BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c9889_g1_i2 len=176 path=[1:0-106 108:107-175]

Length=176
                                                                      Score     E

gb|ELR55573.1|  hypothetical protein M91_15722                        52.8    4e-10   
gb|ELR56367.1|  hypothetical protein M91_05200                        52.0    9e-10   
gb|ELR53815.1|  hypothetical protein M91_04027                        52.0    1e-09   
gb|ELR48661.1|  hypothetical protein M91_21373                        50.4    1e-09   
gb|AIE45854.1|  ORF2                                                  56.2    1e-09   
dbj|BAA25253.1|  unnamed protein product                              56.2    6e-09   Canis lupus familiaris [dogs]
gb|ELR61551.1|  hypothetical protein M91_14419                        52.8    7e-09   
gb|ELR51705.1|  hypothetical protein M91_10420                        52.8    7e-09   
gb|ELR57788.1|  hypothetical protein M91_08672                        52.8    7e-09   
gb|ELR47881.1|  hypothetical protein M91_03766                        52.8    7e-09   
gb|ELR57783.1|  hypothetical protein M91_04059                        52.8    8e-09   
gb|ELR58543.1|  hypothetical protein M91_01925                        52.8    8e-09   
gb|ELR50089.1|  hypothetical protein M91_20222                        52.8    8e-09   
gb|ELR58510.1|  hypothetical protein M91_05513                        52.8    8e-09   
gb|ELR50830.1|  hypothetical protein M91_07955                        52.8    8e-09   
gb|ELR59055.1|  hypothetical protein M91_11778                        52.8    8e-09   
gb|ELR50258.1|  hypothetical protein M91_08673                        52.8    8e-09   
gb|ELR58001.1|  hypothetical protein M91_20110                        52.8    8e-09   
gb|ELR62244.1|  hypothetical protein M91_20933                        52.8    8e-09   
gb|ELR58410.1|  Retrovirus-related Pol polyprotein LINE-1             52.8    8e-09   
gb|ELR48937.1|  hypothetical protein M91_02115                        52.8    8e-09   
gb|ELR47131.1|  hypothetical protein M91_12925                        52.8    8e-09   
gb|ELR59242.1|  hypothetical protein M91_06506                        52.8    8e-09   
gb|ELR59381.1|  hypothetical protein M91_14726                        52.8    8e-09   
gb|ELR48628.1|  hypothetical protein M91_07595                        52.8    8e-09   
gb|ELR47876.1|  hypothetical protein M91_20604                        52.8    8e-09   
gb|ELR58330.1|  hypothetical protein M91_20393                        52.8    8e-09   
gb|ELR48539.1|  hypothetical protein M91_08335                        52.8    8e-09   
gb|ELR61175.1|  hypothetical protein M91_01570                        52.8    8e-09   
gb|ELR48604.1|  hypothetical protein M91_19605                        52.8    8e-09   
gb|ELR54609.1|  hypothetical protein M91_07551                        52.8    8e-09   
gb|ELR62420.1|  hypothetical protein M91_10472                        52.8    8e-09   
gb|ELR49012.1|  hypothetical protein M91_01141                        52.8    8e-09   
gb|ELR60873.1|  hypothetical protein M91_12677                        52.8    8e-09   
gb|ELR57344.1|  hypothetical protein M91_03782                        52.8    8e-09   
gb|ELR46636.1|  hypothetical protein M91_20043                        52.8    8e-09   
gb|ELR59187.1|  hypothetical protein M91_00785                        52.8    8e-09   
gb|ELR54676.1|  hypothetical protein M91_15199                        52.8    8e-09   
gb|ELR48758.1|  hypothetical protein M91_16623                        52.8    8e-09   
gb|ELR45185.1|  hypothetical protein M91_00772                        52.8    8e-09   
gb|ELR44776.1|  hypothetical protein M91_14132                        52.8    8e-09   
gb|ELR60459.1|  hypothetical protein M91_06316                        52.8    8e-09   
gb|ELR48316.1|  hypothetical protein M91_13338                        52.8    8e-09   
gb|ELR59648.1|  hypothetical protein M91_01704                        52.8    8e-09   
gb|ELR60383.1|  hypothetical protein M91_04365                        52.8    8e-09   
gb|ELR55746.1|  hypothetical protein M91_14620                        52.8    8e-09   
gb|ELR48978.1|  hypothetical protein M91_07252                        52.8    8e-09   
gb|ELR46271.1|  hypothetical protein M91_17975                        52.8    8e-09   
gb|ELR56608.1|  hypothetical protein M91_06993                        52.8    8e-09   
gb|ELR56451.1|  hypothetical protein M91_09901                        52.8    8e-09   
gb|ELR48591.1|  hypothetical protein M91_17934                        52.8    8e-09   
gb|ELR61814.1|  hypothetical protein M91_08065                        52.8    8e-09   
gb|ELR50540.1|  hypothetical protein M91_05014                        52.8    8e-09   
gb|ELR54602.1|  LINE-1 reverse transcriptase-like protein             52.8    8e-09   
gb|ELR53960.1|  hypothetical protein M91_16134                        52.8    9e-09   
gb|ELR55211.1|  hypothetical protein M91_18560                        52.8    1e-08   
gb|ELR60343.1|  hypothetical protein M91_06787                        52.4    1e-08   
gb|ELR58139.1|  hypothetical protein M91_02702                        52.4    1e-08   
gb|ELR53834.1|  hypothetical protein M91_03393                        52.4    1e-08   
gb|ELR54311.1|  hypothetical protein M91_18376                        52.4    1e-08   
gb|ELR57077.1|  hypothetical protein M91_12176                        52.4    1e-08   
gb|EFH22208.1|  hypothetical protein NEIPOLOT_02020                   55.1    1e-08   
gb|ELR62772.1|  hypothetical protein M91_11495                        52.4    1e-08   
gb|ELR60928.1|  hypothetical protein M91_16901                        52.0    1e-08   
gb|ELR48287.1|  hypothetical protein M91_03394                        52.0    1e-08   
gb|ELR51682.1|  hypothetical protein M91_10300                        52.0    1e-08   
gb|ELR50664.1|  hypothetical protein M91_01403                        52.4    2e-08   
ref|WP_032458404.1|  endonuclease                                     50.4    2e-08   
gb|EFH22226.1|  hypothetical protein NEIPOLOT_02002                   55.5    2e-08   
gb|ELR58787.1|  hypothetical protein M91_05495                        52.0    2e-08   
gb|ELR57656.1|  hypothetical protein M91_20590                        52.0    2e-08   
gb|ELR60342.1|  hypothetical protein M91_06785                        52.0    2e-08   
gb|ELR59724.1|  hypothetical protein M91_04684                        52.0    2e-08   
gb|ELR46478.1|  hypothetical protein M91_04770                        52.0    2e-08   
gb|ELR61457.1|  hypothetical protein M91_11874                        52.0    2e-08   
gb|ELR47522.1|  hypothetical protein M91_05125                        52.0    2e-08   
gb|ELR60151.1|  hypothetical protein M91_19437                        52.0    2e-08   
gb|ELR56734.1|  hypothetical protein M91_11961                        52.0    2e-08   
gb|ELR52812.1|  hypothetical protein M91_08847                        52.0    2e-08   
gb|ELR50637.1|  hypothetical protein M91_04340                        52.0    2e-08   
gb|ELR61686.1|  hypothetical protein M91_04321                        52.0    2e-08   
gb|ELR54523.1|  hypothetical protein M91_05887                        52.0    2e-08   
gb|ELR55073.1|  hypothetical protein M91_18372                        51.6    2e-08   
gb|ELR58792.1|  hypothetical protein M91_05501                        51.6    2e-08   
gb|ELR57084.1|  hypothetical protein M91_12053                        51.6    2e-08   
gb|EPT66614.1|  endonuclease                                          50.8    3e-08   
ref|WP_032459752.1|  endonuclease                                     50.8    3e-08   
ref|WP_003773276.1|  retrovirus-related Pol polyprotein LINE-1        55.1    3e-08   
gb|ACT35644.1|  hypothetical protein                                  55.1    3e-08   Ailuropoda melanoleuca
gb|AAB38375.1|  reverse transcriptase                                 56.2    3e-08   Peromyscus maniculatus
gb|AAC64415.1|  reverse transcriptase                                 56.2    3e-08   Peromyscus maniculatus
gb|AAA67727.1|  reverse transcriptase                                 50.4    3e-08   Mus musculus [mouse]
gb|AAY53484.1|  endonuclease reverse transcriptase                    52.0    3e-08   Bos taurus [bovine]
prf||1510254A  L1 repetitive element ORF                              52.0    4e-08
pir||B34087  hypothetical protein (L1H 3' region) - human             50.8    4e-08
ref|WP_039670468.1|  endonuclease                                     50.8    5e-08   
gb|ELR47172.1|  hypothetical protein M91_06713                        50.4    6e-08   
gb|ELR58788.1|  hypothetical protein M91_05496                        49.7    7e-08   
gb|AER41895.1|  unknown                                               50.8    7e-08   
gb|KAK51372.1|  PF08333 family protein                                51.2    7e-08   
gb|KHK25500.1|  recombinase                                           51.2    7e-08   
gb|EPT69641.1|  endonuclease                                          50.8    7e-08   
gb|AAC51261.1|  putative p150                                         50.8    8e-08   Homo sapiens [man]
ref|WP_029666940.1|  endonuclease                                     50.8    8e-08   
gb|KHK05566.1|  groupII intron-encoded protein                        50.8    9e-08   
gb|ETO03995.1|  hypothetical protein RFI_33407                        50.8    9e-08   
gb|EAY84242.1|  hypothetical protein OsI_05624                        51.2    1e-07   Oryza sativa Indica Group [Indian rice]
gb|AAA88037.1|  unknown protein                                       50.8    1e-07   Homo sapiens [man]
ref|WP_039382860.1|  hypothetical protein                             50.1    1e-07   
gb|AAH36758.1|  MGC4836 protein                                       49.3    1e-07   Homo sapiens [man]
gb|AAB59368.1|  ORF2 contains a reverse transcriptase domain          50.8    1e-07   
gb|AAD39215.1|AF148856_2  unknown                                     50.8    1e-07   
pir||S65824  reverse transcriptase homolog - human transposon L1.1    50.8    1e-07
gb|AAL50637.1|  unknown                                               50.8    1e-07   Homo sapiens [man]
sp|O00370.1|LORF2_HUMAN  RecName: Full=LINE-1 retrotransposable e...  50.8    1e-07   Homo sapiens [man]
gb|AAC51263.1|  putative p150                                         50.8    1e-07   Homo sapiens [man]
gb|AAD38785.1|AF149422_2  unknown                                     50.8    1e-07   
ref|WP_020883489.1|  hypothetical protein                             51.2    1e-07   
gb|AAC51279.1|  putative p150                                         50.8    1e-07   Homo sapiens [man]
gb|KHM23816.1|  endonuclease                                          50.8    1e-07   
ref|WP_001897351.1|  endonuclease                                     50.8    1e-07   
prf||1207289A  reverse transcriptase related protein                  50.8    1e-07
emb|CAA36480.1|  unnamed protein product                              50.4    1e-07   Homo sapiens [man]
ref|WP_033911260.1|  hypothetical protein                             53.1    1e-07   
gb|AAC51276.1|  putative p150                                         50.8    1e-07   Homo sapiens [man]
ref|WP_008930570.1|  RNA-directed DNA polymerase                      50.8    1e-07   
gb|EPT52249.1|  hypothetical protein SAG0051_02725                    50.8    1e-07   
ref|WP_039380839.1|  hypothetical protein                             50.1    2e-07   
gb|AAH32807.1|  Unknown (protein for IMAGE:4480714)                   50.4    2e-07   Homo sapiens [man]
ref|WP_039678096.1|  endonuclease                                     50.8    2e-07   
gb|AAA88038.1|  unknown protein                                       50.4    2e-07   
ref|WP_033757829.1|  hypothetical protein                             53.1    2e-07   
gb|ELR55438.1|  hypothetical protein M91_04089                        50.4    2e-07   
gb|AAH09313.1|  Unknown (protein for MGC:16614)                       48.5    2e-07   
gb|AAL17970.1|  pORF2                                                 50.4    2e-07   Mus musculus domesticus
dbj|BAA20419.1|  reverse transcriptase                                50.4    2e-07   Mus musculus [mouse]
gb|AAC72810.1|  ORF2                                                  50.4    2e-07   Mus musculus domesticus
sp|P11369.2|LORF2_MOUSE  RecName: Full=LINE-1 retrotransposable e...  50.4    2e-07   Mus musculus [mouse]
gb|AAC72793.1|  ORF2                                                  50.4    2e-07   Mus musculus domesticus
gb|AAC53542.1|  endonuclease/reverse transcriptase                    50.4    2e-07   Mus musculus [mouse]
gb|AAC72807.1|  ORF2                                                  50.4    2e-07   Mus musculus domesticus
gb|AAC72799.1|  ORF2                                                  50.4    2e-07   Mus musculus domesticus
gb|AAC72805.1|  ORF2                                                  50.4    2e-07   Mus musculus domesticus
gb|AAA39398.2|  ORF2                                                  50.4    2e-07   Mus musculus domesticus
emb|CAA43592.1|  unnamed protein product                              49.3    2e-07   Rattus norvegicus [brown rat]
gb|EHH23914.1|  hypothetical protein EGK_07482                        47.8    3e-07   
gb|AAC51267.1|  putative p150                                         50.8    3e-07   Homo sapiens [man]
sp|P08548.1|LIN1_NYCCO  RecName: Full=LINE-1 reverse transcriptas...  52.4    3e-07   Nycticebus coucang
gb|ABR01162.1|  endonuclease/reverse transcriptase                    50.1    3e-07   Sus scrofa [pigs]
gb|AAL17972.1|  pORF2                                                 50.4    3e-07   Mus musculus domesticus
gb|ELR50247.1|  hypothetical protein M91_16801                        47.8    3e-07   
gb|AAB41224.1|  ORF2                                                  48.9    3e-07   Rattus norvegicus [brown rat]
ref|XP_726997.1|  hypothetical protein                                50.1    3e-07   Plasmodium yoelii yoelii 17XNL
dbj|BAA87885.1|  unnamed protein product                              49.7    4e-07   Mus musculus [mouse]
ref|WP_002874006.1|  hypothetical protein                             50.1    4e-07   
gb|EHH60795.1|  hypothetical protein EGM_18659                        47.4    4e-07   
gb|AAQ96270.1|  LRRGT00057                                            49.3    4e-07   Rattus norvegicus [brown rat]
gb|EHH24065.1|  hypothetical protein EGK_07653                        47.4    4e-07   
pir||I38588  reverse transcriptase homolog - human retrotransposo...  48.9    4e-07
ref|XP_728222.1|  hypothetical protein                                49.7    5e-07   Plasmodium yoelii yoelii 17XNL
ref|XP_728532.1|  hypothetical protein                                49.7    5e-07   Plasmodium yoelii yoelii 17XNL
ref|XP_728214.1|  hypothetical protein                                49.3    6e-07   Plasmodium yoelii yoelii 17XNL
gb|EDM13183.1|  rCG47246                                              48.9    6e-07   
gb|AAS66285.1|  LRRGT00194                                            48.9    6e-07   Rattus norvegicus [brown rat]
gb|EGT49041.1|  hypothetical protein CAEBREN_30431                    45.4    6e-07   
emb|CCD14539.1|  unnamed protein product                              50.1    7e-07   
gb|AAC72803.1|  ORF2                                                  48.9    7e-07   Mus musculus domesticus
gb|AAQ96221.1|  LRRGT00008                                            48.9    7e-07   Rattus norvegicus [brown rat]
gb|AAP92576.1|  Ab2-051                                               48.5    7e-07   Rattus norvegicus [brown rat]
gb|AAS66282.1|  LRRGT00191                                            48.9    7e-07   Rattus norvegicus [brown rat]
gb|AAS66223.1|  LRRG00132                                             48.5    7e-07   Rattus norvegicus [brown rat]
gb|AAC72797.1|  ORF2                                                  48.5    7e-07   Mus musculus domesticus
gb|AAS66234.1|  LRRGT00143                                            48.9    7e-07   Rattus norvegicus [brown rat]
gb|AAQ91044.1|  LRRGT00088                                            48.5    8e-07   Rattus norvegicus [brown rat]
gb|AAY88216.1|  endonuclease/reverse transcriptase                    48.5    8e-07   Rattus norvegicus [brown rat]
gb|EDL87471.1|  rCG65875                                              48.5    9e-07   
gb|EDM14942.1|  rCG50128                                              48.5    9e-07   
gb|AAQ91021.1|  LRRGT00065                                            49.3    9e-07   Rattus norvegicus [brown rat]
gb|AAS66226.1|  LRRG00135                                             48.5    1e-06   Rattus norvegicus [brown rat]
gb|AAC60655.2|  reverse transcriptase homolog                         48.5    1e-06   Rattus sp. [rats]
gb|AAC51269.1|  putative p150                                         47.0    1e-06   Homo sapiens [man]
gb|AAS66221.1|  LRRG00130                                             47.8    1e-06   Rattus norvegicus [brown rat]
emb|CAA43593.1|  unnamed protein product                              48.5    1e-06   Rattus norvegicus [brown rat]
gb|AAQ91064.1|  LRRGT00108                                            45.8    1e-06   Rattus norvegicus [brown rat]
gb|AAA66456.1|  unknown protein                                       48.1    1e-06   
emb|CCD16839.1|  unnamed protein product                              48.1    1e-06   
ref|WP_032607882.1|  hypothetical protein                             50.8    1e-06   
gb|AAD04635.1|  ORF2-like protein                                     47.0    1e-06   Homo sapiens [man]
ref|XP_674009.1|  ferlin like protein                                 48.5    1e-06   Plasmodium berghei ANKA
gb|ERE67000.1|  catenin alpha-2-like protein                          53.1    2e-06   
emb|CAA37646.1|  ORF3                                                 48.9    2e-06   Rattus norvegicus [brown rat]
gb|AAP78757.1|  Ac1233                                                47.8    2e-06   Rattus norvegicus [brown rat]
gb|ELR59305.1|  hypothetical protein M91_02272                        52.0    2e-06   
gb|ELK09466.1|  Retrovirus-related Pol polyprotein LINE-1             50.4    2e-06   
gb|ABE73456.1|  endonuclease/reverse transcriptase                    49.3    2e-06   Pan troglodytes
gb|AAQ91034.1|  LRRGT00078                                            47.8    2e-06   Rattus norvegicus [brown rat]
gb|AAS66242.1|  LRRGT00151                                            48.5    2e-06   Rattus norvegicus [brown rat]
gb|AAP78761.1|  Ac1262                                                47.0    2e-06   Rattus norvegicus [brown rat]
dbj|BAH12888.1|  unnamed protein product                              46.2    2e-06   Homo sapiens [man]
ref|WP_032535348.1|  hypothetical protein                             50.8    2e-06   
gb|AAQ91041.1|  LRRGT00085                                            46.2    3e-06   Rattus norvegicus [brown rat]
ref|NP_001162315.1|  LRRGT00196                                       47.0    4e-06   Papio anubis [baboon]
ref|WP_039264834.1|  endonuclease                                     51.2    6e-06   
gb|AAC51273.1|  putative p150                                         45.8    6e-06   Homo sapiens [man]
gb|AAS66241.1|  LRRGT00150                                            45.1    8e-06   Rattus norvegicus [brown rat]
ref|WP_016893089.1|  hypothetical protein                             47.8    2e-05   
gb|AAS66287.1|  LRRGT00196                                            44.3    2e-05   Rattus norvegicus [brown rat]
gb|EGT53486.1|  hypothetical protein CAEBREN_30893                    50.1    2e-05   
ref|WP_032742722.1|  hypothetical protein                             47.8    2e-05   
gb|EPJ23932.1|  hypothetical protein CP09DC77_1161                    47.8    2e-05   
gb|AAY88218.1|  endonuclease/reverse transcriptase                    48.5    4e-05   Rattus norvegicus [brown rat]
gb|EGV99744.1|  Retrovirus-related Pol polyprotein LINE-1             47.0    4e-05   
gb|AAQ96249.1|  LRRGT00036                                            42.7    5e-05   Rattus norvegicus [brown rat]
gb|ACE79050.1|  LINE-1 element ORF2 (predicted)                       45.1    7e-05   Sorex araneus [Eurasian shrew]
gb|ELR60158.1|  hypothetical protein M91_08556                        38.9    1e-04   
gb|AAC51264.1|  putative p150                                         48.1    1e-04   Homo sapiens [man]
gb|EGT50279.1|  hypothetical protein CAEBREN_30272                    45.4    2e-04   
gb|AAQ91043.1|  LRRGT00087                                            44.7    4e-04   Rattus norvegicus [brown rat]
gb|EHH55858.1|  hypothetical protein EGM_05144                        44.3    7e-04   
gb|ABE73458.1|  endonuclease/reverse transcriptase                    46.2    7e-04   Pan troglodytes
gb|ERE72289.1|  atlastin-1-like protein                               46.2    7e-04   
dbj|BAH12753.1|  unnamed protein product                              35.4    8e-04   Homo sapiens [man]



>gb|ELR55573.1| hypothetical protein M91_15722 [Bos mutus]
Length=1272

 Score = 52.8 bits (125),  Expect(2) = 4e-10, Method: Compositional matrix adjust.
 Identities = 21/32 (66%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = -3

Query  171  LPEFKIYCKAIVIKTAWYWHKKRHTDQWNQIQ  76
            LP+F++Y KA VIKT WYWHK R+ DQWN+I+
Sbjct  871  LPDFRLYYKATVIKTVWYWHKDRNIDQWNKIE  902


 Score = 37.4 bits (85),  Expect(2) = 4e-10, Method: Compositional matrix adjust.
 Identities = 15/25 (60%), Positives = 18/25 (72%), Gaps = 0/25 (0%)
 Frame = -2

Query  76   APEINTCIYSQLIFNKGDRNTQWGK  2
            +PEIN C Y  LIF+KG +N QW K
Sbjct  903  SPEINPCTYGHLIFDKGGKNIQWIK  927



>gb|ELR56367.1| hypothetical protein M91_05200, partial [Bos mutus]
Length=246

 Score = 52.0 bits (123),  Expect(2) = 9e-10, Method: Compositional matrix adjust.
 Identities = 21/32 (66%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = -3

Query  171  LPEFKIYCKAIVIKTAWYWHKKRHTDQWNQIQ  76
            LP+F++Y KA VIKT WYWHK R+ DQWN+I+
Sbjct  58   LPDFRLYYKATVIKTVWYWHKDRNIDQWNKIE  89


 Score = 37.4 bits (85),  Expect(2) = 9e-10, Method: Compositional matrix adjust.
 Identities = 15/25 (60%), Positives = 18/25 (72%), Gaps = 0/25 (0%)
 Frame = -2

Query  76   APEINTCIYSQLIFNKGDRNTQWGK  2
            +PEIN C Y  LIF+KG +N QW K
Sbjct  90   SPEINPCTYGHLIFDKGGKNIQWIK  114



>gb|ELR53815.1| hypothetical protein M91_04027, partial [Bos mutus]
Length=246

 Score = 52.0 bits (123),  Expect(2) = 1e-09, Method: Compositional matrix adjust.
 Identities = 21/32 (66%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = -3

Query  171  LPEFKIYCKAIVIKTAWYWHKKRHTDQWNQIQ  76
            LP+F++Y KA VIKT WYWHK R+ DQWN+I+
Sbjct  58   LPDFRLYYKATVIKTVWYWHKDRNIDQWNKIE  89


 Score = 37.4 bits (85),  Expect(2) = 1e-09, Method: Compositional matrix adjust.
 Identities = 15/25 (60%), Positives = 18/25 (72%), Gaps = 0/25 (0%)
 Frame = -2

Query  76   APEINTCIYSQLIFNKGDRNTQWGK  2
            +PEIN C Y  LIF+KG +N QW K
Sbjct  90   SPEINPCTYGHLIFDKGGKNIQWIK  114



>gb|ELR48661.1| hypothetical protein M91_21373, partial [Bos mutus]
Length=247

 Score = 50.4 bits (119),  Expect(2) = 1e-09, Method: Compositional matrix adjust.
 Identities = 20/32 (63%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = -3

Query  171  LPEFKIYCKAIVIKTAWYWHKKRHTDQWNQIQ  76
            LP+F++Y KA VIKT WYWHK R+ DQWN+ +
Sbjct  59   LPDFRLYYKATVIKTVWYWHKDRNIDQWNKTE  90


 Score = 38.5 bits (88),  Expect(2) = 1e-09, Method: Compositional matrix adjust.
 Identities = 15/25 (60%), Positives = 18/25 (72%), Gaps = 0/25 (0%)
 Frame = -2

Query  76   APEINTCIYSQLIFNKGDRNTQWGK  2
            +PEIN C Y  LIF+KG +N QW K
Sbjct  91   SPEINPCTYGHLIFDKGSKNIQWRK  115



>gb|AIE45854.1| ORF2 [synthetic construct]
Length=1276

 Score = 56.2 bits (134),  Expect(2) = 1e-09, Method: Compositional matrix adjust.
 Identities = 23/32 (72%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = -3

Query  171  LPEFKIYCKAIVIKTAWYWHKKRHTDQWNQIQ  76
            LP+FK+Y KA VIKTAWYW + RHTDQWN+I+
Sbjct  872  LPDFKLYYKATVIKTAWYWQQNRHTDQWNRIE  903


 Score = 32.7 bits (73),  Expect(2) = 1e-09, Method: Compositional matrix adjust.
 Identities = 12/25 (48%), Positives = 18/25 (72%), Gaps = 0/25 (0%)
 Frame = -2

Query  76   APEINTCIYSQLIFNKGDRNTQWGK  2
            +PE+N  +Y Q+IF+K  +N QW K
Sbjct  904  SPEVNPYLYGQIIFDKKAKNIQWRK  928



>dbj|BAA25253.1| unnamed protein product [Canis lupus familiaris]
Length=1275

 Score = 56.2 bits (134),  Expect(2) = 6e-09, Method: Compositional matrix adjust.
 Identities = 21/32 (66%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = -3

Query  171  LPEFKIYCKAIVIKTAWYWHKKRHTDQWNQIQ  76
            +P+F++Y KA+VIKT WYWHK RH DQWN+I+
Sbjct  872  MPDFRLYYKAVVIKTVWYWHKNRHIDQWNRIE  903


 Score = 30.4 bits (67),  Expect(2) = 6e-09, Method: Compositional matrix adjust.
 Identities = 11/24 (46%), Positives = 16/24 (67%), Gaps = 0/24 (0%)
 Frame = -2

Query  73   PEINTCIYSQLIFNKGDRNTQWGK  2
            PE++  +Y QLIF+KG +   W K
Sbjct  905  PEVDPELYGQLIFDKGGKTIHWKK  928



>gb|ELR61551.1| hypothetical protein M91_14419, partial [Bos mutus]
Length=1264

 Score = 52.8 bits (125),  Expect(2) = 7e-09, Method: Compositional matrix adjust.
 Identities = 21/32 (66%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = -3

Query  171  LPEFKIYCKAIVIKTAWYWHKKRHTDQWNQIQ  76
            LP+F++Y KA VIKT WYWHK R+ DQWN+I+
Sbjct  871  LPDFRLYYKATVIKTVWYWHKDRNIDQWNKIE  902


 Score = 33.1 bits (74),  Expect(2) = 7e-09, Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 17/25 (68%), Gaps = 0/25 (0%)
 Frame = -2

Query  76   APEINTCIYSQLIFNKGDRNTQWGK  2
            +PEIN   Y  LIF+KG +N QW K
Sbjct  903  SPEINPRTYGHLIFDKGGKNIQWIK  927



>gb|ELR51705.1| hypothetical protein M91_10420, partial [Bos mutus]
Length=1179

 Score = 52.8 bits (125),  Expect(2) = 7e-09, Method: Compositional matrix adjust.
 Identities = 21/32 (66%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = -3

Query  171  LPEFKIYCKAIVIKTAWYWHKKRHTDQWNQIQ  76
            LP+F++Y KA VIKT WYWHK R+ DQWN+I+
Sbjct  871  LPDFRLYYKATVIKTVWYWHKDRNIDQWNKIE  902


 Score = 33.1 bits (74),  Expect(2) = 7e-09, Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 17/25 (68%), Gaps = 0/25 (0%)
 Frame = -2

Query  76   APEINTCIYSQLIFNKGDRNTQWGK  2
            +PEIN   Y  LIF+KG +N QW K
Sbjct  903  SPEINPRTYGHLIFDKGGKNIQWIK  927



>gb|ELR57788.1| hypothetical protein M91_08672 [Bos mutus]
Length=1265

 Score = 52.8 bits (125),  Expect(2) = 7e-09, Method: Compositional matrix adjust.
 Identities = 21/32 (66%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = -3

Query  171  LPEFKIYCKAIVIKTAWYWHKKRHTDQWNQIQ  76
            LP+F++Y KA VIKT WYWHK R+ DQWN+I+
Sbjct  871  LPDFRLYYKATVIKTVWYWHKDRNIDQWNKIE  902


 Score = 33.1 bits (74),  Expect(2) = 7e-09, Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 17/25 (68%), Gaps = 0/25 (0%)
 Frame = -2

Query  76   APEINTCIYSQLIFNKGDRNTQWGK  2
            +PEIN   Y  LIF+KG +N QW K
Sbjct  903  SPEINPRTYGHLIFDKGGKNIQWIK  927



>gb|ELR47881.1| hypothetical protein M91_03766 [Bos mutus]
Length=1260

 Score = 52.8 bits (125),  Expect(2) = 7e-09, Method: Compositional matrix adjust.
 Identities = 21/32 (66%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = -3

Query  171  LPEFKIYCKAIVIKTAWYWHKKRHTDQWNQIQ  76
            LP+F++Y KA VIKT WYWHK R+ DQWN+I+
Sbjct  870  LPDFRLYYKATVIKTVWYWHKDRNIDQWNKIE  901


 Score = 33.1 bits (74),  Expect(2) = 7e-09, Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 17/25 (68%), Gaps = 0/25 (0%)
 Frame = -2

Query  76   APEINTCIYSQLIFNKGDRNTQWGK  2
            +PEIN   Y  LIF+KG +N QW K
Sbjct  902  SPEINPRTYGHLIFDKGGKNIQWIK  926



>gb|ELR57783.1| hypothetical protein M91_04059 [Bos mutus]
Length=1266

 Score = 52.8 bits (125),  Expect(2) = 8e-09, Method: Compositional matrix adjust.
 Identities = 21/32 (66%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = -3

Query  171  LPEFKIYCKAIVIKTAWYWHKKRHTDQWNQIQ  76
            LP+F++Y KA VIKT WYWHK R+ DQWN+I+
Sbjct  871  LPDFRLYYKATVIKTVWYWHKDRNIDQWNKIE  902


 Score = 33.1 bits (74),  Expect(2) = 8e-09, Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 17/25 (68%), Gaps = 0/25 (0%)
 Frame = -2

Query  76   APEINTCIYSQLIFNKGDRNTQWGK  2
            +PEIN   Y  LIF+KG +N QW K
Sbjct  903  SPEINPRTYGHLIFDKGGKNIQWIK  927



>gb|ELR58543.1| hypothetical protein M91_01925 [Bos mutus]
Length=1215

 Score = 52.8 bits (125),  Expect(2) = 8e-09, Method: Compositional matrix adjust.
 Identities = 21/32 (66%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = -3

Query  171  LPEFKIYCKAIVIKTAWYWHKKRHTDQWNQIQ  76
            LP+F++Y KA VIKT WYWHK R+ DQWN+I+
Sbjct  871  LPDFRLYYKATVIKTVWYWHKDRNIDQWNKIE  902


 Score = 33.1 bits (74),  Expect(2) = 8e-09, Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 17/25 (68%), Gaps = 0/25 (0%)
 Frame = -2

Query  76   APEINTCIYSQLIFNKGDRNTQWGK  2
            +PEIN   Y  LIF+KG +N QW K
Sbjct  903  SPEINPRTYGHLIFDKGGKNIQWIK  927



>gb|ELR50089.1| hypothetical protein M91_20222, partial [Bos mutus]
Length=1182

 Score = 52.8 bits (125),  Expect(2) = 8e-09, Method: Compositional matrix adjust.
 Identities = 21/32 (66%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = -3

Query  171  LPEFKIYCKAIVIKTAWYWHKKRHTDQWNQIQ  76
            LP+F++Y KA VIKT WYWHK R+ DQWN+I+
Sbjct  871  LPDFRLYYKATVIKTVWYWHKDRNIDQWNKIE  902


 Score = 33.1 bits (74),  Expect(2) = 8e-09, Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 17/25 (68%), Gaps = 0/25 (0%)
 Frame = -2

Query  76   APEINTCIYSQLIFNKGDRNTQWGK  2
            +PEIN   Y  LIF+KG +N QW K
Sbjct  903  SPEINPRTYGHLIFDKGGKNIQWIK  927



>gb|ELR58510.1| hypothetical protein M91_05513, partial [Bos mutus]
Length=1170

 Score = 52.8 bits (125),  Expect(2) = 8e-09, Method: Compositional matrix adjust.
 Identities = 21/32 (66%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = -3

Query  171  LPEFKIYCKAIVIKTAWYWHKKRHTDQWNQIQ  76
            LP+F++Y KA VIKT WYWHK R+ DQWN+I+
Sbjct  871  LPDFRLYYKATVIKTVWYWHKDRNIDQWNKIE  902


 Score = 33.1 bits (74),  Expect(2) = 8e-09, Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 17/25 (68%), Gaps = 0/25 (0%)
 Frame = -2

Query  76   APEINTCIYSQLIFNKGDRNTQWGK  2
            +PEIN   Y  LIF+KG +N QW K
Sbjct  903  SPEINPRTYGHLIFDKGGKNIQWIK  927



>gb|ELR50830.1| hypothetical protein M91_07955 [Bos mutus]
Length=1271

 Score = 52.8 bits (125),  Expect(2) = 8e-09, Method: Compositional matrix adjust.
 Identities = 21/32 (66%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = -3

Query  171  LPEFKIYCKAIVIKTAWYWHKKRHTDQWNQIQ  76
            LP+F++Y KA VIKT WYWHK R+ DQWN+I+
Sbjct  871  LPDFRLYYKATVIKTVWYWHKDRNIDQWNKIE  902


 Score = 33.1 bits (74),  Expect(2) = 8e-09, Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 17/25 (68%), Gaps = 0/25 (0%)
 Frame = -2

Query  76   APEINTCIYSQLIFNKGDRNTQWGK  2
            +PEIN   Y  LIF+KG +N QW K
Sbjct  903  SPEINPRTYGHLIFDKGGKNIQWIK  927



>gb|ELR59055.1| hypothetical protein M91_11778 [Bos mutus]
Length=1272

 Score = 52.8 bits (125),  Expect(2) = 8e-09, Method: Compositional matrix adjust.
 Identities = 21/32 (66%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = -3

Query  171  LPEFKIYCKAIVIKTAWYWHKKRHTDQWNQIQ  76
            LP+F++Y KA VIKT WYWHK R+ DQWN+I+
Sbjct  871  LPDFRLYYKATVIKTVWYWHKDRNIDQWNKIE  902


 Score = 33.1 bits (74),  Expect(2) = 8e-09, Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 17/25 (68%), Gaps = 0/25 (0%)
 Frame = -2

Query  76   APEINTCIYSQLIFNKGDRNTQWGK  2
            +PEIN   Y  LIF+KG +N QW K
Sbjct  903  SPEINPRTYGHLIFDKGGKNIQWIK  927



>gb|ELR50258.1| hypothetical protein M91_08673 [Bos mutus]
Length=1271

 Score = 52.8 bits (125),  Expect(2) = 8e-09, Method: Compositional matrix adjust.
 Identities = 21/32 (66%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = -3

Query  171  LPEFKIYCKAIVIKTAWYWHKKRHTDQWNQIQ  76
            LP+F++Y KA VIKT WYWHK R+ DQWN+I+
Sbjct  871  LPDFRLYYKATVIKTVWYWHKDRNIDQWNKIE  902


 Score = 33.1 bits (74),  Expect(2) = 8e-09, Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 17/25 (68%), Gaps = 0/25 (0%)
 Frame = -2

Query  76   APEINTCIYSQLIFNKGDRNTQWGK  2
            +PEIN   Y  LIF+KG +N QW K
Sbjct  903  SPEINPRTYGHLIFDKGGKNIQWIK  927



>gb|ELR58001.1| hypothetical protein M91_20110 [Bos mutus]
Length=1245

 Score = 52.8 bits (125),  Expect(2) = 8e-09, Method: Compositional matrix adjust.
 Identities = 21/32 (66%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = -3

Query  171  LPEFKIYCKAIVIKTAWYWHKKRHTDQWNQIQ  76
            LP+F++Y KA VIKT WYWHK R+ DQWN+I+
Sbjct  871  LPDFRLYYKATVIKTVWYWHKDRNIDQWNKIE  902


 Score = 33.1 bits (74),  Expect(2) = 8e-09, Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 17/25 (68%), Gaps = 0/25 (0%)
 Frame = -2

Query  76   APEINTCIYSQLIFNKGDRNTQWGK  2
            +PEIN   Y  LIF+KG +N QW K
Sbjct  903  SPEINPRTYGHLIFDKGGKNIQWIK  927



>gb|ELR62244.1| hypothetical protein M91_20933 [Bos mutus]
Length=1273

 Score = 52.8 bits (125),  Expect(2) = 8e-09, Method: Compositional matrix adjust.
 Identities = 21/32 (66%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = -3

Query  171  LPEFKIYCKAIVIKTAWYWHKKRHTDQWNQIQ  76
            LP+F++Y KA VIKT WYWHK R+ DQWN+I+
Sbjct  871  LPDFRLYYKATVIKTVWYWHKDRNIDQWNKIE  902


 Score = 33.1 bits (74),  Expect(2) = 8e-09, Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 17/25 (68%), Gaps = 0/25 (0%)
 Frame = -2

Query  76   APEINTCIYSQLIFNKGDRNTQWGK  2
            +PEIN   Y  LIF+KG +N QW K
Sbjct  903  SPEINPRTYGHLIFDKGGKNIQWIK  927



>gb|ELR58410.1| Retrovirus-related Pol polyprotein LINE-1 [Bos mutus]
Length=1272

 Score = 52.8 bits (125),  Expect(2) = 8e-09, Method: Compositional matrix adjust.
 Identities = 21/32 (66%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = -3

Query  171  LPEFKIYCKAIVIKTAWYWHKKRHTDQWNQIQ  76
            LP+F++Y KA VIKT WYWHK R+ DQWN+I+
Sbjct  871  LPDFRLYYKATVIKTVWYWHKDRNIDQWNKIE  902


 Score = 33.1 bits (74),  Expect(2) = 8e-09, Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 17/25 (68%), Gaps = 0/25 (0%)
 Frame = -2

Query  76   APEINTCIYSQLIFNKGDRNTQWGK  2
            +PEIN   Y  LIF+KG +N QW K
Sbjct  903  SPEINPRTYGHLIFDKGGKNIQWIK  927



>gb|ELR48937.1| hypothetical protein M91_02115 [Bos mutus]
Length=1272

 Score = 52.8 bits (125),  Expect(2) = 8e-09, Method: Compositional matrix adjust.
 Identities = 21/32 (66%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = -3

Query  171  LPEFKIYCKAIVIKTAWYWHKKRHTDQWNQIQ  76
            LP+F++Y KA VIKT WYWHK R+ DQWN+I+
Sbjct  871  LPDFRLYYKATVIKTVWYWHKDRNIDQWNKIE  902


 Score = 33.1 bits (74),  Expect(2) = 8e-09, Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 17/25 (68%), Gaps = 0/25 (0%)
 Frame = -2

Query  76   APEINTCIYSQLIFNKGDRNTQWGK  2
            +PEIN   Y  LIF+KG +N QW K
Sbjct  903  SPEINPRTYGHLIFDKGGKNIQWIK  927



>gb|ELR47131.1| hypothetical protein M91_12925 [Bos mutus]
Length=1271

 Score = 52.8 bits (125),  Expect(2) = 8e-09, Method: Compositional matrix adjust.
 Identities = 21/32 (66%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = -3

Query  171  LPEFKIYCKAIVIKTAWYWHKKRHTDQWNQIQ  76
            LP+F++Y KA VIKT WYWHK R+ DQWN+I+
Sbjct  870  LPDFRLYYKATVIKTVWYWHKDRNIDQWNKIE  901


 Score = 33.1 bits (74),  Expect(2) = 8e-09, Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 17/25 (68%), Gaps = 0/25 (0%)
 Frame = -2

Query  76   APEINTCIYSQLIFNKGDRNTQWGK  2
            +PEIN   Y  LIF+KG +N QW K
Sbjct  902  SPEINPRTYGHLIFDKGGKNIQWIK  926



>gb|ELR59242.1| hypothetical protein M91_06506 [Bos mutus]
Length=1264

 Score = 52.8 bits (125),  Expect(2) = 8e-09, Method: Compositional matrix adjust.
 Identities = 21/32 (66%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = -3

Query  171  LPEFKIYCKAIVIKTAWYWHKKRHTDQWNQIQ  76
            LP+F++Y KA VIKT WYWHK R+ DQWN+I+
Sbjct  871  LPDFRLYYKATVIKTVWYWHKDRNIDQWNKIE  902


 Score = 33.1 bits (74),  Expect(2) = 8e-09, Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 17/25 (68%), Gaps = 0/25 (0%)
 Frame = -2

Query  76   APEINTCIYSQLIFNKGDRNTQWGK  2
            +PEIN   Y  LIF+KG +N QW K
Sbjct  903  SPEINPRTYGHLIFDKGGKNIQWIK  927



>gb|ELR59381.1| hypothetical protein M91_14726 [Bos mutus]
Length=1272

 Score = 52.8 bits (125),  Expect(2) = 8e-09, Method: Compositional matrix adjust.
 Identities = 21/32 (66%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = -3

Query  171  LPEFKIYCKAIVIKTAWYWHKKRHTDQWNQIQ  76
            LP+F++Y KA VIKT WYWHK R+ DQWN+I+
Sbjct  871  LPDFRLYYKATVIKTVWYWHKDRNIDQWNKIE  902


 Score = 33.1 bits (74),  Expect(2) = 8e-09, Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 17/25 (68%), Gaps = 0/25 (0%)
 Frame = -2

Query  76   APEINTCIYSQLIFNKGDRNTQWGK  2
            +PEIN   Y  LIF+KG +N QW K
Sbjct  903  SPEINPRTYGHLIFDKGGKNIQWIK  927



>gb|ELR48628.1| hypothetical protein M91_07595, partial [Bos mutus]
Length=1271

 Score = 52.8 bits (125),  Expect(2) = 8e-09, Method: Compositional matrix adjust.
 Identities = 21/32 (66%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = -3

Query  171  LPEFKIYCKAIVIKTAWYWHKKRHTDQWNQIQ  76
            LP+F++Y KA VIKT WYWHK R+ DQWN+I+
Sbjct  871  LPDFRLYYKATVIKTVWYWHKDRNIDQWNKIE  902


 Score = 33.1 bits (74),  Expect(2) = 8e-09, Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 17/25 (68%), Gaps = 0/25 (0%)
 Frame = -2

Query  76   APEINTCIYSQLIFNKGDRNTQWGK  2
            +PEIN   Y  LIF+KG +N QW K
Sbjct  903  SPEINPRTYGHLIFDKGGKNIQWIK  927



>gb|ELR47876.1| hypothetical protein M91_20604 [Bos mutus]
Length=1271

 Score = 52.8 bits (125),  Expect(2) = 8e-09, Method: Compositional matrix adjust.
 Identities = 21/32 (66%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = -3

Query  171  LPEFKIYCKAIVIKTAWYWHKKRHTDQWNQIQ  76
            LP+F++Y KA VIKT WYWHK R+ DQWN+I+
Sbjct  870  LPDFRLYYKATVIKTVWYWHKDRNIDQWNKIE  901


 Score = 33.1 bits (74),  Expect(2) = 8e-09, Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 17/25 (68%), Gaps = 0/25 (0%)
 Frame = -2

Query  76   APEINTCIYSQLIFNKGDRNTQWGK  2
            +PEIN   Y  LIF+KG +N QW K
Sbjct  902  SPEINPRTYGHLIFDKGGKNIQWIK  926



>gb|ELR58330.1| hypothetical protein M91_20393 [Bos mutus]
Length=1273

 Score = 52.8 bits (125),  Expect(2) = 8e-09, Method: Compositional matrix adjust.
 Identities = 21/32 (66%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = -3

Query  171  LPEFKIYCKAIVIKTAWYWHKKRHTDQWNQIQ  76
            LP+F++Y KA VIKT WYWHK R+ DQWN+I+
Sbjct  871  LPDFRLYYKATVIKTVWYWHKDRNIDQWNKIE  902


 Score = 33.1 bits (74),  Expect(2) = 8e-09, Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 17/25 (68%), Gaps = 0/25 (0%)
 Frame = -2

Query  76   APEINTCIYSQLIFNKGDRNTQWGK  2
            +PEIN   Y  LIF+KG +N QW K
Sbjct  903  SPEINPRTYGHLIFDKGGKNIQWIK  927



>gb|ELR48539.1| hypothetical protein M91_08335 [Bos mutus]
Length=1271

 Score = 52.8 bits (125),  Expect(2) = 8e-09, Method: Compositional matrix adjust.
 Identities = 21/32 (66%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = -3

Query  171  LPEFKIYCKAIVIKTAWYWHKKRHTDQWNQIQ  76
            LP+F++Y KA VIKT WYWHK R+ DQWN+I+
Sbjct  870  LPDFRLYYKATVIKTVWYWHKDRNIDQWNKIE  901


 Score = 33.1 bits (74),  Expect(2) = 8e-09, Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 17/25 (68%), Gaps = 0/25 (0%)
 Frame = -2

Query  76   APEINTCIYSQLIFNKGDRNTQWGK  2
            +PEIN   Y  LIF+KG +N QW K
Sbjct  902  SPEINPRTYGHLIFDKGGKNIQWIK  926



>gb|ELR61175.1| hypothetical protein M91_01570 [Bos mutus]
Length=1270

 Score = 52.8 bits (125),  Expect(2) = 8e-09, Method: Compositional matrix adjust.
 Identities = 21/32 (66%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = -3

Query  171  LPEFKIYCKAIVIKTAWYWHKKRHTDQWNQIQ  76
            LP+F++Y KA VIKT WYWHK R+ DQWN+I+
Sbjct  871  LPDFRLYYKATVIKTVWYWHKDRNIDQWNKIE  902


 Score = 33.1 bits (74),  Expect(2) = 8e-09, Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 17/25 (68%), Gaps = 0/25 (0%)
 Frame = -2

Query  76   APEINTCIYSQLIFNKGDRNTQWGK  2
            +PEIN   Y  LIF+KG +N QW K
Sbjct  903  SPEINPRTYGHLIFDKGGKNIQWIK  927



>gb|ELR48604.1| hypothetical protein M91_19605 [Bos mutus]
Length=1256

 Score = 52.8 bits (125),  Expect(2) = 8e-09, Method: Compositional matrix adjust.
 Identities = 21/32 (66%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = -3

Query  171  LPEFKIYCKAIVIKTAWYWHKKRHTDQWNQIQ  76
            LP+F++Y KA VIKT WYWHK R+ DQWN+I+
Sbjct  872  LPDFRLYYKATVIKTVWYWHKDRNIDQWNKIE  903


 Score = 33.1 bits (74),  Expect(2) = 8e-09, Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 17/25 (68%), Gaps = 0/25 (0%)
 Frame = -2

Query  76   APEINTCIYSQLIFNKGDRNTQWGK  2
            +PEIN   Y  LIF+KG +N QW K
Sbjct  904  SPEINPRTYGHLIFDKGGKNIQWIK  928



>gb|ELR54609.1| hypothetical protein M91_07551 [Bos mutus]
Length=1142

 Score = 52.8 bits (125),  Expect(2) = 8e-09, Method: Compositional matrix adjust.
 Identities = 21/32 (66%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = -3

Query  171  LPEFKIYCKAIVIKTAWYWHKKRHTDQWNQIQ  76
            LP+F++Y KA VIKT WYWHK R+ DQWN+I+
Sbjct  741  LPDFRLYYKATVIKTVWYWHKDRNIDQWNKIE  772


 Score = 33.1 bits (74),  Expect(2) = 8e-09, Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 17/25 (68%), Gaps = 0/25 (0%)
 Frame = -2

Query  76   APEINTCIYSQLIFNKGDRNTQWGK  2
            +PEIN   Y  LIF+KG +N QW K
Sbjct  773  SPEINPRTYGHLIFDKGGKNIQWIK  797



>gb|ELR62420.1| hypothetical protein M91_10472 [Bos mutus]
Length=1273

 Score = 52.8 bits (125),  Expect(2) = 8e-09, Method: Compositional matrix adjust.
 Identities = 21/32 (66%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = -3

Query  171  LPEFKIYCKAIVIKTAWYWHKKRHTDQWNQIQ  76
            LP+F++Y KA VIKT WYWHK R+ DQWN+I+
Sbjct  871  LPDFRLYYKATVIKTVWYWHKDRNIDQWNKIE  902


 Score = 33.1 bits (74),  Expect(2) = 8e-09, Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 17/25 (68%), Gaps = 0/25 (0%)
 Frame = -2

Query  76   APEINTCIYSQLIFNKGDRNTQWGK  2
            +PEIN   Y  LIF+KG +N QW K
Sbjct  903  SPEINPRTYGHLIFDKGGKNIQWIK  927



>gb|ELR49012.1| hypothetical protein M91_01141 [Bos mutus]
Length=1273

 Score = 52.8 bits (125),  Expect(2) = 8e-09, Method: Compositional matrix adjust.
 Identities = 21/32 (66%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = -3

Query  171  LPEFKIYCKAIVIKTAWYWHKKRHTDQWNQIQ  76
            LP+F++Y KA VIKT WYWHK R+ DQWN+I+
Sbjct  872  LPDFRLYYKATVIKTVWYWHKDRNIDQWNKIE  903


 Score = 33.1 bits (74),  Expect(2) = 8e-09, Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 17/25 (68%), Gaps = 0/25 (0%)
 Frame = -2

Query  76   APEINTCIYSQLIFNKGDRNTQWGK  2
            +PEIN   Y  LIF+KG +N QW K
Sbjct  904  SPEINPRTYGHLIFDKGGKNIQWIK  928



>gb|ELR60873.1| hypothetical protein M91_12677 [Bos mutus]
Length=1271

 Score = 52.8 bits (125),  Expect(2) = 8e-09, Method: Compositional matrix adjust.
 Identities = 21/32 (66%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = -3

Query  171  LPEFKIYCKAIVIKTAWYWHKKRHTDQWNQIQ  76
            LP+F++Y KA VIKT WYWHK R+ DQWN+I+
Sbjct  870  LPDFRLYYKATVIKTVWYWHKDRNIDQWNKIE  901


 Score = 33.1 bits (74),  Expect(2) = 8e-09, Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 17/25 (68%), Gaps = 0/25 (0%)
 Frame = -2

Query  76   APEINTCIYSQLIFNKGDRNTQWGK  2
            +PEIN   Y  LIF+KG +N QW K
Sbjct  902  SPEINPRTYGHLIFDKGGKNIQWIK  926



>gb|ELR57344.1| hypothetical protein M91_03782 [Bos mutus]
Length=1271

 Score = 52.8 bits (125),  Expect(2) = 8e-09, Method: Compositional matrix adjust.
 Identities = 21/32 (66%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = -3

Query  171  LPEFKIYCKAIVIKTAWYWHKKRHTDQWNQIQ  76
            LP+F++Y KA VIKT WYWHK R+ DQWN+I+
Sbjct  870  LPDFRLYYKATVIKTVWYWHKDRNIDQWNKIE  901


 Score = 33.1 bits (74),  Expect(2) = 8e-09, Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 17/25 (68%), Gaps = 0/25 (0%)
 Frame = -2

Query  76   APEINTCIYSQLIFNKGDRNTQWGK  2
            +PEIN   Y  LIF+KG +N QW K
Sbjct  902  SPEINPRTYGHLIFDKGGKNIQWIK  926



>gb|ELR46636.1| hypothetical protein M91_20043 [Bos mutus]
Length=1258

 Score = 52.8 bits (125),  Expect(2) = 8e-09, Method: Compositional matrix adjust.
 Identities = 21/32 (66%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = -3

Query  171  LPEFKIYCKAIVIKTAWYWHKKRHTDQWNQIQ  76
            LP+F++Y KA VIKT WYWHK R+ DQWN+I+
Sbjct  871  LPDFRLYYKATVIKTVWYWHKDRNIDQWNKIE  902


 Score = 33.1 bits (74),  Expect(2) = 8e-09, Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 17/25 (68%), Gaps = 0/25 (0%)
 Frame = -2

Query  76   APEINTCIYSQLIFNKGDRNTQWGK  2
            +PEIN   Y  LIF+KG +N QW K
Sbjct  903  SPEINPRTYGHLIFDKGGKNIQWIK  927



>gb|ELR59187.1| hypothetical protein M91_00785, partial [Bos mutus]
Length=1233

 Score = 52.8 bits (125),  Expect(2) = 8e-09, Method: Compositional matrix adjust.
 Identities = 21/32 (66%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = -3

Query  171  LPEFKIYCKAIVIKTAWYWHKKRHTDQWNQIQ  76
            LP+F++Y KA VIKT WYWHK R+ DQWN+I+
Sbjct  832  LPDFRLYYKATVIKTVWYWHKDRNIDQWNKIE  863


 Score = 33.1 bits (74),  Expect(2) = 8e-09, Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 17/25 (68%), Gaps = 0/25 (0%)
 Frame = -2

Query  76   APEINTCIYSQLIFNKGDRNTQWGK  2
            +PEIN   Y  LIF+KG +N QW K
Sbjct  864  SPEINPRTYGHLIFDKGGKNIQWIK  888



>gb|ELR54676.1| hypothetical protein M91_15199 [Bos mutus]
Length=1272

 Score = 52.8 bits (125),  Expect(2) = 8e-09, Method: Compositional matrix adjust.
 Identities = 21/32 (66%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = -3

Query  171  LPEFKIYCKAIVIKTAWYWHKKRHTDQWNQIQ  76
            LP+F++Y KA VIKT WYWHK R+ DQWN+I+
Sbjct  871  LPDFRLYYKATVIKTVWYWHKDRNIDQWNKIE  902


 Score = 33.1 bits (74),  Expect(2) = 8e-09, Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 17/25 (68%), Gaps = 0/25 (0%)
 Frame = -2

Query  76   APEINTCIYSQLIFNKGDRNTQWGK  2
            +PEIN   Y  LIF+KG +N QW K
Sbjct  903  SPEINPRTYGHLIFDKGGKNIQWIK  927



>gb|ELR48758.1| hypothetical protein M91_16623 [Bos mutus]
Length=1272

 Score = 52.8 bits (125),  Expect(2) = 8e-09, Method: Compositional matrix adjust.
 Identities = 21/32 (66%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = -3

Query  171  LPEFKIYCKAIVIKTAWYWHKKRHTDQWNQIQ  76
            LP+F++Y KA VIKT WYWHK R+ DQWN+I+
Sbjct  871  LPDFRLYYKATVIKTVWYWHKDRNIDQWNKIE  902


 Score = 33.1 bits (74),  Expect(2) = 8e-09, Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 17/25 (68%), Gaps = 0/25 (0%)
 Frame = -2

Query  76   APEINTCIYSQLIFNKGDRNTQWGK  2
            +PEIN   Y  LIF+KG +N QW K
Sbjct  903  SPEINPRTYGHLIFDKGGKNIQWIK  927



>gb|ELR45185.1| hypothetical protein M91_00772 [Bos mutus]
Length=1272

 Score = 52.8 bits (125),  Expect(2) = 8e-09, Method: Compositional matrix adjust.
 Identities = 21/32 (66%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = -3

Query  171  LPEFKIYCKAIVIKTAWYWHKKRHTDQWNQIQ  76
            LP+F++Y KA VIKT WYWHK R+ DQWN+I+
Sbjct  871  LPDFRLYYKATVIKTVWYWHKDRNIDQWNKIE  902


 Score = 33.1 bits (74),  Expect(2) = 8e-09, Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 17/25 (68%), Gaps = 0/25 (0%)
 Frame = -2

Query  76   APEINTCIYSQLIFNKGDRNTQWGK  2
            +PEIN   Y  LIF+KG +N QW K
Sbjct  903  SPEINPRTYGHLIFDKGGKNIQWIK  927



>gb|ELR44776.1| hypothetical protein M91_14132 [Bos mutus]
Length=1272

 Score = 52.8 bits (125),  Expect(2) = 8e-09, Method: Compositional matrix adjust.
 Identities = 21/32 (66%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = -3

Query  171  LPEFKIYCKAIVIKTAWYWHKKRHTDQWNQIQ  76
            LP+F++Y KA VIKT WYWHK R+ DQWN+I+
Sbjct  871  LPDFRLYYKATVIKTVWYWHKDRNIDQWNKIE  902


 Score = 33.1 bits (74),  Expect(2) = 8e-09, Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 17/25 (68%), Gaps = 0/25 (0%)
 Frame = -2

Query  76   APEINTCIYSQLIFNKGDRNTQWGK  2
            +PEIN   Y  LIF+KG +N QW K
Sbjct  903  SPEINPRTYGHLIFDKGGKNIQWIK  927



>gb|ELR60459.1| hypothetical protein M91_06316 [Bos mutus]
Length=1270

 Score = 52.8 bits (125),  Expect(2) = 8e-09, Method: Compositional matrix adjust.
 Identities = 21/32 (66%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = -3

Query  171  LPEFKIYCKAIVIKTAWYWHKKRHTDQWNQIQ  76
            LP+F++Y KA VIKT WYWHK R+ DQWN+I+
Sbjct  871  LPDFRLYYKATVIKTVWYWHKDRNIDQWNKIE  902


 Score = 33.1 bits (74),  Expect(2) = 8e-09, Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 17/25 (68%), Gaps = 0/25 (0%)
 Frame = -2

Query  76   APEINTCIYSQLIFNKGDRNTQWGK  2
            +PEIN   Y  LIF+KG +N QW K
Sbjct  903  SPEINPRTYGHLIFDKGGKNIQWIK  927



>gb|ELR48316.1| hypothetical protein M91_13338 [Bos mutus]
Length=1269

 Score = 52.8 bits (125),  Expect(2) = 8e-09, Method: Compositional matrix adjust.
 Identities = 21/32 (66%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = -3

Query  171  LPEFKIYCKAIVIKTAWYWHKKRHTDQWNQIQ  76
            LP+F++Y KA VIKT WYWHK R+ DQWN+I+
Sbjct  871  LPDFRLYYKATVIKTVWYWHKDRNIDQWNKIE  902


 Score = 33.1 bits (74),  Expect(2) = 8e-09, Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 17/25 (68%), Gaps = 0/25 (0%)
 Frame = -2

Query  76   APEINTCIYSQLIFNKGDRNTQWGK  2
            +PEIN   Y  LIF+KG +N QW K
Sbjct  903  SPEINPRTYGHLIFDKGGKNIQWIK  927



>gb|ELR59648.1| hypothetical protein M91_01704 [Bos mutus]
Length=1230

 Score = 52.8 bits (125),  Expect(2) = 8e-09, Method: Compositional matrix adjust.
 Identities = 21/32 (66%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = -3

Query  171  LPEFKIYCKAIVIKTAWYWHKKRHTDQWNQIQ  76
            LP+F++Y KA VIKT WYWHK R+ DQWN+I+
Sbjct  871  LPDFRLYYKATVIKTVWYWHKDRNIDQWNKIE  902


 Score = 33.1 bits (74),  Expect(2) = 8e-09, Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 17/25 (68%), Gaps = 0/25 (0%)
 Frame = -2

Query  76   APEINTCIYSQLIFNKGDRNTQWGK  2
            +PEIN   Y  LIF+KG +N QW K
Sbjct  903  SPEINPRTYGHLIFDKGGKNIQWIK  927



>gb|ELR60383.1| hypothetical protein M91_04365 [Bos mutus]
Length=1272

 Score = 52.8 bits (125),  Expect(2) = 8e-09, Method: Compositional matrix adjust.
 Identities = 21/32 (66%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = -3

Query  171  LPEFKIYCKAIVIKTAWYWHKKRHTDQWNQIQ  76
            LP+F++Y KA VIKT WYWHK R+ DQWN+I+
Sbjct  871  LPDFRLYYKATVIKTVWYWHKDRNIDQWNKIE  902


 Score = 33.1 bits (74),  Expect(2) = 8e-09, Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 17/25 (68%), Gaps = 0/25 (0%)
 Frame = -2

Query  76   APEINTCIYSQLIFNKGDRNTQWGK  2
            +PEIN   Y  LIF+KG +N QW K
Sbjct  903  SPEINPRTYGHLIFDKGGKNIQWIK  927



>gb|ELR55746.1| hypothetical protein M91_14620 [Bos mutus]
Length=1272

 Score = 52.8 bits (125),  Expect(2) = 8e-09, Method: Compositional matrix adjust.
 Identities = 21/32 (66%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = -3

Query  171  LPEFKIYCKAIVIKTAWYWHKKRHTDQWNQIQ  76
            LP+F++Y KA VIKT WYWHK R+ DQWN+I+
Sbjct  871  LPDFRLYYKATVIKTVWYWHKDRNIDQWNKIE  902


 Score = 33.1 bits (74),  Expect(2) = 8e-09, Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 17/25 (68%), Gaps = 0/25 (0%)
 Frame = -2

Query  76   APEINTCIYSQLIFNKGDRNTQWGK  2
            +PEIN   Y  LIF+KG +N QW K
Sbjct  903  SPEINPRTYGHLIFDKGGKNIQWIK  927



>gb|ELR48978.1| hypothetical protein M91_07252 [Bos mutus]
Length=1272

 Score = 52.8 bits (125),  Expect(2) = 8e-09, Method: Compositional matrix adjust.
 Identities = 21/32 (66%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = -3

Query  171  LPEFKIYCKAIVIKTAWYWHKKRHTDQWNQIQ  76
            LP+F++Y KA VIKT WYWHK R+ DQWN+I+
Sbjct  871  LPDFRLYYKATVIKTVWYWHKDRNIDQWNKIE  902


 Score = 33.1 bits (74),  Expect(2) = 8e-09, Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 17/25 (68%), Gaps = 0/25 (0%)
 Frame = -2

Query  76   APEINTCIYSQLIFNKGDRNTQWGK  2
            +PEIN   Y  LIF+KG +N QW K
Sbjct  903  SPEINPRTYGHLIFDKGGKNIQWIK  927



>gb|ELR46271.1| hypothetical protein M91_17975 [Bos mutus]
Length=1272

 Score = 52.8 bits (125),  Expect(2) = 8e-09, Method: Compositional matrix adjust.
 Identities = 21/32 (66%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = -3

Query  171  LPEFKIYCKAIVIKTAWYWHKKRHTDQWNQIQ  76
            LP+F++Y KA VIKT WYWHK R+ DQWN+I+
Sbjct  871  LPDFRLYYKATVIKTVWYWHKDRNIDQWNKIE  902


 Score = 33.1 bits (74),  Expect(2) = 8e-09, Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 17/25 (68%), Gaps = 0/25 (0%)
 Frame = -2

Query  76   APEINTCIYSQLIFNKGDRNTQWGK  2
            +PEIN   Y  LIF+KG +N QW K
Sbjct  903  SPEINPRTYGHLIFDKGGKNIQWIK  927



>gb|ELR56608.1| hypothetical protein M91_06993, partial [Bos mutus]
Length=1267

 Score = 52.8 bits (125),  Expect(2) = 8e-09, Method: Compositional matrix adjust.
 Identities = 21/32 (66%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = -3

Query  171  LPEFKIYCKAIVIKTAWYWHKKRHTDQWNQIQ  76
            LP+F++Y KA VIKT WYWHK R+ DQWN+I+
Sbjct  871  LPDFRLYYKATVIKTVWYWHKDRNIDQWNKIE  902


 Score = 33.1 bits (74),  Expect(2) = 8e-09, Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 17/25 (68%), Gaps = 0/25 (0%)
 Frame = -2

Query  76   APEINTCIYSQLIFNKGDRNTQWGK  2
            +PEIN   Y  LIF+KG +N QW K
Sbjct  903  SPEINPRTYGHLIFDKGGKNIQWIK  927



>gb|ELR56451.1| hypothetical protein M91_09901 [Bos mutus]
Length=1268

 Score = 52.8 bits (125),  Expect(2) = 8e-09, Method: Compositional matrix adjust.
 Identities = 21/32 (66%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = -3

Query  171  LPEFKIYCKAIVIKTAWYWHKKRHTDQWNQIQ  76
            LP+F++Y KA VIKT WYWHK R+ DQWN+I+
Sbjct  871  LPDFRLYYKATVIKTVWYWHKDRNIDQWNKIE  902


 Score = 33.1 bits (74),  Expect(2) = 8e-09, Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 17/25 (68%), Gaps = 0/25 (0%)
 Frame = -2

Query  76   APEINTCIYSQLIFNKGDRNTQWGK  2
            +PEIN   Y  LIF+KG +N QW K
Sbjct  903  SPEINPRTYGHLIFDKGGKNIQWIK  927



>gb|ELR48591.1| hypothetical protein M91_17934 [Bos mutus]
Length=1273

 Score = 52.8 bits (125),  Expect(2) = 8e-09, Method: Compositional matrix adjust.
 Identities = 21/32 (66%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = -3

Query  171  LPEFKIYCKAIVIKTAWYWHKKRHTDQWNQIQ  76
            LP+F++Y KA VIKT WYWHK R+ DQWN+I+
Sbjct  870  LPDFRLYYKATVIKTVWYWHKDRNIDQWNKIE  901


 Score = 33.1 bits (74),  Expect(2) = 8e-09, Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 17/25 (68%), Gaps = 0/25 (0%)
 Frame = -2

Query  76   APEINTCIYSQLIFNKGDRNTQWGK  2
            +PEIN   Y  LIF+KG +N QW K
Sbjct  902  SPEINPRTYGHLIFDKGGKNIQWIK  926



>gb|ELR61814.1| hypothetical protein M91_08065 [Bos mutus]
Length=1272

 Score = 52.8 bits (125),  Expect(2) = 8e-09, Method: Compositional matrix adjust.
 Identities = 21/32 (66%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = -3

Query  171  LPEFKIYCKAIVIKTAWYWHKKRHTDQWNQIQ  76
            LP+F++Y KA VIKT WYWHK R+ DQWN+I+
Sbjct  871  LPDFRLYYKATVIKTVWYWHKDRNIDQWNKIE  902


 Score = 33.1 bits (74),  Expect(2) = 8e-09, Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 17/25 (68%), Gaps = 0/25 (0%)
 Frame = -2

Query  76   APEINTCIYSQLIFNKGDRNTQWGK  2
            +PEIN   Y  LIF+KG +N QW K
Sbjct  903  SPEINPRTYGHLIFDKGGKNIQWIK  927



>gb|ELR50540.1| hypothetical protein M91_05014, partial [Bos mutus]
Length=1234

 Score = 52.8 bits (125),  Expect(2) = 8e-09, Method: Compositional matrix adjust.
 Identities = 21/32 (66%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = -3

Query  171  LPEFKIYCKAIVIKTAWYWHKKRHTDQWNQIQ  76
            LP+F++Y KA VIKT WYWHK R+ DQWN+I+
Sbjct  871  LPDFRLYYKATVIKTVWYWHKDRNIDQWNKIE  902


 Score = 33.1 bits (74),  Expect(2) = 8e-09, Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 17/25 (68%), Gaps = 0/25 (0%)
 Frame = -2

Query  76   APEINTCIYSQLIFNKGDRNTQWGK  2
            +PEIN   Y  LIF+KG +N QW K
Sbjct  903  SPEINPRTYGHLIFDKGGKNIQWIK  927



>gb|ELR54602.1| LINE-1 reverse transcriptase-like protein [Bos mutus]
Length=1206

 Score = 52.8 bits (125),  Expect(2) = 8e-09, Method: Compositional matrix adjust.
 Identities = 21/32 (66%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = -3

Query  171  LPEFKIYCKAIVIKTAWYWHKKRHTDQWNQIQ  76
            LP+F++Y KA VIKT WYWHK R+ DQWN+I+
Sbjct  871  LPDFRLYYKATVIKTVWYWHKDRNIDQWNKIE  902


 Score = 33.1 bits (74),  Expect(2) = 8e-09, Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 17/25 (68%), Gaps = 0/25 (0%)
 Frame = -2

Query  76   APEINTCIYSQLIFNKGDRNTQWGK  2
            +PEIN   Y  LIF+KG +N QW K
Sbjct  903  SPEINPRTYGHLIFDKGGKNIQWIK  927



>gb|ELR53960.1| hypothetical protein M91_16134, partial [Bos mutus]
Length=1251

 Score = 52.8 bits (125),  Expect(2) = 9e-09, Method: Compositional matrix adjust.
 Identities = 21/32 (66%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = -3

Query  171  LPEFKIYCKAIVIKTAWYWHKKRHTDQWNQIQ  76
            LP+F++Y KA VIKT WYWHK R+ DQWN+I+
Sbjct  850  LPDFRLYYKATVIKTVWYWHKDRNIDQWNKIE  881


 Score = 33.1 bits (74),  Expect(2) = 9e-09, Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 17/25 (68%), Gaps = 0/25 (0%)
 Frame = -2

Query  76   APEINTCIYSQLIFNKGDRNTQWGK  2
            +PEIN   Y  LIF+KG +N QW K
Sbjct  882  SPEINPRTYGHLIFDKGGKNIQWIK  906



>gb|ELR55211.1| hypothetical protein M91_18560, partial [Bos mutus]
Length=910

 Score = 52.8 bits (125),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 21/32 (66%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = -3

Query  171  LPEFKIYCKAIVIKTAWYWHKKRHTDQWNQIQ  76
            LP+F++Y KA VIKT WYWHK R+ DQWN+I+
Sbjct  553  LPDFRLYYKATVIKTVWYWHKDRNIDQWNKIE  584


 Score = 33.1 bits (74),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 17/25 (68%), Gaps = 0/25 (0%)
 Frame = -2

Query  76   APEINTCIYSQLIFNKGDRNTQWGK  2
            +PEIN   Y  LIF+KG +N QW K
Sbjct  585  SPEINPRTYGHLIFDKGGKNIQWIK  609



>gb|ELR60343.1| hypothetical protein M91_06787, partial [Bos mutus]
Length=725

 Score = 52.4 bits (124),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 21/32 (66%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = -3

Query  171  LPEFKIYCKAIVIKTAWYWHKKRHTDQWNQIQ  76
            LP+F++Y KA VIKT WYWHK R+ DQWN+I+
Sbjct  337  LPDFRLYYKATVIKTVWYWHKDRNIDQWNKIE  368


 Score = 33.1 bits (74),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 17/25 (68%), Gaps = 0/25 (0%)
 Frame = -2

Query  76   APEINTCIYSQLIFNKGDRNTQWGK  2
            +PEIN   Y  LIF+KG +N QW K
Sbjct  369  SPEINPRTYGHLIFDKGGKNIQWIK  393



>gb|ELR58139.1| hypothetical protein M91_02702, partial [Bos mutus]
Length=729

 Score = 52.4 bits (124),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 21/32 (66%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = -3

Query  171  LPEFKIYCKAIVIKTAWYWHKKRHTDQWNQIQ  76
            LP+F++Y KA VIKT WYWHK R+ DQWN+I+
Sbjct  337  LPDFRLYYKATVIKTVWYWHKDRNIDQWNKIE  368


 Score = 33.1 bits (74),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 17/25 (68%), Gaps = 0/25 (0%)
 Frame = -2

Query  76   APEINTCIYSQLIFNKGDRNTQWGK  2
            +PEIN   Y  LIF+KG +N QW K
Sbjct  369  SPEINPRTYGHLIFDKGGKNIQWIK  393



>gb|ELR53834.1| hypothetical protein M91_03393, partial [Bos mutus]
Length=722

 Score = 52.4 bits (124),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 21/32 (66%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = -3

Query  171  LPEFKIYCKAIVIKTAWYWHKKRHTDQWNQIQ  76
            LP+F++Y KA VIKT WYWHK R+ DQWN+I+
Sbjct  337  LPDFRLYYKATVIKTVWYWHKDRNIDQWNKIE  368


 Score = 33.1 bits (74),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 17/25 (68%), Gaps = 0/25 (0%)
 Frame = -2

Query  76   APEINTCIYSQLIFNKGDRNTQWGK  2
            +PEIN   Y  LIF+KG +N QW K
Sbjct  369  SPEINPRTYGHLIFDKGGKNIQWIK  393



>gb|ELR54311.1| hypothetical protein M91_18376, partial [Bos mutus]
Length=731

 Score = 52.4 bits (124),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 21/32 (66%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = -3

Query  171  LPEFKIYCKAIVIKTAWYWHKKRHTDQWNQIQ  76
            LP+F++Y KA VIKT WYWHK R+ DQWN+I+
Sbjct  340  LPDFRLYYKATVIKTVWYWHKDRNIDQWNKIE  371


 Score = 33.1 bits (74),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 17/25 (68%), Gaps = 0/25 (0%)
 Frame = -2

Query  76   APEINTCIYSQLIFNKGDRNTQWGK  2
            +PEIN   Y  LIF+KG +N QW K
Sbjct  372  SPEINPRTYGHLIFDKGGKNIQWIK  396



>gb|ELR57077.1| hypothetical protein M91_12176, partial [Bos mutus]
Length=728

 Score = 52.4 bits (124),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 21/32 (66%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = -3

Query  171  LPEFKIYCKAIVIKTAWYWHKKRHTDQWNQIQ  76
            LP+F++Y KA VIKT WYWHK R+ DQWN+I+
Sbjct  337  LPDFRLYYKATVIKTVWYWHKDRNIDQWNKIE  368


 Score = 33.1 bits (74),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 17/25 (68%), Gaps = 0/25 (0%)
 Frame = -2

Query  76   APEINTCIYSQLIFNKGDRNTQWGK  2
            +PEIN   Y  LIF+KG +N QW K
Sbjct  369  SPEINPRTYGHLIFDKGGKNIQWIK  393



>gb|EFH22208.1| hypothetical protein NEIPOLOT_02020, partial [Neisseria polysaccharea 
ATCC 43768]
Length=180

 Score = 55.1 bits (131),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 21/32 (66%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = -3

Query  171  LPEFKIYCKAIVIKTAWYWHKKRHTDQWNQIQ  76
            +P+F +Y KA++IKTAWYWHK RH DQWN+I+
Sbjct  66   IPDFSLYYKAVIIKTAWYWHKNRHIDQWNRIE  97


 Score = 30.4 bits (67),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 12/25 (48%), Positives = 16/25 (64%), Gaps = 0/25 (0%)
 Frame = -2

Query  76   APEINTCIYSQLIFNKGDRNTQWGK  2
             PE++   Y QLIF+K  +N QW K
Sbjct  98   TPELDPQTYGQLIFDKAGKNIQWKK  122



>gb|ELR62772.1| hypothetical protein M91_11495, partial [Bos mutus]
Length=722

 Score = 52.4 bits (124),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 21/32 (66%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = -3

Query  171  LPEFKIYCKAIVIKTAWYWHKKRHTDQWNQIQ  76
            LP+F++Y KA VIKT WYWHK R+ DQWN+I+
Sbjct  337  LPDFRLYYKATVIKTVWYWHKDRNIDQWNKIE  368


 Score = 33.1 bits (74),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 17/25 (68%), Gaps = 0/25 (0%)
 Frame = -2

Query  76   APEINTCIYSQLIFNKGDRNTQWGK  2
            +PEIN   Y  LIF+KG +N QW K
Sbjct  369  SPEINPRTYGHLIFDKGGKNIQWIK  393



>gb|ELR60928.1| hypothetical protein M91_16901, partial [Bos mutus]
Length=246

 Score = 52.0 bits (123),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 21/32 (66%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = -3

Query  171  LPEFKIYCKAIVIKTAWYWHKKRHTDQWNQIQ  76
            LP+F++Y KA VIKT WYWHK R+ DQWN+I+
Sbjct  58   LPDFRLYYKATVIKTVWYWHKDRNIDQWNKIE  89


 Score = 33.1 bits (74),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 17/25 (68%), Gaps = 0/25 (0%)
 Frame = -2

Query  76   APEINTCIYSQLIFNKGDRNTQWGK  2
            +PEIN   Y  LIF+KG +N QW K
Sbjct  90   SPEINPHTYGHLIFDKGGKNIQWIK  114



>gb|ELR48287.1| hypothetical protein M91_03394, partial [Bos mutus]
Length=246

 Score = 52.0 bits (123),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 21/32 (66%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = -3

Query  171  LPEFKIYCKAIVIKTAWYWHKKRHTDQWNQIQ  76
            LP+F++Y KA VIKT WYWHK R+ DQWN+I+
Sbjct  58   LPDFRLYYKATVIKTVWYWHKDRNIDQWNKIE  89


 Score = 33.1 bits (74),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 17/25 (68%), Gaps = 0/25 (0%)
 Frame = -2

Query  76   APEINTCIYSQLIFNKGDRNTQWGK  2
            +PEIN   Y  LIF+KG +N QW K
Sbjct  90   SPEINPHTYGHLIFDKGGKNIQWIK  114



>gb|ELR51682.1| hypothetical protein M91_10300, partial [Bos mutus]
Length=244

 Score = 52.0 bits (123),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 21/32 (66%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = -3

Query  171  LPEFKIYCKAIVIKTAWYWHKKRHTDQWNQIQ  76
            LP+F++Y KA VIKT WYWHK R+ DQWN+I+
Sbjct  56   LPDFRLYYKATVIKTVWYWHKDRNIDQWNKIE  87


 Score = 33.1 bits (74),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 17/25 (68%), Gaps = 0/25 (0%)
 Frame = -2

Query  76   APEINTCIYSQLIFNKGDRNTQWGK  2
            +PEIN   Y  LI+NKG +N QW K
Sbjct  88   SPEINPRTYGHLIYNKGGKNIQWIK  112



>gb|ELR50664.1| hypothetical protein M91_01403, partial [Bos mutus]
Length=416

 Score = 52.4 bits (124),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 21/32 (66%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = -3

Query  171  LPEFKIYCKAIVIKTAWYWHKKRHTDQWNQIQ  76
            LP+F++Y KA VIKT WYWHK R+ DQWN+I+
Sbjct  217  LPDFRLYYKATVIKTVWYWHKDRNIDQWNKIE  248


 Score = 32.7 bits (73),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 17/25 (68%), Gaps = 0/25 (0%)
 Frame = -2

Query  76   APEINTCIYSQLIFNKGDRNTQWGK  2
            +PEIN   Y  LIF+KG +N QW K
Sbjct  249  SPEINPRTYGHLIFDKGGKNIQWIK  273



>ref|WP_032458404.1| endonuclease, partial [Klebsiella pneumoniae]
Length=386

 Score = 50.4 bits (119),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = -3

Query  171  LPEFKIYCKAIVIKTAWYWHKKRHTDQWNQIQPQK  67
            LP+FK+Y KA V KTAWYW++ R  DQWN+ +P +
Sbjct  164  LPDFKLYYKATVTKTAWYWYQNRDIDQWNRTEPSE  198


 Score = 34.3 bits (77),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 16/27 (59%), Positives = 19/27 (70%), Gaps = 1/27 (4%)
 Frame = -2

Query  79   TAP-EINTCIYSQLIFNKGDRNTQWGK  2
            T P EI   IY+ LIF+K D+N QWGK
Sbjct  194  TEPSEITPHIYNHLIFDKPDKNKQWGK  220



>gb|EFH22226.1| hypothetical protein NEIPOLOT_02002 [Neisseria polysaccharea 
ATCC 43768]
Length=66

 Score = 55.5 bits (132),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 21/31 (68%), Positives = 28/31 (90%), Gaps = 0/31 (0%)
 Frame = -3

Query  168  PEFKIYCKAIVIKTAWYWHKKRHTDQWNQIQ  76
            P+FK+Y KA++IKT WYWHK RH+DQWN+I+
Sbjct  25   PDFKLYYKAVIIKTVWYWHKNRHSDQWNRIE  55



>gb|ELR58787.1| hypothetical protein M91_05495, partial [Bos mutus]
Length=246

 Score = 52.0 bits (123),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 21/32 (66%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = -3

Query  171  LPEFKIYCKAIVIKTAWYWHKKRHTDQWNQIQ  76
            LP+F++Y KA VIKT WYWHK R+ DQWN+I+
Sbjct  58   LPDFRLYYKATVIKTVWYWHKDRNIDQWNKIE  89


 Score = 32.7 bits (73),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 17/25 (68%), Gaps = 0/25 (0%)
 Frame = -2

Query  76   APEINTCIYSQLIFNKGDRNTQWGK  2
            +PEIN   Y  LIF+KG +N QW K
Sbjct  90   SPEINPRTYGHLIFDKGGKNIQWIK  114



>gb|ELR57656.1| hypothetical protein M91_20590, partial [Bos mutus]
 gb|ELR60601.1| hypothetical protein M91_10686, partial [Bos mutus]
Length=246

 Score = 52.0 bits (123),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 21/32 (66%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = -3

Query  171  LPEFKIYCKAIVIKTAWYWHKKRHTDQWNQIQ  76
            LP+F++Y KA VIKT WYWHK R+ DQWN+I+
Sbjct  58   LPDFRLYYKATVIKTVWYWHKDRNIDQWNKIE  89


 Score = 32.7 bits (73),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 17/25 (68%), Gaps = 0/25 (0%)
 Frame = -2

Query  76   APEINTCIYSQLIFNKGDRNTQWGK  2
            +PEIN   Y  LIF+KG +N QW K
Sbjct  90   SPEINPRTYGHLIFDKGGKNIQWIK  114



>gb|ELR60342.1| hypothetical protein M91_06785, partial [Bos mutus]
Length=246

 Score = 52.0 bits (123),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 21/32 (66%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = -3

Query  171  LPEFKIYCKAIVIKTAWYWHKKRHTDQWNQIQ  76
            LP+F++Y KA VIKT WYWHK R+ DQWN+I+
Sbjct  58   LPDFRLYYKATVIKTVWYWHKDRNIDQWNKIE  89


 Score = 32.7 bits (73),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 17/25 (68%), Gaps = 0/25 (0%)
 Frame = -2

Query  76   APEINTCIYSQLIFNKGDRNTQWGK  2
            +PEIN   Y  LIF+KG +N QW K
Sbjct  90   SPEINPRTYGHLIFDKGGKNIQWIK  114



>gb|ELR59724.1| hypothetical protein M91_04684, partial [Bos mutus]
 gb|ELR60152.1| hypothetical protein M91_19438, partial [Bos mutus]
 gb|ELR60409.1| hypothetical protein M91_19883, partial [Bos mutus]
Length=246

 Score = 52.0 bits (123),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 21/32 (66%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = -3

Query  171  LPEFKIYCKAIVIKTAWYWHKKRHTDQWNQIQ  76
            LP+F++Y KA VIKT WYWHK R+ DQWN+I+
Sbjct  58   LPDFRLYYKATVIKTVWYWHKDRNIDQWNKIE  89


 Score = 32.7 bits (73),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 17/25 (68%), Gaps = 0/25 (0%)
 Frame = -2

Query  76   APEINTCIYSQLIFNKGDRNTQWGK  2
            +PEIN   Y  LIF+KG +N QW K
Sbjct  90   SPEINPRTYGHLIFDKGGKNIQWIK  114



>gb|ELR46478.1| hypothetical protein M91_04770, partial [Bos mutus]
 gb|ELR60635.1| hypothetical protein M91_17232, partial [Bos mutus]
Length=246

 Score = 52.0 bits (123),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 21/32 (66%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = -3

Query  171  LPEFKIYCKAIVIKTAWYWHKKRHTDQWNQIQ  76
            LP+F++Y KA VIKT WYWHK R+ DQWN+I+
Sbjct  58   LPDFRLYYKATVIKTVWYWHKDRNIDQWNKIE  89


 Score = 32.7 bits (73),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 17/25 (68%), Gaps = 0/25 (0%)
 Frame = -2

Query  76   APEINTCIYSQLIFNKGDRNTQWGK  2
            +PEIN   Y  LIF+KG +N QW K
Sbjct  90   SPEINPRTYGHLIFDKGGKNIQWIK  114



>gb|ELR61457.1| hypothetical protein M91_11874, partial [Bos mutus]
Length=245

 Score = 52.0 bits (123),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 21/32 (66%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = -3

Query  171  LPEFKIYCKAIVIKTAWYWHKKRHTDQWNQIQ  76
            LP+F++Y KA VIKT WYWHK R+ DQWN+I+
Sbjct  57   LPDFRLYYKATVIKTVWYWHKDRNIDQWNKIE  88


 Score = 32.7 bits (73),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 17/25 (68%), Gaps = 0/25 (0%)
 Frame = -2

Query  76   APEINTCIYSQLIFNKGDRNTQWGK  2
            +PEIN   Y  LIF+KG +N QW K
Sbjct  89   SPEINPRTYGHLIFDKGGKNIQWIK  113



>gb|ELR47522.1| hypothetical protein M91_05125, partial [Bos mutus]
Length=246

 Score = 52.0 bits (123),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 21/32 (66%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = -3

Query  171  LPEFKIYCKAIVIKTAWYWHKKRHTDQWNQIQ  76
            LP+F++Y KA VIKT WYWHK R+ DQWN+I+
Sbjct  58   LPDFRLYYKATVIKTVWYWHKDRNIDQWNKIE  89


 Score = 32.7 bits (73),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 17/25 (68%), Gaps = 0/25 (0%)
 Frame = -2

Query  76   APEINTCIYSQLIFNKGDRNTQWGK  2
            +PEIN   Y  LIF+KG +N QW K
Sbjct  90   SPEINPRTYGHLIFDKGGKNIQWIK  114



>gb|ELR60151.1| hypothetical protein M91_19437, partial [Bos mutus]
Length=240

 Score = 52.0 bits (123),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 21/32 (66%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = -3

Query  171  LPEFKIYCKAIVIKTAWYWHKKRHTDQWNQIQ  76
            LP+F++Y KA VIKT WYWHK R+ DQWN+I+
Sbjct  58   LPDFRLYYKATVIKTVWYWHKDRNIDQWNKIE  89


 Score = 32.7 bits (73),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 17/25 (68%), Gaps = 0/25 (0%)
 Frame = -2

Query  76   APEINTCIYSQLIFNKGDRNTQWGK  2
            +PEIN   Y  LIF+KG +N QW K
Sbjct  90   SPEINPRTYGHLIFDKGGKNIQWIK  114



>gb|ELR56734.1| hypothetical protein M91_11961, partial [Bos mutus]
Length=246

 Score = 52.0 bits (123),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 21/32 (66%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = -3

Query  171  LPEFKIYCKAIVIKTAWYWHKKRHTDQWNQIQ  76
            LP+F++Y KA VIKT WYWHK R+ DQWN+I+
Sbjct  58   LPDFRLYYKATVIKTVWYWHKDRNIDQWNKIE  89


 Score = 32.7 bits (73),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 17/25 (68%), Gaps = 0/25 (0%)
 Frame = -2

Query  76   APEINTCIYSQLIFNKGDRNTQWGK  2
            +PEIN   Y  LIF+KG +N QW K
Sbjct  90   SPEINPRTYGHLIFDKGGKNIQWIK  114



>gb|ELR52812.1| hypothetical protein M91_08847, partial [Bos mutus]
Length=242

 Score = 52.0 bits (123),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 21/32 (66%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = -3

Query  171  LPEFKIYCKAIVIKTAWYWHKKRHTDQWNQIQ  76
            LP+F++Y KA VIKT WYWHK R+ DQWN+I+
Sbjct  58   LPDFRLYYKATVIKTVWYWHKDRNIDQWNKIE  89


 Score = 32.7 bits (73),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 17/25 (68%), Gaps = 0/25 (0%)
 Frame = -2

Query  76   APEINTCIYSQLIFNKGDRNTQWGK  2
            +PEIN   Y  LIF+KG +N QW K
Sbjct  90   SPEINPRTYGHLIFDKGGKNIQWIK  114



>gb|ELR50637.1| hypothetical protein M91_04340, partial [Bos mutus]
Length=245

 Score = 52.0 bits (123),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 21/32 (66%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = -3

Query  171  LPEFKIYCKAIVIKTAWYWHKKRHTDQWNQIQ  76
            LP+F++Y KA VIKT WYWHK R+ DQWN+I+
Sbjct  57   LPDFRLYYKATVIKTVWYWHKDRNIDQWNKIE  88


 Score = 32.7 bits (73),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 17/25 (68%), Gaps = 0/25 (0%)
 Frame = -2

Query  76   APEINTCIYSQLIFNKGDRNTQWGK  2
            +PEIN   Y  LIF+KG +N QW K
Sbjct  89   SPEINPRTYGHLIFDKGGKNIQWIK  113



>gb|ELR61686.1| hypothetical protein M91_04321, partial [Bos mutus]
Length=241

 Score = 52.0 bits (123),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 21/32 (66%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = -3

Query  171  LPEFKIYCKAIVIKTAWYWHKKRHTDQWNQIQ  76
            LP+F++Y KA VIKT WYWHK R+ DQWN+I+
Sbjct  53   LPDFRLYYKATVIKTVWYWHKDRNIDQWNKIE  84


 Score = 32.7 bits (73),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 17/25 (68%), Gaps = 0/25 (0%)
 Frame = -2

Query  76   APEINTCIYSQLIFNKGDRNTQWGK  2
            +PEIN   Y  LIF+KG +N QW K
Sbjct  85   SPEINPRTYGHLIFDKGGKNIQWIK  109



>gb|ELR54523.1| hypothetical protein M91_05887, partial [Bos mutus]
Length=246

 Score = 52.0 bits (123),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 21/32 (66%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = -3

Query  171  LPEFKIYCKAIVIKTAWYWHKKRHTDQWNQIQ  76
            LP+F++Y KA VIKT WYWHK R+ DQWN+I+
Sbjct  58   LPDFRLYYKATVIKTVWYWHKDRNIDQWNKIE  89


 Score = 32.7 bits (73),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 17/25 (68%), Gaps = 0/25 (0%)
 Frame = -2

Query  76   APEINTCIYSQLIFNKGDRNTQWGK  2
            +PEIN   Y  LIF+KG +N QW K
Sbjct  90   SPEINPRAYGHLIFDKGGKNIQWIK  114



>gb|ELR55073.1| hypothetical protein M91_18372, partial [Bos mutus]
Length=247

 Score = 51.6 bits (122),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 21/32 (66%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = -3

Query  171  LPEFKIYCKAIVIKTAWYWHKKRHTDQWNQIQ  76
            LP+F++Y KA VIKT WYWHK R+ DQWN+I+
Sbjct  58   LPDFRLYYKATVIKTVWYWHKDRNIDQWNKIK  89


 Score = 33.1 bits (74),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 17/25 (68%), Gaps = 0/25 (0%)
 Frame = -2

Query  76   APEINTCIYSQLIFNKGDRNTQWGK  2
            +PEIN   Y  LIF+KG +N QW K
Sbjct  90   SPEINPRTYGHLIFDKGGKNIQWIK  114



>gb|ELR58792.1| hypothetical protein M91_05501, partial [Bos mutus]
Length=233

 Score = 51.6 bits (122),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 21/32 (66%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = -3

Query  171  LPEFKIYCKAIVIKTAWYWHKKRHTDQWNQIQ  76
            LP+F++Y KA VIKT WYWHK R+ DQWN+I+
Sbjct  58   LPDFRLYYKATVIKTVWYWHKDRNIDQWNKIE  89


 Score = 32.7 bits (73),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 17/25 (68%), Gaps = 0/25 (0%)
 Frame = -2

Query  76   APEINTCIYSQLIFNKGDRNTQWGK  2
            +PEIN   Y  LIF+KG +N QW K
Sbjct  90   SPEINPRTYGHLIFDKGGKNIQWIK  114



>gb|ELR57084.1| hypothetical protein M91_12053, partial [Bos mutus]
Length=249

 Score = 51.6 bits (122),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 21/32 (66%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = -3

Query  171  LPEFKIYCKAIVIKTAWYWHKKRHTDQWNQIQ  76
            LP+F++Y KA VIKT WYWHK R+ DQWN+I+
Sbjct  61   LPDFRLYYKATVIKTVWYWHKDRNIDQWNKIE  92


 Score = 32.7 bits (73),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 17/25 (68%), Gaps = 0/25 (0%)
 Frame = -2

Query  76   APEINTCIYSQLIFNKGDRNTQWGK  2
            +PEIN   Y  LIF+KG +N QW K
Sbjct  93   SPEINPRTYGHLIFDKGGKNIQWIK  117



>gb|EPT66614.1| endonuclease [Streptococcus agalactiae CCUG 37742]
Length=1275

 Score = 50.8 bits (120),  Expect(2) = 3e-08, Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = -3

Query  171  LPEFKIYCKAIVIKTAWYWHKKRHTDQWNQIQPQK  67
            LP+FK+Y KA V KTAWYW++ R  DQWN+ +P +
Sbjct  872  LPDFKLYYKATVTKTAWYWYQNRDIDQWNRTEPSE  906


 Score = 33.5 bits (75),  Expect(2) = 3e-08, Method: Compositional matrix adjust.
 Identities = 16/27 (59%), Positives = 19/27 (70%), Gaps = 1/27 (4%)
 Frame = -2

Query  79   TAP-EINTCIYSQLIFNKGDRNTQWGK  2
            T P EI   IY+ LIF+K D+N QWGK
Sbjct  902  TEPSEITPHIYNYLIFDKPDKNKQWGK  928



>ref|WP_032459752.1| endonuclease [Streptococcus agalactiae]
Length=1108

 Score = 50.8 bits (120),  Expect(2) = 3e-08, Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = -3

Query  171  LPEFKIYCKAIVIKTAWYWHKKRHTDQWNQIQPQK  67
            LP+FK+Y KA V KTAWYW++ R  DQWN+ +P +
Sbjct  705  LPDFKLYYKATVTKTAWYWYQNRDIDQWNRTEPSE  739


 Score = 33.5 bits (75),  Expect(2) = 3e-08, Method: Compositional matrix adjust.
 Identities = 16/27 (59%), Positives = 19/27 (70%), Gaps = 1/27 (4%)
 Frame = -2

Query  79   TAP-EINTCIYSQLIFNKGDRNTQWGK  2
            T P EI   IY+ LIF+K D+N QWGK
Sbjct  735  TEPSEITPHIYNYLIFDKPDKNKQWGK  761



>ref|WP_003773276.1| retrovirus-related Pol polyprotein LINE-1, partial [Neisseria 
elongata]
 gb|EFE49267.1| hypothetical protein NEIELOOT_01963, partial [Neisseria elongata 
subsp. glycolytica ATCC 29315]
Length=78

 Score = 55.1 bits (131),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 23/32 (72%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = -3

Query  171  LPEFKIYCKAIVIKTAWYWHKKRHTDQWNQIQ  76
            LP+ KIY KA++IKTAWYWHK RH DQWN+I+
Sbjct  45   LPDPKIYYKAVIIKTAWYWHKNRHVDQWNRIE  76



>gb|ACT35644.1| hypothetical protein [Ailuropoda melanoleuca]
Length=764

 Score = 55.1 bits (131),  Expect(2) = 3e-08, Method: Compositional matrix adjust.
 Identities = 20/32 (63%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = -3

Query  171  LPEFKIYCKAIVIKTAWYWHKKRHTDQWNQIQ  76
            +P+F++Y KA++ KTAWYWHK RH DQWN+I+
Sbjct  325  MPDFELYYKAVITKTAWYWHKNRHMDQWNRIE  356


 Score = 28.9 bits (63),  Expect(2) = 3e-08, Method: Compositional matrix adjust.
 Identities = 10/24 (42%), Positives = 17/24 (71%), Gaps = 0/24 (0%)
 Frame = -2

Query  73   PEINTCIYSQLIFNKGDRNTQWGK  2
            PE++  ++ QLIF+K  +N +W K
Sbjct  358  PEMDPRLFGQLIFDKAGKNIRWKK  381



>gb|AAB38375.1| reverse transcriptase, partial [Peromyscus maniculatus]
Length=203

 Score = 56.2 bits (134),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 22/32 (69%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = -3

Query  171  LPEFKIYCKAIVIKTAWYWHKKRHTDQWNQIQ  76
            +P+FK+Y +A VIKTAWYWHK RH DQWN+I+
Sbjct  157  IPDFKLYYRATVIKTAWYWHKNRHVDQWNRIE  188



>gb|AAC64415.1| reverse transcriptase, partial [Peromyscus maniculatus]
Length=203

 Score = 56.2 bits (134),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 22/32 (69%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = -3

Query  171  LPEFKIYCKAIVIKTAWYWHKKRHTDQWNQIQ  76
            +P+FK+Y +A VIKTAWYWHK RH DQWN+I+
Sbjct  157  IPDFKLYYRATVIKTAWYWHKNRHVDQWNRIE  188



>gb|AAA67727.1| reverse transcriptase [Mus musculus domesticus]
Length=1281

 Score = 50.4 bits (119),  Expect(2) = 3e-08, Method: Compositional matrix adjust.
 Identities = 19/32 (59%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = -3

Query  171  LPEFKIYCKAIVIKTAWYWHKKRHTDQWNQIQ  76
            +P+ K+Y +AIVIKTAWYW++ R  DQWN+I+
Sbjct  879  MPDLKLYYRAIVIKTAWYWYRDRQVDQWNRIE  910


 Score = 33.5 bits (75),  Expect(2) = 3e-08, Method: Compositional matrix adjust.
 Identities = 13/24 (54%), Positives = 16/24 (67%), Gaps = 0/24 (0%)
 Frame = -2

Query  73   PEINTCIYSQLIFNKGDRNTQWGK  2
            PE+N   Y  LIF+KGD+  QW K
Sbjct  912  PEMNPHTYGHLIFDKGDKTIQWKK  935



>gb|AAY53484.1| endonuclease reverse transcriptase [Bos taurus]
Length=1272

 Score = 52.0 bits (123),  Expect(2) = 3e-08, Method: Compositional matrix adjust.
 Identities = 20/32 (63%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = -3

Query  171  LPEFKIYCKAIVIKTAWYWHKKRHTDQWNQIQ  76
            LP+F++Y +A VIKT WYWHK R+ DQWN+I+
Sbjct  871  LPDFRLYYRATVIKTVWYWHKDRNMDQWNKIE  902


 Score = 31.6 bits (70),  Expect(2) = 3e-08, Method: Compositional matrix adjust.
 Identities = 13/25 (52%), Positives = 17/25 (68%), Gaps = 0/25 (0%)
 Frame = -2

Query  76   APEINTCIYSQLIFNKGDRNTQWGK  2
            +PEIN   Y  LIF+KG ++ QW K
Sbjct  903  SPEINPRTYGHLIFDKGGKDIQWIK  927



>prf||1510254A L1 repetitive element ORF
Length=562

 Score = 52.0 bits (123),  Expect(2) = 4e-08, Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = -3

Query  171  LPEFKIYCKAIVIKTAWYWHKKRHTDQWNQIQPQK  67
            LP+FK+Y KA V KT WYW++ RH DQWN+ +P +
Sbjct  361  LPDFKLYYKATVTKTVWYWYQNRHIDQWNRTEPSE  395


 Score = 32.0 bits (71),  Expect(2) = 4e-08, Method: Compositional matrix adjust.
 Identities = 15/27 (56%), Positives = 19/27 (70%), Gaps = 1/27 (4%)
 Frame = -2

Query  79   TAP-EINTCIYSQLIFNKGDRNTQWGK  2
            T P EI   IY+ LIF+K ++N QWGK
Sbjct  391  TEPSEITPHIYNYLIFDKPEKNKQWGK  417



>pir||B34087 hypothetical protein (L1H 3' region) - human
Length=1280

 Score = 50.8 bits (120),  Expect(2) = 4e-08, Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = -3

Query  171  LPEFKIYCKAIVIKTAWYWHKKRHTDQWNQIQPQK  67
            LP+FK+Y KA V KTAWYW++ R  DQWN+ +P +
Sbjct  877  LPDFKLYYKATVTKTAWYWYQNRDIDQWNRTEPSE  911


 Score = 32.7 bits (73),  Expect(2) = 4e-08, Method: Compositional matrix adjust.
 Identities = 16/27 (59%), Positives = 19/27 (70%), Gaps = 1/27 (4%)
 Frame = -2

Query  79   TAP-EINTCIYSQLIFNKGDRNTQWGK  2
            T P EI   IY+ LIF+K D+N QWGK
Sbjct  907  TEPSEIMPHIYNYLIFDKPDKNKQWGK  933



>ref|WP_039670468.1| endonuclease, partial [Enterobacter cloacae]
 gb|KHM36058.1| endonuclease, partial [Enterobacter cloacae]
Length=375

 Score = 50.8 bits (120),  Expect(2) = 5e-08, Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = -3

Query  171  LPEFKIYCKAIVIKTAWYWHKKRHTDQWNQIQPQK  67
            LP+FK+Y KA V KTAWYW++ R  DQWN+ +P +
Sbjct  165  LPDFKLYYKATVTKTAWYWYQNRDIDQWNRTEPSE  199


 Score = 32.7 bits (73),  Expect(2) = 5e-08, Method: Compositional matrix adjust.
 Identities = 14/23 (61%), Positives = 17/23 (74%), Gaps = 0/23 (0%)
 Frame = -2

Query  70   EINTCIYSQLIFNKGDRNTQWGK  2
            EI   IY+ LIF+K D+N QWGK
Sbjct  199  EIMPHIYNYLIFDKPDKNKQWGK  221



>gb|ELR47172.1| hypothetical protein M91_06713, partial [Bos mutus]
Length=246

 Score = 50.4 bits (119),  Expect(2) = 6e-08, Method: Compositional matrix adjust.
 Identities = 20/31 (65%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = -3

Query  168  PEFKIYCKAIVIKTAWYWHKKRHTDQWNQIQ  76
            P+F++Y KA VIKT WYWHK R+ DQWN+I+
Sbjct  59   PDFRLYYKATVIKTVWYWHKDRNIDQWNKIE  89


 Score = 32.7 bits (73),  Expect(2) = 6e-08, Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 17/25 (68%), Gaps = 0/25 (0%)
 Frame = -2

Query  76   APEINTCIYSQLIFNKGDRNTQWGK  2
            +PEIN   Y  LIF+KG +N QW K
Sbjct  90   SPEINPRTYGHLIFDKGGKNIQWIK  114



>gb|ELR58788.1| hypothetical protein M91_05496, partial [Bos mutus]
Length=246

 Score = 49.7 bits (117),  Expect(2) = 7e-08, Method: Compositional matrix adjust.
 Identities = 20/32 (63%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = -3

Query  171  LPEFKIYCKAIVIKTAWYWHKKRHTDQWNQIQ  76
            LP+F++Y KA VIK  WYWHK R+ DQWN+I+
Sbjct  58   LPDFRLYYKATVIKRVWYWHKDRNIDQWNKIE  89


 Score = 33.1 bits (74),  Expect(2) = 7e-08, Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 17/25 (68%), Gaps = 0/25 (0%)
 Frame = -2

Query  76   APEINTCIYSQLIFNKGDRNTQWGK  2
            +PEIN   Y  LIF+KG +N QW K
Sbjct  90   SPEINPRTYGHLIFDKGGKNIQWRK  114



>gb|AER41895.1| unknown [Homo sapiens]
Length=1275

 Score = 50.8 bits (120),  Expect(2) = 7e-08, Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = -3

Query  171  LPEFKIYCKAIVIKTAWYWHKKRHTDQWNQIQPQK  67
            LP+FK+Y KA V KTAWYW++ R  DQWN+ +P +
Sbjct  872  LPDFKLYYKATVTKTAWYWYQNRDIDQWNRTEPSE  906


 Score = 31.6 bits (70),  Expect(2) = 7e-08, Method: Compositional matrix adjust.
 Identities = 15/27 (56%), Positives = 19/27 (70%), Gaps = 1/27 (4%)
 Frame = -2

Query  79   TAP-EINTCIYSQLIFNKGDRNTQWGK  2
            T P EI   IY+ LIF+K ++N QWGK
Sbjct  902  TEPSEIMPLIYNYLIFDKPEKNKQWGK  928



>gb|KAK51372.1| PF08333 family protein [Bordetella bronchiseptica OSU054]
Length=681

 Score = 51.2 bits (121),  Expect(2) = 7e-08, Method: Compositional matrix adjust.
 Identities = 20/36 (56%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = -3

Query  174  ILPEFKIYCKAIVIKTAWYWHKKRHTDQWNQIQPQK  67
            +LP+FK+Y KA V KTAWYW++ R  DQWN+ +P +
Sbjct  277  MLPDFKLYYKATVTKTAWYWYQNRDIDQWNRTEPSE  312


 Score = 31.6 bits (70),  Expect(2) = 7e-08, Method: Compositional matrix adjust.
 Identities = 15/29 (52%), Positives = 20/29 (69%), Gaps = 3/29 (10%)
 Frame = -2

Query  88   EPNTAPEINTCIYSQLIFNKGDRNTQWGK  2
            EP+   EI   IY+ LIF+K ++N QWGK
Sbjct  309  EPS---EITPHIYNYLIFDKPEKNKQWGK  334



>gb|KHK25500.1| recombinase, partial [Listeria monocytogenes SHL009]
Length=507

 Score = 51.2 bits (121),  Expect(2) = 7e-08, Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = -3

Query  171  LPEFKIYCKAIVIKTAWYWHKKRHTDQWNQIQPQK  67
            LP+FK+Y KA V KTAWYW++ R  DQWN+ +P +
Sbjct  297  LPDFKLYYKATVTKTAWYWYQNRDIDQWNRTEPSE  331


 Score = 31.6 bits (70),  Expect(2) = 7e-08, Method: Compositional matrix adjust.
 Identities = 15/27 (56%), Positives = 19/27 (70%), Gaps = 1/27 (4%)
 Frame = -2

Query  79   TAP-EINTCIYSQLIFNKGDRNTQWGK  2
            T P EI   IY+ LIF+K ++N QWGK
Sbjct  327  TEPSEITPHIYNYLIFDKPEKNKQWGK  353



>gb|EPT69641.1| endonuclease, partial [Streptococcus agalactiae CCUG 38383]
Length=1130

 Score = 50.8 bits (120),  Expect(2) = 7e-08, Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = -3

Query  171  LPEFKIYCKAIVIKTAWYWHKKRHTDQWNQIQPQK  67
            LP+FK+Y KA V KTAWYW++ R  DQWN+ +P +
Sbjct  727  LPDFKLYYKATVTKTAWYWYQNRDIDQWNRTEPSE  761


 Score = 32.0 bits (71),  Expect(2) = 7e-08, Method: Compositional matrix adjust.
 Identities = 15/27 (56%), Positives = 19/27 (70%), Gaps = 1/27 (4%)
 Frame = -2

Query  79   TAP-EINTCIYSQLIFNKGDRNTQWGK  2
            T P EI   IY+ LIF+K ++N QWGK
Sbjct  757  TEPSEITPHIYNYLIFDKPEKNKQWGK  783



>gb|AAC51261.1| putative p150 [Homo sapiens]
Length=1275

 Score = 50.8 bits (120),  Expect(2) = 8e-08, Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = -3

Query  171  LPEFKIYCKAIVIKTAWYWHKKRHTDQWNQIQPQK  67
            LP+FK+Y KA V KTAWYW++ R  DQWN+ +P +
Sbjct  872  LPDFKLYYKATVTKTAWYWYQNRDIDQWNRTEPSE  906


 Score = 31.6 bits (70),  Expect(2) = 8e-08, Method: Compositional matrix adjust.
 Identities = 15/27 (56%), Positives = 19/27 (70%), Gaps = 1/27 (4%)
 Frame = -2

Query  79   TAP-EINTCIYSQLIFNKGDRNTQWGK  2
            T P EI   IY+ LIF+K ++N QWGK
Sbjct  902  TEPSEITPHIYNYLIFDKPEKNKQWGK  928



>ref|WP_029666940.1| endonuclease [Streptococcus agalactiae]
Length=1108

 Score = 50.8 bits (120),  Expect(2) = 8e-08, Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = -3

Query  171  LPEFKIYCKAIVIKTAWYWHKKRHTDQWNQIQPQK  67
            LP+FK+Y KA V KTAWYW++ R  DQWN+ +P +
Sbjct  705  LPDFKLYYKATVTKTAWYWYQNRDIDQWNRTEPSE  739


 Score = 32.0 bits (71),  Expect(2) = 8e-08, Method: Compositional matrix adjust.
 Identities = 15/27 (56%), Positives = 19/27 (70%), Gaps = 1/27 (4%)
 Frame = -2

Query  79   TAP-EINTCIYSQLIFNKGDRNTQWGK  2
            T P EI   IY+ LIF+K ++N QWGK
Sbjct  735  TEPSEITPHIYNYLIFDKPEKNKQWGK  761



>gb|KHK05566.1| groupII intron-encoded protein [Listeria monocytogenes SHL001]
Length=348

 Score = 50.8 bits (120),  Expect(2) = 9e-08, Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = -3

Query  171  LPEFKIYCKAIVIKTAWYWHKKRHTDQWNQIQPQK  67
            LP+FK+Y KA V KTAWYW++ R  DQWN+ +P +
Sbjct  277  LPDFKLYYKATVTKTAWYWYQNRDIDQWNRTEPSE  311


 Score = 31.6 bits (70),  Expect(2) = 9e-08, Method: Compositional matrix adjust.
 Identities = 13/23 (57%), Positives = 17/23 (74%), Gaps = 0/23 (0%)
 Frame = -2

Query  70   EINTCIYSQLIFNKGDRNTQWGK  2
            EI   IY+ LIF+K ++N QWGK
Sbjct  311  EITPHIYNYLIFDKPEKNKQWGK  333



>gb|ETO03995.1| hypothetical protein RFI_33407, partial [Reticulomyxa filosa]
Length=774

 Score = 50.8 bits (120),  Expect(2) = 9e-08, Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = -3

Query  171  LPEFKIYCKAIVIKTAWYWHKKRHTDQWNQIQPQK  67
            LP+FK+Y KA V KTAWYW++ R  DQWN+ +P +
Sbjct  530  LPDFKLYYKATVTKTAWYWYQNRDIDQWNRTEPSE  564


 Score = 31.2 bits (69),  Expect(2) = 9e-08, Method: Compositional matrix adjust.
 Identities = 15/27 (56%), Positives = 19/27 (70%), Gaps = 1/27 (4%)
 Frame = -2

Query  79   TAP-EINTCIYSQLIFNKGDRNTQWGK  2
            T P EI   IY+ LIF+K ++N QWGK
Sbjct  560  TEPSEIMPHIYNYLIFDKPEKNKQWGK  586



>gb|EAY84242.1| hypothetical protein OsI_05624 [Oryza sativa Indica Group]
Length=225

 Score = 51.2 bits (121),  Expect(2) = 1e-07, Method: Compositional matrix adjust.
 Identities = 21/32 (66%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = -3

Query  171  LPEFKIYCKAIVIKTAWYWHKKRHTDQWNQIQ  76
            LP+F+ Y KA VIKT WYW++ RHTDQWN+I+
Sbjct  57   LPDFRQYYKATVIKTVWYWYQNRHTDQWNRIE  88


 Score = 31.2 bits (69),  Expect(2) = 1e-07, Method: Compositional matrix adjust.
 Identities = 13/24 (54%), Positives = 17/24 (71%), Gaps = 0/24 (0%)
 Frame = -2

Query  73   PEINTCIYSQLIFNKGDRNTQWGK  2
            P+IN   Y QLIF+KG +N +W K
Sbjct  90   PDINPDTYGQLIFDKGGKNIKWEK  113



>gb|AAA88037.1| unknown protein, partial [Homo sapiens]
Length=1192

 Score = 50.8 bits (120),  Expect(2) = 1e-07, Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = -3

Query  171  LPEFKIYCKAIVIKTAWYWHKKRHTDQWNQIQPQK  67
            LP+FK+Y KA V KTAWYW++ R  DQWN+ +P +
Sbjct  789  LPDFKLYYKATVTKTAWYWYQNRDIDQWNRTEPSE  823


 Score = 31.2 bits (69),  Expect(2) = 1e-07, Method: Compositional matrix adjust.
 Identities = 15/27 (56%), Positives = 19/27 (70%), Gaps = 1/27 (4%)
 Frame = -2

Query  79   TAP-EINTCIYSQLIFNKGDRNTQWGK  2
            T P EI   IY+ LIF+K ++N QWGK
Sbjct  819  TEPSEIMPHIYNYLIFDKPEKNKQWGK  845



>ref|WP_039382860.1| hypothetical protein, partial [Listeria monocytogenes]
 gb|KHK14847.1| hypothetical protein I615_15071, partial [Listeria monocytogenes 
SHL007]
Length=150

 Score = 50.1 bits (118),  Expect(2) = 1e-07, Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = -3

Query  171  LPEFKIYCKAIVIKTAWYWHKKRHTDQWNQIQPQK  67
            LP+FK+Y KA V KTAWYW++ R  DQWN+ +P +
Sbjct  60   LPDFKLYYKATVTKTAWYWYQNRDIDQWNRTEPSE  94


 Score = 32.3 bits (72),  Expect(2) = 1e-07, Method: Compositional matrix adjust.
 Identities = 13/23 (57%), Positives = 17/23 (74%), Gaps = 0/23 (0%)
 Frame = -2

Query  70   EINTCIYSQLIFNKGDRNTQWGK  2
            EI   IY+ LIF+K D+N +WGK
Sbjct  94   EIMPHIYNHLIFDKPDKNKKWGK  116



>gb|AAH36758.1| MGC4836 protein [Homo sapiens]
Length=328

 Score = 49.3 bits (116),  Expect(2) = 1e-07, Method: Compositional matrix adjust.
 Identities = 20/36 (56%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = -3

Query  174  ILPEFKIYCKAIVIKTAWYWHKKRHTDQWNQIQPQK  67
            +LP+FK+Y KA VIKTAWYW++ R  DQ N+ +P +
Sbjct  259  MLPDFKLYHKATVIKTAWYWYQNRDIDQRNRTEPSE  294


 Score = 32.7 bits (73),  Expect(2) = 1e-07, Method: Compositional matrix adjust.
 Identities = 16/27 (59%), Positives = 19/27 (70%), Gaps = 1/27 (4%)
 Frame = -2

Query  79   TAP-EINTCIYSQLIFNKGDRNTQWGK  2
            T P EI   IY+ LIF+K D+N QWGK
Sbjct  290  TEPSEIMPHIYNYLIFDKTDKNKQWGK  316



>gb|AAB59368.1| ORF2 contains a reverse transcriptase domain [Homo sapiens]
Length=1275

 Score = 50.8 bits (120),  Expect(2) = 1e-07, Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = -3

Query  171  LPEFKIYCKAIVIKTAWYWHKKRHTDQWNQIQPQK  67
            LP+FK+Y KA V KTAWYW++ R  DQWN+ +P +
Sbjct  872  LPDFKLYYKATVTKTAWYWYQNRDIDQWNRTEPSE  906


 Score = 31.2 bits (69),  Expect(2) = 1e-07, Method: Compositional matrix adjust.
 Identities = 15/27 (56%), Positives = 19/27 (70%), Gaps = 1/27 (4%)
 Frame = -2

Query  79   TAP-EINTCIYSQLIFNKGDRNTQWGK  2
            T P EI   IY+ LIF+K ++N QWGK
Sbjct  902  TEPSEIMPHIYNYLIFDKPEKNKQWGK  928



>gb|AAD39215.1|AF148856_2 unknown [Homo sapiens]
Length=1275

 Score = 50.8 bits (120),  Expect(2) = 1e-07, Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = -3

Query  171  LPEFKIYCKAIVIKTAWYWHKKRHTDQWNQIQPQK  67
            LP+FK+Y KA V KTAWYW++ R  DQWN+ +P +
Sbjct  872  LPDFKLYYKATVTKTAWYWYQNRDIDQWNRTEPSE  906


 Score = 31.2 bits (69),  Expect(2) = 1e-07, Method: Compositional matrix adjust.
 Identities = 15/27 (56%), Positives = 19/27 (70%), Gaps = 1/27 (4%)
 Frame = -2

Query  79   TAP-EINTCIYSQLIFNKGDRNTQWGK  2
            T P EI   IY+ LIF+K ++N QWGK
Sbjct  902  TEPSEIMPHIYNYLIFDKPEKNKQWGK  928



>pir||S65824 reverse transcriptase homolog - human transposon L1.1
 gb|AAA51622.1| ORF2 [Homo sapiens]
Length=1275

 Score = 50.8 bits (120),  Expect(2) = 1e-07, Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = -3

Query  171  LPEFKIYCKAIVIKTAWYWHKKRHTDQWNQIQPQK  67
            LP+FK+Y KA V KTAWYW++ R  DQWN+ +P +
Sbjct  872  LPDFKLYYKATVTKTAWYWYQNRDIDQWNRTEPSE  906


 Score = 31.2 bits (69),  Expect(2) = 1e-07, Method: Compositional matrix adjust.
 Identities = 15/27 (56%), Positives = 19/27 (70%), Gaps = 1/27 (4%)
 Frame = -2

Query  79   TAP-EINTCIYSQLIFNKGDRNTQWGK  2
            T P EI   IY+ LIF+K ++N QWGK
Sbjct  902  TEPSEIMPHIYNYLIFDKPEKNKQWGK  928



>gb|AAL50637.1| unknown [Homo sapiens]
Length=1275

 Score = 50.8 bits (120),  Expect(2) = 1e-07, Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = -3

Query  171  LPEFKIYCKAIVIKTAWYWHKKRHTDQWNQIQPQK  67
            LP+FK+Y KA V KTAWYW++ R  DQWN+ +P +
Sbjct  872  LPDFKLYYKATVTKTAWYWYQNRDIDQWNRTEPSE  906


 Score = 31.2 bits (69),  Expect(2) = 1e-07, Method: Compositional matrix adjust.
 Identities = 15/27 (56%), Positives = 19/27 (70%), Gaps = 1/27 (4%)
 Frame = -2

Query  79   TAP-EINTCIYSQLIFNKGDRNTQWGK  2
            T P EI   IY+ LIF+K ++N QWGK
Sbjct  902  TEPSEIMPHIYNYLIFDKPEKNKQWGK  928



>sp|O00370.1|LORF2_HUMAN RecName: Full=LINE-1 retrotransposable element ORF2 protein; 
Short=ORF2p; Includes: RecName: Full=Reverse transcriptase; 
Includes: RecName: Full=Endonuclease [Homo sapiens]
 gb|AAC51271.1| putative p150 [Homo sapiens]
Length=1275

 Score = 50.8 bits (120),  Expect(2) = 1e-07, Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = -3

Query  171  LPEFKIYCKAIVIKTAWYWHKKRHTDQWNQIQPQK  67
            LP+FK+Y KA V KTAWYW++ R  DQWN+ +P +
Sbjct  872  LPDFKLYYKATVTKTAWYWYQNRDIDQWNRTEPSE  906


 Score = 31.2 bits (69),  Expect(2) = 1e-07, Method: Compositional matrix adjust.
 Identities = 15/27 (56%), Positives = 19/27 (70%), Gaps = 1/27 (4%)
 Frame = -2

Query  79   TAP-EINTCIYSQLIFNKGDRNTQWGK  2
            T P EI   IY+ LIF+K ++N QWGK
Sbjct  902  TEPSEIMPHIYNYLIFDKPEKNKQWGK  928



>gb|AAC51263.1| putative p150 [Homo sapiens]
Length=1275

 Score = 50.8 bits (120),  Expect(2) = 1e-07, Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = -3

Query  171  LPEFKIYCKAIVIKTAWYWHKKRHTDQWNQIQPQK  67
            LP+FK+Y KA V KTAWYW++ R  DQWN+ +P +
Sbjct  872  LPDFKLYYKATVTKTAWYWYQNRDIDQWNRTEPSE  906


 Score = 31.2 bits (69),  Expect(2) = 1e-07, Method: Compositional matrix adjust.
 Identities = 15/27 (56%), Positives = 19/27 (70%), Gaps = 1/27 (4%)
 Frame = -2

Query  79   TAP-EINTCIYSQLIFNKGDRNTQWGK  2
            T P EI   IY+ LIF+K ++N QWGK
Sbjct  902  TEPSEIMPHIYNYLIFDKPEKNKQWGK  928



>gb|AAD38785.1|AF149422_2 unknown [Homo sapiens]
Length=1275

 Score = 50.8 bits (120),  Expect(2) = 1e-07, Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = -3

Query  171  LPEFKIYCKAIVIKTAWYWHKKRHTDQWNQIQPQK  67
            LP+FK+Y KA V KTAWYW++ R  DQWN+ +P +
Sbjct  872  LPDFKLYYKATVTKTAWYWYQNRDIDQWNRTEPSE  906


 Score = 31.2 bits (69),  Expect(2) = 1e-07, Method: Compositional matrix adjust.
 Identities = 15/27 (56%), Positives = 19/27 (70%), Gaps = 1/27 (4%)
 Frame = -2

Query  79   TAP-EINTCIYSQLIFNKGDRNTQWGK  2
            T P EI   IY+ LIF+K ++N QWGK
Sbjct  902  TEPSEIMPHIYNYLIFDKPEKNKQWGK  928



>ref|WP_020883489.1| hypothetical protein [Enterobacter cloacae]
 gb|EPR38652.1| hypothetical protein EcloH_4483 [Enterobacter cloacae str. Hanford]
Length=115

 Score = 51.2 bits (121),  Expect(2) = 1e-07, Method: Compositional matrix adjust.
 Identities = 20/36 (56%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = -3

Query  174  ILPEFKIYCKAIVIKTAWYWHKKRHTDQWNQIQPQK  67
            +LP+FK+Y KA V KTAWYW++ R  DQWN+ +P +
Sbjct  1    MLPDFKLYYKATVTKTAWYWYQNRDVDQWNRTEPSE  36


 Score = 30.8 bits (68),  Expect(2) = 1e-07, Method: Compositional matrix adjust.
 Identities = 13/23 (57%), Positives = 17/23 (74%), Gaps = 0/23 (0%)
 Frame = -2

Query  70  EINTCIYSQLIFNKGDRNTQWGK  2
           EI   IY+ LIF+K D+N +WGK
Sbjct  36  EIMPHIYNYLIFDKPDKNKKWGK  58



>gb|AAC51279.1| putative p150 [Homo sapiens]
Length=1275

 Score = 50.8 bits (120),  Expect(2) = 1e-07, Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = -3

Query  171  LPEFKIYCKAIVIKTAWYWHKKRHTDQWNQIQPQK  67
            LP+FK+Y KA V KTAWYW++ R  DQWN+ +P +
Sbjct  872  LPDFKLYYKATVTKTAWYWYQNRDIDQWNRTEPSE  906


 Score = 31.2 bits (69),  Expect(2) = 1e-07, Method: Compositional matrix adjust.
 Identities = 15/27 (56%), Positives = 19/27 (70%), Gaps = 1/27 (4%)
 Frame = -2

Query  79   TAP-EINTCIYSQLIFNKGDRNTQWGK  2
            T P EI   IY+ LIF+K ++N QWGK
Sbjct  902  TEPSEIMPHIYNYLIFDKPEKNKQWGK  928



>gb|KHM23816.1| endonuclease [Enterobacter aerogenes]
Length=1275

 Score = 50.8 bits (120),  Expect(2) = 1e-07, Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = -3

Query  171  LPEFKIYCKAIVIKTAWYWHKKRHTDQWNQIQPQK  67
            LP+FK+Y KA V KTAWYW++ R  DQWN+ +P +
Sbjct  872  LPDFKLYYKATVTKTAWYWYQNRDIDQWNRTEPSE  906


 Score = 31.2 bits (69),  Expect(2) = 1e-07, Method: Compositional matrix adjust.
 Identities = 15/27 (56%), Positives = 19/27 (70%), Gaps = 1/27 (4%)
 Frame = -2

Query  79   TAP-EINTCIYSQLIFNKGDRNTQWGK  2
            T P EI   IY+ LIF+K ++N QWGK
Sbjct  902  TEPSEIMPHIYNYLIFDKPEKNKQWGK  928



>ref|WP_001897351.1| endonuclease [Helicobacter pylori]
 gb|EJB99260.1| retrovirus-related Pol polyprotein LINE-1 [Helicobacter pylori 
Hp P-4]
Length=1108

 Score = 50.8 bits (120),  Expect(2) = 1e-07, Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = -3

Query  171  LPEFKIYCKAIVIKTAWYWHKKRHTDQWNQIQPQK  67
            LP+FK+Y KA V KTAWYW++ R  DQWN+ +P +
Sbjct  705  LPDFKLYYKATVTKTAWYWYQNRDIDQWNRTEPSE  739


 Score = 31.2 bits (69),  Expect(2) = 1e-07, Method: Compositional matrix adjust.
 Identities = 15/27 (56%), Positives = 19/27 (70%), Gaps = 1/27 (4%)
 Frame = -2

Query  79   TAP-EINTCIYSQLIFNKGDRNTQWGK  2
            T P EI   IY+ LIF+K ++N QWGK
Sbjct  735  TEPSEIMPHIYNYLIFDKPEKNKQWGK  761



>prf||1207289A reverse transcriptase related protein
Length=1259

 Score = 50.8 bits (120),  Expect(2) = 1e-07, Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = -3

Query  171  LPEFKIYCKAIVIKTAWYWHKKRHTDQWNQIQPQK  67
            LP+FK+Y KA V KTAWYW++ R  DQWN+ +P +
Sbjct  871  LPDFKLYYKATVTKTAWYWYQNRDIDQWNRTEPSE  905


 Score = 31.2 bits (69),  Expect(2) = 1e-07, Method: Compositional matrix adjust.
 Identities = 15/27 (56%), Positives = 19/27 (70%), Gaps = 1/27 (4%)
 Frame = -2

Query  79   TAP-EINTCIYSQLIFNKGDRNTQWGK  2
            T P EI   IY+ LIF+K ++N QWGK
Sbjct  901  TEPSEIMPHIYNYLIFDKPEKNKQWGK  927



>emb|CAA36480.1| unnamed protein product [Homo sapiens]
Length=712

 Score = 50.4 bits (119),  Expect(2) = 1e-07, Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = -3

Query  171  LPEFKIYCKAIVIKTAWYWHKKRHTDQWNQIQPQK  67
            LP+FK+Y KA V KTAWYW++ R  DQWN+ +P +
Sbjct  309  LPDFKLYYKATVTKTAWYWYQNRDIDQWNRTEPSE  343


 Score = 31.2 bits (69),  Expect(2) = 1e-07, Method: Compositional matrix adjust.
 Identities = 13/23 (57%), Positives = 17/23 (74%), Gaps = 0/23 (0%)
 Frame = -2

Query  70   EINTCIYSQLIFNKGDRNTQWGK  2
            EI   IY+ LIF+K ++N QWGK
Sbjct  343  EITPHIYNYLIFDKPEKNEQWGK  365



>ref|WP_033911260.1| hypothetical protein, partial [Neisseria gonorrhoeae]
Length=61

 Score = 53.1 bits (126),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 34/57 (60%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  LPEFKIYCKAIVIKTAWYWHKKRHTDQWNQIQPQK*IHAFTVN*FSTKVTGIHNGER  1
            LP+FK+Y KA V KTAWYW++ R  DQWN+ +P + I     +    K     NGER
Sbjct  2    LPDFKLYYKATVTKTAWYWYQNRDIDQWNRTEPSEIIAHIYNHLIFDKPDKNRNGER  58



>gb|AAC51276.1| putative p150 [Homo sapiens]
Length=1275

 Score = 50.8 bits (120),  Expect(2) = 1e-07, Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = -3

Query  171  LPEFKIYCKAIVIKTAWYWHKKRHTDQWNQIQPQK  67
            LP+FK+Y KA V KTAWYW++ R  DQWN+ +P +
Sbjct  872  LPDFKLYHKATVTKTAWYWYQNRDIDQWNRTEPSE  906


 Score = 31.2 bits (69),  Expect(2) = 1e-07, Method: Compositional matrix adjust.
 Identities = 15/27 (56%), Positives = 19/27 (70%), Gaps = 1/27 (4%)
 Frame = -2

Query  79   TAP-EINTCIYSQLIFNKGDRNTQWGK  2
            T P EI   IY+ LIF+K ++N QWGK
Sbjct  902  TEPSEIMPHIYNYLIFDKPEKNKQWGK  928



>ref|WP_008930570.1| RNA-directed DNA polymerase, partial [Alcanivorax hongdengensis]
 gb|EKF72771.1| RNA-directed DNA polymerase, partial [Alcanivorax hongdengensis 
A-11-3]
Length=991

 Score = 50.8 bits (120),  Expect(2) = 1e-07, Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = -3

Query  171  LPEFKIYCKAIVIKTAWYWHKKRHTDQWNQIQPQK  67
            LP+FK+Y KA V KTAWYW++ R  DQWN+ +P +
Sbjct  588  LPDFKLYYKATVTKTAWYWYQNRDIDQWNRTEPSE  622


 Score = 31.2 bits (69),  Expect(2) = 1e-07, Method: Compositional matrix adjust.
 Identities = 15/27 (56%), Positives = 19/27 (70%), Gaps = 1/27 (4%)
 Frame = -2

Query  79   TAP-EINTCIYSQLIFNKGDRNTQWGK  2
            T P EI   IY+ LIF+K ++N QWGK
Sbjct  618  TEPSEIMPHIYNYLIFDKPEKNKQWGK  644



>gb|EPT52249.1| hypothetical protein SAG0051_02725, partial [Streptococcus agalactiae 
CCUG 19094]
Length=830

 Score = 50.8 bits (120),  Expect(2) = 1e-07, Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = -3

Query  171  LPEFKIYCKAIVIKTAWYWHKKRHTDQWNQIQPQK  67
            LP+FK+Y KA V KTAWYW++ R  DQWN+ +P +
Sbjct  427  LPDFKLYYKATVTKTAWYWYQNRDIDQWNRTEPSE  461


 Score = 30.8 bits (68),  Expect(2) = 1e-07, Method: Compositional matrix adjust.
 Identities = 13/23 (57%), Positives = 17/23 (74%), Gaps = 0/23 (0%)
 Frame = -2

Query  70   EINTCIYSQLIFNKGDRNTQWGK  2
            EI   IY+ LIF+K ++N QWGK
Sbjct  461  EIMPHIYNYLIFDKPEKNKQWGK  483



>ref|WP_039380839.1| hypothetical protein, partial [Listeria monocytogenes]
 gb|KHK14207.1| hypothetical protein I614_14894, partial [Listeria monocytogenes 
SHL006]
Length=188

 Score = 50.1 bits (118),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = -3

Query  171  LPEFKIYCKAIVIKTAWYWHKKRHTDQWNQIQPQK  67
            LP+FK+Y KA V KTAWYW++ R  DQWN+ +P +
Sbjct  12   LPDFKLYYKATVTKTAWYWYQNRDIDQWNRTEPSE  46


 Score = 31.2 bits (69),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 13/23 (57%), Positives = 17/23 (74%), Gaps = 0/23 (0%)
 Frame = -2

Query  70  EINTCIYSQLIFNKGDRNTQWGK  2
           EI   IY+ LIF+K ++N QWGK
Sbjct  46  EITPHIYNYLIFDKPEKNKQWGK  68



>gb|AAH32807.1| Unknown (protein for IMAGE:4480714) [Homo sapiens]
Length=252

 Score = 50.4 bits (119),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = -3

Query  171  LPEFKIYCKAIVIKTAWYWHKKRHTDQWNQIQPQK  67
            LP+FK+Y KA V KTAWYW++ R  DQWN+ +P +
Sbjct  58   LPDFKLYYKATVTKTAWYWYQNRDIDQWNRTEPSE  92


 Score = 30.8 bits (68),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 15/29 (52%), Positives = 20/29 (69%), Gaps = 3/29 (10%)
 Frame = -2

Query  88   EPNTAPEINTCIYSQLIFNKGDRNTQWGK  2
            EP+   EI   IY+ LIF+K ++N QWGK
Sbjct  89   EPS---EIMPHIYNYLIFDKPEKNKQWGK  114



>ref|WP_039678096.1| endonuclease [Enterobacter cloacae]
 gb|KHM13631.1| endonuclease [Enterobacter cloacae]
Length=1108

 Score = 50.8 bits (120),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = -3

Query  171  LPEFKIYCKAIVIKTAWYWHKKRHTDQWNQIQPQK  67
            LP+FK+Y KA V KTAWYW++ R  DQWN+ +P +
Sbjct  705  LPDFKLYYKATVTKTAWYWYQNRDIDQWNRTEPSE  739


 Score = 30.4 bits (67),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 15/27 (56%), Positives = 19/27 (70%), Gaps = 1/27 (4%)
 Frame = -2

Query  79   TAP-EINTCIYSQLIFNKGDRNTQWGK  2
            T P EI   IY+ LIF+K ++N QWGK
Sbjct  735  TEPSEIIPHIYNYLIFDKPEKNKQWGK  761



>gb|AAA88038.1| unknown protein, partial [Homo sapiens]
Length=641

 Score = 50.4 bits (119),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = -3

Query  171  LPEFKIYCKAIVIKTAWYWHKKRHTDQWNQIQPQK  67
            LP+FK+Y KA V KTAWYW++ R  DQWN+ +P +
Sbjct  238  LPDFKLYYKATVTKTAWYWYQNRDIDQWNRTEPSE  272


 Score = 30.8 bits (68),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 13/23 (57%), Positives = 17/23 (74%), Gaps = 0/23 (0%)
 Frame = -2

Query  70   EINTCIYSQLIFNKGDRNTQWGK  2
            EI   IY+ LIF+K ++N QWGK
Sbjct  272  EIMPHIYNYLIFDKPEKNKQWGK  294



>ref|WP_033757829.1| hypothetical protein, partial [Helicobacter pylori]
Length=89

 Score = 53.1 bits (126),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 26/45 (58%), Positives = 31/45 (69%), Gaps = 2/45 (4%)
 Frame = -3

Query  171  LPEFKIYCKAIVIKTAWYWHKKRHTDQWNQIQP--QK*IHAFTVN  43
            +P FK Y KA VIKTAWYW+K R TDQWN+I+    K  H +T N
Sbjct  23   IPNFKTYYKATVIKTAWYWYKNRSTDQWNRIEKPRDKTTHLWTAN  67



>gb|ELR55438.1| hypothetical protein M91_04089, partial [Bos mutus]
Length=246

 Score = 50.4 bits (119),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 21/32 (66%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = -3

Query  171  LPEFKIYCKAIVIKTAWYWHKKRHTDQWNQIQ  76
            LP+F+ Y KA VIKT WYWHK R+ DQWN+I+
Sbjct  58   LPDFRPYYKATVIKTVWYWHKDRNIDQWNKIE  89


 Score = 30.8 bits (68),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 13/25 (52%), Positives = 16/25 (64%), Gaps = 0/25 (0%)
 Frame = -2

Query  76   APEINTCIYSQLIFNKGDRNTQWGK  2
            +PEIN   Y  LI +KG +N QW K
Sbjct  90   SPEINPRTYGHLIVDKGGKNIQWRK  114



>gb|AAH09313.1| Unknown (protein for MGC:16614) [Homo sapiens]
 gb|AIC61929.1| hypothetical protein, partial [synthetic construct]
Length=246

 Score = 48.5 bits (114),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 19/35 (54%), Positives = 26/35 (74%), Gaps = 0/35 (0%)
 Frame = -3

Query  171  LPEFKIYCKAIVIKTAWYWHKKRHTDQWNQIQPQK  67
            LP+FK+Y  A V KTAWYW++ R  DQWN+ +P +
Sbjct  58   LPDFKLYYTATVTKTAWYWYQNRDIDQWNRTEPSE  92


 Score = 32.3 bits (72),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 16/30 (53%), Positives = 20/30 (67%), Gaps = 3/30 (10%)
 Frame = -2

Query  91   VEPNTAPEINTCIYSQLIFNKGDRNTQWGK  2
             EP+   EI   IY+ LIF+K D+N QWGK
Sbjct  88   TEPS---EIMPHIYNYLIFDKPDKNKQWGK  114



>gb|AAL17970.1| pORF2 [Mus musculus domesticus]
Length=1281

 Score = 50.4 bits (119),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 19/32 (59%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = -3

Query  171  LPEFKIYCKAIVIKTAWYWHKKRHTDQWNQIQ  76
            +P+ K+Y +AIVIKTAWYW++ R  DQWN+I+
Sbjct  879  MPDLKLYYRAIVIKTAWYWYRDRQVDQWNRIE  910


 Score = 30.4 bits (67),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 12/24 (50%), Positives = 15/24 (63%), Gaps = 0/24 (0%)
 Frame = -2

Query  73   PEINTCIYSQLIFNKGDRNTQWGK  2
            PE+N   Y  LIF+KG +  QW K
Sbjct  912  PEMNPHTYGHLIFDKGAKTIQWKK  935



>dbj|BAA20419.1| reverse transcriptase [Mus musculus]
Length=1300

 Score = 50.4 bits (119),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 19/32 (59%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = -3

Query  171  LPEFKIYCKAIVIKTAWYWHKKRHTDQWNQIQ  76
            +P+ K+Y +AIVIKTAWYW++ R  DQWN+I+
Sbjct  898  MPDLKLYYRAIVIKTAWYWYRDRQVDQWNRIE  929


 Score = 30.4 bits (67),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 12/24 (50%), Positives = 15/24 (63%), Gaps = 0/24 (0%)
 Frame = -2

Query  73   PEINTCIYSQLIFNKGDRNTQWGK  2
            PE+N   Y  LIF+KG +  QW K
Sbjct  931  PEMNPHTYGHLIFDKGAKTIQWKK  954



>gb|AAC72810.1| ORF2 [Mus musculus domesticus]
Length=1281

 Score = 50.4 bits (119),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 19/32 (59%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = -3

Query  171  LPEFKIYCKAIVIKTAWYWHKKRHTDQWNQIQ  76
            +P+ K+Y +AIVIKTAWYW++ R  DQWN+I+
Sbjct  879  MPDLKLYYRAIVIKTAWYWYRDRQVDQWNRIE  910


 Score = 30.4 bits (67),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 12/24 (50%), Positives = 15/24 (63%), Gaps = 0/24 (0%)
 Frame = -2

Query  73   PEINTCIYSQLIFNKGDRNTQWGK  2
            PE+N   Y  LIF+KG +  QW K
Sbjct  912  PEMNPHTYGHLIFDKGAKTIQWKK  935



>sp|P11369.2|LORF2_MOUSE RecName: Full=LINE-1 retrotransposable element ORF2 protein; 
Short=ORF2p; AltName: Full=Long interspersed element-1; Short=L1; 
AltName: Full=Retrovirus-related Pol polyprotein LINE-1; 
Includes: RecName: Full=Reverse transcriptase; Includes: 
RecName: Full=Endonuclease [Mus musculus]
 gb|AAA66024.1| 2855 is the position of the first start codon in ORF 2; putative 
[Mus musculus domesticus]
Length=1281

 Score = 50.4 bits (119),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 19/32 (59%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = -3

Query  171  LPEFKIYCKAIVIKTAWYWHKKRHTDQWNQIQ  76
            +P+ K+Y +AIVIKTAWYW++ R  DQWN+I+
Sbjct  879  MPDLKLYYRAIVIKTAWYWYRDRQVDQWNRIE  910


 Score = 30.4 bits (67),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 12/24 (50%), Positives = 15/24 (63%), Gaps = 0/24 (0%)
 Frame = -2

Query  73   PEINTCIYSQLIFNKGDRNTQWGK  2
            PE+N   Y  LIF+KG +  QW K
Sbjct  912  PEMNPHTYGHLIFDKGAKTIQWKK  935



>gb|AAC72793.1| ORF2 [Mus musculus domesticus]
 gb|AAC72795.1| ORF2 [Mus musculus domesticus]
Length=1281

 Score = 50.4 bits (119),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 19/32 (59%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = -3

Query  171  LPEFKIYCKAIVIKTAWYWHKKRHTDQWNQIQ  76
            +P+ K+Y +AIVIKTAWYW++ R  DQWN+I+
Sbjct  879  MPDLKLYYRAIVIKTAWYWYRDRQVDQWNRIE  910


 Score = 30.8 bits (68),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 12/24 (50%), Positives = 15/24 (63%), Gaps = 0/24 (0%)
 Frame = -2

Query  73   PEINTCIYSQLIFNKGDRNTQWGK  2
            PE+N   Y  LIF+KG +  QW K
Sbjct  912  PEMNPHTYGHLIFDKGAKTIQWKK  935



>gb|AAC53542.1| endonuclease/reverse transcriptase [Mus musculus]
 gb|AAC72802.1| ORF2 [Mus musculus domesticus]
Length=1281

 Score = 50.4 bits (119),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 19/32 (59%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = -3

Query  171  LPEFKIYCKAIVIKTAWYWHKKRHTDQWNQIQ  76
            +P+ K+Y +AIVIKTAWYW++ R  DQWN+I+
Sbjct  879  MPDLKLYYRAIVIKTAWYWYRDRQVDQWNRIE  910


 Score = 30.8 bits (68),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 12/24 (50%), Positives = 15/24 (63%), Gaps = 0/24 (0%)
 Frame = -2

Query  73   PEINTCIYSQLIFNKGDRNTQWGK  2
            PE+N   Y  LIF+KG +  QW K
Sbjct  912  PEMNPHTYGHLIFDKGAKTIQWKK  935



>gb|AAC72807.1| ORF2 [Mus musculus domesticus]
Length=1281

 Score = 50.4 bits (119),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 19/32 (59%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = -3

Query  171  LPEFKIYCKAIVIKTAWYWHKKRHTDQWNQIQ  76
            +P+ K+Y +AIVIKTAWYW++ R  DQWN+I+
Sbjct  879  MPDLKLYYRAIVIKTAWYWYRDRQVDQWNRIE  910


 Score = 30.8 bits (68),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 12/24 (50%), Positives = 15/24 (63%), Gaps = 0/24 (0%)
 Frame = -2

Query  73   PEINTCIYSQLIFNKGDRNTQWGK  2
            PE+N   Y  LIF+KG +  QW K
Sbjct  912  PEMNPHTYGHLIFDKGAKTIQWKK  935



>gb|AAC72799.1| ORF2 [Mus musculus domesticus]
Length=1281

 Score = 50.4 bits (119),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 19/32 (59%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = -3

Query  171  LPEFKIYCKAIVIKTAWYWHKKRHTDQWNQIQ  76
            +P+ K+Y +AIVIKTAWYW++ R  DQWN+I+
Sbjct  879  MPDLKLYYRAIVIKTAWYWYRDRQVDQWNRIE  910


 Score = 30.4 bits (67),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 12/24 (50%), Positives = 15/24 (63%), Gaps = 0/24 (0%)
 Frame = -2

Query  73   PEINTCIYSQLIFNKGDRNTQWGK  2
            PE+N   Y  LIF+KG +  QW K
Sbjct  912  PEMNPHTYGHLIFDKGAKTIQWKK  935



>gb|AAC72805.1| ORF2 [Mus musculus domesticus]
Length=1252

 Score = 50.4 bits (119),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 19/32 (59%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = -3

Query  171  LPEFKIYCKAIVIKTAWYWHKKRHTDQWNQIQ  76
            +P+ K+Y +AIVIKTAWYW++ R  DQWN+I+
Sbjct  879  MPDLKLYYRAIVIKTAWYWYRDRQVDQWNRIE  910


 Score = 30.4 bits (67),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 12/24 (50%), Positives = 15/24 (63%), Gaps = 0/24 (0%)
 Frame = -2

Query  73   PEINTCIYSQLIFNKGDRNTQWGK  2
            PE+N   Y  LIF+KG +  QW K
Sbjct  912  PEMNPHTYGHLIFDKGAKTIQWKK  935



>gb|AAA39398.2| ORF2 [Mus musculus domesticus]
Length=1300

 Score = 50.4 bits (119),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 19/32 (59%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = -3

Query  171  LPEFKIYCKAIVIKTAWYWHKKRHTDQWNQIQ  76
            +P+ K+Y +AIVIKTAWYW++ R  DQWN+I+
Sbjct  898  MPDLKLYYRAIVIKTAWYWYRDRQVDQWNRIE  929


 Score = 30.4 bits (67),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 12/24 (50%), Positives = 15/24 (63%), Gaps = 0/24 (0%)
 Frame = -2

Query  73   PEINTCIYSQLIFNKGDRNTQWGK  2
            PE+N   Y  LIF+KG +  QW K
Sbjct  931  PEMNPHTYGHLIFDKGAKTIQWKK  954



>emb|CAA43592.1| unnamed protein product [Rattus norvegicus]
Length=685

 Score = 49.3 bits (116),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 20/32 (63%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = -3

Query  171  LPEFKIYCKAIVIKTAWYWHKKRHTDQWNQIQ  76
            +PE K Y +AIVIKTAWYW++ R  DQWN+I+
Sbjct  614  IPELKQYYRAIVIKTAWYWYRDRQIDQWNRIE  645


 Score = 31.6 bits (70),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 12/24 (50%), Positives = 16/24 (67%), Gaps = 0/24 (0%)
 Frame = -2

Query  73   PEINTCIYSQLIFNKGDRNTQWGK  2
            PE+N+  Y  LIF+KG +  QW K
Sbjct  647  PEMNSHTYGHLIFDKGAKTIQWKK  670



>gb|EHH23914.1| hypothetical protein EGK_07482, partial [Macaca mulatta]
Length=247

 Score = 47.8 bits (112),  Expect(2) = 3e-07, Method: Compositional matrix adjust.
 Identities = 19/32 (59%), Positives = 25/32 (78%), Gaps = 0/32 (0%)
 Frame = -3

Query  171  LPEFKIYCKAIVIKTAWYWHKKRHTDQWNQIQ  76
            LP+FK+Y KA V KTAWYW++ R  DQWN+ +
Sbjct  58   LPDFKLYYKATVTKTAWYWYQNRDIDQWNRTE  89


 Score = 32.7 bits (73),  Expect(2) = 3e-07, Method: Compositional matrix adjust.
 Identities = 14/23 (61%), Positives = 17/23 (74%), Gaps = 0/23 (0%)
 Frame = -2

Query  70   EINTCIYSQLIFNKGDRNTQWGK  2
            EI   IYS LIF+K +RN +WGK
Sbjct  92   EIIPHIYSHLIFDKPERNKKWGK  114



>gb|AAC51267.1| putative p150 [Homo sapiens]
Length=1275

 Score = 50.8 bits (120),  Expect(2) = 3e-07, Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = -3

Query  171  LPEFKIYCKAIVIKTAWYWHKKRHTDQWNQIQPQK  67
            LP+FK+Y KA V KTAWYW++ R  DQWN+ +P +
Sbjct  872  LPDFKLYYKATVTKTAWYWYQNRDIDQWNRTEPSE  906


 Score = 29.6 bits (65),  Expect(2) = 3e-07, Method: Compositional matrix adjust.
 Identities = 15/27 (56%), Positives = 18/27 (67%), Gaps = 1/27 (4%)
 Frame = -2

Query  79   TAP-EINTCIYSQLIFNKGDRNTQWGK  2
            T P EI   IY+ LIF+K  +N QWGK
Sbjct  902  TEPSEIMPHIYNYLIFDKPGKNKQWGK  928



>sp|P08548.1|LIN1_NYCCO RecName: Full=LINE-1 reverse transcriptase homolog [Nycticebus 
coucang]
 prf||1207289B reverse transcriptase related protein
Length=1260

 Score = 52.4 bits (124),  Expect(2) = 3e-07, Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = -3

Query  171  LPEFKIYCKAIVIKTAWYWHKKRHTDQWNQIQPQK  67
            LP+ ++Y K+IVIKTAWYWHK R  D WN+I+ Q+
Sbjct  871  LPDLRLYYKSIVIKTAWYWHKNREVDVWNRIENQE  905


 Score = 28.1 bits (61),  Expect(2) = 3e-07, Method: Compositional matrix adjust.
 Identities = 11/23 (48%), Positives = 15/23 (65%), Gaps = 0/23 (0%)
 Frame = -2

Query  70   EINTCIYSQLIFNKGDRNTQWGK  2
            E++   Y  LIF+K  +N QWGK
Sbjct  905  EMDPATYHYLIFDKPIKNIQWGK  927



>gb|ABR01162.1| endonuclease/reverse transcriptase [Sus scrofa]
Length=1272

 Score = 50.1 bits (118),  Expect(2) = 3e-07, Method: Compositional matrix adjust.
 Identities = 21/32 (66%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = -3

Query  171  LPEFKIYCKAIVIKTAWYWHKKRHTDQWNQIQ  76
            LP+FK Y KA VIKT WYW++ R TDQWN+I+
Sbjct  871  LPDFKKYYKATVIKTVWYWYQNRQTDQWNRIE  902


 Score = 30.4 bits (67),  Expect(2) = 3e-07, Method: Compositional matrix adjust.
 Identities = 13/23 (57%), Positives = 16/23 (70%), Gaps = 0/23 (0%)
 Frame = -2

Query  70   EINTCIYSQLIFNKGDRNTQWGK  2
            EIN   Y QLIF+KG +N +W K
Sbjct  905  EINPDTYGQLIFDKGGKNIKWEK  927



>gb|AAL17972.1| pORF2 [Mus musculus domesticus]
Length=1281

 Score = 50.4 bits (119),  Expect(2) = 3e-07, Method: Compositional matrix adjust.
 Identities = 19/32 (59%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = -3

Query  171  LPEFKIYCKAIVIKTAWYWHKKRHTDQWNQIQ  76
            +P+ K+Y +AIVIKTAWYW++ R  DQWN+I+
Sbjct  879  MPDLKLYYRAIVIKTAWYWYRDRQVDQWNRIE  910


 Score = 30.0 bits (66),  Expect(2) = 3e-07, Method: Compositional matrix adjust.
 Identities = 12/24 (50%), Positives = 15/24 (63%), Gaps = 0/24 (0%)
 Frame = -2

Query  73   PEINTCIYSQLIFNKGDRNTQWGK  2
            PE+N   Y  LIF+KG +  QW K
Sbjct  912  PEMNPHTYGHLIFDKGVKTIQWKK  935



>gb|ELR50247.1| hypothetical protein M91_16801, partial [Bos mutus]
Length=239

 Score = 47.8 bits (112),  Expect(2) = 3e-07, Method: Compositional matrix adjust.
 Identities = 20/32 (63%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = -3

Query  171  LPEFKIYCKAIVIKTAWYWHKKRHTDQWNQIQ  76
            L +F++Y KA VIKT WYWHK R+ DQWN+I+
Sbjct  51   LSDFRLYYKAKVIKTVWYWHKDRNIDQWNKIE  82


 Score = 32.7 bits (73),  Expect(2) = 3e-07, Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 17/25 (68%), Gaps = 0/25 (0%)
 Frame = -2

Query  76   APEINTCIYSQLIFNKGDRNTQWGK  2
            +PEIN   Y  LIF+KG +N QW K
Sbjct  83   SPEINPRTYGHLIFDKGGKNIQWIK  107



>gb|AAB41224.1| ORF2 [Rattus norvegicus]
Length=1300

 Score = 48.9 bits (115),  Expect(2) = 3e-07, Method: Compositional matrix adjust.
 Identities = 20/32 (63%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = -3

Query  171  LPEFKIYCKAIVIKTAWYWHKKRHTDQWNQIQ  76
            +PE K Y +AIVIKTAWYW++ R  DQWN+I+
Sbjct  898  IPELKQYYRAIVIKTAWYWYRDRQIDQWNRIE  929


 Score = 31.2 bits (69),  Expect(2) = 3e-07, Method: Compositional matrix adjust.
 Identities = 12/24 (50%), Positives = 16/24 (67%), Gaps = 0/24 (0%)
 Frame = -2

Query  73   PEINTCIYSQLIFNKGDRNTQWGK  2
            PE+N+  Y  LIF+KG +  QW K
Sbjct  931  PEMNSHTYGHLIFDKGAKTIQWKK  954



>ref|XP_726997.1| hypothetical protein [Plasmodium yoelii yoelii 17XNL]
 gb|EAA18562.1| hypothetical protein [Plasmodium yoelii yoelii]
Length=627

 Score = 50.1 bits (118),  Expect(2) = 3e-07, Method: Compositional matrix adjust.
 Identities = 19/32 (59%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = -3

Query  171  LPEFKIYCKAIVIKTAWYWHKKRHTDQWNQIQ  76
            +P+ K+Y +AIVIKTAWYW++ R  DQWN+I+
Sbjct  225  MPDLKLYYRAIVIKTAWYWYRDRQVDQWNRIE  256


 Score = 30.4 bits (67),  Expect(2) = 3e-07, Method: Compositional matrix adjust.
 Identities = 12/24 (50%), Positives = 15/24 (63%), Gaps = 0/24 (0%)
 Frame = -2

Query  73   PEINTCIYSQLIFNKGDRNTQWGK  2
            PE+N   Y  LIF+KG +  QW K
Sbjct  258  PEMNPHTYGHLIFDKGAKTIQWKK  281



>dbj|BAA87885.1| unnamed protein product [Mus musculus]
Length=1219

 Score = 49.7 bits (117),  Expect(2) = 4e-07, Method: Compositional matrix adjust.
 Identities = 19/32 (59%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = -3

Query  171  LPEFKIYCKAIVIKTAWYWHKKRHTDQWNQIQ  76
            +P+ K+Y +AIVIKTAWYW++ R  DQWN I+
Sbjct  817  MPDLKLYYRAIVIKTAWYWYRDRQVDQWNGIE  848


 Score = 30.4 bits (67),  Expect(2) = 4e-07, Method: Compositional matrix adjust.
 Identities = 12/24 (50%), Positives = 15/24 (63%), Gaps = 0/24 (0%)
 Frame = -2

Query  73   PEINTCIYSQLIFNKGDRNTQWGK  2
            PE+N   Y  LIF+KG +  QW K
Sbjct  850  PEMNPHTYGHLIFDKGAKTIQWKK  873



>ref|WP_002874006.1| hypothetical protein, partial [Campylobacter jejuni]
 gb|EIB23141.1| hypothetical protein cje109_09794, partial [Campylobacter jejuni 
subsp. jejuni LMG 23263]
Length=106

 Score = 50.1 bits (118),  Expect(2) = 4e-07, Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = -3

Query  171  LPEFKIYCKAIVIKTAWYWHKKRHTDQWNQIQPQK  67
            LP+FK+Y KA V KTAWYW++ R  DQWN+ +P +
Sbjct  9    LPDFKLYYKATVTKTAWYWYQNRDIDQWNRTEPSE  43


 Score = 30.4 bits (67),  Expect(2) = 4e-07, Method: Compositional matrix adjust.
 Identities = 13/23 (57%), Positives = 17/23 (74%), Gaps = 0/23 (0%)
 Frame = -2

Query  70  EINTCIYSQLIFNKGDRNTQWGK  2
           EI   IY+ LIF+K ++N QWGK
Sbjct  43  EIMPHIYNYLIFDKPEKNKQWGK  65



>gb|EHH60795.1| hypothetical protein EGM_18659, partial [Macaca fascicularis]
Length=643

 Score = 47.4 bits (111),  Expect(2) = 4e-07, Method: Compositional matrix adjust.
 Identities = 19/32 (59%), Positives = 25/32 (78%), Gaps = 0/32 (0%)
 Frame = -3

Query  171  LPEFKIYCKAIVIKTAWYWHKKRHTDQWNQIQ  76
            LP+FK+Y KA V KTAWYW++ R  DQWN+ +
Sbjct  269  LPDFKLYYKATVTKTAWYWYQNRDIDQWNRTE  300


 Score = 32.7 bits (73),  Expect(2) = 4e-07, Method: Compositional matrix adjust.
 Identities = 14/23 (61%), Positives = 17/23 (74%), Gaps = 0/23 (0%)
 Frame = -2

Query  70   EINTCIYSQLIFNKGDRNTQWGK  2
            EI   IYS LIF+K +RN +WGK
Sbjct  303  EIIPHIYSHLIFDKPERNKKWGK  325



>gb|AAQ96270.1| LRRGT00057 [Rattus norvegicus]
Length=2321

 Score = 49.3 bits (116),  Expect(2) = 4e-07, Method: Compositional matrix adjust.
 Identities = 20/32 (63%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = -3

Query  171   LPEFKIYCKAIVIKTAWYWHKKRHTDQWNQIQ  76
             +PE K Y +AIVIKTAWYW++ R  DQWN+I+
Sbjct  1889  IPELKQYYRAIVIKTAWYWYRNRQIDQWNRIE  1920


 Score = 30.8 bits (68),  Expect(2) = 4e-07, Method: Compositional matrix adjust.
 Identities = 12/24 (50%), Positives = 15/24 (63%), Gaps = 0/24 (0%)
 Frame = -2

Query  73    PEINTCIYSQLIFNKGDRNTQWGK  2
             PE+N   Y  LIF+KG +  QW K
Sbjct  1922  PEMNPHTYGHLIFDKGAKTIQWKK  1945



>gb|EHH24065.1| hypothetical protein EGK_07653, partial [Macaca mulatta]
Length=643

 Score = 47.4 bits (111),  Expect(2) = 4e-07, Method: Compositional matrix adjust.
 Identities = 19/32 (59%), Positives = 25/32 (78%), Gaps = 0/32 (0%)
 Frame = -3

Query  171  LPEFKIYCKAIVIKTAWYWHKKRHTDQWNQIQ  76
            LP+FK+Y KA V KTAWYW++ R  DQWN+ +
Sbjct  269  LPDFKLYYKATVTKTAWYWYQNRDIDQWNRTE  300


 Score = 32.7 bits (73),  Expect(2) = 4e-07, Method: Compositional matrix adjust.
 Identities = 14/23 (61%), Positives = 17/23 (74%), Gaps = 0/23 (0%)
 Frame = -2

Query  70   EINTCIYSQLIFNKGDRNTQWGK  2
            EI   IYS LIF+K +RN +WGK
Sbjct  303  EIIPHIYSHLIFDKPERNKKWGK  325



>pir||I38588 reverse transcriptase homolog - human retrotransposon L1
 gb|AAB60345.1| ORF2 [Homo sapiens]
Length=1275

 Score = 48.9 bits (115),  Expect(2) = 4e-07, Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 26/35 (74%), Gaps = 0/35 (0%)
 Frame = -3

Query  171  LPEFKIYCKAIVIKTAWYWHKKRHTDQWNQIQPQK  67
            LP FK+Y KA V KTAWYW++ R  DQWN+ +P +
Sbjct  872  LPYFKLYYKATVTKTAWYWYQNRDIDQWNRTEPSE  906


 Score = 31.2 bits (69),  Expect(2) = 4e-07, Method: Compositional matrix adjust.
 Identities = 15/27 (56%), Positives = 19/27 (70%), Gaps = 1/27 (4%)
 Frame = -2

Query  79   TAP-EINTCIYSQLIFNKGDRNTQWGK  2
            T P EI   IY+ LIF+K ++N QWGK
Sbjct  902  TEPSEIMPHIYNYLIFDKPEKNKQWGK  928



>ref|XP_728222.1| hypothetical protein [Plasmodium yoelii yoelii 17XNL]
 gb|EAA19787.1| Unknown protein [Plasmodium yoelii yoelii]
Length=305

 Score = 49.7 bits (117),  Expect(2) = 5e-07, Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 31/41 (76%), Gaps = 1/41 (2%)
 Frame = -3

Query  171  LPEFKIYCKAIVIKTAWYWHKKRHTDQWNQIQ-PQK*IHAF  52
            +P+ K+Y +AIVIKTAWYW++ R  DQWN+I+ P+   H +
Sbjct  102  MPDLKLYYRAIVIKTAWYWYRDRQVDQWNRIEDPEMNPHTY  142


 Score = 30.0 bits (66),  Expect(2) = 5e-07, Method: Compositional matrix adjust.
 Identities = 12/24 (50%), Positives = 15/24 (63%), Gaps = 0/24 (0%)
 Frame = -2

Query  73   PEINTCIYSQLIFNKGDRNTQWGK  2
            PE+N   Y  LIF+KG +  QW K
Sbjct  135  PEMNPHTYGHLIFDKGAKTIQWKK  158



>ref|XP_728532.1| hypothetical protein [Plasmodium yoelii yoelii 17XNL]
 gb|EAA20097.1| hypothetical protein [Plasmodium yoelii yoelii]
Length=432

 Score = 49.7 bits (117),  Expect(2) = 5e-07, Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 31/41 (76%), Gaps = 1/41 (2%)
 Frame = -3

Query  171  LPEFKIYCKAIVIKTAWYWHKKRHTDQWNQIQ-PQK*IHAF  52
            +P+ K+Y +AIVIKTAWYW++ R  DQWN+I+ P+   H +
Sbjct  30   MPDLKLYYRAIVIKTAWYWYRDRQVDQWNRIEDPEMNPHTY  70


 Score = 30.0 bits (66),  Expect(2) = 5e-07, Method: Compositional matrix adjust.
 Identities = 12/24 (50%), Positives = 15/24 (63%), Gaps = 0/24 (0%)
 Frame = -2

Query  73  PEINTCIYSQLIFNKGDRNTQWGK  2
           PE+N   Y  LIF+KG +  QW K
Sbjct  63  PEMNPHTYGHLIFDKGAKTIQWKK  86



>ref|XP_728214.1| hypothetical protein [Plasmodium yoelii yoelii 17XNL]
 gb|EAA19779.1| hypothetical protein [Plasmodium yoelii yoelii]
Length=477

 Score = 49.3 bits (116),  Expect(2) = 6e-07, Method: Compositional matrix adjust.
 Identities = 18/32 (56%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = -3

Query  171  LPEFKIYCKAIVIKTAWYWHKKRHTDQWNQIQ  76
            +P+ K+Y +AIV+KTAWYW++ R  DQWN+I+
Sbjct  75   MPDLKLYYRAIVVKTAWYWYRDRQVDQWNRIE  106


 Score = 30.4 bits (67),  Expect(2) = 6e-07, Method: Compositional matrix adjust.
 Identities = 12/24 (50%), Positives = 15/24 (63%), Gaps = 0/24 (0%)
 Frame = -2

Query  73   PEINTCIYSQLIFNKGDRNTQWGK  2
            PE+N   Y  LIF+KG +  QW K
Sbjct  108  PEMNPHTYGHLIFDKGAKTIQWKK  131



>gb|EDM13183.1| rCG47246 [Rattus norvegicus]
Length=653

 Score = 48.9 bits (115),  Expect(2) = 6e-07, Method: Compositional matrix adjust.
 Identities = 20/32 (63%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = -3

Query  171  LPEFKIYCKAIVIKTAWYWHKKRHTDQWNQIQ  76
            +PE K Y +AIVIKTAWYW++ R  DQWN+I+
Sbjct  582  IPELKQYYRAIVIKTAWYWYRDRQIDQWNRIE  613


 Score = 30.4 bits (67),  Expect(2) = 6e-07, Method: Compositional matrix adjust.
 Identities = 12/24 (50%), Positives = 15/24 (63%), Gaps = 0/24 (0%)
 Frame = -2

Query  73   PEINTCIYSQLIFNKGDRNTQWGK  2
            PE+N   Y  LIF+KG +  QW K
Sbjct  615  PEMNPHTYGHLIFDKGAKTIQWKK  638



>gb|AAS66285.1| LRRGT00194 [Rattus norvegicus]
Length=1710

 Score = 48.9 bits (115),  Expect(2) = 6e-07, Method: Compositional matrix adjust.
 Identities = 20/32 (63%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = -3

Query  171   LPEFKIYCKAIVIKTAWYWHKKRHTDQWNQIQ  76
             +PE K Y +AIVIKTAWYW++ R  DQWN+I+
Sbjct  1282  IPELKQYYRAIVIKTAWYWYRDRQIDQWNRIE  1313


 Score = 30.8 bits (68),  Expect(2) = 6e-07, Method: Compositional matrix adjust.
 Identities = 12/24 (50%), Positives = 15/24 (63%), Gaps = 0/24 (0%)
 Frame = -2

Query  73    PEINTCIYSQLIFNKGDRNTQWGK  2
             PE+N   Y  LIF+KG +  QW K
Sbjct  1315  PEMNPHTYGHLIFDKGAKTIQWKK  1338



>gb|EGT49041.1| hypothetical protein CAEBREN_30431 [Caenorhabditis brenneri]
Length=346

 Score = 45.4 bits (106),  Expect(2) = 6e-07, Method: Compositional matrix adjust.
 Identities = 19/32 (59%), Positives = 25/32 (78%), Gaps = 0/32 (0%)
 Frame = -3

Query  171  LPEFKIYCKAIVIKTAWYWHKKRHTDQWNQIQ  76
            LP+FK+  KA VIKTAWYW++ R  DQWN+ +
Sbjct  48   LPDFKLDYKATVIKTAWYWYQNRDMDQWNKTE  79


 Score = 34.3 bits (77),  Expect(2) = 6e-07, Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 18/25 (72%), Gaps = 0/25 (0%)
 Frame = -2

Query  76   APEINTCIYSQLIFNKGDRNTQWGK  2
            APE    IY+ +IF+K D+N QWGK
Sbjct  80   APEATQHIYNYIIFDKPDKNKQWGK  104



>emb|CCD14539.1| unnamed protein product [Trypanosoma congolense IL3000]
Length=710

 Score = 50.1 bits (118),  Expect(2) = 7e-07, Method: Compositional matrix adjust.
 Identities = 19/32 (59%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = -3

Query  171  LPEFKIYCKAIVIKTAWYWHKKRHTDQWNQIQ  76
            +P+ K+Y +AIVIKTAWYW++ R  DQWN+I+
Sbjct  337  MPDLKLYYRAIVIKTAWYWYRDRQVDQWNRIE  368


 Score = 29.3 bits (64),  Expect(2) = 7e-07, Method: Compositional matrix adjust.
 Identities = 12/24 (50%), Positives = 15/24 (63%), Gaps = 0/24 (0%)
 Frame = -2

Query  73   PEINTCIYSQLIFNKGDRNTQWGK  2
            PE+N   Y  LI+NKG +  QW K
Sbjct  370  PEMNPHNYGHLIYNKGAKTIQWKK  393



>gb|AAC72803.1| ORF2 [Mus musculus domesticus]
Length=1281

 Score = 48.9 bits (115),  Expect(2) = 7e-07, Method: Compositional matrix adjust.
 Identities = 18/32 (56%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = -3

Query  171  LPEFKIYCKAIVIKTAWYWHKKRHTDQWNQIQ  76
            +P+ K+Y +AIVIKTAWYW++ R  DQWN+ +
Sbjct  879  MPDLKLYYRAIVIKTAWYWYRDRQVDQWNRFE  910


 Score = 30.8 bits (68),  Expect(2) = 7e-07, Method: Compositional matrix adjust.
 Identities = 12/24 (50%), Positives = 15/24 (63%), Gaps = 0/24 (0%)
 Frame = -2

Query  73   PEINTCIYSQLIFNKGDRNTQWGK  2
            PE+N   Y  LIF+KG +  QW K
Sbjct  912  PEMNPHTYGHLIFDKGAKTIQWKK  935



>gb|AAQ96221.1| LRRGT00008 [Rattus norvegicus]
Length=1575

 Score = 48.9 bits (115),  Expect(2) = 7e-07, Method: Compositional matrix adjust.
 Identities = 20/32 (63%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = -3

Query  171   LPEFKIYCKAIVIKTAWYWHKKRHTDQWNQIQ  76
             +PE K Y +AIVIKTAWYW++ R  DQWN+I+
Sbjct  1388  IPELKQYYRAIVIKTAWYWYRDRQIDQWNRIE  1419


 Score = 30.4 bits (67),  Expect(2) = 7e-07, Method: Compositional matrix adjust.
 Identities = 11/24 (46%), Positives = 15/24 (63%), Gaps = 0/24 (0%)
 Frame = -2

Query  73    PEINTCIYSQLIFNKGDRNTQWGK  2
             PE+N   Y  +IF+KG +  QW K
Sbjct  1421  PEVNPHTYGHMIFDKGAKTIQWKK  1444



>gb|AAP92576.1| Ab2-051 [Rattus norvegicus]
Length=616

 Score = 48.5 bits (114),  Expect(2) = 7e-07, Method: Compositional matrix adjust.
 Identities = 20/32 (63%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = -3

Query  171  LPEFKIYCKAIVIKTAWYWHKKRHTDQWNQIQ  76
            +PE K Y +AIVIKTAWYW++ R  DQWN+I+
Sbjct  472  IPELKQYYRAIVIKTAWYWYRDRQIDQWNRIE  503


 Score = 30.8 bits (68),  Expect(2) = 7e-07, Method: Compositional matrix adjust.
 Identities = 12/24 (50%), Positives = 15/24 (63%), Gaps = 0/24 (0%)
 Frame = -2

Query  73   PEINTCIYSQLIFNKGDRNTQWGK  2
            PE+N   Y  LIF+KG +  QW K
Sbjct  505  PEMNPHTYGHLIFDKGAKTIQWKK  528



>gb|AAS66282.1| LRRGT00191 [Rattus norvegicus]
Length=1687

 Score = 48.9 bits (115),  Expect(2) = 7e-07, Method: Compositional matrix adjust.
 Identities = 20/32 (63%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = -3

Query  171  LPEFKIYCKAIVIKTAWYWHKKRHTDQWNQIQ  76
            +PE K Y +AIVIKTAWYW++ R  DQWN+I+
Sbjct  663  IPELKQYYRAIVIKTAWYWYRDRQIDQWNRIE  694


 Score = 30.4 bits (67),  Expect(2) = 7e-07, Method: Compositional matrix adjust.
 Identities = 12/24 (50%), Positives = 15/24 (63%), Gaps = 0/24 (0%)
 Frame = -2

Query  73   PEINTCIYSQLIFNKGDRNTQWGK  2
            PE+N   Y  LIF+KG +  QW K
Sbjct  696  PEMNPHTYGHLIFDKGAKTIQWKK  719



>gb|AAS66223.1| LRRG00132 [Rattus norvegicus]
Length=1356

 Score = 48.5 bits (114),  Expect(2) = 7e-07, Method: Compositional matrix adjust.
 Identities = 20/32 (63%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = -3

Query  171  LPEFKIYCKAIVIKTAWYWHKKRHTDQWNQIQ  76
            +PE K Y +AIVIKTAWYW++ R  DQWN+I+
Sbjct  812  IPELKQYYRAIVIKTAWYWYRDRQIDQWNRIE  843


 Score = 30.4 bits (67),  Expect(2) = 7e-07, Method: Compositional matrix adjust.
 Identities = 12/24 (50%), Positives = 15/24 (63%), Gaps = 0/24 (0%)
 Frame = -2

Query  73   PEINTCIYSQLIFNKGDRNTQWGK  2
            PE+N   Y  LIF+KG +  QW K
Sbjct  845  PEMNPHTYGHLIFDKGAKTIQWKK  868



>gb|AAC72797.1| ORF2 [Mus musculus domesticus]
Length=1281

 Score = 48.5 bits (114),  Expect(2) = 7e-07, Method: Compositional matrix adjust.
 Identities = 18/32 (56%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = -3

Query  171  LPEFKIYCKAIVIKTAWYWHKKRHTDQWNQIQ  76
            +P+ K+Y + IVIKTAWYW++ R  DQWN+I+
Sbjct  879  MPDLKLYYRVIVIKTAWYWYRDRQVDQWNRIE  910


 Score = 30.4 bits (67),  Expect(2) = 7e-07, Method: Compositional matrix adjust.
 Identities = 12/24 (50%), Positives = 15/24 (63%), Gaps = 0/24 (0%)
 Frame = -2

Query  73   PEINTCIYSQLIFNKGDRNTQWGK  2
            PE+N   Y  LIF+KG +  QW K
Sbjct  912  PEMNPHTYGHLIFDKGAKTIQWKK  935



>gb|AAS66234.1| LRRGT00143 [Rattus norvegicus]
Length=1142

 Score = 48.9 bits (115),  Expect(2) = 7e-07, Method: Compositional matrix adjust.
 Identities = 20/32 (63%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = -3

Query  171  LPEFKIYCKAIVIKTAWYWHKKRHTDQWNQIQ  76
            +PE K Y +AIVIKTAWYW++ R  DQWN+I+
Sbjct  569  IPELKQYYRAIVIKTAWYWYRDRQIDQWNRIE  600


 Score = 30.4 bits (67),  Expect(2) = 7e-07, Method: Compositional matrix adjust.
 Identities = 12/24 (50%), Positives = 15/24 (63%), Gaps = 0/24 (0%)
 Frame = -2

Query  73   PEINTCIYSQLIFNKGDRNTQWGK  2
            PE+N   Y  LIF+KG +  QW K
Sbjct  602  PEMNPHTYGHLIFDKGAKTIQWKK  625



>gb|AAQ91044.1| LRRGT00088 [Rattus norvegicus]
Length=1217

 Score = 48.5 bits (114),  Expect(2) = 8e-07, Method: Compositional matrix adjust.
 Identities = 20/32 (63%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = -3

Query  171  LPEFKIYCKAIVIKTAWYWHKKRHTDQWNQIQ  76
            +PE K Y +AIVIKTAWYW++ R  DQWN+I+
Sbjct  697  IPELKQYYRAIVIKTAWYWYRDRQIDQWNRIE  728


 Score = 30.4 bits (67),  Expect(2) = 8e-07, Method: Compositional matrix adjust.
 Identities = 12/24 (50%), Positives = 15/24 (63%), Gaps = 0/24 (0%)
 Frame = -2

Query  73   PEINTCIYSQLIFNKGDRNTQWGK  2
            PE+N   Y  LIF+KG +  QW K
Sbjct  730  PEMNPHTYGHLIFDKGAKTIQWKK  753



>gb|AAY88216.1| endonuclease/reverse transcriptase [Rattus norvegicus]
Length=1275

 Score = 48.5 bits (114),  Expect(2) = 8e-07, Method: Compositional matrix adjust.
 Identities = 20/32 (63%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = -3

Query  171  LPEFKIYCKAIVIKTAWYWHKKRHTDQWNQIQ  76
            +PE K Y +AIVIKTAWYW++ R  DQWN+I+
Sbjct  873  IPELKQYYRAIVIKTAWYWYRDRQIDQWNRIE  904


 Score = 30.4 bits (67),  Expect(2) = 8e-07, Method: Compositional matrix adjust.
 Identities = 12/24 (50%), Positives = 15/24 (63%), Gaps = 0/24 (0%)
 Frame = -2

Query  73   PEINTCIYSQLIFNKGDRNTQWGK  2
            PE+N   Y  LIF+KG +  QW K
Sbjct  906  PEMNPHTYGHLIFDKGAKTIQWKK  929



>gb|EDL87471.1| rCG65875 [Rattus norvegicus]
Length=1100

 Score = 48.5 bits (114),  Expect(2) = 9e-07, Method: Compositional matrix adjust.
 Identities = 20/32 (63%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = -3

Query  171  LPEFKIYCKAIVIKTAWYWHKKRHTDQWNQIQ  76
            +PE K Y +AIVIKTAWYW++ R  DQWN+I+
Sbjct  719  IPELKQYYRAIVIKTAWYWYRDRQIDQWNRIE  750


 Score = 30.4 bits (67),  Expect(2) = 9e-07, Method: Compositional matrix adjust.
 Identities = 12/24 (50%), Positives = 15/24 (63%), Gaps = 0/24 (0%)
 Frame = -2

Query  73   PEINTCIYSQLIFNKGDRNTQWGK  2
            PE+N   Y  LIF+KG +  QW K
Sbjct  752  PEMNPHTYGHLIFDKGAKTIQWKK  775



>gb|EDM14942.1| rCG50128 [Rattus norvegicus]
Length=502

 Score = 48.5 bits (114),  Expect(2) = 9e-07, Method: Compositional matrix adjust.
 Identities = 20/32 (63%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = -3

Query  171  LPEFKIYCKAIVIKTAWYWHKKRHTDQWNQIQ  76
            +PE K Y +AIVIKTAWYW++ R  DQWN+I+
Sbjct  303  IPELKQYYRAIVIKTAWYWYRDRQIDQWNRIE  334


 Score = 30.4 bits (67),  Expect(2) = 9e-07, Method: Compositional matrix adjust.
 Identities = 12/24 (50%), Positives = 15/24 (63%), Gaps = 0/24 (0%)
 Frame = -2

Query  73   PEINTCIYSQLIFNKGDRNTQWGK  2
            PE+N   Y  LIF+KG +  QW K
Sbjct  336  PEMNPHTYGHLIFDKGAKTIQWKK  359



>gb|AAQ91021.1| LRRGT00065 [Rattus norvegicus]
Length=1104

 Score = 49.3 bits (116),  Expect(2) = 9e-07, Method: Compositional matrix adjust.
 Identities = 20/32 (63%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = -3

Query  171  LPEFKIYCKAIVIKTAWYWHKKRHTDQWNQIQ  76
            +PE K Y +AIVIKTAWYW++ R  DQWN+I+
Sbjct  901  IPELKQYYRAIVIKTAWYWYRDRQIDQWNRIE  932


 Score = 29.6 bits (65),  Expect(2) = 9e-07, Method: Compositional matrix adjust.
 Identities = 12/24 (50%), Positives = 15/24 (63%), Gaps = 0/24 (0%)
 Frame = -2

Query  73   PEINTCIYSQLIFNKGDRNTQWGK  2
            PE+N   Y  LIF+KG +  QW K
Sbjct  934  PEMNPHTYGPLIFDKGAKTIQWKK  957



>gb|AAS66226.1| LRRG00135 [Rattus norvegicus]
Length=1451

 Score = 48.5 bits (114),  Expect(2) = 1e-06, Method: Compositional matrix adjust.
 Identities = 20/32 (63%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = -3

Query  171  LPEFKIYCKAIVIKTAWYWHKKRHTDQWNQIQ  76
            +PE K Y +AIVIKTAWYW++ R  DQWN+I+
Sbjct  873  IPELKQYYRAIVIKTAWYWYRDRQIDQWNRIE  904


 Score = 30.4 bits (67),  Expect(2) = 1e-06, Method: Compositional matrix adjust.
 Identities = 12/24 (50%), Positives = 15/24 (63%), Gaps = 0/24 (0%)
 Frame = -2

Query  73   PEINTCIYSQLIFNKGDRNTQWGK  2
            PE+N   Y  LIF+KG +  QW K
Sbjct  906  PEMNPHTYGHLIFDKGAKTIQWKK  929



>gb|AAC60655.2| reverse transcriptase homolog, partial [Rattus sp.]
Length=341

 Score = 48.5 bits (114),  Expect(2) = 1e-06, Method: Compositional matrix adjust.
 Identities = 20/32 (63%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = -3

Query  171  LPEFKIYCKAIVIKTAWYWHKKRHTDQWNQIQ  76
            +PE K Y +AIVIKTAWYW++ R  DQWN+I+
Sbjct  250  IPELKQYYRAIVIKTAWYWYRDRQIDQWNRIE  281


 Score = 30.0 bits (66),  Expect(2) = 1e-06, Method: Compositional matrix adjust.
 Identities = 12/24 (50%), Positives = 15/24 (63%), Gaps = 0/24 (0%)
 Frame = -2

Query  73   PEINTCIYSQLIFNKGDRNTQWGK  2
            PE+N   Y  LIF+KG +  QW K
Sbjct  283  PEMNPHTYGHLIFDKGAKTIQWKK  306



>gb|AAC51269.1| putative p150 [Homo sapiens]
Length=1275

 Score = 47.0 bits (110),  Expect(2) = 1e-06, Method: Compositional matrix adjust.
 Identities = 19/35 (54%), Positives = 26/35 (74%), Gaps = 0/35 (0%)
 Frame = -3

Query  171  LPEFKIYCKAIVIKTAWYWHKKRHTDQWNQIQPQK  67
            LP+FK+Y KA V KTA YW++ R  DQWN+ +P +
Sbjct  872  LPDFKLYYKATVTKTACYWYQNRDIDQWNRTEPSE  906


 Score = 31.6 bits (70),  Expect(2) = 1e-06, Method: Compositional matrix adjust.
 Identities = 15/27 (56%), Positives = 19/27 (70%), Gaps = 1/27 (4%)
 Frame = -2

Query  79   TAP-EINTCIYSQLIFNKGDRNTQWGK  2
            T P EI   IY+ LIF+K ++N QWGK
Sbjct  902  TEPSEITPHIYNYLIFDKPEKNKQWGK  928



>gb|AAS66221.1| LRRG00130 [Rattus norvegicus]
Length=1714

 Score = 47.8 bits (112),  Expect(2) = 1e-06, Method: Compositional matrix adjust.
 Identities = 20/32 (63%), Positives = 25/32 (78%), Gaps = 0/32 (0%)
 Frame = -3

Query  171   LPEFKIYCKAIVIKTAWYWHKKRHTDQWNQIQ  76
             +PE K Y +AIVIKTAWYW++ R  DQWN I+
Sbjct  1135  IPELKQYYRAIVIKTAWYWYRDRQIDQWNGIE  1166


 Score = 30.4 bits (67),  Expect(2) = 1e-06, Method: Compositional matrix adjust.
 Identities = 12/24 (50%), Positives = 15/24 (63%), Gaps = 0/24 (0%)
 Frame = -2

Query  73    PEINTCIYSQLIFNKGDRNTQWGK  2
             PE+N   Y  LIF+KG +  QW K
Sbjct  1168  PEMNPHTYGHLIFDKGAKTIQWKK  1191


 Score = 47.4 bits (111),  Expect(2) = 2e-06, Method: Compositional matrix adjust.
 Identities = 19/32 (59%), Positives = 25/32 (78%), Gaps = 0/32 (0%)
 Frame = -3

Query  171   LPEFKIYCKAIVIKTAWYWHKKRHTDQWNQIQ  76
             +PE K Y +AIVIKT WYW++ R  DQWN+I+
Sbjct  1055  IPELKQYYRAIVIKTGWYWYRDRQIDQWNRIE  1086


 Score = 30.4 bits (67),  Expect(2) = 2e-06, Method: Compositional matrix adjust.
 Identities = 12/24 (50%), Positives = 15/24 (63%), Gaps = 0/24 (0%)
 Frame = -2

Query  73    PEINTCIYSQLIFNKGDRNTQWGK  2
             PE+N   Y  LIF+KG +  QW K
Sbjct  1088  PEMNPHTYGHLIFDKGAKTIQWKK  1111



>emb|CAA43593.1| unnamed protein product [Rattus norvegicus]
Length=513

 Score = 48.5 bits (114),  Expect(2) = 1e-06, Method: Compositional matrix adjust.
 Identities = 20/32 (63%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = -3

Query  171  LPEFKIYCKAIVIKTAWYWHKKRHTDQWNQIQ  76
            +PE K Y +AIVIKTAWYW++ R  DQWN+I+
Sbjct  314  IPELKQYYRAIVIKTAWYWYRDRQIDQWNRIE  345


 Score = 30.0 bits (66),  Expect(2) = 1e-06, Method: Compositional matrix adjust.
 Identities = 12/24 (50%), Positives = 15/24 (63%), Gaps = 0/24 (0%)
 Frame = -2

Query  73   PEINTCIYSQLIFNKGDRNTQWGK  2
            PE+N   Y  LIF+KG +  QW K
Sbjct  347  PEMNPHTYGHLIFDKGAKAIQWKK  370



>gb|AAQ91064.1| LRRGT00108 [Rattus norvegicus]
Length=1102

 Score = 45.8 bits (107),  Expect(2) = 1e-06, Method: Compositional matrix adjust.
 Identities = 19/32 (59%), Positives = 25/32 (78%), Gaps = 0/32 (0%)
 Frame = -3

Query  171  LPEFKIYCKAIVIKTAWYWHKKRHTDQWNQIQ  76
            +PE K Y +AIVIKTAW W++ R  DQWN+I+
Sbjct  924  IPELKQYYRAIVIKTAWDWYRDRQIDQWNRIE  955


 Score = 32.7 bits (73),  Expect(2) = 1e-06, Method: Compositional matrix adjust.
 Identities = 13/24 (54%), Positives = 16/24 (67%), Gaps = 0/24 (0%)
 Frame = -2

Query  73   PEINTCIYSQLIFNKGDRNTQWGK  2
            PE+N   Y  LIF+KG + TQW K
Sbjct  957  PEMNPHTYGHLIFDKGAKTTQWKK  980



>gb|AAA66456.1| unknown protein [Rattus norvegicus]
Length=646

 Score = 48.1 bits (113),  Expect(2) = 1e-06, Method: Compositional matrix adjust.
 Identities = 20/32 (63%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = -3

Query  171  LPEFKIYCKAIVIKTAWYWHKKRHTDQWNQIQ  76
            +PE K Y +AIVIKTAWYW++ R  DQWN+I+
Sbjct  244  IPELKQYYRAIVIKTAWYWYRDRQIDQWNRIE  275


 Score = 30.0 bits (66),  Expect(2) = 1e-06, Method: Compositional matrix adjust.
 Identities = 12/24 (50%), Positives = 15/24 (63%), Gaps = 0/24 (0%)
 Frame = -2

Query  73   PEINTCIYSQLIFNKGDRNTQWGK  2
            PE+N   Y  LIF+KG +  QW K
Sbjct  277  PEMNPHTYGHLIFHKGAKTIQWKK  300



>emb|CCD16839.1| unnamed protein product [Trypanosoma congolense IL3000]
Length=571

 Score = 48.1 bits (113),  Expect(2) = 1e-06, Method: Compositional matrix adjust.
 Identities = 20/32 (63%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = -3

Query  171  LPEFKIYCKAIVIKTAWYWHKKRHTDQWNQIQ  76
            +PE K Y +AIVIKTAWYW++ R  DQWN+I+
Sbjct  169  IPELKQYYRAIVIKTAWYWYRDRQIDQWNRIE  200


 Score = 30.0 bits (66),  Expect(2) = 1e-06, Method: Compositional matrix adjust.
 Identities = 12/24 (50%), Positives = 15/24 (63%), Gaps = 0/24 (0%)
 Frame = -2

Query  73   PEINTCIYSQLIFNKGDRNTQWGK  2
            PE+N   Y  LIF+KG +  QW K
Sbjct  202  PEMNPHTYGHLIFDKGAKTIQWKK  225



>ref|WP_032607882.1| hypothetical protein, partial [Pseudomonas syringae]
Length=94

 Score = 50.8 bits (120),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = -3

Query  171  LPEFKIYCKAIVIKTAWYWHKKRHTDQWNQIQPQK  67
            LP+FK+Y KA V KTAWYW++ R  DQWN+ +P +
Sbjct  53   LPDFKLYYKATVTKTAWYWYQNRDIDQWNRTEPSE  87



>gb|AAD04635.1| ORF2-like protein [Homo sapiens]
Length=573

 Score = 47.0 bits (110),  Expect(2) = 1e-06, Method: Compositional matrix adjust.
 Identities = 19/35 (54%), Positives = 26/35 (74%), Gaps = 0/35 (0%)
 Frame = -3

Query  171  LPEFKIYCKAIVIKTAWYWHKKRHTDQWNQIQPQK  67
            L +FK+Y KA V KTAWYW++ R  DQWN+ +P +
Sbjct  386  LLDFKLYYKATVTKTAWYWYQNRDIDQWNRTEPSE  420


 Score = 31.2 bits (69),  Expect(2) = 1e-06, Method: Compositional matrix adjust.
 Identities = 15/27 (56%), Positives = 19/27 (70%), Gaps = 1/27 (4%)
 Frame = -2

Query  79   TAP-EINTCIYSQLIFNKGDRNTQWGK  2
            T P EI   IY+ LIF+K ++N QWGK
Sbjct  416  TEPSEIMPHIYNYLIFDKPEKNKQWGK  442



>ref|XP_674009.1| ferlin like protein [Plasmodium berghei strain ANKA]
 emb|CAI01881.1| ferlin like protein, putative [Plasmodium berghei]
Length=133

 Score = 48.5 bits (114),  Expect(2) = 1e-06, Method: Compositional matrix adjust.
 Identities = 19/32 (59%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = -3

Query  171  LPEFKIYCKAIVIKTAWYWHKKRHTDQWNQIQ  76
            +P+ K+Y +AIVIKTAWYW+  R  DQWN+I+
Sbjct  58   MPDLKLYYRAIVIKTAWYWYSDRQVDQWNRIE  89


 Score = 30.0 bits (66),  Expect(2) = 1e-06, Method: Compositional matrix adjust.
 Identities = 12/24 (50%), Positives = 15/24 (63%), Gaps = 0/24 (0%)
 Frame = -2

Query  73   PEINTCIYSQLIFNKGDRNTQWGK  2
            PE+N   Y  LIF+KG +  QW K
Sbjct  91   PEMNPHTYGHLIFDKGAKTIQWKK  114



>gb|ERE67000.1| catenin alpha-2-like protein [Cricetulus griseus]
Length=376

 Score = 53.1 bits (126),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 21/32 (66%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = -3

Query  171  LPEFKIYCKAIVIKTAWYWHKKRHTDQWNQIQ  76
            +P+FK+Y +AIV+KTAWYWHK R  DQWN+I+
Sbjct  213  IPDFKLYYRAIVLKTAWYWHKNRLIDQWNRIE  244



>emb|CAA37646.1| ORF3 [Rattus norvegicus]
Length=556

 Score = 48.9 bits (115),  Expect(2) = 2e-06, Method: Compositional matrix adjust.
 Identities = 20/32 (63%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = -3

Query  171  LPEFKIYCKAIVIKTAWYWHKKRHTDQWNQIQ  76
            +PE K Y +AIVIKTAWYW++ R  DQWN+I+
Sbjct  492  IPELKQYYRAIVIKTAWYWYRDRQIDQWNRIE  523


 Score = 28.9 bits (63),  Expect(2) = 2e-06, Method: Compositional matrix adjust.
 Identities = 11/24 (46%), Positives = 15/24 (63%), Gaps = 0/24 (0%)
 Frame = -2

Query  73   PEINTCIYSQLIFNKGDRNTQWGK  2
            PE+N   Y  LIF+KG +  +W K
Sbjct  525  PEMNPHTYGHLIFDKGAKTIKWKK  548



>gb|AAP78757.1| Ac1233 [Rattus norvegicus]
Length=473

 Score = 47.8 bits (112),  Expect(2) = 2e-06, Method: Compositional matrix adjust.
 Identities = 20/32 (63%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = -3

Query  171  LPEFKIYCKAIVIKTAWYWHKKRHTDQWNQIQ  76
            +PE K Y +AIVIKTAWYW++ R  DQWN+I+
Sbjct  335  IPELKQYYRAIVIKTAWYWYRDRKIDQWNRIE  366


 Score = 30.0 bits (66),  Expect(2) = 2e-06, Method: Compositional matrix adjust.
 Identities = 12/24 (50%), Positives = 15/24 (63%), Gaps = 0/24 (0%)
 Frame = -2

Query  73   PEINTCIYSQLIFNKGDRNTQWGK  2
            PE+N   Y  LIF+KG +  QW K
Sbjct  368  PEMNPHTYGHLIFDKGAKTIQWKK  391



>gb|ELR59305.1| hypothetical protein M91_02272, partial [Bos mutus]
Length=254

 Score = 52.0 bits (123),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 21/32 (66%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = -3

Query  171  LPEFKIYCKAIVIKTAWYWHKKRHTDQWNQIQ  76
            LP+F++Y KA VIKT WYWHK R+ DQWN+I+
Sbjct  58   LPDFRLYYKATVIKTVWYWHKDRNIDQWNKIE  89



>gb|ELK09466.1| Retrovirus-related Pol polyprotein LINE-1 [Pteropus alecto]
Length=116

 Score = 50.4 bits (119),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 29/36 (81%), Gaps = 1/36 (3%)
 Frame = -3

Query  171  LPEFKIYCKAIVIKTAWYWHKKRHTDQWNQIQ-PQK  67
            LP+FK+  KA VIKTAWYW + RH DQWN+I+ P+K
Sbjct  58   LPDFKLDYKATVIKTAWYWQQNRHMDQWNRIESPEK  93



>gb|ABE73456.1| endonuclease/reverse transcriptase [Pan troglodytes]
Length=1275

 Score = 49.3 bits (116),  Expect(2) = 2e-06, Method: Compositional matrix adjust.
 Identities = 19/34 (56%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = -3

Query  168  PEFKIYCKAIVIKTAWYWHKKRHTDQWNQIQPQK  67
            P+FK+Y KA V KTAWYW++ R  DQWN+ +P +
Sbjct  874  PDFKLYYKATVTKTAWYWYQNRDIDQWNRTEPSE  907


 Score = 28.5 bits (62),  Expect(2) = 2e-06, Method: Compositional matrix adjust.
 Identities = 14/27 (52%), Positives = 18/27 (67%), Gaps = 1/27 (4%)
 Frame = -2

Query  79   TAP-EINTCIYSQLIFNKGDRNTQWGK  2
            T P EI   IY+ LIF+K ++N QW K
Sbjct  903  TEPSEITPHIYNYLIFDKPEKNKQWVK  929



>gb|AAQ91034.1| LRRGT00078 [Rattus norvegicus]
Length=370

 Score = 47.8 bits (112),  Expect(2) = 2e-06, Method: Compositional matrix adjust.
 Identities = 20/32 (63%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = -3

Query  171  LPEFKIYCKAIVIKTAWYWHKKRHTDQWNQIQ  76
            +PE K Y +AIVIKTAWYW++ R  DQWN+I+
Sbjct  58   IPELKQYYRAIVIKTAWYWYRDRQIDQWNRIE  89


 Score = 30.0 bits (66),  Expect(2) = 2e-06, Method: Compositional matrix adjust.
 Identities = 12/24 (50%), Positives = 15/24 (63%), Gaps = 0/24 (0%)
 Frame = -2

Query  73   PEINTCIYSQLIFNKGDRNTQWGK  2
            PE+N   Y  LIF+KG +  QW K
Sbjct  91   PEMNRHTYGHLIFDKGAKTIQWKK  114



>gb|AAS66242.1| LRRGT00151 [Rattus norvegicus]
Length=1073

 Score = 48.5 bits (114),  Expect(2) = 2e-06, Method: Compositional matrix adjust.
 Identities = 20/32 (63%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = -3

Query  171  LPEFKIYCKAIVIKTAWYWHKKRHTDQWNQIQ  76
            +PE K Y +AIVIKTAWYW++ R  DQWN+I+
Sbjct  337  IPELKQYFRAIVIKTAWYWYRDRQIDQWNRIE  368


 Score = 28.9 bits (63),  Expect(2) = 2e-06, Method: Compositional matrix adjust.
 Identities = 11/24 (46%), Positives = 15/24 (63%), Gaps = 0/24 (0%)
 Frame = -2

Query  73   PEINTCIYSQLIFNKGDRNTQWGK  2
            PE+N   Y  LIF+KG +  +W K
Sbjct  370  PEMNPHTYGHLIFDKGAKTIKWKK  393



>gb|AAP78761.1| Ac1262 [Rattus norvegicus]
 gb|AAP85372.1| Aa1249 [Rattus norvegicus]
 gb|AAP86250.1| Ac1-114 [Rattus norvegicus]
 gb|AAP86256.1| Ac2-069 [Rattus norvegicus]
 gb|AAP92597.1| Ab2-196 [Rattus norvegicus]
 gb|AAP92619.1| Ab1-341 [Rattus norvegicus]
 gb|AAP92633.1| Ba2-693 [Rattus norvegicus]
Length=1015

 Score = 47.0 bits (110),  Expect(2) = 2e-06, Method: Compositional matrix adjust.
 Identities = 19/32 (59%), Positives = 25/32 (78%), Gaps = 0/32 (0%)
 Frame = -3

Query  171  LPEFKIYCKAIVIKTAWYWHKKRHTDQWNQIQ  76
            +PE K Y +AI IKTAWYW++ R  DQWN+I+
Sbjct  246  IPELKQYYRAIAIKTAWYWYRDRQIDQWNRIE  277


 Score = 30.4 bits (67),  Expect(2) = 2e-06, Method: Compositional matrix adjust.
 Identities = 12/24 (50%), Positives = 15/24 (63%), Gaps = 0/24 (0%)
 Frame = -2

Query  73   PEINTCIYSQLIFNKGDRNTQWGK  2
            PE+N   Y  LIF+KG +  QW K
Sbjct  279  PEMNPHTYGHLIFDKGAKTIQWKK  302



>dbj|BAH12888.1| unnamed protein product [Homo sapiens]
Length=295

 Score = 46.2 bits (108),  Expect(2) = 2e-06, Method: Compositional matrix adjust.
 Identities = 19/36 (53%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = -3

Query  174  ILPEFKIYCKAIVIKTAWYWHKKRHTDQWNQIQPQK  67
            +LP+FK+Y KA V KTAWY ++ R  DQWN+ +P +
Sbjct  1    MLPDFKLYYKATVTKTAWYRYQNRDIDQWNRTEPSE  36


 Score = 31.2 bits (69),  Expect(2) = 2e-06, Method: Compositional matrix adjust.
 Identities = 15/30 (50%), Positives = 20/30 (67%), Gaps = 3/30 (10%)
 Frame = -2

Query  91  VEPNTAPEINTCIYSQLIFNKGDRNTQWGK  2
            EP+   EI   IY+ LIF+K ++N QWGK
Sbjct  32  TEPS---EITPHIYNYLIFDKPEKNKQWGK  58



>ref|WP_032535348.1| hypothetical protein, partial [Bacteroides fragilis]
Length=177

 Score = 50.8 bits (120),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = -3

Query  171  LPEFKIYCKAIVIKTAWYWHKKRHTDQWNQIQPQK  67
            LP+FK+Y KA V KTAWYW++ R  DQWN+ +P +
Sbjct  14   LPDFKLYYKATVTKTAWYWYQNREIDQWNRTEPSE  48



>gb|AAQ91041.1| LRRGT00085 [Rattus norvegicus]
Length=1119

 Score = 46.2 bits (108),  Expect(2) = 3e-06, Method: Compositional matrix adjust.
 Identities = 19/32 (59%), Positives = 25/32 (78%), Gaps = 0/32 (0%)
 Frame = -3

Query  171  LPEFKIYCKAIVIKTAWYWHKKRHTDQWNQIQ  76
            +PE K Y +AIV KTAWYW++ R  DQWN+I+
Sbjct  296  IPELKQYYRAIVTKTAWYWYRDRLIDQWNRIE  327


 Score = 30.8 bits (68),  Expect(2) = 3e-06, Method: Compositional matrix adjust.
 Identities = 12/24 (50%), Positives = 15/24 (63%), Gaps = 0/24 (0%)
 Frame = -2

Query  73   PEINTCIYSQLIFNKGDRNTQWGK  2
            PE+N   Y  LIF+KG +  QW K
Sbjct  329  PEMNPHTYGHLIFDKGAKTIQWKK  352



>ref|NP_001162315.1| LRRGT00196 [Papio anubis]
 gb|ABX52135.1| LRRGT00196 (predicted) [Papio anubis]
Length=330

 Score = 47.0 bits (110),  Expect(2) = 4e-06, Method: Compositional matrix adjust.
 Identities = 19/32 (59%), Positives = 25/32 (78%), Gaps = 0/32 (0%)
 Frame = -3

Query  171  LPEFKIYCKAIVIKTAWYWHKKRHTDQWNQIQ  76
            LP+FK Y KA V KTAWYW++ R+ DQWN+ +
Sbjct  167  LPDFKPYYKATVTKTAWYWYQSRYIDQWNRTE  198


 Score = 29.6 bits (65),  Expect(2) = 4e-06, Method: Compositional matrix adjust.
 Identities = 13/23 (57%), Positives = 16/23 (70%), Gaps = 0/23 (0%)
 Frame = -2

Query  70   EINTCIYSQLIFNKGDRNTQWGK  2
            EI   IYS LIF+K  +N +WGK
Sbjct  201  EIIPHIYSHLIFDKPVKNKKWGK  223



>ref|WP_039264834.1| endonuclease, partial [Enterobacter cloacae]
 gb|KHL97719.1| endonuclease, partial [Enterobacter cloacae]
Length=290

 Score = 51.2 bits (121),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = -3

Query  171  LPEFKIYCKAIVIKTAWYWHKKRHTDQWNQIQPQK  67
            LP+FK+Y KA V KTAWYW++ R  DQWN+ +P +
Sbjct  250  LPDFKLYYKATVTKTAWYWYQNRDIDQWNRTEPSE  284



>gb|AAC51273.1| putative p150 [Homo sapiens]
Length=1275

 Score = 45.8 bits (107),  Expect(2) = 6e-06, Method: Compositional matrix adjust.
 Identities = 18/35 (51%), Positives = 25/35 (71%), Gaps = 0/35 (0%)
 Frame = -3

Query  171  LPEFKIYCKAIVIKTAWYWHKKRHTDQWNQIQPQK  67
            LP+FK+Y KA V KT WYW++ R  DQ N+ +P +
Sbjct  872  LPDFKLYYKATVTKTVWYWYQNRDIDQGNRTEPSE  906


 Score = 30.4 bits (67),  Expect(2) = 6e-06, Method: Compositional matrix adjust.
 Identities = 14/27 (52%), Positives = 19/27 (70%), Gaps = 1/27 (4%)
 Frame = -2

Query  79   TAP-EINTCIYSQLIFNKGDRNTQWGK  2
            T P EI   IY+ +IF+K ++N QWGK
Sbjct  902  TEPSEIMPHIYNYMIFDKPEKNKQWGK  928



>gb|AAS66241.1| LRRGT00150 [Rattus norvegicus]
 gb|EDL95058.1| rCG65891 [Rattus norvegicus]
Length=1366

 Score = 45.1 bits (105),  Expect(2) = 8e-06, Method: Compositional matrix adjust.
 Identities = 19/32 (59%), Positives = 25/32 (78%), Gaps = 0/32 (0%)
 Frame = -3

Query  171  LPEFKIYCKAIVIKTAWYWHKKRHTDQWNQIQ  76
            +PE K Y +AIVIKTAWYW++ R  DQ N+I+
Sbjct  520  IPELKQYYRAIVIKTAWYWYRDRQIDQRNRIE  551


 Score = 30.8 bits (68),  Expect(2) = 8e-06, Method: Compositional matrix adjust.
 Identities = 12/24 (50%), Positives = 15/24 (63%), Gaps = 0/24 (0%)
 Frame = -2

Query  73   PEINTCIYSQLIFNKGDRNTQWGK  2
            PE+N   Y  LIF+KG +  QW K
Sbjct  553  PEMNPHTYGHLIFDKGAKTIQWKK  576



>ref|WP_016893089.1| hypothetical protein, partial [Chlamydia psittaci]
 gb|EPJ18665.1| hypothetical protein CP02DC22_1193, partial [Chlamydia psittaci 
02DC22]
Length=71

 Score = 47.8 bits (112),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 19/35 (54%), Positives = 26/35 (74%), Gaps = 0/35 (0%)
 Frame = -3

Query  171  LPEFKIYCKAIVIKTAWYWHKKRHTDQWNQIQPQK  67
            LP+FK+Y KA V KTAWYW++ R  DQWN+ +  +
Sbjct  31   LPDFKLYYKATVTKTAWYWYQNRDIDQWNRTESSE  65



>gb|AAS66287.1| LRRGT00196 [Rattus norvegicus]
Length=754

 Score = 44.3 bits (103),  Expect(2) = 2e-05, Method: Compositional matrix adjust.
 Identities = 19/32 (59%), Positives = 25/32 (78%), Gaps = 0/32 (0%)
 Frame = -3

Query  171  LPEFKIYCKAIVIKTAWYWHKKRHTDQWNQIQ  76
            +PE K Y +AIVIKTAWYW++ R  DQ N+I+
Sbjct  319  IPELKQYYRAIVIKTAWYWYRDRQIDQCNRIE  350


 Score = 30.4 bits (67),  Expect(2) = 2e-05, Method: Compositional matrix adjust.
 Identities = 12/24 (50%), Positives = 15/24 (63%), Gaps = 0/24 (0%)
 Frame = -2

Query  73   PEINTCIYSQLIFNKGDRNTQWGK  2
            PE+N   Y  LIF+KG +  QW K
Sbjct  352  PEMNPHTYGHLIFDKGAKTIQWKK  375



>gb|EGT53486.1| hypothetical protein CAEBREN_30893 [Caenorhabditis brenneri]
Length=386

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 20/32 (63%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = -3

Query  171  LPEFKIYCKAIVIKTAWYWHKKRHTDQWNQIQ  76
            LP+FK+Y KA VIKTAWYW++ R  DQWN+ +
Sbjct  228  LPDFKLYYKATVIKTAWYWYQNRDIDQWNKTE  259



>ref|WP_032742722.1| hypothetical protein, partial [Chlamydia psittaci]
Length=108

 Score = 47.8 bits (112),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 19/32 (59%), Positives = 25/32 (78%), Gaps = 0/32 (0%)
 Frame = -3

Query  171  LPEFKIYCKAIVIKTAWYWHKKRHTDQWNQIQ  76
            LP+FK+Y KA V KTAWYW++ R  DQWN+ +
Sbjct  60   LPDFKLYYKATVTKTAWYWYQNRDIDQWNRTE  91



>gb|EPJ23932.1| hypothetical protein CP09DC77_1161, partial [Chlamydia psittaci 
09DC77]
Length=106

 Score = 47.8 bits (112),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 19/32 (59%), Positives = 25/32 (78%), Gaps = 0/32 (0%)
 Frame = -3

Query  171  LPEFKIYCKAIVIKTAWYWHKKRHTDQWNQIQ  76
            LP+FK+Y KA V KTAWYW++ R  DQWN+ +
Sbjct  58   LPDFKLYYKATVTKTAWYWYQNRDIDQWNRTE  89



>gb|AAY88218.1| endonuclease/reverse transcriptase [Rattus norvegicus]
Length=1275

 Score = 48.5 bits (114),  Expect(2) = 4e-05, Method: Compositional matrix adjust.
 Identities = 20/32 (63%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = -3

Query  171  LPEFKIYCKAIVIKTAWYWHKKRHTDQWNQIQ  76
            +PE K Y +AIVIKTAWYW++ R  DQWN+I+
Sbjct  873  IPELKQYYRAIVIKTAWYWYRDRQIDQWNRIE  904


 Score = 25.0 bits (53),  Expect(2) = 4e-05, Method: Compositional matrix adjust.
 Identities = 10/23 (43%), Positives = 13/23 (57%), Gaps = 0/23 (0%)
 Frame = -2

Query  70   EINTCIYSQLIFNKGDRNTQWGK  2
            E+N   Y  LIF+K  +  QW K
Sbjct  907  EMNPHTYGHLIFDKRAKTIQWKK  929



>gb|EGV99744.1| Retrovirus-related Pol polyprotein LINE-1 [Cricetulus griseus]
Length=82

 Score = 47.0 bits (110),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 17/29 (59%), Positives = 23/29 (79%), Gaps = 0/29 (0%)
 Frame = -3

Query  171  LPEFKIYCKAIVIKTAWYWHKKRHTDQWN  85
            + +FK+YC+A ++KTAWY HK R  DQWN
Sbjct  54   IADFKLYCRATLMKTAWYLHKNRQVDQWN  82



>gb|AAQ96249.1| LRRGT00036 [Rattus norvegicus]
Length=753

 Score = 42.7 bits (99),  Expect(2) = 5e-05, Method: Compositional matrix adjust.
 Identities = 17/32 (53%), Positives = 25/32 (78%), Gaps = 0/32 (0%)
 Frame = -3

Query  171  LPEFKIYCKAIVIKTAWYWHKKRHTDQWNQIQ  76
            +PE K Y +A+VI+TAWYW++ R  DQ N+I+
Sbjct  58   IPELKQYNRAVVIQTAWYWYRDRQIDQRNRIE  89


 Score = 30.4 bits (67),  Expect(2) = 5e-05, Method: Compositional matrix adjust.
 Identities = 12/24 (50%), Positives = 15/24 (63%), Gaps = 0/24 (0%)
 Frame = -2

Query  73   PEINTCIYSQLIFNKGDRNTQWGK  2
            PE+N   Y  LIF+KG +  QW K
Sbjct  91   PEMNPHTYGHLIFDKGAKTIQWKK  114



>gb|ACE79050.1| LINE-1 element ORF2 (predicted) [Sorex araneus]
Length=705

 Score = 45.1 bits (105),  Expect(2) = 7e-05, Method: Compositional matrix adjust.
 Identities = 17/32 (53%), Positives = 24/32 (75%), Gaps = 0/32 (0%)
 Frame = -3

Query  171  LPEFKIYCKAIVIKTAWYWHKKRHTDQWNQIQ  76
            +P  K+Y KA+  KTAWYW+K R  DQWN+++
Sbjct  302  IPNLKLYYKAVTSKTAWYWNKGRAVDQWNRVE  333


 Score = 27.7 bits (60),  Expect(2) = 7e-05, Method: Compositional matrix adjust.
 Identities = 12/28 (43%), Positives = 16/28 (57%), Gaps = 4/28 (14%)
 Frame = -2

Query  85   PNTAPEINTCIYSQLIFNKGDRNTQWGK  2
            P T P++    Y  LIF+KG R  +W K
Sbjct  335  PYTQPQM----YDHLIFDKGAREVKWSK  358



>gb|ELR60158.1| hypothetical protein M91_08556, partial [Bos mutus]
Length=238

 Score = 38.9 bits (89),  Expect(2) = 1e-04, Method: Compositional matrix adjust.
 Identities = 16/32 (50%), Positives = 24/32 (75%), Gaps = 0/32 (0%)
 Frame = -3

Query  171  LPEFKIYCKAIVIKTAWYWHKKRHTDQWNQIQ  76
            L +F++Y KA +I+T WYW K R+ DQ N+I+
Sbjct  58   LLDFRLYYKAKIIRTVWYWDKTRNIDQRNKIE  89


 Score = 33.1 bits (74),  Expect(2) = 1e-04, Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 17/25 (68%), Gaps = 0/25 (0%)
 Frame = -2

Query  76   APEINTCIYSQLIFNKGDRNTQWGK  2
            +PEIN   Y   IF+KG +N QWGK
Sbjct  90   SPEINPRTYGHPIFDKGGQNIQWGK  114



>gb|AAC51264.1| putative p150 [Homo sapiens]
Length=1275

 Score = 48.1 bits (113),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 19/35 (54%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = -3

Query  171  LPEFKIYCKAIVIKTAWYWHKKRHTDQWNQIQPQK  67
            LP+FK+Y KA V KTAWYW++ R  DQW++ +P +
Sbjct  872  LPDFKLYYKATVTKTAWYWYQNRDIDQWHRTEPSE  906



>gb|EGT50279.1| hypothetical protein CAEBREN_30272 [Caenorhabditis brenneri]
Length=506

 Score = 45.4 bits (106),  Expect(2) = 2e-04, Method: Compositional matrix adjust.
 Identities = 19/32 (59%), Positives = 25/32 (78%), Gaps = 0/32 (0%)
 Frame = -3

Query  171  LPEFKIYCKAIVIKTAWYWHKKRHTDQWNQIQ  76
            L +FK+Y KA VIKTAWYW++ R  DQWN+ +
Sbjct  260  LLDFKLYYKATVIKTAWYWYQNRDIDQWNKTE  291


 Score = 25.8 bits (55),  Expect(2) = 2e-04, Method: Compositional matrix adjust.
 Identities = 10/17 (59%), Positives = 13/17 (76%), Gaps = 0/17 (0%)
 Frame = -2

Query  52   YSQLIFNKGDRNTQWGK  2
            Y+  IF+K D+N QWGK
Sbjct  300  YNYTIFDKPDKNKQWGK  316



>gb|AAQ91043.1| LRRGT00087 [Rattus norvegicus]
Length=320

 Score = 44.7 bits (104),  Expect(2) = 4e-04, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 29/41 (71%), Gaps = 1/41 (2%)
 Frame = -3

Query  171  LPEFKIYCKAIVIKTAWYWHKKRHTDQWNQIQ-PQK*IHAF  52
            +PE K Y +AIVIKT  YW++ R  DQWN+I+ P+  +H +
Sbjct  230  IPELKQYYRAIVIKTVCYWYRDRQIDQWNRIEDPEMDLHTY  270


 Score = 25.4 bits (54),  Expect(2) = 4e-04, Method: Compositional matrix adjust.
 Identities = 11/24 (46%), Positives = 15/24 (63%), Gaps = 0/24 (0%)
 Frame = -2

Query  73   PEINTCIYSQLIFNKGDRNTQWGK  2
            PE++   Y  LIF+KG + TQ  K
Sbjct  263  PEMDLHTYGPLIFDKGSKTTQCKK  286



>gb|EHH55858.1| hypothetical protein EGM_05144, partial [Macaca fascicularis]
Length=177

 Score = 44.3 bits (103),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 18/28 (64%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = -3

Query  171  LPEFKIYCKAIVIKTAWYWHKKRHTDQW  88
            LP+FK+Y KA V KTAWYW++ R  DQW
Sbjct  118  LPDFKLYYKATVTKTAWYWYQNRDIDQW  145



>gb|ABE73458.1| endonuclease/reverse transcriptase [Pan troglodytes]
Length=1275

 Score = 46.2 bits (108),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 19/35 (54%), Positives = 25/35 (71%), Gaps = 0/35 (0%)
 Frame = -3

Query  171  LPEFKIYCKAIVIKTAWYWHKKRHTDQWNQIQPQK  67
            LP FK+Y KA V KTAWYW++ R  D WN+ +P +
Sbjct  872  LPYFKLYYKATVTKTAWYWYQNRDIDPWNRTEPSE  906



>gb|ERE72289.1| atlastin-1-like protein [Cricetulus griseus]
Length=779

 Score = 46.2 bits (108),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 26/59 (44%), Positives = 38/59 (64%), Gaps = 5/59 (8%)
 Frame = -3

Query  171  LPEFKIYCKAIVIKTAWYWHKKRHTDQWNQIQPQK*I--HAFTVN*FSTKVTGIHNGER  1
            +P+FK+Y +AIV+KTAWYWHK R T   N I+ +  I  H  T     TK+  ++NG++
Sbjct  169  IPDFKLYYRAIVLKTAWYWHKNRQT---NGIKLKMLILTHEPTNTLSLTKMLNLYNGKK  224



>dbj|BAH12753.1| unnamed protein product [Homo sapiens]
Length=179

 Score = 35.4 bits (80),  Expect(2) = 8e-04, Method: Compositional matrix adjust.
 Identities = 16/32 (50%), Positives = 21/32 (66%), Gaps = 0/32 (0%)
 Frame = -3

Query  171  LPEFKIYCKAIVIKTAWYWHKKRHTDQWNQIQ  76
            LP+FK+  KA V KTA  W+  R  DQWN+ +
Sbjct  117  LPDFKLCYKATVTKTACCWYLNRDIDQWNRTE  148


 Score = 33.5 bits (75),  Expect(2) = 8e-04, Method: Compositional matrix adjust.
 Identities = 14/23 (61%), Positives = 17/23 (74%), Gaps = 0/23 (0%)
 Frame = -2

Query  70   EINTCIYSQLIFNKGDRNTQWGK  2
            EI   IY+ LIF+K D+N QWGK
Sbjct  151  EITIHIYNHLIFDKPDKNKQWGK  173



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 511558873218