BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c9873_g1_i1 len=902 path=[2:0-901]

Length=902
                                                                      Score     E

ref|XP_009762241.1|  PREDICTED: ethylene-responsive transcription...    130   6e-32   
ref|XP_002517949.1|  conserved hypothetical protein                     127   5e-30   Ricinus communis
ref|XP_006360275.1|  PREDICTED: ethylene-responsive transcription...    125   1e-29   
ref|XP_010689679.1|  PREDICTED: ethylene-responsive transcription...    125   2e-29   
ref|XP_007149866.1|  hypothetical protein PHAVU_005G105200g             125   3e-29   
ref|XP_010245316.1|  PREDICTED: ethylene-responsive transcription...    125   5e-29   
ref|XP_010540852.1|  PREDICTED: ethylene-responsive transcription...    123   6e-29   
ref|XP_010242006.1|  PREDICTED: ethylene-responsive transcription...    124   1e-28   
ref|XP_010035718.1|  PREDICTED: ethylene-responsive transcription...    124   1e-28   
ref|XP_003526286.2|  PREDICTED: ethylene-responsive transcription...    123   1e-28   
dbj|BAF47193.1|  embryonic element binding Factor 7                     122   2e-28   Daucus carota [carrots]
ref|XP_007043551.1|  AP2/ERF domain-containing transcription fact...    123   2e-28   
ref|XP_010916895.1|  PREDICTED: ethylene-responsive transcription...    122   2e-28   
ref|XP_004305415.1|  PREDICTED: ethylene-responsive transcription...    122   3e-28   
gb|KHN41135.1|  Ethylene-responsive transcription factor ERF054         122   3e-28   
ref|XP_009615540.1|  PREDICTED: ethylene-responsive transcription...    121   3e-28   
dbj|BAG50057.1|  transcription factor AP2-EREBP                         122   4e-28   Lotus japonicus
ref|XP_004252538.1|  PREDICTED: ethylene-responsive transcription...    121   4e-28   
ref|XP_004487298.1|  PREDICTED: ethylene-responsive transcription...    122   4e-28   
ref|XP_009797394.1|  PREDICTED: ethylene-responsive transcription...    121   4e-28   
gb|AIX48026.1|  dehydration responsive element-binding protein A6       120   4e-28   
gb|KDP24155.1|  hypothetical protein JCGZ_25812                         122   5e-28   
gb|AFK73558.1|  AP2 transcription factor                                119   5e-28   
gb|KDO48161.1|  hypothetical protein CISIN_1g039976mg                   122   5e-28   
gb|ABR53728.1|  DRE-binding protein DREB1                               120   5e-28   Cymbidium insigne
gb|KHN31960.1|  Ethylene-responsive transcription factor ERF053         121   6e-28   
ref|XP_003540897.1|  PREDICTED: ethylene-responsive transcription...    121   6e-28   
ref|XP_008342928.1|  PREDICTED: ethylene-responsive transcription...    121   6e-28   
ref|XP_008779564.1|  PREDICTED: ethylene-responsive transcription...    121   7e-28   
ref|XP_009357820.1|  PREDICTED: ethylene-responsive transcription...    121   7e-28   
ref|NP_001235100.1|  dehydration-responsive element binding prote...    120   7e-28   
ref|XP_009616719.1|  PREDICTED: ethylene-responsive transcription...    120   8e-28   
gb|KEH39107.1|  ethylene response factor                                121   8e-28   
ref|XP_008381261.1|  PREDICTED: ethylene-responsive transcription...    121   8e-28   
gb|KFK40469.1|  hypothetical protein AALP_AA3G376800                    120   9e-28   
ref|XP_006298084.1|  hypothetical protein CARUB_v10014129mg             120   9e-28   
emb|CCF23313.1|  drought responsive element binding protein 5           119   9e-28   
emb|CCF23312.1|  drought responsive element binding protein 5           119   9e-28   
ref|XP_010099577.1|  Ethylene-responsive transcription factor           121   9e-28   
ref|XP_007047994.1|  AP2/ERF domain-containing transcription fact...    120   9e-28   
gb|AIB05872.1|  AP2-EREBP transcription factor                          121   1e-27   
ref|XP_008678858.1|  PREDICTED: ethylene-responsive transcription...    121   1e-27   
ref|XP_004516587.1|  PREDICTED: uncharacterized protein LOC101497734    121   1e-27   
ref|XP_011095770.1|  PREDICTED: ethylene-responsive transcription...    120   1e-27   
ref|XP_010918447.1|  PREDICTED: ethylene-responsive transcription...    121   1e-27   
ref|XP_008244505.1|  PREDICTED: ethylene-responsive transcription...    120   1e-27   
gb|ABR16078.1|  unknown                                                 121   1e-27   Picea sitchensis
ref|XP_007216848.1|  hypothetical protein PRUPE_ppa021711mg             120   1e-27   
ref|XP_007132714.1|  hypothetical protein PHAVU_011G118600g             120   1e-27   
ref|XP_004288218.1|  PREDICTED: ethylene-responsive transcription...    119   2e-27   
ref|XP_009342655.1|  PREDICTED: ethylene-responsive transcription...    120   2e-27   
ref|XP_006447343.1|  hypothetical protein CICLE_v10015144mg             120   2e-27   
ref|XP_009413180.1|  PREDICTED: ethylene-responsive transcription...    119   2e-27   
ref|XP_002454234.1|  hypothetical protein SORBIDRAFT_04g027180          120   2e-27   Sorghum bicolor [broomcorn]
gb|KHN27877.1|  Ethylene-responsive transcription factor ERF053         120   2e-27   
ref|XP_004515941.1|  PREDICTED: ethylene-responsive transcription...    117   2e-27   
ref|XP_002319909.2|  hypothetical protein POPTR_0013s13920g             120   2e-27   Populus trichocarpa [western balsam poplar]
gb|ABQ62985.1|  RAP2-like protein                                       120   2e-27   Populus trichocarpa [western balsam poplar]
gb|ABK24284.1|  unknown                                                 120   2e-27   Picea sitchensis
gb|ABR17765.1|  unknown                                                 119   2e-27   Picea sitchensis
ref|XP_011039744.1|  PREDICTED: ethylene-responsive transcription...    120   2e-27   
gb|AAT39542.1|  transcription factor DRE-binding factor 2               119   3e-27   Gossypium hirsutum [American cotton]
ref|NP_001173092.1|  Os02g0638650                                       120   3e-27   
ref|XP_002267468.1|  PREDICTED: ethylene-responsive transcription...    119   3e-27   Vitis vinifera
ref|XP_009397949.1|  PREDICTED: ethylene-responsive transcription...    119   3e-27   
ref|XP_010555135.1|  PREDICTED: ethylene-responsive transcription...    119   3e-27   
ref|XP_008448413.1|  PREDICTED: ethylene-responsive transcription...    119   3e-27   
ref|XP_011098323.1|  PREDICTED: ethylene-responsive transcription...    119   3e-27   
gb|AFP90334.1|  transcription factor 2                                  118   3e-27   
ref|XP_003638785.1|  Ethylene-responsive transcription factor RAP2-4    118   3e-27   
gb|EEC73669.1|  hypothetical protein OsI_08216                          119   3e-27   Oryza sativa Indica Group [Indian rice]
gb|ADE41121.1|  AP2 domain class transcription factor                   117   4e-27   
ref|XP_006371578.1|  hypothetical protein POPTR_0019s13330g             119   4e-27   
ref|XP_002884229.1|  hypothetical protein ARALYDRAFT_900468             118   4e-27   
ref|XP_009400292.1|  PREDICTED: ethylene-responsive transcription...    119   4e-27   
emb|CDP14752.1|  unnamed protein product                                119   4e-27   
ref|XP_011045500.1|  PREDICTED: ethylene-responsive transcription...    119   4e-27   
ref|XP_009373164.1|  PREDICTED: LOW QUALITY PROTEIN: ethylene-res...    118   4e-27   
ref|XP_003552083.1|  PREDICTED: ethylene-responsive transcription...    117   5e-27   
ref|XP_009592286.1|  PREDICTED: ethylene-responsive transcription...    120   5e-27   
gb|AIZ74389.1|  DREB3                                                   118   5e-27   
ref|XP_009592157.1|  PREDICTED: ethylene-responsive transcription...    119   6e-27   
ref|XP_006303258.1|  hypothetical protein CARUB_v10009949mg             117   6e-27   
ref|XP_002890498.1|  hypothetical protein ARALYDRAFT_472454             116   6e-27   
ref|XP_006357496.1|  PREDICTED: ethylene-responsive transcription...    118   6e-27   
gb|AFK73559.1|  AP2 transcription factor                                117   7e-27   
ref|XP_004953233.1|  PREDICTED: ethylene-responsive transcription...    119   7e-27   
ref|XP_007221531.1|  hypothetical protein PRUPE_ppa020676mg             113   7e-27   
ref|XP_003569954.1|  PREDICTED: ethylene-responsive transcription...    119   7e-27   
ref|XP_009117462.1|  PREDICTED: ethylene-responsive transcription...    117   8e-27   
ref|XP_009781334.1|  PREDICTED: ethylene-responsive transcription...    118   8e-27   
gb|ACP18975.1|  dehydration responsive element binding factor           117   8e-27   Limonium bicolor
ref|XP_002310574.2|  hypothetical protein POPTR_0007s05690g             117   9e-27   Populus trichocarpa [western balsam poplar]
gb|ABK95243.1|  unknown                                                 117   9e-27   Populus trichocarpa [western balsam poplar]
ref|XP_008378545.1|  PREDICTED: ethylene-responsive transcription...    117   9e-27   
ref|XP_003570628.1|  PREDICTED: ethylene-responsive transcription...    117   1e-26   
ref|XP_011085351.1|  PREDICTED: ethylene-responsive transcription...    117   1e-26   
dbj|BAJ98638.1|  predicted protein                                      118   1e-26   
gb|EPS68328.1|  dehydration responsive element-binding protein 2        112   1e-26   
gb|AIB05165.1|  AP2-EREBP transcription factor                          118   1e-26   
ref|XP_008455331.1|  PREDICTED: ethylene-responsive transcription...    117   1e-26   
gb|KDP46862.1|  hypothetical protein JCGZ_24071                         117   1e-26   
ref|XP_004142609.1|  PREDICTED: ethylene-responsive transcription...    117   1e-26   
ref|XP_004163671.1|  PREDICTED: LOW QUALITY PROTEIN: ethylene-res...    117   1e-26   
ref|XP_008803760.1|  PREDICTED: ethylene-responsive transcription...    117   1e-26   
dbj|BAJ99190.1|  predicted protein                                      117   1e-26   
ref|XP_010061815.1|  PREDICTED: ethylene-responsive transcription...    117   1e-26   
gb|AFO38387.1|  putative ethylene-responsive transcription factor...    116   1e-26   
ref|XP_007226002.1|  hypothetical protein PRUPE_ppa010345mg             115   1e-26   
ref|XP_009345480.1|  PREDICTED: ethylene-responsive transcription...    116   1e-26   
ref|XP_004514265.1|  PREDICTED: ethylene-responsive transcription...    116   1e-26   
gb|AFW72505.1|  putative AP2/EREBP transcription factor superfami...    117   1e-26   
gb|KHN44333.1|  Ethylene-responsive transcription factor RAP2-4         116   1e-26   
emb|CBZ41765.1|  drought responsive element binding protein 5           116   1e-26   
gb|EYU23219.1|  hypothetical protein MIMGU_mgv1a019226mg                116   1e-26   
ref|XP_004136820.1|  PREDICTED: ethylene-responsive transcription...    117   1e-26   
gb|ACU17684.1|  unknown                                                 116   2e-26   Glycine max [soybeans]
emb|CCD42020.1|  drought responsive element binding protein 5           116   2e-26   
ref|XP_009393593.1|  PREDICTED: ethylene-responsive transcription...    117   2e-26   
ref|XP_010644377.1|  PREDICTED: uncharacterized protein LOC104877562    117   2e-26   
gb|EYU26148.1|  hypothetical protein MIMGU_mgv11b016405mg               118   2e-26   
ref|XP_006302477.1|  hypothetical protein CARUB_v10020567mg             116   2e-26   
ref|XP_010498682.1|  PREDICTED: ethylene-responsive transcription...    115   2e-26   
ref|NP_001236953.1|  dehydration responsive element-binding prote...    115   2e-26   
gb|AFP90314.1|  transcription factor 2                                  116   2e-26   
ref|NP_001234707.1|  dehydration-responsive element binding prote...    115   2e-26   
ref|XP_007223221.1|  hypothetical protein PRUPE_ppa007193mg             117   2e-26   
ref|XP_009787574.1|  PREDICTED: ethylene-responsive transcription...    116   2e-26   
ref|XP_010459960.1|  PREDICTED: ethylene-responsive transcription...    115   2e-26   
ref|XP_009389564.1|  PREDICTED: ethylene-responsive transcription...    116   2e-26   
ref|XP_004976312.1|  PREDICTED: ethylene-responsive transcription...    117   2e-26   
ref|XP_008645977.1|  PREDICTED: ethylene-responsive transcription...    118   2e-26   
ref|XP_002887717.1|  hypothetical protein ARALYDRAFT_476975             116   2e-26   
ref|XP_004140031.1|  PREDICTED: LOW QUALITY PROTEIN: ethylene-res...    117   2e-26   
ref|XP_002301042.2|  AP2 domain-containing transcription factor f...    116   2e-26   Populus trichocarpa [western balsam poplar]
ref|XP_010937498.1|  PREDICTED: LOW QUALITY PROTEIN: ethylene-res...    116   2e-26   
gb|ABC74512.1|  DRF-like transcription factor DRFL2b                    116   2e-26   Triticum aestivum [Canadian hard winter wheat]
emb|CBG76431.1|  OO_Ba0013J05-OO_Ba0033A15.18                           117   2e-26   Oryza officinalis
ref|XP_002454259.1|  hypothetical protein SORBIDRAFT_04g027660          116   2e-26   Sorghum bicolor [broomcorn]
gb|AFP90315.1|  transcription factor 2                                  116   2e-26   
gb|AFP90326.1|  transcription factor 2                                  116   2e-26   
ref|XP_004237407.1|  PREDICTED: ethylene-responsive transcription...    116   3e-26   
gb|AFJ14639.1|  dehydration-responsive element-binding protein (D...    116   3e-26   
gb|AFP90323.1|  transcription factor 2                                  115   3e-26   
ref|XP_004166373.1|  PREDICTED: ethylene-responsive transcription...    115   3e-26   
gb|AHK24883.1|  DRE-binding protein                                     110   3e-26   
gb|AFP90308.1|  transcription factor 2                                  115   3e-26   
ref|XP_008444109.1|  PREDICTED: ethylene-responsive transcription...    116   3e-26   
gb|ABC74511.1|  DRF-like transcription factor DRFL2c                    115   3e-26   Triticum aestivum [Canadian hard winter wheat]
gb|AFP90294.1|  transcription factor 2                                  115   3e-26   
gb|AFP90299.1|  transcription factor 2                                  115   3e-26   
gb|AFP90310.1|  transcription factor 2                                  115   3e-26   
gb|AFP90309.1|  transcription factor 2                                  115   3e-26   
gb|AFP90317.1|  transcription factor 2                                  115   3e-26   
ref|XP_003541916.1|  PREDICTED: ethylene-responsive transcription...    116   3e-26   
gb|AFP90292.1|  transcription factor 2                                  115   3e-26   
gb|AFP90288.1|  transcription factor 2                                  115   3e-26   
gb|AFP90306.1|  transcription factor 2                                  115   3e-26   
gb|AFP90301.1|  transcription factor 2                                  115   3e-26   
ref|XP_011090520.1|  PREDICTED: ethylene-responsive transcription...    115   3e-26   
ref|XP_011097593.1|  PREDICTED: ethylene-responsive transcription...    116   3e-26   
gb|AFP90312.1|  transcription factor 2                                  115   3e-26   
gb|AFP90332.1|  transcription factor 2                                  115   3e-26   
gb|AFP90333.1|  transcription factor 2                                  115   3e-26   
gb|AFP90330.1|  transcription factor 2                                  115   3e-26   
gb|AFP90307.1|  transcription factor 2                                  115   3e-26   
gb|AFP90293.1|  transcription factor 2                                  115   3e-26   
ref|XP_004299631.1|  PREDICTED: ethylene-responsive transcription...    116   3e-26   
gb|ADE41115.1|  AP2 domain class transcription factor                   116   3e-26   
emb|CDX81987.1|  BnaC08g36140D                                          115   3e-26   
gb|AFP90291.1|  transcription factor 2                                  115   3e-26   
ref|NP_001053379.1|  Os04g0529100                                       116   3e-26   Oryza sativa Japonica Group [Japonica rice]
gb|AFP90303.1|  transcription factor 2                                  115   4e-26   
ref|XP_010105895.1|  Ethylene-responsive transcription factor           115   4e-26   
gb|AFP90320.1|  transcription factor 2                                  115   4e-26   
gb|KHN36624.1|  Ethylene-responsive transcription factor ERF053         116   4e-26   
ref|XP_006355363.1|  PREDICTED: ethylene-responsive transcription...    115   4e-26   
ref|XP_002533146.1|  DNA binding protein, putative                      116   4e-26   Ricinus communis
ref|XP_011016241.1|  PREDICTED: ethylene-responsive transcription...    115   4e-26   
ref|NP_179685.1|  ethylene-responsive transcription factor ERF053       115   4e-26   Arabidopsis thaliana [mouse-ear cress]
gb|ABJ09421.1|  putative DRE-binding protein DREB1                      113   4e-26   Aloe vera [acibar]
ref|XP_008375600.1|  PREDICTED: LOW QUALITY PROTEIN: ethylene-res...    115   4e-26   
gb|AFV60736.1|  ethylene-responsive transcription factor 4              116   4e-26   
gb|AFP90305.1|  transcription factor 2                                  115   4e-26   
ref|XP_008663401.1|  PREDICTED: ethylene-responsive transcription...    116   4e-26   
ref|XP_008445348.1|  PREDICTED: ethylene-responsive transcription...    115   4e-26   
ref|XP_006390026.1|  hypothetical protein EUTSA_v10018771mg             115   4e-26   
gb|ACY25088.1|  DREB1C                                                  115   4e-26   
gb|EPS73079.1|  hypothetical protein M569_01680                         112   4e-26   
gb|ABB89755.1|  putative dehydration-responsive element binding p...    115   4e-26   Broussonetia papyrifera [aka]
gb|AFP90321.1|  transcription factor 2                                  115   4e-26   
ref|XP_008362598.1|  PREDICTED: LOW QUALITY PROTEIN: ethylene-res...    115   4e-26   
ref|XP_011022769.1|  PREDICTED: ethylene-responsive transcription...    115   4e-26   
ref|XP_009349966.1|  PREDICTED: ethylene-responsive transcription...    115   5e-26   
ref|XP_004243339.1|  PREDICTED: ethylene-responsive transcription...    115   5e-26   
ref|NP_001288047.1|  ethylene-responsive transcription factor ERF060    115   5e-26   
ref|XP_008352604.1|  PREDICTED: LOW QUALITY PROTEIN: ethylene-res...    115   5e-26   
ref|XP_006416222.1|  hypothetical protein EUTSA_v10008326mg             114   5e-26   
ref|XP_002285802.1|  PREDICTED: ethylene-responsive transcription...    115   5e-26   Vitis vinifera
ref|XP_007205497.1|  hypothetical protein PRUPE_ppa008234mg             115   5e-26   
emb|CAD41199.2|  OSJNBa0074L08.10                                       116   5e-26   Oryza sativa Japonica Group [Japonica rice]
ref|NP_173638.1|  ethylene-responsive transcription factor RAP2.4       114   5e-26   Arabidopsis thaliana [mouse-ear cress]
gb|ADE41144.1|  AP2 domain class transcription factor                   115   6e-26   
gb|AFP90302.1|  transcription factor 2                                  115   6e-26   
ref|XP_009779133.1|  PREDICTED: ethylene-responsive transcription...    115   6e-26   
ref|XP_009366366.1|  PREDICTED: ethylene-responsive transcription...    114   6e-26   
gb|ADD09620.1|  dehydration responsive element binding protein          114   6e-26   Trifolium repens [creeping white clover]
gb|ADD69957.1|  DREB2                                                   114   6e-26   Caragana korshinskii
gb|ABC74510.1|  DRF-like transcription factor DRFL2a                    115   6e-26   Triticum aestivum [Canadian hard winter wheat]
ref|XP_009613405.1|  PREDICTED: ethylene-responsive transcription...    115   6e-26   
gb|ADM47480.1|  DREB2                                                   115   6e-26   
gb|ABQ62983.1|  TINY-like protein                                       114   7e-26   Populus trichocarpa [western balsam poplar]
gb|AFP90311.1|  transcription factor 2                                  114   7e-26   
gb|AAG52091.1|AC012680_2  putative AP2 domain transcriptional reg...    111   7e-26   Arabidopsis thaliana [mouse-ear cress]
gb|AHJ08575.1|  DREB6-like protein                                      114   7e-26   
ref|XP_003526587.1|  PREDICTED: ethylene-responsive transcription...    114   7e-26   
gb|EYU24006.1|  hypothetical protein MIMGU_mgv1a009524mg                115   7e-26   
gb|KHN29077.1|  Ethylene-responsive transcription factor RAP2-4         113   7e-26   
ref|XP_010477479.1|  PREDICTED: ethylene-responsive transcription...    114   7e-26   
emb|CDP01030.1|  unnamed protein product                                114   7e-26   
ref|XP_010428923.1|  PREDICTED: ethylene-responsive transcription...    115   7e-26   
ref|XP_009145366.1|  PREDICTED: ethylene-responsive transcription...    113   8e-26   
emb|CDY21346.1|  BnaA09g30810D                                          113   8e-26   
ref|XP_010060168.1|  PREDICTED: ethylene-responsive transcription...    115   8e-26   
gb|KFK42189.1|  hypothetical protein AALP_AA2G223100                    114   8e-26   
ref|XP_009150596.1|  PREDICTED: ethylene-responsive transcription...    114   8e-26   
gb|AFX68812.1|  ERF transcription factor 8                              113   8e-26   
emb|CDY14636.1|  BnaC02g24770D                                          113   8e-26   
emb|CDY08816.1|  BnaA06g24080D                                          114   8e-26   
ref|XP_008659105.1|  PREDICTED: ethylene-responsive transcription...    114   8e-26   
gb|ABY63297.1|  DREB protein                                            114   9e-26   
ref|XP_008219663.1|  PREDICTED: ethylene-responsive transcription...    115   9e-26   
ref|XP_008790815.1|  PREDICTED: ethylene-responsive transcription...    114   9e-26   
gb|AFH56408.1|  ethylene response factor 1                              111   1e-25   
emb|CDY38238.1|  BnaC05g17550D                                          113   1e-25   
ref|XP_004985387.1|  PREDICTED: ethylene-responsive transcription...    114   1e-25   
gb|ADD09598.1|  dehydration responsive element binding protein          114   1e-25   Trifolium repens [creeping white clover]
ref|XP_006827824.1|  hypothetical protein AMTR_s00009p00268560          115   1e-25   
ref|XP_008808175.1|  PREDICTED: ethylene-responsive transcription...    114   1e-25   
ref|XP_009798155.1|  PREDICTED: ethylene-responsive transcription...    114   1e-25   
ref|XP_008234629.1|  PREDICTED: ethylene-responsive transcription...    114   1e-25   
ref|XP_010102588.1|  Ethylene-responsive transcription factor           114   1e-25   
gb|AHB33872.1|  ERF transcription factor 01                             113   1e-25   
gb|KGN48763.1|  AP2/ERF domain-containing transcription factor          113   1e-25   
ref|XP_003615022.1|  Ethylene-responsive transcription factor RAP2-4    114   1e-25   
ref|XP_006428165.1|  hypothetical protein CICLE_v10025961mg             114   1e-25   
ref|XP_006411774.1|  hypothetical protein EUTSA_v10025958mg             113   1e-25   
gb|KDO56612.1|  hypothetical protein CISIN_1g018103mg                   114   1e-25   
gb|AEX88462.1|  ethylene-responsive element binding factor 3            113   1e-25   
ref|XP_004143476.1|  PREDICTED: ethylene-responsive transcription...    114   1e-25   
gb|KFK30541.1|  hypothetical protein AALP_AA7G275700                    112   1e-25   
ref|XP_008669101.1|  PREDICTED: ethylene-responsive transcription...    115   1e-25   
gb|AID51416.1|  ethylene response factor 11                             113   1e-25   
ref|XP_004150659.1|  PREDICTED: ethylene-responsive transcription...    114   1e-25   
gb|AFJ14638.1|  dehydration-responsive element-binding protein (D...    114   2e-25   
ref|XP_002307098.1|  hypothetical protein POPTR_0005s07900g             114   2e-25   Populus trichocarpa [western balsam poplar]
ref|XP_002448218.1|  hypothetical protein SORBIDRAFT_06g023313          114   2e-25   Sorghum bicolor [broomcorn]
ref|XP_010261262.1|  PREDICTED: ethylene-responsive transcription...    114   2e-25   
emb|CBI83762.1|  transcription factor DREB2a                            114   2e-25   
ref|XP_006303237.1|  hypothetical protein CARUB_v10012538mg             113   2e-25   
dbj|BAJ96243.1|  predicted protein                                      114   2e-25   
ref|XP_006596336.1|  PREDICTED: ethylene-responsive transcription...    113   2e-25   
emb|CDY14542.1|  BnaC03g49170D                                          112   2e-25   
emb|CDX87480.1|  BnaA07g33930D                                          112   2e-25   
ref|XP_008440612.1|  PREDICTED: ethylene-responsive transcription...    114   2e-25   
ref|XP_004953948.1|  PREDICTED: ethylene-responsive transcription...    113   2e-25   
gb|AEA76436.1|  DRE binding transcription factor                        112   2e-25   
ref|XP_010939626.1|  PREDICTED: ethylene-responsive transcription...    114   2e-25   
gb|AEI16474.1|  dehydration-responsive element binding protein          113   2e-25   
gb|KFK44310.1|  hypothetical protein AALP_AA1G241600                    111   2e-25   
gb|AEY75252.1|  DRE binding transcription factor                        112   2e-25   
gb|ACM17914.1|  dehydration-responsive element binding protein          111   2e-25   Aloe vera var. chinensis
ref|XP_010676915.1|  PREDICTED: ethylene-responsive transcription...    114   2e-25   
ref|XP_010526650.1|  PREDICTED: ethylene-responsive transcription...    113   2e-25   
ref|XP_006826963.1|  hypothetical protein AMTR_s00010p00194910          112   2e-25   
gb|AAF76898.1|AF274033_1  apetala2 domain-containing protein            111   2e-25   Atriplex hortensis
ref|XP_003531359.1|  PREDICTED: ethylene-responsive transcription...    113   2e-25   
ref|XP_009380194.1|  PREDICTED: ethylene-responsive transcription...    112   2e-25   
ref|XP_011074161.1|  PREDICTED: ethylene-responsive transcription...    113   3e-25   
ref|XP_003542454.1|  PREDICTED: ethylene-responsive transcription...    112   3e-25   
gb|EPS62721.1|  hypothetical protein M569_12068                         112   3e-25   
emb|CDX69387.1|  BnaC01g00660D                                          112   3e-25   
gb|AAZ14831.1|  putative AP2-binding protein                            112   3e-25   
ref|XP_010440558.1|  PREDICTED: ethylene-responsive transcription...    113   3e-25   
ref|XP_009104590.1|  PREDICTED: ethylene-responsive transcription...    112   3e-25   
ref|XP_010680571.1|  PREDICTED: ethylene-responsive transcription...    112   3e-25   
ref|XP_002307390.2|  hypothetical protein POPTR_0005s16690g             113   3e-25   
gb|AAC49770.1|  AP2 domain containing protein RAP2.4                    111   3e-25   
gb|ABU86872.1|  dehydrate responsive element-binding protein            113   3e-25   
gb|AIM47745.1|  DREBa                                                   112   3e-25   
ref|XP_007136233.1|  hypothetical protein PHAVU_009G029600g             113   3e-25   
ref|XP_007141161.1|  hypothetical protein PHAVU_008G172200g             112   3e-25   
emb|CDX88414.1|  BnaC06g38580D                                          112   3e-25   
ref|XP_011011480.1|  PREDICTED: ethylene-responsive transcription...    113   3e-25   
ref|NP_564468.1|  ethylene-responsive transcription factor ERF055       112   3e-25   
ref|XP_002438081.1|  hypothetical protein SORBIDRAFT_10g007780          113   3e-25   
gb|KEH20859.1|  ethylene response factor                                112   3e-25   
gb|KHN31362.1|  Ethylene-responsive transcription factor ERF060         111   3e-25   
gb|AIM47746.1|  DREBb                                                   113   4e-25   
gb|ABB89754.1|  dehydration-responsive element binding protein 3        111   4e-25   
gb|AFG56310.1|  hypothetical protein 0_13096_01                         108   4e-25   
emb|CDY31606.1|  BnaA03g54460D                                          111   4e-25   
ref|XP_006660575.1|  PREDICTED: ethylene-responsive transcription...    112   4e-25   
ref|XP_009106455.1|  PREDICTED: ethylene-responsive transcription...    112   4e-25   
gb|ABC65854.1|  drought-responsive factor-like transcription fact...    112   4e-25   
emb|CBX87025.1|  DBF2 protein                                           112   4e-25   
ref|NP_001266857.1|  DRE-binding protein 2                              112   4e-25   
gb|ADC94857.1|  DRE transcription factor 2                              111   4e-25   
ref|XP_010531386.1|  PREDICTED: ethylene-responsive transcription...    112   4e-25   
ref|XP_007018819.1|  AP2 4, putative                                    113   4e-25   
ref|XP_010647274.1|  PREDICTED: ethylene-responsive transcription...    111   4e-25   
emb|CDP01435.1|  unnamed protein product                                113   4e-25   
gb|AHB33873.1|  ERF transcription factor 02                             112   4e-25   
gb|ADX97444.1|  DREB1p                                                  111   4e-25   
ref|XP_004956678.1|  PREDICTED: ethylene-responsive transcription...    112   4e-25   
ref|NP_001146944.1|  LOC100280553                                       112   4e-25   
gb|KHN38186.1|  Ethylene-responsive transcription factor RAP2-4         114   4e-25   
ref|XP_004504059.1|  PREDICTED: ethylene-responsive transcription...    112   4e-25   
ref|XP_009390585.1|  PREDICTED: ethylene-responsive transcription...    112   5e-25   
ref|XP_006434017.1|  hypothetical protein CICLE_v10001563mg             112   5e-25   
ref|XP_010496065.1|  PREDICTED: ethylene-responsive transcription...    112   5e-25   
ref|XP_010269215.1|  PREDICTED: ethylene-responsive transcription...    113   5e-25   
gb|KDO80918.1|  hypothetical protein CISIN_1g017798mg                   112   5e-25   
ref|XP_009128273.1|  PREDICTED: ethylene-responsive transcription...    112   5e-25   
ref|XP_002444319.1|  hypothetical protein SORBIDRAFT_07g020090          111   5e-25   
gb|AFP90324.1|  transcription factor 2                                  112   5e-25   
emb|CBI19140.3|  unnamed protein product                                111   5e-25   
ref|XP_009124887.1|  PREDICTED: ethylene-responsive transcription...    112   5e-25   
ref|XP_003564067.1|  PREDICTED: ethylene-responsive transcription...    112   5e-25   
emb|CDX90362.1|  BnaA08g16220D                                          110   5e-25   
gb|AFH96116.1|  DREB                                                    111   6e-25   
gb|AIZ74390.1|  DREB4                                                   112   6e-25   
ref|XP_010416775.1|  PREDICTED: ethylene-responsive transcription...    112   6e-25   
ref|XP_004500614.1|  PREDICTED: ethylene-responsive transcription...    112   6e-25   
gb|AFY98895.1|  ethylene-responsive element binding-factor              112   6e-25   
emb|CDY14255.1|  BnaA08g13860D                                          111   6e-25   
emb|CDY39455.1|  BnaC03g60650D                                          111   6e-25   
ref|XP_006354001.1|  PREDICTED: ethylene-responsive transcription...    112   6e-25   
emb|CCF23021.1|  drought responsive element binding protein 5           111   6e-25   
emb|CDX68032.1|  BnaA07g20720D                                          112   6e-25   
ref|XP_009127404.1|  PREDICTED: ethylene-responsive transcription...    111   7e-25   
ref|XP_010647272.1|  PREDICTED: ethylene-responsive transcription...    112   7e-25   
gb|ABC65853.1|  drought-responsive factor-like transcription fact...    111   7e-25   
emb|CDX73367.1|  BnaC05g27390D                                          112   7e-25   
ref|XP_002513895.1|  DNA binding protein, putative                      112   7e-25   
emb|CBI23500.3|  unnamed protein product                                110   7e-25   
gb|AET99101.1|  dehydration-responsive element-binding protein DREB4    112   7e-25   
ref|XP_009381506.1|  PREDICTED: ethylene-responsive transcription...    112   7e-25   
ref|XP_003525060.1|  PREDICTED: ethylene-responsive transcription...    111   7e-25   
emb|CDX79244.1|  BnaC06g20590D                                          112   7e-25   
gb|ADC94856.1|  DRE transcription factor 1                              112   8e-25   
gb|AAK43967.1|AF370152_1  putative AP2 domain-containing protein        112   8e-25   
ref|XP_010461345.1|  PREDICTED: ethylene-responsive transcription...    111   8e-25   
ref|XP_003635449.1|  PREDICTED: ethylene-responsive transcription...    112   8e-25   
ref|NP_177931.1|  ethylene-responsive transcription factor RAP2-4       111   8e-25   
ref|XP_010472009.1|  PREDICTED: ethylene-responsive transcription...    112   8e-25   
ref|XP_006434018.1|  hypothetical protein CICLE_v10001563mg             112   8e-25   
ref|NP_001048142.1|  Os02g0752800                                       112   8e-25   
ref|XP_003581450.1|  PREDICTED: ethylene-responsive transcription...    113   8e-25   
ref|XP_009417374.1|  PREDICTED: ethylene-responsive transcription...    112   8e-25   
emb|CDY42004.1|  BnaA01g05760D                                          110   8e-25   
gb|AAF17691.1|AC009243_18  F28K19.29                                    111   8e-25   
gb|EEC74022.1|  hypothetical protein OsI_08968                          111   8e-25   
ref|XP_007163638.1|  hypothetical protein PHAVU_001G251200g             111   9e-25   
ref|XP_004964981.1|  PREDICTED: ethylene-responsive transcription...    112   9e-25   
ref|XP_008782127.1|  PREDICTED: ethylene-responsive transcription...    111   9e-25   
ref|XP_008224508.1|  PREDICTED: ethylene-responsive transcription...    112   9e-25   
ref|XP_010500063.1|  PREDICTED: ethylene-responsive transcription...    111   1e-24   
ref|XP_010500062.1|  PREDICTED: ethylene-responsive transcription...    111   1e-24   
gb|KDO80917.1|  hypothetical protein CISIN_1g017798mg                   111   1e-24   
ref|XP_006472629.1|  PREDICTED: ethylene-responsive transcription...    111   1e-24   
ref|NP_001049235.1|  Os03g0191900                                       110   1e-24   
gb|EAY88866.1|  hypothetical protein OsI_10343                          110   1e-24   
ref|XP_010535636.1|  PREDICTED: ethylene-responsive transcription...    111   1e-24   
gb|AFB33269.1|  hypothetical protein 2_2931_01                          107   1e-24   
ref|XP_002893909.1|  hypothetical protein ARALYDRAFT_473706             110   1e-24   
ref|XP_006285323.1|  hypothetical protein CARUB_v10006710mg             111   1e-24   
gb|AEW08200.1|  hypothetical protein 2_2931_01                          107   2e-24   
gb|EYU44887.1|  hypothetical protein MIMGU_mgv1a017888mg                110   2e-24   
ref|XP_008652630.1|  PREDICTED: ethylene-responsive transcription...    110   2e-24   
ref|NP_195688.1|  ethylene-responsive transcription factor ERF060       110   2e-24   
gb|AAT44917.1|  putative AP2/EREBP transcription factor                 110   2e-24   
ref|XP_002465715.1|  hypothetical protein SORBIDRAFT_01g044410          110   2e-24   
gb|KFK29338.1|  hypothetical protein AALP_AA7G120800                    108   2e-24   
gb|AEW08199.1|  hypothetical protein 2_2931_01                          106   2e-24   
gb|ADE41127.1|  AP2 domain class transcription factor                   110   2e-24   
ref|XP_006286220.1|  hypothetical protein CARUB_v10007787mg             109   2e-24   
ref|XP_009138555.1|  PREDICTED: ethylene-responsive transcription...    109   2e-24   
gb|EYU36517.1|  hypothetical protein MIMGU_mgv1a009828mg                110   2e-24   
emb|CDX72672.1|  BnaC07g46940D                                          108   3e-24   
ref|XP_006412990.1|  hypothetical protein EUTSA_v10025862mg             109   3e-24   
dbj|BAD37688.1|  putative AP2-domain DRE binding factor DBF1            110   3e-24   
ref|XP_003578039.1|  PREDICTED: ethylene-responsive transcription...    109   3e-24   
ref|NP_001183842.1|  putative AP2/EREBP transcription factor supe...    110   3e-24   
ref|XP_010241385.1|  PREDICTED: ethylene-responsive transcription...    110   3e-24   
gb|ACN28514.1|  unknown                                                 108   3e-24   
ref|NP_179810.1|  ethylene-responsive transcription factor ERF056       108   4e-24   
gb|EAZ00198.1|  hypothetical protein OsI_22202                          110   4e-24   
ref|NP_001105578.1|  LOC542569                                          107   4e-24   
ref|XP_010431962.1|  PREDICTED: ethylene-responsive transcription...    109   4e-24   
tpg|DAA46884.1|  TPA: putative AP2/EREBP transcription factor sup...    108   4e-24   
ref|XP_008666300.1|  PREDICTED: ethylene-responsive transcription...    108   4e-24   
ref|XP_009390914.1|  PREDICTED: ethylene-responsive transcription...    109   4e-24   
ref|NP_001266604.1|  DRE binding factor                                 109   4e-24   
ref|NP_001136823.1|  putative AP2/EREBP transcription factor supe...    109   4e-24   
ref|XP_010437100.1|  PREDICTED: ethylene-responsive transcription...    108   4e-24   
gb|AAP70033.1|  DRE binding factor 2                                    108   4e-24   
tpg|DAA49099.1|  TPA: putative AP2/EREBP transcription factor sup...    108   5e-24   
ref|NP_001063013.1|  Os09g0369000                                       108   5e-24   
tpg|DAA49098.1|  TPA: putative AP2/EREBP transcription factor sup...    108   5e-24   
ref|XP_002868928.1|  hypothetical protein ARALYDRAFT_490762             108   5e-24   
ref|XP_010446537.1|  PREDICTED: ethylene-responsive transcription...    108   5e-24   
ref|XP_010521193.1|  PREDICTED: ethylene-responsive transcription...    109   5e-24   
ref|XP_009109443.1|  PREDICTED: ethylene-responsive transcription...    108   5e-24   
ref|XP_002460137.1|  hypothetical protein SORBIDRAFT_02g023230          108   5e-24   
ref|XP_006414873.1|  hypothetical protein EUTSA_v10025587mg             109   5e-24   
ref|NP_001266537.1|  DRE binding factor 1                               108   6e-24   
ref|XP_004973405.1|  PREDICTED: ethylene-responsive transcription...    108   6e-24   
ref|NP_001141968.1|  putative AP2/EREBP transcription factor supe...    108   6e-24   
ref|XP_002976369.1|  hypothetical protein SELMODRAFT_104980             109   6e-24   
ref|XP_009404053.1|  PREDICTED: ethylene-responsive transcription...    108   6e-24   
ref|XP_009387776.1|  PREDICTED: ethylene-responsive transcription...    109   7e-24   
ref|XP_010926272.1|  PREDICTED: ethylene-responsive transcription...    108   8e-24   
ref|XP_004496081.1|  PREDICTED: ethylene-responsive transcription...    109   8e-24   
ref|XP_004247959.1|  PREDICTED: ethylene-responsive transcription...    109   9e-24   
gb|ABQ62986.1|  RAP2-like protein                                       106   1e-23   
ref|XP_010544197.1|  PREDICTED: ethylene-responsive transcription...    108   1e-23   
gb|EAZ06962.1|  hypothetical protein OsI_29203                          107   1e-23   
ref|XP_006840184.1|  hypothetical protein AMTR_s00089p00102760          108   1e-23   
ref|NP_001061779.1|  Os08g0408500                                       107   1e-23   
ref|XP_010673427.1|  PREDICTED: ethylene-responsive transcription...    108   1e-23   
ref|NP_194543.1|  ethylene-responsive transcription factor ERF054       107   1e-23   
ref|XP_010546408.1|  PREDICTED: ethylene-responsive transcription...    107   2e-23   
ref|XP_003574464.1|  PREDICTED: ethylene-responsive transcription...    107   2e-23   
gb|EAY78232.1|  hypothetical protein OsI_33276                          107   2e-23   
gb|AAM08622.1|AC107314_13  Putative AP2 domain transcriptional re...    107   2e-23   
ref|XP_010448023.1|  PREDICTED: ethylene-responsive transcription...    107   2e-23   
ref|XP_002867464.1|  hypothetical protein ARALYDRAFT_491962             107   2e-23   
ref|XP_009589826.1|  PREDICTED: ethylene-responsive transcription...    108   2e-23   
ref|XP_004983222.1|  PREDICTED: ethylene-responsive transcription...    107   2e-23   
ref|XP_009607801.1|  PREDICTED: ethylene-responsive transcription...    108   2e-23   
gb|KHN30687.1|  Ethylene-responsive transcription factor ERF062         105   2e-23   
ref|XP_010519793.1|  PREDICTED: ethylene-responsive transcription...    106   2e-23   
ref|XP_006296204.1|  hypothetical protein CARUB_v10025369mg             106   2e-23   
ref|XP_010053127.1|  PREDICTED: ethylene-responsive transcription...    107   2e-23   
ref|XP_010484316.1|  PREDICTED: ethylene-responsive transcription...    106   3e-23   
ref|XP_011041894.1|  PREDICTED: ethylene-responsive transcription...    108   3e-23   
emb|CDX89202.1|  BnaA01g16910D                                          107   3e-23   
ref|XP_009144196.1|  PREDICTED: ethylene-responsive transcription...    106   3e-23   
ref|XP_010042789.1|  PREDICTED: ethylene-responsive transcription...    107   3e-23   
ref|XP_010023704.1|  PREDICTED: ethylene-responsive transcription...    107   3e-23   
ref|XP_010027841.1|  PREDICTED: ethylene-responsive transcription...    107   3e-23   
gb|AAL91280.1|  At2g22200/T26C19.14                                     106   3e-23   
ref|XP_009781485.1|  PREDICTED: ethylene-responsive transcription...    107   3e-23   
ref|XP_006366853.1|  PREDICTED: ethylene-responsive transcription...    107   3e-23   
ref|XP_011041893.1|  PREDICTED: ethylene-responsive transcription...    108   4e-23   
gb|AAT44938.1|  putative AP2/EREBP transcription factor                 107   4e-23   
ref|NP_193098.1|  ethylene-responsive transcription factor ERF062       107   4e-23   
ref|XP_002987212.1|  hypothetical protein SELMODRAFT_73149              100   4e-23   
emb|CDY58717.1|  BnaC07g50590D                                          105   4e-23   
ref|XP_010416976.1|  PREDICTED: ethylene-responsive transcription...    105   4e-23   
ref|XP_006606324.1|  PREDICTED: ethylene-responsive transcription...    107   4e-23   
ref|XP_007144182.1|  hypothetical protein PHAVU_007G135300g             107   4e-23   
ref|XP_002870369.1|  hypothetical protein ARALYDRAFT_493551             107   4e-23   
dbj|BAI94491.1|  AP2/EREBP family transcription factor                  105   5e-23   
ref|XP_010448024.1|  PREDICTED: ethylene-responsive transcription...    106   5e-23   
gb|KHN00994.1|  Ethylene-responsive transcription factor ERF062         107   5e-23   
ref|XP_010462245.1|  PREDICTED: ethylene-responsive transcription...    106   5e-23   
gb|ACU23778.1|  unknown                                                 107   5e-23   
ref|XP_003571744.2|  PREDICTED: ethylene-responsive transcription...    105   5e-23   
ref|XP_010472214.1|  PREDICTED: ethylene-responsive transcription...    105   5e-23   
ref|XP_004139008.1|  PREDICTED: ethylene-responsive transcription...    107   6e-23   
gb|KEH43295.1|  AP2 domain class transcription factor                   106   6e-23   
ref|XP_010438499.1|  PREDICTED: ethylene-responsive transcription...    105   6e-23   
ref|XP_003591645.1|  Ethylene-responsive transcription factor RAP2-3    107   6e-23   
ref|XP_008457242.1|  PREDICTED: ethylene-responsive transcription...    107   6e-23   
ref|XP_007159638.1|  hypothetical protein PHAVU_002G254500g             106   6e-23   
ref|XP_009109110.1|  PREDICTED: ethylene-responsive transcription...    105   7e-23   
ref|XP_010433257.1|  PREDICTED: ethylene-responsive transcription...    105   7e-23   
ref|XP_010444489.1|  PREDICTED: ethylene-responsive transcription...    105   1e-22   
ref|XP_006394075.1|  hypothetical protein EUTSA_v10005326mg             105   1e-22   
ref|XP_010429137.1|  PREDICTED: ethylene-responsive transcription...    104   1e-22   
gb|ABQ62987.1|  RAP2-like protein                                       106   1e-22   
ref|XP_002323984.2|  hypothetical protein POPTR_0017s08250g             106   1e-22   
gb|KHN02024.1|  Ethylene-responsive transcription factor RAP2-4         102   1e-22   
ref|XP_011073782.1|  PREDICTED: ethylene-responsive transcription...    105   1e-22   
ref|XP_010274030.1|  PREDICTED: ethylene-responsive transcription...    105   1e-22   
gb|KFK32834.1|  hypothetical protein AALP_AA6G293100                    103   2e-22   
emb|CDX97423.1|  BnaC08g12880D                                          104   2e-22   
ref|XP_009137764.1|  PREDICTED: ethylene-responsive transcription...    103   2e-22   
ref|XP_006280928.1|  hypothetical protein CARUB_v10026925mg             104   2e-22   
ref|XP_002880436.1|  hypothetical protein ARALYDRAFT_900671             104   3e-22   
gb|KDP39366.1|  hypothetical protein JCGZ_01123                         105   3e-22   
ref|XP_002518093.1|  hypothetical protein RCOM_1019500                  105   3e-22   
ref|XP_010551186.1|  PREDICTED: ethylene-responsive transcription...    105   3e-22   
ref|XP_010107796.1|  Ethylene-responsive transcription factor           104   3e-22   
ref|XP_006282662.1|  hypothetical protein CARUB_v10005203mg             104   3e-22   
gb|KFK36252.1|  hypothetical protein AALP_AA4G097800                    104   4e-22   
emb|CDY33983.1|  BnaC02g43540D                                          103   5e-22   
ref|NP_201318.1|  ethylene-responsive transcription factor ERF057       102   6e-22   



>ref|XP_009762241.1| PREDICTED: ethylene-responsive transcription factor SHINE 3-like 
[Nicotiana sylvestris]
Length=283

 Score =   130 bits (328),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 86/166 (52%), Positives = 99/166 (60%), Gaps = 18/166 (11%)
 Frame = +3

Query  216  DRPLKKMKNIP----QLLSSSTSHPTHKPLIsppqppsfrfpfALHDTIP-HPLFHHQTM  380
            DRPLKK+K IP    + L ++T  P  K          F FPFAL D +P      +QTM
Sbjct  17   DRPLKKLK-IPSSEHKDLRAATYDP--KQSTYTAHNSRFSFPFALDDQLPMQSPVQNQTM  73

Query  381  ISFAPQQQLQSSSGCGNDQISWQSAGPIGLGHDGLNEAASPLPKLYRGVRQRHLGRWVAE  560
            ISFAPQ    S   C    +  ++    G          S  PK YRGVRQRH G+WVAE
Sbjct  74   ISFAPQNC--SLYPCHLALVQCRNTYNYG--------TVSTTPKWYRGVRQRHWGKWVAE  123

Query  561  IRLPHNRARLWLGTFDSAEDAALAYDREAYRLRGAKARLNFPHLFL  698
            IRLP  R RLWLGTFDSAE+AA AYD EA+RLRG+ ARLNFPHLFL
Sbjct  124  IRLPRKRTRLWLGTFDSAEEAAFAYDVEAFRLRGSNARLNFPHLFL  169



>ref|XP_002517949.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF44467.1| conserved hypothetical protein [Ricinus communis]
Length=426

 Score =   127 bits (320),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 86/194 (44%), Positives = 102/194 (53%), Gaps = 43/194 (22%)
 Frame = +3

Query  240  NIPQLLSSSTSHPTHKPLIsppqppsfrfpfALHDTIPH--------PLFHH-------Q  374
            ++P  +SS ++ P + P           FPFA    +PH        P F H       Q
Sbjct  85   SVPSTVSSISTLPLNPP---SSSGSRLSFPFAFEGQLPHQFTTNTCLPYFRHPLHNQQQQ  141

Query  375  TMISFAPQQQLQSSSGCGNDQIS----------WQSA---GPIG-------LGHDGLNEA  494
             MISFA  QQL   S      ++          W  A    P G       LG DG    
Sbjct  142  QMISFAQNQQLAMPSDSSPSALTYQQQQQLYQYWSDALNLSPRGRMMMMNRLGADGRPLF  201

Query  495  ASPL-----PKLYRGVRQRHLGRWVAEIRLPHNRARLWLGTFDSAEDAALAYDREAYRLR  659
            + P+      KLYRGVRQRH G+WVAEIRLP NR RLWLGTFD+AEDAA+AYDREA+RLR
Sbjct  202  SQPIQPINTTKLYRGVRQRHWGKWVAEIRLPRNRTRLWLGTFDTAEDAAMAYDREAFRLR  261

Query  660  GAKARLNFPHLFLD  701
            G  ARLNFP LFL+
Sbjct  262  GENARLNFPELFLN  275



>ref|XP_006360275.1| PREDICTED: ethylene-responsive transcription factor RAP2-4-like 
[Solanum tuberosum]
Length=339

 Score =   125 bits (315),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 64/121 (53%), Positives = 84/121 (69%), Gaps = 5/121 (4%)
 Frame = +3

Query  351  PHPLFHHQTMISFAPQQQLQSSSGCGNDQ-ISWQSAGPIGLGHDGLNEAASPLPKLYRGV  527
            P  ++ +Q  I + PQQ + + +   N+Q +S+    P+ +   G   +    PKLYRGV
Sbjct  103  PGSIWLNQAQI-YLPQQIMPAVTFQNNNQYVSYLGPKPVSMKQSG---SPPKPPKLYRGV  158

Query  528  RQRHLGRWVAEIRLPHNRARLWLGTFDSAEDAALAYDREAYRLRGAKARLNFPHLFLDGA  707
            RQRH G+WVAEIRLP NR RLWLGTFD+AE+AALAYD+ AY+LRG  ARLNFPHL  +G+
Sbjct  159  RQRHWGKWVAEIRLPKNRTRLWLGTFDTAEEAALAYDKAAYKLRGEFARLNFPHLRHNGS  218

Query  708  L  710
            L
Sbjct  219  L  219



>ref|XP_010689679.1| PREDICTED: ethylene-responsive transcription factor ERF053-like 
[Beta vulgaris subsp. vulgaris]
Length=415

 Score =   125 bits (315),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 71/141 (50%), Positives = 86/141 (61%), Gaps = 18/141 (13%)
 Frame = +3

Query  381  ISFAPQQQLQSSSGCGNDQISWQSAGPI---------GLGHDGLNEAASPLP-----KLY  518
            I  A  QQLQ    C +D ++    G +         G G   + +   P+P     KLY
Sbjct  149  IPMATNQQLQQLQYC-SDALNLSPRGKMMMMNRFTAQGFGRQ-IPQGGGPVPPISTTKLY  206

Query  519  RGVRQRHLGRWVAEIRLPHNRARLWLGTFDSAEDAALAYDREAYRLRGAKARLNFPHLFL  698
            RGVRQRH G+WVAEIRLP NR RLWLGTFD+AEDAALAYDREAY+LRG  ARLNFP LFL
Sbjct  207  RGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTAEDAALAYDREAYKLRGENARLNFPELFL  266

Query  699  DGALHEDLETATQKEAKPKQI  761
            +    E  ET      +P+++
Sbjct  267  NKDRVE--ETTLSSSTQPQEM  285



>ref|XP_007149866.1| hypothetical protein PHAVU_005G105200g [Phaseolus vulgaris]
 gb|ESW21860.1| hypothetical protein PHAVU_005G105200g [Phaseolus vulgaris]
Length=407

 Score =   125 bits (313),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 84/198 (42%), Positives = 99/198 (50%), Gaps = 37/198 (19%)
 Frame = +3

Query  333  ALHDTIPHPLFHHQT--MISFAPQQQ-----------------LQSSSGCGNDQISWQSA  455
            A +   PHP F +Q   MISF  QQQ                              W  A
Sbjct  120  ATNSPFPHPSFQNQQQQMISFDSQQQNLPFPPIMARDSSLPHYHHHQQHPQQLLQYWSDA  179

Query  456  ---GPIG----LGHDG---LNEAASPL--PKLYRGVRQRHLGRWVAEIRLPHNRARLWLG  599
                P G    LG DG         PL   KLYRGVRQRH G+WVAEIRLP NR RLWLG
Sbjct  180  LHLSPRGMLTHLGPDGRPLFRPPTQPLNATKLYRGVRQRHWGKWVAEIRLPRNRTRLWLG  239

Query  600  TFDSAEDAALAYDREAYRLRGAKARLNFPHLFLDGALHEDLE------TATQKEAKPKQI  761
            TFD+AEDAA+AYDREA++LRG  ARLNFP LFL+   ++ +E         Q E +P  +
Sbjct  240  TFDTAEDAAMAYDREAFKLRGENARLNFPELFLNKDKNKQVEEEPSSPAQNQPELEPVPV  299

Query  762  TSGNIIESNNTKCSGISA  815
                  E +N   SGI +
Sbjct  300  GRDMPREESNENDSGIGS  317



>ref|XP_010245316.1| PREDICTED: ethylene-responsive transcription factor ERF054 [Nelumbo 
nucifera]
Length=461

 Score =   125 bits (313),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 60/82 (73%), Positives = 64/82 (78%), Gaps = 5/82 (6%)
 Frame = +3

Query  468  LGHDGLNEAASPLP-----KLYRGVRQRHLGRWVAEIRLPHNRARLWLGTFDSAEDAALA  632
            LG DG N    P P     KLYRGVRQRH G+WVAEIRLP NR RLWLGTFD+AEDAALA
Sbjct  187  LGQDGRNLFRPPAPPATTTKLYRGVRQRHWGKWVAEIRLPRNRTRLWLGTFDTAEDAALA  246

Query  633  YDREAYRLRGAKARLNFPHLFL  698
            YDREA++LRG  ARLNFP LFL
Sbjct  247  YDREAFKLRGENARLNFPELFL  268



>ref|XP_010540852.1| PREDICTED: ethylene-responsive transcription factor ERF054 [Tarenaya 
hassleriana]
Length=350

 Score =   123 bits (309),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 73/159 (46%), Positives = 94/159 (59%), Gaps = 13/159 (8%)
 Frame = +3

Query  354  HPLFHHQTMISFAPQQQLQSSSGCGNDQISWQSAGPIG----LGHDG--LNEAASPLP--  509
             P    Q +ISFAPQ Q   +         W   G +     LG +G  L  +  P    
Sbjct  85   QPSQSQQRIISFAPQHQQPMAQQRQYLLQYWSPRGRLAMMNSLGQEGGQLRPSLQPFSAT  144

Query  510  KLYRGVRQRHLGRWVAEIRLPHNRARLWLGTFDSAEDAALAYDREAYRLRGAKARLNFPH  689
            KLYRGVRQRH G+WVAEIRLP NR RLWLGTFD+AE+AALAYDREA++LRG  ARLNFP 
Sbjct  145  KLYRGVRQRHWGKWVAEIRLPRNRTRLWLGTFDTAEEAALAYDREAFKLRGENARLNFPE  204

Query  690  LFLD-----GALHEDLETATQKEAKPKQITSGNIIESNN  791
            LF++      + H++ +  ++   +P + T  N  E+ N
Sbjct  205  LFVNKENASNSSHQEQQEVSRALHEPSKETLQNEQEAAN  243



>ref|XP_010242006.1| PREDICTED: ethylene-responsive transcription factor ERF053-like 
[Nelumbo nucifera]
Length=432

 Score =   124 bits (310),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 78/150 (52%), Positives = 84/150 (56%), Gaps = 32/150 (21%)
 Frame = +3

Query  345  TIPHPLFH-----HQTMISFAPQQ------------QLQSSSGCGNDQISWQSA---GPI  464
            T P  LFH     HQ MISF PQ             + QS+         W  A    P 
Sbjct  116  TTPFTLFHQPHPQHQQMISFIPQNHGMGYYPPFFIGEGQSTEQQQQLLRYWSDALNLSPR  175

Query  465  G-------LGHDGLNEAASPLP-----KLYRGVRQRHLGRWVAEIRLPHNRARLWLGTFD  608
            G       LG  G +    P P     KLYRGVRQRH G+WVAEIRLP NR RLWLGTFD
Sbjct  176  GRTMMMNRLGQHGRSLFRPPAPPGSTTKLYRGVRQRHWGKWVAEIRLPRNRTRLWLGTFD  235

Query  609  SAEDAALAYDREAYRLRGAKARLNFPHLFL  698
            +AEDAALAYDREAY+LRG  ARLNFP LFL
Sbjct  236  TAEDAALAYDREAYKLRGDHARLNFPELFL  265



>ref|XP_010035718.1| PREDICTED: ethylene-responsive transcription factor ERF054 [Eucalyptus 
grandis]
 gb|KCW47156.1| hypothetical protein EUGRSUZ_K00961 [Eucalyptus grandis]
Length=476

 Score =   124 bits (310),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 68/127 (54%), Positives = 79/127 (62%), Gaps = 6/127 (5%)
 Frame = +3

Query  468  LGHDGLNEAASPLP----KLYRGVRQRHLGRWVAEIRLPHNRARLWLGTFDSAEDAALAY  635
            LG DG      P P    KLYRGVRQRH G+WVAEIRLP NR RLWLGTFD+AEDAALAY
Sbjct  218  LGPDGRPIFRPPQPINTTKLYRGVRQRHWGKWVAEIRLPRNRTRLWLGTFDTAEDAALAY  277

Query  636  DREAYRLRGAKARLNFPHLFLDGALHEDLETATQKEAKPKQITSGNIIESNNTKCSGISA  815
            DREA++LRG  ARLNFP LFL+    E  E+A    +        N+I     K S  ++
Sbjct  278  DREAFKLRGENARLNFPELFLNKDKAE--ESAGPSSSSSSPPKDENVITRQYMKTSPQAS  335

Query  816  HEPKTID  836
             +P   D
Sbjct  336  EDPTQQD  342



>ref|XP_003526286.2| PREDICTED: ethylene-responsive transcription factor ERF053-like 
[Glycine max]
Length=404

 Score =   123 bits (308),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 68/136 (50%), Positives = 82/136 (60%), Gaps = 12/136 (9%)
 Frame = +3

Query  471  GHDGLNEAASPL--PKLYRGVRQRHLGRWVAEIRLPHNRARLWLGTFDSAEDAALAYDRE  644
            G   L   A PL   KLYRGVRQRH G+WVAEIRLP NR RLWLGTFD+AEDAA+AYDRE
Sbjct  191  GRQMLRPQAQPLNATKLYRGVRQRHWGKWVAEIRLPRNRTRLWLGTFDTAEDAAMAYDRE  250

Query  645  AYRLRGAKARLNFPHLFLDGALHEDLETATQKEAKPKQITSGNIIESNNTKCSGISAHEP  824
            A++LRG  A+LNFP LFL+    E   T     +  +  TS     S NTK       +P
Sbjct  251  AFKLRGENAKLNFPELFLNKDKAEQSTTVAPASSSNEGSTS---TSSQNTK-------QP  300

Query  825  KTIDDDYVNHDRDVEP  872
            + I ++      D+ P
Sbjct  301  EPIPEEINTESEDIPP  316



>dbj|BAF47193.1| embryonic element binding Factor 7 [Daucus carota]
Length=320

 Score =   122 bits (305),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 74/161 (46%), Positives = 95/161 (59%), Gaps = 17/161 (11%)
 Frame = +3

Query  366  HHQTMISFAPQQQLQSSSGCGNDQISWQSAGPIGLGHDGLNEAASPLPKLYRGVRQRHLG  545
            ++ ++ S  PQ Q +SS+  G          P+ + H G     +   KLYRGVRQRH G
Sbjct  119  YYSSISSLPPQPQ-RSSNFLG--------PKPVQMKHTGSPTKPT---KLYRGVRQRHWG  166

Query  546  RWVAEIRLPHNRARLWLGTFDSAEDAALAYDREAYRLRGAKARLNFPHLFLDGALHEDLE  725
            +WVAEIRLP NR RLWLGTFD+AE+AALAYDR AY+LRG  ARLNFPHL LD  L     
Sbjct  167  KWVAEIRLPKNRTRLWLGTFDTAEEAALAYDRAAYKLRGDFARLNFPHLKLDQELSTFKP  226

Query  726  TATQKEAKPKQITSGNIIESNNTKCSGISAHEPKTIDDDYV  848
              +  +AK +      I ++ N +    SA +PKT    +V
Sbjct  227  LHSTVDAKLQA-----ICQNLNKEPKQKSAKKPKTSKPAFV  262



>ref|XP_007043551.1| AP2/ERF domain-containing transcription factor, putative [Theobroma 
cacao]
 gb|EOX99382.1| AP2/ERF domain-containing transcription factor, putative [Theobroma 
cacao]
Length=484

 Score =   123 bits (309),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 61/94 (65%), Positives = 70/94 (74%), Gaps = 9/94 (10%)
 Frame = +3

Query  468  LGHDGLNEAASPL-----PKLYRGVRQRHLGRWVAEIRLPHNRARLWLGTFDSAEDAALA  632
            LG DG      P+      KLYRGVRQRH G+WVAEIRLP NR RLWLGTFD+AEDAALA
Sbjct  226  LGQDGRQLFRPPVQPINTTKLYRGVRQRHWGKWVAEIRLPRNRTRLWLGTFDTAEDAALA  285

Query  633  YDREAYRLRGAKARLNFPHLFLDGALHEDLETAT  734
            YDREA++LRG  ARLNFP LF    L++D +T+T
Sbjct  286  YDREAFKLRGENARLNFPELF----LNKDKDTST  315



>ref|XP_010916895.1| PREDICTED: ethylene-responsive transcription factor RAP2-4-like 
[Elaeis guineensis]
Length=348

 Score =   122 bits (306),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 76/164 (46%), Positives = 94/164 (57%), Gaps = 22/164 (13%)
 Frame = +3

Query  381  ISFAPQQQLQSSSGCGNDQISWQSAGPIGLGHDGLNEAASPLP-----KLYRGVRQRHLG  545
            +S AP QQ+Q      N + S Q    +G+    +    SPLP     KLYRGVRQRH G
Sbjct  122  LSLAPIQQIQVQFQHQNPRQSQQQMSLLGMRPQPMKRTGSPLPLPKPTKLYRGVRQRHWG  181

Query  546  RWVAEIRLPHNRARLWLGTFDSAEDAALAYDREAYRLRGAKARLNFPHLFLDGA-----L  710
            +WVAEIRLP NR RLWLGTFD+A++AALAYDR AY+LRG  ARLNFP L   GA     L
Sbjct  182  KWVAEIRLPRNRTRLWLGTFDTAKEAALAYDRAAYKLRGDAARLNFPELRCSGAHLSVPL  241

Query  711  HEDLETATQ--------KEAKPKQITSGNIIESNNTK----CSG  806
            H  ++   Q         + + K +++  I E   TK    CSG
Sbjct  242  HSSVDAKLQAICQSLASSKKQGKGVSNSVIPEEVGTKGELACSG  285



>ref|XP_004305415.1| PREDICTED: ethylene-responsive transcription factor ERF054-like 
[Fragaria vesca subsp. vesca]
Length=441

 Score =   122 bits (307),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 54/70 (77%), Positives = 60/70 (86%), Gaps = 0/70 (0%)
 Frame = +3

Query  510  KLYRGVRQRHLGRWVAEIRLPHNRARLWLGTFDSAEDAALAYDREAYRLRGAKARLNFPH  689
            KLYRGVRQRH G+WVAEIRLP NR RLWLGTFD+AEDAA+AYDREA++LRG  ARLNFP 
Sbjct  208  KLYRGVRQRHWGKWVAEIRLPRNRTRLWLGTFDTAEDAAMAYDREAFKLRGENARLNFPE  267

Query  690  LFLDGALHED  719
            LFL+   H D
Sbjct  268  LFLNKEKHND  277



>gb|KHN41135.1| Ethylene-responsive transcription factor ERF054 [Glycine soja]
Length=415

 Score =   122 bits (306),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 68/136 (50%), Positives = 82/136 (60%), Gaps = 12/136 (9%)
 Frame = +3

Query  471  GHDGLNEAASPL--PKLYRGVRQRHLGRWVAEIRLPHNRARLWLGTFDSAEDAALAYDRE  644
            G   L   A PL   KLYRGVRQRH G+WVAEIRLP NR RLWLGTFD+AEDAA+AYDRE
Sbjct  191  GRQILRPQAQPLNATKLYRGVRQRHWGKWVAEIRLPRNRTRLWLGTFDTAEDAAMAYDRE  250

Query  645  AYRLRGAKARLNFPHLFLDGALHEDLETATQKEAKPKQITSGNIIESNNTKCSGISAHEP  824
            A++LRG  A+LNFP LFL+    E   T     +  +  TS     S NTK       +P
Sbjct  251  AFKLRGENAKLNFPELFLNKDKAEQSTTVAPASSSNEGSTS---TSSQNTK-------QP  300

Query  825  KTIDDDYVNHDRDVEP  872
            + I ++      D+ P
Sbjct  301  EPIPEEINTESEDIPP  316



>ref|XP_009615540.1| PREDICTED: ethylene-responsive transcription factor RAP2-4-like 
[Nicotiana tomentosiformis]
Length=355

 Score =   121 bits (304),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 63/113 (56%), Positives = 77/113 (68%), Gaps = 11/113 (10%)
 Frame = +3

Query  396  QQQLQSSSGCGNDQISWQ--------SAGPIGLGHDGLNEAASPLPKLYRGVRQRHLGRW  551
            QQQ+ SS+    D +S Q        S  P+ +   G   +    PKLYRGVRQRH G+W
Sbjct  142  QQQIMSSAATFQDSLSRQHNHHASLLSPKPVSMKQSG---SPPKPPKLYRGVRQRHWGKW  198

Query  552  VAEIRLPHNRARLWLGTFDSAEDAALAYDREAYRLRGAKARLNFPHLFLDGAL  710
            VAEIRLP NR RLWLGTFD+AE+AALAYD+ A++LRG  ARLNFPHL  +G+L
Sbjct  199  VAEIRLPKNRTRLWLGTFDTAEEAALAYDKAAFKLRGDFARLNFPHLRHNGSL  251



>dbj|BAG50057.1| transcription factor AP2-EREBP [Lotus japonicus]
Length=370

 Score =   122 bits (305),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 66/132 (50%), Positives = 81/132 (61%), Gaps = 12/132 (9%)
 Frame = +3

Query  333  ALHDTIPHPLFHHQTMISFAPQQQLQSSSGCGNDQISWQSAGPIGLGHDGLNEAASPLP-  509
             L+   P  +   QT I F  QQ   +S       +S+ +  P+ +   G      P P 
Sbjct  144  GLNQLTPSQISQIQTQIHFQSQQNTSNS-------LSFLAPKPVAMKQSG----TPPKPT  192

Query  510  KLYRGVRQRHLGRWVAEIRLPHNRARLWLGTFDSAEDAALAYDREAYRLRGAKARLNFPH  689
            KLYRGVRQRH G+WVAEIRLP NR RLWLGTF++AE+AALAYDR AYRLRG  ARLNFP+
Sbjct  193  KLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFETAEEAALAYDRAAYRLRGDFARLNFPN  252

Query  690  LFLDGALHEDLE  725
            L   G+   D +
Sbjct  253  LKDQGSCFGDYK  264



>ref|XP_004252538.1| PREDICTED: ethylene-responsive transcription factor RAP2-13-like 
[Solanum lycopersicum]
Length=337

 Score =   121 bits (303),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 58/90 (64%), Positives = 68/90 (76%), Gaps = 2/90 (2%)
 Frame = +3

Query  447  QSAGPIGLGHDGLNEAASPL--PKLYRGVRQRHLGRWVAEIRLPHNRARLWLGTFDSAED  620
            Q A  +G     + +  SP   PKLYRGVRQRH G+WVAEIRLP NR RLWLGTFD+AE+
Sbjct  130  QYASYLGPKPVSMKQTGSPPKPPKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTAEE  189

Query  621  AALAYDREAYRLRGAKARLNFPHLFLDGAL  710
            AALAYD+ AY+LRG  ARLNFPHL  +G+L
Sbjct  190  AALAYDKAAYKLRGEFARLNFPHLRHNGSL  219



>ref|XP_004487298.1| PREDICTED: ethylene-responsive transcription factor ERF053-like 
[Cicer arietinum]
Length=427

 Score =   122 bits (306),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 53/64 (83%), Positives = 58/64 (91%), Gaps = 0/64 (0%)
 Frame = +3

Query  510  KLYRGVRQRHLGRWVAEIRLPHNRARLWLGTFDSAEDAALAYDREAYRLRGAKARLNFPH  689
            KLYRGVRQRH G+WVAEIRLP NR RLWLGTFD+AEDAALAYDREA++LRG  ARLNFP 
Sbjct  216  KLYRGVRQRHWGKWVAEIRLPRNRTRLWLGTFDTAEDAALAYDREAFKLRGENARLNFPE  275

Query  690  LFLD  701
            LFL+
Sbjct  276  LFLN  279



>ref|XP_009797394.1| PREDICTED: ethylene-responsive transcription factor RAP2-4-like 
[Nicotiana sylvestris]
Length=357

 Score =   121 bits (304),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 63/113 (56%), Positives = 75/113 (66%), Gaps = 11/113 (10%)
 Frame = +3

Query  396  QQQLQSSSGCGNDQISWQ--------SAGPIGLGHDGLNEAASPLPKLYRGVRQRHLGRW  551
            QQQ+ SS+    D ++ Q        S  P+ +   G        PKLYRGVRQRH G+W
Sbjct  145  QQQIMSSAATFQDSLTHQHNHHASLLSPKPVSMKQSGWPPKP---PKLYRGVRQRHWGKW  201

Query  552  VAEIRLPHNRARLWLGTFDSAEDAALAYDREAYRLRGAKARLNFPHLFLDGAL  710
            VAEIRLP NR RLWLGTFD+AE+AALAYD+ AY+LRG  ARLNFPHL   G+L
Sbjct  202  VAEIRLPKNRTRLWLGTFDTAEEAALAYDKAAYKLRGDFARLNFPHLRHSGSL  254



>gb|AIX48026.1| dehydration responsive element-binding protein A6 [Daucus carota]
Length=330

 Score =   120 bits (302),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 72/150 (48%), Positives = 88/150 (59%), Gaps = 24/150 (16%)
 Frame = +3

Query  459  PIGLGHDGLNEAASPLPKLYRGVRQRHLGRWVAEIRLPHNRARLWLGTFDSAEDAALAYD  638
            P+ + H G   + +   KLYRGVRQRH G+WVAEIRLP NR RLWLGTFD+AE+AALAYD
Sbjct  152  PVQMKHTG---SVTKPTKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTAEEAALAYD  208

Query  639  REAYRLRGAKARLNFPHLFLD------GALHEDLETA------------TQKEAKPKQIT  764
            R AY+LRG  ARLNFPHL LD        LH  ++               QK AKPK   
Sbjct  209  RAAYKLRGDFARLNFPHLKLDQELSTFKPLHSTVDAKLQAICQNLNKEPKQKNAKPKTSK  268

Query  765  SGNI-IE--SNNTKCSGISAHEPKTIDDDY  845
               + +E  SN +  SG S+ E +    D+
Sbjct  269  PAVVKVEEASNGSDLSGGSSPESEVTFLDF  298



>gb|KDP24155.1| hypothetical protein JCGZ_25812 [Jatropha curcas]
Length=451

 Score =   122 bits (305),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 55/81 (68%), Positives = 63/81 (78%), Gaps = 0/81 (0%)
 Frame = +3

Query  510  KLYRGVRQRHLGRWVAEIRLPHNRARLWLGTFDSAEDAALAYDREAYRLRGAKARLNFPH  689
            KLYRGVRQRH G+WVAEIRLP NR RLWLGTFD+AEDAALAYDREA++LRG  ARLNFP 
Sbjct  222  KLYRGVRQRHWGKWVAEIRLPRNRTRLWLGTFDTAEDAALAYDREAFKLRGENARLNFPE  281

Query  690  LFLDGALHEDLETATQKEAKP  752
            LFL+      +  +T   + P
Sbjct  282  LFLNKNKETSITPSTSTISSP  302



>gb|AFK73558.1| AP2 transcription factor [Papaver somniferum]
Length=277

 Score =   119 bits (299),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 61/108 (56%), Positives = 74/108 (69%), Gaps = 6/108 (6%)
 Frame = +3

Query  369  HQTMISFAPQQQLQSSSGCGNDQISWQSAGPIGLGHDGLNEAASPLPKLYRGVRQRHLGR  548
            +  MIS   QQ  ++++     Q S+     I +   GL   A P  KLYRGVRQRH G+
Sbjct  10   YMNMISQQQQQHFRTTA-----QNSYICPKSIPMKAMGLPTTAKPT-KLYRGVRQRHWGK  63

Query  549  WVAEIRLPHNRARLWLGTFDSAEDAALAYDREAYRLRGAKARLNFPHL  692
            WVAEIRLP NR RLWLGTFD+AE+AA+AYD+ AY+LRG  ARLNFPHL
Sbjct  64   WVAEIRLPRNRTRLWLGTFDTAEEAAMAYDKAAYKLRGDFARLNFPHL  111



>gb|KDO48161.1| hypothetical protein CISIN_1g039976mg [Citrus sinensis]
Length=438

 Score =   122 bits (305),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 75/152 (49%), Positives = 83/152 (55%), Gaps = 34/152 (22%)
 Frame = +3

Query  348  IPHPLFH--------HQTMISFAPQQQLQSSSGCGNDQI------------SWQSA---G  458
             P P FH         Q MISF+  QQ Q       + +             W  A    
Sbjct  102  TPLPNFHPPIQPAQTQQQMISFSAHQQQQGFPFFAGESMLPHQQHQRQLLQYWSDALNLS  161

Query  459  PIG------LGHDG---LNEAASPL--PKLYRGVRQRHLGRWVAEIRLPHNRARLWLGTF  605
            P G      +G DG       A PL   KLYRGVRQRH G+WVAEIRLP NR RLWLGTF
Sbjct  162  PRGRLMMNRIGPDGRPLFRPQAQPLNTTKLYRGVRQRHWGKWVAEIRLPRNRTRLWLGTF  221

Query  606  DSAEDAALAYDREAYRLRGAKARLNFPHLFLD  701
            D AEDAALAYDREA++LRG  ARLNFP LFL+
Sbjct  222  DRAEDAALAYDREAFKLRGENARLNFPELFLN  253



>gb|ABR53728.1| DRE-binding protein DREB1 [Cymbidium insigne]
Length=309

 Score =   120 bits (301),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 53/70 (76%), Positives = 61/70 (87%), Gaps = 0/70 (0%)
 Frame = +3

Query  483  LNEAASPLPKLYRGVRQRHLGRWVAEIRLPHNRARLWLGTFDSAEDAALAYDREAYRLRG  662
             +EAA+  PKLYRGVRQRH G+WVAEIRLP NR RLWLGTFD+AE+AA+AYD+ A+RLRG
Sbjct  140  FSEAAAKPPKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTAEEAAMAYDKAAFRLRG  199

Query  663  AKARLNFPHL  692
              ARLNFPHL
Sbjct  200  EFARLNFPHL  209



>gb|KHN31960.1| Ethylene-responsive transcription factor ERF053 [Glycine soja]
Length=406

 Score =   121 bits (304),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 59/89 (66%), Positives = 66/89 (74%), Gaps = 2/89 (2%)
 Frame = +3

Query  471  GHDGLNEAASPL--PKLYRGVRQRHLGRWVAEIRLPHNRARLWLGTFDSAEDAALAYDRE  644
            G   L   A PL   KLYRGVRQRH G+WVAEIRLP NR RLWLGTFD+AEDAA+AYDRE
Sbjct  186  GRQMLRPQAQPLNATKLYRGVRQRHWGKWVAEIRLPRNRTRLWLGTFDTAEDAAMAYDRE  245

Query  645  AYRLRGAKARLNFPHLFLDGALHEDLETA  731
            A++LRG  A+LNFP LFL+    E   TA
Sbjct  246  AFKLRGENAKLNFPELFLNKDKAEQSTTA  274



>ref|XP_003540897.1| PREDICTED: ethylene-responsive transcription factor ERF053-like 
[Glycine max]
Length=406

 Score =   121 bits (304),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 59/89 (66%), Positives = 66/89 (74%), Gaps = 2/89 (2%)
 Frame = +3

Query  471  GHDGLNEAASPL--PKLYRGVRQRHLGRWVAEIRLPHNRARLWLGTFDSAEDAALAYDRE  644
            G   L   A PL   KLYRGVRQRH G+WVAEIRLP NR RLWLGTFD+AEDAA+AYDRE
Sbjct  186  GRQMLRPQAQPLNATKLYRGVRQRHWGKWVAEIRLPRNRTRLWLGTFDTAEDAAMAYDRE  245

Query  645  AYRLRGAKARLNFPHLFLDGALHEDLETA  731
            A++LRG  A+LNFP LFL+    E   TA
Sbjct  246  AFKLRGENAKLNFPELFLNKDKAEQSTTA  274



>ref|XP_008342928.1| PREDICTED: ethylene-responsive transcription factor ERF054-like 
[Malus domestica]
Length=440

 Score =   121 bits (304),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 58/83 (70%), Positives = 66/83 (80%), Gaps = 5/83 (6%)
 Frame = +3

Query  468  LGHDGLNEAASP-LP----KLYRGVRQRHLGRWVAEIRLPHNRARLWLGTFDSAEDAALA  632
            LG DG     +P +P    KLYRGVRQRH G+WVAEIRLP NR RLWLGTFD+AEDAA+A
Sbjct  181  LGPDGRPMFRAPAMPYNTTKLYRGVRQRHWGKWVAEIRLPRNRTRLWLGTFDTAEDAAMA  240

Query  633  YDREAYRLRGAKARLNFPHLFLD  701
            YDREA++LRG  ARLNFP LFL+
Sbjct  241  YDREAFKLRGENARLNFPELFLN  263



>ref|XP_008779564.1| PREDICTED: ethylene-responsive transcription factor ERF054-like 
[Phoenix dactylifera]
Length=479

 Score =   121 bits (304),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 54/63 (86%), Positives = 58/63 (92%), Gaps = 0/63 (0%)
 Frame = +3

Query  510  KLYRGVRQRHLGRWVAEIRLPHNRARLWLGTFDSAEDAALAYDREAYRLRGAKARLNFPH  689
            KLYRGVRQRH G+WVAEIRLP NR RLWLGTFD+AEDAALAYDREA+RLRG  ARLNFP+
Sbjct  227  KLYRGVRQRHWGKWVAEIRLPRNRTRLWLGTFDTAEDAALAYDREAFRLRGENARLNFPN  286

Query  690  LFL  698
            LFL
Sbjct  287  LFL  289



>ref|XP_009357820.1| PREDICTED: ethylene-responsive transcription factor ERF053-like 
[Pyrus x bretschneideri]
Length=451

 Score =   121 bits (304),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 59/83 (71%), Positives = 65/83 (78%), Gaps = 5/83 (6%)
 Frame = +3

Query  468  LGHDG---LNEAASPL--PKLYRGVRQRHLGRWVAEIRLPHNRARLWLGTFDSAEDAALA  632
            LG DG   L   A P    KLYRGVRQRH G+WVAEIRLP NR RLWLGTFD+AEDAA+A
Sbjct  187  LGPDGRPMLRPPAMPYNTTKLYRGVRQRHWGKWVAEIRLPRNRTRLWLGTFDTAEDAAMA  246

Query  633  YDREAYRLRGAKARLNFPHLFLD  701
            YDREA++LRG  ARLNFP LFL+
Sbjct  247  YDREAFKLRGENARLNFPELFLN  269



>ref|NP_001235100.1| dehydration-responsive element binding protein 5 [Glycine max]
 gb|ABQ53928.1| dehydration-responsive element binding protein 5 [Glycine max]
Length=308

 Score =   120 bits (300),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 52/64 (81%), Positives = 58/64 (91%), Gaps = 0/64 (0%)
 Frame = +3

Query  510  KLYRGVRQRHLGRWVAEIRLPHNRARLWLGTFDSAEDAALAYDREAYRLRGAKARLNFPH  689
            KLYRGVRQRH G+WVAEIRLP NR RLWLGTFD+AEDAA+AYDREA++LRG  ARLNFP 
Sbjct  108  KLYRGVRQRHWGKWVAEIRLPRNRTRLWLGTFDTAEDAAMAYDREAFKLRGENARLNFPE  167

Query  690  LFLD  701
            LFL+
Sbjct  168  LFLN  171



>ref|XP_009616719.1| PREDICTED: ethylene-responsive transcription factor RAP2-13-like 
[Nicotiana tomentosiformis]
Length=361

 Score =   120 bits (302),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 61/110 (55%), Positives = 72/110 (65%), Gaps = 12/110 (11%)
 Frame = +3

Query  510  KLYRGVRQRHLGRWVAEIRLPHNRARLWLGTFDSAEDAALAYDREAYRLRGAKARLNFPH  689
            KLYRGVRQRH G+WVAEIRLP NR RLWLGTFD+AE+AALAYD+ AY+LRG  ARLNFPH
Sbjct  166  KLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTAEEAALAYDKAAYKLRGEFARLNFPH  225

Query  690  LF------------LDGALHEDLETATQKEAKPKQITSGNIIESNNTKCS  803
            L             L  ++   L+   Q  A PK  T+ + + SNN   S
Sbjct  226  LRHQLNNELSDFKPLHSSVDAKLQAICQNLANPKNPTNSDDLSSNNNTVS  275



>gb|KEH39107.1| ethylene response factor [Medicago truncatula]
Length=426

 Score =   121 bits (303),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 53/63 (84%), Positives = 57/63 (90%), Gaps = 0/63 (0%)
 Frame = +3

Query  510  KLYRGVRQRHLGRWVAEIRLPHNRARLWLGTFDSAEDAALAYDREAYRLRGAKARLNFPH  689
            KLYRGVRQRH G+WVAEIRLP NR RLWLGTFD+AEDAALAYDREA++LRG  ARLNFP 
Sbjct  216  KLYRGVRQRHWGKWVAEIRLPRNRTRLWLGTFDTAEDAALAYDREAFKLRGENARLNFPD  275

Query  690  LFL  698
            LFL
Sbjct  276  LFL  278



>ref|XP_008381261.1| PREDICTED: ethylene-responsive transcription factor ERF054-like 
[Malus domestica]
Length=450

 Score =   121 bits (303),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 72/148 (49%), Positives = 87/148 (59%), Gaps = 33/148 (22%)
 Frame = +3

Query  510  KLYRGVRQRHLGRWVAEIRLPHNRARLWLGTFDSAEDAALAYDREAYRLRGAKARLNFPH  689
            KLYRGVRQRH G+WVAEIRLP NR RLWLGTFD+AEDAA+AYDREA++LRG  ARLNFP 
Sbjct  207  KLYRGVRQRHWGKWVAEIRLPRNRTRLWLGTFDTAEDAAMAYDREAFKLRGENARLNFPE  266

Query  690  LFLD------------------GALHEDLETATQKEAKPKQITS--GNI-----------  776
            LFL+                     HE     T+   +P++I S   NI           
Sbjct  267  LFLNKDKSDVSVSSAPSSAATSPPRHEG-SKPTRNRKQPQKIKSSASNIEAMPPPPIPHT  325

Query  777  IESNNT-KCSGISAHEPKTIDDDYVNHD  857
             E N+T   SG+ ++E K ID+  VN D
Sbjct  326  QEENSTDNYSGLESNEAKAIDEVEVNID  353



>gb|KFK40469.1| hypothetical protein AALP_AA3G376800 [Arabis alpina]
Length=315

 Score =   120 bits (300),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 55/79 (70%), Positives = 65/79 (82%), Gaps = 2/79 (3%)
 Frame = +3

Query  510  KLYRGVRQRHLGRWVAEIRLPHNRARLWLGTFDSAEDAALAYDREAYRLRGAKARLNFPH  689
            KLYRGVRQRH G+WVAEIR+P NR RLWLGTFD+AE+AA+AYDREA++LRG  ARLNFP 
Sbjct  183  KLYRGVRQRHWGKWVAEIRMPRNRTRLWLGTFDTAEEAAMAYDREAFKLRGETARLNFPE  242

Query  690  LFLDGALHEDLETATQKEA  746
            LFL+    E  ++  QKEA
Sbjct  243  LFLNK--KEATKSGEQKEA  259



>ref|XP_006298084.1| hypothetical protein CARUB_v10014129mg [Capsella rubella]
 gb|EOA30982.1| hypothetical protein CARUB_v10014129mg [Capsella rubella]
Length=336

 Score =   120 bits (300),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 73/156 (47%), Positives = 90/156 (58%), Gaps = 23/156 (15%)
 Frame = +3

Query  345  TIPHPLFHH--QTMISFAPQQQLQ--------SSSGCGNDQISWQSAGPIGL------GH  476
            + P+ L  H  Q MISF PQ Q+Q               D +    +G + +      G 
Sbjct  115  SYPNDLSGHRQQQMISFGPQLQVQPYLAQQQQQLLQYWRDILKLSPSGRMMMMNMLRQGG  174

Query  477  DGLNEAASPLP--KLYRGVRQRHLGRWVAEIRLPHNRARLWLGTFDSAEDAALAYDREAY  650
            D       P    KLYRGVRQRH G+WVAEIR+P NR RLWLGTFD+AE+AA+AYDREA+
Sbjct  175  DLTRPPMQPFSATKLYRGVRQRHWGKWVAEIRMPRNRTRLWLGTFDTAEEAAMAYDREAF  234

Query  651  RLRGAKARLNFPHLFLDGA----LHE-DLETATQKE  743
            +LRG  ARLNFP LFL+      +H+   ETAT  E
Sbjct  235  KLRGETARLNFPELFLNKQEATPVHQKQCETATASE  270



>emb|CCF23313.1| drought responsive element binding protein 5 [Glycine max]
Length=307

 Score =   119 bits (299),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 52/64 (81%), Positives = 58/64 (91%), Gaps = 0/64 (0%)
 Frame = +3

Query  510  KLYRGVRQRHLGRWVAEIRLPHNRARLWLGTFDSAEDAALAYDREAYRLRGAKARLNFPH  689
            KLYRGVRQRH G+WVAEIRLP NR RLWLGTFD+AEDAA+AYDREA++LRG  ARLNFP 
Sbjct  107  KLYRGVRQRHWGKWVAEIRLPRNRTRLWLGTFDTAEDAAMAYDREAFKLRGENARLNFPE  166

Query  690  LFLD  701
            LFL+
Sbjct  167  LFLN  170



>emb|CCF23312.1| drought responsive element binding protein 5 [Glycine max]
Length=307

 Score =   119 bits (299),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 52/64 (81%), Positives = 58/64 (91%), Gaps = 0/64 (0%)
 Frame = +3

Query  510  KLYRGVRQRHLGRWVAEIRLPHNRARLWLGTFDSAEDAALAYDREAYRLRGAKARLNFPH  689
            KLYRGVRQRH G+WVAEIRLP NR RLWLGTFD+AEDAA+AYDREA++LRG  ARLNFP 
Sbjct  107  KLYRGVRQRHWGKWVAEIRLPRNRTRLWLGTFDTAEDAAMAYDREAFKLRGENARLNFPE  166

Query  690  LFLD  701
            LFL+
Sbjct  167  LFLN  170



>ref|XP_010099577.1| Ethylene-responsive transcription factor [Morus notabilis]
 gb|AHJ25977.1| dehydration responsive element binding transcription factor [Morus 
notabilis]
 gb|EXB79643.1| Ethylene-responsive transcription factor [Morus notabilis]
Length=440

 Score =   121 bits (303),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 56/86 (65%), Positives = 64/86 (74%), Gaps = 0/86 (0%)
 Frame = +3

Query  510  KLYRGVRQRHLGRWVAEIRLPHNRARLWLGTFDSAEDAALAYDREAYRLRGAKARLNFPH  689
            KLYRGVRQRH G+WVAEIRLP NR RLWLGTFD+AEDAA+AYDREAY+LRG  ARLNFP 
Sbjct  197  KLYRGVRQRHWGKWVAEIRLPRNRTRLWLGTFDTAEDAAMAYDREAYKLRGENARLNFPE  256

Query  690  LFLDGALHEDLETATQKEAKPKQITS  767
            LFL+   + +      + A P    S
Sbjct  257  LFLNKDNNNNNNNNKSESAGPSSTVS  282



>ref|XP_007047994.1| AP2/ERF domain-containing transcription factor, putative [Theobroma 
cacao]
 gb|EOX92151.1| AP2/ERF domain-containing transcription factor, putative [Theobroma 
cacao]
Length=380

 Score =   120 bits (302),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 64/125 (51%), Positives = 81/125 (65%), Gaps = 14/125 (11%)
 Frame = +3

Query  510  KLYRGVRQRHLGRWVAEIRLPHNRARLWLGTFDSAEDAALAYDREAYRLRGAKARLNFPH  689
            KLYRGVRQRH G+WVAEIRLP NR RLWLGTFD+AE+AALAYD+ AY+LRG  ARLNFPH
Sbjct  175  KLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTAEEAALAYDKAAYKLRGEFARLNFPH  234

Query  690  LFLDGA-----------LHEDLETATQK--EAKPKQITSGNIIESNNTKCSGISAHEPKT  830
            L   GA           LH  ++   Q   ++  KQ  SG     +++K + +   +PK 
Sbjct  235  LKHQGAHVSGEFGDYKPLHSSVDAKLQAICQSLQKQGNSGKTCSVSDSKPNSVVPSQPK-  293

Query  831  IDDDY  845
            ++ DY
Sbjct  294  VEFDY  298



>gb|AIB05872.1| AP2-EREBP transcription factor, partial [Zea mays]
Length=445

 Score =   121 bits (303),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 58/80 (73%), Positives = 64/80 (80%), Gaps = 0/80 (0%)
 Frame = +3

Query  459  PIGLGHDGLNEAASPLPKLYRGVRQRHLGRWVAEIRLPHNRARLWLGTFDSAEDAALAYD  638
            P  L    L  A+S  PKLYRGVRQRH G+WVAEIRLP NR RLWLGTFD+AEDAA+AYD
Sbjct  194  PARLYQQLLLRASSGPPKLYRGVRQRHWGKWVAEIRLPRNRTRLWLGTFDTAEDAAMAYD  253

Query  639  REAYRLRGAKARLNFPHLFL  698
            REA++LRG  ARLNFP LFL
Sbjct  254  REAFKLRGDNARLNFPDLFL  273



>ref|XP_008678858.1| PREDICTED: ethylene-responsive transcription factor ERF053-like 
[Zea mays]
 ref|XP_008678859.1| PREDICTED: ethylene-responsive transcription factor ERF053-like 
[Zea mays]
 ref|XP_008678860.1| PREDICTED: ethylene-responsive transcription factor ERF053-like 
[Zea mays]
 ref|XP_008678861.1| PREDICTED: ethylene-responsive transcription factor ERF053-like 
[Zea mays]
 gb|AFW63146.1| putative AP2/EREBP transcription factor superfamily protein [Zea 
mays]
Length=445

 Score =   121 bits (303),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 58/80 (73%), Positives = 64/80 (80%), Gaps = 0/80 (0%)
 Frame = +3

Query  459  PIGLGHDGLNEAASPLPKLYRGVRQRHLGRWVAEIRLPHNRARLWLGTFDSAEDAALAYD  638
            P  L    L  A+S  PKLYRGVRQRH G+WVAEIRLP NR RLWLGTFD+AEDAA+AYD
Sbjct  194  PARLYQQLLLRASSGPPKLYRGVRQRHWGKWVAEIRLPRNRTRLWLGTFDTAEDAAMAYD  253

Query  639  REAYRLRGAKARLNFPHLFL  698
            REA++LRG  ARLNFP LFL
Sbjct  254  REAFKLRGDNARLNFPDLFL  273



>ref|XP_004516587.1| PREDICTED: uncharacterized protein LOC101497734 [Cicer arietinum]
Length=506

 Score =   121 bits (303),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 58/112 (52%), Positives = 81/112 (72%), Gaps = 5/112 (4%)
 Frame = +3

Query  510  KLYRGVRQRHLGRWVAEIRLPHNRARLWLGTFDSAEDAALAYDREAYRLRGAKARLNFPH  689
            KLYRGVRQRH G+WVAEIRLP NR RLWLGTFD+AEDAA+AYDREA++ RG  A+LNFP 
Sbjct  317  KLYRGVRQRHWGKWVAEIRLPRNRTRLWLGTFDTAEDAAMAYDREAFKFRGENAKLNFPE  376

Query  690  LFLDGALHEDLETATQKEAKPKQITSGNIIESNNTKCSGISAHEPKTIDDDY  845
            LFL+    +D  T++   +   QI+S ++    ++  S  + ++PK + +++
Sbjct  377  LFLN----KDKPTSSS-SSTIVQISSASLPHEGSSSISCQNTNQPKLVSEEH  423



>ref|XP_011095770.1| PREDICTED: ethylene-responsive transcription factor ERF056-like 
[Sesamum indicum]
Length=350

 Score =   120 bits (300),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 59/97 (61%), Positives = 67/97 (69%), Gaps = 4/97 (4%)
 Frame = +3

Query  507  PKLYRGVRQRHLGRWVAEIRLPHNRARLWLGTFDSAEDAALAYDREAYRLRGAKARLNFP  686
            PKLYRGVRQRH G+WVAEIRLP  R RLWLGTF+SAE AALAYDR+A+RLRG  ARLNFP
Sbjct  124  PKLYRGVRQRHWGKWVAEIRLPRKRTRLWLGTFESAEKAALAYDRQAFRLRGENARLNFP  183

Query  687  HLFLDGALHED----LETATQKEAKPKQITSGNIIES  785
            HLF+      D       +      P +I SG  +ES
Sbjct  184  HLFIPAKRPVDQTQLAPVSNTYVISPTRIFSGKALES  220



>ref|XP_010918447.1| PREDICTED: ethylene-responsive transcription factor RAP2-4-like 
[Elaeis guineensis]
Length=480

 Score =   121 bits (303),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 56/69 (81%), Positives = 61/69 (88%), Gaps = 0/69 (0%)
 Frame = +3

Query  492  AASPLPKLYRGVRQRHLGRWVAEIRLPHNRARLWLGTFDSAEDAALAYDREAYRLRGAKA  671
            AAS   KLYRGVRQRH G+WVAEIRLP NR RLWLGTFD+AEDAALAYDREA++LRG  A
Sbjct  222  AASTPTKLYRGVRQRHWGKWVAEIRLPRNRTRLWLGTFDTAEDAALAYDREAFKLRGENA  281

Query  672  RLNFPHLFL  698
            RLNFP+LFL
Sbjct  282  RLNFPNLFL  290



>ref|XP_008244505.1| PREDICTED: ethylene-responsive transcription factor ERF053-like 
[Prunus mume]
Length=466

 Score =   120 bits (302),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 52/64 (81%), Positives = 58/64 (91%), Gaps = 0/64 (0%)
 Frame = +3

Query  510  KLYRGVRQRHLGRWVAEIRLPHNRARLWLGTFDSAEDAALAYDREAYRLRGAKARLNFPH  689
            KLYRGVRQRH G+WVAEIRLP NR RLWLGTFD+AEDAA+AYDREA++LRG  ARLNFP 
Sbjct  223  KLYRGVRQRHWGKWVAEIRLPRNRTRLWLGTFDTAEDAAMAYDREAFKLRGENARLNFPE  282

Query  690  LFLD  701
            LFL+
Sbjct  283  LFLN  286



>gb|ABR16078.1| unknown [Picea sitchensis]
Length=479

 Score =   121 bits (303),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 57/79 (72%), Positives = 64/79 (81%), Gaps = 0/79 (0%)
 Frame = +3

Query  465  GLGHDGLNEAASPLPKLYRGVRQRHLGRWVAEIRLPHNRARLWLGTFDSAEDAALAYDRE  644
            G  HD    A +   KLYRGVRQRH G+WVAEIRLP +R RLWLGTFD+AEDAALAYD+E
Sbjct  219  GKHHDRRGFALARPMKLYRGVRQRHWGKWVAEIRLPRDRTRLWLGTFDTAEDAALAYDQE  278

Query  645  AYRLRGAKARLNFPHLFLD  701
            AY+LRG  ARLNFPHLFL+
Sbjct  279  AYKLRGENARLNFPHLFLN  297



>ref|XP_007216848.1| hypothetical protein PRUPE_ppa021711mg [Prunus persica]
 gb|EMJ18047.1| hypothetical protein PRUPE_ppa021711mg [Prunus persica]
Length=461

 Score =   120 bits (302),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 52/64 (81%), Positives = 58/64 (91%), Gaps = 0/64 (0%)
 Frame = +3

Query  510  KLYRGVRQRHLGRWVAEIRLPHNRARLWLGTFDSAEDAALAYDREAYRLRGAKARLNFPH  689
            KLYRGVRQRH G+WVAEIRLP NR RLWLGTFD+AEDAA+AYDREA++LRG  ARLNFP 
Sbjct  216  KLYRGVRQRHWGKWVAEIRLPRNRTRLWLGTFDTAEDAAMAYDREAFKLRGENARLNFPE  275

Query  690  LFLD  701
            LFL+
Sbjct  276  LFLN  279



>ref|XP_007132714.1| hypothetical protein PHAVU_011G118600g [Phaseolus vulgaris]
 gb|ESW04708.1| hypothetical protein PHAVU_011G118600g [Phaseolus vulgaris]
Length=416

 Score =   120 bits (301),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 57/82 (70%), Positives = 65/82 (79%), Gaps = 5/82 (6%)
 Frame = +3

Query  471  GHDG---LNEAASPL--PKLYRGVRQRHLGRWVAEIRLPHNRARLWLGTFDSAEDAALAY  635
            GH+G   L     PL   KLYRGVRQRH G+WVAEIRLP NR RLWLGTFD+AEDAA+AY
Sbjct  191  GHEGRPMLRPQGQPLNATKLYRGVRQRHWGKWVAEIRLPRNRTRLWLGTFDTAEDAAMAY  250

Query  636  DREAYRLRGAKARLNFPHLFLD  701
            DREA++LRG  A+LNFP LFL+
Sbjct  251  DREAFKLRGENAKLNFPELFLN  272



>ref|XP_004288218.1| PREDICTED: ethylene-responsive transcription factor RAP2-4-like 
[Fragaria vesca subsp. vesca]
Length=356

 Score =   119 bits (299),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 72/158 (46%), Positives = 96/158 (61%), Gaps = 22/158 (14%)
 Frame = +3

Query  483  LNEAASPLP-KLYRGVRQRHLGRWVAEIRLPHNRARLWLGTFDSAEDAALAYDREAYRLR  659
            + ++++P P KLYRGVRQRH G+WVAEIRLP NR RLWLGTF++AE+AALAYD+ AY+LR
Sbjct  146  MKQSSTPKPTKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFETAEEAALAYDKAAYKLR  205

Query  660  GAKARLNFPHLF---------------LDGALHEDLETATQKEA--KPKQITSGNIIESN  788
            G  ARLNFPHL                L  A+   LE   +  A   PKQ  +  +    
Sbjct  206  GDFARLNFPHLKHQGAHISGDFGNYKPLHAAVDAKLEAICESLAVNAPKQTKTEELCSET  265

Query  789  NTKCSGISAHEPKTIDDDYVNHDR-DVEPEWAGDELES  899
             TK   ISA   K + DD ++ +R +++ EW   +LE+
Sbjct  266  ETK-PVISAQ--KMVFDDALSTERTELKTEWDFPKLEA  300



>ref|XP_009342655.1| PREDICTED: ethylene-responsive transcription factor ERF054-like 
[Pyrus x bretschneideri]
Length=444

 Score =   120 bits (301),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 58/83 (70%), Positives = 66/83 (80%), Gaps = 5/83 (6%)
 Frame = +3

Query  468  LGHDGLNEAASP-LP----KLYRGVRQRHLGRWVAEIRLPHNRARLWLGTFDSAEDAALA  632
            LG DG     +P +P    KLYRGVRQRH G+WVAEIRLP NR RLWLGTFD+AEDAA+A
Sbjct  183  LGPDGRPMFRAPAMPYNTTKLYRGVRQRHWGKWVAEIRLPRNRTRLWLGTFDTAEDAAMA  242

Query  633  YDREAYRLRGAKARLNFPHLFLD  701
            YDREA++LRG  ARLNFP LFL+
Sbjct  243  YDREAFKLRGENARLNFPDLFLN  265



>ref|XP_006447343.1| hypothetical protein CICLE_v10015144mg [Citrus clementina]
 ref|XP_006491642.1| PREDICTED: ethylene-responsive transcription factor ERF053-like 
[Citrus sinensis]
 gb|ESR60583.1| hypothetical protein CICLE_v10015144mg [Citrus clementina]
Length=466

 Score =   120 bits (301),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 53/64 (83%), Positives = 57/64 (89%), Gaps = 0/64 (0%)
 Frame = +3

Query  510  KLYRGVRQRHLGRWVAEIRLPHNRARLWLGTFDSAEDAALAYDREAYRLRGAKARLNFPH  689
            KLYRGVRQRH G+WVAEIRLP NR RLWLGTFD AEDAALAYDREA++LRG  ARLNFP 
Sbjct  218  KLYRGVRQRHWGKWVAEIRLPRNRTRLWLGTFDRAEDAALAYDREAFKLRGENARLNFPE  277

Query  690  LFLD  701
            LFL+
Sbjct  278  LFLN  281



>ref|XP_009413180.1| PREDICTED: ethylene-responsive transcription factor ERF053-like 
[Musa acuminata subsp. malaccensis]
Length=299

 Score =   119 bits (297),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 51/63 (81%), Positives = 59/63 (94%), Gaps = 0/63 (0%)
 Frame = +3

Query  510  KLYRGVRQRHLGRWVAEIRLPHNRARLWLGTFDSAEDAALAYDREAYRLRGAKARLNFPH  689
            KLYRGVRQRH G+WVAEIRLP NR+RLWLGTF++AE+AALAYDREA++LRG  A+LNFPH
Sbjct  66   KLYRGVRQRHWGKWVAEIRLPRNRSRLWLGTFNTAEEAALAYDREAFKLRGENAKLNFPH  125

Query  690  LFL  698
            LFL
Sbjct  126  LFL  128



>ref|XP_002454234.1| hypothetical protein SORBIDRAFT_04g027180 [Sorghum bicolor]
 gb|EES07210.1| hypothetical protein SORBIDRAFT_04g027180 [Sorghum bicolor]
Length=468

 Score =   120 bits (301),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 57/82 (70%), Positives = 64/82 (78%), Gaps = 0/82 (0%)
 Frame = +3

Query  453  AGPIGLGHDGLNEAASPLPKLYRGVRQRHLGRWVAEIRLPHNRARLWLGTFDSAEDAALA  632
            A P  L    L  A+ P  KLYRGVRQRH G+WVAEIRLP NR RLWLGTFD+AEDAA+A
Sbjct  206  AVPPALYQQLLMRASGPPTKLYRGVRQRHWGKWVAEIRLPRNRTRLWLGTFDTAEDAAMA  265

Query  633  YDREAYRLRGAKARLNFPHLFL  698
            YDREA++LRG  A+LNFP LFL
Sbjct  266  YDREAFKLRGENAKLNFPDLFL  287



>gb|KHN27877.1| Ethylene-responsive transcription factor ERF053 [Glycine soja]
Length=427

 Score =   120 bits (300),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 52/64 (81%), Positives = 58/64 (91%), Gaps = 0/64 (0%)
 Frame = +3

Query  510  KLYRGVRQRHLGRWVAEIRLPHNRARLWLGTFDSAEDAALAYDREAYRLRGAKARLNFPH  689
            KLYRGVRQRH G+WVAEIRLP NR RLWLGTFD+AEDAA+AYDREA++LRG  ARLNFP 
Sbjct  227  KLYRGVRQRHWGKWVAEIRLPRNRTRLWLGTFDTAEDAAMAYDREAFKLRGENARLNFPE  286

Query  690  LFLD  701
            LFL+
Sbjct  287  LFLN  290



>ref|XP_004515941.1| PREDICTED: ethylene-responsive transcription factor ERF054-like, 
partial [Cicer arietinum]
Length=233

 Score =   117 bits (292),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 55/112 (49%), Positives = 77/112 (69%), Gaps = 5/112 (4%)
 Frame = +3

Query  510  KLYRGVRQRHLGRWVAEIRLPHNRARLWLGTFDSAEDAALAYDREAYRLRGAKARLNFPH  689
            KLYRGVRQRH G+WVAEIRLP  R RLWLGTFD+AEDA +AYDREA++ RG   +LNFP 
Sbjct  97   KLYRGVRQRHWGKWVAEIRLPRKRTRLWLGTFDTAEDAGMAYDREAFKFRGENPKLNFPE  156

Query  690  LFLDGALHEDLETATQKEAKPKQITSGNIIESNNTKCSGISAHEPKTIDDDY  845
            LFL+    +D  T++       QI+S ++    ++  S  + ++PK + +++
Sbjct  157  LFLN----KDKPTSSSSSTI-VQISSASLPHEGSSSISCQNTNQPKLVSEEH  203



>ref|XP_002319909.2| hypothetical protein POPTR_0013s13920g [Populus trichocarpa]
 gb|EEE95832.2| hypothetical protein POPTR_0013s13920g [Populus trichocarpa]
Length=469

 Score =   120 bits (301),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 53/64 (83%), Positives = 58/64 (91%), Gaps = 0/64 (0%)
 Frame = +3

Query  510  KLYRGVRQRHLGRWVAEIRLPHNRARLWLGTFDSAEDAALAYDREAYRLRGAKARLNFPH  689
            KLYRGVRQRH G+WVAEIRLP NR RLWLGTFD+AEDAALAYDREA++LRG  ARLNFP 
Sbjct  230  KLYRGVRQRHWGKWVAEIRLPRNRTRLWLGTFDTAEDAALAYDREAFKLRGENARLNFPE  289

Query  690  LFLD  701
            LFL+
Sbjct  290  LFLN  293



>gb|ABQ62985.1| RAP2-like protein [Populus trichocarpa]
Length=469

 Score =   120 bits (301),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 53/64 (83%), Positives = 58/64 (91%), Gaps = 0/64 (0%)
 Frame = +3

Query  510  KLYRGVRQRHLGRWVAEIRLPHNRARLWLGTFDSAEDAALAYDREAYRLRGAKARLNFPH  689
            KLYRGVRQRH G+WVAEIRLP NR RLWLGTFD+AEDAALAYDREA++LRG  ARLNFP 
Sbjct  230  KLYRGVRQRHWGKWVAEIRLPRNRTRLWLGTFDTAEDAALAYDREAFKLRGENARLNFPE  289

Query  690  LFLD  701
            LFL+
Sbjct  290  LFLN  293



>gb|ABK24284.1| unknown [Picea sitchensis]
Length=420

 Score =   120 bits (300),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 56/80 (70%), Positives = 65/80 (81%), Gaps = 4/80 (5%)
 Frame = +3

Query  453  AGPIGLGHDGLNEAASPLPKLYRGVRQRHLGRWVAEIRLPHNRARLWLGTFDSAEDAALA  632
            A P+ L   GL++AA    KLYRGVRQRH G+WVAEIRLP +R RLWLGTFD+AE+AA+A
Sbjct  189  AQPMKLHSSGLSKAA----KLYRGVRQRHWGKWVAEIRLPRDRTRLWLGTFDTAEEAAMA  244

Query  633  YDREAYRLRGAKARLNFPHL  692
            YD+ AYRLRG  ARLNFPHL
Sbjct  245  YDKAAYRLRGEYARLNFPHL  264



>gb|ABR17765.1| unknown [Picea sitchensis]
Length=415

 Score =   119 bits (299),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 56/80 (70%), Positives = 65/80 (81%), Gaps = 4/80 (5%)
 Frame = +3

Query  453  AGPIGLGHDGLNEAASPLPKLYRGVRQRHLGRWVAEIRLPHNRARLWLGTFDSAEDAALA  632
            A P+ L   GL++AA    KLYRGVRQRH G+WVAEIRLP +R RLWLGTFD+AE+AA+A
Sbjct  189  AQPMKLHSSGLSKAA----KLYRGVRQRHWGKWVAEIRLPRDRTRLWLGTFDTAEEAAMA  244

Query  633  YDREAYRLRGAKARLNFPHL  692
            YD+ AYRLRG  ARLNFPHL
Sbjct  245  YDKAAYRLRGEYARLNFPHL  264



>ref|XP_011039744.1| PREDICTED: ethylene-responsive transcription factor ERF054-like 
[Populus euphratica]
Length=463

 Score =   120 bits (300),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 53/64 (83%), Positives = 58/64 (91%), Gaps = 0/64 (0%)
 Frame = +3

Query  510  KLYRGVRQRHLGRWVAEIRLPHNRARLWLGTFDSAEDAALAYDREAYRLRGAKARLNFPH  689
            KLYRGVRQRH G+WVAEIRLP NR RLWLGTFD+AEDAALAYDREA++LRG  ARLNFP 
Sbjct  228  KLYRGVRQRHWGKWVAEIRLPRNRTRLWLGTFDNAEDAALAYDREAFKLRGENARLNFPE  287

Query  690  LFLD  701
            LFL+
Sbjct  288  LFLN  291



>gb|AAT39542.1| transcription factor DRE-binding factor 2 [Gossypium hirsutum]
 gb|AAZ41376.1| dehydration responsive element-binding protein 2 [Gossypium hirsutum]
Length=350

 Score =   119 bits (297),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 63/112 (56%), Positives = 75/112 (67%), Gaps = 5/112 (4%)
 Frame = +3

Query  363  FH-HQTMISFAPQQ-QLQSSSGCGNDQISWQSAGPIGLGHDGLNEAASPLPKLYRGVRQR  536
            FH H    S+  Q  Q  + S   N  +S+    P+ + H G   A S   KLYRGVRQR
Sbjct  111  FHLHNNQPSYLCQSPQPNTISANSNPMVSFLCPKPVPMKHVG---APSKPTKLYRGVRQR  167

Query  537  HLGRWVAEIRLPHNRARLWLGTFDSAEDAALAYDREAYRLRGAKARLNFPHL  692
            H G+WVAEIRLP NR RLWLGTFD+AE+AALAYD+ AY+LRG  ARLNFP+L
Sbjct  168  HWGKWVAEIRLPRNRTRLWLGTFDTAEEAALAYDKAAYKLRGDFARLNFPNL  219



>ref|NP_001173092.1| Os02g0638650 [Oryza sativa Japonica Group]
 dbj|BAD25342.1| AP2 domain-containing transcription factor-like [Oryza sativa 
Japonica Group]
 dbj|BAD25897.1| AP2 domain-containing transcription factor-like [Oryza sativa 
Japonica Group]
 dbj|BAH91821.1| Os02g0638650 [Oryza sativa Japonica Group]
Length=473

 Score =   120 bits (300),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 53/64 (83%), Positives = 58/64 (91%), Gaps = 0/64 (0%)
 Frame = +3

Query  507  PKLYRGVRQRHLGRWVAEIRLPHNRARLWLGTFDSAEDAALAYDREAYRLRGAKARLNFP  686
            PKLYRGVRQRH G+WVAEIRLP NR RLWLGTFD+AEDAA+AYDREA++LRG  ARLNFP
Sbjct  223  PKLYRGVRQRHWGKWVAEIRLPRNRTRLWLGTFDTAEDAAMAYDREAFKLRGENARLNFP  282

Query  687  HLFL  698
             LFL
Sbjct  283  DLFL  286



>ref|XP_002267468.1| PREDICTED: ethylene-responsive transcription factor ERF054-like 
[Vitis vinifera]
Length=465

 Score =   119 bits (299),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 53/64 (83%), Positives = 58/64 (91%), Gaps = 0/64 (0%)
 Frame = +3

Query  510  KLYRGVRQRHLGRWVAEIRLPHNRARLWLGTFDSAEDAALAYDREAYRLRGAKARLNFPH  689
            KLYRGVRQRH G+WVAEIRLP NR RLWLGTFD+AEDAALAYDREA++LRG  ARLNFP 
Sbjct  217  KLYRGVRQRHWGKWVAEIRLPRNRTRLWLGTFDTAEDAALAYDREAFKLRGENARLNFPE  276

Query  690  LFLD  701
            LFL+
Sbjct  277  LFLN  280



>ref|XP_009397949.1| PREDICTED: ethylene-responsive transcription factor ERF054-like 
[Musa acuminata subsp. malaccensis]
Length=427

 Score =   119 bits (299),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 53/63 (84%), Positives = 58/63 (92%), Gaps = 0/63 (0%)
 Frame = +3

Query  510  KLYRGVRQRHLGRWVAEIRLPHNRARLWLGTFDSAEDAALAYDREAYRLRGAKARLNFPH  689
            KLYRGVRQRH G+WVAEIRLP NR RLWLGTFD+AEDAALAYDREA++LRG  ARLNFP+
Sbjct  203  KLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTAEDAALAYDREAFKLRGDNARLNFPN  262

Query  690  LFL  698
            LFL
Sbjct  263  LFL  265



>ref|XP_010555135.1| PREDICTED: ethylene-responsive transcription factor ERF054 [Tarenaya 
hassleriana]
Length=419

 Score =   119 bits (299),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 55/83 (66%), Positives = 63/83 (76%), Gaps = 0/83 (0%)
 Frame = +3

Query  510  KLYRGVRQRHLGRWVAEIRLPHNRARLWLGTFDSAEDAALAYDREAYRLRGAKARLNFPH  689
            KLYRGVRQRH G+WVAEIRLP NR RLWLGTFD+AE AALAYDREA++LRG  ARLNFP 
Sbjct  223  KLYRGVRQRHWGKWVAEIRLPRNRTRLWLGTFDTAEAAALAYDREAFKLRGENARLNFPE  282

Query  690  LFLDGALHEDLETATQKEAKPKQ  758
            LF++    E   T     ++ KQ
Sbjct  283  LFINNTDKEINATTASNSSREKQ  305



>ref|XP_008448413.1| PREDICTED: ethylene-responsive transcription factor ERF054-like 
[Cucumis melo]
Length=391

 Score =   119 bits (298),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 53/64 (83%), Positives = 58/64 (91%), Gaps = 0/64 (0%)
 Frame = +3

Query  510  KLYRGVRQRHLGRWVAEIRLPHNRARLWLGTFDSAEDAALAYDREAYRLRGAKARLNFPH  689
            KLYRGVRQRH G+WVAEIRLP NR RLWLGTFD+AEDAALAYDREA++LRG  ARLNFP 
Sbjct  187  KLYRGVRQRHWGKWVAEIRLPRNRNRLWLGTFDTAEDAALAYDREAFKLRGENARLNFPE  246

Query  690  LFLD  701
            LFL+
Sbjct  247  LFLN  250



>ref|XP_011098323.1| PREDICTED: ethylene-responsive transcription factor RAP2-13-like 
[Sesamum indicum]
Length=343

 Score =   119 bits (297),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 72/155 (46%), Positives = 91/155 (59%), Gaps = 27/155 (17%)
 Frame = +3

Query  402  QLQSSSGCGNDQISWQSAG---------PIGLGHDGLNEAASPLP-KLYRGVRQRHLGRW  551
            Q+Q+ SG  + Q   Q+ G         P+ +   G    A P P KLYRGVRQRH G+W
Sbjct  135  QVQTGSGSFHVQYPLQATGTTAQFLGPRPVSMKQVG----APPKPAKLYRGVRQRHWGKW  190

Query  552  VAEIRLPHNRARLWLGTFDSAEDAALAYDREAYRLRGAKARLNFPHLFLDGA--------  707
            VAEIRLP NR RLWLGTFD+AE+AALAYD+ AY+LRG  ARLNFPHL  +G+        
Sbjct  191  VAEIRLPKNRTRLWLGTFDTAEEAALAYDKAAYQLRGDSARLNFPHLRHNGSHIGGEFGE  250

Query  708  ---LHEDLETATQKEAKPKQITSGNIIESNNTKCS  803
               LH  ++   Q  A  + +  G  I++N  K S
Sbjct  251  YQPLHASVDAKLQ--AICQTLAEGKSIDANRCKNS  283



>gb|AFP90334.1| transcription factor 2 [Pinus armandii]
Length=328

 Score =   118 bits (296),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 56/80 (70%), Positives = 64/80 (80%), Gaps = 4/80 (5%)
 Frame = +3

Query  453  AGPIGLGHDGLNEAASPLPKLYRGVRQRHLGRWVAEIRLPHNRARLWLGTFDSAEDAALA  632
            A P+ L   GL++ A    KLYRGVRQRH G+WVAEIRLP NR RLWLGTFD+AE+AA+A
Sbjct  100  AQPMKLHGSGLSKPA----KLYRGVRQRHWGKWVAEIRLPRNRTRLWLGTFDTAEEAAMA  155

Query  633  YDREAYRLRGAKARLNFPHL  692
            YD+ AYRLRG  ARLNFPHL
Sbjct  156  YDKAAYRLRGDYARLNFPHL  175



>ref|XP_003638785.1| Ethylene-responsive transcription factor RAP2-4 [Medicago truncatula]
 gb|AEX93413.1| putative AP2/EREBP transcription factor [Medicago truncatula]
 gb|KEH34901.1| ethylene response factor [Medicago truncatula]
Length=340

 Score =   118 bits (296),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 57/96 (59%), Positives = 72/96 (75%), Gaps = 1/96 (1%)
 Frame = +3

Query  423  CGNDQISWQSAGPIGLGHDGLNEAASPLPKLYRGVRQRHLGRWVAEIRLPHNRARLWLGT  602
            C ++ +S+ S   I + H G +  + P  KLYRGVRQRH G+WVAEIRLP NR RLWLGT
Sbjct  120  CLSNTLSFLSPKSIPMKHVGGSSVSKPT-KLYRGVRQRHWGKWVAEIRLPKNRTRLWLGT  178

Query  603  FDSAEDAALAYDREAYRLRGAKARLNFPHLFLDGAL  710
            FD+AE+AALAYD+ AY+LRG  ARLNFP+L   G++
Sbjct  179  FDTAEEAALAYDKAAYKLRGDFARLNFPNLKHQGSI  214



>gb|EEC73669.1| hypothetical protein OsI_08216 [Oryza sativa Indica Group]
Length=471

 Score =   119 bits (299),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 53/64 (83%), Positives = 58/64 (91%), Gaps = 0/64 (0%)
 Frame = +3

Query  507  PKLYRGVRQRHLGRWVAEIRLPHNRARLWLGTFDSAEDAALAYDREAYRLRGAKARLNFP  686
            PKLYRGVRQRH G+WVAEIRLP NR RLWLGTFD+AEDAA+AYDREA++LRG  ARLNFP
Sbjct  221  PKLYRGVRQRHWGKWVAEIRLPRNRTRLWLGTFDTAEDAAMAYDREAFKLRGENARLNFP  280

Query  687  HLFL  698
             LFL
Sbjct  281  DLFL  284



>gb|ADE41121.1| AP2 domain class transcription factor [Malus domestica]
Length=268

 Score =   117 bits (293),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 60/102 (59%), Positives = 74/102 (73%), Gaps = 2/102 (2%)
 Frame = +3

Query  408  QSSSGCGNDQISWQSAGPIGLGHDGLNEAASPLP-KLYRGVRQRHLGRWVAEIRLPHNRA  584
            Q  S   +  +S+ S  PI +   G +  + P P KLYRGVRQRH G+WVAEIRLP NR 
Sbjct  52   QQVSQTTSRTLSFLSPKPIPMKQVG-SAGSPPKPTKLYRGVRQRHWGKWVAEIRLPKNRT  110

Query  585  RLWLGTFDSAEDAALAYDREAYRLRGAKARLNFPHLFLDGAL  710
            RLWLGTFD+AE+AALAYD+ AY+LRG  ARLNFPHL  +G++
Sbjct  111  RLWLGTFDTAEEAALAYDKAAYKLRGDFARLNFPHLRHNGSV  152



>ref|XP_006371578.1| hypothetical protein POPTR_0019s13330g [Populus trichocarpa]
 gb|ERP49375.1| hypothetical protein POPTR_0019s13330g [Populus trichocarpa]
Length=464

 Score =   119 bits (299),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 52/64 (81%), Positives = 58/64 (91%), Gaps = 0/64 (0%)
 Frame = +3

Query  510  KLYRGVRQRHLGRWVAEIRLPHNRARLWLGTFDSAEDAALAYDREAYRLRGAKARLNFPH  689
            KLYRGVRQRH G+WVAEIRLP NR RLWLGTFD+AEDAALAYDREA++LRG  A+LNFP 
Sbjct  230  KLYRGVRQRHWGKWVAEIRLPRNRTRLWLGTFDNAEDAALAYDREAFKLRGENAKLNFPE  289

Query  690  LFLD  701
            LFL+
Sbjct  290  LFLN  293



>ref|XP_002884229.1| hypothetical protein ARALYDRAFT_900468 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60488.1| hypothetical protein ARALYDRAFT_900468 [Arabidopsis lyrata subsp. 
lyrata]
Length=327

 Score =   118 bits (295),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 71/149 (48%), Positives = 86/149 (58%), Gaps = 23/149 (15%)
 Frame = +3

Query  366  HHQTMISFAPQ--------QQLQSSSGCGNDQISWQSAGPIGLGHDGLNEAASPLP----  509
              Q MISF PQ        QQ Q       D +    +G + + +    E+  PL     
Sbjct  110  RQQQMISFGPQLQVQPYLVQQQQHMLQYWRDILKLSPSGRMMMMNMLRQESDLPLTRPPI  169

Query  510  ------KLYRGVRQRHLGRWVAEIRLPHNRARLWLGTFDSAEDAALAYDREAYRLRGAKA  671
                  KLYRGVRQRH G+WVAEIR P NR RLWLGTFD+AE+AA+AYDREA++LRG  A
Sbjct  170  QPFSATKLYRGVRQRHWGKWVAEIRKPRNRTRLWLGTFDTAEEAAMAYDREAFKLRGETA  229

Query  672  RLNFPHLFLDGA----LHE-DLETATQKE  743
            RLNFP LFL+      +H+   ETAT  E
Sbjct  230  RLNFPELFLNKQESTPVHQKQCETATTSE  258



>ref|XP_009400292.1| PREDICTED: ethylene-responsive transcription factor ERF053-like 
[Musa acuminata subsp. malaccensis]
Length=370

 Score =   119 bits (297),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 54/67 (81%), Positives = 60/67 (90%), Gaps = 1/67 (1%)
 Frame = +3

Query  501  PLP-KLYRGVRQRHLGRWVAEIRLPHNRARLWLGTFDSAEDAALAYDREAYRLRGAKARL  677
            P+P KLYRGVRQRH G+WVAEIRLP NR RLWLGTFD+AE AALAYDREA++LRG  ARL
Sbjct  168  PVPTKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTAEAAALAYDREAFKLRGENARL  227

Query  678  NFPHLFL  698
            NFP+LFL
Sbjct  228  NFPNLFL  234



>emb|CDP14752.1| unnamed protein product [Coffea canephora]
Length=493

 Score =   119 bits (299),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 53/63 (84%), Positives = 57/63 (90%), Gaps = 0/63 (0%)
 Frame = +3

Query  510  KLYRGVRQRHLGRWVAEIRLPHNRARLWLGTFDSAEDAALAYDREAYRLRGAKARLNFPH  689
            KLYRGVRQRH G+WVAEIRLP NR RLWLGTFD+AEDAALAYDREA++LRG  ARLNFP 
Sbjct  248  KLYRGVRQRHWGKWVAEIRLPRNRTRLWLGTFDTAEDAALAYDREAFKLRGENARLNFPE  307

Query  690  LFL  698
            LFL
Sbjct  308  LFL  310



>ref|XP_011045500.1| PREDICTED: ethylene-responsive transcription factor ERF053-like 
[Populus euphratica]
 ref|XP_011045501.1| PREDICTED: ethylene-responsive transcription factor ERF053-like 
[Populus euphratica]
Length=469

 Score =   119 bits (298),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 53/64 (83%), Positives = 58/64 (91%), Gaps = 0/64 (0%)
 Frame = +3

Query  510  KLYRGVRQRHLGRWVAEIRLPHNRARLWLGTFDSAEDAALAYDREAYRLRGAKARLNFPH  689
            KLYRGVRQRH G+WVAEIRLP NR RLWLGTFD+AEDAALAYDREA++LRG  ARLNFP 
Sbjct  231  KLYRGVRQRHWGKWVAEIRLPRNRTRLWLGTFDNAEDAALAYDREAFKLRGENARLNFPE  290

Query  690  LFLD  701
            LFL+
Sbjct  291  LFLN  294



>ref|XP_009373164.1| PREDICTED: LOW QUALITY PROTEIN: ethylene-responsive transcription 
factor RAP2-4-like [Pyrus x bretschneideri]
Length=356

 Score =   118 bits (296),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 58/92 (63%), Positives = 71/92 (77%), Gaps = 2/92 (2%)
 Frame = +3

Query  438  ISWQSAGPIGLGHDGLNEAASPLP-KLYRGVRQRHLGRWVAEIRLPHNRARLWLGTFDSA  614
            +S+ S  PI +   G +  + P P KLYRGVRQRH G+WVAEIRLP NR RLWLGTFD+A
Sbjct  151  LSFLSPKPIPMKQVG-SAGSPPKPTKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTA  209

Query  615  EDAALAYDREAYRLRGAKARLNFPHLFLDGAL  710
            E+AALAYD+ AY+LRG  ARLNFPHL  +G++
Sbjct  210  EEAALAYDKAAYKLRGDFARLNFPHLRHNGSV  241



>ref|XP_003552083.1| PREDICTED: ethylene-responsive transcription factor RAP2-4-like 
[Glycine max]
Length=309

 Score =   117 bits (294),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 59/107 (55%), Positives = 71/107 (66%), Gaps = 1/107 (1%)
 Frame = +3

Query  387  FAPQQQLQSSSGCGNDQISWQSAGPIGLGHDGLNEAASPLPKLYRGVRQRHLGRWVAEIR  566
              P Q  Q  +     +  + S  PI + H   + ++ P  KLYRGVRQRH G+WVAEIR
Sbjct  81   LTPSQMFQIQARIQVPRGQFLSPKPIPMKHVRASPSSKPT-KLYRGVRQRHWGKWVAEIR  139

Query  567  LPHNRARLWLGTFDSAEDAALAYDREAYRLRGAKARLNFPHLFLDGA  707
            LP NR RLWLGTFD+AE+AALAYD  A++LRG  ARLNFPHL   GA
Sbjct  140  LPKNRTRLWLGTFDTAEEAALAYDNAAFKLRGENARLNFPHLRHHGA  186



>ref|XP_009592286.1| PREDICTED: ethylene-responsive transcription factor ERF053-like 
[Nicotiana tomentosiformis]
Length=547

 Score =   120 bits (300),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 52/63 (83%), Positives = 57/63 (90%), Gaps = 0/63 (0%)
 Frame = +3

Query  510  KLYRGVRQRHLGRWVAEIRLPHNRARLWLGTFDSAEDAALAYDREAYRLRGAKARLNFPH  689
            KLYRGVRQRH G+WVAEIRLP  R RLWLGTFD+AEDAA+AYDREAY+LRG KA+LNFP 
Sbjct  206  KLYRGVRQRHWGKWVAEIRLPRKRTRLWLGTFDTAEDAAMAYDREAYKLRGEKAKLNFPE  265

Query  690  LFL  698
            LFL
Sbjct  266  LFL  268



>gb|AIZ74389.1| DREB3 [Sophora moorcroftiana]
Length=347

 Score =   118 bits (295),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 76/193 (39%), Positives = 99/193 (51%), Gaps = 46/193 (24%)
 Frame = +3

Query  429  NDQISWQSAGPIGLGHDGLNEAASPLPKLYRGVRQRHLGRWVAEIRLPHNRARLWLGTFD  608
            N  +S+ S  P+ + H G+    +   KLYRGVRQRH G+WVAEIRLP NR RLWLGTFD
Sbjct  136  NTTLSFLSPKPVPMKHMGVPPKPT---KLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFD  192

Query  609  SAEDAALAYDREAYRLRGAKARLNFPHL-----FLDGALHE-------------------  716
            +AE+AALAYD+ AY+LRG  ARLNFP+L      + GA  E                   
Sbjct  193  TAEEAALAYDKAAYKLRGDVARLNFPNLKHQGSCVGGAFGEYKPLHSSVYAKLDALCESL  252

Query  717  -DLETATQKEAKP----KQITSGNI------IESNNTKCSGISAHEPKTIDDDY------  845
             DL+   + E KP    K+   G+       +E+NN  C   ++  P   D D       
Sbjct  253  GDLQKPGKPEKKPVRPSKRSKLGSSKEAQPQLENNNNNCKVEASLSPVMTDSDGSAGSSL  312

Query  846  --VNHDRDVEPEW  878
              +  D   EP+W
Sbjct  313  SDLTFDDVTEPQW  325



>ref|XP_009592157.1| PREDICTED: ethylene-responsive transcription factor ERF054-like 
[Nicotiana tomentosiformis]
Length=423

 Score =   119 bits (297),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 55/82 (67%), Positives = 65/82 (79%), Gaps = 4/82 (5%)
 Frame = +3

Query  510  KLYRGVRQRHLGRWVAEIRLPHNRARLWLGTFDSAEDAALAYDREAYRLRGAKARLNFPH  689
            KLYRGVRQRH G+WVAEIRLP NR RLWLGTFD+AEDAA+AYDREA++LRG  A+LNFP 
Sbjct  205  KLYRGVRQRHWGKWVAEIRLPRNRTRLWLGTFDTAEDAAMAYDREAFKLRGENAKLNFPE  264

Query  690  LFL----DGALHEDLETATQKE  743
            LFL    +G   E +E+   K+
Sbjct  265  LFLGKDREGPSIETIESTHTKQ  286



>ref|XP_006303258.1| hypothetical protein CARUB_v10009949mg [Capsella rubella]
 gb|EOA36156.1| hypothetical protein CARUB_v10009949mg [Capsella rubella]
Length=282

 Score =   117 bits (292),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 61/121 (50%), Positives = 78/121 (64%), Gaps = 20/121 (17%)
 Frame = +3

Query  450  SAGPIGLGHDGLNEAASPLPKLYRGVRQRHLGRWVAEIRLPHNRARLWLGTFDSAEDAAL  629
            S  P+ +   G + A  P+ KLYRGVRQRH G+WVAEIRLP NR RLWLGTFD+AE+AAL
Sbjct  73   SPKPVSMKQTG-SSAPKPM-KLYRGVRQRHWGKWVAEIRLPRNRTRLWLGTFDTAEEAAL  130

Query  630  AYDREAYRLRGAKARLNFPHLFLDG------------------ALHEDLETATQKEAKPK  755
            AYD+ A++LRG  ARLNFP+L  +G                  A+ ++L   TQK+ KP 
Sbjct  131  AYDKAAFKLRGDFARLNFPNLRHNGSNIGEYQPLQSSVDAKLEAICQNLAETTQKQVKPT  190

Query  756  Q  758
            +
Sbjct  191  K  191



>ref|XP_002890498.1| hypothetical protein ARALYDRAFT_472454 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66757.1| hypothetical protein ARALYDRAFT_472454 [Arabidopsis lyrata subsp. 
lyrata]
Length=261

 Score =   116 bits (291),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 62/121 (51%), Positives = 80/121 (66%), Gaps = 18/121 (15%)
 Frame = +3

Query  450  SAGPIGLGHDGLNEAASPLP-KLYRGVRQRHLGRWVAEIRLPHNRARLWLGTFDSAEDAA  626
            S  P+ +   G   +++P P KLYRGVRQRH G+WVAEIRLP NR RLWLGTFD+AE+AA
Sbjct  63   SPKPVSMKQTG---SSAPKPTKLYRGVRQRHWGKWVAEIRLPRNRTRLWLGTFDTAEEAA  119

Query  627  LAYDREAYRLRGAKARLNFPHLFLDG--------------ALHEDLETATQKEAKPKQIT  764
            LAYD+ AY+LRG  ARLNFP+L  +G              A+ ++L   TQK+ K  + +
Sbjct  120  LAYDKAAYKLRGDFARLNFPNLRHNGEYQPLQSSVDAKLEAICQNLAEMTQKQGKSTKKS  179

Query  765  S  767
            S
Sbjct  180  S  180



>ref|XP_006357496.1| PREDICTED: ethylene-responsive transcription factor ERF054-like 
[Solanum tuberosum]
Length=389

 Score =   118 bits (296),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 51/63 (81%), Positives = 57/63 (90%), Gaps = 0/63 (0%)
 Frame = +3

Query  510  KLYRGVRQRHLGRWVAEIRLPHNRARLWLGTFDSAEDAALAYDREAYRLRGAKARLNFPH  689
            KLYRGVRQRH G+WVAEIRLP NR RLWLGTFD+AEDAA+AYDREAY+LRG  A+LNFP 
Sbjct  182  KLYRGVRQRHWGKWVAEIRLPRNRTRLWLGTFDTAEDAAMAYDREAYKLRGDNAKLNFPE  241

Query  690  LFL  698
            LF+
Sbjct  242  LFI  244



>gb|AFK73559.1| AP2 transcription factor [Mentha x piperita]
Length=298

 Score =   117 bits (292),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 52/71 (73%), Positives = 59/71 (83%), Gaps = 0/71 (0%)
 Frame = +3

Query  480  GLNEAASPLPKLYRGVRQRHLGRWVAEIRLPHNRARLWLGTFDSAEDAALAYDREAYRLR  659
            GL+   +   KLYRGVRQRH G+WVAEIRLP NR RLWLGTFD+AE+AA+AYDR AY+LR
Sbjct  61   GLSSQTAKPTKLYRGVRQRHWGKWVAEIRLPRNRTRLWLGTFDTAEEAAMAYDRAAYKLR  120

Query  660  GAKARLNFPHL  692
            G  ARLNFPHL
Sbjct  121  GDFARLNFPHL  131



>ref|XP_004953233.1| PREDICTED: ethylene-responsive transcription factor ERF053-like 
[Setaria italica]
Length=460

 Score =   119 bits (297),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 52/64 (81%), Positives = 58/64 (91%), Gaps = 0/64 (0%)
 Frame = +3

Query  507  PKLYRGVRQRHLGRWVAEIRLPHNRARLWLGTFDSAEDAALAYDREAYRLRGAKARLNFP  686
            PKLYRGVRQRH G+WVAEIRLP NR RLWLGTFD+AEDAA+AYDREA++LRG  A+LNFP
Sbjct  216  PKLYRGVRQRHWGKWVAEIRLPRNRTRLWLGTFDTAEDAAMAYDREAFKLRGENAKLNFP  275

Query  687  HLFL  698
             LFL
Sbjct  276  DLFL  279



>ref|XP_007221531.1| hypothetical protein PRUPE_ppa020676mg, partial [Prunus persica]
 gb|EMJ22730.1| hypothetical protein PRUPE_ppa020676mg, partial [Prunus persica]
Length=152

 Score =   113 bits (283),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 53/76 (70%), Positives = 62/76 (82%), Gaps = 1/76 (1%)
 Frame = +3

Query  483  LNEAASPLP-KLYRGVRQRHLGRWVAEIRLPHNRARLWLGTFDSAEDAALAYDREAYRLR  659
             +  + P P KLYRGVRQRH G+WVAEIRLP NR RLWLGTFD+AE+AALAYD+ AY+LR
Sbjct  5    FSSGSPPKPTKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTAEEAALAYDKAAYKLR  64

Query  660  GAKARLNFPHLFLDGA  707
            G  ARLNFPHL  +G+
Sbjct  65   GDFARLNFPHLRHNGS  80



>ref|XP_003569954.1| PREDICTED: ethylene-responsive transcription factor ERF054 [Brachypodium 
distachyon]
Length=470

 Score =   119 bits (297),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 54/68 (79%), Positives = 61/68 (90%), Gaps = 1/68 (1%)
 Frame = +3

Query  498  SPLP-KLYRGVRQRHLGRWVAEIRLPHNRARLWLGTFDSAEDAALAYDREAYRLRGAKAR  674
            +P+P KLYRGVRQRH G+WVAEIRLP NR RLWLGTFD+AEDAA+AYDREA++LRG  AR
Sbjct  211  APVPAKLYRGVRQRHWGKWVAEIRLPRNRTRLWLGTFDTAEDAAMAYDREAFKLRGENAR  270

Query  675  LNFPHLFL  698
            LNFP LFL
Sbjct  271  LNFPDLFL  278



>ref|XP_009117462.1| PREDICTED: ethylene-responsive transcription factor ERF053 [Brassica 
rapa]
 emb|CDY69209.1| BnaAnng29660D [Brassica napus]
Length=311

 Score =   117 bits (293),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 81/181 (45%), Positives = 100/181 (55%), Gaps = 14/181 (8%)
 Frame = +3

Query  189  VEEQDHDLSDRPLKKMKNI-----PQLLSSSTSHPTHKPLIsppqppsfrfpfALHDTIP  353
            V E    LS R L+K++ I     P LLSSS   P       PP   +F F  A  +   
Sbjct  51   VGETSSTLSQRSLRKIRTIDRHNHPYLLSSSYVTPDQP----PPPTTAFPFSLAPSNIQN  106

Query  354  HPLFHH-QTMISFAPQQQLQSSSGCGNDQIS--WQSAGPIGLGHDGLNEAASPLP--KLY  518
              LF + + MISF PQ Q+          +   W+    + L          P    KLY
Sbjct  107  QQLFSYPRQMISFGPQHQVHPFLNAHQQHMMQYWRDILNLPLPLQLARPVIQPFSATKLY  166

Query  519  RGVRQRHLGRWVAEIRLPHNRARLWLGTFDSAEDAALAYDREAYRLRGAKARLNFPHLFL  698
            RGVRQRH G+WVAEIR P NR RLWLGTFD+A++AA+AYDREA++LRG  ARLNFP LFL
Sbjct  167  RGVRQRHWGKWVAEIRKPRNRTRLWLGTFDTAKEAAMAYDREAFKLRGETARLNFPELFL  226

Query  699  D  701
            +
Sbjct  227  N  227



>ref|XP_009781334.1| PREDICTED: ethylene-responsive transcription factor ERF054-like 
[Nicotiana sylvestris]
Length=414

 Score =   118 bits (295),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 55/82 (67%), Positives = 65/82 (79%), Gaps = 4/82 (5%)
 Frame = +3

Query  510  KLYRGVRQRHLGRWVAEIRLPHNRARLWLGTFDSAEDAALAYDREAYRLRGAKARLNFPH  689
            KLYRGVRQRH G+WVAEIRLP NR RLWLGTFD+AEDAA+AYDREA++LRG  A+LNFP 
Sbjct  196  KLYRGVRQRHWGKWVAEIRLPRNRTRLWLGTFDTAEDAAMAYDREAFKLRGENAKLNFPE  255

Query  690  LFL----DGALHEDLETATQKE  743
            LFL    +G   E +E+   K+
Sbjct  256  LFLGKDREGPSIETVESTHTKQ  277



>gb|ACP18975.1| dehydration responsive element binding factor [Limonium bicolor]
Length=356

 Score =   117 bits (294),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 57/91 (63%), Positives = 69/91 (76%), Gaps = 3/91 (3%)
 Frame = +3

Query  447  QSAGPIGLGHDGLNEAASPLPK---LYRGVRQRHLGRWVAEIRLPHNRARLWLGTFDSAE  617
            +S  P+ L    +  +AS  PK   LYRGVRQRH G+WVAEIRLP NR RLWLGTFD+AE
Sbjct  156  RSTNPLSLKPIPMKNSASVPPKPTKLYRGVRQRHWGKWVAEIRLPRNRTRLWLGTFDTAE  215

Query  618  DAALAYDREAYRLRGAKARLNFPHLFLDGAL  710
            +AALAYD+ AY+LRG  ARLNFPHL  +G++
Sbjct  216  EAALAYDKAAYKLRGDFARLNFPHLKHEGSI  246



>ref|XP_002310574.2| hypothetical protein POPTR_0007s05690g [Populus trichocarpa]
 gb|EEE91024.2| hypothetical protein POPTR_0007s05690g [Populus trichocarpa]
Length=375

 Score =   117 bits (294),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 56/76 (74%), Positives = 63/76 (83%), Gaps = 3/76 (4%)
 Frame = +3

Query  489  EAASPLPK---LYRGVRQRHLGRWVAEIRLPHNRARLWLGTFDSAEDAALAYDREAYRLR  659
            ++ASP PK   LYRGVRQRH G+WVAEIRLP NR RLWLGTFD+AE+AALAYD+ AY+LR
Sbjct  165  QSASPPPKPTKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTAEEAALAYDKAAYKLR  224

Query  660  GAKARLNFPHLFLDGA  707
            G  ARLNFPHL   GA
Sbjct  225  GEFARLNFPHLRHQGA  240



>gb|ABK95243.1| unknown [Populus trichocarpa]
Length=373

 Score =   117 bits (294),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 56/76 (74%), Positives = 63/76 (83%), Gaps = 3/76 (4%)
 Frame = +3

Query  489  EAASPLPK---LYRGVRQRHLGRWVAEIRLPHNRARLWLGTFDSAEDAALAYDREAYRLR  659
            ++ASP PK   LYRGVRQRH G+WVAEIRLP NR RLWLGTFD+AE+AALAYD+ AY+LR
Sbjct  163  QSASPPPKPTKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTAEEAALAYDKAAYKLR  222

Query  660  GAKARLNFPHLFLDGA  707
            G  ARLNFPHL   GA
Sbjct  223  GEFARLNFPHLRHQGA  238



>ref|XP_008378545.1| PREDICTED: ethylene-responsive transcription factor RAP2-4-like 
[Malus domestica]
Length=364

 Score =   117 bits (294),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 60/102 (59%), Positives = 74/102 (73%), Gaps = 2/102 (2%)
 Frame = +3

Query  408  QSSSGCGNDQISWQSAGPIGLGHDGLNEAASPLP-KLYRGVRQRHLGRWVAEIRLPHNRA  584
            Q  S   +  +S+ S  PI +   G +  + P P KLYRGVRQRH G+WVAEIRLP NR 
Sbjct  139  QQVSQTTSRTLSFLSPKPIPMKQVG-SAGSPPKPTKLYRGVRQRHWGKWVAEIRLPKNRT  197

Query  585  RLWLGTFDSAEDAALAYDREAYRLRGAKARLNFPHLFLDGAL  710
            RLWLGTFD+AE+AALAYD+ AY+LRG  ARLNFPHL  +G++
Sbjct  198  RLWLGTFDTAEEAALAYDKAAYKLRGDFARLNFPHLRHNGSV  239



>ref|XP_003570628.1| PREDICTED: ethylene-responsive transcription factor RAP2-4-like 
[Brachypodium distachyon]
Length=315

 Score =   117 bits (292),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 61/107 (57%), Positives = 73/107 (68%), Gaps = 7/107 (7%)
 Frame = +3

Query  510  KLYRGVRQRHLGRWVAEIRLPHNRARLWLGTFDSAEDAALAYDREAYRLRGAKARLNFPH  689
            KLYRGVRQRH G+WVAEIRLP NR RLWLGTFD+AEDAALAYD+ A+RLRG +ARLNFP 
Sbjct  154  KLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDAAEDAALAYDKAAFRLRGDQARLNFPA  213

Query  690  L-----FLDGALHEDLETATQKEAKPKQITSGNIIESNNTKCSGISA  815
            L      L G LH  ++   +  A  + + +    E  + KCS  SA
Sbjct  214  LRRGGAHLAGPLHASVD--AKLTAICQSLQNPAAAEPESPKCSAASA  258



>ref|XP_011085351.1| PREDICTED: ethylene-responsive transcription factor ERF054-like 
[Sesamum indicum]
Length=367

 Score =   117 bits (294),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 50/63 (79%), Positives = 57/63 (90%), Gaps = 0/63 (0%)
 Frame = +3

Query  510  KLYRGVRQRHLGRWVAEIRLPHNRARLWLGTFDSAEDAALAYDREAYRLRGAKARLNFPH  689
            KLYRGVRQRH G+WVAEIRLP NR RLWLGTFD+AE+AALAYDREA++LRG  ARLNFP 
Sbjct  149  KLYRGVRQRHWGKWVAEIRLPRNRTRLWLGTFDTAEEAALAYDREAFKLRGENARLNFPE  208

Query  690  LFL  698
            +F+
Sbjct  209  VFI  211



>dbj|BAJ98638.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=459

 Score =   118 bits (295),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 52/63 (83%), Positives = 57/63 (90%), Gaps = 0/63 (0%)
 Frame = +3

Query  510  KLYRGVRQRHLGRWVAEIRLPHNRARLWLGTFDSAEDAALAYDREAYRLRGAKARLNFPH  689
            KLYRGVRQRH G+WVAEIRLP NR RLWLGTFD+AEDAA+AYDREA++LRG  ARLNFP 
Sbjct  211  KLYRGVRQRHWGKWVAEIRLPRNRTRLWLGTFDTAEDAAMAYDREAFKLRGENARLNFPD  270

Query  690  LFL  698
            LFL
Sbjct  271  LFL  273



>gb|EPS68328.1| dehydration responsive element-binding protein 2, partial [Genlisea 
aurea]
Length=142

 Score =   112 bits (281),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 52/81 (64%), Positives = 62/81 (77%), Gaps = 0/81 (0%)
 Frame = +3

Query  450  SAGPIGLGHDGLNEAASPLPKLYRGVRQRHLGRWVAEIRLPHNRARLWLGTFDSAEDAAL  629
            S  P+ + H G+        K++RGVRQRH G+WVAEIRLP NR RLWLGTFD+AE+AAL
Sbjct  35   SPPPVPMKHHGVIITPQKPVKIFRGVRQRHWGKWVAEIRLPRNRTRLWLGTFDTAEEAAL  94

Query  630  AYDREAYRLRGAKARLNFPHL  692
            AYD+ AY+LRG  ARLNFPHL
Sbjct  95   AYDKAAYKLRGDYARLNFPHL  115



>gb|AIB05165.1| AP2-EREBP transcription factor, partial [Zea mays]
Length=449

 Score =   118 bits (295),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 52/64 (81%), Positives = 58/64 (91%), Gaps = 0/64 (0%)
 Frame = +3

Query  507  PKLYRGVRQRHLGRWVAEIRLPHNRARLWLGTFDSAEDAALAYDREAYRLRGAKARLNFP  686
            PKLYRGVRQRH G+WVAEIRLP NR RLWLGTFD+AEDAA+AYDREA++LRG  A+LNFP
Sbjct  205  PKLYRGVRQRHWGKWVAEIRLPRNRTRLWLGTFDTAEDAAMAYDREAFKLRGENAKLNFP  264

Query  687  HLFL  698
             LFL
Sbjct  265  DLFL  268



>ref|XP_008455331.1| PREDICTED: ethylene-responsive transcription factor ERF054 [Cucumis 
melo]
Length=397

 Score =   117 bits (294),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 60/108 (56%), Positives = 71/108 (66%), Gaps = 10/108 (9%)
 Frame = +3

Query  468  LGHDGLNEAASPL-----PKLYRGVRQRHLGRWVAEIRLPHNRARLWLGTFDSAEDAALA  632
             G DG N    PL      KLYRGVRQRH G+WVAEIRLP NR RLWLGTFD+AEDAA+A
Sbjct  179  FGPDGGNLFRPPLQPISATKLYRGVRQRHWGKWVAEIRLPRNRTRLWLGTFDTAEDAAMA  238

Query  633  YDREAYRLRGAKARLNFPHLFLDGAL-----HEDLETATQKEAKPKQI  761
            YDREA++LRG  ARLNFP  F+   +       +L     +EA P+ +
Sbjct  239  YDREAFKLRGENARLNFPDRFIKKDIPKTEAETELTIPITEEAHPESV  286



>gb|KDP46862.1| hypothetical protein JCGZ_24071 [Jatropha curcas]
Length=358

 Score =   117 bits (293),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 56/90 (62%), Positives = 69/90 (77%), Gaps = 7/90 (8%)
 Frame = +3

Query  429  NDQISWQSAGPIGLGHDGLNEAASPL--PKLYRGVRQRHLGRWVAEIRLPHNRARLWLGT  602
            N ++S+ +  P+ +      ++ASP    KLYRGVRQRH G+WVAEIRLP NR RLWLGT
Sbjct  138  NQRLSYLAPKPVSM-----KQSASPSKPTKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGT  192

Query  603  FDSAEDAALAYDREAYRLRGAKARLNFPHL  692
            FD+AE+AALAYD+ AY+LRG  ARLNFPHL
Sbjct  193  FDTAEEAALAYDKAAYKLRGEFARLNFPHL  222



>ref|XP_004142609.1| PREDICTED: ethylene-responsive transcription factor RAP2-4-like 
[Cucumis sativus]
 gb|KGN54614.1| hypothetical protein Csa_4G378010 [Cucumis sativus]
Length=358

 Score =   117 bits (293),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 65/128 (51%), Positives = 81/128 (63%), Gaps = 8/128 (6%)
 Frame = +3

Query  348  IPHP-----LFHHQTMISFAPQQQLQSSSGCGNDQISWQSAGPIGLGHDGLNEAASPLPK  512
            IPH      L  +QT ++FA  QQ            S+ +  PI +   G   ++S   K
Sbjct  117  IPHSQPQNNLLQNQTPLAFAWGQQNHQPPSSSEQPPSFLAPKPIPMKQVG---SSSKPTK  173

Query  513  LYRGVRQRHLGRWVAEIRLPHNRARLWLGTFDSAEDAALAYDREAYRLRGAKARLNFPHL  692
            LYRGVRQRH G+WVAEIRLP NR RLWLGTFD+AE+AALAYD+ A++LRG  ARLNFP+L
Sbjct  174  LYRGVRQRHWGKWVAEIRLPRNRTRLWLGTFDTAEEAALAYDKAAFKLRGDSARLNFPNL  233

Query  693  FLDGALHE  716
               G+  E
Sbjct  234  KHQGSCVE  241



>ref|XP_004163671.1| PREDICTED: LOW QUALITY PROTEIN: ethylene-responsive transcription 
factor RAP2-4-like [Cucumis sativus]
Length=358

 Score =   117 bits (293),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 65/128 (51%), Positives = 81/128 (63%), Gaps = 8/128 (6%)
 Frame = +3

Query  348  IPHP-----LFHHQTMISFAPQQQLQSSSGCGNDQISWQSAGPIGLGHDGLNEAASPLPK  512
            IPH      L  +QT ++FA  QQ            S+ +  PI +   G   ++S   K
Sbjct  117  IPHSQPQNNLLQNQTPLAFAWGQQNHQPPSSSEQPPSFLAPKPIPMKQVG---SSSKPTK  173

Query  513  LYRGVRQRHLGRWVAEIRLPHNRARLWLGTFDSAEDAALAYDREAYRLRGAKARLNFPHL  692
            LYRGVRQRH G+WVAEIRLP NR RLWLGTFD+AE+AALAYD+ A++LRG  ARLNFP+L
Sbjct  174  LYRGVRQRHWGKWVAEIRLPRNRTRLWLGTFDTAEEAALAYDKAAFKLRGDSARLNFPNL  233

Query  693  FLDGALHE  716
               G+  E
Sbjct  234  KHQGSCVE  241



>ref|XP_008803760.1| PREDICTED: ethylene-responsive transcription factor RAP2-4-like 
[Phoenix dactylifera]
Length=339

 Score =   117 bits (292),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 62/116 (53%), Positives = 77/116 (66%), Gaps = 8/116 (7%)
 Frame = +3

Query  483  LNEAASPLP-----KLYRGVRQRHLGRWVAEIRLPHNRARLWLGTFDSAEDAALAYDREA  647
            +    SPLP     KLYRGVRQRH G+WVAEIRLP NR RLWLGTFD+A++AALAYDR A
Sbjct  150  MKRTGSPLPPSKPAKLYRGVRQRHWGKWVAEIRLPRNRTRLWLGTFDTAKEAALAYDRAA  209

Query  648  YRLRGAKARLNFPHLFLDGALHEDLETATQKEAKPKQITSGNIIESNNTKCSGISA  815
            Y+LRG  ARLNFP L   GA H  +   +  +AK + I     + S+  + +G+S 
Sbjct  210  YKLRGDAARLNFPELRCSGA-HLSVPLHSSVDAKLQSICQS--LASSKKQGNGLSG  262



>dbj|BAJ99190.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=395

 Score =   117 bits (294),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 54/72 (75%), Positives = 59/72 (82%), Gaps = 0/72 (0%)
 Frame = +3

Query  483  LNEAASPLPKLYRGVRQRHLGRWVAEIRLPHNRARLWLGTFDSAEDAALAYDREAYRLRG  662
            L  A  P  KLYRGVRQRH G+WVAEIRLP NR RLWLGTFD+AEDAA+AYDREA++LRG
Sbjct  132  LLRAPPPPQKLYRGVRQRHWGKWVAEIRLPRNRTRLWLGTFDTAEDAAMAYDREAFKLRG  191

Query  663  AKARLNFPHLFL  698
              ARLNFP  FL
Sbjct  192  ENARLNFPDRFL  203



>ref|XP_010061815.1| PREDICTED: ethylene-responsive transcription factor RAP2-4-like 
[Eucalyptus grandis]
 gb|KCW68840.1| hypothetical protein EUGRSUZ_F02440 [Eucalyptus grandis]
Length=335

 Score =   117 bits (292),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 53/67 (79%), Positives = 57/67 (85%), Gaps = 0/67 (0%)
 Frame = +3

Query  492  AASPLPKLYRGVRQRHLGRWVAEIRLPHNRARLWLGTFDSAEDAALAYDREAYRLRGAKA  671
            A  P  KLYRGVRQRH G+WVAEIRLP NR RLWLGTFD+AE+AALAYDR AY+LRG  A
Sbjct  134  AGKPATKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTAEEAALAYDRAAYKLRGDFA  193

Query  672  RLNFPHL  692
            RLNFPHL
Sbjct  194  RLNFPHL  200



>gb|AFO38387.1| putative ethylene-responsive transcription factor ERF060-like 
[Glycine max]
Length=290

 Score =   116 bits (290),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 55/86 (64%), Positives = 64/86 (74%), Gaps = 0/86 (0%)
 Frame = +3

Query  450  SAGPIGLGHDGLNEAASPLPKLYRGVRQRHLGRWVAEIRLPHNRARLWLGTFDSAEDAAL  629
            S  PI + H   + + S   KLYRGVRQRH G+WVAEIRLP NR RLWLGTF++AE+AAL
Sbjct  88   SPKPITMKHVRASCSNSKATKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFETAEEAAL  147

Query  630  AYDREAYRLRGAKARLNFPHLFLDGA  707
            AYD  A++LRG  ARLNFPHL   GA
Sbjct  148  AYDNAAFKLRGENARLNFPHLRHHGA  173



>ref|XP_007226002.1| hypothetical protein PRUPE_ppa010345mg [Prunus persica]
 gb|EMJ27201.1| hypothetical protein PRUPE_ppa010345mg [Prunus persica]
Length=253

 Score =   115 bits (288),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 67/130 (52%), Positives = 82/130 (63%), Gaps = 10/130 (8%)
 Frame = +3

Query  474  HDGLNEAASPLPKLYRGVRQRHLGRWVAEIRLPHNRARLWLGTFDSAEDAALAYDREAYR  653
            H+ L+ AAS   KL+RGVRQRH G+WVAEIRLP NRAR+WLGTFD+AE+AA+AYD  AY 
Sbjct  77   HNNLSSAASTPGKLFRGVRQRHWGKWVAEIRLPRNRARVWLGTFDTAEEAAMAYDTAAYM  136

Query  654  LRGAKARLNFP---HLFLDGALHEDLETATQKEAKPKQITSGN-----IIESNNTKCSGI  809
            LRG  A LNFP   H     AL     TA   EAK + ITS       I+ES +++ +  
Sbjct  137  LRGEHAHLNFPDLKHQLKANALKGT--TAALLEAKLQAITSSQAHQKAIMESKSSQLASP  194

Query  810  SAHEPKTIDD  839
            + H     DD
Sbjct  195  NKHSADDHDD  204



>ref|XP_009345480.1| PREDICTED: ethylene-responsive transcription factor ERF060-like 
[Pyrus x bretschneideri]
Length=325

 Score =   116 bits (291),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 53/70 (76%), Positives = 59/70 (84%), Gaps = 0/70 (0%)
 Frame = +3

Query  498  SPLPKLYRGVRQRHLGRWVAEIRLPHNRARLWLGTFDSAEDAALAYDREAYRLRGAKARL  677
            S L KLYRGVRQRH G+WVAEIRLP NR RLWLGTFD+AE+AALAYD+ A++LRG  ARL
Sbjct  129  SKLTKLYRGVRQRHWGKWVAEIRLPRNRTRLWLGTFDTAEEAALAYDKAAFKLRGDFARL  188

Query  678  NFPHLFLDGA  707
            NFPHL   GA
Sbjct  189  NFPHLKQQGA  198



>ref|XP_004514265.1| PREDICTED: ethylene-responsive transcription factor RAP2-4-like 
[Cicer arietinum]
Length=313

 Score =   116 bits (291),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 59/100 (59%), Positives = 71/100 (71%), Gaps = 5/100 (5%)
 Frame = +3

Query  396  QQQLQSSSGCGNDQISWQSAGPIGLGHDGLNEAASPLP-KLYRGVRQRHLGRWVAEIRLP  572
            Q  LQ+ +   N  +S+    PI +   G+     P P KLYRGVRQRH G+WVAEIRLP
Sbjct  96   QIHLQAQNLNNNTNLSFLGPKPIPMKQPGV----PPKPTKLYRGVRQRHWGKWVAEIRLP  151

Query  573  HNRARLWLGTFDSAEDAALAYDREAYRLRGAKARLNFPHL  692
             NR RLWLGTF++AE+AALAYDR AYRLRG  ARLNFP++
Sbjct  152  KNRTRLWLGTFETAEEAALAYDRAAYRLRGDFARLNFPNM  191



>gb|AFW72505.1| putative AP2/EREBP transcription factor superfamily protein [Zea 
mays]
Length=449

 Score =   117 bits (294),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 52/64 (81%), Positives = 58/64 (91%), Gaps = 0/64 (0%)
 Frame = +3

Query  507  PKLYRGVRQRHLGRWVAEIRLPHNRARLWLGTFDSAEDAALAYDREAYRLRGAKARLNFP  686
            PKLYRGVRQRH G+WVAEIRLP NR RLWLGTFD+AEDAA+AYDREA++LRG  A+LNFP
Sbjct  205  PKLYRGVRQRHWGKWVAEIRLPRNRTRLWLGTFDTAEDAAMAYDREAFKLRGENAKLNFP  264

Query  687  HLFL  698
             LFL
Sbjct  265  DLFL  268



>gb|KHN44333.1| Ethylene-responsive transcription factor RAP2-4 [Glycine soja]
Length=318

 Score =   116 bits (291),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 55/86 (64%), Positives = 64/86 (74%), Gaps = 0/86 (0%)
 Frame = +3

Query  450  SAGPIGLGHDGLNEAASPLPKLYRGVRQRHLGRWVAEIRLPHNRARLWLGTFDSAEDAAL  629
            S  PI + H   + + S   KLYRGVRQRH G+WVAEIRLP NR RLWLGTF++AE+AAL
Sbjct  116  SPKPITMKHVRASCSNSKATKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFETAEEAAL  175

Query  630  AYDREAYRLRGAKARLNFPHLFLDGA  707
            AYD  A++LRG  ARLNFPHL   GA
Sbjct  176  AYDNAAFKLRGENARLNFPHLRHHGA  201



>emb|CBZ41765.1| drought responsive element binding protein 5 [Glycine max]
Length=307

 Score =   116 bits (291),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 60/103 (58%), Positives = 66/103 (64%), Gaps = 10/103 (10%)
 Frame = +3

Query  510  KLYRGVRQRHLGRWVAEIRLPHNRARLWLGTFDSAEDAALAYDREAYRLRGAKARLNFPH  689
            KLYRGVRQRH G+WVAEIRLP NR RLWLGTFD+AEDAA+AYDREA++ RG  ARLNFP 
Sbjct  105  KLYRGVRQRHWGKWVAEIRLPRNRTRLWLGTFDTAEDAAMAYDREAFKQRGENARLNFPE  164

Query  690  LFLDGALHEDLE----------TATQKEAKPKQITSGNIIESN  788
            LF +    E  E           A Q E  P       I ESN
Sbjct  165  LFFNKDKKEQGEEEASSPVLSAIAKQNEPPPAHHRDVTIEESN  207



>gb|EYU23219.1| hypothetical protein MIMGU_mgv1a019226mg [Erythranthe guttata]
Length=318

 Score =   116 bits (291),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 64/129 (50%), Positives = 76/129 (59%), Gaps = 10/129 (8%)
 Frame = +3

Query  351  PHPLFHHQTMISFAPQQQLQSSSGCGNDQISWQSAGPIGLGHDGLNEAASPLP-KLYRGV  527
            P P F      SF P Q +Q      +   ++    P+ +          P P KLYRGV
Sbjct  89   PSPQFEPTPNYSFGPVQDVQMWGPLQSHNSNFPIPRPVYV---------PPKPAKLYRGV  139

Query  528  RQRHLGRWVAEIRLPHNRARLWLGTFDSAEDAALAYDREAYRLRGAKARLNFPHLFLDGA  707
            RQRH G+WVAEIRLP NR RLWLGTFD+AE+AALAYDR AY+LRG  ARLNFPHL   G 
Sbjct  140  RQRHWGKWVAEIRLPKNRTRLWLGTFDTAEEAALAYDRAAYKLRGDSARLNFPHLRRAGG  199

Query  708  LHEDLETAT  734
             +  L  + 
Sbjct  200  EYTPLHASV  208



>ref|XP_004136820.1| PREDICTED: ethylene-responsive transcription factor ERF053-like 
[Cucumis sativus]
 ref|XP_004168511.1| PREDICTED: ethylene-responsive transcription factor ERF053-like 
[Cucumis sativus]
 gb|KGN43605.1| hypothetical protein Csa_7G047400 [Cucumis sativus]
Length=397

 Score =   117 bits (293),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 56/82 (68%), Positives = 61/82 (74%), Gaps = 5/82 (6%)
 Frame = +3

Query  468  LGHDGLNEAASPL-----PKLYRGVRQRHLGRWVAEIRLPHNRARLWLGTFDSAEDAALA  632
             G DG N    PL      KLYRGVRQRH G+WVAEIRLP NR RLWLGTFD+AEDAA+A
Sbjct  179  FGPDGGNLFRPPLQPISATKLYRGVRQRHWGKWVAEIRLPRNRTRLWLGTFDTAEDAAMA  238

Query  633  YDREAYRLRGAKARLNFPHLFL  698
            YDREA++LRG  ARLNFP  F 
Sbjct  239  YDREAFKLRGENARLNFPDRFF  260



>gb|ACU17684.1| unknown [Glycine max]
Length=318

 Score =   116 bits (291),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 55/86 (64%), Positives = 64/86 (74%), Gaps = 0/86 (0%)
 Frame = +3

Query  450  SAGPIGLGHDGLNEAASPLPKLYRGVRQRHLGRWVAEIRLPHNRARLWLGTFDSAEDAAL  629
            S  PI + H   + + S   KLYRGVRQRH G+WVAEIRLP NR RLWLGTF++AE+AAL
Sbjct  116  SPKPITMEHVRASCSNSKATKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFETAEEAAL  175

Query  630  AYDREAYRLRGAKARLNFPHLFLDGA  707
            AYD  A++LRG  ARLNFPHL   GA
Sbjct  176  AYDNAAFKLRGENARLNFPHLRHHGA  201



>emb|CCD42020.1| drought responsive element binding protein 5 [Glycine max]
Length=307

 Score =   116 bits (290),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 60/103 (58%), Positives = 66/103 (64%), Gaps = 10/103 (10%)
 Frame = +3

Query  510  KLYRGVRQRHLGRWVAEIRLPHNRARLWLGTFDSAEDAALAYDREAYRLRGAKARLNFPH  689
            KLYRGVRQRH G+WVAEIRLP NR RLWLGTFD+AEDAA+AYDREA++ RG  ARLNFP 
Sbjct  105  KLYRGVRQRHWGKWVAEIRLPRNRTRLWLGTFDTAEDAAMAYDREAFKQRGENARLNFPE  164

Query  690  LFLDGALHEDLE----------TATQKEAKPKQITSGNIIESN  788
            LF +    E  E           A Q E  P       I ESN
Sbjct  165  LFFNKDKKEQGEEEASSPVLSAIAKQNEPPPAHHRDVTIEESN  207



>ref|XP_009393593.1| PREDICTED: ethylene-responsive transcription factor ERF053-like 
[Musa acuminata subsp. malaccensis]
Length=437

 Score =   117 bits (293),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 52/63 (83%), Positives = 57/63 (90%), Gaps = 0/63 (0%)
 Frame = +3

Query  510  KLYRGVRQRHLGRWVAEIRLPHNRARLWLGTFDSAEDAALAYDREAYRLRGAKARLNFPH  689
            KLYRGVRQRH G+WVAEIRLP NR RLWLGTFD+AE AALAYDREA++LRG  ARLNFP+
Sbjct  205  KLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTAEAAALAYDREAFKLRGENARLNFPN  264

Query  690  LFL  698
            LFL
Sbjct  265  LFL  267



>ref|XP_010644377.1| PREDICTED: uncharacterized protein LOC104877562 [Vitis vinifera]
Length=403

 Score =   117 bits (293),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 78/182 (43%), Positives = 100/182 (55%), Gaps = 25/182 (14%)
 Frame = +3

Query  216  DRPLKKMKNIPQLLSSSTSHPTHKPLIsppqppsfrfpfALHDTIPHPLFHH--QTMISF  389
            +RPLK+++++   +      P+H   I    P     P +L   +P  +  H  Q MISF
Sbjct  56   NRPLKRVRSLEHQIP--IQRPSH--FIHQMAPNPISSPASLRFGLPFSMPTHVEQQMISF  111

Query  390  APQ----------QQLQSSSGCGNDQISWQSAGPI----GLGHDG-----LNEAASPLPK  512
            +P           + LQ  S   N     ++  P     GL  DG      +    P  K
Sbjct  112  SPNDSELEPYSNHRLLQYWSSVLNLSPRGRTMMPTMLTNGLVQDGGGVFRPSTIGPPNAK  171

Query  513  LYRGVRQRHLGRWVAEIRLPHNRARLWLGTFDSAEDAALAYDREAYRLRGAKARLNFPHL  692
            LYRGVRQR  G+WVAEIRLP NR RLWLGTFD+AE+AALAYDREA++ RG  ARLNFPHL
Sbjct  172  LYRGVRQRQWGKWVAEIRLPRNRRRLWLGTFDTAEEAALAYDREAFKQRGENARLNFPHL  231

Query  693  FL  698
            F+
Sbjct  232  FV  233



>gb|EYU26148.1| hypothetical protein MIMGU_mgv11b016405mg, partial [Erythranthe 
guttata]
Length=526

 Score =   118 bits (295),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 57/85 (67%), Positives = 65/85 (76%), Gaps = 8/85 (9%)
 Frame = +3

Query  468  LGHDGLNEAA---SPLP-----KLYRGVRQRHLGRWVAEIRLPHNRARLWLGTFDSAEDA  623
            LG +G    A    P+P     +LYRGVRQRH G+WVAEIRLP NR RLWLGTFD+AEDA
Sbjct  280  LGQNGGRGPALFRPPIPPLSTTRLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTAEDA  339

Query  624  ALAYDREAYRLRGAKARLNFPHLFL  698
            A+AYDREAY+LRG  ARLNFP LF+
Sbjct  340  AMAYDREAYKLRGDNARLNFPELFI  364



>ref|XP_006302477.1| hypothetical protein CARUB_v10020567mg [Capsella rubella]
 gb|EOA35375.1| hypothetical protein CARUB_v10020567mg [Capsella rubella]
Length=350

 Score =   116 bits (291),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 63/122 (52%), Positives = 75/122 (61%), Gaps = 16/122 (13%)
 Frame = +3

Query  351  PHPLFHHQTMIS--FAPQQQLQSSSGCGNDQISWQSAGPIGLGHDGLNEAASPLP-KLYR  521
            P P  HH    S   +P+  L   SG      ++ S  P             P P KLYR
Sbjct  115  PLPPTHHSNTFSNLLSPKPLLMKQSGVAGSCFAYGSGVP-------------PKPTKLYR  161

Query  522  GVRQRHLGRWVAEIRLPHNRARLWLGTFDSAEDAALAYDREAYRLRGAKARLNFPHLFLD  701
            GVRQRH G+WVAEIRLP NR RLWLGTFD+AE+AALAYD+ AY+LRG  ARLNFP+L  +
Sbjct  162  GVRQRHWGKWVAEIRLPRNRTRLWLGTFDTAEEAALAYDKAAYKLRGDFARLNFPNLRHN  221

Query  702  GA  707
            G+
Sbjct  222  GS  223



>ref|XP_010498682.1| PREDICTED: ethylene-responsive transcription factor RAP2-13-like 
[Camelina sativa]
Length=285

 Score =   115 bits (289),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 67/155 (43%), Positives = 88/155 (57%), Gaps = 25/155 (16%)
 Frame = +3

Query  450  SAGPIGLGHDGLNEAASPLP-KLYRGVRQRHLGRWVAEIRLPHNRARLWLGTFDSAEDAA  626
            S  P+ +   G   A+ P P KLYRGVRQRH G+WVAEIRLP NR RLWLGTFD+AE+AA
Sbjct  67   SPKPVSMKQTG---ASLPKPMKLYRGVRQRHWGKWVAEIRLPRNRTRLWLGTFDTAEEAA  123

Query  627  LAYDREAYRLRGAKARLNFPHLFLDG------------------ALHEDLETATQKEAKP  752
            LAYD+ A++LRG  ARLNFP+L  +G                  A+ ++L   TQK+   
Sbjct  124  LAYDKAAFKLRGDFARLNFPNLRHNGSNIGEYQPLQSSVDAKLEAICQNLAETTQKQ---  180

Query  753  KQITSGNIIESNNTKCSGISAHEPKTIDDDYVNHD  857
            KQ+ S     S     S ++  + +  D    + D
Sbjct  181  KQVKSTKKATSRRRSSSTVAVKQTEAADSGVKSED  215



>ref|NP_001236953.1| dehydration responsive element-binding protein 3 [Glycine max]
 gb|AAZ03388.1| dehydration responsive element-binding protein 3 [Glycine max]
Length=272

 Score =   115 bits (288),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 54/88 (61%), Positives = 67/88 (76%), Gaps = 3/88 (3%)
 Frame = +3

Query  429  NDQISWQSAGPIGLGHDGLNEAASPLPKLYRGVRQRHLGRWVAEIRLPHNRARLWLGTFD  608
            ++ +S+    PI + H G+    +   KLYRGVRQRH G+WVAEIRLP NR RLWLGTFD
Sbjct  113  SNTLSFLGPKPIPMKHVGMPPKPT---KLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFD  169

Query  609  SAEDAALAYDREAYRLRGAKARLNFPHL  692
            +AE+AALAYD+ AY+LRG  ARLNFP+L
Sbjct  170  TAEEAALAYDKAAYKLRGDFARLNFPNL  197



>gb|AFP90314.1| transcription factor 2 [Pinus yunnanensis]
Length=330

 Score =   116 bits (290),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 55/81 (68%), Positives = 64/81 (79%), Gaps = 4/81 (5%)
 Frame = +3

Query  450  SAGPIGLGHDGLNEAASPLPKLYRGVRQRHLGRWVAEIRLPHNRARLWLGTFDSAEDAAL  629
            +A P+ L    L++ A    KLYRGVRQRH G+WVAEIRLP NR RLWLGTFD+AE+AA+
Sbjct  99   TAQPMKLHGSSLSKPA----KLYRGVRQRHWGKWVAEIRLPRNRTRLWLGTFDTAEEAAM  154

Query  630  AYDREAYRLRGAKARLNFPHL  692
            AYD+ AYRLRG  ARLNFPHL
Sbjct  155  AYDKAAYRLRGDYARLNFPHL  175



>ref|NP_001234707.1| dehydration-responsive element binding protein 3 [Solanum lycopersicum]
 gb|AAO13360.1| dehydration-responsive element binding protein 3 [Solanum lycopersicum]
Length=264

 Score =   115 bits (287),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 62/117 (53%), Positives = 73/117 (62%), Gaps = 9/117 (8%)
 Frame = +3

Query  510  KLYRGVRQRHLGRWVAEIRLPHNRARLWLGTFDSAEDAALAYDREAYRLRGAKARLNFPH  689
            KLYRGVRQRH G+WVAEIRLP NR RLWLGTFD+AE+AALAYD+ AY LRG  ARLNFP 
Sbjct  83   KLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTAEEAALAYDKAAYMLRGDFARLNFPQ  142

Query  690  L-----FLDGALHEDLETATQKEAKPKQI----TSGNIIESNNTKCSGISAHEPKTI  833
            L      + G   E     +  +AK K I      G  I+S   K  G+SA +   +
Sbjct  143  LRHNGNLIGGDFGEYNPLHSSVDAKLKDICQSLAQGKSIDSKKKKTKGLSAEKAAVV  199



>ref|XP_007223221.1| hypothetical protein PRUPE_ppa007193mg [Prunus persica]
 gb|EMJ24420.1| hypothetical protein PRUPE_ppa007193mg [Prunus persica]
Length=378

 Score =   117 bits (292),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 56/90 (62%), Positives = 68/90 (76%), Gaps = 0/90 (0%)
 Frame = +3

Query  438  ISWQSAGPIGLGHDGLNEAASPLPKLYRGVRQRHLGRWVAEIRLPHNRARLWLGTFDSAE  617
            +S+ S  PI +   G + +     KLYRGVRQRH G+WVAEIRLP NR RLWLGTFD+AE
Sbjct  171  LSFLSPKPIPMKQVGSSGSPPKPTKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTAE  230

Query  618  DAALAYDREAYRLRGAKARLNFPHLFLDGA  707
            +AALAYD+ AY+LRG  ARLNFPHL  +G+
Sbjct  231  EAALAYDKAAYKLRGDFARLNFPHLRHNGS  260



>ref|XP_009787574.1| PREDICTED: ethylene-responsive transcription factor ERF054-like 
[Nicotiana sylvestris]
Length=331

 Score =   116 bits (290),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 51/65 (78%), Positives = 57/65 (88%), Gaps = 0/65 (0%)
 Frame = +3

Query  504  LPKLYRGVRQRHLGRWVAEIRLPHNRARLWLGTFDSAEDAALAYDREAYRLRGAKARLNF  683
            + KLYRGVRQRH G+WVAEIRLP  R RLWLGTFD+AEDAA+AYDREAY+LRG  A+LNF
Sbjct  156  MTKLYRGVRQRHWGKWVAEIRLPRKRTRLWLGTFDTAEDAAMAYDREAYKLRGESAKLNF  215

Query  684  PHLFL  698
            P LFL
Sbjct  216  PELFL  220



>ref|XP_010459960.1| PREDICTED: ethylene-responsive transcription factor RAP2-13-like 
[Camelina sativa]
Length=285

 Score =   115 bits (288),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 67/152 (44%), Positives = 87/152 (57%), Gaps = 25/152 (16%)
 Frame = +3

Query  459  PIGLGHDGLNEAASPLP-KLYRGVRQRHLGRWVAEIRLPHNRARLWLGTFDSAEDAALAY  635
            P+ +   G   A+ P P KLYRGVRQRH G+WVAEIRLP NR RLWLGTFD+AE+AALAY
Sbjct  70   PVSMKQTG---ASLPKPMKLYRGVRQRHWGKWVAEIRLPRNRTRLWLGTFDTAEEAALAY  126

Query  636  DREAYRLRGAKARLNFPHLFLDG------------------ALHEDLETATQKEAKPKQI  761
            D+ A++LRG  ARLNFP+L  +G                  A+ ++L   TQK+   KQ+
Sbjct  127  DKAAFKLRGDFARLNFPNLRHNGSNIGEYQPLQSSVDAKLEAICQNLAETTQKQ---KQV  183

Query  762  TSGNIIESNNTKCSGISAHEPKTIDDDYVNHD  857
             S     S     S  +  + +T D    + D
Sbjct  184  KSTKKATSRRRSSSTAAVKQTETADSGVKSED  215



>ref|XP_009389564.1| PREDICTED: ethylene-responsive transcription factor RAP2-13-like 
[Musa acuminata subsp. malaccensis]
Length=314

 Score =   116 bits (290),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 71/163 (44%), Positives = 93/163 (57%), Gaps = 26/163 (16%)
 Frame = +3

Query  381  ISFAPQQQLQSSSGCGNDQISWQSAGPIG-----LGHDGLNEAASPLP-KLYRGVRQRHL  542
            +++ P  Q Q       +Q     AG +G     +   G + A+ P P KLYRGVRQRH 
Sbjct  94   LNYLPAVQFQHPLSAAAEQQQMAYAGFLGPRPQSMKRSGCS-ASPPKPTKLYRGVRQRHW  152

Query  543  GRWVAEIRLPHNRARLWLGTFDSAEDAALAYDREAYRLRGAKARLNFPHLFLDGA-----  707
            G+WVAEIRLP NR RLWLGTFD+AE+AA+AYDR A++LRG  ARLNFP L  +GA     
Sbjct  153  GKWVAEIRLPRNRTRLWLGTFDTAEEAAMAYDRAAFKLRGDAARLNFPELRRNGAHFGAP  212

Query  708  LHEDLE----------TATQKEAKPKQITSGNIIESNNTKCSG  806
            LH  ++           ++QK+ K    T  N+  +N    SG
Sbjct  213  LHSSVDAKLQAICESMVSSQKQGK----TRPNVAAANEIISSG  251



>ref|XP_004976312.1| PREDICTED: ethylene-responsive transcription factor ERF053-like 
[Setaria italica]
Length=417

 Score =   117 bits (292),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 54/72 (75%), Positives = 58/72 (81%), Gaps = 0/72 (0%)
 Frame = +3

Query  483  LNEAASPLPKLYRGVRQRHLGRWVAEIRLPHNRARLWLGTFDSAEDAALAYDREAYRLRG  662
            L  A  P  KLYRGVRQRH G+WVAEIRLP NR RLWLGTFDSAEDAA+AYDREA++LRG
Sbjct  167  LVRAPPPPQKLYRGVRQRHWGKWVAEIRLPRNRTRLWLGTFDSAEDAAMAYDREAFKLRG  226

Query  663  AKARLNFPHLFL  698
              ARLNFP  F 
Sbjct  227  ENARLNFPDRFF  238



>ref|XP_008645977.1| PREDICTED: ethylene-responsive transcription factor ERF053-like 
[Zea mays]
Length=528

 Score =   118 bits (295),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 52/64 (81%), Positives = 58/64 (91%), Gaps = 0/64 (0%)
 Frame = +3

Query  507  PKLYRGVRQRHLGRWVAEIRLPHNRARLWLGTFDSAEDAALAYDREAYRLRGAKARLNFP  686
            PKLYRGVRQRH G+WVAEIRLP NR RLWLGTFD+AEDAA+AYDREA++LRG  A+LNFP
Sbjct  284  PKLYRGVRQRHWGKWVAEIRLPRNRTRLWLGTFDTAEDAAMAYDREAFKLRGENAKLNFP  343

Query  687  HLFL  698
             LFL
Sbjct  344  DLFL  347



>ref|XP_002887717.1| hypothetical protein ARALYDRAFT_476975 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH63976.1| hypothetical protein ARALYDRAFT_476975 [Arabidopsis lyrata subsp. 
lyrata]
Length=341

 Score =   116 bits (291),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 63/122 (52%), Positives = 75/122 (61%), Gaps = 16/122 (13%)
 Frame = +3

Query  351  PHPLFHHQTMIS--FAPQQQLQSSSGCGNDQISWQSAGPIGLGHDGLNEAASPLP-KLYR  521
            P P  HH    S   +P+  L   SG      ++ S  P             P P KLYR
Sbjct  110  PLPPTHHNNTFSNLLSPKPLLMKQSGVAGSCFAYGSGVP-------------PKPTKLYR  156

Query  522  GVRQRHLGRWVAEIRLPHNRARLWLGTFDSAEDAALAYDREAYRLRGAKARLNFPHLFLD  701
            GVRQRH G+WVAEIRLP NR RLWLGTFD+AE+AALAYD+ AY+LRG  ARLNFP+L  +
Sbjct  157  GVRQRHWGKWVAEIRLPRNRTRLWLGTFDTAEEAALAYDKAAYKLRGDFARLNFPNLRHN  216

Query  702  GA  707
            G+
Sbjct  217  GS  218



>ref|XP_004140031.1| PREDICTED: LOW QUALITY PROTEIN: ethylene-responsive transcription 
factor ERF054-like [Cucumis sativus]
Length=386

 Score =   117 bits (292),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 52/64 (81%), Positives = 57/64 (89%), Gaps = 0/64 (0%)
 Frame = +3

Query  510  KLYRGVRQRHLGRWVAEIRLPHNRARLWLGTFDSAEDAALAYDREAYRLRGAKARLNFPH  689
            KLYRGVRQRH G+WVAEIRLP NR RLWLGTFD+AEDAALAYDREA++LRG  ARLNFP 
Sbjct  187  KLYRGVRQRHWGKWVAEIRLPRNRNRLWLGTFDTAEDAALAYDREAFKLRGENARLNFPE  246

Query  690  LFLD  701
            L L+
Sbjct  247  LLLN  250



>ref|XP_002301042.2| AP2 domain-containing transcription factor family protein [Populus 
trichocarpa]
 gb|ABK96094.1| unknown [Populus trichocarpa]
 gb|EEE80315.2| AP2 domain-containing transcription factor family protein [Populus 
trichocarpa]
Length=344

 Score =   116 bits (290),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 61/115 (53%), Positives = 73/115 (63%), Gaps = 11/115 (10%)
 Frame = +3

Query  363  FHHQTMISFAPQQQLQSSSGCGNDQISWQSAGPIGLGHDGLNEAASPLPKLYRGVRQRHL  542
             HH  +      QQ Q+        + + S  PI +   G    A+   KLYRGVRQRH 
Sbjct  123  MHHNNLSYLQAYQQPQT--------LKFLSPKPIPMKQIGTPPKAT---KLYRGVRQRHW  171

Query  543  GRWVAEIRLPHNRARLWLGTFDSAEDAALAYDREAYRLRGAKARLNFPHLFLDGA  707
            G+WVAEIRLP NR RLWLGTFD+AE+AALAYDR AY+LRG  ARLNFP+L   G+
Sbjct  172  GKWVAEIRLPKNRTRLWLGTFDTAEEAALAYDRAAYKLRGDFARLNFPNLLHQGS  226



>ref|XP_010937498.1| PREDICTED: LOW QUALITY PROTEIN: ethylene-responsive transcription 
factor RAP2-13 [Elaeis guineensis]
Length=355

 Score =   116 bits (291),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 64/113 (57%), Positives = 73/113 (65%), Gaps = 12/113 (11%)
 Frame = +3

Query  435  QISWQSAGPIGLGHDG--LNEAASPLP----KLYRGVRQRHLGRWVAEIRLPHNRARLWL  596
            Q+S   A P  LG     +  A SP P    KLYRGVRQRH G+WVAEIRLP NR RLWL
Sbjct  146  QLSQGRAAPSFLGPRAQPMKHAGSPPPPRPAKLYRGVRQRHWGKWVAEIRLPKNRTRLWL  205

Query  597  GTFDSAEDAALAYDREAYRLRGAKARLNFPHL------FLDGALHEDLETATQ  737
            GTFD+AE+AA AYD+ A+RLRG  ARLNFPHL        DG LH  ++   Q
Sbjct  206  GTFDTAEEAAFAYDKAAFRLRGDFARLNFPHLRDEIARAADGPLHSSVDAKLQ  258



>gb|ABC74512.1| DRF-like transcription factor DRFL2b [Triticum aestivum]
Length=333

 Score =   116 bits (290),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 60/109 (55%), Positives = 69/109 (63%), Gaps = 5/109 (5%)
 Frame = +3

Query  510  KLYRGVRQRHLGRWVAEIRLPHNRARLWLGTFDSAEDAALAYDREAYRLRGAKARLNFPH  689
            KLYRGVRQRH G+WVAEIRLP NR RLWLGTFD+AEDAALAYD+ A+RLRG  ARLNFP 
Sbjct  174  KLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTAEDAALAYDKAAFRLRGDLARLNFPS  233

Query  690  L-----FLDGALHEDLETATQKEAKPKQITSGNIIESNNTKCSGISAHE  821
            L      L G LH  ++       +     S    E  + KCS  +  E
Sbjct  234  LRRGGAHLAGPLHASVDAKLTAICESLAAPSSKNSEPESPKCSASTEGE  282



>emb|CBG76431.1| OO_Ba0013J05-OO_Ba0033A15.18 [Oryza officinalis]
Length=458

 Score =   117 bits (293),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 54/72 (75%), Positives = 59/72 (82%), Gaps = 0/72 (0%)
 Frame = +3

Query  483  LNEAASPLPKLYRGVRQRHLGRWVAEIRLPHNRARLWLGTFDSAEDAALAYDREAYRLRG  662
            L  A  P  KLYRGVRQRH G+WVAEIRLP NR RLWLGTFD+AEDAA+AYDREA++LRG
Sbjct  200  LLRAPPPPQKLYRGVRQRHWGKWVAEIRLPRNRTRLWLGTFDTAEDAAMAYDREAFKLRG  259

Query  663  AKARLNFPHLFL  698
              ARLNFP  FL
Sbjct  260  ENARLNFPDRFL  271



>ref|XP_002454259.1| hypothetical protein SORBIDRAFT_04g027660 [Sorghum bicolor]
 gb|EES07235.1| hypothetical protein SORBIDRAFT_04g027660 [Sorghum bicolor]
Length=331

 Score =   116 bits (290),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 53/66 (80%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = +3

Query  510  KLYRGVRQRHLGRWVAEIRLPHNRARLWLGTFDSAEDAALAYDREAYRLRGAKARLNFPH  689
            KLYRGVRQRH G+WVAEIRLP NR RLWLGTFD+AEDAALAYD+ A+RLRG  ARLNFP 
Sbjct  159  KLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTAEDAALAYDKAAFRLRGDMARLNFPA  218

Query  690  LFLDGA  707
            L  DGA
Sbjct  219  LRRDGA  224



>gb|AFP90315.1| transcription factor 2 [Pinus densata]
Length=330

 Score =   116 bits (290),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 55/80 (69%), Positives = 63/80 (79%), Gaps = 4/80 (5%)
 Frame = +3

Query  453  AGPIGLGHDGLNEAASPLPKLYRGVRQRHLGRWVAEIRLPHNRARLWLGTFDSAEDAALA  632
            A P+ L    L++ A    KLYRGVRQRH G+WVAEIRLP NR RLWLGTFD+AE+AA+A
Sbjct  100  AQPMKLHGSSLSKPA----KLYRGVRQRHWGKWVAEIRLPRNRTRLWLGTFDTAEEAAMA  155

Query  633  YDREAYRLRGAKARLNFPHL  692
            YD+ AYRLRG  ARLNFPHL
Sbjct  156  YDKAAYRLRGDYARLNFPHL  175



>gb|AFP90326.1| transcription factor 2 [Pinus tabuliformis]
Length=330

 Score =   116 bits (290),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 55/80 (69%), Positives = 63/80 (79%), Gaps = 4/80 (5%)
 Frame = +3

Query  453  AGPIGLGHDGLNEAASPLPKLYRGVRQRHLGRWVAEIRLPHNRARLWLGTFDSAEDAALA  632
            A P+ L    L++ A    KLYRGVRQRH G+WVAEIRLP NR RLWLGTFD+AE+AA+A
Sbjct  100  AQPMKLHGSSLSKPA----KLYRGVRQRHWGKWVAEIRLPRNRTRLWLGTFDTAEEAAMA  155

Query  633  YDREAYRLRGAKARLNFPHL  692
            YD+ AYRLRG  ARLNFPHL
Sbjct  156  YDKAAYRLRGDYARLNFPHL  175



>ref|XP_004237407.1| PREDICTED: ethylene-responsive transcription factor RAP2-4-like 
[Solanum lycopersicum]
Length=367

 Score =   116 bits (291),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 50/61 (82%), Positives = 55/61 (90%), Gaps = 0/61 (0%)
 Frame = +3

Query  510  KLYRGVRQRHLGRWVAEIRLPHNRARLWLGTFDSAEDAALAYDREAYRLRGAKARLNFPH  689
            KLYRGVRQRH G+WVAEIRLP NR RLWLGTFD+AE+AALAYD+ AY+LRG  ARLNFPH
Sbjct  164  KLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTAEEAALAYDKAAYKLRGEFARLNFPH  223

Query  690  L  692
            L
Sbjct  224  L  224



>gb|AFJ14639.1| dehydration-responsive element-binding protein (DREB6), partial 
[Malus domestica]
Length=355

 Score =   116 bits (290),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 60/102 (59%), Positives = 73/102 (72%), Gaps = 2/102 (2%)
 Frame = +3

Query  408  QSSSGCGNDQISWQSAGPIGLGHDGLNEAASPLP-KLYRGVRQRHLGRWVAEIRLPHNRA  584
            Q  S   +  +S+ S  PI +   G +  + P P KLYRGVRQRH G+WVAEIRLP NR 
Sbjct  139  QQVSQTTSRTLSFLSPKPIPMKQVG-SAGSPPKPTKLYRGVRQRHWGKWVAEIRLPKNRT  197

Query  585  RLWLGTFDSAEDAALAYDREAYRLRGAKARLNFPHLFLDGAL  710
            RLWLGTFD+AE+AALAYD  AY+LRG  ARLNFPHL  +G++
Sbjct  198  RLWLGTFDTAEEAALAYDEAAYKLRGDFARLNFPHLRHNGSV  239



>gb|AFP90323.1| transcription factor 2 [Pinus densata]
Length=330

 Score =   115 bits (289),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 55/80 (69%), Positives = 63/80 (79%), Gaps = 4/80 (5%)
 Frame = +3

Query  453  AGPIGLGHDGLNEAASPLPKLYRGVRQRHLGRWVAEIRLPHNRARLWLGTFDSAEDAALA  632
            A P+ L    L++ A    KLYRGVRQRH G+WVAEIRLP NR RLWLGTFD+AE+AA+A
Sbjct  100  AQPMKLHGSSLSKPA----KLYRGVRQRHWGKWVAEIRLPRNRTRLWLGTFDTAEEAAMA  155

Query  633  YDREAYRLRGAKARLNFPHL  692
            YD+ AYRLRG  ARLNFPHL
Sbjct  156  YDKAAYRLRGDYARLNFPHL  175



>ref|XP_004166373.1| PREDICTED: ethylene-responsive transcription factor ERF054-like 
[Cucumis sativus]
Length=332

 Score =   115 bits (289),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 52/64 (81%), Positives = 57/64 (89%), Gaps = 0/64 (0%)
 Frame = +3

Query  510  KLYRGVRQRHLGRWVAEIRLPHNRARLWLGTFDSAEDAALAYDREAYRLRGAKARLNFPH  689
            KLYRGVRQRH G+WVAEIRLP NR RLWLGTFD+AEDAALAYDREA++LRG  ARLNFP 
Sbjct  171  KLYRGVRQRHWGKWVAEIRLPRNRNRLWLGTFDTAEDAALAYDREAFKLRGENARLNFPE  230

Query  690  LFLD  701
            L L+
Sbjct  231  LLLN  234



>gb|AHK24883.1| DRE-binding protein, partial [Lilium lancifolium]
Length=106

 Score =   110 bits (275),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 56/82 (68%), Positives = 64/82 (78%), Gaps = 4/82 (5%)
 Frame = +3

Query  459  PIGLGHDGLNEAASP-LPK---LYRGVRQRHLGRWVAEIRLPHNRARLWLGTFDSAEDAA  626
            P+ + H     +ASP LPK   LYRGVRQRH G+WVAEIRLP NR RLWLGTFD+AE+AA
Sbjct  5    PMPMKHVAAAVSASPPLPKPTKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTAEEAA  64

Query  627  LAYDREAYRLRGAKARLNFPHL  692
            +AYD+ AYRLRG  ARLNFP L
Sbjct  65   MAYDKAAYRLRGDFARLNFPGL  86



>gb|AFP90308.1| transcription factor 2 [Pinus densata]
Length=330

 Score =   115 bits (289),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 55/80 (69%), Positives = 63/80 (79%), Gaps = 4/80 (5%)
 Frame = +3

Query  453  AGPIGLGHDGLNEAASPLPKLYRGVRQRHLGRWVAEIRLPHNRARLWLGTFDSAEDAALA  632
            A P+ L    L++ A    KLYRGVRQRH G+WVAEIRLP NR RLWLGTFD+AE+AA+A
Sbjct  100  AQPMKLHGSSLSKPA----KLYRGVRQRHWGKWVAEIRLPRNRTRLWLGTFDTAEEAAMA  155

Query  633  YDREAYRLRGAKARLNFPHL  692
            YD+ AYRLRG  ARLNFPHL
Sbjct  156  YDKAAYRLRGDYARLNFPHL  175



>ref|XP_008444109.1| PREDICTED: ethylene-responsive transcription factor RAP2-13-like 
[Cucumis melo]
Length=363

 Score =   116 bits (290),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 65/129 (50%), Positives = 81/129 (63%), Gaps = 9/129 (7%)
 Frame = +3

Query  348  IPHP-----LFHHQTMISFA-PQQQLQSSSGCGNDQISWQSAGPIGLGHDGLNEAASPLP  509
            IPH         +QT ++FA  +Q  Q  S       S+ +  PI +   G   ++S   
Sbjct  121  IPHSQPQNSFLQNQTPLAFAWGEQNYQPPSSSEQQTPSFLAPKPIPMKQVG---SSSKPT  177

Query  510  KLYRGVRQRHLGRWVAEIRLPHNRARLWLGTFDSAEDAALAYDREAYRLRGAKARLNFPH  689
            KLYRGVRQRH G+WVAEIRLP NR RLWLGTFD+AE+AALAYD  A++LRG  ARLNFP+
Sbjct  178  KLYRGVRQRHWGKWVAEIRLPRNRTRLWLGTFDTAEEAALAYDEAAFKLRGDSARLNFPN  237

Query  690  LFLDGALHE  716
            L   G+  E
Sbjct  238  LKHQGSCVE  246



>gb|ABC74511.1| DRF-like transcription factor DRFL2c [Triticum aestivum]
Length=328

 Score =   115 bits (289),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 60/109 (55%), Positives = 69/109 (63%), Gaps = 5/109 (5%)
 Frame = +3

Query  510  KLYRGVRQRHLGRWVAEIRLPHNRARLWLGTFDSAEDAALAYDREAYRLRGAKARLNFPH  689
            KLYRGVRQRH G+WVAEIRLP NR RLWLGTFD+AEDAALAYD+ A+RLRG  ARLNFP 
Sbjct  173  KLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTAEDAALAYDKAAFRLRGDLARLNFPS  232

Query  690  L-----FLDGALHEDLETATQKEAKPKQITSGNIIESNNTKCSGISAHE  821
            L      L G LH  ++       +     S    E  + KCS  +  E
Sbjct  233  LRRGGAHLAGPLHASVDAKLTAICESLAAPSSKNSEPESPKCSASTEGE  281



>gb|AFP90294.1| transcription factor 2 [Pinus densata]
 gb|AFP90295.1| transcription factor 2 [Pinus densata]
 gb|AFP90296.1| transcription factor 2 [Pinus tabuliformis]
 gb|AFP90297.1| transcription factor 2 [Pinus densata]
 gb|AFP90300.1| transcription factor 2 [Pinus tabuliformis]
Length=328

 Score =   115 bits (289),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 55/80 (69%), Positives = 63/80 (79%), Gaps = 4/80 (5%)
 Frame = +3

Query  453  AGPIGLGHDGLNEAASPLPKLYRGVRQRHLGRWVAEIRLPHNRARLWLGTFDSAEDAALA  632
            A P+ L    L++ A    KLYRGVRQRH G+WVAEIRLP NR RLWLGTFD+AE+AA+A
Sbjct  100  AQPMKLHGSSLSKPA----KLYRGVRQRHWGKWVAEIRLPRNRTRLWLGTFDTAEEAAMA  155

Query  633  YDREAYRLRGAKARLNFPHL  692
            YD+ AYRLRG  ARLNFPHL
Sbjct  156  YDKAAYRLRGDYARLNFPHL  175



>gb|AFP90299.1| transcription factor 2 [Pinus tabuliformis]
Length=328

 Score =   115 bits (289),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 55/80 (69%), Positives = 63/80 (79%), Gaps = 4/80 (5%)
 Frame = +3

Query  453  AGPIGLGHDGLNEAASPLPKLYRGVRQRHLGRWVAEIRLPHNRARLWLGTFDSAEDAALA  632
            A P+ L    L++ A    KLYRGVRQRH G+WVAEIRLP NR RLWLGTFD+AE+AA+A
Sbjct  100  AQPMKLHGSSLSKPA----KLYRGVRQRHWGKWVAEIRLPRNRTRLWLGTFDTAEEAAMA  155

Query  633  YDREAYRLRGAKARLNFPHL  692
            YD+ AYRLRG  ARLNFPHL
Sbjct  156  YDKAAYRLRGDYARLNFPHL  175



>gb|AFP90310.1| transcription factor 2 [Pinus yunnanensis]
Length=330

 Score =   115 bits (289),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 55/80 (69%), Positives = 63/80 (79%), Gaps = 4/80 (5%)
 Frame = +3

Query  453  AGPIGLGHDGLNEAASPLPKLYRGVRQRHLGRWVAEIRLPHNRARLWLGTFDSAEDAALA  632
            A P+ L    L++ A    KLYRGVRQRH G+WVAEIRLP NR RLWLGTFD+AE+AA+A
Sbjct  100  AQPMKLHGSSLSKPA----KLYRGVRQRHWGKWVAEIRLPRNRTRLWLGTFDTAEEAAMA  155

Query  633  YDREAYRLRGAKARLNFPHL  692
            YD+ AYRLRG  ARLNFPHL
Sbjct  156  YDKAAYRLRGDYARLNFPHL  175



>gb|AFP90309.1| transcription factor 2 [Pinus yunnanensis]
 gb|AFP90313.1| transcription factor 2 [Pinus yunnanensis]
 gb|AFP90316.1| transcription factor 2 [Pinus yunnanensis]
 gb|AFP90318.1| transcription factor 2 [Pinus yunnanensis]
 gb|AFP90319.1| transcription factor 2 [Pinus yunnanensis]
 gb|AFP90322.1| transcription factor 2 [Pinus densata]
 gb|AFP90325.1| transcription factor 2 [Pinus yunnanensis]
 gb|AFP90327.1| transcription factor 2 [Pinus tabuliformis]
 gb|AFP90328.1| transcription factor 2 [Pinus tabuliformis]
 gb|AFP90329.1| transcription factor 2 [Pinus tabuliformis]
 gb|AFP90331.1| transcription factor 2 [Pinus tabuliformis]
Length=330

 Score =   115 bits (289),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 55/80 (69%), Positives = 63/80 (79%), Gaps = 4/80 (5%)
 Frame = +3

Query  453  AGPIGLGHDGLNEAASPLPKLYRGVRQRHLGRWVAEIRLPHNRARLWLGTFDSAEDAALA  632
            A P+ L    L++ A    KLYRGVRQRH G+WVAEIRLP NR RLWLGTFD+AE+AA+A
Sbjct  100  AQPMKLHGSSLSKPA----KLYRGVRQRHWGKWVAEIRLPRNRTRLWLGTFDTAEEAAMA  155

Query  633  YDREAYRLRGAKARLNFPHL  692
            YD+ AYRLRG  ARLNFPHL
Sbjct  156  YDKAAYRLRGDYARLNFPHL  175



>gb|AFP90317.1| transcription factor 2 [Pinus tabuliformis]
Length=330

 Score =   115 bits (289),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 55/80 (69%), Positives = 63/80 (79%), Gaps = 4/80 (5%)
 Frame = +3

Query  453  AGPIGLGHDGLNEAASPLPKLYRGVRQRHLGRWVAEIRLPHNRARLWLGTFDSAEDAALA  632
            A P+ L    L++ A    KLYRGVRQRH G+WVAEIRLP NR RLWLGTFD+AE+AA+A
Sbjct  100  AQPMKLHGSSLSKPA----KLYRGVRQRHWGKWVAEIRLPRNRTRLWLGTFDTAEEAAMA  155

Query  633  YDREAYRLRGAKARLNFPHL  692
            YD+ AYRLRG  ARLNFPHL
Sbjct  156  YDKAAYRLRGDYARLNFPHL  175



>ref|XP_003541916.1| PREDICTED: ethylene-responsive transcription factor ERF053-like 
[Glycine max]
Length=419

 Score =   116 bits (291),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 60/103 (58%), Positives = 66/103 (64%), Gaps = 10/103 (10%)
 Frame = +3

Query  510  KLYRGVRQRHLGRWVAEIRLPHNRARLWLGTFDSAEDAALAYDREAYRLRGAKARLNFPH  689
            KLYRGVRQRH G+WVAEIRLP NR RLWLGTFD+AEDAA+AYDREA++ RG  ARLNFP 
Sbjct  217  KLYRGVRQRHWGKWVAEIRLPRNRTRLWLGTFDTAEDAAMAYDREAFKQRGENARLNFPE  276

Query  690  LFLDGALHEDLE----------TATQKEAKPKQITSGNIIESN  788
            LF +    E  E           A Q E  P       I ESN
Sbjct  277  LFFNKDKKEQGEEEASSPVLSAIAKQNEPPPAHHRDVTIEESN  319



>gb|AFP90292.1| transcription factor 2 [Pinus densata]
Length=328

 Score =   115 bits (289),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 55/80 (69%), Positives = 63/80 (79%), Gaps = 4/80 (5%)
 Frame = +3

Query  453  AGPIGLGHDGLNEAASPLPKLYRGVRQRHLGRWVAEIRLPHNRARLWLGTFDSAEDAALA  632
            A P+ L    L++ A    KLYRGVRQRH G+WVAEIRLP NR RLWLGTFD+AE+AA+A
Sbjct  100  AQPMKLHGSSLSKPA----KLYRGVRQRHWGKWVAEIRLPRNRTRLWLGTFDTAEEAAMA  155

Query  633  YDREAYRLRGAKARLNFPHL  692
            YD+ AYRLRG  ARLNFPHL
Sbjct  156  YDKAAYRLRGDYARLNFPHL  175



>gb|AFP90288.1| transcription factor 2 [Pinus densata]
 gb|AFP90289.1| transcription factor 2 [Pinus densata]
 gb|AFP90290.1| transcription factor 2 [Pinus densata]
 gb|AFP90298.1| transcription factor 2 [Pinus tabuliformis]
 gb|AFP90304.1| transcription factor 2 [Pinus tabuliformis]
Length=328

 Score =   115 bits (289),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 55/80 (69%), Positives = 63/80 (79%), Gaps = 4/80 (5%)
 Frame = +3

Query  453  AGPIGLGHDGLNEAASPLPKLYRGVRQRHLGRWVAEIRLPHNRARLWLGTFDSAEDAALA  632
            A P+ L    L++ A    KLYRGVRQRH G+WVAEIRLP NR RLWLGTFD+AE+AA+A
Sbjct  100  AQPMKLHGSSLSKPA----KLYRGVRQRHWGKWVAEIRLPRNRTRLWLGTFDTAEEAAMA  155

Query  633  YDREAYRLRGAKARLNFPHL  692
            YD+ AYRLRG  ARLNFPHL
Sbjct  156  YDKAAYRLRGDYARLNFPHL  175



>gb|AFP90306.1| transcription factor 2 [Pinus densata]
Length=330

 Score =   115 bits (289),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 55/80 (69%), Positives = 63/80 (79%), Gaps = 4/80 (5%)
 Frame = +3

Query  453  AGPIGLGHDGLNEAASPLPKLYRGVRQRHLGRWVAEIRLPHNRARLWLGTFDSAEDAALA  632
            A P+ L    L++ A    KLYRGVRQRH G+WVAEIRLP NR RLWLGTFD+AE+AA+A
Sbjct  100  AQPMKLHGSSLSKPA----KLYRGVRQRHWGKWVAEIRLPRNRTRLWLGTFDTAEEAAMA  155

Query  633  YDREAYRLRGAKARLNFPHL  692
            YD+ AYRLRG  ARLNFPHL
Sbjct  156  YDKAAYRLRGDYARLNFPHL  175



>gb|AFP90301.1| transcription factor 2 [Pinus tabuliformis]
Length=328

 Score =   115 bits (289),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 55/80 (69%), Positives = 63/80 (79%), Gaps = 4/80 (5%)
 Frame = +3

Query  453  AGPIGLGHDGLNEAASPLPKLYRGVRQRHLGRWVAEIRLPHNRARLWLGTFDSAEDAALA  632
            A P+ L    L++ A    KLYRGVRQRH G+WVAEIRLP NR RLWLGTFD+AE+AA+A
Sbjct  100  AQPMKLHGSSLSKPA----KLYRGVRQRHWGKWVAEIRLPRNRTRLWLGTFDTAEEAAMA  155

Query  633  YDREAYRLRGAKARLNFPHL  692
            YD+ AYRLRG  ARLNFPHL
Sbjct  156  YDKAAYRLRGDYARLNFPHL  175



>ref|XP_011090520.1| PREDICTED: ethylene-responsive transcription factor ERF060 [Sesamum 
indicum]
Length=322

 Score =   115 bits (289),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 50/61 (82%), Positives = 55/61 (90%), Gaps = 0/61 (0%)
 Frame = +3

Query  510  KLYRGVRQRHLGRWVAEIRLPHNRARLWLGTFDSAEDAALAYDREAYRLRGAKARLNFPH  689
            KLYRGVRQRH G+WVAEIRLP NR RLWLGTFD+AE+AALAYD+ AY+LRG  ARLNFPH
Sbjct  122  KLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTAEEAALAYDKAAYKLRGEFARLNFPH  181

Query  690  L  692
            L
Sbjct  182  L  182



>ref|XP_011097593.1| PREDICTED: ethylene-responsive transcription factor RAP2-4 [Sesamum 
indicum]
Length=369

 Score =   116 bits (290),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 51/61 (84%), Positives = 55/61 (90%), Gaps = 0/61 (0%)
 Frame = +3

Query  510  KLYRGVRQRHLGRWVAEIRLPHNRARLWLGTFDSAEDAALAYDREAYRLRGAKARLNFPH  689
            KLYRGVRQRH G+WVAEIRLP NR RLWLGTFD+AEDAALAYD+ AY+LRG  ARLNFPH
Sbjct  171  KLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTAEDAALAYDKAAYKLRGEFARLNFPH  230

Query  690  L  692
            L
Sbjct  231  L  231



>gb|AFP90312.1| transcription factor 2 [Pinus tabuliformis]
Length=330

 Score =   115 bits (289),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 55/80 (69%), Positives = 63/80 (79%), Gaps = 4/80 (5%)
 Frame = +3

Query  453  AGPIGLGHDGLNEAASPLPKLYRGVRQRHLGRWVAEIRLPHNRARLWLGTFDSAEDAALA  632
            A P+ L    L++ A    KLYRGVRQRH G+WVAEIRLP NR RLWLGTFD+AE+AA+A
Sbjct  100  AQPMKLHGSSLSKPA----KLYRGVRQRHWGKWVAEIRLPRNRTRLWLGTFDTAEEAAMA  155

Query  633  YDREAYRLRGAKARLNFPHL  692
            YD+ AYRLRG  ARLNFPHL
Sbjct  156  YDKAAYRLRGDYARLNFPHL  175



>gb|AFP90332.1| transcription factor 2 [Pinus tabuliformis]
Length=330

 Score =   115 bits (289),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 55/80 (69%), Positives = 63/80 (79%), Gaps = 4/80 (5%)
 Frame = +3

Query  453  AGPIGLGHDGLNEAASPLPKLYRGVRQRHLGRWVAEIRLPHNRARLWLGTFDSAEDAALA  632
            A P+ L    L++ A    KLYRGVRQRH G+WVAEIRLP NR RLWLGTFD+AE+AA+A
Sbjct  100  AQPMKLHGSSLSKPA----KLYRGVRQRHWGKWVAEIRLPRNRTRLWLGTFDTAEEAAMA  155

Query  633  YDREAYRLRGAKARLNFPHL  692
            YD+ AYRLRG  ARLNFPHL
Sbjct  156  YDKAAYRLRGDYARLNFPHL  175



>gb|AFP90333.1| transcription factor 2 [Pinus tabuliformis]
Length=330

 Score =   115 bits (289),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 50/61 (82%), Positives = 55/61 (90%), Gaps = 0/61 (0%)
 Frame = +3

Query  510  KLYRGVRQRHLGRWVAEIRLPHNRARLWLGTFDSAEDAALAYDREAYRLRGAKARLNFPH  689
            KLYRGVRQRH G+WVAEIRLP NR RLWLGTFD+AE+AA+AYD+ AYRLRG  ARLNFPH
Sbjct  115  KLYRGVRQRHWGKWVAEIRLPRNRTRLWLGTFDTAEEAAMAYDKAAYRLRGDYARLNFPH  174

Query  690  L  692
            L
Sbjct  175  L  175



>gb|AFP90330.1| transcription factor 2 [Pinus densata]
Length=330

 Score =   115 bits (289),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 55/80 (69%), Positives = 63/80 (79%), Gaps = 4/80 (5%)
 Frame = +3

Query  453  AGPIGLGHDGLNEAASPLPKLYRGVRQRHLGRWVAEIRLPHNRARLWLGTFDSAEDAALA  632
            A P+ L    L++ A    KLYRGVRQRH G+WVAEIRLP NR RLWLGTFD+AE+AA+A
Sbjct  100  AQPMKLHGSSLSKPA----KLYRGVRQRHWGKWVAEIRLPRNRTRLWLGTFDTAEEAAMA  155

Query  633  YDREAYRLRGAKARLNFPHL  692
            YD+ AYRLRG  ARLNFPHL
Sbjct  156  YDKAAYRLRGDYARLNFPHL  175



>gb|AFP90307.1| transcription factor 2 [Pinus densata]
Length=330

 Score =   115 bits (289),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 55/80 (69%), Positives = 63/80 (79%), Gaps = 4/80 (5%)
 Frame = +3

Query  453  AGPIGLGHDGLNEAASPLPKLYRGVRQRHLGRWVAEIRLPHNRARLWLGTFDSAEDAALA  632
            A P+ L    L++ A    KLYRGVRQRH G+WVAEIRLP NR RLWLGTFD+AE+AA+A
Sbjct  100  AQPMKLHGSSLSKPA----KLYRGVRQRHWGKWVAEIRLPRNRTRLWLGTFDTAEEAAMA  155

Query  633  YDREAYRLRGAKARLNFPHL  692
            YD+ AYRLRG  ARLNFPHL
Sbjct  156  YDKAAYRLRGDYARLNFPHL  175



>gb|AFP90293.1| transcription factor 2 [Pinus densata]
Length=328

 Score =   115 bits (289),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 55/80 (69%), Positives = 63/80 (79%), Gaps = 4/80 (5%)
 Frame = +3

Query  453  AGPIGLGHDGLNEAASPLPKLYRGVRQRHLGRWVAEIRLPHNRARLWLGTFDSAEDAALA  632
            A P+ L    L++ A    KLYRGVRQRH G+WVAEIRLP NR RLWLGTFD+AE+AA+A
Sbjct  100  AQPMKLHGSSLSKPA----KLYRGVRQRHWGKWVAEIRLPRNRTRLWLGTFDTAEEAAMA  155

Query  633  YDREAYRLRGAKARLNFPHL  692
            YD+ AYRLRG  ARLNFPHL
Sbjct  156  YDKAAYRLRGDYARLNFPHL  175



>ref|XP_004299631.1| PREDICTED: ethylene-responsive transcription factor RAP2-4-like 
[Fragaria vesca subsp. vesca]
Length=372

 Score =   116 bits (290),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 57/92 (62%), Positives = 69/92 (75%), Gaps = 5/92 (5%)
 Frame = +3

Query  438  ISWQSAGPIGLGHDGLNEAASPLP-KLYRGVRQRHLGRWVAEIRLPHNRARLWLGTFDSA  614
            +S+ S  P+ +   G    + P P KLYRGVRQRH G+WVAEIRLP NR RLWLGTFD+A
Sbjct  150  LSFLSPKPVPMKQSG----SPPKPTKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTA  205

Query  615  EDAALAYDREAYRLRGAKARLNFPHLFLDGAL  710
            E+AALAYD+ AY+LRG  ARLNFPHL   G++
Sbjct  206  EEAALAYDKAAYKLRGDFARLNFPHLKHTGSV  237



>gb|ADE41115.1| AP2 domain class transcription factor [Malus domestica]
Length=365

 Score =   116 bits (290),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 51/67 (76%), Positives = 59/67 (88%), Gaps = 0/67 (0%)
 Frame = +3

Query  510  KLYRGVRQRHLGRWVAEIRLPHNRARLWLGTFDSAEDAALAYDREAYRLRGAKARLNFPH  689
            KLYRGVRQRH G+WVAEIRLP NR RLWLGTFD+AE+AALAYD+ AY+LRG  ARLNFPH
Sbjct  183  KLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTAEEAALAYDKAAYKLRGDFARLNFPH  242

Query  690  LFLDGAL  710
            L  +G++
Sbjct  243  LRHNGSV  249



>emb|CDX81987.1| BnaC08g36140D [Brassica napus]
Length=313

 Score =   115 bits (288),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 84/187 (45%), Positives = 102/187 (55%), Gaps = 25/187 (13%)
 Frame = +3

Query  192  EEQDHDLSDRPLKKMKNI----PQLLSSSTSHPTHKPLIsppqppsfrfpfALHDTIPHP  359
            E     LS R L+K++ I    P LLSSS   P       PP   +F F  A  +     
Sbjct  51   ETSSTTLSQRSLRKIRTIDRHNPYLLSSSCVTPDQP----PPPTTAFPFSLAPSNIQNQQ  106

Query  360  LFHH---QTMISFAPQQQLQSSSGCGNDQISWQSAGPIGLGHDGLN-----EAASPL---  506
            LF +     MISF PQ+Q+         Q        +    D LN     + A P+   
Sbjct  107  LFSYPRQMQMISFGPQRQVYPFLNAHQQQ----QQHMMQYWRDILNLPLPLQLARPIQPF  162

Query  507  --PKLYRGVRQRHLGRWVAEIRLPHNRARLWLGTFDSAEDAALAYDREAYRLRGAKARLN  680
               KLYRGVRQRH G+WVAEIR P NR RLWLGTFD+AE+AA+AYDREA++LRG  ARLN
Sbjct  163  SATKLYRGVRQRHWGKWVAEIRKPRNRTRLWLGTFDTAEEAAMAYDREAFKLRGETARLN  222

Query  681  FPHLFLD  701
            FP LFL+
Sbjct  223  FPDLFLN  229



>gb|AFP90291.1| transcription factor 2 [Pinus densata]
Length=328

 Score =   115 bits (288),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 50/61 (82%), Positives = 55/61 (90%), Gaps = 0/61 (0%)
 Frame = +3

Query  510  KLYRGVRQRHLGRWVAEIRLPHNRARLWLGTFDSAEDAALAYDREAYRLRGAKARLNFPH  689
            KLYRGVRQRH G+WVAEIRLP NR RLWLGTFD+AE+AA+AYD+ AYRLRG  ARLNFPH
Sbjct  115  KLYRGVRQRHWGKWVAEIRLPRNRTRLWLGTFDTAEEAAMAYDKAAYRLRGDYARLNFPH  174

Query  690  L  692
            L
Sbjct  175  L  175



>ref|NP_001053379.1| Os04g0529100 [Oryza sativa Japonica Group]
 dbj|BAF15293.1| Os04g0529100 [Oryza sativa Japonica Group]
Length=377

 Score =   116 bits (290),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 52/66 (79%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = +3

Query  501  PLPKLYRGVRQRHLGRWVAEIRLPHNRARLWLGTFDSAEDAALAYDREAYRLRGAKARLN  680
            P  KLYRGVRQRH G+WVAEIRLP NR RLWLGTFD+AEDAA+AYDREA++LRG  ARLN
Sbjct  121  PPQKLYRGVRQRHWGKWVAEIRLPRNRTRLWLGTFDTAEDAAMAYDREAFKLRGENARLN  180

Query  681  FPHLFL  698
            FP  FL
Sbjct  181  FPDRFL  186



>gb|AFP90303.1| transcription factor 2 [Pinus tabuliformis]
Length=328

 Score =   115 bits (288),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 55/80 (69%), Positives = 63/80 (79%), Gaps = 4/80 (5%)
 Frame = +3

Query  453  AGPIGLGHDGLNEAASPLPKLYRGVRQRHLGRWVAEIRLPHNRARLWLGTFDSAEDAALA  632
            A P+ L    L++ A    KLYRGVRQRH G+WVAEIRLP NR RLWLGTFD+AE+AA+A
Sbjct  100  AQPMKLHGSSLSKPA----KLYRGVRQRHWGKWVAEIRLPRNRTRLWLGTFDTAEEAAMA  155

Query  633  YDREAYRLRGAKARLNFPHL  692
            YD+ AYRLRG  ARLNFPHL
Sbjct  156  YDKAAYRLRGDYARLNFPHL  175



>ref|XP_010105895.1| Ethylene-responsive transcription factor [Morus notabilis]
 gb|AHJ25985.1| dehydration responsive element binding transcription factor [Morus 
notabilis]
 gb|EXC06714.1| Ethylene-responsive transcription factor [Morus notabilis]
Length=354

 Score =   115 bits (289),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 61/100 (61%), Positives = 68/100 (68%), Gaps = 13/100 (13%)
 Frame = +3

Query  396  QQQLQSSSGCGNDQISWQSAGPIGLGHDGLNEAASPLP-KLYRGVRQRHLGRWVAEIRLP  572
            QQQL S S  G   +  +  G            + P P KLYRGVRQRH G+WVAEIRLP
Sbjct  138  QQQLHSLSFLGPRPVPMKQVG------------SPPKPTKLYRGVRQRHWGKWVAEIRLP  185

Query  573  HNRARLWLGTFDSAEDAALAYDREAYRLRGAKARLNFPHL  692
             NR RLWLGTFD+AE+AALAYDR AY+LRG  ARLNFPHL
Sbjct  186  KNRTRLWLGTFDTAEEAALAYDRAAYKLRGDFARLNFPHL  225



>gb|AFP90320.1| transcription factor 2 [Pinus densata]
Length=330

 Score =   115 bits (288),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 55/80 (69%), Positives = 63/80 (79%), Gaps = 4/80 (5%)
 Frame = +3

Query  453  AGPIGLGHDGLNEAASPLPKLYRGVRQRHLGRWVAEIRLPHNRARLWLGTFDSAEDAALA  632
            A P+ L    L++ A    KLYRGVRQRH G+WVAEIRLP NR RLWLGTFD+AE+AA+A
Sbjct  100  AQPMKLHGSSLSKPA----KLYRGVRQRHWGKWVAEIRLPRNRTRLWLGTFDTAEEAAMA  155

Query  633  YDREAYRLRGAKARLNFPHL  692
            YD+ AYRLRG  ARLNFPHL
Sbjct  156  YDKAAYRLRGDYARLNFPHL  175



>gb|KHN36624.1| Ethylene-responsive transcription factor ERF053 [Glycine soja]
Length=414

 Score =   116 bits (290),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 50/64 (78%), Positives = 56/64 (88%), Gaps = 0/64 (0%)
 Frame = +3

Query  510  KLYRGVRQRHLGRWVAEIRLPHNRARLWLGTFDSAEDAALAYDREAYRLRGAKARLNFPH  689
            KLYRGVRQRH G+WVAEIRLP NR RLWLGTFD+AEDAA+AYDREA++ RG  ARLNFP 
Sbjct  218  KLYRGVRQRHWGKWVAEIRLPRNRTRLWLGTFDTAEDAAMAYDREAFKQRGENARLNFPE  277

Query  690  LFLD  701
            LF +
Sbjct  278  LFFN  281



>ref|XP_006355363.1| PREDICTED: ethylene-responsive transcription factor RAP2-4-like 
[Solanum tuberosum]
Length=370

 Score =   115 bits (289),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 59/105 (56%), Positives = 71/105 (68%), Gaps = 12/105 (11%)
 Frame = +3

Query  510  KLYRGVRQRHLGRWVAEIRLPHNRARLWLGTFDSAEDAALAYDREAYRLRGAKARLNFPH  689
            KLYRGVRQRH G+WVAEIRLP NR RLWLGTFD+AE+AALAYD+ AY+LRG  ARLNFPH
Sbjct  165  KLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTAEEAALAYDKAAYKLRGEFARLNFPH  224

Query  690  LF---------LDGALHEDLETATQKEAKPKQITSGNIIESNNTK  797
            L          L  ++   L+   Q  A PK   S ++   +N+K
Sbjct  225  LRHQLNNEFSPLHSSVDAKLQAICQSLANPK---SDDLCSKSNSK  266



>ref|XP_002533146.1| DNA binding protein, putative [Ricinus communis]
 gb|EEF29242.1| DNA binding protein, putative [Ricinus communis]
Length=374

 Score =   116 bits (290),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 55/73 (75%), Positives = 61/73 (84%), Gaps = 1/73 (1%)
 Frame = +3

Query  492  AASPLP-KLYRGVRQRHLGRWVAEIRLPHNRARLWLGTFDSAEDAALAYDREAYRLRGAK  668
            A+ P P KLYRGVRQRH G+WVAEIRLP NR RLWLGTFD+AE+AALAYD+ AY+LRG  
Sbjct  168  ASPPKPTKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTAEEAALAYDKAAYKLRGEF  227

Query  669  ARLNFPHLFLDGA  707
            ARLNFPHL   GA
Sbjct  228  ARLNFPHLRHQGA  240



>ref|XP_011016241.1| PREDICTED: ethylene-responsive transcription factor RAP2-13 [Populus 
euphratica]
Length=343

 Score =   115 bits (289),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 61/114 (54%), Positives = 73/114 (64%), Gaps = 11/114 (10%)
 Frame = +3

Query  366  HHQTMISFAPQQQLQSSSGCGNDQISWQSAGPIGLGHDGLNEAASPLPKLYRGVRQRHLG  545
            HH  +      QQ Q+        + + S  PI +   G    A+   KLYRGVRQRH G
Sbjct  124  HHSNLSYLQAYQQPQT--------LKFLSPKPIPMKQIGTPPKAT---KLYRGVRQRHWG  172

Query  546  RWVAEIRLPHNRARLWLGTFDSAEDAALAYDREAYRLRGAKARLNFPHLFLDGA  707
            +WVAEIRLP NR RLWLGTFD+AE+AALAYDR AY+LRG  ARLNFP+L   G+
Sbjct  173  KWVAEIRLPKNRTRLWLGTFDTAEEAALAYDRAAYKLRGDFARLNFPNLLHQGS  226



>ref|NP_179685.1| ethylene-responsive transcription factor ERF053 [Arabidopsis 
thaliana]
 sp|Q9SKT1.1|ERF53_ARATH RecName: Full=Ethylene-responsive transcription factor ERF053 
[Arabidopsis thaliana]
 gb|AAD20907.1| AP2 domain transcription factor [Arabidopsis thaliana]
 gb|AAL32921.1| AP2 domain transcription factor [Arabidopsis thaliana]
 gb|AAM10221.1| AP2 domain transcription factor [Arabidopsis thaliana]
 gb|AEC07091.1| ethylene-responsive transcription factor ERF053 [Arabidopsis 
thaliana]
Length=336

 Score =   115 bits (288),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 50/64 (78%), Positives = 57/64 (89%), Gaps = 0/64 (0%)
 Frame = +3

Query  510  KLYRGVRQRHLGRWVAEIRLPHNRARLWLGTFDSAEDAALAYDREAYRLRGAKARLNFPH  689
            KLYRGVRQRH G+WVAEIR P NR RLWLGTFD+AE+AA+AYDREA++LRG  ARLNFP 
Sbjct  185  KLYRGVRQRHWGKWVAEIRKPRNRTRLWLGTFDTAEEAAMAYDREAFKLRGETARLNFPE  244

Query  690  LFLD  701
            LFL+
Sbjct  245  LFLN  248



>gb|ABJ09421.1| putative DRE-binding protein DREB1 [Aloe vera]
Length=211

 Score =   113 bits (282),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 52/66 (79%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = +3

Query  510  KLYRGVRQRHLGRWVAEIRLPHNRARLWLGTFDSAEDAALAYDREAYRLRGAKARLNFPH  689
            KLYRGVRQRH G+WVAEIRLP NR RLWLGTFD+AE+AALAYD+ AY+LRG  ARLNFPH
Sbjct  35   KLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTAEEAALAYDKAAYKLRGDYARLNFPH  94

Query  690  LFLDGA  707
            L   GA
Sbjct  95   LKHTGA  100



>ref|XP_008375600.1| PREDICTED: LOW QUALITY PROTEIN: ethylene-responsive transcription 
factor RAP2-13-like [Malus domestica]
Length=365

 Score =   115 bits (289),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 51/67 (76%), Positives = 59/67 (88%), Gaps = 0/67 (0%)
 Frame = +3

Query  510  KLYRGVRQRHLGRWVAEIRLPHNRARLWLGTFDSAEDAALAYDREAYRLRGAKARLNFPH  689
            KLYRGVRQRH G+WVAEIRLP NR RLWLGTFD+AE+AALAYD+ AY+LRG  ARLNFPH
Sbjct  183  KLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTAEEAALAYDKAAYKLRGDFARLNFPH  242

Query  690  LFLDGAL  710
            L  +G++
Sbjct  243  LRHNGSV  249



>gb|AFV60736.1| ethylene-responsive transcription factor 4 [Carica papaya]
Length=430

 Score =   116 bits (290),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 50/64 (78%), Positives = 56/64 (88%), Gaps = 0/64 (0%)
 Frame = +3

Query  510  KLYRGVRQRHLGRWVAEIRLPHNRARLWLGTFDSAEDAALAYDREAYRLRGAKARLNFPH  689
            KLYRGVRQRH G+WVAEIRLP NR RLWLGTFD+AEDAA+AYDREA++LRG  ARLNFP 
Sbjct  212  KLYRGVRQRHWGKWVAEIRLPRNRTRLWLGTFDTAEDAAMAYDREAFKLRGENARLNFPE  271

Query  690  LFLD  701
             F +
Sbjct  272  RFFN  275



>gb|AFP90305.1| transcription factor 2 [Pinus densata]
Length=328

 Score =   115 bits (288),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 50/61 (82%), Positives = 55/61 (90%), Gaps = 0/61 (0%)
 Frame = +3

Query  510  KLYRGVRQRHLGRWVAEIRLPHNRARLWLGTFDSAEDAALAYDREAYRLRGAKARLNFPH  689
            KLYRGVRQRH G+WVAEIRLP NR RLWLGTFD+AE+AA+AYD+ AYRLRG  ARLNFPH
Sbjct  115  KLYRGVRQRHWGKWVAEIRLPRNRTRLWLGTFDTAEEAAMAYDKAAYRLRGDYARLNFPH  174

Query  690  L  692
            L
Sbjct  175  L  175



>ref|XP_008663401.1| PREDICTED: ethylene-responsive transcription factor ERF053-like 
[Zea mays]
 gb|AFW58935.1| putative AP2/EREBP transcription factor superfamily protein [Zea 
mays]
 gb|AIB05155.1| AP2-EREBP transcription factor, partial [Zea mays]
Length=404

 Score =   116 bits (290),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 53/72 (74%), Positives = 58/72 (81%), Gaps = 0/72 (0%)
 Frame = +3

Query  483  LNEAASPLPKLYRGVRQRHLGRWVAEIRLPHNRARLWLGTFDSAEDAALAYDREAYRLRG  662
            L     PL KLYRGVRQRH G+WVAEIRLP +R RLWLGTFDSAEDAA+AYDREA++LRG
Sbjct  164  LRAPPPPLQKLYRGVRQRHWGKWVAEIRLPRDRTRLWLGTFDSAEDAAMAYDREAFKLRG  223

Query  663  AKARLNFPHLFL  698
              ARLNFP  F 
Sbjct  224  ENARLNFPDRFF  235



>ref|XP_008445348.1| PREDICTED: ethylene-responsive transcription factor RAP2-4-like 
[Cucumis melo]
Length=362

 Score =   115 bits (289),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 62/105 (59%), Positives = 72/105 (69%), Gaps = 6/105 (6%)
 Frame = +3

Query  396  QQQLQSSSGCGNDQISWQSAGPIG--LGHDG--LNEAASP--LPKLYRGVRQRHLGRWVA  557
            Q Q+Q   G  N+Q+    +   G  LG  G  +    SP    KLYRGVRQRH G+WVA
Sbjct  115  QTQIQPVWGQINNQVVRNQSNTAGNLLGPKGIPMKHVGSPPKSTKLYRGVRQRHWGKWVA  174

Query  558  EIRLPHNRARLWLGTFDSAEDAALAYDREAYRLRGAKARLNFPHL  692
            EIRLP NR RLWLGTFD+AE+AALAYD+ AY+LRG  ARLNFPHL
Sbjct  175  EIRLPRNRTRLWLGTFDTAEEAALAYDKAAYKLRGDFARLNFPHL  219



>ref|XP_006390026.1| hypothetical protein EUTSA_v10018771mg [Eutrema salsugineum]
 dbj|BAJ34031.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ27312.1| hypothetical protein EUTSA_v10018771mg [Eutrema salsugineum]
Length=356

 Score =   115 bits (289),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 62/126 (49%), Positives = 78/126 (62%), Gaps = 18/126 (14%)
 Frame = +3

Query  348  IPHPLFHHQTMIS-----FAPQQQLQSSSGCGNDQISWQSAGPIGLGHDGLNEAASPLP-  509
            +P P  HH + I+      +P+  L   SG      ++ S              + P P 
Sbjct  118  LPLPPTHHHSQINSFSNLLSPKPLLMKQSGVAGSCFAYGSG------------VSPPKPT  165

Query  510  KLYRGVRQRHLGRWVAEIRLPHNRARLWLGTFDSAEDAALAYDREAYRLRGAKARLNFPH  689
            KLYRGVRQRH G+WVAEIRLP NR RLWLGTFD+AE+AALAYD+ AY+LRG  ARLNFP+
Sbjct  166  KLYRGVRQRHWGKWVAEIRLPRNRTRLWLGTFDTAEEAALAYDKAAYKLRGDFARLNFPN  225

Query  690  LFLDGA  707
            L  +G+
Sbjct  226  LRHNGS  231



>gb|ACY25088.1| DREB1C [Gossypium hirsutum]
Length=351

 Score =   115 bits (289),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 68/136 (50%), Positives = 82/136 (60%), Gaps = 8/136 (6%)
 Frame = +3

Query  510  KLYRGVRQRHLGRWVAEIRLPHNRARLWLGTFDSAEDAALAYDREAYRLRGAKARLNFPH  689
            KLYRGVRQRH G+WVAEIRLP NR RLWLGTFD+AE+AALAYD+ AY+LRG  ARLNFPH
Sbjct  149  KLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTAEEAALAYDKAAYKLRGEFARLNFPH  208

Query  690  LFLDGALHEDLETATQK------EAKPKQITSGNIIESNNTKCSGISAHEPKTIDDDYVN  851
            L   GA H   E    K      +AK + I      + N+ K   +    PK   D  V 
Sbjct  209  LKHQGA-HISGEFGDYKPLHSAVDAKLQAICQSLQKQENSGKGCSVPDSNPKVEFDYPVK  267

Query  852  HDR-DVEPEWAGDELE  896
             +  D  P +A  ++E
Sbjct  268  REEFDQSPRFASPKVE  283



>gb|EPS73079.1| hypothetical protein M569_01680, partial [Genlisea aurea]
Length=202

 Score =   112 bits (281),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 54/87 (62%), Positives = 66/87 (76%), Gaps = 9/87 (10%)
 Frame = +3

Query  510  KLYRGVRQRHLGRWVAEIRLPHNRARLWLGTFDSAEDAALAYDREAYRLRGAKARLNFPH  689
            KLYRGVRQRH G+WVAEIRLP NR RLWLGTFD+AE+AA+AYDREA++LRG  A+LNFP 
Sbjct  72   KLYRGVRQRHWGKWVAEIRLPRNRTRLWLGTFDTAEEAAMAYDREAFKLRGENAKLNFPQ  131

Query  690  LFLDGALH--------EDLETATQKEA  746
             F+ G +H         ++ETA +  A
Sbjct  132  HFV-GKIHNPPPTENSSEMETAAETSA  157



>gb|ABB89755.1| putative dehydration-responsive element binding protein [Broussonetia 
papyrifera]
Length=330

 Score =   115 bits (288),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 52/66 (79%), Positives = 58/66 (88%), Gaps = 0/66 (0%)
 Frame = +3

Query  510  KLYRGVRQRHLGRWVAEIRLPHNRARLWLGTFDSAEDAALAYDREAYRLRGAKARLNFPH  689
            KLYRGVRQRH G+WVAEIRLP NR RLWLGTFD+AE+AALAYD+ AY+LRG  ARLNFPH
Sbjct  133  KLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTAEEAALAYDKAAYKLRGDFARLNFPH  192

Query  690  LFLDGA  707
            L  +GA
Sbjct  193  LRHEGA  198



>gb|AFP90321.1| transcription factor 2 [Pinus densata]
Length=330

 Score =   115 bits (288),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 55/80 (69%), Positives = 63/80 (79%), Gaps = 4/80 (5%)
 Frame = +3

Query  453  AGPIGLGHDGLNEAASPLPKLYRGVRQRHLGRWVAEIRLPHNRARLWLGTFDSAEDAALA  632
            A P+ L    L++ A    KLYRGVRQRH G+WVAEIRLP NR RLWLGTFD+AE+AA+A
Sbjct  100  AQPMKLHGSSLSKPA----KLYRGVRQRHWGKWVAEIRLPRNRTRLWLGTFDTAEEAAMA  155

Query  633  YDREAYRLRGAKARLNFPHL  692
            YD+ AYRLRG  ARLNFPHL
Sbjct  156  YDKAAYRLRGDYARLNFPHL  175



>ref|XP_008362598.1| PREDICTED: LOW QUALITY PROTEIN: ethylene-responsive transcription 
factor RAP2-4-like [Malus domestica]
Length=365

 Score =   115 bits (289),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 51/67 (76%), Positives = 59/67 (88%), Gaps = 0/67 (0%)
 Frame = +3

Query  510  KLYRGVRQRHLGRWVAEIRLPHNRARLWLGTFDSAEDAALAYDREAYRLRGAKARLNFPH  689
            KLYRGVRQRH G+WVAEIRLP NR RLWLGTFD+AE+AALAYD+ AY+LRG  ARLNFPH
Sbjct  183  KLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTAEEAALAYDKAAYKLRGDFARLNFPH  242

Query  690  LFLDGAL  710
            L  +G++
Sbjct  243  LRHNGSV  249



>ref|XP_011022769.1| PREDICTED: ethylene-responsive transcription factor RAP2-4-like 
[Populus euphratica]
Length=371

 Score =   115 bits (289),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 68/142 (48%), Positives = 83/142 (58%), Gaps = 15/142 (11%)
 Frame = +3

Query  510  KLYRGVRQRHLGRWVAEIRLPHNRARLWLGTFDSAEDAALAYDREAYRLRGAKARLNFPH  689
            KLYRGVRQRH G+WVAEIRLP NR RLWLGTFD+AE+AALAYD+ AY+LRG  ARLNFPH
Sbjct  171  KLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTAEEAALAYDKAAYKLRGEFARLNFPH  230

Query  690  LFLDGA-----------LHED----LETATQKEAKPKQITSGNIIESNNTKCSGISAHEP  824
            L   GA           LH      L+   Q     KQ  +G     +++K +  +  + 
Sbjct  231  LRHQGAHVSGEFGDYKPLHSSVDAKLQAICQSLGLQKQGETGEPCSVSDSKKTVSAPLQV  290

Query  825  KTIDDDYVNHDRDVEPEWAGDE  890
            K  DD  +  +   E E  GDE
Sbjct  291  KIEDDCSLQGELKREFENLGDE  312



>ref|XP_009349966.1| PREDICTED: ethylene-responsive transcription factor ERF060-like 
[Pyrus x bretschneideri]
Length=323

 Score =   115 bits (287),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 53/70 (76%), Positives = 58/70 (83%), Gaps = 0/70 (0%)
 Frame = +3

Query  498  SPLPKLYRGVRQRHLGRWVAEIRLPHNRARLWLGTFDSAEDAALAYDREAYRLRGAKARL  677
            S L KLYRGVRQRH G+WVAEIRLP NR RLWLGTFD+AE+AALAYD+ A +LRG  ARL
Sbjct  127  SKLTKLYRGVRQRHWGKWVAEIRLPRNRTRLWLGTFDTAEEAALAYDKAALKLRGDFARL  186

Query  678  NFPHLFLDGA  707
            NFPHL   GA
Sbjct  187  NFPHLKQQGA  196



>ref|XP_004243339.1| PREDICTED: ethylene-responsive transcription factor ERF054 [Solanum 
lycopersicum]
Length=390

 Score =   115 bits (289),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 56/86 (65%), Positives = 63/86 (73%), Gaps = 5/86 (6%)
 Frame = +3

Query  510  KLYRGVRQRHLGRWVAEIRLPHNRARLWLGTFDSAEDAALAYDREAYRLRGAKARLNFPH  689
            KLYRGVRQRH G+WVAEIRLP NR RLWLGTFD+AEDAA+AYDREAY+LRG  A+LNFP 
Sbjct  179  KLYRGVRQRHWGKWVAEIRLPRNRTRLWLGTFDTAEDAAMAYDREAYKLRGDNAKLNFPE  238

Query  690  LFLDGALHEDLETATQKEAKPKQITS  767
             F+     E     T  EA    IT+
Sbjct  239  HFIGKDRGE-----TSTEANSSSITT  259



>ref|NP_001288047.1| ethylene-responsive transcription factor ERF060 [Malus domestica]
 ref|XP_008338614.1| PREDICTED: ethylene-responsive transcription factor ERF060 [Malus 
domestica]
 gb|ADZ28107.1| ethylene response factor 4 [Malus domestica]
Length=323

 Score =   115 bits (287),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 52/67 (78%), Positives = 58/67 (87%), Gaps = 0/67 (0%)
 Frame = +3

Query  510  KLYRGVRQRHLGRWVAEIRLPHNRARLWLGTFDSAEDAALAYDREAYRLRGAKARLNFPH  689
            KLYRGVRQRH G+WVAEIRLP NR RLWLGTFD+AE+AALAYD+ A++LRG  ARLNFPH
Sbjct  134  KLYRGVRQRHWGKWVAEIRLPRNRTRLWLGTFDTAEEAALAYDKAAFKLRGDFARLNFPH  193

Query  690  LFLDGAL  710
            L   GAL
Sbjct  194  LRHQGAL  200



>ref|XP_008352604.1| PREDICTED: LOW QUALITY PROTEIN: ethylene-responsive transcription 
factor ERF060-like [Malus domestica]
Length=329

 Score =   115 bits (287),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 52/67 (78%), Positives = 58/67 (87%), Gaps = 0/67 (0%)
 Frame = +3

Query  510  KLYRGVRQRHLGRWVAEIRLPHNRARLWLGTFDSAEDAALAYDREAYRLRGAKARLNFPH  689
            KLYRGVRQRH G+WVAEIRLP NR RLWLGTFD+AE+AALAYD+ A++LRG  ARLNFPH
Sbjct  134  KLYRGVRQRHWGKWVAEIRLPRNRTRLWLGTFDTAEEAALAYDKAAFKLRGDFARLNFPH  193

Query  690  LFLDGAL  710
            L   GAL
Sbjct  194  LRHQGAL  200



>ref|XP_006416222.1| hypothetical protein EUTSA_v10008326mg [Eutrema salsugineum]
 gb|ESQ34575.1| hypothetical protein EUTSA_v10008326mg [Eutrema salsugineum]
Length=298

 Score =   114 bits (286),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 55/86 (64%), Positives = 66/86 (77%), Gaps = 3/86 (3%)
 Frame = +3

Query  450  SAGPIGLGHDGLNEAASPLPKLYRGVRQRHLGRWVAEIRLPHNRARLWLGTFDSAEDAAL  629
            S  P+ +   G   AA+   KLYRGVRQRH G+WVAEIRLP NR RLWLGTFD+AE+AAL
Sbjct  90   SPKPVPMKQTG---AATKPTKLYRGVRQRHWGKWVAEIRLPRNRTRLWLGTFDTAEEAAL  146

Query  630  AYDREAYRLRGAKARLNFPHLFLDGA  707
            AYD+ AY+LRG  ARLNFP+L  +G+
Sbjct  147  AYDKAAYKLRGDFARLNFPNLRHNGS  172



>ref|XP_002285802.1| PREDICTED: ethylene-responsive transcription factor RAP2-4 [Vitis 
vinifera]
Length=367

 Score =   115 bits (288),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 69/157 (44%), Positives = 88/157 (56%), Gaps = 32/157 (20%)
 Frame = +3

Query  510  KLYRGVRQRHLGRWVAEIRLPHNRARLWLGTFDSAEDAALAYDREAYRLRGAKARLNFPH  689
            KLYRGVRQRH G+WVAEIRLP NR RLWLGTFD+AE+AALAYD+ AY+LRG  ARLNFP+
Sbjct  168  KLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTAEEAALAYDKAAYKLRGDFARLNFPN  227

Query  690  LFLDGA-----------LHEDLETA----------TQKEAKPKQITSGNIIESNNTKCSG  806
            L   G+           LH  ++            TQK+ KP Q       + + ++   
Sbjct  228  LRHQGSHIGGEFGDYKPLHSSVDAKLQAICQSLAETQKQGKPTQ------GKKSRSRAVA  281

Query  807  ISAHEPKTIDDDYV-----NHDRDVEPEWAGDELESD  902
             SA +P T+ +        + D  VEP  +    ESD
Sbjct  282  PSASQPVTVSESSTLSEQGSEDCKVEPTSSSMFTESD  318



>ref|XP_007205497.1| hypothetical protein PRUPE_ppa008234mg [Prunus persica]
 gb|EMJ06696.1| hypothetical protein PRUPE_ppa008234mg [Prunus persica]
Length=340

 Score =   115 bits (288),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 60/134 (45%), Positives = 80/134 (60%), Gaps = 13/134 (10%)
 Frame = +3

Query  510  KLYRGVRQRHLGRWVAEIRLPHNRARLWLGTFDSAEDAALAYDREAYRLRGAKARLNFPH  689
            KLYRGVRQRH G+WVAEIRLP NR RLWLGTFD+AE+AALAYD+ AY+LRG  ARLNFPH
Sbjct  145  KLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTAEEAALAYDKAAYKLRGDFARLNFPH  204

Query  690  LFLDGA-----------LHEDLETATQKEAKPKQITSGNIIESNNTKCSGISAHEPKTID  836
            L   GA           LH  ++   Q  A  + + + +  +    +   ++  +P    
Sbjct  205  LKHQGAHVSGDFGHYKPLHSSVDAKLQ--AICQSLAANSAKQGKTGELCSVAERKPAITS  262

Query  837  DDYVNHDRDVEPEW  878
               V+   +++ EW
Sbjct  263  PKEVSLKTELKSEW  276



>emb|CAD41199.2| OSJNBa0074L08.10 [Oryza sativa Japonica Group]
 emb|CAH67919.1| OSIGBa0115K01-H0319F09.25 [Oryza sativa Indica Group]
 gb|EAY94930.1| hypothetical protein OsI_16734 [Oryza sativa Indica Group]
 gb|EAZ31416.1| hypothetical protein OsJ_15549 [Oryza sativa Japonica Group]
Length=466

 Score =   116 bits (290),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 51/63 (81%), Positives = 56/63 (89%), Gaps = 0/63 (0%)
 Frame = +3

Query  510  KLYRGVRQRHLGRWVAEIRLPHNRARLWLGTFDSAEDAALAYDREAYRLRGAKARLNFPH  689
            KLYRGVRQRH G+WVAEIRLP NR RLWLGTFD+AEDAA+AYDREA++LRG  ARLNFP 
Sbjct  213  KLYRGVRQRHWGKWVAEIRLPRNRTRLWLGTFDTAEDAAMAYDREAFKLRGENARLNFPD  272

Query  690  LFL  698
             FL
Sbjct  273  RFL  275



>ref|NP_173638.1| ethylene-responsive transcription factor RAP2.4 [Arabidopsis 
thaliana]
 sp|Q9LM15.1|RA213_ARATH RecName: Full=Ethylene-responsive transcription factor RAP2-13; 
AltName: Full=Ethylene-responsive transcription factor ERF058; 
AltName: Full=Protein RELATED TO APETALA2 13 [Arabidopsis 
thaliana]
 gb|AAF87854.1|AC073942_8 Contains similarity to a cadmium-imduced protein AS30 from Arabidopsis 
thaliana gi|1168862 and contains an AP2 PF|00847 domain. 
EST gb|AI099641 comes from this gene [Arabidopsis thaliana]
 gb|AAN41307.1| putative AP2 domain containing protein RAP2 [Arabidopsis thaliana]
 gb|AEE30209.1| ethylene-responsive transcription factor ERF058 [Arabidopsis 
thaliana]
Length=261

 Score =   114 bits (284),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 55/81 (68%), Positives = 62/81 (77%), Gaps = 2/81 (2%)
 Frame = +3

Query  450  SAGPIGLGHDGLNEAASPLPKLYRGVRQRHLGRWVAEIRLPHNRARLWLGTFDSAEDAAL  629
            S  P+ +   G   AA P  KLYRGVRQRH G+WVAEIRLP NR RLWLGTFD+AE+AAL
Sbjct  63   SPKPVSMKQTG-TSAAKPT-KLYRGVRQRHWGKWVAEIRLPRNRTRLWLGTFDTAEEAAL  120

Query  630  AYDREAYRLRGAKARLNFPHL  692
            AYD+ AY+LRG  ARLNFP L
Sbjct  121  AYDKAAYKLRGDFARLNFPDL  141



>gb|ADE41144.1| AP2 domain class transcription factor [Malus domestica]
Length=323

 Score =   115 bits (287),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 52/67 (78%), Positives = 58/67 (87%), Gaps = 0/67 (0%)
 Frame = +3

Query  510  KLYRGVRQRHLGRWVAEIRLPHNRARLWLGTFDSAEDAALAYDREAYRLRGAKARLNFPH  689
            KLYRGVRQRH G+WVAEIRLP NR RLWLGTFD+AE+AALAYD+ A++LRG  ARLNFPH
Sbjct  134  KLYRGVRQRHWGKWVAEIRLPRNRTRLWLGTFDTAEEAALAYDKAAFKLRGDFARLNFPH  193

Query  690  LFLDGAL  710
            L   GAL
Sbjct  194  LRHQGAL  200



>gb|AFP90302.1| transcription factor 2 [Pinus densata]
Length=328

 Score =   115 bits (287),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 55/80 (69%), Positives = 62/80 (78%), Gaps = 4/80 (5%)
 Frame = +3

Query  453  AGPIGLGHDGLNEAASPLPKLYRGVRQRHLGRWVAEIRLPHNRARLWLGTFDSAEDAALA  632
            A P+ L    L++ A    KLYRGVRQRH G+WVAEIRLP NR RLWLGTFD+AE+AA+A
Sbjct  100  AQPMKLHGSSLSKPA----KLYRGVRQRHWGKWVAEIRLPRNRTRLWLGTFDTAEEAAMA  155

Query  633  YDREAYRLRGAKARLNFPHL  692
            YD  AYRLRG  ARLNFPHL
Sbjct  156  YDEAAYRLRGDYARLNFPHL  175



>ref|XP_009779133.1| PREDICTED: ethylene-responsive transcription factor RAP2-4-like 
[Nicotiana sylvestris]
Length=361

 Score =   115 bits (288),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 52/67 (78%), Positives = 58/67 (87%), Gaps = 0/67 (0%)
 Frame = +3

Query  510  KLYRGVRQRHLGRWVAEIRLPHNRARLWLGTFDSAEDAALAYDREAYRLRGAKARLNFPH  689
            KLYRGVRQRH G+WVAEIRLP NR RLWLGTFD+AE+AALAYD+ AY LRG  ARLNFPH
Sbjct  181  KLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTAEEAALAYDKAAYMLRGDFARLNFPH  240

Query  690  LFLDGAL  710
            L  +G+L
Sbjct  241  LRHNGSL  247



>ref|XP_009366366.1| PREDICTED: ethylene-responsive transcription factor ERF060 [Pyrus 
x bretschneideri]
Length=323

 Score =   114 bits (286),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 52/67 (78%), Positives = 58/67 (87%), Gaps = 0/67 (0%)
 Frame = +3

Query  510  KLYRGVRQRHLGRWVAEIRLPHNRARLWLGTFDSAEDAALAYDREAYRLRGAKARLNFPH  689
            KLYRGVRQRH G+WVAEIRLP NR RLWLGTFD+AE+AALAYD+ A++LRG  ARLNFPH
Sbjct  134  KLYRGVRQRHWGKWVAEIRLPRNRTRLWLGTFDTAEEAALAYDKAAFKLRGDFARLNFPH  193

Query  690  LFLDGAL  710
            L   GAL
Sbjct  194  LRHQGAL  200



>gb|ADD09620.1| dehydration responsive element binding protein [Trifolium repens]
Length=304

 Score =   114 bits (286),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 51/81 (63%), Positives = 62/81 (77%), Gaps = 3/81 (4%)
 Frame = +3

Query  450  SAGPIGLGHDGLNEAASPLPKLYRGVRQRHLGRWVAEIRLPHNRARLWLGTFDSAEDAAL  629
            S  P+ + H   +  + P+ KLYRGVRQRH G+WVAEIRLP NR RLWLGTF++AE+AA 
Sbjct  99   SQKPVSMKH--FSTPSKPM-KLYRGVRQRHWGKWVAEIRLPRNRTRLWLGTFETAEEAAF  155

Query  630  AYDREAYRLRGAKARLNFPHL  692
            AYD  AY+LRG  ARLNFPH+
Sbjct  156  AYDNAAYKLRGEFARLNFPHM  176



>gb|ADD69957.1| DREB2 [Caragana korshinskii]
Length=323

 Score =   114 bits (286),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 57/89 (64%), Positives = 67/89 (75%), Gaps = 5/89 (6%)
 Frame = +3

Query  429  NDQISWQSAGPIGLGHDGLNEAASPLP-KLYRGVRQRHLGRWVAEIRLPHNRARLWLGTF  605
            ++ +S+    PI +   G+     P P KLYRGVRQRH G+WVAEIRLP NR RLWLGTF
Sbjct  118  SNTLSFLGPKPIPMKQAGV----PPKPTKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTF  173

Query  606  DSAEDAALAYDREAYRLRGAKARLNFPHL  692
            D+AE+AALAYDR AYRLRG  ARLNFP+L
Sbjct  174  DTAEEAALAYDRAAYRLRGDFARLNFPNL  202



>gb|ABC74510.1| DRF-like transcription factor DRFL2a [Triticum aestivum]
Length=333

 Score =   115 bits (287),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 63/113 (56%), Positives = 70/113 (62%), Gaps = 10/113 (9%)
 Frame = +3

Query  510  KLYRGVRQRHLGRWVAEIRLPHNRARLWLGTFDSAEDAALAYDREAYRLRGAKARLNFPH  689
            KLYRGVRQRH G+WVAEIRLP NR RLWLGTFD+AEDAALAYD+ A+RLRG  ARLNFP 
Sbjct  171  KLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTAEDAALAYDKAAFRLRGDLARLNFPS  230

Query  690  L-----FLDGALHED----LETATQKEAKPKQITSGNIIESNNTKCSGISAHE  821
            L      L G LH      L    +  A P    S    E  + KCS  +  E
Sbjct  231  LRRGGAHLAGPLHASVDAKLTAICESLAAPSSKNSAE-AEPESPKCSASTEGE  282



>ref|XP_009613405.1| PREDICTED: ethylene-responsive transcription factor RAP2-4-like 
[Nicotiana tomentosiformis]
Length=366

 Score =   115 bits (288),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 52/67 (78%), Positives = 58/67 (87%), Gaps = 0/67 (0%)
 Frame = +3

Query  510  KLYRGVRQRHLGRWVAEIRLPHNRARLWLGTFDSAEDAALAYDREAYRLRGAKARLNFPH  689
            KLYRGVRQRH G+WVAEIRLP NR RLWLGTFD+AE+AALAYD+ AY LRG  ARLNFPH
Sbjct  185  KLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTAEEAALAYDKAAYMLRGDFARLNFPH  244

Query  690  LFLDGAL  710
            L  +G+L
Sbjct  245  LRHNGSL  251



>gb|ADM47480.1| DREB2 [Eucalyptus globulus]
Length=337

 Score =   115 bits (287),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 54/79 (68%), Positives = 60/79 (76%), Gaps = 0/79 (0%)
 Frame = +3

Query  456  GPIGLGHDGLNEAASPLPKLYRGVRQRHLGRWVAEIRLPHNRARLWLGTFDSAEDAALAY  635
            GP  +       A  P  KLYRGVRQRH G+WVAEIRLP NR RLWLGTFD+AE+AALAY
Sbjct  122  GPKPVSMKISGSAGKPATKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTAEEAALAY  181

Query  636  DREAYRLRGAKARLNFPHL  692
            DR AY+LRG  ARLNFP+L
Sbjct  182  DRAAYKLRGDFARLNFPNL  200



>gb|ABQ62983.1| TINY-like protein [Populus trichocarpa]
 gb|ABQ62984.1| RAP2.4-like protein [Populus trichocarpa]
Length=276

 Score =   114 bits (284),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 55/74 (74%), Positives = 60/74 (81%), Gaps = 2/74 (3%)
 Frame = +3

Query  492  AASPL--PKLYRGVRQRHLGRWVAEIRLPHNRARLWLGTFDSAEDAALAYDREAYRLRGA  665
            AASP    KLYRGVRQRH G+WVAEIRLP NR RLWLGT+D+AE+AALAYD  AY+LRG 
Sbjct  67   AASPQKPTKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTYDTAEEAALAYDNAAYKLRGE  126

Query  666  KARLNFPHLFLDGA  707
             ARLNFPHL   GA
Sbjct  127  YARLNFPHLRHQGA  140



>gb|AFP90311.1| transcription factor 2 [Pinus densata]
Length=330

 Score =   114 bits (286),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 55/80 (69%), Positives = 62/80 (78%), Gaps = 4/80 (5%)
 Frame = +3

Query  453  AGPIGLGHDGLNEAASPLPKLYRGVRQRHLGRWVAEIRLPHNRARLWLGTFDSAEDAALA  632
            A P+ L    L++ A    KLYRGVRQRH G WVAEIRLP NR RLWLGTFD+AE+AA+A
Sbjct  100  AQPMKLHGSSLSKPA----KLYRGVRQRHWGNWVAEIRLPRNRTRLWLGTFDTAEEAAMA  155

Query  633  YDREAYRLRGAKARLNFPHL  692
            YD+ AYRLRG  ARLNFPHL
Sbjct  156  YDKAAYRLRGDYARLNFPHL  175



>gb|AAG52091.1|AC012680_2 putative AP2 domain transcriptional regulator, 5' partial; 1-558 
[Arabidopsis thaliana]
Length=185

 Score =   111 bits (278),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 50/66 (76%), Positives = 58/66 (88%), Gaps = 0/66 (0%)
 Frame = +3

Query  510  KLYRGVRQRHLGRWVAEIRLPHNRARLWLGTFDSAEDAALAYDREAYRLRGAKARLNFPH  689
            KLYRGVRQRH G+WVAEIRLP NR RLWLGTFD+AE+AALAYD+ AY+LRG  ARLNFP+
Sbjct  1    KLYRGVRQRHWGKWVAEIRLPRNRTRLWLGTFDTAEEAALAYDKAAYKLRGDFARLNFPN  60

Query  690  LFLDGA  707
            L  +G+
Sbjct  61   LRHNGS  66



>gb|AHJ08575.1| DREB6-like protein [Cichorium intybus]
Length=314

 Score =   114 bits (286),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 64/128 (50%), Positives = 81/128 (63%), Gaps = 11/128 (9%)
 Frame = +3

Query  345  TIPHPLFHHQTMISFAPQQQLQSSSGCGNDQI------SWQSAGPIGLGHDGLNEAASPL  506
            +I +P  + Q++ SF   Q   S       QI      ++ +  P+ +   G    + P 
Sbjct  80   SIQNPFGYEQSVSSFGLNQLTPSQIHQIQAQINLPTHSTYLAPKPVSMKQTG----SPPK  135

Query  507  P-KLYRGVRQRHLGRWVAEIRLPHNRARLWLGTFDSAEDAALAYDREAYRLRGAKARLNF  683
            P KLYRGVRQRH G+WVAEIRLP NR RLWLGTFD+AE+AALAYD  AY+LRG  ARLNF
Sbjct  136  PTKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTAEEAALAYDIAAYKLRGDYARLNF  195

Query  684  PHLFLDGA  707
            PHL  +G+
Sbjct  196  PHLRHNGS  203



>ref|XP_003526587.1| PREDICTED: ethylene-responsive transcription factor RAP2-4 [Glycine 
max]
Length=302

 Score =   114 bits (285),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 56/89 (63%), Positives = 68/89 (76%), Gaps = 5/89 (6%)
 Frame = +3

Query  429  NDQISWQSAGPIGLGHDGLNEAASPLP-KLYRGVRQRHLGRWVAEIRLPHNRARLWLGTF  605
            ++ +S+    PI + H G+     P P KLYRGVRQRH G+WVAEIRLP NR RLWLGTF
Sbjct  102  SNTLSFLGPKPIPMKHAGM----PPKPTKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTF  157

Query  606  DSAEDAALAYDREAYRLRGAKARLNFPHL  692
            D+AE+AALAYD+ AY+LRG  ARLNFP+L
Sbjct  158  DTAEEAALAYDKAAYKLRGDFARLNFPNL  186



>gb|EYU24006.1| hypothetical protein MIMGU_mgv1a009524mg [Erythranthe guttata]
Length=339

 Score =   115 bits (287),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 51/78 (65%), Positives = 60/78 (77%), Gaps = 0/78 (0%)
 Frame = +3

Query  459  PIGLGHDGLNEAASPLPKLYRGVRQRHLGRWVAEIRLPHNRARLWLGTFDSAEDAALAYD  638
            P+ +   G     S   KLYRGVRQRH G+WVAEIRLP NR RLWLGTFD++E+AALAYD
Sbjct  142  PVSMKQTGPGLTPSKPVKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTSEEAALAYD  201

Query  639  REAYRLRGAKARLNFPHL  692
            + AY+LRG  A+LNFPHL
Sbjct  202  KAAYKLRGEFAKLNFPHL  219



>gb|KHN29077.1| Ethylene-responsive transcription factor RAP2-4 [Glycine soja]
Length=249

 Score =   113 bits (282),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 54/73 (74%), Positives = 59/73 (81%), Gaps = 1/73 (1%)
 Frame = +3

Query  492  AASPLPKLYRGVRQRHLGRWVAEIRLPHNRARLWLGTFDSAEDAALAYDREAYRLRGAKA  671
            AA P  KLYRGVRQRH G+WVAEIRLP NR RLWLGTFD+AE+AALAYD  A++LRG  A
Sbjct  7    AAKPT-KLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTAEEAALAYDNAAFKLRGEFA  65

Query  672  RLNFPHLFLDGAL  710
            RLNFPHL   GA 
Sbjct  66   RLNFPHLRHHGAF  78



>ref|XP_010477479.1| PREDICTED: ethylene-responsive transcription factor RAP2-13 [Camelina 
sativa]
Length=273

 Score =   114 bits (284),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 55/87 (63%), Positives = 67/87 (77%), Gaps = 4/87 (5%)
 Frame = +3

Query  450  SAGPIGLGHDGLNEAASPLP-KLYRGVRQRHLGRWVAEIRLPHNRARLWLGTFDSAEDAA  626
            S  P+ +   G   A+ P P KLYRGVRQRH G+WVAEIRLP NR RLWLGTFD+AE+AA
Sbjct  65   SPKPVSMKQTG---ASLPKPMKLYRGVRQRHWGKWVAEIRLPRNRTRLWLGTFDTAEEAA  121

Query  627  LAYDREAYRLRGAKARLNFPHLFLDGA  707
            LAYD+ A++LRG  ARLNFP+L  +G+
Sbjct  122  LAYDKAAFKLRGDFARLNFPNLRHNGS  148



>emb|CDP01030.1| unnamed protein product [Coffea canephora]
Length=330

 Score =   114 bits (286),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 54/74 (73%), Positives = 63/74 (85%), Gaps = 1/74 (1%)
 Frame = +3

Query  492  AASPLP-KLYRGVRQRHLGRWVAEIRLPHNRARLWLGTFDSAEDAALAYDREAYRLRGAK  668
            A+ P P KLYRGVRQRH G+WVAEIRLP NR RLWLGTFD+AE+AALAYD+ A++LRG  
Sbjct  115  ASPPKPTKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTAEEAALAYDKAAFKLRGDF  174

Query  669  ARLNFPHLFLDGAL  710
            ARLNFPHL  +G+L
Sbjct  175  ARLNFPHLRHNGSL  188



>ref|XP_010428923.1| PREDICTED: ethylene-responsive transcription factor RAP2-4-like 
[Camelina sativa]
Length=351

 Score =   115 bits (287),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 62/126 (49%), Positives = 78/126 (62%), Gaps = 13/126 (10%)
 Frame = +3

Query  336  LHDTIPHPLFHHQTMISF-APQQQLQSSSGCGNDQISWQSAGPIGLGHDGLNEAASPLP-  509
            +   I HP  H  T  +  +P+  +   SG      ++ S G +            P P 
Sbjct  114  IQSQIHHPTHHTNTFSNLLSPKPLMMKQSGVAGSCFAYGSGGVL-----------PPKPT  162

Query  510  KLYRGVRQRHLGRWVAEIRLPHNRARLWLGTFDSAEDAALAYDREAYRLRGAKARLNFPH  689
            KLYRGVRQRH G+WVAEIRLP NR RLWLGTFD+AE+AALAYD+ AY+LRG  ARLNFP+
Sbjct  163  KLYRGVRQRHWGKWVAEIRLPRNRTRLWLGTFDTAEEAALAYDKAAYKLRGDFARLNFPN  222

Query  690  LFLDGA  707
            L  +G+
Sbjct  223  LRHNGS  228



>ref|XP_009145366.1| PREDICTED: ethylene-responsive transcription factor RAP2-13 [Brassica 
rapa]
Length=260

 Score =   113 bits (283),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 52/68 (76%), Positives = 59/68 (87%), Gaps = 1/68 (1%)
 Frame = +3

Query  492  AASPLP-KLYRGVRQRHLGRWVAEIRLPHNRARLWLGTFDSAEDAALAYDREAYRLRGAK  668
            A+ P P KLYRGVRQRH G+WVAEIRLP NR RLWLGTFD+AE+AALAYD+ AY+LRG  
Sbjct  85   ASPPKPMKLYRGVRQRHWGKWVAEIRLPRNRTRLWLGTFDTAEEAALAYDKAAYKLRGDF  144

Query  669  ARLNFPHL  692
            ARLNFP+L
Sbjct  145  ARLNFPNL  152



>emb|CDY21346.1| BnaA09g30810D [Brassica napus]
Length=260

 Score =   113 bits (283),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 52/68 (76%), Positives = 59/68 (87%), Gaps = 1/68 (1%)
 Frame = +3

Query  492  AASPLP-KLYRGVRQRHLGRWVAEIRLPHNRARLWLGTFDSAEDAALAYDREAYRLRGAK  668
            A+ P P KLYRGVRQRH G+WVAEIRLP NR RLWLGTFD+AE+AALAYD+ AY+LRG  
Sbjct  85   ASPPKPMKLYRGVRQRHWGKWVAEIRLPRNRTRLWLGTFDTAEEAALAYDKAAYKLRGDF  144

Query  669  ARLNFPHL  692
            ARLNFP+L
Sbjct  145  ARLNFPNL  152



>ref|XP_010060168.1| PREDICTED: ethylene-responsive transcription factor RAP2-4-like 
[Eucalyptus grandis]
 gb|KCW66742.1| hypothetical protein EUGRSUZ_F00497 [Eucalyptus grandis]
Length=361

 Score =   115 bits (287),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 51/61 (84%), Positives = 55/61 (90%), Gaps = 0/61 (0%)
 Frame = +3

Query  510  KLYRGVRQRHLGRWVAEIRLPHNRARLWLGTFDSAEDAALAYDREAYRLRGAKARLNFPH  689
            KLYRGVRQRH G+WVAEIRLP NR RLWLGTFD+AE+AALAYD+ AYRLRG  ARLNFPH
Sbjct  168  KLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTAEEAALAYDKAAYRLRGDFARLNFPH  227

Query  690  L  692
            L
Sbjct  228  L  228



>gb|KFK42189.1| hypothetical protein AALP_AA2G223100 [Arabis alpina]
Length=309

 Score =   114 bits (285),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 54/87 (62%), Positives = 66/87 (76%), Gaps = 4/87 (5%)
 Frame = +3

Query  459  PIGLGHDGLNEAASPLP----KLYRGVRQRHLGRWVAEIRLPHNRARLWLGTFDSAEDAA  626
            PI +   G+  +   +P    KLYRGVRQRH G+WVAEIRLP NR RLWLGTFD+AE+AA
Sbjct  112  PILMKQTGIPGSCFGVPAKPTKLYRGVRQRHWGKWVAEIRLPRNRTRLWLGTFDTAEEAA  171

Query  627  LAYDREAYRLRGAKARLNFPHLFLDGA  707
            LAYD+ AY+LRG  ARLNFP+L  +G+
Sbjct  172  LAYDKAAYKLRGDFARLNFPNLRHNGS  198



>ref|XP_009150596.1| PREDICTED: ethylene-responsive transcription factor ERF057-like 
[Brassica rapa]
Length=282

 Score =   114 bits (284),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 57/130 (44%), Positives = 81/130 (62%), Gaps = 7/130 (5%)
 Frame = +3

Query  333  ALHDTIPHPLFHHQTMISFAPQQQLQSSSGCGNDQISWQSAGPIGLGHDGLNEAASPLPK  512
             L+   P  +   QT +     +Q Q+  GC    ++  +A P  +    + + A    K
Sbjct  56   GLNQLTPTQILQIQTELQL---RQNQARRGCSGHDLNVLNAKPTLMKKTNVTKPA----K  108

Query  513  LYRGVRQRHLGRWVAEIRLPHNRARLWLGTFDSAEDAALAYDREAYRLRGAKARLNFPHL  692
            LYRG+RQRH G+WVAEIRLP NR RLWLGTF++AE+AALAYD+ A+++RG  ARLNFP++
Sbjct  109  LYRGIRQRHWGKWVAEIRLPKNRTRLWLGTFETAEEAALAYDQAAHKIRGENARLNFPNI  168

Query  693  FLDGALHEDL  722
               G  ++ L
Sbjct  169  AFLGEYNQTL  178



>gb|AFX68812.1| ERF transcription factor 8 [Nicotiana tabacum]
Length=274

 Score =   113 bits (283),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 51/67 (76%), Positives = 57/67 (85%), Gaps = 0/67 (0%)
 Frame = +3

Query  510  KLYRGVRQRHLGRWVAEIRLPHNRARLWLGTFDSAEDAALAYDREAYRLRGAKARLNFPH  689
            KLYRGVRQRH G+WV EIRLP NR RLWLGTFD+AE+AALAYD+ AY LRG  ARLNFPH
Sbjct  93   KLYRGVRQRHWGKWVVEIRLPKNRTRLWLGTFDTAEEAALAYDKAAYMLRGDFARLNFPH  152

Query  690  LFLDGAL  710
            L  +G+L
Sbjct  153  LRHNGSL  159



>emb|CDY14636.1| BnaC02g24770D [Brassica napus]
Length=250

 Score =   113 bits (282),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 50/66 (76%), Positives = 58/66 (88%), Gaps = 0/66 (0%)
 Frame = +3

Query  510  KLYRGVRQRHLGRWVAEIRLPHNRARLWLGTFDSAEDAALAYDREAYRLRGAKARLNFPH  689
            KLYRGVRQRH G+WVAEIRLP NR RLWLGTFD+AE+AALAYD+ A++LRG  ARLNFPH
Sbjct  76   KLYRGVRQRHWGKWVAEIRLPRNRTRLWLGTFDTAEEAALAYDKAAFKLRGDHARLNFPH  135

Query  690  LFLDGA  707
            L  +G+
Sbjct  136  LRHNGS  141



>emb|CDY08816.1| BnaA06g24080D [Brassica napus]
Length=282

 Score =   114 bits (284),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 57/130 (44%), Positives = 81/130 (62%), Gaps = 7/130 (5%)
 Frame = +3

Query  333  ALHDTIPHPLFHHQTMISFAPQQQLQSSSGCGNDQISWQSAGPIGLGHDGLNEAASPLPK  512
             L+   P  +   QT +     +Q Q+  GC    ++  +A P  +    + + A    K
Sbjct  56   GLNQLTPTQILQIQTELQL---RQNQARRGCSGHDLNVLNAKPTLMKKTNVTKPA----K  108

Query  513  LYRGVRQRHLGRWVAEIRLPHNRARLWLGTFDSAEDAALAYDREAYRLRGAKARLNFPHL  692
            LYRG+RQRH G+WVAEIRLP NR RLWLGTF++AE+AALAYD+ A+++RG  ARLNFP++
Sbjct  109  LYRGIRQRHWGKWVAEIRLPKNRTRLWLGTFETAEEAALAYDQAAHKIRGENARLNFPNI  168

Query  693  FLDGALHEDL  722
               G  ++ L
Sbjct  169  AFLGEYNQTL  178



>ref|XP_008659105.1| PREDICTED: ethylene-responsive transcription factor RAP2-13-like 
[Zea mays]
 gb|AFW85270.1| putative AP2/EREBP transcription factor superfamily protein [Zea 
mays]
 gb|AIB04615.1| AP2-EREBP transcription factor, partial [Zea mays]
Length=349

 Score =   114 bits (286),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 62/107 (58%), Positives = 71/107 (66%), Gaps = 3/107 (3%)
 Frame = +3

Query  510  KLYRGVRQRHLGRWVAEIRLPHNRARLWLGTFDSAEDAALAYDREAYRLRGAKARLNFPH  689
            KLYRGVRQRH G+WVAEIRLP NR RLWLGTFDSAEDAALAYD+ A+RLRG  ARLNFP 
Sbjct  172  KLYRGVRQRHWGKWVAEIRLPRNRTRLWLGTFDSAEDAALAYDKAAFRLRGDAARLNFPS  231

Query  690  LFLDGA-LHEDLETATQKEAKPKQITSGNIIESNNTKCSGISAHEPK  827
            L   GA L   L+ +   +AK   I  G   E  +   +   +  PK
Sbjct  232  LRRGGAHLAGPLDASV--DAKLTAICQGITAEPTSKAAAAAPSDSPK  276



>gb|ABY63297.1| DREB protein [Populus pruinosa]
Length=291

 Score =   114 bits (284),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 59/107 (55%), Positives = 75/107 (70%), Gaps = 8/107 (7%)
 Frame = +3

Query  399  QQLQSSSGCGNDQIS--WQSAGPIGLGHDGLNEAASPL--PKLYRGVRQRHLGRWVAEIR  566
            + L ++S C +++ +  + +  P+ +   G    ASP    KLYRGVRQRH G+WVAEIR
Sbjct  133  ENLATTSQCVHNRKASNYLAPKPVPMKQSG----ASPQKPTKLYRGVRQRHWGKWVAEIR  188

Query  567  LPHNRARLWLGTFDSAEDAALAYDREAYRLRGAKARLNFPHLFLDGA  707
            LP NR RLWLGT+D+AE+AALAYD  AY+LRG  ARLNFPHL   GA
Sbjct  189  LPKNRTRLWLGTYDTAEEAALAYDNAAYKLRGKYARLNFPHLRHQGA  235



>ref|XP_008219663.1| PREDICTED: ethylene-responsive transcription factor RAP2-4 [Prunus 
mume]
Length=377

 Score =   115 bits (287),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 54/90 (60%), Positives = 67/90 (74%), Gaps = 0/90 (0%)
 Frame = +3

Query  438  ISWQSAGPIGLGHDGLNEAASPLPKLYRGVRQRHLGRWVAEIRLPHNRARLWLGTFDSAE  617
            +S+    P+ +   G + +     KLYRGVRQRH G+WVAEIRLP NR RLWLGTFD+AE
Sbjct  170  LSFLGPKPVPMKQVGSSGSPPKPTKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTAE  229

Query  618  DAALAYDREAYRLRGAKARLNFPHLFLDGA  707
            +AALAYD+ AY+LRG  ARLNFPHL  +G+
Sbjct  230  EAALAYDKAAYKLRGDFARLNFPHLRHNGS  259



>ref|XP_008790815.1| PREDICTED: ethylene-responsive transcription factor RAP2-13-like 
[Phoenix dactylifera]
Length=369

 Score =   114 bits (286),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 60/95 (63%), Positives = 68/95 (72%), Gaps = 6/95 (6%)
 Frame = +3

Query  426  GNDQISWQSAGPIGLGH--DGLNEAASPLP----KLYRGVRQRHLGRWVAEIRLPHNRAR  587
            G  ++S   A P  LG     +  A SP P    KLYRGVRQRH G+WVAEIRLP NR R
Sbjct  150  GARRVSRDHAAPSFLGPRPQPMKHAGSPPPPRPAKLYRGVRQRHWGKWVAEIRLPKNRTR  209

Query  588  LWLGTFDSAEDAALAYDREAYRLRGAKARLNFPHL  692
            LWLGTFD+AE+AALAYD+ A+RLRG  ARLNFPHL
Sbjct  210  LWLGTFDTAEEAALAYDKAAFRLRGDFARLNFPHL  244



>gb|AFH56408.1| ethylene response factor 1, partial [Diospyros kaki]
Length=195

 Score =   111 bits (278),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 51/67 (76%), Positives = 59/67 (88%), Gaps = 0/67 (0%)
 Frame = +3

Query  510  KLYRGVRQRHLGRWVAEIRLPHNRARLWLGTFDSAEDAALAYDREAYRLRGAKARLNFPH  689
            KLYRGVRQRH G+WVAEIRLP NR RLWLGTFD+AE+AALAYD+ AY+LRG  ARLNFP+
Sbjct  23   KLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTAEEAALAYDKAAYKLRGDFARLNFPN  82

Query  690  LFLDGAL  710
            L  +G+L
Sbjct  83   LRHNGSL  89



>emb|CDY38238.1| BnaC05g17550D [Brassica napus]
Length=260

 Score =   113 bits (282),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 54/82 (66%), Positives = 63/82 (77%), Gaps = 5/82 (6%)
 Frame = +3

Query  450  SAGPIGLGHDGLNEAASPLP-KLYRGVRQRHLGRWVAEIRLPHNRARLWLGTFDSAEDAA  626
            S  P+ +   G    + P P KLYRGVRQRH G+WVAEIRLP NR RLWLGTFD+AE+AA
Sbjct  75   SPKPVPMKQTG----SPPKPMKLYRGVRQRHWGKWVAEIRLPRNRTRLWLGTFDTAEEAA  130

Query  627  LAYDREAYRLRGAKARLNFPHL  692
            LAYD+ AY+LRG  ARLNFP+L
Sbjct  131  LAYDKAAYKLRGDFARLNFPNL  152



>ref|XP_004985387.1| PREDICTED: ethylene-responsive transcription factor RAP2-4-like 
[Setaria italica]
Length=298

 Score =   114 bits (284),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 55/80 (69%), Positives = 63/80 (79%), Gaps = 4/80 (5%)
 Frame = +3

Query  480  GLNEAASPLP----KLYRGVRQRHLGRWVAEIRLPHNRARLWLGTFDSAEDAALAYDREA  647
            G+ +A +P+P    KLYRGVRQRH G+WVAEIRLP NR RLWLGTFD+AE+AALAYD  A
Sbjct  100  GVVKAPAPVPRPVSKLYRGVRQRHWGKWVAEIRLPRNRTRLWLGTFDTAEEAALAYDSAA  159

Query  648  YRLRGAKARLNFPHLFLDGA  707
            +RLRG  ARLNFP L   GA
Sbjct  160  FRLRGDSARLNFPELRRGGA  179



>gb|ADD09598.1| dehydration responsive element binding protein [Trifolium repens]
Length=304

 Score =   114 bits (284),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 51/81 (63%), Positives = 62/81 (77%), Gaps = 3/81 (4%)
 Frame = +3

Query  450  SAGPIGLGHDGLNEAASPLPKLYRGVRQRHLGRWVAEIRLPHNRARLWLGTFDSAEDAAL  629
            S  P+ + H   +  + P+ KLYRGVRQRH G+WVAEIRLP NR RLWLGTF++AE+AA 
Sbjct  99   SQKPVSMKH--FSTPSKPI-KLYRGVRQRHWGKWVAEIRLPRNRTRLWLGTFETAEEAAF  155

Query  630  AYDREAYRLRGAKARLNFPHL  692
            AYD  AY+LRG  ARLNFPH+
Sbjct  156  AYDNAAYKLRGEFARLNFPHM  176



>ref|XP_006827824.1| hypothetical protein AMTR_s00009p00268560 [Amborella trichopoda]
 gb|ERM95240.1| hypothetical protein AMTR_s00009p00268560 [Amborella trichopoda]
Length=465

 Score =   115 bits (288),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 53/63 (84%), Positives = 57/63 (90%), Gaps = 0/63 (0%)
 Frame = +3

Query  510  KLYRGVRQRHLGRWVAEIRLPHNRARLWLGTFDSAEDAALAYDREAYRLRGAKARLNFPH  689
            KLYRGVRQRH G+WVAEIRLP NR RLWLGTFD+AE+AALAYDREAY+LRG  ARLNFP 
Sbjct  222  KLYRGVRQRHWGKWVAEIRLPRNRTRLWLGTFDTAEEAALAYDREAYKLRGDNARLNFPD  281

Query  690  LFL  698
            LFL
Sbjct  282  LFL  284



>ref|XP_008808175.1| PREDICTED: ethylene-responsive transcription factor ERF060-like 
[Phoenix dactylifera]
Length=349

 Score =   114 bits (286),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 60/92 (65%), Positives = 67/92 (73%), Gaps = 6/92 (7%)
 Frame = +3

Query  435  QISWQSAGPIGLGH--DGLNEAASPLP----KLYRGVRQRHLGRWVAEIRLPHNRARLWL  596
            Q+S   A P  LG     +  A SP P    KLYRGVRQRH G+WVAEIRLP NR RLWL
Sbjct  140  QLSHVGAAPRFLGPRPQPMKHAGSPPPPRPAKLYRGVRQRHWGKWVAEIRLPKNRTRLWL  199

Query  597  GTFDSAEDAALAYDREAYRLRGAKARLNFPHL  692
            GTFD+AE+AALAYD+ A+RLRG  ARLNFPHL
Sbjct  200  GTFDTAEEAALAYDKAAFRLRGDFARLNFPHL  231



>ref|XP_009798155.1| PREDICTED: ethylene-responsive transcription factor RAP2-13-like 
[Nicotiana sylvestris]
Length=356

 Score =   114 bits (286),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 50/61 (82%), Positives = 55/61 (90%), Gaps = 0/61 (0%)
 Frame = +3

Query  510  KLYRGVRQRHLGRWVAEIRLPHNRARLWLGTFDSAEDAALAYDREAYRLRGAKARLNFPH  689
            KLYRGVRQRH G+WVAEIRLP NR RLWLGTFD+AE+AALAYD+ AY+LRG  ARLNFPH
Sbjct  167  KLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTAEEAALAYDKAAYKLRGEFARLNFPH  226

Query  690  L  692
            L
Sbjct  227  L  227



>ref|XP_008234629.1| PREDICTED: ethylene-responsive transcription factor RAP2-4 [Prunus 
mume]
Length=374

 Score =   114 bits (286),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 52/66 (79%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = +3

Query  510  KLYRGVRQRHLGRWVAEIRLPHNRARLWLGTFDSAEDAALAYDREAYRLRGAKARLNFPH  689
            KLYRGVRQRH G+WVAEIRLP NR RLWLGTFD+AE+AALAYD+ AY+LRG  ARLNFPH
Sbjct  179  KLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTAEEAALAYDKAAYKLRGDFARLNFPH  238

Query  690  LFLDGA  707
            L   GA
Sbjct  239  LKHQGA  244



>ref|XP_010102588.1| Ethylene-responsive transcription factor [Morus notabilis]
 gb|AHJ25981.1| dehydration responsive element binding transcription factor [Morus 
notabilis]
 gb|EXB93691.1| Ethylene-responsive transcription factor [Morus notabilis]
Length=335

 Score =   114 bits (285),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 51/66 (77%), Positives = 58/66 (88%), Gaps = 0/66 (0%)
 Frame = +3

Query  510  KLYRGVRQRHLGRWVAEIRLPHNRARLWLGTFDSAEDAALAYDREAYRLRGAKARLNFPH  689
            KLYRGVRQRH G+WVAEIRLP NR RLWLGTFD+AE+AALAYD+ A++LRG  ARLNFPH
Sbjct  154  KLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTAEEAALAYDKAAFKLRGDFARLNFPH  213

Query  690  LFLDGA  707
            L  DG+
Sbjct  214  LRHDGS  219



>gb|AHB33872.1| ERF transcription factor 01 [Coffea arabica]
Length=270

 Score =   113 bits (282),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 53/74 (72%), Positives = 62/74 (84%), Gaps = 1/74 (1%)
 Frame = +3

Query  492  AASPLP-KLYRGVRQRHLGRWVAEIRLPHNRARLWLGTFDSAEDAALAYDREAYRLRGAK  668
            A+ P P KLYRGVRQRH G+WVAEIRLP NR RLWLGTFD+AE+AALAYD+ A++LRG  
Sbjct  85   ASPPKPTKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTAEEAALAYDKAAFKLRGDF  144

Query  669  ARLNFPHLFLDGAL  710
             RLNFPHL  +G+L
Sbjct  145  TRLNFPHLRHNGSL  158



>gb|KGN48763.1| AP2/ERF domain-containing transcription factor [Cucumis sativus]
Length=271

 Score =   113 bits (282),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 50/61 (82%), Positives = 55/61 (90%), Gaps = 0/61 (0%)
 Frame = +3

Query  510  KLYRGVRQRHLGRWVAEIRLPHNRARLWLGTFDSAEDAALAYDREAYRLRGAKARLNFPH  689
            KLYRGVRQRH G+WVAEIRLP NR RLWLGTFD+AE+AALAYD+ AY+LRG  ARLNFPH
Sbjct  152  KLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTAEEAALAYDQAAYKLRGDFARLNFPH  211

Query  690  L  692
            L
Sbjct  212  L  212



>ref|XP_003615022.1| Ethylene-responsive transcription factor RAP2-4 [Medicago truncatula]
 gb|AES97980.1| AP2 domain class transcription factor [Medicago truncatula]
 gb|AEX93412.1| putative AP2/EREBP transcription factor [Medicago truncatula]
Length=371

 Score =   114 bits (286),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 56/89 (63%), Positives = 66/89 (74%), Gaps = 5/89 (6%)
 Frame = +3

Query  429  NDQISWQSAGPIGLGHDGLNEAASPLP-KLYRGVRQRHLGRWVAEIRLPHNRARLWLGTF  605
            N  +++    PI +   G+     P P KLYRGVRQRH G+WVAEIRLP NR RLWLGTF
Sbjct  147  NSSLNFLGPKPIPMKQPGV----PPKPTKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTF  202

Query  606  DSAEDAALAYDREAYRLRGAKARLNFPHL  692
            D+AE+AALAYDR AYRLRG  ARLNFP++
Sbjct  203  DTAEEAALAYDRAAYRLRGDFARLNFPNM  231



>ref|XP_006428165.1| hypothetical protein CICLE_v10025961mg [Citrus clementina]
 ref|XP_006464216.1| PREDICTED: ethylene-responsive transcription factor RAP2-4-like 
[Citrus sinensis]
 gb|ESR41405.1| hypothetical protein CICLE_v10025961mg [Citrus clementina]
Length=354

 Score =   114 bits (285),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 58/101 (57%), Positives = 70/101 (69%), Gaps = 1/101 (1%)
 Frame = +3

Query  405  LQSSSGCGNDQISWQSAGPIGLGHDGLNEAASPLPKLYRGVRQRHLGRWVAEIRLPHNRA  584
            L S +   + + +  S   + + H    + A P  KLYRGVRQRH G+WVAEIRLP NR 
Sbjct  124  LASRASISSPKSNLLSPKAVPMKHVSNAQVAKPT-KLYRGVRQRHWGKWVAEIRLPKNRT  182

Query  585  RLWLGTFDSAEDAALAYDREAYRLRGAKARLNFPHLFLDGA  707
            RLWLGTFD+AE+AALAYD+ AY+LRG  ARLNFPHL   GA
Sbjct  183  RLWLGTFDTAEEAALAYDQAAYKLRGEFARLNFPHLKHHGA  223



>ref|XP_006411774.1| hypothetical protein EUTSA_v10025958mg [Eutrema salsugineum]
 gb|ESQ53227.1| hypothetical protein EUTSA_v10025958mg [Eutrema salsugineum]
Length=275

 Score =   113 bits (282),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 48/61 (79%), Positives = 55/61 (90%), Gaps = 0/61 (0%)
 Frame = +3

Query  510  KLYRGVRQRHLGRWVAEIRLPHNRARLWLGTFDSAEDAALAYDREAYRLRGAKARLNFPH  689
            KLYRGVRQRH G+WVAEIRLP NR RLWLGTFD+AE+AA+AYD+ AY+LRG  ARLNFPH
Sbjct  93   KLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTAEEAAMAYDQAAYKLRGELARLNFPH  152

Query  690  L  692
            +
Sbjct  153  I  153



>gb|KDO56612.1| hypothetical protein CISIN_1g018103mg [Citrus sinensis]
Length=360

 Score =   114 bits (285),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 58/101 (57%), Positives = 70/101 (69%), Gaps = 1/101 (1%)
 Frame = +3

Query  405  LQSSSGCGNDQISWQSAGPIGLGHDGLNEAASPLPKLYRGVRQRHLGRWVAEIRLPHNRA  584
            L S +   + + +  S   + + H    + A P  KLYRGVRQRH G+WVAEIRLP NR 
Sbjct  130  LASRASISSPKSNLLSPKAVPMKHVSNAQVAKPT-KLYRGVRQRHWGKWVAEIRLPKNRT  188

Query  585  RLWLGTFDSAEDAALAYDREAYRLRGAKARLNFPHLFLDGA  707
            RLWLGTFD+AE+AALAYD+ AY+LRG  ARLNFPHL   GA
Sbjct  189  RLWLGTFDTAEEAALAYDQAAYKLRGEFARLNFPHLKHHGA  229



>gb|AEX88462.1| ethylene-responsive element binding factor 3 [Arachis hypogaea]
Length=297

 Score =   113 bits (283),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 50/61 (82%), Positives = 54/61 (89%), Gaps = 0/61 (0%)
 Frame = +3

Query  510  KLYRGVRQRHLGRWVAEIRLPHNRARLWLGTFDSAEDAALAYDREAYRLRGAKARLNFPH  689
            KLYRGVRQRH G+WVAEIRLP NR RLWLGTFD+AE+AALAYD  AY+LRG  ARLNFPH
Sbjct  126  KLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTAEEAALAYDNAAYKLRGEFARLNFPH  185

Query  690  L  692
            L
Sbjct  186  L  186



>ref|XP_004143476.1| PREDICTED: ethylene-responsive transcription factor ERF060-like 
[Cucumis sativus]
 ref|XP_004160135.1| PREDICTED: ethylene-responsive transcription factor ERF060-like 
[Cucumis sativus]
Length=346

 Score =   114 bits (285),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 50/61 (82%), Positives = 55/61 (90%), Gaps = 0/61 (0%)
 Frame = +3

Query  510  KLYRGVRQRHLGRWVAEIRLPHNRARLWLGTFDSAEDAALAYDREAYRLRGAKARLNFPH  689
            KLYRGVRQRH G+WVAEIRLP NR RLWLGTFD+AE+AALAYD+ AY+LRG  ARLNFPH
Sbjct  152  KLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTAEEAALAYDQAAYKLRGDFARLNFPH  211

Query  690  L  692
            L
Sbjct  212  L  212



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1851063916768