENLSFHFLCAHSDSE--LVSSIKSTFPYLNFTIYR  129

Query  48   FDVSSVARLISTSIR  4
            FD + V   IS SIR
Sbjct  130  FDSNRVRGKISKSIR  144



>gb|KDP29364.1| hypothetical protein JCGZ_18285 [Jatropha curcas]
Length=348

 Score = 81.6 bits (200),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 40/75 (53%), Positives = 55/75 (73%), Gaps = 2/75 (3%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFVasasanaSLLRATIAASFPFLRFRVYR  49
            MTLD++Y+RGS+A VLS+LQH+SCP+N VFHF+A+       LR TI  +FP+L F +Y 
Sbjct  68   MTLDSSYLRGSVAGVLSVLQHASCPENIVFHFIATHRRAE--LRRTITITFPYLSFHLYH  125

Query  48   FDVSSVARLISTSIR  4
            FD + V   IS+S+R
Sbjct  126  FDSNLVKGKISSSVR  140



>ref|XP_006850846.1| hypothetical protein AMTR_s00025p00136940 [Amborella trichopoda]
 gb|ERN12427.1| hypothetical protein AMTR_s00025p00136940 [Amborella trichopoda]
Length=339

 Score = 81.6 bits (200),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 42/75 (56%), Positives = 56/75 (75%), Gaps = 2/75 (3%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFVasasanaSLLRATIAASFPFLRFRVYR  49
            MTLDA Y+RGS+AAVLSILQH+SCPQ+  FHF+AS   +   L++ + ASFP+L F ++ 
Sbjct  59   MTLDANYLRGSLAAVLSILQHASCPQDITFHFLASGRESK--LQSALKASFPYLSFSLHH  116

Query  48   FDVSSVARLISTSIR  4
            FD + V  LIS S+R
Sbjct  117  FDPARVKALISASVR  131



>ref|NP_001137113.1| hypothetical protein precursor [Zea mays]
 gb|ACF83289.1| unknown [Zea mays]
 gb|AFW85174.1| hypothetical protein ZEAMMB73_350653 [Zea mays]
Length=372

 Score = 82.0 bits (201),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 42/83 (51%), Positives = 56/83 (67%), Gaps = 7/83 (8%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFVasasana-------SLLRATIAASFPF  70
            MTLD  Y+RGSMAAV S+L+H+SCP++  FHF+A+ +           LLR  +AASFP 
Sbjct  64   MTLDTHYLRGSMAAVYSLLKHASCPESIFFHFLAAEAGAVDGADPEPELLRRAVAASFPS  123

Query  69   LRFRVYRFDVSSVARLISTSIRS  1
            LRF +Y F   +VA LIS S+R+
Sbjct  124  LRFEIYPFRAEAVAGLISASVRA  146



>ref|XP_007016224.1| Galacturonosyltransferase-like 3 [Theobroma cacao]
 gb|EOY33843.1| Galacturonosyltransferase-like 3 [Theobroma cacao]
Length=344

 Score = 81.6 bits (200),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 39/75 (52%), Positives = 53/75 (71%), Gaps = 1/75 (1%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFVasasanaSLLRATIAASFPFLRFRVYR  49
            MTLD AY+RGS+A V S+L H++CP+N VFHF+ +    A L RA I ++FP+L F +Y 
Sbjct  61   MTLDTAYLRGSIAGVFSVLHHATCPENIVFHFITTHRRGAELTRA-ITSTFPYLNFHLYH  119

Query  48   FDVSSVARLISTSIR  4
            FD + V   IS+SIR
Sbjct  120  FDSNLVKGKISSSIR  134



>ref|XP_009124935.1| PREDICTED: probable galacturonosyltransferase-like 4 [Brassica 
rapa]
Length=351

 Score = 81.6 bits (200),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 40/75 (53%), Positives = 54/75 (72%), Gaps = 1/75 (1%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFVasasanaSLLRATIAASFPFLRFRVYR  49
            MTLD  Y+RG+MAAVLS+LQHSSCP+N  FHF++ A     L   +I ++FP+L F++Y+
Sbjct  70   MTLDTNYLRGTMAAVLSLLQHSSCPENLSFHFLSLAHFENDLF-TSIKSTFPYLNFKIYQ  128

Query  48   FDVSSVARLISTSIR  4
            FD + V   IS SIR
Sbjct  129  FDPNLVRSKISKSIR  143



>dbj|BAK07300.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=353

 Score = 81.6 bits (200),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 42/76 (55%), Positives = 57/76 (75%), Gaps = 1/76 (1%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFVasasanaSLLRATIAASFPFLRFRVYR  49
            MTLDA Y+RGSMAA+ S+L+H+SCP++  FHF+A+A  +   LRA + ASFP LRF +Y 
Sbjct  57   MTLDAHYLRGSMAAIYSLLRHASCPESLFFHFLAAAPGDGE-LRAALGASFPSLRFEIYP  115

Query  48   FDVSSVARLISTSIRS  1
            F   +VA LIS S+R+
Sbjct  116  FRAEAVAGLISASVRA  131



>gb|ACJ85290.1| unknown [Medicago truncatula]
Length=220

 Score = 80.5 bits (197),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 39/75 (52%), Positives = 49/75 (65%), Gaps = 0/75 (0%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFVasasanaSLLRATIAASFPFLRFRVYR  49
            MTLDA Y+RGS A V S+LQH+SCP+N  FHFV +       LR  I ++FP+L F +Y 
Sbjct  59   MTLDATYLRGSTAGVFSVLQHASCPENIAFHFVTTTHRRRQELRRIIISTFPYLNFHIYH  118

Query  48   FDVSSVARLISTSIR  4
            FD + V   IS SIR
Sbjct  119  FDSNLVRGKISYSIR  133



>ref|XP_002281658.1| PREDICTED: probable galacturonosyltransferase-like 3 [Vitis vinifera]
Length=345

 Score = 81.6 bits (200),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 42/75 (56%), Positives = 53/75 (71%), Gaps = 2/75 (3%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFVasasanaSLLRATIAASFPFLRFRVYR  49
            MTLDA Y+RGS+A VLS+LQH+SCP+N VFHF+AS       LR  I  +FP+L F +Y 
Sbjct  65   MTLDATYLRGSIAGVLSVLQHASCPENIVFHFLASHRRAE--LRRIIVTTFPYLSFHLYH  122

Query  48   FDVSSVARLISTSIR  4
            FD + V   IS+SIR
Sbjct  123  FDTNLVKGKISSSIR  137



>ref|XP_010262920.1| PREDICTED: probable galacturonosyltransferase-like 3 [Nelumbo 
nucifera]
Length=388

 Score = 82.0 bits (201),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 42/75 (56%), Positives = 54/75 (72%), Gaps = 2/75 (3%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFVasasanaSLLRATIAASFPFLRFRVYR  49
            MTLD  Y+RGS+A VLS+L+H+SCP+N VFHF+AS       LR TI  +FP+L F+VY 
Sbjct  108  MTLDTTYLRGSVAGVLSVLKHASCPENIVFHFLASHRRAE--LRRTILTTFPYLNFQVYH  165

Query  48   FDVSSVARLISTSIR  4
            FD + V   IS+SIR
Sbjct  166  FDTNLVKGKISSSIR  180



>ref|XP_006843824.1| hypothetical protein AMTR_s00007p00258170 [Amborella trichopoda]
 gb|ERN05499.1| hypothetical protein AMTR_s00007p00258170 [Amborella trichopoda]
Length=365

 Score = 81.6 bits (200),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 41/75 (55%), Positives = 56/75 (75%), Gaps = 2/75 (3%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFVasasanaSLLRATIAASFPFLRFRVYR  49
            MTLDA Y+RGS+A +LS+L+H+SCP+N  FH +AS  A+   LR T+ A+FP+L FR+Y+
Sbjct  84   MTLDATYLRGSVAGILSVLRHASCPENLFFHLLASHRADD--LRRTLVATFPYLSFRLYK  141

Query  48   FDVSSVARLISTSIR  4
            FD  SV   IS S+R
Sbjct  142  FDPRSVRDKISLSVR  156



>emb|CDX85191.1| BnaC07g25020D [Brassica napus]
Length=363

 Score = 81.6 bits (200),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 43/75 (57%), Positives = 58/75 (77%), Gaps = 1/75 (1%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFVasasanaSLLRATIAASFPFLRFRVYR  49
            MTLD AY+RG+++AV SIL+H+SCPQNT FHF+AS   + SL + T+++ FP L F+VY 
Sbjct  74   MTLDPAYLRGTLSAVHSILKHTSCPQNTFFHFIASGLHHGSLAK-TLSSVFPSLSFKVYT  132

Query  48   FDVSSVARLISTSIR  4
            FD + V  LIS+SIR
Sbjct  133  FDETIVKNLISSSIR  147



>gb|AAG43554.1|AF211536_1 Avr9/Cf-9 rapidly elicited protein 231 [Nicotiana tabacum]
Length=353

 Score = 81.6 bits (200),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 40/75 (53%), Positives = 51/75 (68%), Gaps = 0/75 (0%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFVasasanaSLLRATIAASFPFLRFRVYR  49
            MTLD+ Y RGS+AAV S+L+H+SCP+N  FHFV S   +   L  T+ + FP L F+VY 
Sbjct  73   MTLDSHYFRGSIAAVHSVLKHTSCPENIYFHFVTSKDFDFQQLTQTVMSIFPSLSFKVYS  132

Query  48   FDVSSVARLISTSIR  4
            FD   V  LIS+SIR
Sbjct  133  FDELRVKNLISSSIR  147



>ref|XP_003602336.1| Glycosyltransferase CAZy family GT8 [Medicago truncatula]
 gb|AES72587.1| CAZy family GT8 glycosyltransferase [Medicago truncatula]
Length=343

 Score = 81.3 bits (199),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 39/75 (52%), Positives = 49/75 (65%), Gaps = 0/75 (0%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFVasasanaSLLRATIAASFPFLRFRVYR  49
            MTLDA Y+RGS A V S+LQH+SCP+N  FHFV +       LR  I ++FP+L F +Y 
Sbjct  59   MTLDATYLRGSTAGVFSVLQHASCPENIAFHFVTTTHRRRQELRRIIISTFPYLNFHIYH  118

Query  48   FDVSSVARLISTSIR  4
            FD + V   IS SIR
Sbjct  119  FDSNLVRGKISYSIR  133



>ref|XP_009771460.1| PREDICTED: probable galacturonosyltransferase-like 10 [Nicotiana 
sylvestris]
Length=362

 Score = 81.6 bits (200),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 40/75 (53%), Positives = 51/75 (68%), Gaps = 0/75 (0%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFVasasanaSLLRATIAASFPFLRFRVYR  49
            MTLD+ Y RGS+AAV S+L+H+SCP+N  FHFV S   +   L  T+ + FP L F+VY 
Sbjct  73   MTLDSHYFRGSIAAVHSVLKHTSCPENIYFHFVTSKDFDFQQLTQTVMSIFPSLSFKVYS  132

Query  48   FDVSSVARLISTSIR  4
            FD   V  LIS+SIR
Sbjct  133  FDELRVKNLISSSIR  147



>ref|XP_002466674.1| hypothetical protein SORBIDRAFT_01g012060 [Sorghum bicolor]
 gb|EER93672.1| hypothetical protein SORBIDRAFT_01g012060 [Sorghum bicolor]
Length=353

 Score = 81.3 bits (199),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 51/81 (63%), Positives = 62/81 (77%), Gaps = 5/81 (6%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFVasas----anaSLLRATIAASFPFLRF  61
            MTLDA+Y+RG+MAAVLS+L+H+SCP++  FHF+ASAS    A A  L AT+ ASFP L F
Sbjct  63   MTLDASYLRGTMAAVLSVLRHASCPESIHFHFIASASPKSRATAEELGATVRASFPSLAF  122

Query  60   RVYRF-DVSSVARLISTSIRS  1
            RVY F D + VA LISTSIR 
Sbjct  123  RVYPFADEARVAGLISTSIRG  143



>ref|XP_008223046.1| PREDICTED: probable galacturonosyltransferase-like 4 isoform 
X2 [Prunus mume]
Length=352

 Score = 81.3 bits (199),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 39/75 (52%), Positives = 53/75 (71%), Gaps = 2/75 (3%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFVasasanaSLLRATIAASFPFLRFRVYR  49
            MTLDA YIRG+MAAV S+LQHS+CP+N  FHF+++  A      ++I ++FP+L F+ Y 
Sbjct  103  MTLDANYIRGTMAAVFSLLQHSTCPENLYFHFLSAHIAPEFF--SSIKSTFPYLNFKTYA  160

Query  48   FDVSSVARLISTSIR  4
            FD + V   IS SIR
Sbjct  161  FDSNRVRGKISKSIR  175



>ref|XP_001777911.1| predicted protein [Physcomitrella patens]
 gb|EDQ57235.1| predicted protein [Physcomitrella patens]
Length=279

 Score = 80.5 bits (197),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 38/75 (51%), Positives = 52/75 (69%), Gaps = 2/75 (3%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFVasasanaSLLRATIAASFPFLRFRVYR  49
            MTLD  Y+RGS+AA+ SIL+H++CP+N +FHF A+       LR  + + FPFLRF+VY 
Sbjct  1    MTLDVEYLRGSIAAIFSILKHTACPENVIFHFFAANRDEE--LRFLVCSIFPFLRFKVYH  58

Query  48   FDVSSVARLISTSIR  4
            FD + V   IS S+R
Sbjct  59   FDEALVNSRISPSVR  73



>ref|XP_008775723.1| PREDICTED: LOW QUALITY PROTEIN: probable galacturonosyltransferase-like 
4 [Phoenix dactylifera]
Length=360

 Score = 81.3 bits (199),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 41/75 (55%), Positives = 55/75 (73%), Gaps = 2/75 (3%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFVasasanaSLLRATIAASFPFLRFRVYR  49
            MTLDA Y+RG++AAVLSILQH+SCP++ VFHF+A+      L   +I ++FP+L F VYR
Sbjct  80   MTLDANYLRGTIAAVLSILQHTSCPESVVFHFLAARLEPDIL--TSIRSTFPYLDFHVYR  137

Query  48   FDVSSVARLISTSIR  4
            F+ + V   IS SIR
Sbjct  138  FESNRVRGRISRSIR  152



>emb|CDY69900.1| BnaA06g38050D [Brassica napus]
Length=342

 Score = 81.3 bits (199),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 41/75 (55%), Positives = 57/75 (76%), Gaps = 1/75 (1%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFVasasanaSLLRATIAASFPFLRFRVYR  49
            MTLDA Y+RGS+A V S+LQH+SCP+N VFHF+A+   +A  LR  I+++FP+L F++Y 
Sbjct  61   MTLDAIYLRGSVAGVFSVLQHASCPENVVFHFIATQRHSAD-LRRIISSTFPYLTFQIYH  119

Query  48   FDVSSVARLISTSIR  4
            FD + V   IS+SIR
Sbjct  120  FDPNLVRSKISSSIR  134



>ref|XP_010486120.1| PREDICTED: probable galacturonosyltransferase-like 4 [Camelina 
sativa]
Length=345

 Score = 81.3 bits (199),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 38/75 (51%), Positives = 54/75 (72%), Gaps = 1/75 (1%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFVasasanaSLLRATIAASFPFLRFRVYR  49
            MTLD  Y+RG+MAAVLS+LQHS+CP+N  FHF++       L  ++I ++FP+L F++Y+
Sbjct  64   MTLDTNYLRGTMAAVLSLLQHSTCPENLSFHFLSLPHFENDLF-SSIKSTFPYLNFKIYQ  122

Query  48   FDVSSVARLISTSIR  4
            FD + V   IS SIR
Sbjct  123  FDPNLVRSKISKSIR  137



>ref|XP_004965127.1| PREDICTED: probable galacturonosyltransferase-like 9-like [Setaria 
italica]
Length=374

 Score = 81.6 bits (200),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 42/85 (49%), Positives = 54/85 (64%), Gaps = 9/85 (11%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFV---------asasanaSLLRATIAASF  76
            MTLDA Y+RGSMAAV S+L+H+SCP++  FHF+                 LLR  +AASF
Sbjct  64   MTLDAHYLRGSMAAVYSLLKHASCPESIFFHFLAAEAGAAGGEGPEPEPELLRRAVAASF  123

Query  75   PFLRFRVYRFDVSSVARLISTSIRS  1
            P LRF +Y F   +VA LIS S+R+
Sbjct  124  PSLRFEIYPFRAEAVAGLISASVRA  148



>ref|XP_010029247.1| PREDICTED: probable galacturonosyltransferase-like 9 [Eucalyptus 
grandis]
 gb|KCW56131.1| hypothetical protein EUGRSUZ_I01882 [Eucalyptus grandis]
Length=353

 Score = 81.3 bits (199),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 43/75 (57%), Positives = 56/75 (75%), Gaps = 0/75 (0%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFVasasanaSLLRATIAASFPFLRFRVYR  49
            MTLD  Y+RG++AAV S+L+H+SCP+N  FHFVASASA+   L   +  +FP L FR+Y 
Sbjct  67   MTLDFEYLRGTVAAVHSVLRHASCPENVFFHFVASASADRESLAGILRTAFPSLGFRIYG  126

Query  48   FDVSSVARLISTSIR  4
            FD  SV RLIS+S+R
Sbjct  127  FDDGSVGRLISSSVR  141



>ref|XP_008234923.1| PREDICTED: probable galacturonosyltransferase-like 4 [Prunus 
mume]
Length=345

 Score = 80.9 bits (198),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 40/75 (53%), Positives = 53/75 (71%), Gaps = 2/75 (3%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFVasasanaSLLRATIAASFPFLRFRVYR  49
            MTLD+ Y+RG+MAAVLSILQHS+CP+   FHF+ +      L  + I ++FP+L+F VYR
Sbjct  65   MTLDSNYLRGTMAAVLSILQHSTCPEFIEFHFLWARFEPEVL--SNIKSAFPYLKFNVYR  122

Query  48   FDVSSVARLISTSIR  4
            FD + V   IS SIR
Sbjct  123  FDSNRVRGKISKSIR  137



>gb|AFW85173.1| hypothetical protein ZEAMMB73_350653 [Zea mays]
Length=147

 Score = 79.0 bits (193),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 42/81 (52%), Positives = 52/81 (64%), Gaps = 7/81 (9%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHF-------VasasanaSLLRATIAASFPF  70
            MTLD  Y+RGSMAAV S+L+H+SCP++  FHF       V  A     LLR  +AASFP 
Sbjct  64   MTLDTHYLRGSMAAVYSLLKHASCPESIFFHFLAAEAGAVDGADPEPELLRRAVAASFPS  123

Query  69   LRFRVYRFDVSSVARLISTSI  7
            LRF +Y F   +VA LIS S+
Sbjct  124  LRFEIYPFRAEAVAGLISASV  144



>ref|XP_009148532.1| PREDICTED: probable galacturonosyltransferase-like 3 [Brassica 
rapa]
Length=342

 Score = 80.9 bits (198),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 41/75 (55%), Positives = 57/75 (76%), Gaps = 1/75 (1%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFVasasanaSLLRATIAASFPFLRFRVYR  49
            MTLDA Y+RGS+A V S+LQH+SCP+N VFHF+A+   +A  LR  I+++FP+L F++Y 
Sbjct  61   MTLDAIYLRGSVAGVFSVLQHASCPENVVFHFIATQRRSAD-LRRIISSTFPYLTFQIYH  119

Query  48   FDVSSVARLISTSIR  4
            FD + V   IS+SIR
Sbjct  120  FDPNLVRSKISSSIR  134



>ref|XP_004232258.1| PREDICTED: probable galacturonosyltransferase-like 10 [Solanum 
lycopersicum]
Length=366

 Score = 81.3 bits (199),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 41/75 (55%), Positives = 52/75 (69%), Gaps = 0/75 (0%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFVasasanaSLLRATIAASFPFLRFRVYR  49
            MTLD  Y RGS+AAV S+L+HSSCP+N  FHFVAS   +   LR  + + FP L F+VY 
Sbjct  75   MTLDVKYFRGSVAAVHSVLKHSSCPENVYFHFVASKDKDFQDLRKMVKSIFPSLSFKVYS  134

Query  48   FDVSSVARLISTSIR  4
            F+   V +LIS+SIR
Sbjct  135  FNEFRVKKLISSSIR  149



>ref|XP_004238964.1| PREDICTED: probable galacturonosyltransferase-like 3 [Solanum 
lycopersicum]
Length=349

 Score = 80.9 bits (198),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 41/77 (53%), Positives = 54/77 (70%), Gaps = 3/77 (4%)
 Frame = -2

Query  228  MTLD--AAYIRGSMAAVLSILQHSSCPQNTVFHFVasasanaSLLRATIAASFPFLRFRV  55
            MTLD  + Y+RGS+A VLS+LQHS+CP+NT FHF+A        L  TI ++FP+L F +
Sbjct  66   MTLDYSSPYLRGSIAGVLSVLQHSTCPENTFFHFLAVRRHFNH-LNKTITSTFPYLNFNL  124

Query  54   YRFDVSSVARLISTSIR  4
            Y F+ S V  LIS+SIR
Sbjct  125  YNFNPSLVRHLISSSIR  141



>gb|KDP21514.1| hypothetical protein JCGZ_21985 [Jatropha curcas]
Length=356

 Score = 80.9 bits (198),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 39/75 (52%), Positives = 52/75 (69%), Gaps = 2/75 (3%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFVasasanaSLLRATIAASFPFLRFRVYR  49
            M LDA Y+RG+MAAVLSIL+HS+CP+N  FHF+ S         + I ++FP+L F++YR
Sbjct  74   MNLDANYLRGTMAAVLSILKHSTCPENFSFHFLWSRFQPEIF--SNIKSTFPYLNFKIYR  131

Query  48   FDVSSVARLISTSIR  4
            FD + V   IS SIR
Sbjct  132  FDSNHVRGKISKSIR  146



>ref|NP_001168674.1| uncharacterized protein LOC100382462 precursor [Zea mays]
 gb|ACN29140.1| unknown [Zea mays]
Length=366

 Score = 81.3 bits (199),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 42/80 (53%), Positives = 56/80 (70%), Gaps = 4/80 (5%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFV----asasanaSLLRATIAASFPFLRF  61
            MTLDA Y+RGSMAA+ S+L+H+SCP++  FHF+       +  AS LRA +AASFP L F
Sbjct  63   MTLDAHYLRGSMAAIYSLLKHASCPESLFFHFLAAAEGGGAPAASGLRAVVAASFPSLSF  122

Query  60   RVYRFDVSSVARLISTSIRS  1
             +Y F   +VA LIS S+R+
Sbjct  123  EIYPFRADAVAGLISASVRA  142



>ref|XP_009406013.1| PREDICTED: probable galacturonosyltransferase-like 3 [Musa acuminata 
subsp. malaccensis]
Length=341

 Score = 80.5 bits (197),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 43/75 (57%), Positives = 55/75 (73%), Gaps = 3/75 (4%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFVasasanaSLLRATIAASFPFLRFRVYR  49
            +TLDAAY+RGS+A VLSIL+HSSCP++  FHF+A+        R  +AASFP L F VYR
Sbjct  55   VTLDAAYLRGSLAGVLSILRHSSCPESITFHFLATRPRR---FRPAVAASFPSLAFDVYR  111

Query  48   FDVSSVARLISTSIR  4
            FD + V  LIS+S+R
Sbjct  112  FDPALVRGLISSSVR  126



>ref|NP_001050151.1| Os03g0359600 [Oryza sativa Japonica Group]
 gb|ABF96069.1| galactinol synthase, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF12065.1| Os03g0359600 [Oryza sativa Japonica Group]
 gb|EAY90080.1| hypothetical protein OsI_11648 [Oryza sativa Indica Group]
 gb|EAZ26992.1| hypothetical protein OsJ_10917 [Oryza sativa Japonica Group]
 dbj|BAG92891.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG94457.1| unnamed protein product [Oryza sativa Japonica Group]
Length=347

 Score = 80.9 bits (198),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 42/75 (56%), Positives = 53/75 (71%), Gaps = 2/75 (3%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFVasasanaSLLRATIAASFPFLRFRVYR  49
            MTLDA Y+RG+MA VLSILQH++CP++  FHF+A+       L A + A+FP+L  RVYR
Sbjct  67   MTLDANYLRGTMAGVLSILQHTACPESVSFHFLAAGMDAD--LAAAVRATFPYLDLRVYR  124

Query  48   FDVSSVARLISTSIR  4
            FD S V   IS SIR
Sbjct  125  FDPSRVRGRISRSIR  139



>gb|EMS59063.1| putative galacturonosyltransferase-like 4 [Triticum urartu]
Length=346

 Score = 80.5 bits (197),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 43/75 (57%), Positives = 53/75 (71%), Gaps = 2/75 (3%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFVasasanaSLLRATIAASFPFLRFRVYR  49
            MTLDA  +RG+MA VLSILQH++CP+N VFHF+A+       L A + A+FP+L  RVYR
Sbjct  66   MTLDANSLRGTMAGVLSILQHTACPENVVFHFLAARMDGD--LVAMLRATFPYLDLRVYR  123

Query  48   FDVSSVARLISTSIR  4
            FD S V   IS SIR
Sbjct  124  FDPSRVRGRISRSIR  138



>ref|XP_007224926.1| hypothetical protein PRUPE_ppa021809mg [Prunus persica]
 gb|EMJ26125.1| hypothetical protein PRUPE_ppa021809mg [Prunus persica]
Length=350

 Score = 80.9 bits (198),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 39/75 (52%), Positives = 53/75 (71%), Gaps = 2/75 (3%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFVasasanaSLLRATIAASFPFLRFRVYR  49
            MTLDA YIRG+MAAV S+LQHS+CP+N  FHF+++  A      ++I ++FP+L F+ Y 
Sbjct  70   MTLDANYIRGTMAAVFSLLQHSTCPENLYFHFLSAHIAPEFF--SSIKSTFPYLNFKTYA  127

Query  48   FDVSSVARLISTSIR  4
            FD + V   IS SIR
Sbjct  128  FDSNRVRGKISKSIR  142



>ref|XP_003518684.1| PREDICTED: probable galacturonosyltransferase-like 3-like [Glycine 
max]
Length=342

 Score = 80.5 bits (197),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 41/75 (55%), Positives = 52/75 (69%), Gaps = 1/75 (1%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFVasasanaSLLRATIAASFPFLRFRVYR  49
            MTLDA Y+RGS+A V S+LQH+SCP+N VFHF+A+       LR  I A+FP+L F +Y 
Sbjct  60   MTLDATYLRGSVAGVFSVLQHASCPENVVFHFIATTHRRTE-LRRIITATFPYLSFHLYH  118

Query  48   FDVSSVARLISTSIR  4
            FD + V   IS SIR
Sbjct  119  FDANLVRGKISYSIR  133



>gb|ABD96888.1| hypothetical protein [Cleome spinosa]
Length=351

 Score = 80.9 bits (198),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 38/75 (51%), Positives = 53/75 (71%), Gaps = 1/75 (1%)
 Frame = -2

Query  228  MTLDAAYIRGSMAAVLSILQHSSCPQNTVFHFVasasanaSLLRATIAASFPFLRFRVYR  49
            MTLD  Y+RG+MAAVLS+LQHS+CP+N  FHF++       L   +I ++FP+L F++Y+
Sbjct  70   MTLDTNYLRGTMAAVLSLLQHSTCPENLSFHFLSLPHFETELF-TSIKSTFPYLSFKIYQ  128

Query  48   FDVSSVARLISTSIR  4
            FD + V   IS SIR
Sbjct  129  FDPNLVRSRISKSIR  143



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 522609235886