BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c98631_g1_i1 len=899 path=[877:0-898]

Length=899
                                                                      Score     E

ref|XP_002510564.1|  multidrug resistance protein 1, 2, putative        407   1e-128   Ricinus communis
gb|KHG13479.1|  ABC transporter B family member 13                      404   3e-127   
ref|XP_003549468.1|  PREDICTED: ABC transporter B family member 1...    402   2e-126   
ref|XP_007160658.1|  hypothetical protein PHAVU_001G005900g             401   2e-126   
emb|CAN71068.1|  hypothetical protein VITISV_031708                     402   3e-126   Vitis vinifera
ref|XP_002279471.2|  PREDICTED: ABC transporter B family member 1...    400   5e-126   Vitis vinifera
ref|XP_003544389.1|  PREDICTED: ABC transporter B family member 1...    397   6e-125   
emb|CBI19899.3|  unnamed protein product                                389   4e-123   
ref|XP_007017851.1|  P-glycoprotein 13                                  392   6e-123   
emb|CDP07374.1|  unnamed protein product                                390   5e-122   
ref|XP_007225446.1|  hypothetical protein PRUPE_ppa000363mg             389   1e-121   
ref|XP_004292938.1|  PREDICTED: ABC transporter B family member 1...    384   8e-121   
ref|XP_008221400.1|  PREDICTED: ABC transporter B family member 1...    385   2e-120   
gb|KDP36900.1|  hypothetical protein JCGZ_08191                         382   2e-119   
ref|XP_004136487.1|  PREDICTED: ABC transporter B family member 1...    383   3e-119   
gb|KDO84910.1|  hypothetical protein CISIN_1g000851mg                   372   5e-119   
ref|XP_010069803.1|  PREDICTED: ABC transporter B family member 1...    382   6e-119   
gb|KGN60047.1|  hypothetical protein Csa_3G873270                       380   2e-118   
ref|XP_004164800.1|  PREDICTED: LOW QUALITY PROTEIN: ABC transpor...    377   2e-117   
gb|KDO84908.1|  hypothetical protein CISIN_1g000851mg                   374   5e-116   
ref|XP_006435210.1|  hypothetical protein CICLE_v10000054mg             374   6e-116   
ref|XP_006473687.1|  PREDICTED: ABC transporter B family member 1...    372   2e-115   
gb|KHN39417.1|  ABC transporter B family member 13                      369   1e-114   
gb|KHN12634.1|  ABC transporter B family member 13                      369   1e-114   
ref|XP_008387923.1|  PREDICTED: ABC transporter B family member 1...    367   1e-113   
ref|XP_004499289.1|  PREDICTED: ABC transporter B family member 1...    362   6e-112   
ref|XP_011034997.1|  PREDICTED: ABC transporter B family member 1...    362   8e-112   
ref|XP_011083466.1|  PREDICTED: LOW QUALITY PROTEIN: ABC transpor...    361   2e-111   
ref|XP_002301961.1|  multidrug resistance P-glycoprotein                358   3e-110   Populus trichocarpa [western balsam poplar]
ref|XP_009334844.1|  PREDICTED: ABC transporter B family member 1...    357   4e-110   
emb|CDX84896.1|  BnaC05g21590D                                          353   1e-109   
ref|XP_009113724.1|  PREDICTED: ABC transporter B family member 1...    353   1e-108   
ref|XP_009113722.1|  PREDICTED: ABC transporter B family member 1...    353   1e-108   
ref|XP_002893495.1|  P-glycoprotein 13                                  352   6e-108   
ref|NP_174115.1|  ABC transporter B family member 13                    351   8e-108   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006415715.1|  hypothetical protein EUTSA_v10006582mg             350   1e-107   
ref|XP_009113714.1|  PREDICTED: ABC transporter B family member 14      348   1e-106   
gb|KFK44669.1|  hypothetical protein AALP_AA1G288400                    348   1e-106   
ref|XP_010478144.1|  PREDICTED: ABC transporter B family member 1...    347   2e-106   
ref|XP_010266821.1|  PREDICTED: ABC transporter B family member 1...    347   2e-106   
ref|XP_010460561.1|  PREDICTED: ABC transporter B family member 1...    347   3e-106   
ref|XP_010499285.1|  PREDICTED: ABC transporter B family member 1...    345   2e-105   
ref|NP_174122.1|  ABC transporter B family member 14                    345   2e-105   Arabidopsis thaliana [mouse-ear cress]
gb|AES59767.2|  ABC transporter B family protein                        344   4e-105   
ref|XP_003589516.1|  ABC transporter B family member                    343   7e-105   
ref|XP_002890755.1|  P-glycoprotein 14                                  341   5e-104   
ref|XP_010527726.1|  PREDICTED: LOW QUALITY PROTEIN: ABC transpor...    341   6e-104   
ref|XP_010501626.1|  PREDICTED: ABC transporter B family member 1...    338   6e-103   
ref|XP_006306598.1|  hypothetical protein CARUB_v10008102mg             338   6e-103   
ref|XP_006415706.1|  hypothetical protein EUTSA_v10006583mg             337   9e-103   
ref|XP_010439790.1|  PREDICTED: ABC transporter B family member 1...    336   3e-102   
ref|XP_008788471.1|  PREDICTED: ABC transporter B family member 1...    335   9e-102   
ref|XP_006306603.1|  hypothetical protein CARUB_v10008108mg             332   8e-101   
ref|XP_010439800.1|  PREDICTED: ABC transporter B family member 1...    331   2e-100   
ref|XP_010480688.1|  PREDICTED: ABC transporter B family member 14      329   1e-99    
ref|XP_010478145.1|  PREDICTED: ABC transporter B family member 1...    328   2e-99    
ref|XP_010095529.1|  ABC transporter B family member 13                 318   4e-99    
ref|XP_010460562.1|  PREDICTED: ABC transporter B family member 1...    327   7e-99    
ref|XP_010499286.1|  PREDICTED: ABC transporter B family member 1...    326   1e-98    
gb|KFK33112.1|  hypothetical protein AALP_AA6G332600                    323   2e-97    
ref|XP_010666235.1|  PREDICTED: ABC transporter B family member 1...    320   2e-96    
emb|CDY27639.1|  BnaA09g27680D                                          299   3e-89    
ref|XP_006856780.1|  hypothetical protein AMTR_s00055p00102180          294   3e-87    
ref|XP_001757525.1|  ATP-binding cassette transporter, subfamily ...    287   1e-84    
emb|CDY27649.1|  BnaA09g27580D                                          277   1e-81    
ref|XP_002983053.1|  hypothetical protein SELMODRAFT_117529             278   2e-81    
ref|XP_002965566.1|  ATP-binding cassette transporter                   275   2e-80    
ref|XP_004173028.1|  PREDICTED: ABC transporter B family member 1...    268   3e-79    
ref|XP_006431131.1|  hypothetical protein CICLE_v10010931mg             270   9e-79    
ref|XP_006482578.1|  PREDICTED: ABC transporter B family member 1...    270   1e-78    
gb|KDO72551.1|  hypothetical protein CISIN_1g000856mg                   270   1e-78    
ref|XP_007032498.1|  ATP binding cassette subfamily B19 isoform 2       269   2e-78    
ref|XP_001774240.1|  ATP-binding cassette transporter, subfamily ...    269   2e-78    
ref|XP_007032497.1|  ATP binding cassette subfamily B19 isoform 1       269   2e-78    
ref|XP_010692517.1|  PREDICTED: uncharacterized protein LOC104905624    271   4e-78    
ref|XP_008459308.1|  PREDICTED: ABC transporter B family member 19      268   5e-78    
gb|AAP72956.1|  putative MDR-like P-glycoprotein                        268   6e-78    Lactuca sativa [cultivated lettuce]
ref|XP_002517493.1|  multidrug resistance protein 1, 2, putative        268   8e-78    Ricinus communis
ref|XP_004148691.1|  PREDICTED: ABC transporter B family member 1...    268   8e-78    
ref|XP_002323847.1|  multidrug resistance P-glycoprotein                268   8e-78    Populus trichocarpa [western balsam poplar]
ref|XP_011008935.1|  PREDICTED: ABC transporter B family member 19      268   8e-78    
gb|KGN52452.1|  Multidrug resistance protein 1, 2                       268   1e-77    
gb|KEH24996.1|  ABC transporter B family protein                        267   1e-77    
gb|KDP45498.1|  hypothetical protein JCGZ_09747                         267   2e-77    
ref|XP_003543769.1|  PREDICTED: ABC transporter B family member 1...    266   2e-77    
ref|XP_008379345.1|  PREDICTED: ABC transporter B family member 19      266   2e-77    
emb|CBI22189.3|  unnamed protein product                                266   2e-77    
gb|KHG20565.1|  ABC transporter B family member 19                      266   2e-77    
ref|XP_006338462.1|  PREDICTED: ABC transporter B family member 1...    266   2e-77    
ref|XP_009591470.1|  PREDICTED: ABC transporter B family member 19      266   3e-77    
gb|ABX82929.1|  LO4                                                     266   3e-77    Solanum pennellii
ref|XP_010693227.1|  PREDICTED: ABC transporter B family member 19      266   3e-77    
ref|NP_001234209.1|  L04                                                266   3e-77    
ref|XP_009758464.1|  PREDICTED: ABC transporter B family member 19      266   3e-77    
ref|XP_002283051.2|  PREDICTED: ABC transporter B family member 19      266   4e-77    Vitis vinifera
gb|KHG22495.1|  ABC transporter B family member 19                      265   5e-77    
ref|XP_011085762.1|  PREDICTED: ABC transporter B family member 1...    265   5e-77    
ref|XP_003554410.1|  PREDICTED: ABC transporter B family member 1...    265   5e-77    
ref|XP_004489384.1|  PREDICTED: ABC transporter B family member 1...    265   5e-77    
gb|KFK33760.1|  hypothetical protein AALP_AA5G056700                    265   6e-77    
emb|CDY00109.1|  BnaC09g01920D                                          265   8e-77    
ref|XP_002976764.1|  hypothetical protein SELMODRAFT_105467             265   1e-76    
ref|XP_010032346.1|  PREDICTED: ABC transporter B family member 19      265   1e-76    
gb|KCW51753.1|  hypothetical protein EUGRSUZ_J01214                     265   1e-76    
gb|AIU41631.1|  ABC transporter family protein                          264   1e-76    
ref|XP_001779184.1|  ATP-binding cassette transporter, subfamily ...    264   2e-76    
ref|XP_009111610.1|  PREDICTED: ABC transporter B family member 1...    264   2e-76    
emb|CDY20012.1|  BnaA09g02390D                                          264   2e-76    
ref|XP_004304313.1|  PREDICTED: ABC transporter B family member 1...    263   2e-76    
ref|XP_010552950.1|  PREDICTED: ABC transporter B family member 1...    263   3e-76    
emb|CDP02220.1|  unnamed protein product                                263   3e-76    
ref|XP_007151220.1|  hypothetical protein PHAVU_004G027800g             263   4e-76    
ref|XP_010256924.1|  PREDICTED: ABC transporter B family member 19      263   5e-76    
ref|XP_010937072.1|  PREDICTED: ABC transporter B family member 19      263   5e-76    
ref|XP_010108971.1|  ABC transporter B family member 19                 262   6e-76    
ref|XP_008230752.1|  PREDICTED: ABC transporter B family member 19      262   6e-76    
ref|XP_007217651.1|  hypothetical protein PRUPE_ppa000359mg             262   6e-76    
ref|XP_008341564.1|  PREDICTED: LOW QUALITY PROTEIN: ABC transpor...    262   7e-76    
emb|CDY65012.1|  BnaCnng45670D                                          262   8e-76    
ref|XP_009347047.1|  PREDICTED: ABC transporter B family member 19      262   9e-76    
ref|XP_010554005.1|  PREDICTED: ABC transporter B family member 1...    261   2e-75    
ref|XP_006652374.1|  PREDICTED: ABC transporter B family member 1...    261   2e-75    
ref|XP_002877137.1|  P-glycoprotein 19                                  261   2e-75    
ref|NP_001052982.1|  Os04g0459000                                       261   3e-75    Oryza sativa Japonica Group [Japonica rice]
ref|XP_006395333.1|  hypothetical protein EUTSA_v10003528mg             261   3e-75    
ref|XP_004975845.1|  PREDICTED: ABC transporter B family member 1...    261   3e-75    
ref|NP_001054045.1|  Os04g0642000                                       253   3e-75    Oryza sativa Japonica Group [Japonica rice]
ref|XP_002447959.1|  hypothetical protein SORBIDRAFT_06g018860          260   3e-75    Sorghum bicolor [broomcorn]
ref|NP_001169660.1|  uncharacterized protein LOC100383541               260   3e-75    Zea mays [maize]
ref|XP_006290510.1|  hypothetical protein CARUB_v10016588mg             260   3e-75    
ref|XP_010502886.1|  PREDICTED: ABC transporter B family member 1...    260   4e-75    
emb|CDX86408.1|  BnaA06g31250D                                          259   7e-75    
ref|XP_009151836.1|  PREDICTED: ABC transporter B family member 19      259   7e-75    
ref|XP_011098607.1|  PREDICTED: ABC transporter B family member 19      259   8e-75    
ref|XP_010514603.1|  PREDICTED: ABC transporter B family member 1...    259   9e-75    
ref|XP_010425667.1|  PREDICTED: ABC transporter B family member 19      259   1e-74    
dbj|BAG91391.1|  unnamed protein product                                252   1e-74    Oryza sativa Japonica Group [Japonica rice]
ref|NP_189528.1|  ABC transporter B family member 19                    259   1e-74    Arabidopsis thaliana [mouse-ear cress]
gb|AAN28720.2|  MDR-like p-glycoprotein                                 259   1e-74    Arabidopsis thaliana [mouse-ear cress]
dbj|BAC41846.1|  putative P-glycoprotein                                259   1e-74    Arabidopsis thaliana [mouse-ear cress]
ref|XP_008784383.1|  PREDICTED: ABC transporter B family member 19      259   1e-74    
ref|XP_006827168.1|  hypothetical protein AMTR_s00010p00254310          258   1e-74    
ref|XP_010528330.1|  PREDICTED: ABC transporter B family member 19      258   2e-74    
ref|XP_010939542.1|  PREDICTED: LOW QUALITY PROTEIN: ABC transpor...    256   9e-74    
dbj|BAK05967.1|  predicted protein                                      256   1e-73    
ref|XP_004977001.1|  PREDICTED: ABC transporter B family member 1...    256   1e-73    
ref|XP_010439807.1|  PREDICTED: ABC transporter B family member 1...    255   1e-73    
ref|XP_008804465.1|  PREDICTED: ABC transporter B family member 1...    256   2e-73    
ref|XP_002973102.1|  ATP-binding cassette transporter                   255   2e-73    
ref|XP_003579896.1|  PREDICTED: ABC transporter B family member 1...    254   4e-73    
ref|XP_002448624.1|  hypothetical protein SORBIDRAFT_06g030350          254   6e-73    Sorghum bicolor [broomcorn]
emb|CAC09461.2|  H0423H10.7                                             254   9e-73    Oryza sativa [red rice]
emb|CAD59581.1|  MDR-like ABC transporter                               253   1e-72    Oryza sativa Japonica Group [Japonica rice]
ref|XP_009415585.1|  PREDICTED: ABC transporter B family member 19      253   1e-72    
ref|XP_009395922.1|  PREDICTED: ABC transporter B family member 1...    253   2e-72    
dbj|BAJ53110.1|  JHL20J20.17                                            251   2e-72    
ref|XP_008663648.1|  PREDICTED: ABC transporter B family member 1...    252   3e-72    
emb|CAD59582.1|  MDR-like ABC transporter                               252   3e-72    Oryza sativa Japonica Group [Japonica rice]
ref|XP_008668793.1|  PREDICTED: ABC transporter B family member 1...    252   3e-72    
gb|ABG75919.1|  MDR-like ABC transporter                                250   2e-71    
ref|XP_009764894.1|  PREDICTED: ABC transporter B family member 2...    249   2e-71    
dbj|BAJ96840.1|  predicted protein                                      249   3e-71    
ref|XP_003579371.1|  PREDICTED: ABC transporter B family member 1...    249   3e-71    
ref|XP_007032499.1|  ATP binding cassette subfamily B19 isoform 3       247   2e-70    
gb|KHN45492.1|  ABC transporter B family member 19                      246   3e-70    
gb|EMT07148.1|  ABC transporter B family member 19                      246   3e-70    
ref|XP_009595706.1|  PREDICTED: ABC transporter B family member 2...    246   5e-70    
ref|XP_001759716.1|  ATP-binding cassette transporter, subfamily ...    245   1e-69    
ref|XP_009113725.1|  PREDICTED: ABC transporter B family member 1...    244   1e-69    
gb|EMT32511.1|  ABC transporter B family member 19                      244   2e-69    
ref|XP_004173771.1|  PREDICTED: ABC transporter B family member 1...    231   3e-69    
ref|XP_010908483.1|  PREDICTED: ABC transporter B family member 2...    243   4e-69    
ref|XP_006352948.1|  PREDICTED: ABC transporter B family member 2...    243   5e-69    
gb|AIU41630.1|  ABC transporter family protein                          242   7e-69    
gb|EAZ32166.1|  hypothetical protein OsJ_16371                          241   3e-68    Oryza sativa Japonica Group [Japonica rice]
emb|CDX92739.1|  BnaC07g39970D                                          241   3e-68    
ref|XP_003625677.1|  ABC transporter-like protein                       235   3e-68    
ref|XP_009396844.1|  PREDICTED: ABC transporter B family member 2...    240   6e-68    
ref|XP_010055294.1|  PREDICTED: ABC transporter B family member 2...    239   1e-67    
ref|XP_008238211.1|  PREDICTED: ABC transporter B family member 2...    239   1e-67    
ref|XP_007210429.1|  hypothetical protein PRUPE_ppa000340mg             238   3e-67    
ref|XP_009789853.1|  PREDICTED: ABC transporter B family member 1...    239   3e-67    
ref|XP_010540773.1|  PREDICTED: ABC transporter B family member 2...    238   3e-67    
gb|KEH42187.1|  ABC transporter B family protein                        238   3e-67    
ref|XP_003572841.1|  PREDICTED: ABC transporter B family member 2...    238   5e-67    
ref|XP_010274279.1|  PREDICTED: ABC transporter B family member 2...    237   6e-67    
ref|XP_004512509.1|  PREDICTED: ABC transporter B family member 2...    237   6e-67    
ref|XP_008800115.1|  PREDICTED: ABC transporter B family member 2...    237   6e-67    
ref|XP_006843046.1|  hypothetical protein AMTR_s00076p00195870          237   8e-67    
ref|XP_003628784.1|  ABC transporter B family member                    228   8e-67    
ref|XP_009137566.1|  PREDICTED: ABC transporter B family member 2...    236   1e-66    
ref|XP_010677330.1|  PREDICTED: ABC transporter B family member 2...    236   1e-66    
ref|XP_002981381.1|  hypothetical protein SELMODRAFT_114581             236   2e-66    
ref|NP_001047803.1|  Os02g0693700                                       236   2e-66    Oryza sativa Japonica Group [Japonica rice]
gb|EEC73824.1|  hypothetical protein OsI_08549                          236   2e-66    Oryza sativa Indica Group [Indian rice]
ref|XP_002969904.1|  ATP-binding cassette transporter                   236   2e-66    
ref|XP_002277547.1|  PREDICTED: ABC transporter B family member 2       236   2e-66    Vitis vinifera
emb|CDY42770.1|  BnaA03g47690D                                          235   2e-66    
ref|XP_006647720.1|  PREDICTED: ABC transporter B family member 2...    235   3e-66    
emb|CDP13052.1|  unnamed protein product                                235   3e-66    
ref|XP_010906448.1|  PREDICTED: ABC transporter B family member 2...    235   4e-66    
ref|XP_002892589.1|  P-glycoprotein 10                                  234   4e-66    
ref|XP_006303653.1|  hypothetical protein CARUB_v10011664mg             234   4e-66    
emb|CAD40903.1|  OSJNBa0036B21.21                                       235   5e-66    Oryza sativa Japonica Group [Japonica rice]
gb|EEC77398.1|  hypothetical protein OsI_16157                          235   5e-66    Oryza sativa Indica Group [Indian rice]
ref|XP_004497537.1|  PREDICTED: ABC transporter B family member 1...    235   5e-66    
gb|AES81895.2|  ABC transporter B family protein                        235   5e-66    
ref|XP_002266505.1|  PREDICTED: ABC transporter B family member 1       235   5e-66    Vitis vinifera
ref|XP_006471591.1|  PREDICTED: ABC transporter B family member 2...    234   5e-66    
ref|XP_010458427.1|  PREDICTED: ABC transporter B family member 1...    234   6e-66    
ref|XP_008789538.1|  PREDICTED: LOW QUALITY PROTEIN: ABC transpor...    235   6e-66    
ref|XP_011018526.1|  PREDICTED: ABC transporter B family member 2...    234   8e-66    
ref|XP_009609959.1|  PREDICTED: ABC transporter B family member 1       234   9e-66    
ref|XP_008676453.1|  PREDICTED: uncharacterized protein LOC100191...    234   1e-65    
gb|KFK43347.1|  hypothetical protein AALP_AA1G113900                    233   2e-65    
ref|XP_007040642.1|  Multidrug/pheromone exporter, MDR family, AB...    232   2e-65    
emb|CDX89380.1|  BnaA01g15130D                                          233   2e-65    
ref|XP_010475946.1|  PREDICTED: ABC transporter B family member 1...    233   2e-65    
ref|XP_011077318.1|  PREDICTED: ABC transporter B family member 1       233   2e-65    
ref|XP_006854029.1|  hypothetical protein AMTR_s00048p00046670          233   2e-65    
ref|XP_009139729.1|  PREDICTED: ABC transporter B family member 2       233   2e-65    
gb|KFK36572.1|  hypothetical protein AALP_AA4G140900                    233   2e-65    
ref|XP_010491749.1|  PREDICTED: ABC transporter B family member 10      233   3e-65    
ref|XP_011094609.1|  PREDICTED: ABC transporter B family member 1...    233   3e-65    
emb|CDX94395.1|  BnaC01g17890D                                          232   3e-65    
ref|XP_010538383.1|  PREDICTED: ABC transporter B family member 2...    232   3e-65    
gb|AFP44695.1|  hypothetical protein                                    233   4e-65    
ref|XP_004953524.1|  PREDICTED: ABC transporter B family member 2...    232   4e-65    
gb|AFP44681.1|  hypothetical protein                                    233   4e-65    
ref|XP_007040641.1|  Multidrug/pheromone exporter, MDR family, AB...    232   4e-65    
ref|XP_010684039.1|  PREDICTED: ABC transporter B family member 1       233   4e-65    
ref|XP_007162774.1|  hypothetical protein PHAVU_001G179300g             232   5e-65    
gb|EYU29874.1|  hypothetical protein MIMGU_mgv1a000299mg                232   5e-65    
ref|XP_006413247.1|  hypothetical protein EUTSA_v10024237mg             232   5e-65    
ref|XP_006410867.1|  hypothetical protein EUTSA_v10016150mg             232   6e-65    
ref|XP_006417431.1|  hypothetical protein EUTSA_v10009914mg             231   6e-65    
ref|XP_010267196.1|  PREDICTED: LOW QUALITY PROTEIN: ABC transpor...    232   6e-65    
ref|XP_004245909.2|  PREDICTED: ABC transporter B family member 2...    231   7e-65    
ref|NP_181228.1|  ABC transporter B family member 1                     231   9e-65    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010240898.1|  PREDICTED: ABC transporter B family member 2...    231   9e-65    
ref|XP_004494063.1|  PREDICTED: ABC transporter B family member 1...    231   9e-65    
gb|AAM98246.1|  putative ABC transporter                                231   1e-64    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002452712.1|  hypothetical protein SORBIDRAFT_04g031170          231   1e-64    Sorghum bicolor [broomcorn]
ref|XP_010509416.1|  PREDICTED: ABC transporter B family member 1...    231   1e-64    
ref|XP_003533440.1|  PREDICTED: ABC transporter B family member 2...    231   1e-64    
ref|XP_010101619.1|  ABC transporter B family member 1                  231   1e-64    
ref|XP_010530473.1|  PREDICTED: ABC transporter B family member 1       231   1e-64    
ref|XP_010505240.1|  PREDICTED: ABC transporter B family member 1       231   1e-64    
ref|XP_010241797.1|  PREDICTED: ABC transporter B family member 1       231   1e-64    
ref|XP_010516925.1|  PREDICTED: ABC transporter B family member 1...    231   1e-64    
emb|CDY18472.1|  BnaA04g21150D                                          228   1e-64    
gb|EYU34148.1|  hypothetical protein MIMGU_mgv1a000301mg                231   2e-64    
ref|XP_003541417.1|  PREDICTED: ABC transporter B family member 1...    231   2e-64    
ref|XP_004137839.1|  PREDICTED: ABC transporter B family member 1...    231   2e-64    
ref|XP_009148411.1|  PREDICTED: ABC transporter B family member 10      230   2e-64    
ref|NP_172538.1|  ABC transporter B family member 10                    230   2e-64    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006585887.1|  PREDICTED: ABC transporter B family member 2...    230   2e-64    
emb|CDY37953.1|  BnaC05g08210D                                          230   2e-64    
emb|CDX93393.1|  BnaA06g06550D                                          230   2e-64    
ref|XP_003535149.1|  PREDICTED: ABC transporter B family member 1...    230   2e-64    
ref|NP_194326.2|  P-glycoprotein 2                                      230   3e-64    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009141619.1|  PREDICTED: ABC transporter B family member 1       230   3e-64    
ref|XP_008777170.1|  PREDICTED: ABC transporter B family member 2...    229   3e-64    
ref|XP_006385671.1|  hypothetical protein POPTR_0003s09320g             228   3e-64    
ref|XP_002879630.1|  ATPGP1                                             229   4e-64    
ref|XP_010096959.1|  ABC transporter B family member 2                  227   4e-64    
ref|XP_003612850.1|  ABC transporter B family member                    229   4e-64    
ref|XP_007144334.1|  hypothetical protein PHAVU_007G147400g             229   4e-64    
ref|XP_007156412.1|  hypothetical protein PHAVU_003G283900g             229   5e-64    
ref|XP_002869639.1|  multidrug resistance protein 2                     229   5e-64    
gb|KGN58982.1|  Multidrug resistance protein 1, 2                       228   5e-64    
ref|XP_003554389.1|  PREDICTED: ABC transporter B family member 1...    229   5e-64    
ref|XP_002519488.1|  multidrug resistance protein 1, 2, putative        229   5e-64    Ricinus communis
ref|XP_007204682.1|  hypothetical protein PRUPE_ppa000269mg             229   6e-64    
ref|XP_011082358.1|  PREDICTED: ABC transporter B family member 2...    229   6e-64    
ref|XP_009133103.1|  PREDICTED: ABC transporter B family member 1       229   6e-64    
gb|AAF23176.1|AF216497_1  P-glycoprotein                                229   6e-64    Gossypium hirsutum [American cotton]
ref|XP_008241411.1|  PREDICTED: ABC transporter B family member 1       229   7e-64    
gb|EPS64351.1|  hypothetical protein M569_10429                         229   7e-64    
ref|XP_006282856.1|  hypothetical protein CARUB_v10006816mg             228   9e-64    
emb|CAA71277.1|  P-glycoprotein-2                                       228   1e-63    
gb|AAM20507.1|  P-glycoprotein-2                                        228   1e-63    
ref|XP_002962569.1|  ATP-binding cassette transporter                   228   1e-63    
ref|XP_003520656.1|  PREDICTED: ABC transporter B family member 1...    228   2e-63    
gb|KHN09525.1|  ABC transporter B family member 1                       228   2e-63    
gb|KHN30010.1|  ABC transporter B family member 2                       228   2e-63    
ref|XP_008373592.1|  PREDICTED: ABC transporter B family member 2...    227   2e-63    
ref|XP_004246624.1|  PREDICTED: ABC transporter B family member 1       228   2e-63    
ref|XP_002304346.1|  P-glycoprotein                                     227   2e-63    
gb|EYU38561.1|  hypothetical protein MIMGU_mgv1a000268mg                227   3e-63    
ref|XP_002527657.1|  multidrug resistance protein 1, 2, putative        226   3e-63    
ref|XP_006293439.1|  hypothetical protein CARUB_v10022511mg             227   3e-63    
tpg|DAA48547.1|  TPA: hypothetical protein ZEAMMB73_189648              221   3e-63    
ref|XP_011018529.1|  PREDICTED: ABC transporter B family member 2...    226   4e-63    
ref|XP_008369562.1|  PREDICTED: ABC transporter B family member 1...    227   4e-63    
ref|XP_009371200.1|  PREDICTED: ABC transporter B family member 2...    226   5e-63    
ref|XP_011028150.1|  PREDICTED: ABC transporter B family member 2...    226   5e-63    
gb|KDP29159.1|  hypothetical protein JCGZ_16548                         226   6e-63    
ref|XP_010940643.1|  PREDICTED: ABC transporter B family member 1...    226   6e-63    
gb|AIU41628.1|  ABC transporter family protein                          226   7e-63    
ref|XP_008800555.1|  PREDICTED: ABC transporter B family member 1...    226   8e-63    
ref|XP_009339155.1|  PREDICTED: ABC transporter B family member 1       226   9e-63    
ref|XP_007158282.1|  hypothetical protein PHAVU_002G139400g             225   9e-63    
gb|KFK29108.1|  hypothetical protein AALP_AA7G090300                    225   9e-63    
ref|XP_009396182.1|  PREDICTED: ABC transporter B family member 1...    226   9e-63    
ref|XP_004301784.1|  PREDICTED: ABC transporter B family member 2...    226   9e-63    
ref|XP_009377013.1|  PREDICTED: ABC transporter B family member 1       225   1e-62    
ref|XP_009376834.1|  PREDICTED: ABC transporter B family member 1...    225   1e-62    
ref|XP_008465999.1|  PREDICTED: ABC transporter B family member 2...    225   1e-62    
ref|XP_008387548.1|  PREDICTED: ABC transporter B family member 1       225   2e-62    
dbj|BAJ99824.1|  predicted protein                                      225   2e-62    
ref|XP_009395305.1|  PREDICTED: ABC transporter B family member 1...    225   2e-62    
ref|XP_010935700.1|  PREDICTED: ABC transporter B family member 1...    225   2e-62    
ref|XP_004974253.1|  PREDICTED: ABC transporter B family member 1...    225   2e-62    
gb|KGN60362.1|  hypothetical protein Csa_3G901080                       224   2e-62    
emb|CDY46744.1|  BnaA03g16880D                                          225   2e-62    
gb|KHG25987.1|  ABC transporter B family member 1                       224   2e-62    
emb|CDX79704.1|  BnaC03g20400D                                          224   3e-62    
ref|NP_001275319.1|  P-glycoprotein                                     224   5e-62    
ref|XP_010037649.1|  PREDICTED: ABC transporter B family member 1...    224   5e-62    
ref|XP_010037650.1|  PREDICTED: ABC transporter B family member 1...    224   5e-62    
gb|KHG30028.1|  ABC transporter B family member 1                       224   6e-62    
ref|XP_006381407.1|  P glycoprotein1                                    223   7e-62    
emb|CBI30138.3|  unnamed protein product                                221   7e-62    
ref|XP_011018746.1|  PREDICTED: ABC transporter B family member 1       223   9e-62    
ref|XP_011013349.1|  PREDICTED: ABC transporter B family member 1...    223   9e-62    
ref|XP_009339152.1|  PREDICTED: ABC transporter B family member 1...    223   1e-61    
ref|XP_007027419.1|  ATP binding cassette subfamily B1 isoform 1        222   2e-61    
ref|XP_004304461.1|  PREDICTED: ABC transporter B family member 1...    222   2e-61    
ref|XP_001751653.1|  ATP-binding cassette transporter, subfamily ...    222   2e-61    
ref|XP_006354367.1|  PREDICTED: ABC transporter B family member 1       222   2e-61    
ref|XP_006660395.1|  PREDICTED: ABC transporter B family member 1...    222   2e-61    
gb|KDO51694.1|  hypothetical protein CISIN_1g000687mg                   221   3e-61    
gb|KDO51692.1|  hypothetical protein CISIN_1g000687mg                   221   3e-61    
ref|XP_002445666.1|  hypothetical protein SORBIDRAFT_07g023730          221   5e-61    
ref|XP_008645880.1|  PREDICTED: uncharacterized protein LOC100384...    221   6e-61    
ref|XP_010234205.1|  PREDICTED: ABC transporter B family member 1       221   6e-61    
ref|XP_002323485.2|  P glycoprotein1                                    221   6e-61    
ref|NP_001062529.2|  Os08g0564300                                       218   7e-61    
ref|XP_006428358.1|  hypothetical protein CICLE_v10010916mg             220   7e-61    
ref|XP_010938901.1|  PREDICTED: ABC transporter B family member 4...    220   1e-60    
ref|XP_008439691.1|  PREDICTED: ABC transporter B family member 9       220   1e-60    
gb|AAR00316.1|  PGP1                                                    219   1e-60    
gb|AAR10387.1|  P-glycoprotein 1                                        219   1e-60    
dbj|BAD12940.1|  putative P-glycoprotein 1                              219   3e-60    
gb|EEC84043.1|  hypothetical protein OsI_30303                          219   3e-60    
gb|EEE69159.1|  hypothetical protein OsJ_28307                          218   4e-60    
gb|KHN39060.1|  ABC transporter B family member 1                       218   4e-60    
gb|KHN48276.1|  ABC transporter B family member 1                       218   5e-60    
gb|KHN04865.1|  ABC transporter B family member 2                       217   8e-60    
ref|XP_003517674.1|  PREDICTED: ABC transporter B family member 2...    217   8e-60    
ref|XP_008227785.1|  PREDICTED: ABC transporter B family member 1...    217   1e-59    
gb|ABG56414.1|  MDR-like ABC transporter                                216   3e-59    
ref|XP_004134559.1|  PREDICTED: ABC transporter B family member 9...    215   4e-59    
emb|CDP06775.1|  unnamed protein product                                215   4e-59    
gb|AAF17668.1|AC009398_17  F20B24.12                                    215   5e-59    
ref|XP_006847022.1|  hypothetical protein AMTR_s00017p00164980          215   5e-59    
ref|XP_004155533.1|  PREDICTED: LOW QUALITY PROTEIN: ABC transpor...    215   5e-59    
ref|XP_010095132.1|  ABC transporter B family member 9                  215   6e-59    
emb|CAD59580.1|  MDR-like ABC transporter                               214   1e-58    
ref|XP_007221461.1|  hypothetical protein PRUPE_ppa000313mg             213   2e-58    
ref|XP_002979534.1|  hypothetical protein SELMODRAFT_177681             213   2e-58    
ref|XP_006597506.1|  PREDICTED: ABC transporter B family member 9...    213   4e-58    
ref|XP_006597507.1|  PREDICTED: ABC transporter B family member 9...    212   4e-58    
ref|XP_004136398.1|  PREDICTED: ABC transporter B family member 2...    212   4e-58    
ref|XP_003547192.1|  PREDICTED: ABC transporter B family member 9...    212   5e-58    
ref|XP_006597505.1|  PREDICTED: ABC transporter B family member 9...    212   5e-58    
ref|XP_001775250.1|  ATP-binding cassette transporter, subfamily ...    212   5e-58    
ref|XP_008441862.1|  PREDICTED: ABC transporter B family member 4...    212   6e-58    
ref|XP_010938828.1|  PREDICTED: ABC transporter B family member 2...    212   6e-58    
ref|XP_010688391.1|  PREDICTED: ABC transporter B family member 1...    212   7e-58    
ref|XP_002986365.1|  ATP-binding cassette transporter                   212   7e-58    
ref|XP_002977745.1|  ATP-binding cassette transporter                   211   7e-58    
ref|XP_006368377.1|  P-glycoprotein                                     211   9e-58    
ref|XP_002981724.1|  hypothetical protein SELMODRAFT_154740             211   1e-57    
ref|XP_002967803.1|  ATP-binding cassette transporter                   211   1e-57    
ref|XP_002988703.1|  hypothetical protein SELMODRAFT_184079             211   1e-57    
ref|XP_008778177.1|  PREDICTED: LOW QUALITY PROTEIN: ABC transpor...    210   1e-57    
ref|XP_010045610.1|  PREDICTED: ABC transporter B family member 1...    211   2e-57    
ref|XP_004152829.1|  PREDICTED: ABC transporter B family member 4...    210   2e-57    
gb|KGN58980.1|  Multidrug resistance protein 1, 2                       210   2e-57    
ref|XP_004155099.1|  PREDICTED: ABC transporter B family member 4...    210   2e-57    
gb|KGN61257.1|  hypothetical protein Csa_2G074190                       210   2e-57    
ref|XP_007027420.1|  ATP binding cassette subfamily B1 isoform 2        210   3e-57    
ref|XP_011005823.1|  PREDICTED: ABC transporter B family member 9       209   4e-57    
ref|XP_010052120.1|  PREDICTED: ABC transporter B family member 9...    209   4e-57    
gb|KHN38940.1|  ABC transporter B family member 2                       209   4e-57    
gb|KGN61258.1|  hypothetical protein Csa_2G074200                       209   5e-57    
ref|XP_002314333.2|  hypothetical protein POPTR_0010s00540g             209   6e-57    
ref|XP_003591310.1|  ABC transporter B family member                    209   8e-57    
ref|XP_004361188.1|  ABC transporter B family protein                   204   9e-57    
gb|KHN45005.1|  ABC transporter B family member 11                      208   1e-56    
ref|XP_006594002.1|  PREDICTED: ABC transporter B family member 1...    208   1e-56    
emb|CBI37062.3|  unnamed protein product                                207   1e-56    
ref|XP_629136.1|  ABC transporter B family protein                      208   1e-56    
ref|XP_003591313.1|  ABC transporter B family member                    206   1e-56    
ref|XP_004304812.1|  PREDICTED: ABC transporter B family member 2...    197   1e-56    
ref|XP_004509740.1|  PREDICTED: ABC transporter B family member 2...    206   2e-56    
ref|XP_010474667.1|  PREDICTED: ABC transporter B family member 1...    207   2e-56    
ref|XP_009353526.1|  PREDICTED: ABC transporter B family member 9...    207   2e-56    
ref|XP_010938829.1|  PREDICTED: ABC transporter B family member 4...    207   2e-56    
ref|XP_003541677.1|  PREDICTED: ABC transporter B family member 9...    207   2e-56    
ref|XP_002273987.1|  PREDICTED: ABC transporter B family member 11      207   3e-56    
ref|XP_002992781.1|  hypothetical protein SELMODRAFT_236608             207   3e-56    
ref|XP_002988773.1|  hypothetical protein SELMODRAFT_184091             207   3e-56    
emb|CAN76787.1|  hypothetical protein VITISV_029557                     207   3e-56    
ref|XP_007154480.1|  hypothetical protein PHAVU_003G122400g             207   3e-56    
ref|XP_002994484.1|  hypothetical protein SELMODRAFT_138662             207   3e-56    
ref|XP_009360960.1|  PREDICTED: ABC transporter B family member 9...    207   3e-56    
ref|XP_006369863.1|  ABC transporter family protein                     207   4e-56    
ref|XP_006375419.1|  multidrug resistant ABC transporter family p...    207   4e-56    
gb|KHN14170.1|  ABC transporter B family member 11                      206   4e-56    
ref|XP_004509738.1|  PREDICTED: ABC transporter B family member 2...    206   4e-56    
ref|XP_010457237.1|  PREDICTED: ABC transporter B family member 1...    206   5e-56    
ref|XP_003593841.1|  ABC transporter B family member                    206   5e-56    
ref|XP_010457236.1|  PREDICTED: ABC transporter B family member 1...    206   5e-56    
gb|AES61564.2|  ABC transporter B family protein                        206   5e-56    
ref|XP_011040312.1|  PREDICTED: LOW QUALITY PROTEIN: ABC transpor...    206   6e-56    
gb|AES64092.2|  ABC transporter B family-like protein                   206   6e-56    
ref|XP_010559276.1|  PREDICTED: ABC transporter B family member 9       206   7e-56    
gb|KHN14227.1|  ABC transporter B family member 4                       206   7e-56    
ref|XP_010905016.1|  PREDICTED: ABC transporter B family member 2...    206   7e-56    
ref|XP_002983357.1|  hypothetical protein SELMODRAFT_117838             206   8e-56    
gb|KCW46760.1|  hypothetical protein EUGRSUZ_K00568                     204   8e-56    
gb|EYU38437.1|  hypothetical protein MIMGU_mgv1a000327mg                206   8e-56    
ref|XP_010905014.1|  PREDICTED: ABC transporter B family member 1...    206   9e-56    
ref|XP_010045640.1|  PREDICTED: ABC transporter B family member 1...    205   1e-55    
ref|XP_003535294.1|  PREDICTED: ABC transporter B family member 2...    205   1e-55    
ref|XP_002515184.1|  multidrug resistance protein 1, 2, putative        205   1e-55    
ref|XP_010507777.1|  PREDICTED: ABC transporter B family member 4...    200   2e-55    
ref|XP_009360959.1|  PREDICTED: ABC transporter B family member 9...    205   2e-55    
ref|XP_006577181.1|  PREDICTED: ABC transporter B family member 4...    205   2e-55    
gb|KCW46759.1|  hypothetical protein EUGRSUZ_K00568                     204   2e-55    
ref|XP_003520772.2|  PREDICTED: ABC transporter B family member 4...    205   2e-55    
ref|XP_006577182.1|  PREDICTED: ABC transporter B family member 4...    204   2e-55    
ref|XP_009593037.1|  PREDICTED: ABC transporter B family member 1...    204   2e-55    
gb|KCW88641.1|  hypothetical protein EUGRSUZ_A01006                     203   2e-55    
gb|KHN00238.1|  ABC transporter B family member 4                       204   2e-55    
ref|XP_003518599.1|  PREDICTED: ABC transporter B family member 4...    204   2e-55    
gb|KDO86794.1|  hypothetical protein CISIN_1g000777mg                   204   2e-55    
ref|XP_006577180.1|  PREDICTED: ABC transporter B family member 4...    204   3e-55    
ref|XP_010035385.1|  PREDICTED: ABC transporter B family member 4...    204   3e-55    
gb|KDO86793.1|  hypothetical protein CISIN_1g000777mg                   204   4e-55    
ref|XP_007159374.1|  hypothetical protein PHAVU_002G232900g             204   4e-55    
gb|KDO86792.1|  hypothetical protein CISIN_1g000777mg                   204   4e-55    
ref|XP_010045629.1|  PREDICTED: ABC transporter B family member 1...    204   4e-55    
ref|XP_008349179.1|  PREDICTED: LOW QUALITY PROTEIN: ABC transpor...    204   4e-55    
ref|XP_004308506.1|  PREDICTED: ABC transporter B family member 9...    204   4e-55    
ref|XP_006492413.1|  PREDICTED: ABC transporter B family member 4...    204   4e-55    
ref|XP_006444609.1|  hypothetical protein CICLE_v10018532mg             204   4e-55    
ref|XP_011079475.1|  PREDICTED: ABC transporter B family member 4...    204   5e-55    
gb|KDO86791.1|  hypothetical protein CISIN_1g000777mg                   204   5e-55    
ref|XP_011005954.1|  PREDICTED: ABC transporter B family member 4...    203   6e-55    
ref|XP_011016204.1|  PREDICTED: ABC transporter B family member 2...    203   6e-55    
ref|XP_007214562.1|  hypothetical protein PRUPE_ppa000338mg             203   6e-55    
ref|XP_011096468.1|  PREDICTED: ABC transporter B family member 9       203   7e-55    
gb|EYU38439.1|  hypothetical protein MIMGU_mgv1a020314mg                203   8e-55    
ref|XP_007145097.1|  hypothetical protein PHAVU_007G209600g             203   8e-55    
ref|XP_004166183.1|  PREDICTED: LOW QUALITY PROTEIN: ABC transpor...    203   9e-55    
ref|XP_010544933.1|  PREDICTED: ABC transporter B family member 2...    202   1e-54    
ref|XP_008225385.1|  PREDICTED: ABC transporter B family member 9       202   1e-54    
ref|XP_002872874.1|  P-glycoprotein 5                                   202   1e-54    
ref|XP_003285409.1|  ABC transporter B family protein                   202   1e-54    
ref|XP_008383572.1|  PREDICTED: ABC transporter B family member 9...    202   1e-54    
ref|XP_010522857.1|  PREDICTED: ABC transporter B family member 1...    202   2e-54    
ref|XP_010518387.1|  PREDICTED: ABC transporter B family member 4       202   2e-54    
ref|XP_004135527.1|  PREDICTED: ABC transporter B family member 4...    202   2e-54    
dbj|GAM28104.1|  hypothetical protein SAMD00019534_112800               202   2e-54    
gb|AES76388.2|  ABC transporter B family-like protein                   201   3e-54    
ref|XP_003620170.1|  ABC transporter B family member                    201   3e-54    
gb|AAL74249.1|AF466305_1  ABC transporter AbcB2                         202   3e-54    
ref|XP_010321859.1|  PREDICTED: ABC transporter B family member 2...    201   3e-54    
ref|XP_010481062.1|  PREDICTED: ABC transporter B family member 1...    201   3e-54    
ref|XP_009136898.1|  PREDICTED: ABC transporter B family member 9       201   3e-54    
ref|XP_010481058.1|  PREDICTED: ABC transporter B family member 1...    201   3e-54    
ref|XP_004295414.1|  PREDICTED: ABC transporter B family member 9...    201   3e-54    
ref|XP_009778876.1|  PREDICTED: ABC transporter B family member 2...    201   3e-54    
ref|XP_004233862.2|  PREDICTED: ABC transporter B family member 9...    201   3e-54    
emb|CDY15249.1|  BnaC05g01280D                                          201   4e-54    
emb|CDX90425.1|  BnaA03g43560D                                          201   4e-54    
ref|XP_002299180.2|  P-glycoprotein                                     201   4e-54    
ref|XP_010690905.1|  PREDICTED: ABC transporter B family member 1...    201   4e-54    
ref|XP_008798883.1|  PREDICTED: ABC transporter B family member 2...    201   4e-54    
ref|XP_008445963.1|  PREDICTED: ABC transporter B family member 4...    201   5e-54    
gb|KHG29119.1|  ABC transporter B family member 21                      201   5e-54    
gb|KCW75983.1|  hypothetical protein EUGRSUZ_D00348                     201   5e-54    
ref|XP_010054272.1|  PREDICTED: ABC transporter B family member 9...    201   5e-54    
ref|XP_010999324.1|  PREDICTED: ABC transporter B family member 4...    201   5e-54    
emb|CDY48003.1|  BnaA04g26870D                                          200   5e-54    
gb|KDP28337.1|  hypothetical protein JCGZ_14108                         200   6e-54    
gb|KHF98198.1|  ABC transporter B family member 9                       200   6e-54    
ref|XP_009142463.1|  PREDICTED: ABC transporter B family member 4       200   6e-54    
ref|XP_006397891.1|  hypothetical protein EUTSA_v10001285mg             200   6e-54    
emb|CDY27510.1|  BnaC04g51510D                                          200   7e-54    
ref|XP_010507941.1|  PREDICTED: ABC transporter B family member 4...    200   7e-54    
ref|XP_006396374.1|  hypothetical protein EUTSA_v10029333mg             195   7e-54    
ref|XP_004485975.1|  PREDICTED: ABC transporter B family member 9...    200   7e-54    
ref|XP_010054273.1|  PREDICTED: ABC transporter B family member 9...    200   8e-54    
emb|CDY37776.1|  BnaC04g00490D                                          200   9e-54    
ref|XP_002271185.1|  PREDICTED: ABC transporter B family member 9...    200   1e-53    



>ref|XP_002510564.1| multidrug resistance protein 1, 2, putative [Ricinus communis]
 gb|EEF52751.1| multidrug resistance protein 1, 2, putative [Ricinus communis]
Length=1252

 Score =   407 bits (1047),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 193/270 (71%), Positives = 231/270 (86%), Gaps = 8/270 (3%)
 Frame = +3

Query  111  MGELEISSNLKMDQ-------QPSNSTDRKEMVSFFGLFSAADTVDYFFMVFGSIGACIH  269
            M E+E++S+  +DQ       QPS+S+ +   VSFF LFSAAD +DYF M FGS+GACIH
Sbjct  1    MNEVELASDQVLDQNSPKAMDQPSSSS-KTPTVSFFALFSAADKIDYFLMFFGSLGACIH  59

Query  270  GAALPVFFVLFGRMIDSLGHLSSDSHRLSSQVSKQALYLVYLGSIIFISAWIGVAFWTQT  449
            GA+LPVFF+ FGRMIDSLG+L+SD  ++S+QVSK ALYLVYLG ++F+SAWIGVA W QT
Sbjct  60   GASLPVFFIFFGRMIDSLGNLASDPQKMSTQVSKHALYLVYLGLVVFVSAWIGVALWMQT  119

Query  450  GERQTARLRLRYLQSVLRKKIEFFDTDTRAKDIIFHISSDAILVQDAIGDKIGHTIRYIS  629
            GERQTARLRL+YLQSVLRK + FFDT+ R  +I+FHISSDAIL+QDAIGDK GH +RY+S
Sbjct  120  GERQTARLRLKYLQSVLRKDMNFFDTEARDSNIMFHISSDAILIQDAIGDKTGHAMRYLS  179

Query  630  QFLVGFAVGFISVWKLTLVTLAVVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAI  809
            QF+VGFA+GF+ VW+LTL+TLAVVPLIAVAGG YT+IMS LS+KGEAAYAEAGKVAEE I
Sbjct  180  QFIVGFAIGFVYVWQLTLLTLAVVPLIAVAGGAYTVIMSTLSEKGEAAYAEAGKVAEEVI  239

Query  810  SQVRTVYSFVGEKKAVESYSKSLNNALVLG  899
            SQ+RTVYSFVGE KA+E+YSKSLN AL LG
Sbjct  240  SQIRTVYSFVGEDKAIEAYSKSLNKALKLG  269


 Score = 81.3 bits (199),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 55/223 (25%), Positives = 109/223 (49%), Gaps = 4/223 (2%)
 Frame = +3

Query  216  DTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLSSDSHRLSSQVSKQALYLVYL  395
            ++ ++   + GS+GA + G   P+F +    ++ +  +   D+  +  ++ +  L  V L
Sbjct  677  NSPEWPCALLGSLGAVLAGMEAPMFALGITHVLTAFYY--PDASEMRHEIQRVVLIFVGL  734

Query  396  GSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKKIEFFDTD-TRAKDIIFHISSDA  572
              I      +   F+T  GER TAR+RL    ++L  +I +FD D      +   +++DA
Sbjct  735  AVITIPIYLLQHYFYTLMGERLTARVRLSMFSAILSNEIGWFDLDENNTGSLTSTLAADA  794

Query  573  ILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLAVVPLIAVAGGTYTLIMSNL  752
             LV+ A+ D++   ++ ++  +    + F   W++  V +A +PL+  A     L +   
Sbjct  795  TLVRSALADRLSTVVQNVALTVTACVIAFTLSWRVASVVVASLPLLVGASIAEQLFLKGF  854

Query  753  SQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYSKSLN  881
                  AY+ A  VA EA++ +RTV +F  E++    ++  LN
Sbjct  855  GGDYH-AYSRATSVAREALTNIRTVAAFGAEERISIQFASELN  896



>gb|KHG13479.1| ABC transporter B family member 13 [Gossypium arboreum]
Length=1239

 Score =   404 bits (1037),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 193/265 (73%), Positives = 228/265 (86%), Gaps = 5/265 (2%)
 Frame = +3

Query  111  MGELEISSNLKMDQQPSNSTD--RKEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALP  284
            M E+E+S + +   +P  S+D  R++ VSF GLFSAAD +D   MVFGS+GACIHGAALP
Sbjct  1    MEEIELSHHQESVPKPEQSSDLTRRKPVSFLGLFSAADKLDCALMVFGSLGACIHGAALP  60

Query  285  VFFVLFGRMIDSLGHLSSDSHRLSSQVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQT  464
            VFFV+FGRMIDSLGHLSSD H+LS+Q    A+YLVYLG ++F SAWIGVAFW QTGERQT
Sbjct  61   VFFVMFGRMIDSLGHLSSDPHKLSAQ---HAIYLVYLGLVVFASAWIGVAFWMQTGERQT  117

Query  465  ARLRLRYLQSVLRKKIEFFDTDTRAKDIIFHISSDAILVQDAIGDKIGHTIRYISQFLVG  644
            ARLRL+YLQSVLRK I FFDT+TRA +IIFHISSDAILVQDAIGDK GH  RY+SQF+VG
Sbjct  118  ARLRLKYLQSVLRKDISFFDTETRASNIIFHISSDAILVQDAIGDKTGHAFRYLSQFIVG  177

Query  645  FAVGFISVWKLTLVTLAVVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRT  824
            FA+GF SVW+LTL+TLAVVPLIA+AGG YT+IMS LS+KGEAAYAEAGK+AEE ISQ+RT
Sbjct  178  FAIGFTSVWQLTLLTLAVVPLIAIAGGAYTIIMSTLSEKGEAAYAEAGKIAEEVISQIRT  237

Query  825  VYSFVGEKKAVESYSKSLNNALVLG  899
            VY+FVGE++AV++YS SL NAL +G
Sbjct  238  VYAFVGEERAVKAYSSSLKNALKMG  262


 Score = 75.1 bits (183),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 59/225 (26%), Positives = 106/225 (47%), Gaps = 3/225 (1%)
 Frame = +3

Query  216  DTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLSSDSHRLSSQVSKQALYLVYL  395
            +  ++ + + GS+GA + G   P+F   FG         S D+ ++  +V + AL  V L
Sbjct  670  NAPEWPYALLGSVGAILAGMEAPLF--AFGITHVLTAFYSPDNIQIKEEVERVALIFVGL  727

Query  396  GSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKKIEFFDTD-TRAKDIIFHISSDA  572
              +      +   F+T  GE  TAR+RL    ++L  ++ +FD D      +   +++DA
Sbjct  728  AILTIPIYMLQHYFYTLMGENLTARVRLSMFSAILSNEVGWFDLDENNTGSLTAALAADA  787

Query  573  ILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLAVVPLIAVAGGTYTLIMSNL  752
             LV+ A+ D++   ++ ++  +  F + F   W++  V +A  PL+  A  T  L +   
Sbjct  788  TLVRSALADRLSTIVQNVALTVTAFVIAFALSWRIASVIIASFPLLIGASITEQLFLKGF  847

Query  753  SQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYSKSLNNA  887
                   Y+ A  VA EAI  +RTV +F  E +    ++  LN  
Sbjct  848  GGNYSHTYSRATAVAREAIVNIRTVAAFGVEDRISIKFASELNQP  892



>ref|XP_003549468.1| PREDICTED: ABC transporter B family member 13-like [Glycine max]
Length=1250

 Score =   402 bits (1032),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 189/266 (71%), Positives = 226/266 (85%), Gaps = 3/266 (1%)
 Frame = +3

Query  111  MGELEISSNLKMDQQPSNSTDRK---EMVSFFGLFSAADTVDYFFMVFGSIGACIHGAAL  281
            M E+E++ + +++Q  S+  D++   E VSFFGLF+ AD  D   M  G  G+C+HGAAL
Sbjct  1    MAEVELAPDSRLEQNVSSKIDQQTKTESVSFFGLFATADATDCVLMFLGCFGSCVHGAAL  60

Query  282  PVFFVLFGRMIDSLGHLSSDSHRLSSQVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQ  461
            PVFF+LFGRMIDSLGHLS+D H+LSS+VS+ ALYLVYLG ++ +SAW+GVAFW QTGERQ
Sbjct  61   PVFFILFGRMIDSLGHLSNDPHKLSSRVSEHALYLVYLGGVVLVSAWMGVAFWMQTGERQ  120

Query  462  TARLRLRYLQSVLRKKIEFFDTDTRAKDIIFHISSDAILVQDAIGDKIGHTIRYISQFLV  641
            TARLRL+YLQ+VL+K I FFD + R  +IIFHISSDAILVQDAIGDK GH IRY+SQF+V
Sbjct  121  TARLRLKYLQAVLKKDINFFDNEARDANIIFHISSDAILVQDAIGDKTGHAIRYLSQFIV  180

Query  642  GFAVGFISVWKLTLVTLAVVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVR  821
            GFA+GF SVW+LTL+TLAVVPLIAVAGG YT+IMS LS+KGEAAYAEAGKVA+E ISQVR
Sbjct  181  GFAIGFTSVWQLTLLTLAVVPLIAVAGGAYTIIMSTLSEKGEAAYAEAGKVAQEVISQVR  240

Query  822  TVYSFVGEKKAVESYSKSLNNALVLG  899
            TVYSFVGE+KAV SYSKSL+NAL LG
Sbjct  241  TVYSFVGEEKAVGSYSKSLDNALKLG  266


 Score =   102 bits (253),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 71/272 (26%), Positives = 133/272 (49%), Gaps = 27/272 (10%)
 Frame = +3

Query  123  EISSNLKMDQQ----------------PSNSTDRKEMVSFFGLFSAADTVDYFFMVFGSI  254
            E S NL +++Q                PS +T    ++    L    +  ++ + + GS+
Sbjct  630  EPSDNLTLEEQLKLDAAAELQSRDQHLPSKTTSTPSILDLLKL----NAPEWPYAILGSV  685

Query  255  GACIHGAALPVFFVLFGRMIDSLGHLSSDSHRLSSQVSKQALYLVYLG-SIIFISAWIGV  431
            GA + G   P+F +    ++ +    S    ++  +V + A   ++LG ++I I  ++ +
Sbjct  686  GAILAGMEAPLFALGITHILTAF--YSPQGSKIKQEVDRVAF--IFLGVAVITIPIYLLL  741

Query  432  A-FWTQTGERQTARLRLRYLQSVLRKKIEFFDTD-TRAKDIIFHISSDAILVQDAIGDKI  605
              F+T  GER TAR+RL    ++L  ++ +FD D      +   +++DA LV+ A+ D++
Sbjct  742  HYFYTLMGERLTARVRLLMFSAILNNEVAWFDKDENNTGSLTAMLAADATLVRSALADRL  801

Query  606  GHTIRYISQFLVGFAVGFISVWKLTLVTLAVVPLIAVAGGTYTLIMSNLSQKGEAAYAEA  785
               ++ ++  +  F +GF   WKLT V +A +PL+  A  T  L +         AY+ A
Sbjct  802  STIVQNVALTVTAFVIGFTLSWKLTAVVVACLPLLIGASITEQLFLKGFGGDYGHAYSRA  861

Query  786  GKVAEEAISQVRTVYSFVGEKKAVESYSKSLN  881
              +A EAI+ +RTV +F  E +    ++  LN
Sbjct  862  TSLAREAIANIRTVAAFGAEDRVSTQFASELN  893



>ref|XP_007160658.1| hypothetical protein PHAVU_001G005900g [Phaseolus vulgaris]
 gb|ESW32652.1| hypothetical protein PHAVU_001G005900g [Phaseolus vulgaris]
Length=1247

 Score =   401 bits (1031),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 189/253 (75%), Positives = 221/253 (87%), Gaps = 5/253 (2%)
 Frame = +3

Query  141  KMDQQPSNSTDRKEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDS  320
            K DQQ      + E VSFFGLF+ AD+ D   M  GS+G+C+HGAALPVFF+LFGRMIDS
Sbjct  15   KTDQQ-----TKTESVSFFGLFATADSTDCVLMFLGSVGSCLHGAALPVFFILFGRMIDS  69

Query  321  LGHLSSDSHRLSSQVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVL  500
            LGHLS++ H+LSS+VS+ ALYLVYLG ++ +SAW+GVAFW QTGERQTARLRL+YLQ+VL
Sbjct  70   LGHLSNNPHKLSSRVSEHALYLVYLGGVVLVSAWMGVAFWMQTGERQTARLRLKYLQAVL  129

Query  501  RKKIEFFDTDTRAKDIIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLT  680
            RK I+FFD + R  +IIFHISSDAILVQDAIGDK GHTIRY+SQF+VGFA+GFISVW+LT
Sbjct  130  RKDIDFFDNEARDSNIIFHISSDAILVQDAIGDKTGHTIRYLSQFIVGFAIGFISVWQLT  189

Query  681  LVTLAVVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVE  860
            L+TLAVVPLIA+AGG YT+IMS LS+KGEAAYAEAGKVAEE ISQVRTVYSFVGE+KA+ 
Sbjct  190  LLTLAVVPLIALAGGAYTIIMSTLSEKGEAAYAEAGKVAEEVISQVRTVYSFVGEEKAIG  249

Query  861  SYSKSLNNALVLG  899
            SYSKSL+NAL LG
Sbjct  250  SYSKSLDNALNLG  262


 Score = 99.8 bits (247),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 64/226 (28%), Positives = 121/226 (54%), Gaps = 7/226 (3%)
 Frame = +3

Query  216  DTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLSSDSHRLSSQVSKQALYLVYL  395
            +T ++ + V GS+GA + G   P+F +    ++ +    S  S ++  +V + AL  ++L
Sbjct  670  NTPEWPYAVLGSVGAILAGMEAPLFALGITHILTAF--YSPQSSKIKQEVDRVAL--IFL  725

Query  396  G-SIIFISAWIGVA-FWTQTGERQTARLRLRYLQSVLRKKIEFFDTD-TRAKDIIFHISS  566
            G ++I I  ++ +  F+T  GE  TAR+RL    ++L  ++ +FD D      +   +++
Sbjct  726  GVAVITIPIYLLLHYFYTLMGEHLTARVRLLMFSAILNNEVAWFDKDENNTGSLTAMLAA  785

Query  567  DAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLAVVPLIAVAGGTYTLIMS  746
            DA LV+ A+ D++   ++ ++  +  F +GF   WKLT V +A +PL+  A  T  L + 
Sbjct  786  DATLVRSALADRLSTIVQNVALTVTAFVIGFTLSWKLTAVVVACLPLLIGASITEQLFLK  845

Query  747  NLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYSKSLNN  884
                    AY++A  +A EAI+ +RTV +F  E +    ++  L+ 
Sbjct  846  GFGGDYNHAYSKATSLAREAIANIRTVAAFGAEDRISIQFASELDK  891



>emb|CAN71068.1| hypothetical protein VITISV_031708 [Vitis vinifera]
Length=1344

 Score =   402 bits (1034),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 198/270 (73%), Positives = 226/270 (84%), Gaps = 6/270 (2%)
 Frame = +3

Query  108  SMGELEISSNLKMDQQPSNSTDR------KEMVSFFGLFSAADTVDYFFMVFGSIGACIH  269
            SM  LE+ S    DQ P    D+      K+ VSFFGLF+AADT+D FFM FGSIGACIH
Sbjct  90   SMEGLELRSIQISDQNPLPEKDQQSNSSPKDTVSFFGLFAAADTLDCFFMFFGSIGACIH  149

Query  270  GAALPVFFVLFGRMIDSLGHLSSDSHRLSSQVSKQALYLVYLGSIIFISAWIGVAFWTQT  449
            GAALPVFFVLFGRMIDSLG LSSD  +LSSQVS+ ALYLVYLG  +  SAWIGVAFW QT
Sbjct  150  GAALPVFFVLFGRMIDSLGRLSSDPDKLSSQVSRHALYLVYLGLGVLASAWIGVAFWMQT  209

Query  450  GERQTARLRLRYLQSVLRKKIEFFDTDTRAKDIIFHISSDAILVQDAIGDKIGHTIRYIS  629
            GERQTARLRL+YLQSVLR+ I FFDT+ R K+I FHIS+DAIL+QDAIGDKIGH +RY+S
Sbjct  210  GERQTARLRLKYLQSVLRQDINFFDTEARDKNITFHISNDAILLQDAIGDKIGHGLRYLS  269

Query  630  QFLVGFAVGFISVWKLTLVTLAVVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAI  809
            QF VGFA+GF SVW+LTL+T+AVVPL+A+AGG YT+IM+ LS+KGEAAYAEAGKVAEEAI
Sbjct  270  QFFVGFAIGFTSVWQLTLLTVAVVPLMAIAGGAYTVIMTTLSEKGEAAYAEAGKVAEEAI  329

Query  810  SQVRTVYSFVGEKKAVESYSKSLNNALVLG  899
            SQVRTVYSFVGE +AVE+YS+SL  AL LG
Sbjct  330  SQVRTVYSFVGEDRAVETYSRSLQKALKLG  359


 Score = 85.9 bits (211),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 58/225 (26%), Positives = 107/225 (48%), Gaps = 3/225 (1%)
 Frame = +3

Query  216  DTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLSSDSHRLSSQVSKQALYLVYL  395
            +  ++ F V GS+GA + G   P+F +    ++ +    S    ++  +V   +L  V  
Sbjct  768  NAPEWPFAVLGSVGAILAGMEAPLFALGITHVLTAF--YSGKDFQIKREVDHISLIFVGA  825

Query  396  GSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKKIEFFDTDTRAK-DIIFHISSDA  572
              +      +   F+T  GER T R+RL    ++L  +I +FD D  +   +   +++DA
Sbjct  826  AILTIFIYLLQHYFYTLMGERLTTRIRLLMFSAILSNEIGWFDLDENSTGSLTSKLAADA  885

Query  573  ILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLAVVPLIAVAGGTYTLIMSNL  752
             L + A+ D++   ++ ++  +  F + F   W++  V +A  PL+  A  T  L +   
Sbjct  886  TLXRSALADRLSTIVQNVALTVTAFVIAFTLSWRIASVIIASFPLLIGASITEQLFLKGF  945

Query  753  SQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYSKSLNNA  887
                  AYA+A  VA EAI+ +RTV +F  E +    ++  LN  
Sbjct  946  GGDYTRAYAQATAVAREAIANIRTVAAFGAEDRISLQFASELNQP  990



>ref|XP_002279471.2| PREDICTED: ABC transporter B family member 13-like [Vitis vinifera]
Length=1254

 Score =   400 bits (1028),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 195/256 (76%), Positives = 222/256 (87%), Gaps = 1/256 (0%)
 Frame = +3

Query  132  SNLKMDQQPSNSTDRKEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFVLFGRM  311
            S L    Q SNS+  K+ VSFFGLF+AADT+D FFM FGSIGACIHGAALPVFFVLFGRM
Sbjct  15   SPLPEKDQQSNSSP-KDTVSFFGLFAAADTLDCFFMFFGSIGACIHGAALPVFFVLFGRM  73

Query  312  IDSLGHLSSDSHRLSSQVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARLRLRYLQ  491
            IDSLG LSSD  +LSSQVS+ ALYLVYLG  +  SAWIGVAFW QTGERQTARLRL+YLQ
Sbjct  74   IDSLGRLSSDPDKLSSQVSRHALYLVYLGLGVLASAWIGVAFWMQTGERQTARLRLKYLQ  133

Query  492  SVLRKKIEFFDTDTRAKDIIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVW  671
            SVLR+ I FFDT+ R K+I FHIS+DAIL+QDAIGDKIGH +RY+SQF VGFA+GF SVW
Sbjct  134  SVLRQDINFFDTEARDKNITFHISNDAILLQDAIGDKIGHGLRYLSQFFVGFAIGFTSVW  193

Query  672  KLTLVTLAVVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKK  851
            +LTL+T+AVVPL+A+AGG YT+IM+ LS+KGEAAYAEAGKVAEEAISQVRTVYSFVGE +
Sbjct  194  QLTLLTVAVVPLMAIAGGAYTVIMTTLSEKGEAAYAEAGKVAEEAISQVRTVYSFVGEDR  253

Query  852  AVESYSKSLNNALVLG  899
            AVE+YS+SL  AL LG
Sbjct  254  AVETYSRSLQKALKLG  269


 Score = 87.8 bits (216),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 59/225 (26%), Positives = 108/225 (48%), Gaps = 3/225 (1%)
 Frame = +3

Query  216  DTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLSSDSHRLSSQVSKQALYLVYL  395
            +  ++ F V GS+GA + G   P+F +    ++ +    S    ++  +V   +L  V  
Sbjct  678  NAPEWPFAVLGSVGAILAGMEAPLFALGITHVLTAF--YSGKDFQIKREVDHISLIFVGA  735

Query  396  GSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKKIEFFDTDTRAK-DIIFHISSDA  572
              +      +   F+T  GER T R+RL    ++L  +I +FD D  +   +   +++DA
Sbjct  736  AILTIFIYLLQHYFYTLMGERLTTRIRLLMFSAILSNEIGWFDLDENSTGSLTSKLAADA  795

Query  573  ILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLAVVPLIAVAGGTYTLIMSNL  752
             LV+ A+ D++   ++ ++  +  F + F   W++  V +A  PL+  A  T  L +   
Sbjct  796  TLVRSALADRLSTIVQNVALTVTAFVIAFTLSWRIASVIIASFPLLIGASITEQLFLKGF  855

Query  753  SQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYSKSLNNA  887
                  AYA+A  VA EAI+ +RTV +F  E +    ++  LN  
Sbjct  856  GGDYTRAYAQATAVAREAIANIRTVAAFGAEDRISLQFASELNQP  900



>ref|XP_003544389.1| PREDICTED: ABC transporter B family member 13-like [Glycine max]
Length=1250

 Score =   397 bits (1021),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 187/266 (70%), Positives = 226/266 (85%), Gaps = 3/266 (1%)
 Frame = +3

Query  111  MGELEISSNLKMDQQPSNST---DRKEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAAL  281
            M E+E++ +  ++Q  ++ T    + + VSFFGLF+AAD  D   M  GS+G+C+HGAAL
Sbjct  1    MAEVELAPDSLIEQNVTSKTVQQSKTDSVSFFGLFAAADATDCVLMFLGSVGSCVHGAAL  60

Query  282  PVFFVLFGRMIDSLGHLSSDSHRLSSQVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQ  461
            PVFF+LFGRMIDSLGHLS++ H+LSS++S+ ALYLVYLG ++ +SAW+GVAFW QTGERQ
Sbjct  61   PVFFILFGRMIDSLGHLSNNPHKLSSRISEHALYLVYLGGVVLVSAWMGVAFWMQTGERQ  120

Query  462  TARLRLRYLQSVLRKKIEFFDTDTRAKDIIFHISSDAILVQDAIGDKIGHTIRYISQFLV  641
            TARLRL+YLQ+VL+K I FFD + R  +IIFHISSDAILVQDAIGDK GH IRY+SQF+V
Sbjct  121  TARLRLKYLQAVLKKDINFFDNEARDANIIFHISSDAILVQDAIGDKTGHAIRYLSQFIV  180

Query  642  GFAVGFISVWKLTLVTLAVVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVR  821
            GFA+GF SVW+LTL+TLAVVPLIAVAGG YT+IMS LS+KGEAAYAEAGKVAEE ISQVR
Sbjct  181  GFAIGFTSVWQLTLLTLAVVPLIAVAGGAYTIIMSTLSEKGEAAYAEAGKVAEEVISQVR  240

Query  822  TVYSFVGEKKAVESYSKSLNNALVLG  899
            TVYSFVGE+KA  SYSKSL+NAL LG
Sbjct  241  TVYSFVGEEKAAGSYSKSLDNALKLG  266


 Score = 97.4 bits (241),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 69/260 (27%), Positives = 132/260 (51%), Gaps = 13/260 (5%)
 Frame = +3

Query  117  ELEISSNLKMDQQ--PSNSTDRKEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVF  290
            +L+ ++ L+   Q  PS +T    ++    L    +  ++ + + GS+GA + G   P+F
Sbjct  642  KLDTAAELQSRDQHLPSKTTSTPSILDLLKL----NAPEWPYAILGSVGAILAGMEAPLF  697

Query  291  FVLFGRMIDSLGHLSSDSHRLSSQVSKQALYLVYLG-SIIFISAWIGVA-FWTQTGERQT  464
             +    ++ +    S    ++  +V   A   ++LG ++I I  ++ +  F+T  GER T
Sbjct  698  ALGITHILTAF--YSPQGSKIKQEVDWVAF--IFLGVAVITIPIYLLLHYFYTLMGERLT  753

Query  465  ARLRLRYLQSVLRKKIEFFDTDT-RAKDIIFHISSDAILVQDAIGDKIGHTIRYISQFLV  641
            AR+RL    ++L  ++ +FD D      +   +++DA LV+ A+ D++   ++ ++  + 
Sbjct  754  ARVRLLMFSAILNNEVAWFDMDEHNTGSLTAMLAADATLVRSALADRLSTIVQNVALTVT  813

Query  642  GFAVGFISVWKLTLVTLAVVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVR  821
             F +GF   WKLT V +A +PL+  A  T  L +         AY+ A  +A EAI+ +R
Sbjct  814  AFVIGFTLSWKLTAVVVACLPLLIGASITEQLFLKGFGGDYGHAYSRATSLAREAIANIR  873

Query  822  TVYSFVGEKKAVESYSKSLN  881
            TV +F  E +    ++  LN
Sbjct  874  TVAAFGAEDRISIQFASELN  893



>emb|CBI19899.3| unnamed protein product [Vitis vinifera]
Length=1045

 Score =   389 bits (998),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 195/272 (72%), Positives = 222/272 (82%), Gaps = 17/272 (6%)
 Frame = +3

Query  132  SNLKMDQQPSNSTDRKEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFVLFGRM  311
            S L    Q SNS+  K+ VSFFGLF+AADT+D FFM FGSIGACIHGAALPVFFVLFGRM
Sbjct  15   SPLPEKDQQSNSSP-KDTVSFFGLFAAADTLDCFFMFFGSIGACIHGAALPVFFVLFGRM  73

Query  312  IDSLGHLSSDSHRLSSQVSK----------------QALYLVYLGSIIFISAWIGVAFWT  443
            IDSLG LSSD  +LSSQVS+                 ALYLVYLG  +  SAWIGVAFW 
Sbjct  74   IDSLGRLSSDPDKLSSQVSRVPLILKHRNGNGFLSSHALYLVYLGLGVLASAWIGVAFWM  133

Query  444  QTGERQTARLRLRYLQSVLRKKIEFFDTDTRAKDIIFHISSDAILVQDAIGDKIGHTIRY  623
            QTGERQTARLRL+YLQSVLR+ I FFDT+ R K+I FHIS+DAIL+QDAIGDKIGH +RY
Sbjct  134  QTGERQTARLRLKYLQSVLRQDINFFDTEARDKNITFHISNDAILLQDAIGDKIGHGLRY  193

Query  624  ISQFLVGFAVGFISVWKLTLVTLAVVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEE  803
            +SQF VGFA+GF SVW+LTL+T+AVVPL+A+AGG YT+IM+ LS+KGEAAYAEAGKVAEE
Sbjct  194  LSQFFVGFAIGFTSVWQLTLLTVAVVPLMAIAGGAYTVIMTTLSEKGEAAYAEAGKVAEE  253

Query  804  AISQVRTVYSFVGEKKAVESYSKSLNNALVLG  899
            AISQVRTVYSFVGE +AVE+YS+SL  AL LG
Sbjct  254  AISQVRTVYSFVGEDRAVETYSRSLQKALKLG  285


 Score = 80.5 bits (197),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 46/152 (30%), Positives = 79/152 (52%), Gaps = 1/152 (1%)
 Frame = +3

Query  435  FWTQTGERQTARLRLRYLQSVLRKKIEFFDTDTRAK-DIIFHISSDAILVQDAIGDKIGH  611
            F+T  GER T R+RL    ++L  +I +FD D  +   +   +++DA LV+ A+ D++  
Sbjct  685  FYTLMGERLTTRIRLLMFSAILSNEIGWFDLDENSTGSLTSKLAADATLVRSALADRLST  744

Query  612  TIRYISQFLVGFAVGFISVWKLTLVTLAVVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGK  791
             ++ ++  +  F + F   W++  V +A  PL+  A  T  L +         AYA+A  
Sbjct  745  IVQNVALTVTAFVIAFTLSWRIASVIIASFPLLIGASITEQLFLKGFGGDYTRAYAQATA  804

Query  792  VAEEAISQVRTVYSFVGEKKAVESYSKSLNNA  887
            VA EAI+ +RTV +F  E +    ++  LN  
Sbjct  805  VAREAIANIRTVAAFGAEDRISLQFASELNQP  836



>ref|XP_007017851.1| P-glycoprotein 13 [Theobroma cacao]
 gb|EOY15076.1| P-glycoprotein 13 [Theobroma cacao]
Length=1241

 Score =   392 bits (1007),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 190/265 (72%), Positives = 225/265 (85%), Gaps = 3/265 (1%)
 Frame = +3

Query  111  MGELEIS--SNLKMDQQPSNSTDRKEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALP  284
            M E+E+S  ++    +QPS+S   +  VSF GLF+AAD +DY  M  GS+GACIHGAALP
Sbjct  1    MEEVELSDQNSHPKTEQPSSSAKSRP-VSFLGLFAAADKLDYALMFSGSLGACIHGAALP  59

Query  285  VFFVLFGRMIDSLGHLSSDSHRLSSQVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQT  464
            VFF+LFGRMIDSLGHLSS+  +LS++VS+ ALYLVYLG ++F SAWIGVAFW QTGERQT
Sbjct  60   VFFILFGRMIDSLGHLSSNPQKLSARVSEHALYLVYLGLVVFASAWIGVAFWMQTGERQT  119

Query  465  ARLRLRYLQSVLRKKIEFFDTDTRAKDIIFHISSDAILVQDAIGDKIGHTIRYISQFLVG  644
            ARLRL+YLQSVLRK I FFDT  R  +IIFHISSDAILVQDAIGDK GH IRY+SQF+VG
Sbjct  120  ARLRLKYLQSVLRKDISFFDTKARDSNIIFHISSDAILVQDAIGDKTGHAIRYLSQFVVG  179

Query  645  FAVGFISVWKLTLVTLAVVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRT  824
            FA+GF SVW+LTL+TLAVVPLIA+AGG YT+IMS LS+KGEAAYAEAGKVAEE ISQ+RT
Sbjct  180  FAIGFTSVWQLTLLTLAVVPLIAIAGGAYTIIMSTLSEKGEAAYAEAGKVAEEVISQIRT  239

Query  825  VYSFVGEKKAVESYSKSLNNALVLG  899
            VY++VGE+ AV++YS SL NAL +G
Sbjct  240  VYAYVGEEGAVKAYSDSLKNALKMG  264


 Score = 83.2 bits (204),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 60/223 (27%), Positives = 105/223 (47%), Gaps = 3/223 (1%)
 Frame = +3

Query  216  DTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLSSDSHRLSSQVSKQALYLVYL  395
            +  ++ + + GS+GA + G   P+F   FG         S    ++  +V + AL  V L
Sbjct  672  NAPEWPYALLGSLGAILAGMEAPLF--AFGITHVLTAFYSPHDIQIKKEVERVALIFVGL  729

Query  396  GSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKKIEFFD-TDTRAKDIIFHISSDA  572
              +      +   F+T  GE  TAR+RL    ++L  +I +FD  +     +   +++DA
Sbjct  730  AILTIPIYLLQHYFYTLMGEHLTARVRLSMFSAILSNEIGWFDMNENNTGSLTGALAADA  789

Query  573  ILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLAVVPLIAVAGGTYTLIMSNL  752
             LV+ A+ D++   ++ ++  +  F + F   W++  V +A  PL+  A  T  L +   
Sbjct  790  TLVRSALADRLSTIVQNVALTVTAFVIAFTLSWRIASVIIASFPLLIGASITEQLFLKGF  849

Query  753  SQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYSKSLN  881
                  AY+ A  VA EAI  +RTV SF  E +    ++  LN
Sbjct  850  GGNYSHAYSRATAVAREAIVNIRTVASFGVEDRISIQFASELN  892



>emb|CDP07374.1| unnamed protein product [Coffea canephora]
Length=1259

 Score =   390 bits (1001),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 187/272 (69%), Positives = 224/272 (82%), Gaps = 9/272 (3%)
 Frame = +3

Query  111  MGELEISSNLKMDQQPS---------NSTDRKEMVSFFGLFSAADTVDYFFMVFGSIGAC  263
            MGE+E+ +    +Q            +S+ +K++VS  GLF+AAD +DY  M FGS GAC
Sbjct  1    MGEVELFTEQNFEQNAQAGKVQTVMDSSSQKKKVVSVLGLFAAADKIDYILMFFGSAGAC  60

Query  264  IHGAALPVFFVLFGRMIDSLGHLSSDSHRLSSQVSKQALYLVYLGSIIFISAWIGVAFWT  443
            +HGAALP FFVLFGRMIDSLGHLSS+ H+++S VSK A+YLVYLG +I +SAWIGVA W 
Sbjct  61   LHGAALPAFFVLFGRMIDSLGHLSSNPHQMASVVSKYAVYLVYLGLVILMSAWIGVACWA  120

Query  444  QTGERQTARLRLRYLQSVLRKKIEFFDTDTRAKDIIFHISSDAILVQDAIGDKIGHTIRY  623
            QTGERQT RLRL+YLQS+L+K I FFDT+   K++ FHISSDAILVQDAIGDKIGH++RY
Sbjct  121  QTGERQTTRLRLKYLQSILKKNISFFDTEAMDKNLTFHISSDAILVQDAIGDKIGHSLRY  180

Query  624  ISQFLVGFAVGFISVWKLTLVTLAVVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEE  803
            +SQF VGFA+GFISVW+LTL+TLAVVPLIA+AGG YTLIMS +SQKGEAAYAEAGK+AEE
Sbjct  181  LSQFFVGFAIGFISVWQLTLLTLAVVPLIAIAGGAYTLIMSTISQKGEAAYAEAGKIAEE  240

Query  804  AISQVRTVYSFVGEKKAVESYSKSLNNALVLG  899
             ISQVRTVYSFVGE+KA ++YS SLN AL LG
Sbjct  241  VISQVRTVYSFVGEEKAAKAYSISLNKALRLG  272


 Score = 88.6 bits (218),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 58/215 (27%), Positives = 113/215 (53%), Gaps = 7/215 (3%)
 Frame = +3

Query  216  DTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLSSDSHRLSSQVSKQALYLVYL  395
            +  ++ + VFGSIGA + G   P+F +    ++ +    + D  R++ +V +  + L++L
Sbjct  680  NAPEWPYAVFGSIGAALAGMEAPLFALGITYILTAF--YAQDDTRITQEVHR--VSLIFL  735

Query  396  G-SIIFISAWI-GVAFWTQTGERQTARLRLRYLQSVLRKKIEFFDTDTRAK-DIIFHISS  566
            G +++ I  ++    F+T  GER T R+RLR   ++L  +I +FD D  +   ++  +++
Sbjct  736  GIALLNIPIYLLQHYFYTLMGERLTTRVRLRMFSAILSNEIGWFDMDENSTGSLMSKLAA  795

Query  567  DAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLAVVPLIAVAGGTYTLIMS  746
            DA LV+ A+ D++   ++ ++  +  F + F   W++  V +A  PL+  A       + 
Sbjct  796  DATLVRSALADRLSTVVQNVALTVTSFVIAFTLSWRIAAVIIATFPLLIGASIAEQQFLK  855

Query  747  NLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKK  851
                   AAY     +A EAI  +RTV +F  E++
Sbjct  856  GFGGNYAAAYYRTTALAREAIVNIRTVAAFGAEER  890



>ref|XP_007225446.1| hypothetical protein PRUPE_ppa000363mg [Prunus persica]
 gb|EMJ26645.1| hypothetical protein PRUPE_ppa000363mg [Prunus persica]
Length=1244

 Score =   389 bits (998),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 190/273 (70%), Positives = 223/273 (82%), Gaps = 12/273 (4%)
 Frame = +3

Query  111  MGELEISSN----------LKMDQQPSNSTDRKEMVSFFGLFSAADTVDYFFMVFGSIGA  260
            M E+E++SN           KM+Q  S+S  R   VS  GLF+AAD VD+  M+FGS+GA
Sbjct  1    MEEVELASNKLSDGDSNPLPKMEQPTSSSKHRS--VSLVGLFAAADKVDFVLMLFGSVGA  58

Query  261  CIHGAALPVFFVLFGRMIDSLGHLSSDSHRLSSQVSKQALYLVYLGSIIFISAWIGVAFW  440
            CIHGA LPVFFVLFGRMIDSLGHL+    +LSS+VS+ ALYLVYLG I+F SAWIGVAFW
Sbjct  59   CIHGAVLPVFFVLFGRMIDSLGHLAKHPQQLSSRVSQHALYLVYLGLILFASAWIGVAFW  118

Query  441  TQTGERQTARLRLRYLQSVLRKKIEFFDTDTRAKDIIFHISSDAILVQDAIGDKIGHTIR  620
             +TGERQTARLRL+YLQSVL++ I FFDT+ R  +IIFHISSDAILVQDAIGDK GH +R
Sbjct  119  MRTGERQTARLRLKYLQSVLKQDINFFDTEARDTNIIFHISSDAILVQDAIGDKTGHALR  178

Query  621  YISQFLVGFAVGFISVWKLTLVTLAVVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAE  800
            Y+SQF+VGF +GF SVW+LTL+TLAVVPLIA+AGG YT+IMS LS+KGEAAYAEAGKVAE
Sbjct  179  YLSQFIVGFGIGFTSVWRLTLLTLAVVPLIAIAGGAYTIIMSTLSEKGEAAYAEAGKVAE  238

Query  801  EAISQVRTVYSFVGEKKAVESYSKSLNNALVLG  899
            E ISQ+RTVYSF GE +A+E+YS SLN AL LG
Sbjct  239  EVISQIRTVYSFGGEDRAIEAYSNSLNKALKLG  271


 Score = 85.5 bits (210),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 56/223 (25%), Positives = 109/223 (49%), Gaps = 3/223 (1%)
 Frame = +3

Query  216  DTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLSSDSHRLSSQVSKQALYLVYL  395
            +  ++ + + GS+GA + G   P+F +L   ++ +    +    ++  +V K AL  V +
Sbjct  668  NAPEWPYAILGSVGAVLAGMEAPLFALLITDILTAF--YAPTGSQIKQEVKKVALIFVGV  725

Query  396  GSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKKIEFFDTDTRAKDIIFHI-SSDA  572
                     +   F+T  GER T R+RL    ++L  ++ +FD D      +  I +++A
Sbjct  726  AVATVPIYLLQHYFYTLMGERLTTRVRLLMFTAMLSNEVGWFDLDENNTGALTSILAANA  785

Query  573  ILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLAVVPLIAVAGGTYTLIMSNL  752
             LV+ A+ D++   ++ ++     F + F   W++  V +A +PL+  A     L +   
Sbjct  786  TLVRSALADRLSTIVQNLALTATAFVIAFTLSWRIAAVVIASLPLLIGASIAEQLFLKGF  845

Query  753  SQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYSKSLN  881
                  AY++A  VA EAI+ +RTV +F  E++    ++  LN
Sbjct  846  GGDYNRAYSKATAVAREAIANIRTVAAFGCEERIAMQFASELN  888



>ref|XP_004292938.1| PREDICTED: ABC transporter B family member 13-like, partial [Fragaria 
vesca subsp. vesca]
Length=1126

 Score =   384 bits (987),  Expect = 8e-121, Method: Compositional matrix adjust.
 Identities = 186/275 (68%), Positives = 226/275 (82%), Gaps = 10/275 (4%)
 Frame = +3

Query  105  FSMGELEISSN----------LKMDQQPSNSTDRKEMVSFFGLFSAADTVDYFFMVFGSI  254
            ++M E+E++SN           KM Q   ++      VSF GLF+AAD +DY  M+FGS 
Sbjct  615  YTMEEVELASNSSEVSGTNPHPKMPQPVHSNKQNLGSVSFLGLFAAADQMDYILMLFGSF  674

Query  255  GACIHGAALPVFFVLFGRMIDSLGHLSSDSHRLSSQVSKQALYLVYLGSIIFISAWIGVA  434
            G+CIHGAALPVFFVLFGRMIDSLG+++   + +SS++S+ ALY++YLG ++FISAWIGVA
Sbjct  675  GSCIHGAALPVFFVLFGRMIDSLGNMAMHPNEISSRISEYALYVIYLGIVLFISAWIGVA  734

Query  435  FWTQTGERQTARLRLRYLQSVLRKKIEFFDTDTRAKDIIFHISSDAILVQDAIGDKIGHT  614
             WT+TGERQTARLRL+YLQSVLRK I FFDT+ R  +IIFHISSD ILVQDAIGDK GHT
Sbjct  735  SWTRTGERQTARLRLKYLQSVLRKDISFFDTEARDANIIFHISSDTILVQDAIGDKTGHT  794

Query  615  IRYISQFLVGFAVGFISVWKLTLVTLAVVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKV  794
            +RY+SQF+VGFA+GF SVW+LTL+TLAVVPLIA+AGG YT+IMS LS+KGEAAYAEAGKV
Sbjct  795  LRYLSQFVVGFAIGFTSVWQLTLLTLAVVPLIAIAGGAYTIIMSTLSEKGEAAYAEAGKV  854

Query  795  AEEAISQVRTVYSFVGEKKAVESYSKSLNNALVLG  899
            AEE ISQ+RTVYS VGE KA+E+YS+SLN AL LG
Sbjct  855  AEEVISQIRTVYSSVGEDKAIETYSESLNKALKLG  889


 Score =   383 bits (983),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 187/273 (68%), Positives = 223/273 (82%), Gaps = 10/273 (4%)
 Frame = +3

Query  111  MGELEISSN----------LKMDQQPSNSTDRKEMVSFFGLFSAADTVDYFFMVFGSIGA  260
            M E+E++SN           KM Q   ++T     VSF GLF+AAD +DY  M+FGS G+
Sbjct  1    MEEVELASNSSEVSGTNPHPKMPQPMHSNTQNLGSVSFLGLFAAADQMDYILMLFGSFGS  60

Query  261  CIHGAALPVFFVLFGRMIDSLGHLSSDSHRLSSQVSKQALYLVYLGSIIFISAWIGVAFW  440
            CIHGAA PVFFVLFG MIDSLGH++  S+ +SS++S+ ALY+V LG ++FISAWIGVA W
Sbjct  61   CIHGAAFPVFFVLFGGMIDSLGHMAMRSNEMSSRISEYALYVVCLGIVLFISAWIGVASW  120

Query  441  TQTGERQTARLRLRYLQSVLRKKIEFFDTDTRAKDIIFHISSDAILVQDAIGDKIGHTIR  620
            T+TGERQTARLRL+YLQSVLRK I FFDT+ R  +IIFHISSD ILVQDAIGDK GHT+R
Sbjct  121  TRTGERQTARLRLKYLQSVLRKDISFFDTEARDANIIFHISSDTILVQDAIGDKTGHTLR  180

Query  621  YISQFLVGFAVGFISVWKLTLVTLAVVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAE  800
            Y+SQF+VGF +GF SVW+LTL+TLAVVPLIA+AGG YT+IMS LS+KGEAAYAEAGKVAE
Sbjct  181  YLSQFVVGFVIGFTSVWQLTLLTLAVVPLIAIAGGAYTIIMSTLSEKGEAAYAEAGKVAE  240

Query  801  EAISQVRTVYSFVGEKKAVESYSKSLNNALVLG  899
            E ISQ+RTVYSFVGE KA+E+YS+SLN AL LG
Sbjct  241  EVISQIRTVYSFVGEDKAIETYSESLNKALKLG  273



>ref|XP_008221400.1| PREDICTED: ABC transporter B family member 13-like [Prunus mume]
Length=1205

 Score =   385 bits (988),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 185/253 (73%), Positives = 215/253 (85%), Gaps = 2/253 (1%)
 Frame = +3

Query  141  KMDQQPSNSTDRKEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDS  320
            KM+Q  S+S  R   VS  GLF+AAD VD+  M+FGS+GACIHGA LPVFFVLFGRMIDS
Sbjct  21   KMEQPMSSSKHRS--VSLVGLFAAADKVDFVLMLFGSVGACIHGAVLPVFFVLFGRMIDS  78

Query  321  LGHLSSDSHRLSSQVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVL  500
            LGHL+    +LSS+VS+ ALYLVYLG I+F SAWIGVAFW +TGERQTARLRL+YLQSVL
Sbjct  79   LGHLAKHPQQLSSRVSQHALYLVYLGLILFASAWIGVAFWMRTGERQTARLRLKYLQSVL  138

Query  501  RKKIEFFDTDTRAKDIIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLT  680
            ++ I FFDT+ R  +IIFHISSDAILVQDAIGDK GH +RY+SQF+VGF +GF SVW+LT
Sbjct  139  KQDINFFDTEARDTNIIFHISSDAILVQDAIGDKTGHALRYLSQFIVGFGIGFTSVWQLT  198

Query  681  LVTLAVVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVE  860
            L+TLAVVPLIA+AGG YT+IMS LS+KGEAAYAEAGKVAEE ISQ+RTVYSF GE +A+E
Sbjct  199  LLTLAVVPLIAIAGGAYTIIMSTLSEKGEAAYAEAGKVAEEVISQIRTVYSFGGEHRAIE  258

Query  861  SYSKSLNNALVLG  899
            +YS SLN AL LG
Sbjct  259  AYSNSLNKALKLG  271


 Score = 83.2 bits (204),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 56/223 (25%), Positives = 108/223 (48%), Gaps = 3/223 (1%)
 Frame = +3

Query  216  DTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLSSDSHRLSSQVSKQALYLVYL  395
            +  ++   + GS+GA + G   P+F +L   ++ +    +    ++  +V K +L  V +
Sbjct  629  NAPEWPHAILGSVGAVLAGMEAPLFALLITDILTAF--YAPTGSQIKQEVKKVSLIFVGV  686

Query  396  GSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKKIEFFDTDTRAKDIIFHI-SSDA  572
                     +   F+T  GER T R+RL    ++L  ++ +FD D      +  I +++A
Sbjct  687  AVATVPIYLLQHYFYTLMGERLTTRVRLLMFTAMLSNEVGWFDLDENNTGALTSILAANA  746

Query  573  ILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLAVVPLIAVAGGTYTLIMSNL  752
             LV+ A+ D++   ++ ++     F + F   W++  V +A +PL+  A     L +   
Sbjct  747  TLVRSALADRLSTIVQNLALTATAFVIAFTLSWRIAAVVIASLPLLIGASIAEQLFLKGF  806

Query  753  SQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYSKSLN  881
                  AY++A  VA EAI+ +RTV +F  E++    +S  LN
Sbjct  807  GGDYNRAYSKATAVAREAIANIRTVAAFGCEERIAIQFSSELN  849



>gb|KDP36900.1| hypothetical protein JCGZ_08191 [Jatropha curcas]
Length=1221

 Score =   382 bits (981),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 186/268 (69%), Positives = 220/268 (82%), Gaps = 8/268 (3%)
 Frame = +3

Query  111  MGELEISSNLKMDQ--------QPSNSTDRKEMVSFFGLFSAADTVDYFFMVFGSIGACI  266
            M ELE SS+  +D         QPS+S      VSFFGLF AAD +DY  M  GS+G+CI
Sbjct  1    MEELEHSSDQVLDHNSHPKNMDQPSSSKSSSPTVSFFGLFFAADKIDYLLMFVGSLGSCI  60

Query  267  HGAALPVFFVLFGRMIDSLGHLSSDSHRLSSQVSKQALYLVYLGSIIFISAWIGVAFWTQ  446
            HGAALPVFF+ FGRMIDSLG+L+ D H++SS++S+ ALYLVYLG  +F+SAW+GVAFW Q
Sbjct  61   HGAALPVFFIFFGRMIDSLGNLALDPHKMSSKISQHALYLVYLGLAVFVSAWMGVAFWMQ  120

Query  447  TGERQTARLRLRYLQSVLRKKIEFFDTDTRAKDIIFHISSDAILVQDAIGDKIGHTIRYI  626
            TGERQT+RLRL+YLQSVL+K + FFDT+    +IIFHISSDAILVQDAIGDK GH IRY+
Sbjct  121  TGERQTSRLRLKYLQSVLKKDMNFFDTEAGDSNIIFHISSDAILVQDAIGDKTGHAIRYL  180

Query  627  SQFLVGFAVGFISVWKLTLVTLAVVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEA  806
            SQF+VGFAVGF SVW+LTL+TLAVVPLIAVAGG YT+IMS LS+KGEAAYAEAGKVA+E 
Sbjct  181  SQFVVGFAVGFASVWQLTLLTLAVVPLIAVAGGAYTIIMSTLSEKGEAAYAEAGKVADEV  240

Query  807  ISQVRTVYSFVGEKKAVESYSKSLNNAL  890
            ISQ+RTVYSFVGE KA+E+YS+ L  AL
Sbjct  241  ISQIRTVYSFVGEDKAIETYSRYLKKAL  268


 Score = 84.3 bits (207),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 64/263 (24%), Positives = 125/263 (48%), Gaps = 14/263 (5%)
 Frame = +3

Query  132  SNLKMDQQPSNSTDRKEMVS-FFGLFSAADTV---------DYFFMVFGSIGACIHGAAL  281
            S+ + +QQ   S  ++E  S    ++SA  T+         ++ + + GS+GA + G   
Sbjct  609  SHGQNNQQDFKSISKREGQSDHESMYSATPTIGELVKLNAPEWPYALLGSVGAILGGMEA  668

Query  282  PVFFVLFGRMIDSLGHLSSDSHRLSSQVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQ  461
            P+F +L   ++ +    S D   +  ++ + A   V L  +      +   F+T  GER 
Sbjct  669  PLFALLISHVLTAF--YSPDVSEMKHEIRRVAFIFVGLAVVTIPIYLLQHYFYTLMGERL  726

Query  462  TARLRLRYLQSVLRKKIEFFDTD-TRAKDIIFHISSDAILVQDAIGDKIGHTIRYISQFL  638
            TAR+RL    ++L  +I +FD D      +   +++DA LV+ A+ D++   ++ ++   
Sbjct  727  TARVRLSMFTAILSNEIGWFDLDENNTGSLTSTLAADATLVRSALADRLSTIVQNVALTA  786

Query  639  VGFAVGFISVWKLTLVTLAVVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQV  818
                + F   W++  V +A  PL+  A     L +       + AY++A  +A EA++ +
Sbjct  787  TACVIAFTLSWRIAAVVVASFPLLIGASIAELLFLKGFGGDYQ-AYSKATSLAREALTNI  845

Query  819  RTVYSFVGEKKAVESYSKSLNNA  887
            RTV +F  E++    ++  LN  
Sbjct  846  RTVAAFGAEERISFEFASQLNKP  868



>ref|XP_004136487.1| PREDICTED: ABC transporter B family member 13-like [Cucumis sativus]
Length=1281

 Score =   383 bits (983),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 178/265 (67%), Positives = 219/265 (83%), Gaps = 4/265 (2%)
 Frame = +3

Query  117  ELEISSNLKMDQQPSNSTDRKEM----VSFFGLFSAADTVDYFFMVFGSIGACIHGAALP  284
            E+E++SN ++DQ P    + +E+    +SFFGLF AAD +D   MVFGS+GA +HGA+LP
Sbjct  33   EMELASNGELDQNPPTKMEEQEVKLSKMSFFGLFGAADGIDCLLMVFGSLGAFVHGASLP  92

Query  285  VFFVLFGRMIDSLGHLSSDSHRLSSQVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQT  464
            VFFVLFGRMIDSLGHLS   HRLSS++ + ALYL+YLG I+  SAWIGVAFW QTGERQT
Sbjct  93   VFFVLFGRMIDSLGHLSKHPHRLSSRIVENALYLIYLGLIVLASAWIGVAFWMQTGERQT  152

Query  465  ARLRLRYLQSVLRKKIEFFDTDTRAKDIIFHISSDAILVQDAIGDKIGHTIRYISQFLVG  644
            ARLR++YL S+L+K I FFDT+ +  +I+FHISSD +LVQDAIGDK GH +RY SQF+VG
Sbjct  153  ARLRMKYLNSILKKDINFFDTEAKDFNIMFHISSDMVLVQDAIGDKTGHAMRYFSQFIVG  212

Query  645  FAVGFISVWKLTLVTLAVVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRT  824
            FA+GF SVWKLTL+TLA+VPL+A+AG  YT+IMS LSQKGEAAYA+AGK AEE I+Q+RT
Sbjct  213  FAIGFTSVWKLTLLTLAIVPLVAIAGVAYTVIMSTLSQKGEAAYAQAGKTAEEVIAQIRT  272

Query  825  VYSFVGEKKAVESYSKSLNNALVLG  899
            VYS+VGE KA+E YS+SL NAL LG
Sbjct  273  VYSYVGESKALEKYSESLQNALKLG  297


 Score = 89.4 bits (220),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 65/232 (28%), Positives = 114/232 (49%), Gaps = 27/232 (12%)
 Frame = +3

Query  225  DYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLSSDSHRLSSQVSKQALYLVYLGSI  404
            ++ + + GSIGA + G   P+F +    ++ +     S  H   SQ+ ++  ++ ++   
Sbjct  707  EWPYAILGSIGAILAGIQAPLFALGITHVLSAF---YSPHH---SQIKEEVHHVAFM---  757

Query  405  IFISAWIGVA------------FWTQTGERQTARLRLRYLQSVLRKKIEFFDTDTRAKDI  548
                 ++GVA            F+T  GER TAR+RL    ++L  ++ +FD D      
Sbjct  758  -----FVGVAIFTIPIYLLQHYFYTLMGERLTARVRLLLFSAILSNEVGWFDFDENNTGA  812

Query  549  IFHI-SSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLAVVPLIAVAGG  725
            +  I +S+A LV+ A+ D+I   ++ ++  +  F + FI  W+L  V +A +PL+  A  
Sbjct  813  LTSILASNATLVRSALADRISTIVQNVALTVSAFVIAFIFSWRLAAVVVASLPLLIGASI  872

Query  726  TYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYSKSLN  881
            T  L +         AY  A  VA EAI+ +RTV +F  E+K    ++  LN
Sbjct  873  TEQLFLKGFGGDYGQAYNRATAVAHEAIANIRTVAAFGAEEKISSQFAFELN  924



>gb|KDO84910.1| hypothetical protein CISIN_1g000851mg [Citrus sinensis]
Length=782

 Score =   372 bits (954),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 182/253 (72%), Positives = 208/253 (82%), Gaps = 2/253 (1%)
 Frame = +3

Query  141  KMDQQPSNSTDRKEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDS  320
            KM QQ + S  +K+  SF  LF+AAD +D   M  GS+GA IHGA LPVFF+LFGRMIDS
Sbjct  22   KMKQQTNPS--KKQSGSFLSLFAAADKIDCVLMFLGSLGAFIHGATLPVFFILFGRMIDS  79

Query  321  LGHLSSDSHRLSSQVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVL  500
            LGHLSS  HRL+S++S+ ALYLVYLG +  +SAWIGVAFW QTGERQTARLRL+YLQSVL
Sbjct  80   LGHLSSHPHRLTSRISEHALYLVYLGLVALVSAWIGVAFWMQTGERQTARLRLKYLQSVL  139

Query  501  RKKIEFFDTDTRAKDIIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLT  680
            +K + FFDT+ R  +IIFHISSDAILVQDAIGDK GH +RY+SQF VGFAVGF SVW+LT
Sbjct  140  KKDMSFFDTEARDSNIIFHISSDAILVQDAIGDKTGHALRYLSQFFVGFAVGFTSVWQLT  199

Query  681  LVTLAVVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVE  860
            L+TLAVVPLIAVAGG YT+ MS LS+KGEAAY EAGKVAEE ISQVR VY+FVGE KA+E
Sbjct  200  LLTLAVVPLIAVAGGAYTITMSTLSEKGEAAYGEAGKVAEEIISQVRAVYAFVGEAKAIE  259

Query  861  SYSKSLNNALVLG  899
            SYS SL  AL  G
Sbjct  260  SYSHSLKEALKQG  272



>ref|XP_010069803.1| PREDICTED: ABC transporter B family member 13-like [Eucalyptus 
grandis]
 gb|KCW58265.1| hypothetical protein EUGRSUZ_H00958 [Eucalyptus grandis]
Length=1253

 Score =   382 bits (980),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 188/272 (69%), Positives = 218/272 (80%), Gaps = 19/272 (7%)
 Frame = +3

Query  141  KMDQQPSNSTDRKEMV-------------------SFFGLFSAADTVDYFFMVFGSIGAC  263
            +++++P+N   R + +                   SFFGLF AAD +D   M FGS GAC
Sbjct  5    ELEREPANDPVRDDRIPTLPEPTKEQEKEKEKPSTSFFGLFVAADKIDCVLMFFGSAGAC  64

Query  264  IHGAALPVFFVLFGRMIDSLGHLSSDSHRLSSQVSKQALYLVYLGSIIFISAWIGVAFWT  443
            IHGAALPVFFVLFGRMIDSLG LSSD H LSS+VS+ ALYLVYLG I+F SAWIGVA WT
Sbjct  65   IHGAALPVFFVLFGRMIDSLGKLSSDPHGLSSRVSEDALYLVYLGVIVFASAWIGVALWT  124

Query  444  QTGERQTARLRLRYLQSVLRKKIEFFDTDTRAKDIIFHISSDAILVQDAIGDKIGHTIRY  623
            QTGERQTARLRL+YLQ+VLRK I FFDT+ +  +I+ HI+SDAILVQDAIGDK GH +RY
Sbjct  125  QTGERQTARLRLKYLQAVLRKDINFFDTEAKDCNILHHITSDAILVQDAIGDKTGHALRY  184

Query  624  ISQFLVGFAVGFISVWKLTLVTLAVVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEE  803
            +SQF+VGFAVGF SVW+LTL+TLAVVPLIA AGG YT+IMS+LS+KGEAAYAEAGKVAEE
Sbjct  185  LSQFIVGFAVGFTSVWQLTLLTLAVVPLIAFAGGAYTIIMSSLSEKGEAAYAEAGKVAEE  244

Query  804  AISQVRTVYSFVGEKKAVESYSKSLNNALVLG  899
             ISQ+RTVYSFVGE KAV++YSKSL  AL LG
Sbjct  245  VISQIRTVYSFVGEDKAVQAYSKSLKVALKLG  276


 Score = 97.1 bits (240),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 66/239 (28%), Positives = 116/239 (49%), Gaps = 4/239 (2%)
 Frame = +3

Query  165  STDRKEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLSSDS  344
             TD    VS + L    +  ++ F + GS+GA + G   P+F +    ++ +    S D+
Sbjct  659  PTDTAPSVSIWELLKL-NAPEWPFALLGSVGAVLAGMEAPLFAIGITHILSAF--YSPDA  715

Query  345  HRLSSQVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKKIEFFD  524
            HR   +V + AL  V + +I      I   F+T  GER T R+R     ++L  +I +FD
Sbjct  716  HRAKQEVDRIALLFVGVAAITIPIYLIQHFFYTLMGERLTTRVRSLMFSAILTNEIGWFD  775

Query  525  TDTRAKDIIFHI-SSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLAVV  701
             D  +   +  I ++DA LV+ A+ D++    + ++  +  F + F   W++  V +A  
Sbjct  776  LDENSTGSLTTILAADATLVRSALADRLSTITQNVALTVTAFVIAFKLSWRIAAVVIASF  835

Query  702  PLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYSKSL  878
            PL+  A  T  L +         AY+ A  +A EAI+ +RTV +F  E +  + ++  L
Sbjct  836  PLLVGASITEQLFLKGFGGDYSTAYSRATSLAREAIANIRTVAAFGAEDRISDQFASEL  894



>gb|KGN60047.1| hypothetical protein Csa_3G873270 [Cucumis sativus]
Length=1248

 Score =   380 bits (976),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 177/264 (67%), Positives = 218/264 (83%), Gaps = 4/264 (2%)
 Frame = +3

Query  120  LEISSNLKMDQQPSNSTDRKEM----VSFFGLFSAADTVDYFFMVFGSIGACIHGAALPV  287
            +E++SN ++DQ P    + +E+    +SFFGLF AAD +D   MVFGS+GA +HGA+LPV
Sbjct  1    MELASNGELDQNPPTKMEEQEVKLSKMSFFGLFGAADGIDCLLMVFGSLGAFVHGASLPV  60

Query  288  FFVLFGRMIDSLGHLSSDSHRLSSQVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTA  467
            FFVLFGRMIDSLGHLS   HRLSS++ + ALYL+YLG I+  SAWIGVAFW QTGERQTA
Sbjct  61   FFVLFGRMIDSLGHLSKHPHRLSSRIVENALYLIYLGLIVLASAWIGVAFWMQTGERQTA  120

Query  468  RLRLRYLQSVLRKKIEFFDTDTRAKDIIFHISSDAILVQDAIGDKIGHTIRYISQFLVGF  647
            RLR++YL S+L+K I FFDT+ +  +I+FHISSD +LVQDAIGDK GH +RY SQF+VGF
Sbjct  121  RLRMKYLNSILKKDINFFDTEAKDFNIMFHISSDMVLVQDAIGDKTGHAMRYFSQFIVGF  180

Query  648  AVGFISVWKLTLVTLAVVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTV  827
            A+GF SVWKLTL+TLA+VPL+A+AG  YT+IMS LSQKGEAAYA+AGK AEE I+Q+RTV
Sbjct  181  AIGFTSVWKLTLLTLAIVPLVAIAGVAYTVIMSTLSQKGEAAYAQAGKTAEEVIAQIRTV  240

Query  828  YSFVGEKKAVESYSKSLNNALVLG  899
            YS+VGE KA+E YS+SL NAL LG
Sbjct  241  YSYVGESKALEKYSESLQNALKLG  264


 Score = 89.0 bits (219),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 65/232 (28%), Positives = 114/232 (49%), Gaps = 27/232 (12%)
 Frame = +3

Query  225  DYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLSSDSHRLSSQVSKQALYLVYLGSI  404
            ++ + + GSIGA + G   P+F +    ++ +     S  H   SQ+ ++  ++ ++   
Sbjct  674  EWPYAILGSIGAILAGIQAPLFALGITHVLSAF---YSPHH---SQIKEEVHHVAFM---  724

Query  405  IFISAWIGVA------------FWTQTGERQTARLRLRYLQSVLRKKIEFFDTDTRAKDI  548
                 ++GVA            F+T  GER TAR+RL    ++L  ++ +FD D      
Sbjct  725  -----FVGVAIFTIPIYLLQHYFYTLMGERLTARVRLLLFSAILSNEVGWFDFDENNTGA  779

Query  549  IFHI-SSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLAVVPLIAVAGG  725
            +  I +S+A LV+ A+ D+I   ++ ++  +  F + FI  W+L  V +A +PL+  A  
Sbjct  780  LTSILASNATLVRSALADRISTIVQNVALTVSAFVIAFIFSWRLAAVVVASLPLLIGASI  839

Query  726  TYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYSKSLN  881
            T  L +         AY  A  VA EAI+ +RTV +F  E+K    ++  LN
Sbjct  840  TEQLFLKGFGGDYGQAYNRATAVAHEAIANIRTVAAFGAEEKISSQFAFELN  891



>ref|XP_004164800.1| PREDICTED: LOW QUALITY PROTEIN: ABC transporter B family member 
13-like [Cucumis sativus]
Length=1248

 Score =   377 bits (969),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 176/264 (67%), Positives = 217/264 (82%), Gaps = 4/264 (2%)
 Frame = +3

Query  120  LEISSNLKMDQQPSNSTDRKEM----VSFFGLFSAADTVDYFFMVFGSIGACIHGAALPV  287
            +E++SN ++DQ P    + +E+    +S FGLF AAD +D   MVFGS+GA +HGA+LPV
Sbjct  1    MELASNGELDQNPPTKMEEQEVKLSKMSXFGLFGAADGIDCLLMVFGSLGAFVHGASLPV  60

Query  288  FFVLFGRMIDSLGHLSSDSHRLSSQVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTA  467
            FFVLFGRMIDSLGHLS   HRLSS++ + ALYL+YLG I+  SAWIGVAFW QTGERQTA
Sbjct  61   FFVLFGRMIDSLGHLSKHPHRLSSRIVENALYLIYLGLIVLASAWIGVAFWMQTGERQTA  120

Query  468  RLRLRYLQSVLRKKIEFFDTDTRAKDIIFHISSDAILVQDAIGDKIGHTIRYISQFLVGF  647
            RLR++YL S+L+K I FFDT+ +  +I+FHISSD +LVQDAIGDK GH +RY SQF+VGF
Sbjct  121  RLRMKYLNSILKKDINFFDTEAKDFNIMFHISSDMVLVQDAIGDKTGHAMRYFSQFIVGF  180

Query  648  AVGFISVWKLTLVTLAVVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTV  827
            A+GF SVWKLTL+TLA+VPL+A+AG  YT+IMS LSQKGEAAYA+AGK AEE I+Q+RTV
Sbjct  181  AIGFTSVWKLTLLTLAIVPLVAIAGVAYTVIMSTLSQKGEAAYAQAGKTAEEVIAQIRTV  240

Query  828  YSFVGEKKAVESYSKSLNNALVLG  899
            YS+VGE KA+E YS+SL NAL LG
Sbjct  241  YSYVGESKALEKYSESLQNALKLG  264


 Score = 89.0 bits (219),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 65/232 (28%), Positives = 114/232 (49%), Gaps = 27/232 (12%)
 Frame = +3

Query  225  DYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLSSDSHRLSSQVSKQALYLVYLGSI  404
            ++ + + GSIGA + G   P+F +    ++ +     S  H   SQ+ ++  ++ ++   
Sbjct  674  EWPYAILGSIGAILAGIQAPLFALGITHVLSAF---YSPHH---SQIKEEVHHVAFM---  724

Query  405  IFISAWIGVA------------FWTQTGERQTARLRLRYLQSVLRKKIEFFDTDTRAKDI  548
                 ++GVA            F+T  GER TAR+RL    ++L  ++ +FD D      
Sbjct  725  -----FVGVAIFTIPIYLLQHYFYTLMGERLTARVRLLLFSAILSNEVGWFDFDENNTGA  779

Query  549  IFHI-SSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLAVVPLIAVAGG  725
            +  I +S+A LV+ A+ D+I   ++ ++  +  F + FI  W+L  V +A +PL+  A  
Sbjct  780  LTSILASNATLVRSALADRISTIVQNVALTVSAFVIAFIFSWRLAAVVVASLPLLIGASI  839

Query  726  TYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYSKSLN  881
            T  L +         AY  A  VA EAI+ +RTV +F  E+K    ++  LN
Sbjct  840  TEQLFLKGFGGDYGQAYNRATAVAHEAIANIRTVAAFGAEEKISSQFAFELN  891



>gb|KDO84908.1| hypothetical protein CISIN_1g000851mg [Citrus sinensis]
Length=1253

 Score =   374 bits (959),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 182/253 (72%), Positives = 208/253 (82%), Gaps = 2/253 (1%)
 Frame = +3

Query  141  KMDQQPSNSTDRKEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDS  320
            KM QQ + S  +K+  SF  LF+AAD +D   M  GS+GA IHGA LPVFF+LFGRMIDS
Sbjct  22   KMKQQTNPS--KKQSGSFLSLFAAADKIDCVLMFLGSLGAFIHGATLPVFFILFGRMIDS  79

Query  321  LGHLSSDSHRLSSQVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVL  500
            LGHLSS  HRL+S++S+ ALYLVYLG +  +SAWIGVAFW QTGERQTARLRL+YLQSVL
Sbjct  80   LGHLSSHPHRLTSRISEHALYLVYLGLVALVSAWIGVAFWMQTGERQTARLRLKYLQSVL  139

Query  501  RKKIEFFDTDTRAKDIIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLT  680
            +K + FFDT+ R  +IIFHISSDAILVQDAIGDK GH +RY+SQF VGFAVGF SVW+LT
Sbjct  140  KKDMSFFDTEARDSNIIFHISSDAILVQDAIGDKTGHALRYLSQFFVGFAVGFTSVWQLT  199

Query  681  LVTLAVVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVE  860
            L+TLAVVPLIAVAGG YT+ MS LS+KGEAAY EAGKVAEE ISQVR VY+FVGE KA+E
Sbjct  200  LLTLAVVPLIAVAGGAYTITMSTLSEKGEAAYGEAGKVAEEIISQVRAVYAFVGEAKAIE  259

Query  861  SYSKSLNNALVLG  899
            SYS SL  AL  G
Sbjct  260  SYSHSLKEALKQG  272


 Score = 86.3 bits (212),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 63/240 (26%), Positives = 116/240 (48%), Gaps = 12/240 (5%)
 Frame = +3

Query  162  NSTDRKEMVSFFGLFSAADTV---------DYFFMVFGSIGACIHGAALPVFFVLFGRMI  314
             S+ R+E+ S    F+ + ++         ++ + V GS+GA + G   P+F +    ++
Sbjct  649  ESSKRRELQSSDQSFAPSPSIWELLKLNAAEWPYAVLGSVGAILAGMEAPLFALGITHIL  708

Query  315  DSLGHLSSDSHRLSSQVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARLRLRYLQS  494
             +    S    ++   V + AL  V L  +      +   F+T  GE  TAR+RL    +
Sbjct  709  TAF--YSPHDSQIKRVVDQVALIFVGLAVVTIPVYLLQHYFYTLMGEHLTARVRLSMFSA  766

Query  495  VLRKKIEFFDTDTRAKDIIFH-ISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVW  671
            +L  +I +FD D     ++   +++DA LV+ A+ D++   ++ ++  +  F + FI  W
Sbjct  767  ILSNEIGWFDLDENNTGLLISTLAADATLVRSALADRLSIIVQNVALTVTAFVIAFILSW  826

Query  672  KLTLVTLAVVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKK  851
            +L  V  A +PL+  A     L +         AY+ A  VA EAI+ +RTV ++  EK+
Sbjct  827  RLAAVVAASLPLLIGAFVAEQLFLKGFGGDYNRAYSRATSVAREAIANIRTVAAYGIEKR  886



>ref|XP_006435210.1| hypothetical protein CICLE_v10000054mg [Citrus clementina]
 gb|ESR48450.1| hypothetical protein CICLE_v10000054mg [Citrus clementina]
Length=1253

 Score =   374 bits (959),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 182/253 (72%), Positives = 208/253 (82%), Gaps = 2/253 (1%)
 Frame = +3

Query  141  KMDQQPSNSTDRKEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDS  320
            KM QQ + S  +K+  SF  LF+AAD +D   M  GS+GA IHGA LPVFF+LFGRMIDS
Sbjct  22   KMKQQTNPS--KKQSGSFLSLFAAADKIDCVLMFLGSLGAFIHGATLPVFFILFGRMIDS  79

Query  321  LGHLSSDSHRLSSQVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVL  500
            LGHLSS  HRL+S++S+ ALYLVYLG +  +SAWIGVAFW QTGERQTARLRL+YLQSVL
Sbjct  80   LGHLSSHPHRLTSRISEHALYLVYLGLVALVSAWIGVAFWMQTGERQTARLRLKYLQSVL  139

Query  501  RKKIEFFDTDTRAKDIIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLT  680
            +K + FFDT+ R  +IIFHISSDAILVQDAIGDK GH +RY+SQF VGFAVGF SVW+LT
Sbjct  140  KKDMSFFDTEARDSNIIFHISSDAILVQDAIGDKTGHALRYLSQFFVGFAVGFTSVWQLT  199

Query  681  LVTLAVVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVE  860
            L+TLAVVPLIAVAGG YT+ MS LS+KGEAAY EAGKVAEE ISQVR VY+FVGE KA+E
Sbjct  200  LLTLAVVPLIAVAGGAYTITMSTLSEKGEAAYGEAGKVAEEIISQVRAVYAFVGEAKAIE  259

Query  861  SYSKSLNNALVLG  899
            SYS SL  AL  G
Sbjct  260  SYSHSLKEALKQG  272


 Score = 86.3 bits (212),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 63/240 (26%), Positives = 116/240 (48%), Gaps = 12/240 (5%)
 Frame = +3

Query  162  NSTDRKEMVSFFGLFSAADTV---------DYFFMVFGSIGACIHGAALPVFFVLFGRMI  314
             S+ R+E+ S    F+ + ++         ++ + V GS+GA + G   P+F +    ++
Sbjct  649  ESSKRRELQSSDQSFAPSPSIWELLKLNAAEWPYAVLGSVGAILAGMEAPLFALGITHIL  708

Query  315  DSLGHLSSDSHRLSSQVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARLRLRYLQS  494
             +    S    ++   V + AL  V L  +      +   F+T  GE  TAR+RL    +
Sbjct  709  TAF--YSPHDSQIKRVVDQVALIFVGLAVVTIPVYLLQHYFYTLMGEHLTARVRLSMFSA  766

Query  495  VLRKKIEFFDTDTRAKDIIFH-ISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVW  671
            +L  +I +FD D     ++   +++DA LV+ A+ D++   ++ ++  +  F + FI  W
Sbjct  767  ILSNEIGWFDLDENNTGLLISTLAADATLVRSALADRLSIIVQNVALTVTAFVIAFILSW  826

Query  672  KLTLVTLAVVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKK  851
            +L  V  A +PL+  A     L +         AY+ A  VA EAI+ +RTV ++  EK+
Sbjct  827  RLAAVVAASLPLLIGAFVAEQLFLKGFGGDYNRAYSRATSVAREAIANIRTVAAYGIEKR  886



>ref|XP_006473687.1| PREDICTED: ABC transporter B family member 13-like isoform X1 
[Citrus sinensis]
Length=1260

 Score =   372 bits (955),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 182/253 (72%), Positives = 208/253 (82%), Gaps = 2/253 (1%)
 Frame = +3

Query  141  KMDQQPSNSTDRKEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDS  320
            K  QQ + S  +K+  SF  LF+AAD +D   M  GS+GA IHGA LPVFF+LFGRMIDS
Sbjct  29   KTKQQTNPS--KKQSGSFLSLFAAADKIDCVLMFLGSLGAFIHGATLPVFFILFGRMIDS  86

Query  321  LGHLSSDSHRLSSQVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVL  500
            LGHLSS  HRL+S++S+ ALYLVYLG +  +SAWIGVAFW QTGERQTARLRL+YLQSVL
Sbjct  87   LGHLSSHPHRLTSRISEHALYLVYLGLVALVSAWIGVAFWMQTGERQTARLRLKYLQSVL  146

Query  501  RKKIEFFDTDTRAKDIIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLT  680
            +K + FFDT+ R  +IIFHISSDAILVQDAIGDK GH +RY+SQF VGFAVGF SVW+LT
Sbjct  147  KKDMSFFDTEARDSNIIFHISSDAILVQDAIGDKTGHALRYLSQFFVGFAVGFTSVWQLT  206

Query  681  LVTLAVVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVE  860
            L+TLAVVPLIAVAGG YT+ MS LS+KGEAAYAEAGKVAEE ISQVR VY+FVGE KA+E
Sbjct  207  LLTLAVVPLIAVAGGAYTITMSTLSEKGEAAYAEAGKVAEEIISQVRAVYAFVGEAKAIE  266

Query  861  SYSKSLNNALVLG  899
            SYS SL  AL  G
Sbjct  267  SYSHSLKEALKQG  279


 Score = 86.3 bits (212),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 63/240 (26%), Positives = 116/240 (48%), Gaps = 12/240 (5%)
 Frame = +3

Query  162  NSTDRKEMVSFFGLFSAADTV---------DYFFMVFGSIGACIHGAALPVFFVLFGRMI  314
             S+ R+E+ S    F+ + ++         ++ + V GS+GA + G   P+F +    ++
Sbjct  656  ESSKRRELQSSDQSFAPSPSIWELLKLNAAEWPYAVLGSVGAILAGMEAPLFALGITHIL  715

Query  315  DSLGHLSSDSHRLSSQVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARLRLRYLQS  494
             +    S    ++   V + AL  V L  +      +   F+T  GE  TAR+RL    +
Sbjct  716  TAF--YSPHDSQIKRVVDQVALIFVGLAVVTIPVYLLQHYFYTLMGEHLTARVRLSMFSA  773

Query  495  VLRKKIEFFDTDTRAKDIIFH-ISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVW  671
            +L  +I +FD D     ++   +++DA LV+ A+ D++   ++ ++  +  F + FI  W
Sbjct  774  ILSNEIGWFDLDENNTGLLISTLAADATLVRSALADRLSIIVQNVALTVTAFVIAFILSW  833

Query  672  KLTLVTLAVVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKK  851
            +L  V  A +PL+  A     L +         AY+ A  VA EAI+ +RTV ++  EK+
Sbjct  834  RLAAVVAASLPLLIGAFVAEQLFLKGFGGDYNRAYSRATSVAREAIANIRTVAAYGIEKR  893



>gb|KHN39417.1| ABC transporter B family member 13 [Glycine soja]
Length=1205

 Score =   369 bits (947),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 171/221 (77%), Positives = 199/221 (90%), Gaps = 0/221 (0%)
 Frame = +3

Query  237  MVFGSIGACIHGAALPVFFVLFGRMIDSLGHLSSDSHRLSSQVSKQALYLVYLGSIIFIS  416
            M  GS+G+C+HGAALPVFF+LFGRMIDSLGHLS++ H+LSS++S+ ALYLVYLG ++ +S
Sbjct  1    MFLGSVGSCVHGAALPVFFILFGRMIDSLGHLSNNPHKLSSRISEHALYLVYLGGVVLVS  60

Query  417  AWIGVAFWTQTGERQTARLRLRYLQSVLRKKIEFFDTDTRAKDIIFHISSDAILVQDAIG  596
            AW+GVAFW QTGERQTARLRL+YLQ+VL+K I FFD + R  +IIFHISSDAILVQDAIG
Sbjct  61   AWMGVAFWMQTGERQTARLRLKYLQAVLKKDINFFDNEARDANIIFHISSDAILVQDAIG  120

Query  597  DKIGHTIRYISQFLVGFAVGFISVWKLTLVTLAVVPLIAVAGGTYTLIMSNLSQKGEAAY  776
            DK GH IRY+SQF+VGFA+GF SVW+LTL+TLAVVPLIAVAGG YT+IMS LS+KGEAAY
Sbjct  121  DKTGHAIRYLSQFIVGFAIGFTSVWQLTLLTLAVVPLIAVAGGAYTIIMSTLSEKGEAAY  180

Query  777  AEAGKVAEEAISQVRTVYSFVGEKKAVESYSKSLNNALVLG  899
            AEAGKVAEE ISQVRTVYSFVGE+KA  SYSKSL+NAL LG
Sbjct  181  AEAGKVAEEVISQVRTVYSFVGEEKAAGSYSKSLDNALKLG  221


 Score = 99.4 bits (246),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 69/260 (27%), Positives = 133/260 (51%), Gaps = 13/260 (5%)
 Frame = +3

Query  117  ELEISSNLKMDQQ--PSNSTDRKEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVF  290
            +L+ ++ L+   Q  PS +T    ++    L    +  ++ + + GS+GA + G   P+F
Sbjct  597  KLDTAAELQSRDQHLPSKTTSTPSILDLLKL----NAPEWPYAILGSVGAILAGMEAPLF  652

Query  291  FVLFGRMIDSLGHLSSDSHRLSSQVSKQALYLVYLG-SIIFISAWIGVA-FWTQTGERQT  464
             +    ++ +    S    ++  +V + A   ++LG ++I I  ++ +  F+T  GER T
Sbjct  653  ALGITHILTAF--YSPQGSKIKQEVDRVAF--IFLGVAVITIPIYLLLHYFYTLMGERLT  708

Query  465  ARLRLRYLQSVLRKKIEFFDTDT-RAKDIIFHISSDAILVQDAIGDKIGHTIRYISQFLV  641
            AR+RL    ++L  ++ +FD D      +   +++DA LV+ A+ D++   ++ ++  + 
Sbjct  709  ARVRLLMFSAILNNEVAWFDMDEHNTGSLTAMLAADATLVRSALADRLSTIVQNVALTVT  768

Query  642  GFAVGFISVWKLTLVTLAVVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVR  821
             F +GF   WKLT V +A +PL+  A  T  L +         AY+ A  +A EAI+ +R
Sbjct  769  AFVIGFTLSWKLTAVVVACLPLLIGASITEQLFLKGFGGDYGHAYSRATSLAREAIANIR  828

Query  822  TVYSFVGEKKAVESYSKSLN  881
            TV +F  E +    ++  LN
Sbjct  829  TVAAFGAEDRISIQFASELN  848



>gb|KHN12634.1| ABC transporter B family member 13 [Glycine soja]
Length=1205

 Score =   369 bits (947),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 172/221 (78%), Positives = 198/221 (90%), Gaps = 0/221 (0%)
 Frame = +3

Query  237  MVFGSIGACIHGAALPVFFVLFGRMIDSLGHLSSDSHRLSSQVSKQALYLVYLGSIIFIS  416
            M  G  G+C+HGAALPVFF+LFGRMIDSLGHLS+D H+LSS+VS+ ALYLVYLG ++ +S
Sbjct  1    MFLGCFGSCVHGAALPVFFILFGRMIDSLGHLSNDPHKLSSRVSEHALYLVYLGGVVLVS  60

Query  417  AWIGVAFWTQTGERQTARLRLRYLQSVLRKKIEFFDTDTRAKDIIFHISSDAILVQDAIG  596
            AW+GVAFW QTGERQTARLRL+YLQ+VL+K I FFD + R  +IIFHISSDAILVQDAIG
Sbjct  61   AWMGVAFWMQTGERQTARLRLKYLQAVLKKDINFFDNEARDANIIFHISSDAILVQDAIG  120

Query  597  DKIGHTIRYISQFLVGFAVGFISVWKLTLVTLAVVPLIAVAGGTYTLIMSNLSQKGEAAY  776
            DK GH IRY+SQF+VGFA+GF SVW+LTL+TLAVVPLIAVAGG YT+IMS LS+KGEAAY
Sbjct  121  DKTGHAIRYLSQFIVGFAIGFTSVWQLTLLTLAVVPLIAVAGGAYTIIMSTLSEKGEAAY  180

Query  777  AEAGKVAEEAISQVRTVYSFVGEKKAVESYSKSLNNALVLG  899
            AEAGKVA+E ISQVRTVYSFVGE+KAV SYSKSL+NAL LG
Sbjct  181  AEAGKVAQEVISQVRTVYSFVGEEKAVGSYSKSLDNALKLG  221


 Score =   101 bits (252),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 71/272 (26%), Positives = 133/272 (49%), Gaps = 27/272 (10%)
 Frame = +3

Query  123  EISSNLKMDQQ----------------PSNSTDRKEMVSFFGLFSAADTVDYFFMVFGSI  254
            E S NL +++Q                PS +T    ++    L    +  ++ + + GS+
Sbjct  585  EPSDNLTLEEQLKLDAAAELQSRDQHLPSKTTSTPSILDLLKL----NAPEWPYAILGSV  640

Query  255  GACIHGAALPVFFVLFGRMIDSLGHLSSDSHRLSSQVSKQALYLVYLG-SIIFISAWIGV  431
            GA + G   P+F +    ++ +    S    ++  +V + A   ++LG ++I I  ++ +
Sbjct  641  GAILAGMEAPLFALGITHILTAF--YSPQGSKIKQEVDRVAF--IFLGVAVITIPIYLLL  696

Query  432  A-FWTQTGERQTARLRLRYLQSVLRKKIEFFDTD-TRAKDIIFHISSDAILVQDAIGDKI  605
              F+T  GER TAR+RL    ++L  ++ +FD D      +   +++DA LV+ A+ D++
Sbjct  697  HYFYTLMGERLTARVRLLMFSAILNNEVAWFDKDENNTGSLTAMLAADATLVRSALADRL  756

Query  606  GHTIRYISQFLVGFAVGFISVWKLTLVTLAVVPLIAVAGGTYTLIMSNLSQKGEAAYAEA  785
               ++ ++  +  F +GF   WKLT V +A +PL+  A  T  L +         AY+ A
Sbjct  757  STIVQNVALTVTAFVIGFTLSWKLTAVVVACLPLLIGASITEQLFLKGFGGDYGHAYSRA  816

Query  786  GKVAEEAISQVRTVYSFVGEKKAVESYSKSLN  881
              +A EAI+ +RTV +F  E +    ++  LN
Sbjct  817  TSLAREAIANIRTVAAFGAEDRVSTQFASELN  848



>ref|XP_008387923.1| PREDICTED: ABC transporter B family member 13-like [Malus domestica]
Length=1245

 Score =   367 bits (942),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 188/271 (69%), Positives = 224/271 (83%), Gaps = 10/271 (4%)
 Frame = +3

Query  111  MGELEISSN--------LKMDQQPSNSTDRKEMVSFFGLFSAADTVDYFFMVFGSIGACI  266
            M E+E++S+         KMD+ P+NST ++  VSF GLF+AAD VD   M  GS+GACI
Sbjct  1    MEEVELASDKFSDGNPLPKMDK-PTNSTKQRS-VSFLGLFAAADKVDCVLMFLGSVGACI  58

Query  267  HGAALPVFFVLFGRMIDSLGHLSSDSHRLSSQVSKQALYLVYLGSIIFISAWIGVAFWTQ  446
            HG  LPVFFVLFGRMIDSLGHL+ +  +LS+++S+ ALYLVYLG ++F SAWIGVAFWT+
Sbjct  59   HGGVLPVFFVLFGRMIDSLGHLAMNPQQLSARISEYALYLVYLGLVLFASAWIGVAFWTR  118

Query  447  TGERQTARLRLRYLQSVLRKKIEFFDTDTRAKDIIFHISSDAILVQDAIGDKIGHTIRYI  626
            TGERQTARLR++YLQSVL K I FFDT+ R  +IIFHISSDAILVQDAIGDK GH +RY+
Sbjct  119  TGERQTARLRMKYLQSVLNKDINFFDTEARDTNIIFHISSDAILVQDAIGDKTGHALRYL  178

Query  627  SQFLVGFAVGFISVWKLTLVTLAVVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEA  806
            SQFLVGFA+GF SVW+LTL+TLAVVP IA+AGG YT+IMS LS+KGEAAYAEAGKVAEE 
Sbjct  179  SQFLVGFAIGFTSVWQLTLLTLAVVPFIAIAGGAYTIIMSTLSEKGEAAYAEAGKVAEEV  238

Query  807  ISQVRTVYSFVGEKKAVESYSKSLNNALVLG  899
            ISQ+RTVYSF GE +A+E+YS SLN AL LG
Sbjct  239  ISQIRTVYSFGGEDRAIEAYSTSLNKALKLG  269


 Score = 85.5 bits (210),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 63/252 (25%), Positives = 118/252 (47%), Gaps = 15/252 (6%)
 Frame = +3

Query  150  QQPSNSTDRK-----EMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFVLFGRMI  314
            Q+PS+ T        E+V         +  ++ + + GS+GA + G   P+F +    ++
Sbjct  649  QKPSDQTSSAAAPVWELVKL-------NAPEWPYAILGSVGAVLAGMEAPLFSLGITHIL  701

Query  315  DSLGHLSSDSHRLSSQVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARLRLRYLQS  494
                  +    ++   V + AL  V L ++      +   F+T  GER T R+RL   ++
Sbjct  702  TVF--YAPGGSQIKHVVDRIALIFVGLAAVTVPIYLLQHYFYTLMGERLTTRVRLLMFKA  759

Query  495  VLRKKIEFFD-TDTRAKDIIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVW  671
            +L  ++ +FD  +     +   ++++A LV+ A+ D++   ++ +S  +  F + F   W
Sbjct  760  ILSNEVGWFDLEENNTGSLTSTLAANATLVRSALADRLSTIVQNLSLTVTAFVIAFTFSW  819

Query  672  KLTLVTLAVVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKK  851
            ++  V  A +PL+  A  T  L +         AY+ A  VA EAI+ +RTV SF  E++
Sbjct  820  RMAAVVSASLPLLIGASITEQLFLKGFGGDYNRAYSRATSVAREAIANIRTVASFGCEER  879

Query  852  AVESYSKSLNNA  887
                +S  LN  
Sbjct  880  ISLQFSLELNKP  891



>ref|XP_004499289.1| PREDICTED: ABC transporter B family member 13-like [Cicer arietinum]
Length=1247

 Score =   362 bits (930),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 189/269 (70%), Positives = 221/269 (82%), Gaps = 7/269 (3%)
 Frame = +3

Query  111  MGELEI------SSNLKMDQQPSNSTDRKEMVSFFGLFSAADTVDYFFMVFGSIGACIHG  272
            M E+E+      SSNL+  ++   ++  K  VSFFGLFSAAD  D   M  GS+GA +HG
Sbjct  1    MEEVELACNESSSSNLEYKKREEINSKVKS-VSFFGLFSAADRTDCVLMFVGSVGAFVHG  59

Query  273  AALPVFFVLFGRMIDSLGHLSSDSHRLSSQVSKQALYLVYLGSIIFISAWIGVAFWTQTG  452
            AALPVFFVLFGRMIDSLGHLS+  H+LS Q+S+ ALYLVYLG ++ +SAW+GVAFW QTG
Sbjct  60   AALPVFFVLFGRMIDSLGHLSNKPHKLSQQISQYALYLVYLGLVVLVSAWMGVAFWMQTG  119

Query  453  ERQTARLRLRYLQSVLRKKIEFFDTDTRAKDIIFHISSDAILVQDAIGDKIGHTIRYISQ  632
            ERQTARLRL+YLQSVL+K I FFD + R  +IIFHISSDAILVQDAIGDK GH +RY+SQ
Sbjct  120  ERQTARLRLKYLQSVLKKDINFFDNEARDANIIFHISSDAILVQDAIGDKTGHAMRYLSQ  179

Query  633  FLVGFAVGFISVWKLTLVTLAVVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAIS  812
            F+VGF +GF SVW+LTL+TLAVVP IA+AGG YT+IMS LS+KGEAAYAEAGKVAEE IS
Sbjct  180  FIVGFGIGFTSVWQLTLLTLAVVPFIAIAGGAYTMIMSTLSEKGEAAYAEAGKVAEEVIS  239

Query  813  QVRTVYSFVGEKKAVESYSKSLNNALVLG  899
            QVRTVYSFVGE+KAV SYSKSL+ AL LG
Sbjct  240  QVRTVYSFVGEEKAVGSYSKSLDKALKLG  268


 Score = 93.6 bits (231),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 67/257 (26%), Positives = 122/257 (47%), Gaps = 9/257 (4%)
 Frame = +3

Query  120  LEISSNLKMDQQP--SNSTDRKEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFF  293
            L  +  LK   Q   SN+     M+    L    +  ++ + V GS+GA + G   P+F 
Sbjct  645  LNTARELKSSDQSLTSNNASIPSMLDLLKL----NAPEWPYAVLGSVGAILAGMEAPLFA  700

Query  294  VLFGRMIDSLGHLSSDSHRLSSQVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARL  473
            +    ++ +    S    ++  +V+  AL  V +  +      +   F++  GER TAR+
Sbjct  701  LGITHILTAF--YSPQISKIKQEVAHVALIFVGVAVVTIPIYLLQHYFYSLMGERLTARV  758

Query  474  RLRYLQSVLRKKIEFFDTD-TRAKDIIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFA  650
            RL    ++L  ++ +FD D      +   +++DA LV+  + D++   ++ ++  +  F 
Sbjct  759  RLLMFSAILTNEVAWFDLDENNTGSLTAMLAADATLVRSTLADRLSTIVQNVALTVTAFV  818

Query  651  VGFISVWKLTLVTLAVVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVY  830
            + F   WKLTLV  A +PL+  A  T  L +         AY++A  +A EAI+ +RTV 
Sbjct  819  IAFTLSWKLTLVVAACLPLLIGASITEQLFLKGFGGDYSHAYSKATSLAREAIANIRTVA  878

Query  831  SFVGEKKAVESYSKSLN  881
            +F  E +    ++  LN
Sbjct  879  AFGAEDRISIQFASELN  895



>ref|XP_011034997.1| PREDICTED: ABC transporter B family member 13-like isoform X1 
[Populus euphratica]
Length=1246

 Score =   362 bits (929),  Expect = 8e-112, Method: Compositional matrix adjust.
 Identities = 175/259 (68%), Positives = 210/259 (81%), Gaps = 8/259 (3%)
 Frame = +3

Query  111  MGELEISSNLKMDQ-------QPSNSTDRKEMVSFFGLFSAADTVDYFFMVFGSIGACIH  269
            M ELE++S+  +DQ       Q SNS+ +K  VS FGLFSAAD  D+F M  G +G+C H
Sbjct  1    MEELELTSDQVLDQNSLPKMEQTSNSS-KKPTVSIFGLFSAADKFDHFLMFLGLVGSCAH  59

Query  270  GAALPVFFVLFGRMIDSLGHLSSDSHRLSSQVSKQALYLVYLGSIIFISAWIGVAFWTQT  449
            GA  P+FFVLFG +IDSLGH+ SD H++SSQVSK +L LVYLG  +F++ WIGVA W QT
Sbjct  60   GAVYPMFFVLFGHLIDSLGHVGSDPHQMSSQVSKYSLDLVYLGLGVFVAGWIGVASWMQT  119

Query  450  GERQTARLRLRYLQSVLRKKIEFFDTDTRAKDIIFHISSDAILVQDAIGDKIGHTIRYIS  629
            GERQTARLRL+YLQSVLRK + FFD + R  +I+FHISSDAILVQDAIGDK GH +RY+S
Sbjct  120  GERQTARLRLKYLQSVLRKDMNFFDIEARDSNILFHISSDAILVQDAIGDKTGHAVRYLS  179

Query  630  QFLVGFAVGFISVWKLTLVTLAVVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAI  809
            QF +GF VGF SVW+LTL+TLAVVPL+AVAGG YT+IMS LS+KGEAAYAEAGKVA+EAI
Sbjct  180  QFFIGFVVGFKSVWQLTLLTLAVVPLMAVAGGAYTIIMSTLSEKGEAAYAEAGKVADEAI  239

Query  810  SQVRTVYSFVGEKKAVESY  866
            SQ+RTVYSFVGE+K +E Y
Sbjct  240  SQIRTVYSFVGEEKVLEEY  258


 Score = 89.0 bits (219),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 73/275 (27%), Positives = 129/275 (47%), Gaps = 27/275 (10%)
 Frame = +3

Query  99   ITFSMGELEISSNLKMDQQ---PSNSTDRKEMVSFFGLFSAADTVDYFFMVFGSIGACIH  269
            +T S  +   +  LK D +   P+N +    +     L    +  ++ + V GS GA + 
Sbjct  633  LTSSQNQEGTTRELKSDDEILSPANFSPTPSIWELVKL----NASEWPYAVLGSAGAMMA  688

Query  270  GAALPVFFVLFGRMIDSLGHLSSDSHRLSSQVSKQALYLVYLGSIIFISAWIGVA-----  434
            G   P+F +    M+ +    S D     SQ+ K+    V+L ++IF+ A +        
Sbjct  689  GMEAPLFALGITHMLTAF--YSPDI----SQMKKE----VHLVALIFVGAAVVTVPIYIL  738

Query  435  ---FWTQTGERQTARLRLRYLQSVLRKKIEFFDTDTRAK-DIIFHISSDAILVQDAIGDK  602
               F+T  GER  AR+RL    ++L  +I +FD D  +   +   +++DA LV+  + D+
Sbjct  739  QHYFYTLMGERLIARVRLSMFSAILCNEIGWFDLDENSTGSLTSTLAADATLVRSTLADR  798

Query  603  IGHTIRYISQFLVGFAVGFISVWKLTLVTLAVVPLIAVAGGTYTLIMSNLSQKGEAAYAE  782
            +   ++ +S  +  F +GF   W+++ V +A  PL+  A  T  L +         +Y  
Sbjct  799  LSTMVQNVSLTVTAFVIGFSLSWRVSAVIIACFPLLIGAAITEQLFLKGFGGDYR-SYTR  857

Query  783  AGKVAEEAISQVRTVYSFVGEKKAVESYSKSLNNA  887
            A  VA EAI+ +RTV SF  E++    ++  LN  
Sbjct  858  ANAVAREAIANIRTVASFGAEERIAHQFASELNKP  892



>ref|XP_011083466.1| PREDICTED: LOW QUALITY PROTEIN: ABC transporter B family member 
13-like [Sesamum indicum]
Length=1247

 Score =   361 bits (926),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 176/270 (65%), Positives = 217/270 (80%), Gaps = 8/270 (3%)
 Frame = +3

Query  111  MGELEISSN--------LKMDQQPSNSTDRKEMVSFFGLFSAADTVDYFFMVFGSIGACI  266
            M E+E+S+         L  +Q+  ++    E VSFF LF+ AD +DY  M  GSIGAC+
Sbjct  1    MDEVELSTEQVSKPNEVLGTEQRWDSTAKNGESVSFFRLFAVADKIDYVLMFIGSIGACL  60

Query  267  HGAALPVFFVLFGRMIDSLGHLSSDSHRLSSQVSKQALYLVYLGSIIFISAWIGVAFWTQ  446
             GAALPVFFVLFGRMI++LG+LS D HR SS+VSK ALYLVYLG ++++SAW GVA WTQ
Sbjct  61   QGAALPVFFVLFGRMINTLGNLSLDPHRFSSEVSKYALYLVYLGLVVWLSAWTGVACWTQ  120

Query  447  TGERQTARLRLRYLQSVLRKKIEFFDTDTRAKDIIFHISSDAILVQDAIGDKIGHTIRYI  626
            TGERQTA LR +YL+SVL+K I+FFDT+    +I+FHISSDAILVQDAIGDKI H I Y+
Sbjct  121  TGERQTALLRQKYLESVLKKNIQFFDTEAGQHNILFHISSDAILVQDAIGDKICHAICYL  180

Query  627  SQFLVGFAVGFISVWKLTLVTLAVVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEA  806
            SQF++GF++GF  VW+LTL+TLA+VPLIAVAGG YT+IMS LS++GE AYAEAGK+ EE 
Sbjct  181  SQFVIGFSLGFSMVWQLTLLTLAIVPLIAVAGGAYTIIMSTLSKRGENAYAEAGKLTEEV  240

Query  807  ISQVRTVYSFVGEKKAVESYSKSLNNALVL  896
            ISQVRTVYSFVGE+KA+E+YS+SL NAL L
Sbjct  241  ISQVRTVYSFVGEEKAIETYSRSLENALKL  270


 Score = 86.7 bits (213),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 59/251 (24%), Positives = 119/251 (47%), Gaps = 10/251 (4%)
 Frame = +3

Query  129  SSNLKMDQQPSNSTDRKEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFVLFGR  308
            +++  + QQ + ST   E++         +  ++   + GS+GA + G   P+F +    
Sbjct  647  TTDQNLSQQTTVSTPVWELIKL-------NAPEWPCALLGSLGAILAGMEAPLFALAITH  699

Query  309  MIDSLGHLSSDSHRLSSQVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARLRLRYL  488
            ++      S +  R+  +V + +   +    +  +   +   F+T  GER  AR+RL   
Sbjct  700  ILTVF--YSHNDSRIKQEVRQMSFIFIGAAMVTVLVYLLQHYFYTLMGERLIARVRLLMF  757

Query  489  QSVLRKKIEFFDTDTRAK-DIIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFIS  665
            +++L  ++ +FD D  +   +   +++DA LV+ A+ D+I   I+ I+  +  F + F+ 
Sbjct  758  KAMLSNEVAWFDKDENSTGSLASKLATDATLVRSALADRISTVIQNIALAVTAFVIAFVL  817

Query  666  VWKLTLVTLAVVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGE  845
             W++    +A  PL+  A     L +         AY  A +VA EAI+ +RTV +F  E
Sbjct  818  SWRIAAGVVATFPLLIGANIAEQLFLKGFGGDYVTAYYRATEVAREAIANIRTVAAFGAE  877

Query  846  KKAVESYSKSL  878
            ++    ++  L
Sbjct  878  ERVTAKFASEL  888



>ref|XP_002301961.1| multidrug resistance P-glycoprotein [Populus trichocarpa]
 gb|EEE81234.1| multidrug resistance P-glycoprotein [Populus trichocarpa]
Length=1219

 Score =   358 bits (918),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 168/239 (70%), Positives = 201/239 (84%), Gaps = 1/239 (0%)
 Frame = +3

Query  150  QQPSNSTDRKEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGH  329
            ++PSNS+ +K  VS FGLFSAAD  D+F M  G +G+C HGA  P+FFVLFG +IDSLGH
Sbjct  2    ERPSNSS-KKPTVSIFGLFSAADKFDHFLMFLGLVGSCAHGAVFPLFFVLFGHLIDSLGH  60

Query  330  LSSDSHRLSSQVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKK  509
            + SD H++SSQVSK +L LVYLG  +F++ WIGVA W QTGERQTARLRL+YLQSVLRK 
Sbjct  61   VRSDPHQMSSQVSKYSLDLVYLGLGVFVAGWIGVASWMQTGERQTARLRLKYLQSVLRKD  120

Query  510  IEFFDTDTRAKDIIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVT  689
            + FFD + R  +I+FHISSDAILVQDAIGDK GH +RY+SQF +GF  GF SVW+LTL+T
Sbjct  121  MNFFDIEARDSNILFHISSDAILVQDAIGDKTGHAVRYLSQFFIGFVFGFKSVWQLTLLT  180

Query  690  LAVVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESY  866
            LAVVPL+AVAGG YT+IMS LS+KGEAAYAEAGKVA+EAISQ+RTVYSFVGE+KA+E Y
Sbjct  181  LAVVPLMAVAGGAYTIIMSTLSEKGEAAYAEAGKVADEAISQIRTVYSFVGEEKALEEY  239


 Score = 90.5 bits (223),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 63/232 (27%), Positives = 116/232 (50%), Gaps = 28/232 (12%)
 Frame = +3

Query  216  DTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLSSDSHRLSSQVSKQALYLVYL  395
            +  ++ + V GS+GA + G   P+F +    M+ +    S D+    SQ+ K+    V+L
Sbjct  652  NAPEWPYAVLGSVGAMMAGMEAPLFALGITHMLTAF--YSPDN----SQMKKE----VHL  701

Query  396  GSIIFISAWIGVA--------FWTQTGERQTARLRLRYLQSVLRKKIEFFDTDTRAK-DI  548
             ++IF+ A +           F+T  GER   R+RL    ++L  +I +FD D  +   +
Sbjct  702  VALIFVGAAVVTVPIYILQHYFYTLMGERLITRVRLSMFSAILCNEIGWFDLDENSTGSL  761

Query  549  IFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLAVVPLIAVAGGT  728
               +++DA LV+  + D++   ++ +S  +  F +GF   W+++ V +A  PL       
Sbjct  762  TSTLAADATLVRSTLADRLSTMVQNVSLTVTAFVIGFSLSWRVSAVIIACFPL-------  814

Query  729  YTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYSKSLNN  884
              LI + +++    +Y  A  VA EAI+ +RTV SF  E++    ++  LN 
Sbjct  815  --LIGAAITEANYRSYTRANAVAREAIANIRTVASFGAEERIAHQFASELNK  864



>ref|XP_009334844.1| PREDICTED: ABC transporter B family member 13-like [Pyrus x bretschneideri]
Length=1245

 Score =   357 bits (917),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 183/271 (68%), Positives = 220/271 (81%), Gaps = 10/271 (4%)
 Frame = +3

Query  111  MGELEISSN--------LKMDQQPSNSTDRKEMVSFFGLFSAADTVDYFFMVFGSIGACI  266
            M E+E++S+         +MD+ P+NST  +  VSF GLF+AAD VD   M  GS+GACI
Sbjct  1    MEEVELASDKFSDGNPLPEMDK-PTNSTKHRS-VSFLGLFAAADKVDCVLMFLGSVGACI  58

Query  267  HGAALPVFFVLFGRMIDSLGHLSSDSHRLSSQVSKQALYLVYLGSIIFISAWIGVAFWTQ  446
            HG  LPVFFVLFGRMIDSLGHL+ +  + S+++S+ ALYLVYLG ++F SAWIGVAFWT+
Sbjct  59   HGGVLPVFFVLFGRMIDSLGHLAMNPQQQSARISEYALYLVYLGLVLFASAWIGVAFWTR  118

Query  447  TGERQTARLRLRYLQSVLRKKIEFFDTDTRAKDIIFHISSDAILVQDAIGDKIGHTIRYI  626
            TGERQTARLR++YLQSVL K I FFDT+ R  +IIFHISSDAILVQDAIGDK GH +RY+
Sbjct  119  TGERQTARLRMKYLQSVLNKDINFFDTEARDTNIIFHISSDAILVQDAIGDKTGHALRYL  178

Query  627  SQFLVGFAVGFISVWKLTLVTLAVVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEA  806
            SQFL GFA+GF SVW+LTL+TLAVVP IA+AGG YT+ MS LS+KGEAAYAEAGKVAEE 
Sbjct  179  SQFLTGFAIGFTSVWQLTLLTLAVVPFIAIAGGAYTITMSTLSEKGEAAYAEAGKVAEEV  238

Query  807  ISQVRTVYSFVGEKKAVESYSKSLNNALVLG  899
            ISQ+RTVYSF GE +++E+YS SLN AL LG
Sbjct  239  ISQIRTVYSFGGEDRSIEAYSTSLNKALKLG  269


 Score = 80.5 bits (197),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 62/252 (25%), Positives = 121/252 (48%), Gaps = 15/252 (6%)
 Frame = +3

Query  150  QQPSNSTDRK-----EMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFVLFGRMI  314
            Q+PS+ T        E+V         +  ++ + + GS+GA + G   P+F +    ++
Sbjct  649  QKPSDQTSSAPAPVWELVKL-------NAPEWPYAILGSVGAVLAGMEAPLFSLGITHIL  701

Query  315  DSLGHLSSDSHRLSSQVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARLRLRYLQS  494
             ++ +L   S ++   V + AL  V L ++      +   F+T  GER T R+RL   ++
Sbjct  702  -TVFYLPGGS-QIKHVVDRIALIFVGLAAVTVPIYLLQHYFYTLMGERLTTRVRLLMFKA  759

Query  495  VLRKKIEFFD-TDTRAKDIIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVW  671
            +L  ++ +FD  +     +   ++++A LV+ A+ D++   ++ +S  +  F + F   W
Sbjct  760  ILSNEVGWFDLEENDTGSLTSTLAANATLVRSALADRLSTIVQNLSLTVTAFVIAFTFSW  819

Query  672  KLTLVTLAVVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKK  851
            ++  V  A +PL+  A  T  L +         AY+ A  +A EAI+ + TV +F  E++
Sbjct  820  RMAAVVSASLPLLIGASITEQLFLKGFGGDYNRAYSRATSIAREAIANIGTVAAFGCEER  879

Query  852  AVESYSKSLNNA  887
                +S  LN  
Sbjct  880  ISLQFSLELNKP  891



>emb|CDX84896.1| BnaC05g21590D [Brassica napus]
Length=1051

 Score =   353 bits (906),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 172/262 (66%), Positives = 207/262 (79%), Gaps = 2/262 (1%)
 Frame = +3

Query  111  MGELEISSNLKMDQQPSNSTDRKEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVF  290
            M   E SSN  +  Q    + +K+ VS  GLF AAD +D F M+ G +GAC  GA LP+F
Sbjct  1    MDSTEPSSNGNI--QNEKDSKKKDYVSLMGLFGAADKLDCFLMILGGLGACTLGATLPLF  58

Query  291  FVLFGRMIDSLGHLSSDSHRLSSQVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTAR  470
            FV FG+M+DS+G+LS+D   LSS+VSK AL LVYLG + F+SAWIGVA WTQTGERQTAR
Sbjct  59   FVFFGKMLDSIGNLSTDPKALSSRVSKNALDLVYLGLVTFLSAWIGVACWTQTGERQTAR  118

Query  471  LRLRYLQSVLRKKIEFFDTDTRAKDIIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFA  650
            LR+ YL++VL K I FFDT+ R  ++IFHISSDAILVQDAIGDK GH +RY+SQF+ GF 
Sbjct  119  LRINYLKAVLAKDITFFDTEARDSNLIFHISSDAILVQDAIGDKTGHVLRYLSQFVAGFV  178

Query  651  VGFISVWKLTLVTLAVVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVY  830
            VGF+SVW+LTL+TLAVVPLIA+AGG Y +IMS +S+K EAAYA+AGKVAEE ISQVRTVY
Sbjct  179  VGFLSVWQLTLLTLAVVPLIAIAGGGYAIIMSTISEKSEAAYADAGKVAEEVISQVRTVY  238

Query  831  SFVGEKKAVESYSKSLNNALVL  896
            +FVGE+KAV SYS SL  AL L
Sbjct  239  AFVGEEKAVNSYSNSLKKALKL  260


 Score = 92.0 bits (227),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 62/223 (28%), Positives = 108/223 (48%), Gaps = 3/223 (1%)
 Frame = +3

Query  216  DTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLSSDSHRLSSQVSKQALYLVYL  395
            +  ++ + + GSIGA + GA  P+F +    ++ +    S     +   V K A+  V +
Sbjct  668  NAPEWPYALLGSIGAVLAGAQTPLFSMGIAYVLTAF--YSPSPSVIKRDVEKVAIVFVGI  725

Query  396  GSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKKIEFFDTDTRAKDIIFHI-SSDA  572
              +      +   F+T  GER T+R+RL    ++L  +I +FD D      +  I ++DA
Sbjct  726  AVVTAPIYLLQHYFYTLMGERLTSRVRLSLFSAILSNEIGWFDLDENNTGSLTSILAADA  785

Query  573  ILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLAVVPLIAVAGGTYTLIMSNL  752
             LV+ A+ D++   ++ +S  +   A+ F   W++  V  +  PL+  A  T  L +   
Sbjct  786  TLVRSALADRLSTIVQNLSLTVTALAIAFYYSWRVAAVVTSCFPLLIAAALTEQLFLKGF  845

Query  753  SQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYSKSLN  881
                  AY+ A  VA EAI  +RTV SF  EK+  E ++  L+
Sbjct  846  GGDYTRAYSRATSVAREAIENIRTVASFGAEKQISEQFACELS  888



>ref|XP_009113724.1| PREDICTED: ABC transporter B family member 13 isoform X3 [Brassica 
rapa]
Length=1218

 Score =   353 bits (906),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 171/262 (65%), Positives = 208/262 (79%), Gaps = 2/262 (1%)
 Frame = +3

Query  111  MGELEISSNLKMDQQPSNSTDRKEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVF  290
            M   E SSN  +  +    + +K+ VS  GLF AAD +D F M+ G +GAC  GA LP+F
Sbjct  1    MDSTEPSSNGSIHTE--TDSKKKDSVSLMGLFGAADKLDCFLMILGGLGACTLGATLPLF  58

Query  291  FVLFGRMIDSLGHLSSDSHRLSSQVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTAR  470
            FV FG+M+DSLG+LS+D   LSS+VSK AL LVYLG + F+SAWIGVA WTQTGERQTAR
Sbjct  59   FVFFGKMLDSLGNLSTDPKSLSSRVSKNALDLVYLGLVTFLSAWIGVACWTQTGERQTAR  118

Query  471  LRLRYLQSVLRKKIEFFDTDTRAKDIIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFA  650
            LR++YL+++L K I FFDT+ R  ++IFHISSDAILVQDAIGDK GH +RY+SQF+ GF 
Sbjct  119  LRIKYLKAILAKDITFFDTEARDSNLIFHISSDAILVQDAIGDKTGHVLRYLSQFVAGFV  178

Query  651  VGFISVWKLTLVTLAVVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVY  830
            VGF+SVW+LTL+TLAVVPLIA+AGG Y +IMS +S+K EAAYA+AGKVAEE ISQVRTVY
Sbjct  179  VGFLSVWQLTLLTLAVVPLIAIAGGGYAIIMSTISEKSEAAYADAGKVAEEVISQVRTVY  238

Query  831  SFVGEKKAVESYSKSLNNALVL  896
            +FVGE+KAV SYS SL  AL L
Sbjct  239  AFVGEEKAVNSYSNSLKKALKL  260


 Score = 90.9 bits (224),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 62/223 (28%), Positives = 108/223 (48%), Gaps = 3/223 (1%)
 Frame = +3

Query  216  DTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLSSDSHRLSSQVSKQALYLVYL  395
            +  ++ + + GSIGA + GA  P+F +    ++ +    S     +   V K A+  V +
Sbjct  639  NAPEWPYALLGSIGAVLAGAQTPLFSMGIAYVLTAF--YSPSPSVIKRDVDKVAIVFVGI  696

Query  396  GSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKKIEFFDTDTRAKDIIFHI-SSDA  572
              +      +   F+T  GER T+R+RL    ++L  +I +FD D      +  I ++DA
Sbjct  697  AVVTAPIYLLQHYFYTLMGERLTSRVRLSLFSAILSNEIGWFDLDENNTGSLTSILAADA  756

Query  573  ILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLAVVPLIAVAGGTYTLIMSNL  752
             LV+ A+ D++   ++ +S  +   A+ F   W++  V  +  PL+  A  T  L +   
Sbjct  757  TLVRSALADRLSTIVQNLSLTVTALAIAFYYSWRVAAVVTSCFPLLIAAALTEQLFLKGF  816

Query  753  SQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYSKSLN  881
                  AY+ A  VA EAI  +RTV SF  EK+  E ++  L+
Sbjct  817  GGDYTRAYSRATSVAREAIENIRTVASFGAEKQISEQFACELS  859



>ref|XP_009113722.1| PREDICTED: ABC transporter B family member 13 isoform X1 [Brassica 
rapa]
 ref|XP_009113723.1| PREDICTED: ABC transporter B family member 13 isoform X2 [Brassica 
rapa]
Length=1247

 Score =   353 bits (906),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 171/262 (65%), Positives = 208/262 (79%), Gaps = 2/262 (1%)
 Frame = +3

Query  111  MGELEISSNLKMDQQPSNSTDRKEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVF  290
            M   E SSN  +  +    + +K+ VS  GLF AAD +D F M+ G +GAC  GA LP+F
Sbjct  1    MDSTEPSSNGSIHTE--TDSKKKDSVSLMGLFGAADKLDCFLMILGGLGACTLGATLPLF  58

Query  291  FVLFGRMIDSLGHLSSDSHRLSSQVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTAR  470
            FV FG+M+DSLG+LS+D   LSS+VSK AL LVYLG + F+SAWIGVA WTQTGERQTAR
Sbjct  59   FVFFGKMLDSLGNLSTDPKSLSSRVSKNALDLVYLGLVTFLSAWIGVACWTQTGERQTAR  118

Query  471  LRLRYLQSVLRKKIEFFDTDTRAKDIIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFA  650
            LR++YL+++L K I FFDT+ R  ++IFHISSDAILVQDAIGDK GH +RY+SQF+ GF 
Sbjct  119  LRIKYLKAILAKDITFFDTEARDSNLIFHISSDAILVQDAIGDKTGHVLRYLSQFVAGFV  178

Query  651  VGFISVWKLTLVTLAVVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVY  830
            VGF+SVW+LTL+TLAVVPLIA+AGG Y +IMS +S+K EAAYA+AGKVAEE ISQVRTVY
Sbjct  179  VGFLSVWQLTLLTLAVVPLIAIAGGGYAIIMSTISEKSEAAYADAGKVAEEVISQVRTVY  238

Query  831  SFVGEKKAVESYSKSLNNALVL  896
            +FVGE+KAV SYS SL  AL L
Sbjct  239  AFVGEEKAVNSYSNSLKKALKL  260


 Score = 91.3 bits (225),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 62/223 (28%), Positives = 108/223 (48%), Gaps = 3/223 (1%)
 Frame = +3

Query  216  DTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLSSDSHRLSSQVSKQALYLVYL  395
            +  ++ + + GSIGA + GA  P+F +    ++ +    S     +   V K A+  V +
Sbjct  668  NAPEWPYALLGSIGAVLAGAQTPLFSMGIAYVLTAF--YSPSPSVIKRDVDKVAIVFVGI  725

Query  396  GSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKKIEFFDTDTRAKDIIFHI-SSDA  572
              +      +   F+T  GER T+R+RL    ++L  +I +FD D      +  I ++DA
Sbjct  726  AVVTAPIYLLQHYFYTLMGERLTSRVRLSLFSAILSNEIGWFDLDENNTGSLTSILAADA  785

Query  573  ILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLAVVPLIAVAGGTYTLIMSNL  752
             LV+ A+ D++   ++ +S  +   A+ F   W++  V  +  PL+  A  T  L +   
Sbjct  786  TLVRSALADRLSTIVQNLSLTVTALAIAFYYSWRVAAVVTSCFPLLIAAALTEQLFLKGF  845

Query  753  SQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYSKSLN  881
                  AY+ A  VA EAI  +RTV SF  EK+  E ++  L+
Sbjct  846  GGDYTRAYSRATSVAREAIENIRTVASFGAEKQISEQFACELS  888



>ref|XP_002893495.1| P-glycoprotein 13 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH69754.1| P-glycoprotein 13 [Arabidopsis lyrata subsp. lyrata]
Length=1246

 Score =   352 bits (902),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 164/238 (69%), Positives = 199/238 (84%), Gaps = 0/238 (0%)
 Frame = +3

Query  186  VSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLSSDSHRLSSQV  365
            VS  GLFSAAD +DYF M+ G +GACIHGA LP+FFV FG+M+DSLG+LS+D   +SS+V
Sbjct  31   VSLMGLFSAADKLDYFLMLLGGLGACIHGATLPLFFVFFGKMLDSLGNLSTDPKAISSRV  90

Query  366  SKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKKIEFFDTDTRAKD  545
            S+ ALYLVYLG +  +SAWIGV+ W QTGERQTARLR+ YL+S+L K I FFDT+ R  +
Sbjct  91   SQNALYLVYLGLVNLVSAWIGVSCWMQTGERQTARLRINYLKSILAKDITFFDTEARDSN  150

Query  546  IIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLAVVPLIAVAGG  725
            +IFHISSDAILVQDAIGDK  H +RY+SQF+ GF +GF+SVW+LTL+TLAVVPLIAVAGG
Sbjct  151  LIFHISSDAILVQDAIGDKTDHVLRYLSQFIAGFVIGFLSVWQLTLLTLAVVPLIAVAGG  210

Query  726  TYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYSKSLNNALVLG  899
             Y +IMS +S+K E AYA+AGKVAEE +SQVRTVY+FVGE+KAV+SYS SL  AL LG
Sbjct  211  GYAIIMSTISEKSETAYADAGKVAEEVMSQVRTVYAFVGEEKAVKSYSNSLKKALKLG  268


 Score = 95.1 bits (235),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 68/233 (29%), Positives = 115/233 (49%), Gaps = 7/233 (3%)
 Frame = +3

Query  216  DTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLSSDSHRLSSQVSKQALYLVYL  395
            ++ ++ + + GSIGA + GA  P+F +    ++ +    S   + +   V K A+  V +
Sbjct  675  NSPEWPYALLGSIGAVLAGAQTPLFSMGIAYVLTAF--YSPFPNAIMRDVEKVAIIFVGV  732

Query  396  GSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKKIEFFDTDTRAKDIIFHI-SSDA  572
            G +      +   F+T  GER T+R+RL    ++L  +I +FD D      +  I ++DA
Sbjct  733  GIVTAPIYLLQHYFYTLMGERLTSRVRLSLFSAILSNEIGWFDLDENNTGSLTSILAADA  792

Query  573  ILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLAVVPLIAVAGGTYTLIMSNL  752
             LV+ A+ D++   ++ +S  +   A+ F   W++  V  A  PL+  A  T  L +   
Sbjct  793  TLVRSALADRLSTIVQNLSLTVTALALAFYYSWRVAAVVTACFPLLIAASLTEQLFLKGF  852

Query  753  SQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESY----SKSLNNALVLG  899
                  AY+ A  VA EAI+ +RTV +F  EK+  E +    SK   NA V G
Sbjct  853  GGDYTRAYSRATSVAREAIANIRTVAAFGAEKQIAEQFTCELSKPTKNAFVRG  905



>ref|NP_174115.1| ABC transporter B family member 13 [Arabidopsis thaliana]
 sp|Q9C7F8.1|AB13B_ARATH RecName: Full=ABC transporter B family member 13; Short=ABC transporter 
ABCB.13; Short=AtABCB13; AltName: Full=P-glycoprotein 
13; AltName: Full=Putative multidrug resistance protein 
15 [Arabidopsis thaliana]
 gb|AAG51482.1|AC069471_13 P-glycoprotein, putative [Arabidopsis thaliana]
 gb|AEE30893.1| ABC transporter B family member 13 [Arabidopsis thaliana]
Length=1245

 Score =   351 bits (901),  Expect = 8e-108, Method: Compositional matrix adjust.
 Identities = 162/238 (68%), Positives = 199/238 (84%), Gaps = 0/238 (0%)
 Frame = +3

Query  186  VSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLSSDSHRLSSQV  365
            VS  GLFSAAD +DYF M+ G +GACIHGA LP+FFV FG+M+DSLG+LS+D   +SS+V
Sbjct  30   VSLMGLFSAADKLDYFLMLLGGLGACIHGATLPLFFVFFGKMLDSLGNLSTDPKAISSRV  89

Query  366  SKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKKIEFFDTDTRAKD  545
            S+ ALYLVYLG + F+SAWIGV+ W QTGERQTARLR+ YL+S+L K I FFDT+ R  +
Sbjct  90   SQNALYLVYLGLVNFVSAWIGVSCWMQTGERQTARLRINYLKSILAKDITFFDTEARDSN  149

Query  546  IIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLAVVPLIAVAGG  725
            +IFHISSDAILVQDAIGDK  H +RY+SQF+ GF +GF+SVW+LTL+TL VVPLIA+AGG
Sbjct  150  LIFHISSDAILVQDAIGDKTDHVLRYLSQFIAGFVIGFLSVWQLTLLTLGVVPLIAIAGG  209

Query  726  TYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYSKSLNNALVLG  899
             Y ++MS +S+K E AYA+AGKVAEE +SQVRTVY+FVGE+KAV+SYS SL  AL LG
Sbjct  210  GYAIVMSTISEKSETAYADAGKVAEEVMSQVRTVYAFVGEEKAVKSYSNSLKKALKLG  267


 Score = 92.0 bits (227),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 66/233 (28%), Positives = 113/233 (48%), Gaps = 7/233 (3%)
 Frame = +3

Query  216  DTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLSSDSHRLSSQVSKQALYLVYL  395
            ++ ++ + + GSIGA + GA  P+F +    ++ +    S   + +   V K A+     
Sbjct  674  NSPEWPYALLGSIGAVLAGAQTPLFSMGIAYVLTAF--YSPFPNVIKRDVEKVAIIFAGA  731

Query  396  GSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKKIEFFDTDTRAKDIIFHI-SSDA  572
            G +      +   F+T  GER T+R+RL    ++L  +I +FD D      +  I ++DA
Sbjct  732  GIVTAPIYLLQHYFYTLMGERLTSRVRLSLFSAILSNEIGWFDLDENNTGSLTSILAADA  791

Query  573  ILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLAVVPLIAVAGGTYTLIMSNL  752
             LV+ A+ D++   ++ +S  +   A+ F   W++  V  A  PL+  A  T  L +   
Sbjct  792  TLVRSALADRLSTIVQNLSLTVTALALAFFYSWRVAAVVTACFPLLIAASLTEQLFLKGF  851

Query  753  SQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESY----SKSLNNALVLG  899
                  AY+ A  VA EAI+ +RTV ++  EK+  E +    SK   NA V G
Sbjct  852  GGDYTRAYSRATSVAREAIANIRTVAAYGAEKQISEQFTCELSKPTKNAFVRG  904



>ref|XP_006415715.1| hypothetical protein EUTSA_v10006582mg [Eutrema salsugineum]
 gb|ESQ34068.1| hypothetical protein EUTSA_v10006582mg [Eutrema salsugineum]
Length=1246

 Score =   350 bits (899),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 163/238 (68%), Positives = 199/238 (84%), Gaps = 0/238 (0%)
 Frame = +3

Query  186  VSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLSSDSHRLSSQV  365
            VS  GLFSAAD VD+F M  G +GACIHGA LP+FFV FG+M+DSLG+LS+D   +SS+V
Sbjct  31   VSLMGLFSAADKVDWFLMFLGGLGACIHGATLPLFFVFFGKMLDSLGNLSTDPKAISSRV  90

Query  366  SKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKKIEFFDTDTRAKD  545
            S+ ALYLVYLG +  +SAW+GVA W QTGERQTARLR+ YL+S+L K I FFDT+ R  +
Sbjct  91   SQNALYLVYLGLVNLVSAWMGVACWMQTGERQTARLRINYLKSILAKDITFFDTEARDSN  150

Query  546  IIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLAVVPLIAVAGG  725
            +IFHISSDAILVQDAIGDK  H +RY+SQF+ GF +GF+SVW+LTL+TLAVVPLIA+AGG
Sbjct  151  LIFHISSDAILVQDAIGDKTDHVLRYLSQFIAGFVIGFLSVWQLTLLTLAVVPLIAIAGG  210

Query  726  TYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYSKSLNNALVLG  899
             Y +IMS +S+K EAAY++AGKVAEEA+SQVRTVY+FVGE+KA+ SYS SL  AL LG
Sbjct  211  GYAIIMSTISEKSEAAYSDAGKVAEEAMSQVRTVYAFVGEEKAINSYSNSLKKALKLG  268


 Score = 91.7 bits (226),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 66/233 (28%), Positives = 114/233 (49%), Gaps = 7/233 (3%)
 Frame = +3

Query  216  DTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLSSDSHRLSSQVSKQALYLVYL  395
            +  ++ + + GSIGA + GA   +F +    ++ +    S   + +  +V K A+  V +
Sbjct  675  NAPEWPYALLGSIGAVLAGAQTSLFSMGIAYVLTAF--YSPFPNVIKREVEKVAIIYVVV  732

Query  396  GSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKKIEFFDTDTRAKDIIFHI-SSDA  572
            G +      +   F+T  GER T+R+RL     +L  +I +FD D      +  I ++DA
Sbjct  733  GILTAPVYLLQHYFYTLMGERLTSRVRLSLFSVILTNEIGWFDLDENNTGSLTTILAADA  792

Query  573  ILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLAVVPLIAVAGGTYTLIMSNL  752
             LV+ A+ D++   ++ +S  +   A+ F   W++  V  A  PL+  A  T  L +   
Sbjct  793  TLVRSALADRLSTIVQNLSLTITALAIAFFYSWRVAAVVTACFPLLIAASLTEQLFLKGF  852

Query  753  SQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESY----SKSLNNALVLG  899
                  AY++A  VA EAI+ +RTV +F  EK+  E +    SK   NA + G
Sbjct  853  GGDYTRAYSKATSVAREAIANIRTVAAFGAEKQVSEQFTCELSKPTKNAFLRG  905



>ref|XP_009113714.1| PREDICTED: ABC transporter B family member 14 [Brassica rapa]
Length=1232

 Score =   348 bits (892),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 163/238 (68%), Positives = 195/238 (82%), Gaps = 0/238 (0%)
 Frame = +3

Query  186  VSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLSSDSHRLSSQV  365
            VS  GLFSAAD VDY  M  G+ G C+HG  LP+FFV FG+M+DSLG+LS+DS  +SS+V
Sbjct  20   VSLMGLFSAADRVDYILMFLGTFGTCVHGGTLPLFFVFFGKMLDSLGNLSTDSTAISSRV  79

Query  366  SKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKKIEFFDTDTRAKD  545
            SK ALYLVYLG +  +SAW+GVA W QTGERQTARLR+ YL+S+L K I FFDT+ R  +
Sbjct  80   SKNALYLVYLGFVNLVSAWMGVACWMQTGERQTARLRINYLKSILAKDITFFDTEARDSN  139

Query  546  IIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLAVVPLIAVAGG  725
             IFHISSD ILVQDAIGDK GH +RY+ QF+ GF +GF+SVW+LTL+TLAVVPLIA+AGG
Sbjct  140  FIFHISSDTILVQDAIGDKTGHVLRYLCQFIAGFVIGFLSVWQLTLLTLAVVPLIAIAGG  199

Query  726  TYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYSKSLNNALVLG  899
             Y +IMS +S+K EAAYA+AGKVAEE +SQVRTVY++VGEKKAV SYSKSL  AL LG
Sbjct  200  GYAVIMSTISKKSEAAYADAGKVAEEVLSQVRTVYAYVGEKKAVNSYSKSLKKALKLG  257


 Score = 91.3 bits (225),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 71/260 (27%), Positives = 119/260 (46%), Gaps = 11/260 (4%)
 Frame = +3

Query  147  DQQPSNSTDRKEMV----SFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFVLFGRMI  314
            DQ+ +N  D  + +    S        +  ++ + + GSIGA + GA   +F      ++
Sbjct  634  DQEKTNEKDSNQEILSSSSMVWELIKLNVPEWSYALLGSIGAVLAGAQPALFSTGIAYVL  693

Query  315  DSLGHLSSDSHRLSSQVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARLRLRYLQS  494
            +     S     +   V K A+  V +G +  +   +   F+T  GER T+R+RL    +
Sbjct  694  NLF--YSPFPSVIKRDVEKVAIVFVGVGVVTPLIYLLQHYFYTLMGERLTSRVRLSLFSA  751

Query  495  VLRKKIEFFD-TDTRAKDIIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVW  671
            VL  ++ +FD  D     +   +++DA LV+ A+ D++   ++ +S      AV F   W
Sbjct  752  VLSNEVGWFDMEDNNTGSLTSILAADATLVRSALADRLSTIVQNLSLTFTALAVAFFYSW  811

Query  672  KLTLVTLAVVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKK  851
            ++  V  A  PL+  A  T  L +         AY++A  VA EAI  +RTV SF  EK 
Sbjct  812  RVAAVVTACFPLLIAASLTEQLFLKGFGGDYTRAYSKATSVAREAIENIRTVASFGAEKT  871

Query  852  AVESYS----KSLNNALVLG  899
              E ++    K   NA + G
Sbjct  872  ISEQFACELRKPTKNAFLRG  891



>gb|KFK44669.1| hypothetical protein AALP_AA1G288400 [Arabis alpina]
Length=1247

 Score =   348 bits (892),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 164/238 (69%), Positives = 197/238 (83%), Gaps = 0/238 (0%)
 Frame = +3

Query  186  VSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLSSDSHRLSSQV  365
            VS  GLFSAA+  DYF M  G +GACIHGA LP+FFV FG+M+DSLG+LS+D   +SS+V
Sbjct  31   VSLIGLFSAANKFDYFLMFLGGLGACIHGATLPLFFVFFGKMLDSLGNLSTDPKAISSRV  90

Query  366  SKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKKIEFFDTDTRAKD  545
            S+ ALYLVYLG    +SAWIGVA W QTGERQTA+LR+ YL+S+L K I FFDT+ R  +
Sbjct  91   SQNALYLVYLGLANLVSAWIGVACWMQTGERQTAQLRINYLKSILAKDITFFDTEARDSN  150

Query  546  IIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLAVVPLIAVAGG  725
            +IFHISSDAILVQDAIGDK  H +RY+SQF+ GF +GF+SVW+LTL+TLAVVPLIA+AGG
Sbjct  151  LIFHISSDAILVQDAIGDKTDHVLRYLSQFVAGFVIGFLSVWQLTLLTLAVVPLIAIAGG  210

Query  726  TYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYSKSLNNALVLG  899
             Y +IMS +S+K EAAYA+AGKVAEE +SQVRTVY+FVGE+KAVESYS SL  AL LG
Sbjct  211  GYAIIMSTISEKSEAAYADAGKVAEEVMSQVRTVYAFVGEEKAVESYSNSLKKALKLG  268


 Score = 92.8 bits (229),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 65/233 (28%), Positives = 114/233 (49%), Gaps = 7/233 (3%)
 Frame = +3

Query  216  DTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLSSDSHRLSSQVSKQALYLVYL  395
            +  ++ + + GSIGA + GA  P+F +    ++ +    S     +   V K A+  V  
Sbjct  675  NAPEWPYALLGSIGAVLAGAQTPMFSMGIAYVLTAF--YSPSPSLIKRDVEKVAIVFVGA  732

Query  396  GSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKKIEFFDTDTRAKDIIFHI-SSDA  572
            G +      +   F+T  GER T+R+RL    ++L  +I +FD D      +  I ++DA
Sbjct  733  GILTAPIYLLQHYFYTLMGERLTSRVRLSLFSAILSNEIGWFDLDENNTGSLTSILAADA  792

Query  573  ILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLAVVPLIAVAGGTYTLIMSNL  752
             LV+ A+ D++   ++ +S  +    + F   W++  V  A  PL+  A  T  L +   
Sbjct  793  TLVRSALADRLSTIVQNLSLTVTALVLAFYYSWRVAAVVTACFPLLIAASLTEQLFLKGF  852

Query  753  SQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYSKSLN----NALVLG  899
                  AY++A  VA EAI  +RTV +F  EK+ +E +++ L+    NA + G
Sbjct  853  GGDYTKAYSKATSVAREAIGNIRTVAAFGAEKQIMEQFTRELSKPTKNAFLRG  905



>ref|XP_010478144.1| PREDICTED: ABC transporter B family member 13 isoform X1 [Camelina 
sativa]
 ref|XP_010478146.1| PREDICTED: ABC transporter B family member 13 isoform X3 [Camelina 
sativa]
Length=1246

 Score =   347 bits (891),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 160/230 (70%), Positives = 196/230 (85%), Gaps = 0/230 (0%)
 Frame = +3

Query  186  VSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLSSDSHRLSSQV  365
            VS  GLFSAAD +DYF M+ G +GAC+HGA LP+FFVLFG+M+DSLG+LS+DS  +SS V
Sbjct  31   VSLMGLFSAADKLDYFLMLLGGLGACVHGATLPLFFVLFGKMLDSLGNLSADSKAISSHV  90

Query  366  SKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKKIEFFDTDTRAKD  545
            SK ALYLVYLG +  +SAWIGV+ W QTGERQTARLR+ YL+S+L K I FFDT+ R  +
Sbjct  91   SKNALYLVYLGLVNLVSAWIGVSCWMQTGERQTARLRINYLKSILAKDITFFDTEARDSN  150

Query  546  IIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLAVVPLIAVAGG  725
            +I+HISSDAILVQDAIGDK  H +RY+SQF+ GF +GF+SVW+LTL+TLAVVPLIA+AGG
Sbjct  151  LIYHISSDAILVQDAIGDKTDHVLRYLSQFIAGFVIGFLSVWQLTLLTLAVVPLIAIAGG  210

Query  726  TYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYSKS  875
             Y +IMS +S+K EAAYA+AGKVAEE +SQVRTVY+FVGE+KAV+SYS S
Sbjct  211  GYAIIMSTISEKSEAAYADAGKVAEEVMSQVRTVYAFVGEEKAVKSYSTS  260


 Score = 95.5 bits (236),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 68/233 (29%), Positives = 114/233 (49%), Gaps = 7/233 (3%)
 Frame = +3

Query  216  DTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLSSDSHRLSSQVSKQALYLVYL  395
            +  ++ + + GSIGA + GA  P+F +    ++ +    S   + +   + K A+  V  
Sbjct  675  NAPEWPYALLGSIGAVLAGAQTPLFSMGIAYVLTAF--YSPHPNVIKRDIDKVAIVFVVA  732

Query  396  GSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKKIEFFDTDTRAKDIIFHI-SSDA  572
            G +      +   F+T  GER TAR+RL    ++L  +I +FD D      +  I ++DA
Sbjct  733  GIVTAPIYLLQHYFYTLMGERLTARVRLSLFSAILSNEIGWFDLDENNTGSLTSILAADA  792

Query  573  ILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLAVVPLIAVAGGTYTLIMSNL  752
             LV+ A+ D++   ++ +S  +   A+ F   W++  V  A  PL+  A  T  L +   
Sbjct  793  TLVRSALADRLSTIVQNLSLTVTALALAFYYSWRVAAVVTACFPLLIAASLTEQLFLKGF  852

Query  753  SQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESY----SKSLNNALVLG  899
                  AY++A  VA EAI+ +RTV +F  EK+  E +    SK   NA V G
Sbjct  853  GGDYTRAYSKATSVAREAIANIRTVAAFGVEKQISEQFTSELSKPTKNAFVRG  905



>ref|XP_010266821.1| PREDICTED: ABC transporter B family member 13-like [Nelumbo nucifera]
Length=1248

 Score =   347 bits (891),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 167/269 (62%), Positives = 209/269 (78%), Gaps = 6/269 (2%)
 Frame = +3

Query  111  MGELEISSNLKMDQQPSNSTDRK------EMVSFFGLFSAADTVDYFFMVFGSIGACIHG  272
            M E+EI S + ++  P   TD +        VS FGLF+ ADT DYF M   +IG+ IHG
Sbjct  1    MEEVEIPSIVVLNGNPQQKTDTEFSSSTNPKVSLFGLFAFADTFDYFLMFLATIGSIIHG  60

Query  273  AALPVFFVLFGRMIDSLGHLSSDSHRLSSQVSKQALYLVYLGSIIFISAWIGVAFWTQTG  452
            AALP+FFV FGR+I+SL  ++ D HRL+S++S++AL+ VYLG ++F SAW+G+AFW QTG
Sbjct  61   AALPLFFVFFGRLINSLDSIAKDPHRLTSEISQEALHFVYLGVLVFASAWMGIAFWMQTG  120

Query  453  ERQTARLRLRYLQSVLRKKIEFFDTDTRAKDIIFHISSDAILVQDAIGDKIGHTIRYISQ  632
            ERQ A LRL+YLQSVL++ I+FFD + R ++IIF ISSDAILVQDAIGDK GH +RY++Q
Sbjct  121  ERQAACLRLKYLQSVLKRDIDFFDREARDENIIFCISSDAILVQDAIGDKTGHALRYLAQ  180

Query  633  FLVGFAVGFISVWKLTLVTLAVVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAIS  812
            F VG  +GF +VW+L+LV LAVVPLI +AGG Y +IMS LS+KGEAAYAEAGK AEE IS
Sbjct  181  FCVGIVIGFTTVWQLSLVILAVVPLIVIAGGGYAIIMSTLSRKGEAAYAEAGKDAEEIIS  240

Query  813  QVRTVYSFVGEKKAVESYSKSLNNALVLG  899
            QVRTVYSFVGE KA+E YS+SL  AL LG
Sbjct  241  QVRTVYSFVGEDKAIEKYSRSLTKALNLG  269


 Score = 84.7 bits (208),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 56/225 (25%), Positives = 108/225 (48%), Gaps = 3/225 (1%)
 Frame = +3

Query  216  DTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLSSDSHRLSSQVSKQALYLVYL  395
            +  ++ + + GS+GA + G   P+F      M+    + S D   +  +V +  L ++ +
Sbjct  674  NAPEWPYALLGSVGAVLAGMEAPLFAFGITHMLAV--YTSDDDLHIKHEVRRVCLIMIGV  731

Query  396  GSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKKIEFFDTDTRAK-DIIFHISSDA  572
            G+I      +   F+T  GE+ T+R+R     ++LR +I +FD D  +   +   ++ DA
Sbjct  732  GAITVPIYLLQHYFYTLMGEQITSRIRFLMFSAILRNEIGWFDLDENSTGSLTTSLAVDA  791

Query  573  ILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLAVVPLIAVAGGTYTLIMSNL  752
             LV+ AI D++   ++ ++  +  FA+ F   W+L  V +A  P +  +     L +   
Sbjct  792  TLVRAAIADRLSTILQNVALTVTAFAISFTLSWRLAAVMVATYPFLISSSLAEQLFLRGF  851

Query  753  SQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYSKSLNNA  887
                  AY++   V  EAI+ +RTV +F  E   V  +   L+ +
Sbjct  852  GGDYNRAYSQDIVVVREAITNIRTVAAFGAEDHVVRQFIHELSQS  896



>ref|XP_010460561.1| PREDICTED: ABC transporter B family member 13-like isoform X1 
[Camelina sativa]
Length=1248

 Score =   347 bits (890),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 160/230 (70%), Positives = 195/230 (85%), Gaps = 0/230 (0%)
 Frame = +3

Query  186  VSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLSSDSHRLSSQV  365
            VS  GLFSAAD +DYF M+ G +GAC+HGA LP+FFV FG+M+DSLG+LS+DS  +SS V
Sbjct  33   VSLMGLFSAADKLDYFLMLLGGLGACVHGATLPLFFVFFGKMLDSLGNLSTDSKAISSHV  92

Query  366  SKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKKIEFFDTDTRAKD  545
            SK ALYLVYLG +  +SAWIGVA W QTGERQTARLR+ YL+S+L K I FFDT+ R  +
Sbjct  93   SKNALYLVYLGLVNLVSAWIGVACWMQTGERQTARLRINYLKSILAKDITFFDTEARDSN  152

Query  546  IIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLAVVPLIAVAGG  725
            +I+HISSDAILVQDAIGDK  H +RY+SQF+ GF +GF+SVW+LTL+TLAVVPLIA+AGG
Sbjct  153  LIYHISSDAILVQDAIGDKTDHVLRYLSQFIAGFVIGFLSVWQLTLLTLAVVPLIAIAGG  212

Query  726  TYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYSKS  875
             Y +IMS +S+K EAAYA+AGKVAEE +SQVRTVY+FVGE+KAV+SYS S
Sbjct  213  GYAIIMSTISEKSEAAYADAGKVAEEVMSQVRTVYAFVGEEKAVKSYSTS  262


 Score = 95.1 bits (235),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 68/233 (29%), Positives = 114/233 (49%), Gaps = 7/233 (3%)
 Frame = +3

Query  216  DTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLSSDSHRLSSQVSKQALYLVYL  395
            +  ++ + + GSIGA + GA  P+F +    ++ +    S   + +   + K A+  V  
Sbjct  677  NAPEWPYALLGSIGAVLAGAQTPLFSMGIAYVLTAF--YSPHPNVIKRDIEKVAIIFVVA  734

Query  396  GSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKKIEFFDTDTRAKDIIFHI-SSDA  572
            G +      +   F+T  GER TAR+RL    ++L  +I +FD D      +  I ++DA
Sbjct  735  GIVTAPIYLLQHYFYTLMGERLTARVRLSLFSAILSNEIGWFDLDENNTGSLTSILAADA  794

Query  573  ILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLAVVPLIAVAGGTYTLIMSNL  752
             LV+ A+ D++   ++ +S  +   A+ F   W++  V  A  PL+  A  T  L +   
Sbjct  795  TLVRSALADRLSTIVQNLSLTVTALALAFYYSWRVAAVVTACFPLLIAASLTEQLFLKGF  854

Query  753  SQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESY----SKSLNNALVLG  899
                  AY++A  VA EAI+ +RTV +F  EK+  E +    SK   NA V G
Sbjct  855  GGDYTRAYSKATSVAREAIANIRTVAAFGVEKQISEQFTSELSKPTKNAFVRG  907



>ref|XP_010499285.1| PREDICTED: ABC transporter B family member 13-like isoform X1 
[Camelina sativa]
Length=1245

 Score =   345 bits (884),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 159/230 (69%), Positives = 195/230 (85%), Gaps = 0/230 (0%)
 Frame = +3

Query  186  VSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLSSDSHRLSSQV  365
            VS  GLFSA+D +DYF M+ G +GAC+HGA LP+FFV FG+M+DSLG+LS+DS  +SS V
Sbjct  30   VSLMGLFSASDKLDYFLMLLGGLGACVHGATLPLFFVFFGKMLDSLGNLSTDSKAISSHV  89

Query  366  SKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKKIEFFDTDTRAKD  545
            SK ALYLVYLG +  +SAWIGV+ W QTGERQTARLR+ YL+SVL K I FFDT+ R  +
Sbjct  90   SKNALYLVYLGLVNLVSAWIGVSCWMQTGERQTARLRINYLKSVLAKDITFFDTEARDSN  149

Query  546  IIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLAVVPLIAVAGG  725
            +I+HISSDAILVQDAIGDK  H +RY+SQF+ GF +GF+SVW+LTL+TLAVVPLIA++GG
Sbjct  150  LIYHISSDAILVQDAIGDKTDHVLRYLSQFIAGFVIGFLSVWQLTLLTLAVVPLIAISGG  209

Query  726  TYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYSKS  875
             Y +IMS LS+K EAAYA+AGKVAEE +SQVRTVY+FVGE+KAV+SYS S
Sbjct  210  GYAIIMSTLSEKSEAAYADAGKVAEEVMSQVRTVYAFVGEEKAVKSYSTS  259


 Score = 92.0 bits (227),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 65/233 (28%), Positives = 113/233 (48%), Gaps = 7/233 (3%)
 Frame = +3

Query  216  DTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLSSDSHRLSSQVSKQALYLVYL  395
            +  ++ + + GS+GA + GA  P+F +    ++ +    S   + +   + K A+  V  
Sbjct  674  NAPEWPYALLGSVGAVLAGAQTPLFSMGIAYVLTAF--YSPHPNVIKRDIEKVAIIFVVA  731

Query  396  GSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKKIEFFDTDTRAKDIIFHI-SSDA  572
            G +      +   F+T  GER TAR+RL    ++L  +I +FD D      +  I ++DA
Sbjct  732  GIVTAPIYLLQHYFYTLMGERLTARVRLSLFSAILSNEIGWFDLDENNTGSLTSILAADA  791

Query  573  ILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLAVVPLIAVAGGTYTLIMSNL  752
             LV+ A+ D++   ++ +S  +   A+ F   W++  V  A  PL+  A  T  L +   
Sbjct  792  TLVRSALADRLSTIVQNLSLTVTALALAFYYSWRVAAVVTACFPLLIAASLTEQLFLKGF  851

Query  753  SQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESY----SKSLNNALVLG  899
                   Y+++  VA EAI+ +RTV +F  EK+  E +    SK   NA V G
Sbjct  852  GGDYTRTYSKSTSVAREAIANIRTVAAFGIEKQISEQFTSELSKPTKNAFVRG  904



>ref|NP_174122.1| ABC transporter B family member 14 [Arabidopsis thaliana]
 sp|Q9C7F2.1|AB14B_ARATH RecName: Full=ABC transporter B family member 14; Short=ABC transporter 
ABCB.14; Short=AtABCB14; AltName: Full=Multidrug 
resistance protein 12; AltName: Full=P-glycoprotein 14 [Arabidopsis 
thaliana]
 gb|AAG51476.1|AC069471_7 P-glycoprotein, putative [Arabidopsis thaliana]
 gb|AEE30902.1| ABC transporter B family member 14 [Arabidopsis thaliana]
Length=1247

 Score =   345 bits (884),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 161/237 (68%), Positives = 193/237 (81%), Gaps = 0/237 (0%)
 Frame = +3

Query  186  VSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLSSDSHRLSSQV  365
            VS  GLFSAAD VDYF M  G +G CIHG  LP+FFV FG M+DSLG LS+D + +SS+V
Sbjct  31   VSLMGLFSAADNVDYFLMFLGGLGTCIHGGTLPLFFVFFGGMLDSLGKLSTDPNAISSRV  90

Query  366  SKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKKIEFFDTDTRAKD  545
            S+ ALYLVYLG +  +SAWIGVA W QTGERQTARLR+ YL+S+L K I FFDT+ R  +
Sbjct  91   SQNALYLVYLGLVNLVSAWIGVACWMQTGERQTARLRINYLKSILAKDITFFDTEARDSN  150

Query  546  IIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLAVVPLIAVAGG  725
             IFHISSDAILVQDAIGDK GH +RY+ QF+ GF +GF+SVW+LTL+TL VVPLIA+AGG
Sbjct  151  FIFHISSDAILVQDAIGDKTGHVLRYLCQFIAGFVIGFLSVWQLTLLTLGVVPLIAIAGG  210

Query  726  TYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYSKSLNNALVL  896
             Y ++MS +S+K EAAYA+AGKVAEE +SQVRTVY+FVGE+KAV+SYS SL  AL L
Sbjct  211  GYAIVMSTISEKSEAAYADAGKVAEEVMSQVRTVYAFVGEEKAVKSYSNSLKKALKL  267


 Score = 90.1 bits (222),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 70/241 (29%), Positives = 115/241 (48%), Gaps = 23/241 (10%)
 Frame = +3

Query  216  DTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLSSDSHRLSSQVSKQALYLVYL  395
            +  ++ + + GSIGA + G+   +F +    ++ +    S     +  +V K A      
Sbjct  676  NAPEWLYALLGSIGAVLAGSQPALFSMGLAYVLTTF--YSPFPSLIKREVDKVA------  727

Query  396  GSIIFISAWIGVA--------FWTQTGERQTARLRLRYLQSVLRKKIEFFDTDTRAKDII  551
              IIF+ A I  A        F+T  GER T+R+RL    ++L  +I +FD D      +
Sbjct  728  --IIFVGAGIVTAPIYILQHYFYTLMGERLTSRVRLSLFSAILSNEIGWFDLDENNTGSL  785

Query  552  FHI-SSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLAVVPLIAVAGGT  728
              I ++DA LV+ AI D++   ++ +S  +   A+ F   W++  V  A  PL+  A  T
Sbjct  786  TSILAADATLVRSAIADRLSTIVQNLSLTITALALAFFYSWRVAAVVTACFPLLIAASLT  845

Query  729  YTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESY----SKSLNNALVL  896
              L +         AY+ A  +A EAIS +RTV +F  EK+  E +    SK   +AL+ 
Sbjct  846  EQLFLKGFGGDYTRAYSRATSLAREAISNIRTVAAFSAEKQISEQFTCELSKPTKSALLR  905

Query  897  G  899
            G
Sbjct  906  G  906



>gb|AES59767.2| ABC transporter B family protein [Medicago truncatula]
Length=1241

 Score =   344 bits (882),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 179/265 (68%), Positives = 211/265 (80%), Gaps = 4/265 (2%)
 Frame = +3

Query  117  ELEISSNLKMDQQPSNSTDRK----EMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALP  284
            EL   S+L+  +     T +K    E VSFFGLF AAD  DY  M  GS+G+ +HGAALP
Sbjct  5    ELACESSLECKKTKEEGTSKKQSKVESVSFFGLFGAADRTDYVLMFLGSVGSFVHGAALP  64

Query  285  VFFVLFGRMIDSLGHLSSDSHRLSSQVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQT  464
            V FVLFGRMIDSLGHLSS+ H+ SSQ+S+ ALYLVYLG ++ +SAW+GVAFWTQTGERQT
Sbjct  65   VSFVLFGRMIDSLGHLSSNPHKFSSQISQHALYLVYLGVVVLVSAWMGVAFWTQTGERQT  124

Query  465  ARLRLRYLQSVLRKKIEFFDTDTRAKDIIFHISSDAILVQDAIGDKIGHTIRYISQFLVG  644
            A +RLRYLQSVL+K I FFD + +  +II HISSDAILVQDAIGDK GH IRY+SQF+VG
Sbjct  125  AWIRLRYLQSVLKKDIRFFDNEAKDANIISHISSDAILVQDAIGDKTGHAIRYLSQFIVG  184

Query  645  FAVGFISVWKLTLVTLAVVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRT  824
            F +G  SVW+LTL+TLAVVP IA+AG TY  I+S LS+KG+AAYAEA KVAEE IS+VRT
Sbjct  185  FGIGLTSVWQLTLLTLAVVPFIAIAGRTYLTIISTLSEKGKAAYAEAEKVAEEVISRVRT  244

Query  825  VYSFVGEKKAVESYSKSLNNALVLG  899
            VYSF GE+KAV SYSKSL+ AL LG
Sbjct  245  VYSFAGEEKAVGSYSKSLDKALKLG  269


 Score = 92.4 bits (228),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 64/258 (25%), Positives = 125/258 (48%), Gaps = 8/258 (3%)
 Frame = +3

Query  123  EISSNLKMDQQPSN----STDRKEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVF  290
            EI +NL  ++  S+    +++   + S  GL    +  ++ + + GS+GA + G   P+F
Sbjct  630  EIPNNLNNEEVQSSDQGLTSNTASVPSILGLLKL-NAPEWPYAILGSVGAVLAGMEAPLF  688

Query  291  FVLFGRMIDSLGHLSSDSHRLSSQVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTAR  470
             +    ++ +    S+ S ++  +V   A+  V L  +      +   F++  G+R TAR
Sbjct  689  AIGITHILATF--YSAQSPKIKHEVDHVAVIFVVLAVVTIPIYLLKHYFYSLMGDRLTAR  746

Query  471  LRLRYLQSVLRKKIEFFD-TDTRAKDIIFHISSDAILVQDAIGDKIGHTIRYISQFLVGF  647
            +RL    ++L  ++ +FD  +     +    ++DA LV+ A+ D++   ++ I+  +  F
Sbjct  747  VRLLMFSAILTNEVAWFDINENNTSSLTATQAADATLVRSALADRLSTLVQNIALTVTAF  806

Query  648  AVGFISVWKLTLVTLAVVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTV  827
             + F   WKLTLV  A +P +  A  T  L +         AY++A  +A +AI  +R V
Sbjct  807  VIAFTMSWKLTLVVAACLPFLIGAYITEQLFLKGFGGDYSHAYSKANSLARDAIVNIRIV  866

Query  828  YSFVGEKKAVESYSKSLN  881
             +F  E +    ++  LN
Sbjct  867  TAFSAEDRMSTQFAYELN  884



>ref|XP_003589516.1| ABC transporter B family member [Medicago truncatula]
Length=1286

 Score =   343 bits (881),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 179/265 (68%), Positives = 211/265 (80%), Gaps = 4/265 (2%)
 Frame = +3

Query  117  ELEISSNLKMDQQPSNSTDRK----EMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALP  284
            EL   S+L+  +     T +K    E VSFFGLF AAD  DY  M  GS+G+ +HGAALP
Sbjct  5    ELACESSLECKKTKEEGTSKKQSKVESVSFFGLFGAADRTDYVLMFLGSVGSFVHGAALP  64

Query  285  VFFVLFGRMIDSLGHLSSDSHRLSSQVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQT  464
            V FVLFGRMIDSLGHLSS+ H+ SSQ+S+ ALYLVYLG ++ +SAW+GVAFWTQTGERQT
Sbjct  65   VSFVLFGRMIDSLGHLSSNPHKFSSQISQHALYLVYLGVVVLVSAWMGVAFWTQTGERQT  124

Query  465  ARLRLRYLQSVLRKKIEFFDTDTRAKDIIFHISSDAILVQDAIGDKIGHTIRYISQFLVG  644
            A +RLRYLQSVL+K I FFD + +  +II HISSDAILVQDAIGDK GH IRY+SQF+VG
Sbjct  125  AWIRLRYLQSVLKKDIRFFDNEAKDANIISHISSDAILVQDAIGDKTGHAIRYLSQFIVG  184

Query  645  FAVGFISVWKLTLVTLAVVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRT  824
            F +G  SVW+LTL+TLAVVP IA+AG TY  I+S LS+KG+AAYAEA KVAEE IS+VRT
Sbjct  185  FGIGLTSVWQLTLLTLAVVPFIAIAGRTYLTIISTLSEKGKAAYAEAEKVAEEVISRVRT  244

Query  825  VYSFVGEKKAVESYSKSLNNALVLG  899
            VYSF GE+KAV SYSKSL+ AL LG
Sbjct  245  VYSFAGEEKAVGSYSKSLDKALKLG  269


 Score = 73.6 bits (179),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 66/303 (22%), Positives = 128/303 (42%), Gaps = 53/303 (17%)
 Frame = +3

Query  123  EISSNLKMDQQPSN----STDRKEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVF  290
            EI +NL  ++  S+    +++   + S  GL    +  ++ + + GS+GA + G   P+F
Sbjct  630  EIPNNLNNEEVQSSDQGLTSNTASVPSILGLLKL-NAPEWPYAILGSVGAVLAGMEAPLF  688

Query  291  FVLFGRMIDSLGHLSSDSHRLSSQVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTAR  470
             +    ++ +    S+ S ++  +V   A+  V L  +      +   F++  G+R TAR
Sbjct  689  AIGITHILATF--YSAQSPKIKHEVDHVAVIFVVLAVVTIPIYLLKHYFYSLMGDRLTAR  746

Query  471  LRL-----------------------RYLQS----------------------VLRKKIE  515
            +RL                       R+L +                      +L  ++ 
Sbjct  747  VRLLMFSGIPKQQNLQYSHTFRTNHLRFLSTSFGMFLIYFCITKSLYLIWHAAILTNEVA  806

Query  516  FFD-TDTRAKDIIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTL  692
            +FD  +     +    ++DA LV+ A+ D++   ++ I+  +  F + F   WKLTLV  
Sbjct  807  WFDINENNTSSLTATQAADATLVRSALADRLSTLVQNIALTVTAFVIAFTMSWKLTLVVA  866

Query  693  AVVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYSK  872
            A +P +  A  T  L +         AY++A  +A +AI  +R V +F  E +    ++ 
Sbjct  867  ACLPFLIGAYITEQLFLKGFGGDYSHAYSKANSLARDAIVNIRIVTAFSAEDRMSTQFAY  926

Query  873  SLN  881
             LN
Sbjct  927  ELN  929



>ref|XP_002890755.1| P-glycoprotein 14 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH67014.1| P-glycoprotein 14 [Arabidopsis lyrata subsp. lyrata]
Length=1248

 Score =   341 bits (874),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 159/237 (67%), Positives = 192/237 (81%), Gaps = 0/237 (0%)
 Frame = +3

Query  186  VSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLSSDSHRLSSQV  365
            VS  GLFSAAD VD F M  G +G CIHG  LP+FFV FG M+DSLG+ S+D + +SS+V
Sbjct  31   VSLMGLFSAADNVDCFLMFLGGLGTCIHGGTLPLFFVFFGGMLDSLGNFSTDPNAISSRV  90

Query  366  SKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKKIEFFDTDTRAKD  545
            S+ ALYLVYLG +  +SAWIGVA W QTGERQTARLR+ YL+S+L K I FFDT+ R  +
Sbjct  91   SQNALYLVYLGLVNLVSAWIGVACWMQTGERQTARLRINYLKSILAKDISFFDTEARDSN  150

Query  546  IIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLAVVPLIAVAGG  725
             IFHISSDAILVQDAIGDK GH +RY+ QF+ GF +GF+SVW+LTL+TL VVPLIA+AGG
Sbjct  151  FIFHISSDAILVQDAIGDKTGHVLRYLCQFIAGFVIGFLSVWQLTLLTLGVVPLIAIAGG  210

Query  726  TYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYSKSLNNALVL  896
             Y ++MS +S+K EAAYA+AGKVAEE +SQVRTVY+FVGE+KAV+SYS SL  AL L
Sbjct  211  GYAIVMSTISEKSEAAYADAGKVAEEVMSQVRTVYAFVGEEKAVKSYSNSLKKALKL  267


 Score = 89.7 bits (221),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 66/233 (28%), Positives = 113/233 (48%), Gaps = 7/233 (3%)
 Frame = +3

Query  216  DTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLSSDSHRLSSQVSKQALYLVYL  395
            +  ++ + + GSIGA + G+   +F +    ++ +    S     +  +V K A+  V  
Sbjct  677  NAPEWLYALLGSIGAVLAGSQPALFSMGLAYVLTTF--YSPFPSLIKREVDKVAIIFVGA  734

Query  396  GSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKKIEFFDTDTRAKDIIFHI-SSDA  572
            G +      +   F+T  GER T+R+RL    ++L  +I +FD D      +  I ++DA
Sbjct  735  GIVTAPIYLLQHYFYTLMGERLTSRVRLSLFSAILSNEIGWFDLDENNTGSLTSILAADA  794

Query  573  ILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLAVVPLIAVAGGTYTLIMSNL  752
             LV+ AI D++   ++ +S  +   A+ F   W++  V  A  PL+  A  T  L +   
Sbjct  795  TLVRSAIADRLSTIVQNLSLTITALALAFYYSWRVAAVVTACFPLLIAASLTEQLFLKGF  854

Query  753  SQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESY----SKSLNNALVLG  899
                  AYA A  +A EAI+ +RTV +F  EK+  E +    SK   +AL+ G
Sbjct  855  GGDYTRAYARATSLAREAITNIRTVAAFGAEKQISEQFTCELSKPTKSALLRG  907



>ref|XP_010527726.1| PREDICTED: LOW QUALITY PROTEIN: ABC transporter B family member 
13-like [Tarenaya hassleriana]
Length=1268

 Score =   341 bits (874),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 167/264 (63%), Positives = 205/264 (78%), Gaps = 6/264 (2%)
 Frame = +3

Query  108  SMGELEISSNLKMDQQPSNSTDRKEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPV  287
            S  E+E++      ++  NST      S FGLF AAD +DY  M FGS+GA IHGA LPV
Sbjct  17   SENEIEMNKEKDKRKKKKNST------SLFGLFGAADKLDYVLMFFGSLGAAIHGATLPV  70

Query  288  FFVLFGRMIDSLGHLSSDSHRLSSQVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTA  467
            FF+LFGRM+D+LG L ++   +SS+VS+ AL  VYLG    +S+W+GVA W QTGERQTA
Sbjct  71   FFILFGRMLDALGTLYANPGSMSSRVSQTALNAVYLGLANLVSSWVGVACWMQTGERQTA  130

Query  468  RLRLRYLQSVLRKKIEFFDTDTRAKDIIFHISSDAILVQDAIGDKIGHTIRYISQFLVGF  647
            RLR+ YL S+LR+ I FFDT+ R  ++IFHISSDAILVQDAIGDK GH +RY+ QFLVGF
Sbjct  131  RLRINYLNSILRRDIAFFDTEVRDSNLIFHISSDAILVQDAIGDKTGHALRYLFQFLVGF  190

Query  648  AVGFISVWKLTLVTLAVVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTV  827
            A+GF SVW++TL+TLAVVPLIA+AGG+Y +IMS +S+K EAAYA+ GKVAEE ISQVRTV
Sbjct  191  AIGFFSVWQITLLTLAVVPLIAIAGGSYAIIMSTISEKSEAAYADGGKVAEEVISQVRTV  250

Query  828  YSFVGEKKAVESYSKSLNNALVLG  899
            Y+FVGE+ AVESYS SL  AL LG
Sbjct  251  YAFVGEENAVESYSNSLKKALKLG  274


 Score = 84.0 bits (206),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 58/223 (26%), Positives = 106/223 (48%), Gaps = 3/223 (1%)
 Frame = +3

Query  216  DTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLSSDSHRLSSQVSKQALYLVYL  395
            +  ++ + + GSIGA   GA  P+F +  G         S   H +   V + A   + +
Sbjct  686  NAPEWPYALLGSIGAVFTGAQTPLFSM--GITYALTAFYSPFPHVIKHDVERVAFIFIGM  743

Query  396  GSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKKIEFFDTDTRAKDIIFHI-SSDA  572
            G +      +   F+T  GER TAR+RL    ++L  +I +FD D      +  I ++DA
Sbjct  744  GFLAVPIYLLHHYFYTLMGERLTARVRLSLFSAILSNEIGWFDLDENNTGSLTSILAADA  803

Query  573  ILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLAVVPLIAVAGGTYTLIMSNL  752
             LV+  + +++   ++ +S  +  F + FI  W++  V  A  PLI ++     + +   
Sbjct  804  TLVRSCLAERLSTIVQNLSLTITAFVLAFIYNWRVAAVVTACFPLIILSFVAEQMFLKGF  863

Query  753  SQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYSKSLN  881
                  AY+ A  VA EA++ +RTV +F  +K+    ++  L+
Sbjct  864  GGDYTTAYSRATTVAREAVTNIRTVAAFGADKQISTQFTYELS  906



>ref|XP_010501626.1| PREDICTED: ABC transporter B family member 14-like [Camelina 
sativa]
Length=1233

 Score =   338 bits (866),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 160/237 (68%), Positives = 191/237 (81%), Gaps = 0/237 (0%)
 Frame = +3

Query  186  VSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLSSDSHRLSSQV  365
            VS  GLF AAD VD F M  G +G CIHG  LP+FFV FG M+DSLG LS+D   +SS+V
Sbjct  12   VSLMGLFGAADHVDCFLMFLGGLGTCIHGGTLPLFFVFFGGMLDSLGSLSTDPKAISSRV  71

Query  366  SKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKKIEFFDTDTRAKD  545
            S+ ALYLVYLG    +SAWIGVA W QTGERQTARLR+ YL+S+L K I FFDT+TR  +
Sbjct  72   SQNALYLVYLGLFNLVSAWIGVACWMQTGERQTARLRINYLKSILAKDITFFDTETRDSN  131

Query  546  IIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLAVVPLIAVAGG  725
             IFHISSDAILVQDAIGDKIGH +RY+ QF+ GF +GF+SVW+LTL+TL VVPLIAVAGG
Sbjct  132  FIFHISSDAILVQDAIGDKIGHVLRYLCQFIAGFVIGFLSVWQLTLLTLGVVPLIAVAGG  191

Query  726  TYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYSKSLNNALVL  896
             Y ++MS +S+K EAAYA+AGKVAEE +SQVRTVY+FVGE+KAV++Y+ SL  AL L
Sbjct  192  GYAIVMSTISEKSEAAYADAGKVAEEVMSQVRTVYAFVGEEKAVKTYASSLKKALKL  248


 Score = 87.4 bits (215),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 69/233 (30%), Positives = 110/233 (47%), Gaps = 7/233 (3%)
 Frame = +3

Query  216  DTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLSSDSHRLSSQVSKQALYLVYL  395
            +  ++ + + GSIGA + G+ LP  F + G         S     +  +V K  +  V  
Sbjct  656  NAPEWLYALLGSIGAVLAGS-LPALFSM-GIAYVLTTFYSPFPSLIKREVEKVIIIFVGT  713

Query  396  GSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKKIEFFDTDTRAKDIIFHI-SSDA  572
            G +      +   F+T  GER T+R+RL    +++  +I +FD D      +  I S+DA
Sbjct  714  GIVTTPIYLLQHYFYTLMGERLTSRVRLSLFSAIILNEIGWFDLDENNTGSLTSILSADA  773

Query  573  ILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLAVVPLIAVAGGTYTLIMSNL  752
             LV+ AI D++   ++ IS  +   A+ F   W++  V  A  PL+  A  T  L +   
Sbjct  774  TLVRSAIADRLSTIVQNISLTVTALALAFFYSWRVAAVVTACFPLLIAASLTEQLFLKGF  833

Query  753  SQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESY----SKSLNNALVLG  899
                  AY+ A  +A EAI  +RTV +F  EK+  E +    SK   NAL+ G
Sbjct  834  GGDYTRAYSRATSLAREAIVNIRTVAAFGAEKQISEQFTCELSKPTKNALLKG  886



>ref|XP_006306598.1| hypothetical protein CARUB_v10008102mg [Capsella rubella]
 gb|EOA39496.1| hypothetical protein CARUB_v10008102mg [Capsella rubella]
Length=1277

 Score =   338 bits (867),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 165/269 (61%), Positives = 201/269 (75%), Gaps = 31/269 (12%)
 Frame = +3

Query  186  VSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLSSDSHRLSSQV  365
            VS  GLFSAAD +DYF M+ G +GACIHGA LP+FFV FG+M+DSLG+LS+D   +SS+V
Sbjct  31   VSLMGLFSAADKLDYFLMLLGGLGACIHGATLPLFFVFFGKMLDSLGNLSTDPKTISSRV  90

Query  366  S-------------------------------KQALYLVYLGSIIFISAWIGVAFWTQTG  452
            S                               K ALYLVYLG +  +SAWIGV+ W QTG
Sbjct  91   SQVSLKPAINGNILFLSIDFVVITFHGVLSFFKNALYLVYLGLVNLVSAWIGVSCWMQTG  150

Query  453  ERQTARLRLRYLQSVLRKKIEFFDTDTRAKDIIFHISSDAILVQDAIGDKIGHTIRYISQ  632
            ERQTARLR+ YL+S+L K I FFDT+ R  ++I+HISSDAILVQDAIGDK  H +RY+SQ
Sbjct  151  ERQTARLRINYLKSILAKDITFFDTEARDSNLIYHISSDAILVQDAIGDKTDHVLRYLSQ  210

Query  633  FLVGFAVGFISVWKLTLVTLAVVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAIS  812
            F+ GF +GF+SVW+LTL+TLAVVPLIA+AGG Y +IMS +S+K EAAYA+AGKVAEE +S
Sbjct  211  FIAGFVIGFLSVWQLTLLTLAVVPLIAIAGGGYAIIMSTISEKSEAAYADAGKVAEEVMS  270

Query  813  QVRTVYSFVGEKKAVESYSKSLNNALVLG  899
            QVRTVY+FVGE+KAV+SYSKSL  AL LG
Sbjct  271  QVRTVYAFVGEEKAVKSYSKSLKKALKLG  299


 Score = 94.4 bits (233),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 70/241 (29%), Positives = 115/241 (48%), Gaps = 23/241 (10%)
 Frame = +3

Query  216  DTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLSSDSHRLSSQVSKQALYLVYL  395
            +  ++ + + GSIGA + GA  P+F +    ++ +    S     +   V K AL     
Sbjct  706  NAPEWPYALLGSIGAVLAGAQTPLFSMGIAYVLTAF--YSPSPSLIKHDVEKVAL-----  758

Query  396  GSIIFISAWIGVA--------FWTQTGERQTARLRLRYLQSVLRKKIEFFDTDTRAKDII  551
               IF+ A I  A        F+T  GER T+R+RL    ++L  +I +FD D      +
Sbjct  759  ---IFVGAGIATAPIYLLQHYFYTLMGERLTSRVRLSLFSAILSNEIGWFDLDENNTGSL  815

Query  552  FHI-SSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLAVVPLIAVAGGT  728
              I ++DA LV+ ++ D++   ++ +S  +   A+ F   W++  +  A  PL+  A  T
Sbjct  816  TSILAADATLVRSSLADRLSTIVQNLSLTITALALAFYYSWRVAAIVTACFPLLIAASLT  875

Query  729  YTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESY----SKSLNNALVL  896
              L +         AY++A  VA EAI+ +RTV +F  EK+  E +    SK   NA V 
Sbjct  876  EQLFLKGFGGDYTRAYSKATSVAREAIANIRTVAAFGAEKQISEQFTSELSKPTKNAFVR  935

Query  897  G  899
            G
Sbjct  936  G  936



>ref|XP_006415706.1| hypothetical protein EUTSA_v10006583mg [Eutrema salsugineum]
 gb|ESQ34059.1| hypothetical protein EUTSA_v10006583mg [Eutrema salsugineum]
Length=1242

 Score =   337 bits (865),  Expect = 9e-103, Method: Compositional matrix adjust.
 Identities = 158/237 (67%), Positives = 192/237 (81%), Gaps = 0/237 (0%)
 Frame = +3

Query  186  VSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLSSDSHRLSSQV  365
            VS  GLF AAD VD   M  GS+G+CIHG  LP+FFV FG+++DSLG LS+D   +SS+V
Sbjct  31   VSLMGLFRAADKVDCLLMFLGSLGSCIHGGTLPLFFVFFGKLLDSLGSLSADPKAISSRV  90

Query  366  SKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKKIEFFDTDTRAKD  545
            S+ ALYLVYLG +  +SAW+GV  W QTGERQTARLR+ YL+S+L K I FFDT+ R  +
Sbjct  91   SQNALYLVYLGLVNLVSAWMGVTCWMQTGERQTARLRINYLKSILAKDITFFDTEARDSN  150

Query  546  IIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLAVVPLIAVAGG  725
             IFHISSDAILVQDAIGDK GH +RY+ QF+ GF +GF+SVW+LTL+TLAVVPLIA+AGG
Sbjct  151  FIFHISSDAILVQDAIGDKTGHVLRYLCQFIAGFVIGFLSVWQLTLLTLAVVPLIAIAGG  210

Query  726  TYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYSKSLNNALVL  896
             Y +IMS +S+K EAAYA+AGKVAEE +SQVRTVY+FVGE+KAV+SYS SL  AL L
Sbjct  211  GYAIIMSTISEKSEAAYADAGKVAEEVMSQVRTVYAFVGEEKAVKSYSTSLTKALKL  267


 Score = 90.5 bits (223),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 63/223 (28%), Positives = 111/223 (50%), Gaps = 3/223 (1%)
 Frame = +3

Query  216  DTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLSSDSHRLSSQVSKQALYLVYL  395
            +  ++ + + GSIGA + GA   +F +    +++     S   + +  +V K A+  V +
Sbjct  671  NAPEWPYALLGSIGAVLAGAQPALFSMGIAYVLNVF--YSPFPNVIKREVEKVAIIFVGV  728

Query  396  GSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKKIEFFDTDTRAKDIIFHI-SSDA  572
            G +      +   F+T  GER T+R+RL    ++L  +I +FD D      +  I ++DA
Sbjct  729  GILTAPIYLLQHYFYTLMGERLTSRVRLSLFSAILSNEIGWFDLDENNTGSLTSILAADA  788

Query  573  ILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLAVVPLIAVAGGTYTLIMSNL  752
             LV+ A+ D++   ++ +S  +   A+ F   W++  V  A  PL+  A  T  L +   
Sbjct  789  TLVRSALADRLSTIVQNLSLTITALAIAFFYSWRVAAVVTACFPLLIAASLTEQLFLKGF  848

Query  753  SQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYSKSLN  881
                  AY+ A  VA EAI+ +RTV SF  EK+  E ++  L+
Sbjct  849  GGDYTMAYSRATTVAREAIANIRTVASFGAEKQISEQFACELS  891



>ref|XP_010439790.1| PREDICTED: ABC transporter B family member 14-like isoform X1 
[Camelina sativa]
Length=1250

 Score =   336 bits (861),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 161/257 (63%), Positives = 195/257 (76%), Gaps = 5/257 (2%)
 Frame = +3

Query  132  SNLKMDQQPSNSTD-----RKEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFV  296
            SN  +  +P   T+     +KE V+  GLF AAD VD F M  G +G CIHG  LP FFV
Sbjct  11   SNGNIQAEPETMTNEKKKMKKESVTLMGLFGAADHVDCFLMFLGGLGNCIHGGTLPFFFV  70

Query  297  LFGRMIDSLGHLSSDSHRLSSQVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARLR  476
             FG M+DSLG+L  D   +SS VS+ ALYLVYLG +  +SAWIGVA W QTGERQT RLR
Sbjct  71   FFGGMLDSLGNLYKDPKAISSHVSQNALYLVYLGLVNLVSAWIGVACWMQTGERQTRRLR  130

Query  477  LRYLQSVLRKKIEFFDTDTRAKDIIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAVG  656
            + YL+S+L K I FFDT+TR  + IFHISSDAILVQDAIGDK GH +RY+ QF+ GF +G
Sbjct  131  ISYLKSILAKDITFFDTETRDSNFIFHISSDAILVQDAIGDKTGHVLRYLCQFIAGFVIG  190

Query  657  FISVWKLTLVTLAVVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSF  836
            F+SVW+LTL+TL VVPLIAVA G Y ++MS +S+K EAAYA+AGK+AEE +SQVRTVY+F
Sbjct  191  FLSVWQLTLLTLGVVPLIAVAVGGYAIVMSTISEKSEAAYADAGKIAEEVMSQVRTVYAF  250

Query  837  VGEKKAVESYSKSLNNA  887
            VGE+KAV+SYSKSL  A
Sbjct  251  VGEEKAVKSYSKSLKEA  267


 Score = 89.0 bits (219),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 68/233 (29%), Positives = 109/233 (47%), Gaps = 7/233 (3%)
 Frame = +3

Query  216  DTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLSSDSHRLSSQVSKQALYLVYL  395
            +  ++ + + GS+GA + G+  P  F + G     +   S     +  QV K  +  V  
Sbjct  679  NAPEWLYALLGSVGAVLAGSQ-PALFSM-GVAYVLITFYSPSPSLIKRQVEKVIVIFVGA  736

Query  396  GSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKKIEFFDTDTRAKDIIFHI-SSDA  572
            G I      +   F+T  GER T+R+RL    ++L  +I +FD +      +  I S+DA
Sbjct  737  GVITTPIYLLQHYFYTLMGERLTSRVRLSLFSAILSNEIGWFDLEENNTGSLTSILSADA  796

Query  573  ILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLAVVPLIAVAGGTYTLIMSNL  752
             LV+ AI D++   ++ IS  +    + F   W++  V  A  PLI  A  T  L +   
Sbjct  797  TLVRSAIADRLSTIVQNISLTVTSLGLAFFYCWRVAAVVTACFPLIITASLTEQLFLKGF  856

Query  753  SQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESY----SKSLNNALVLG  899
                  AY+ A  +A EAI  +RTV +F  EK+  E +    +K   NAL+ G
Sbjct  857  GGDYTRAYSRATSLAREAIVNIRTVAAFGAEKQISEQFTSELTKPTKNALLKG  909



>ref|XP_008788471.1| PREDICTED: ABC transporter B family member 13-like [Phoenix dactylifera]
Length=1276

 Score =   335 bits (859),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 154/235 (66%), Positives = 196/235 (83%), Gaps = 0/235 (0%)
 Frame = +3

Query  195  FGLFSAADTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLSSDSHRLSSQVSKQ  374
            F LFS AD  D   M+FG IGAC+HGAALP+FF+LFGR+IDSLG LS+D  RL+S+VSK 
Sbjct  53   FNLFSFADRFDCLLMIFGGIGACVHGAALPIFFLLFGRLIDSLGSLSADPQRLASEVSKH  112

Query  375  ALYLVYLGSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKKIEFFDTDTRAKDIIF  554
            AL LVY+G ++  SAWIGVAFW +TGERQTARLR++Y+ SVL++   FFDT    ++I+ 
Sbjct  113  ALQLVYVGLLVMASAWIGVAFWAETGERQTARLRVKYIHSVLKQDTSFFDTVATNENILQ  172

Query  555  HISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLAVVPLIAVAGGTYT  734
             ISSDAILVQDAI DK+GH++RY+SQF +GF +GF SVW+LTL+TLA+VPL+ +AGGTYT
Sbjct  173  RISSDAILVQDAIADKLGHSLRYLSQFFIGFIMGFSSVWQLTLLTLAIVPLVVIAGGTYT  232

Query  735  LIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYSKSLNNALVLG  899
            +IMS+LS+KGEAAYAEAGKVAEE IS + TVYS+VGE++A+E+YS+SL  +L  G
Sbjct  233  IIMSSLSRKGEAAYAEAGKVAEEVISHIHTVYSYVGEERAIEAYSRSLKTSLKFG  287


 Score = 83.6 bits (205),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 55/222 (25%), Positives = 117/222 (53%), Gaps = 7/222 (3%)
 Frame = +3

Query  225  DYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLSSDSHRLSSQVSKQALYLVYLGS-  401
            ++ F + GS+GA + G   P+F +    ++ +    S D  ++  ++  + + L+++G+ 
Sbjct  700  EWSFAILGSVGATLAGVEGPLFALGITHVLTAF--YSHDKIQIKHEI--KMVSLIFIGAA  755

Query  402  IIFISAWI-GVAFWTQTGERQTARLRLRYLQSVLRKKIEFFDTDTRAK-DIIFHISSDAI  575
            II +  ++    F+T  GE+ T R+RL    ++L  +I +F+ D  +   +   ++ DA 
Sbjct  756  IITVPVYLLQHYFYTLMGEKLTTRVRLLMFSAILDNEIGWFELDENSSGSLTSSLAVDAT  815

Query  576  LVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLAVVPLIAVAGGTYTLIMSNLS  755
            +++ A+ +++   ++ IS  +  F + F+  W++ LV +A  PL+  A     L +    
Sbjct  816  VLRSALAERMSTMVQNISLTVTAFIIAFLLSWRMALVVVATFPLLISASIAEHLFLKGFG  875

Query  756  QKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYSKSLN  881
                 AY+ A  VA+EAI+  RTV +F  E + + +++  L+
Sbjct  876  GNYTCAYSRANSVAQEAITNNRTVAAFGAEDQVLSNFTHELH  917



>ref|XP_006306603.1| hypothetical protein CARUB_v10008108mg [Capsella rubella]
 gb|EOA39501.1| hypothetical protein CARUB_v10008108mg [Capsella rubella]
Length=1247

 Score =   332 bits (851),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 155/229 (68%), Positives = 184/229 (80%), Gaps = 0/229 (0%)
 Frame = +3

Query  186  VSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLSSDSHRLSSQV  365
            VS  GLF AAD VD F M  G +G CIHG  LP+FFV FG M+DSLG+LS+D   +SS V
Sbjct  31   VSLLGLFGAADNVDCFLMFLGGLGTCIHGGTLPLFFVFFGGMLDSLGNLSTDPKAISSHV  90

Query  366  SKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKKIEFFDTDTRAKD  545
            S+ ALYLVYLG +  +SAWIGVA W QTGERQ ARLR+ YL+S+L K I FFDT+TR  +
Sbjct  91   SQNALYLVYLGFVNLVSAWIGVACWMQTGERQAARLRINYLKSILAKDITFFDTETRDSN  150

Query  546  IIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLAVVPLIAVAGG  725
             IFHISSDAILVQDAIGDK GH +RY+ QF VGF +GF+SVW+LTL+TL VVPLIAVAGG
Sbjct  151  FIFHISSDAILVQDAIGDKTGHVLRYLCQFTVGFVIGFLSVWQLTLLTLGVVPLIAVAGG  210

Query  726  TYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYSK  872
             Y ++MS +S+K EAAYA+AGKVAEE +SQVRTVY+FV E+KA+ESYS 
Sbjct  211  GYAIVMSTISEKSEAAYADAGKVAEEVMSQVRTVYAFVREEKAIESYSN  259


 Score = 84.0 bits (206),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 67/235 (29%), Positives = 115/235 (49%), Gaps = 11/235 (5%)
 Frame = +3

Query  216  DTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLSSDSHRLSSQVSKQALYLVYL  395
            +  ++ + + GSIGA + G+ LP  F + G         S     +  +V K  + ++++
Sbjct  676  NAPEWPYALLGSIGAVLAGS-LPALFSM-GIAYVLTTFYSPFPSLIKREVEK--VIIIFV  731

Query  396  GSIIFISA--WIGVAFWTQTGERQTARLRLRYLQSVLRKKIEFFDTDTRAKDIIFHI-SS  566
            G+ I  +    +   F+T  GER T+R+RL    ++L  +I +FD D      +  I S+
Sbjct  732  GTAIVTTPIYLLQHYFYTLMGERLTSRVRLSLFSAILVNEIGWFDLDENNTGSLTSILSA  791

Query  567  DAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLAVVPLIAVAGGTYTLIMS  746
            DA LV+ A+ D++   ++ IS  +   A+ F   W++  V  A  PL+  A  T  L + 
Sbjct  792  DATLVRSAVADRLSTIVQNISLTVTALALAFFYSWRVAAVVTACFPLLIAASLTEQLFLK  851

Query  747  NLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYSKSLN----NALVLG  899
                    AY+ A  +A EAI  +RTV +F  E +  E ++  L+    NAL+ G
Sbjct  852  GFGGDYTRAYSRATSLAREAIVNIRTVAAFGAENQISEQFACELSIPTKNALLKG  906



>ref|XP_010439800.1| PREDICTED: ABC transporter B family member 14-like isoform X2 
[Camelina sativa]
Length=1249

 Score =   331 bits (849),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 161/257 (63%), Positives = 194/257 (75%), Gaps = 6/257 (2%)
 Frame = +3

Query  132  SNLKMDQQPSNSTD-----RKEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFV  296
            SN  +  +P   T+     +KE V+  GLF AAD VD F M  G +G CIHG  LP FFV
Sbjct  11   SNGNIQAEPETMTNEKKKMKKESVTLMGLFGAADHVDCFLMFLGGLGNCIHGGTLPFFFV  70

Query  297  LFGRMIDSLGHLSSDSHRLSSQVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARLR  476
             FG M+DSLG+L  D   +SS V K ALYLVYLG +  +SAWIGVA W QTGERQT RLR
Sbjct  71   FFGGMLDSLGNLYKDPKAISSHV-KNALYLVYLGLVNLVSAWIGVACWMQTGERQTRRLR  129

Query  477  LRYLQSVLRKKIEFFDTDTRAKDIIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAVG  656
            + YL+S+L K I FFDT+TR  + IFHISSDAILVQDAIGDK GH +RY+ QF+ GF +G
Sbjct  130  ISYLKSILAKDITFFDTETRDSNFIFHISSDAILVQDAIGDKTGHVLRYLCQFIAGFVIG  189

Query  657  FISVWKLTLVTLAVVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSF  836
            F+SVW+LTL+TL VVPLIAVA G Y ++MS +S+K EAAYA+AGK+AEE +SQVRTVY+F
Sbjct  190  FLSVWQLTLLTLGVVPLIAVAVGGYAIVMSTISEKSEAAYADAGKIAEEVMSQVRTVYAF  249

Query  837  VGEKKAVESYSKSLNNA  887
            VGE+KAV+SYSKSL  A
Sbjct  250  VGEEKAVKSYSKSLKEA  266


 Score = 89.0 bits (219),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 68/233 (29%), Positives = 109/233 (47%), Gaps = 7/233 (3%)
 Frame = +3

Query  216  DTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLSSDSHRLSSQVSKQALYLVYL  395
            +  ++ + + GS+GA + G+  P  F + G     +   S     +  QV K  +  V  
Sbjct  678  NAPEWLYALLGSVGAVLAGSQ-PALFSM-GVAYVLITFYSPSPSLIKRQVEKVIVIFVGA  735

Query  396  GSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKKIEFFDTDTRAKDIIFHI-SSDA  572
            G I      +   F+T  GER T+R+RL    ++L  +I +FD +      +  I S+DA
Sbjct  736  GVITTPIYLLQHYFYTLMGERLTSRVRLSLFSAILSNEIGWFDLEENNTGSLTSILSADA  795

Query  573  ILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLAVVPLIAVAGGTYTLIMSNL  752
             LV+ AI D++   ++ IS  +    + F   W++  V  A  PLI  A  T  L +   
Sbjct  796  TLVRSAIADRLSTIVQNISLTVTSLGLAFFYCWRVAAVVTACFPLIITASLTEQLFLKGF  855

Query  753  SQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESY----SKSLNNALVLG  899
                  AY+ A  +A EAI  +RTV +F  EK+  E +    +K   NAL+ G
Sbjct  856  GGDYTRAYSRATSLAREAIVNIRTVAAFGAEKQISEQFTSELTKPTKNALLKG  908



>ref|XP_010480688.1| PREDICTED: ABC transporter B family member 14 [Camelina sativa]
Length=1247

 Score =   329 bits (843),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 154/229 (67%), Positives = 184/229 (80%), Gaps = 0/229 (0%)
 Frame = +3

Query  186  VSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLSSDSHRLSSQV  365
            VS  GLF AAD VD F M  G +G CIHG  LP+FFV FG M+DSLG LS+D   +SS+V
Sbjct  32   VSLMGLFGAADHVDCFLMFLGGLGTCIHGGTLPLFFVFFGGMLDSLGSLSTDPKAISSRV  91

Query  366  SKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKKIEFFDTDTRAKD  545
            S+ ALYLVYLG    +SAWIGVA W QTGERQTARLR+ YL+S+L K I FFDT+TR  +
Sbjct  92   SQNALYLVYLGLFNLVSAWIGVACWMQTGERQTARLRINYLKSILAKDITFFDTETRDSN  151

Query  546  IIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLAVVPLIAVAGG  725
             I+HISSDAILVQDAIGDK GH +RY+ QF+ GF +GF+SVW+LTL+TL VVPLIAVAGG
Sbjct  152  FIYHISSDAILVQDAIGDKTGHVLRYLCQFIAGFVIGFLSVWQLTLLTLGVVPLIAVAGG  211

Query  726  TYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYSK  872
             Y ++MS +S+K E AYA+AGKVAEE +SQVRTVY+FVGE+KAV+SYS 
Sbjct  212  GYAIVMSTISEKSETAYADAGKVAEEVMSQVRTVYAFVGEEKAVKSYSN  260


 Score = 87.8 bits (216),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 70/235 (30%), Positives = 114/235 (49%), Gaps = 11/235 (5%)
 Frame = +3

Query  216  DTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLSSDSHRLSSQVSKQALYLVYL  395
            +  ++ + + GSIGA   G+ LP  F + G         S     +  +V K  + ++++
Sbjct  670  NAPEWLYALLGSIGAVFAGS-LPALFSM-GLAYVLTTFYSPFPSLIKHEVEK--VIIIFV  725

Query  396  GSIIFISA--WIGVAFWTQTGERQTARLRLRYLQSVLRKKIEFFDTDTRAKDIIFHI-SS  566
            G+ I  +    +   F+T  GER T+R+RL    ++L  +I +FD D      +  I S+
Sbjct  726  GTGILTTPIYLLQHYFYTLMGERLTSRVRLSLFSAILLNEIGWFDLDENNTGSLTSILSA  785

Query  567  DAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLAVVPLIAVAGGTYTLIMS  746
            DA LV+ AI D++   ++ IS  +   A+ F   W++  V  A  PL+  A  T  L + 
Sbjct  786  DATLVRSAIADRLSTIVQNISLTVTALALAFFYSWRVAAVVTACFPLLIAASLTEQLFLK  845

Query  747  NLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESY----SKSLNNALVLG  899
                    AY+ A  +A EAI  +RTV +F  EK+  E +    SK   NAL+ G
Sbjct  846  GFGGDYTRAYSRATSLAREAIVNIRTVAAFGAEKQISEQFTCELSKPTKNALLKG  900



>ref|XP_010478145.1| PREDICTED: ABC transporter B family member 13 isoform X2 [Camelina 
sativa]
Length=1238

 Score =   328 bits (842),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 155/230 (67%), Positives = 190/230 (83%), Gaps = 8/230 (3%)
 Frame = +3

Query  186  VSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLSSDSHRLSSQV  365
            VS  GLFSAAD +DYF M+ G +GAC+HGA LP+FFVLFG+M+DSLG+LS+DS  +SS V
Sbjct  31   VSLMGLFSAADKLDYFLMLLGGLGACVHGATLPLFFVLFGKMLDSLGNLSADSKAISSHV  90

Query  366  SKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKKIEFFDTDTRAKD  545
            SK ALYLVYLG +  +SAWIG        ERQTARLR+ YL+S+L K I FFDT+ R  +
Sbjct  91   SKNALYLVYLGLVNLVSAWIG--------ERQTARLRINYLKSILAKDITFFDTEARDSN  142

Query  546  IIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLAVVPLIAVAGG  725
            +I+HISSDAILVQDAIGDK  H +RY+SQF+ GF +GF+SVW+LTL+TLAVVPLIA+AGG
Sbjct  143  LIYHISSDAILVQDAIGDKTDHVLRYLSQFIAGFVIGFLSVWQLTLLTLAVVPLIAIAGG  202

Query  726  TYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYSKS  875
             Y +IMS +S+K EAAYA+AGKVAEE +SQVRTVY+FVGE+KAV+SYS S
Sbjct  203  GYAIIMSTISEKSEAAYADAGKVAEEVMSQVRTVYAFVGEEKAVKSYSTS  252


 Score = 95.5 bits (236),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 68/233 (29%), Positives = 114/233 (49%), Gaps = 7/233 (3%)
 Frame = +3

Query  216  DTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLSSDSHRLSSQVSKQALYLVYL  395
            +  ++ + + GSIGA + GA  P+F +    ++ +    S   + +   + K A+  V  
Sbjct  667  NAPEWPYALLGSIGAVLAGAQTPLFSMGIAYVLTAF--YSPHPNVIKRDIDKVAIVFVVA  724

Query  396  GSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKKIEFFDTDTRAKDIIFHI-SSDA  572
            G +      +   F+T  GER TAR+RL    ++L  +I +FD D      +  I ++DA
Sbjct  725  GIVTAPIYLLQHYFYTLMGERLTARVRLSLFSAILSNEIGWFDLDENNTGSLTSILAADA  784

Query  573  ILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLAVVPLIAVAGGTYTLIMSNL  752
             LV+ A+ D++   ++ +S  +   A+ F   W++  V  A  PL+  A  T  L +   
Sbjct  785  TLVRSALADRLSTIVQNLSLTVTALALAFYYSWRVAAVVTACFPLLIAASLTEQLFLKGF  844

Query  753  SQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESY----SKSLNNALVLG  899
                  AY++A  VA EAI+ +RTV +F  EK+  E +    SK   NA V G
Sbjct  845  GGDYTRAYSKATSVAREAIANIRTVAAFGVEKQISEQFTSELSKPTKNAFVRG  897



>ref|XP_010095529.1| ABC transporter B family member 13 [Morus notabilis]
 gb|EXB60649.1| ABC transporter B family member 13 [Morus notabilis]
Length=733

 Score =   318 bits (816),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 160/264 (61%), Positives = 195/264 (74%), Gaps = 28/264 (11%)
 Frame = +3

Query  120  LEISSNLKMDQQP----SNSTDRKEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPV  287
            +E+++N   +Q P      +  +K   SFFGLFS AD VDY  M FGS+G C HGAALPV
Sbjct  43   VELATNEVSEQNPLPKMEQTASQKSTASFFGLFSGADRVDYVLMFFGSVGTCAHGAALPV  102

Query  288  FFVLFGRMIDSLGHLSSDSHRLSSQVSKQALYLVYLGSIIFISAWIGVAFW---TQTGER  458
            FFVLFGRMIDSLG+L  +  +LSS VS+                      W    + GER
Sbjct  103  FFVLFGRMIDSLGNLFKNPRQLSSHVSE---------------------VWHRGCRRGER  141

Query  459  QTARLRLRYLQSVLRKKIEFFDTDTRAKDIIFHISSDAILVQDAIGDKIGHTIRYISQFL  638
             TA+LR++YL+S+L+K I FFDT+ R  +I+FHISSDAILVQDAIGDK GH + Y+SQF+
Sbjct  142  LTAQLRVKYLESILKKDISFFDTEARDANILFHISSDAILVQDAIGDKTGHALHYLSQFI  201

Query  639  VGFAVGFISVWKLTLVTLAVVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQV  818
            VGFA+GF SVW+LTL+TLAVVPLIA+AGG YT+IMS LS+KGEAAYAEAGKVAEEA+SQV
Sbjct  202  VGFAIGFASVWQLTLLTLAVVPLIAMAGGAYTVIMSTLSEKGEAAYAEAGKVAEEALSQV  261

Query  819  RTVYSFVGEKKAVESYSKSLNNAL  890
            RTVYSFVGE +A+E+YS SLN AL
Sbjct  262  RTVYSFVGEDRAIEAYSMSLNKAL  285



>ref|XP_010460562.1| PREDICTED: ABC transporter B family member 13-like isoform X2 
[Camelina sativa]
Length=1240

 Score =   327 bits (837),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 154/230 (67%), Positives = 189/230 (82%), Gaps = 8/230 (3%)
 Frame = +3

Query  186  VSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLSSDSHRLSSQV  365
            VS  GLFSAAD +DYF M+ G +GAC+HGA LP+FFV FG+M+DSLG+LS+DS  +SS V
Sbjct  33   VSLMGLFSAADKLDYFLMLLGGLGACVHGATLPLFFVFFGKMLDSLGNLSTDSKAISSHV  92

Query  366  SKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKKIEFFDTDTRAKD  545
            SK ALYLVYLG +  +SAWIG        ERQTARLR+ YL+S+L K I FFDT+ R  +
Sbjct  93   SKNALYLVYLGLVNLVSAWIG--------ERQTARLRINYLKSILAKDITFFDTEARDSN  144

Query  546  IIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLAVVPLIAVAGG  725
            +I+HISSDAILVQDAIGDK  H +RY+SQF+ GF +GF+SVW+LTL+TLAVVPLIA+AGG
Sbjct  145  LIYHISSDAILVQDAIGDKTDHVLRYLSQFIAGFVIGFLSVWQLTLLTLAVVPLIAIAGG  204

Query  726  TYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYSKS  875
             Y +IMS +S+K EAAYA+AGKVAEE +SQVRTVY+FVGE+KAV+SYS S
Sbjct  205  GYAIIMSTISEKSEAAYADAGKVAEEVMSQVRTVYAFVGEEKAVKSYSTS  254


 Score = 94.7 bits (234),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 68/233 (29%), Positives = 114/233 (49%), Gaps = 7/233 (3%)
 Frame = +3

Query  216  DTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLSSDSHRLSSQVSKQALYLVYL  395
            +  ++ + + GSIGA + GA  P+F +    ++ +    S   + +   + K A+  V  
Sbjct  669  NAPEWPYALLGSIGAVLAGAQTPLFSMGIAYVLTAF--YSPHPNVIKRDIEKVAIIFVVA  726

Query  396  GSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKKIEFFDTDTRAKDIIFHI-SSDA  572
            G +      +   F+T  GER TAR+RL    ++L  +I +FD D      +  I ++DA
Sbjct  727  GIVTAPIYLLQHYFYTLMGERLTARVRLSLFSAILSNEIGWFDLDENNTGSLTSILAADA  786

Query  573  ILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLAVVPLIAVAGGTYTLIMSNL  752
             LV+ A+ D++   ++ +S  +   A+ F   W++  V  A  PL+  A  T  L +   
Sbjct  787  TLVRSALADRLSTIVQNLSLTVTALALAFYYSWRVAAVVTACFPLLIAASLTEQLFLKGF  846

Query  753  SQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESY----SKSLNNALVLG  899
                  AY++A  VA EAI+ +RTV +F  EK+  E +    SK   NA V G
Sbjct  847  GGDYTRAYSKATSVAREAIANIRTVAAFGVEKQISEQFTSELSKPTKNAFVRG  899



>ref|XP_010499286.1| PREDICTED: ABC transporter B family member 13-like isoform X2 
[Camelina sativa]
Length=1237

 Score =   326 bits (835),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 154/230 (67%), Positives = 189/230 (82%), Gaps = 8/230 (3%)
 Frame = +3

Query  186  VSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLSSDSHRLSSQV  365
            VS  GLFSA+D +DYF M+ G +GAC+HGA LP+FFV FG+M+DSLG+LS+DS  +SS V
Sbjct  30   VSLMGLFSASDKLDYFLMLLGGLGACVHGATLPLFFVFFGKMLDSLGNLSTDSKAISSHV  89

Query  366  SKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKKIEFFDTDTRAKD  545
            SK ALYLVYLG +  +SAWIG        ERQTARLR+ YL+SVL K I FFDT+ R  +
Sbjct  90   SKNALYLVYLGLVNLVSAWIG--------ERQTARLRINYLKSVLAKDITFFDTEARDSN  141

Query  546  IIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLAVVPLIAVAGG  725
            +I+HISSDAILVQDAIGDK  H +RY+SQF+ GF +GF+SVW+LTL+TLAVVPLIA++GG
Sbjct  142  LIYHISSDAILVQDAIGDKTDHVLRYLSQFIAGFVIGFLSVWQLTLLTLAVVPLIAISGG  201

Query  726  TYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYSKS  875
             Y +IMS LS+K EAAYA+AGKVAEE +SQVRTVY+FVGE+KAV+SYS S
Sbjct  202  GYAIIMSTLSEKSEAAYADAGKVAEEVMSQVRTVYAFVGEEKAVKSYSTS  251


 Score = 92.0 bits (227),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 65/233 (28%), Positives = 113/233 (48%), Gaps = 7/233 (3%)
 Frame = +3

Query  216  DTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLSSDSHRLSSQVSKQALYLVYL  395
            +  ++ + + GS+GA + GA  P+F +    ++ +    S   + +   + K A+  V  
Sbjct  666  NAPEWPYALLGSVGAVLAGAQTPLFSMGIAYVLTAF--YSPHPNVIKRDIEKVAIIFVVA  723

Query  396  GSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKKIEFFDTDTRAKDIIFHI-SSDA  572
            G +      +   F+T  GER TAR+RL    ++L  +I +FD D      +  I ++DA
Sbjct  724  GIVTAPIYLLQHYFYTLMGERLTARVRLSLFSAILSNEIGWFDLDENNTGSLTSILAADA  783

Query  573  ILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLAVVPLIAVAGGTYTLIMSNL  752
             LV+ A+ D++   ++ +S  +   A+ F   W++  V  A  PL+  A  T  L +   
Sbjct  784  TLVRSALADRLSTIVQNLSLTVTALALAFYYSWRVAAVVTACFPLLIAASLTEQLFLKGF  843

Query  753  SQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESY----SKSLNNALVLG  899
                   Y+++  VA EAI+ +RTV +F  EK+  E +    SK   NA V G
Sbjct  844  GGDYTRTYSKSTSVAREAIANIRTVAAFGIEKQISEQFTSELSKPTKNAFVRG  896



>gb|KFK33112.1| hypothetical protein AALP_AA6G332600 [Arabis alpina]
Length=1240

 Score =   323 bits (827),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 153/230 (67%), Positives = 183/230 (80%), Gaps = 0/230 (0%)
 Frame = +3

Query  186  VSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLSSDSHRLSSQV  365
            VS   LFSAAD  D F M  G +G CIHG  LP FFV FG+++DSLG+LS D    SS V
Sbjct  27   VSLMILFSAADKFDCFLMFLGGLGTCIHGGTLPFFFVFFGKLLDSLGNLSMDPKATSSTV  86

Query  366  SKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKKIEFFDTDTRAKD  545
            S+ ALYLVYLG +  +SAWIGVA W QTGERQTARLR+ YL+S+L K I FFDT     +
Sbjct  87   SQNALYLVYLGLVNLVSAWIGVACWMQTGERQTARLRINYLKSILAKDITFFDTIASDSN  146

Query  546  IIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLAVVPLIAVAGG  725
             +FHISSDAILVQDAIGDK GH +RYI QF+ GF +GF+SVW+LTL+TLAVVPLIA++GG
Sbjct  147  FVFHISSDAILVQDAIGDKTGHVLRYICQFIAGFVIGFLSVWQLTLLTLAVVPLIAISGG  206

Query  726  TYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYSKS  875
             Y ++MS++SQK EAAYA+AGKVAEE +SQVRTVY+FVGE+KAV+SYS S
Sbjct  207  GYAIVMSSISQKSEAAYADAGKVAEEVMSQVRTVYAFVGEEKAVKSYSDS  256


 Score = 86.7 bits (213),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 68/244 (28%), Positives = 111/244 (45%), Gaps = 29/244 (12%)
 Frame = +3

Query  216  DTVDYFFMVFGSIGACIHGA-----------ALPVFFVLFGRMIDSLGHLSSDSHRLSSQ  362
            +  ++ + + GSIGA + G             L VF+  F  MI                
Sbjct  669  NAPEWPYALLGSIGAVLAGTQPALFSMGLAYVLTVFYSPFPSMI-------------KHD  715

Query  363  VSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKKIEFFDTDTRAK  542
            V + A+  V +G +     ++   ++T  GER T+R+RL    +VL  +I +FD D  + 
Sbjct  716  VERIAIVFVGIGIVTTPIYFLQHYYYTLMGERLTSRVRLSLFSAVLSNEIGWFDLDENST  775

Query  543  DIIFHI-SSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLAVVPLIAVA  719
              +  I ++DA LV+ A+ D++   ++ +S  +   A+ F   W++  V  A  PL+  A
Sbjct  776  GSLTSILAADATLVRSALADRLSTIVQNVSLTVTALALAFFYSWRVASVVTACFPLLIAA  835

Query  720  GGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESY----SKSLNNA  887
              T  L +         AY+ A  VA EAI  +RTV +F  EK+  E +    SK   NA
Sbjct  836  SLTEQLFLRGFGGDYTRAYSRATSVAREAIVNIRTVAAFGAEKQISEQFTCELSKPTKNA  895

Query  888  LVLG  899
             + G
Sbjct  896  FLRG  899



>ref|XP_010666235.1| PREDICTED: ABC transporter B family member 13-like [Beta vulgaris 
subsp. vulgaris]
Length=1217

 Score =   320 bits (819),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 150/235 (64%), Positives = 192/235 (82%), Gaps = 1/235 (0%)
 Frame = +3

Query  195  FGLFSAADTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLSSDSHRLSSQVSKQ  374
            FGLF+AA+T+DY  M+ GSIGACIHGAA PVFFVL G+MIDSLG LSSD H LS+ +SK 
Sbjct  13   FGLFAAAETLDYILMLLGSIGACIHGAAPPVFFVLVGQMIDSLGSLSSDHHLLSTSMSKI  72

Query  375  ALYLVYLGSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKKIEFFDTDTRAKDIIF  554
            +L LVYLG ++ +S+WIGVA W QTGERQ   LRL+YL +VL+K I F +T+ + K +IF
Sbjct  73   SLELVYLGLLMLVSSWIGVAAWKQTGERQALCLRLKYLNAVLKKDIHFVETEAQNKSLIF  132

Query  555  HISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLAVVPLIAVAGGTYT  734
             ISSD ILVQDAIGDK+GH +RY+SQ +VG  +GF+ VW+LTLVT+A++PL+ VAG  YT
Sbjct  133  QISSDTILVQDAIGDKVGHCVRYLSQSIVGMIIGFMLVWQLTLVTVAIIPLMVVAGA-YT  191

Query  735  LIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYSKSLNNALVLG  899
            +I+SNLSQK EAAYAE+GKVAEE +SQ+RTVY+F GE++A+ +Y +SL  A+ LG
Sbjct  192  VILSNLSQKAEAAYAESGKVAEEVLSQIRTVYAFGGERRAIHAYGRSLKKAIKLG  246


 Score = 80.5 bits (197),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 56/227 (25%), Positives = 109/227 (48%), Gaps = 7/227 (3%)
 Frame = +3

Query  234  FMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLSSDSHRLSSQVSKQALYLVYLGSIIFI  413
            + V GSIGA + G  +P+F +    M+ +    S+ + ++   V   A   + + +I   
Sbjct  651  YAVLGSIGAILTGIQVPLFALGITNMLTTF--YSNSNSKIKHDVQVTAFLFLVVAAITVP  708

Query  414  SAWIGVAFWTQTGERQTARLRLRYLQSVLRKKIEFFDTD-TRAKDIIFHISSDAILVQDA  590
               +   F+T  GER T R+R     +++  +  +FD D  R   ++  ++++A L++ A
Sbjct  709  MYLLQNYFFTVMGERITVRMRSEMFSAMISSEPGWFDLDENRIGSLVSKLAANATLIRTA  768

Query  591  IGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLAVVPLIAVAGGTYTLIMSNLSQKGEA  770
            + D++   ++  +  +  F + F   W++  VT+A+ PL+  A  T    +         
Sbjct  769  LVDRLSIIVQNAALVVAAFVIAFKFSWRIASVTIAIFPLLIGASLTEKYFLKGFGGSYTG  828

Query  771  AYAEAGKVAEEAISQVRTVYSFVGEKKAVESY----SKSLNNALVLG  899
            AY+ A  +A EAI  +RT+ +F  E +    +    SK +  AL+ G
Sbjct  829  AYSRANSLAREAIENIRTIVAFGTEDRISAQFASELSKPMKQALIWG  875



>emb|CDY27639.1| BnaA09g27680D [Brassica napus]
Length=1218

 Score =   299 bits (766),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 157/260 (60%), Positives = 188/260 (72%), Gaps = 30/260 (12%)
 Frame = +3

Query  144  MDQ-QPSNS------TD--RKEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFV  296
            MD  +PS+S      TD  +K+ VS  GLF AAD +D F M+ G +GAC  GA LP+FFV
Sbjct  1    MDSTEPSSSGNIHTETDSKKKDSVSLMGLFGAADKLDCFLMILGGLGACTLGATLPLFFV  60

Query  297  LFGRMIDSLGHLSSDSHRLSSQVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARLR  476
             FG+M+DSLG+LS+D   LSS+VSK AL LVYLG + F+SAWIGVA WTQTGERQTARLR
Sbjct  61   FFGKMLDSLGNLSTDPKALSSRVSKNALDLVYLGLVTFLSAWIGVACWTQTGERQTARLR  120

Query  477  LRYLQSVLRKKIEFFDTDTRAKDIIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAVG  656
            + YL+++L K I FFDT+ R  ++IFHISSDAILVQDAIGDK GH       F+ GF V 
Sbjct  121  INYLKAILAKDITFFDTEARDSNLIFHISSDAILVQDAIGDKTGH-------FVAGFVV-  172

Query  657  FISVWKLTLVTLAVVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSF  836
                         VVPLIA+AGG Y +IMS +S+K EAAYA+AGKVAEE ISQVRTVY+F
Sbjct  173  -------------VVPLIAIAGGGYAIIMSTISEKSEAAYADAGKVAEEVISQVRTVYAF  219

Query  837  VGEKKAVESYSKSLNNALVL  896
            VGE+KAV +YS SL  AL L
Sbjct  220  VGEEKAVNTYSNSLKKALKL  239


 Score = 90.1 bits (222),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 62/223 (28%), Positives = 108/223 (48%), Gaps = 3/223 (1%)
 Frame = +3

Query  216  DTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLSSDSHRLSSQVSKQALYLVYL  395
            +  ++ + + GSIGA + GA  P+F +    ++ +    S     +   V K A+  V +
Sbjct  647  NAPEWPYALLGSIGAVLAGAQTPLFSMGIAYVLTAF--YSPSPSVIKRDVEKVAIVFVGI  704

Query  396  GSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKKIEFFDTDTRAKDIIFHI-SSDA  572
              +      +   F+T  GER T+R+RL    ++L  +I +FD D      +  I ++DA
Sbjct  705  AVVTAPIYLLQHYFYTLMGERLTSRVRLSLFSAILSNEIGWFDLDENNTGSLTSILAADA  764

Query  573  ILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLAVVPLIAVAGGTYTLIMSNL  752
             LV+ A+ D++   ++ +S  +   A+ F   W++  V  +  PL+  A  T  L +   
Sbjct  765  TLVRSALADRLSTIVQNLSLTVTALAIAFYYSWRVAAVVTSCFPLLIAAALTEQLFLKGF  824

Query  753  SQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYSKSLN  881
                  AY+ A  VA EAI  +RTV SF  EK+  E ++  L+
Sbjct  825  GGDYTRAYSRATSVAREAIENIRTVASFGAEKQISEQFACELS  867



>ref|XP_006856780.1| hypothetical protein AMTR_s00055p00102180 [Amborella trichopoda]
 gb|ERN18247.1| hypothetical protein AMTR_s00055p00102180 [Amborella trichopoda]
Length=1265

 Score =   294 bits (752),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 153/249 (61%), Positives = 195/249 (78%), Gaps = 0/249 (0%)
 Frame = +3

Query  153  QPSNSTDRKEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHL  332
            Q S+  +R+  VSFF L + ADT D F M FG++GAC+HGAALPVFFV+FGR+IDSLG L
Sbjct  29   QASSFKERESNVSFFKLLAFADTTDMFLMFFGTLGACVHGAALPVFFVIFGRLIDSLGCL  88

Query  333  SSDSHRLSSQVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKKI  512
            S D+++L+S+V K AL L+YLG ++  S+WI VA W QTGERQ   LRL+Y  SVL + I
Sbjct  89   SGDTNKLASEVGKNALQLLYLGLVVMASSWIEVACWMQTGERQATCLRLKYFHSVLNQDI  148

Query  513  EFFDTDTRAKDIIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTL  692
             FFDT   + +++  IS D ILVQDAIGDK+GH + Y+++FLVGFA+GF SVW+LTL+TL
Sbjct  149  SFFDTSITSANVLNCISRDTILVQDAIGDKVGHCLHYLARFLVGFALGFSSVWQLTLLTL  208

Query  693  AVVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYSK  872
            AVVPL+ +AGG YT+ M+ LS+KGEAAYAEA KVAEE ISQ+RTV+SFVGE KA ++YS 
Sbjct  209  AVVPLMVIAGGAYTVTMAGLSKKGEAAYAEAAKVAEEVISQIRTVHSFVGEDKASKAYST  268

Query  873  SLNNALVLG  899
            SL  +L LG
Sbjct  269  SLETSLKLG  277


 Score = 99.4 bits (246),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 75/284 (26%), Positives = 126/284 (44%), Gaps = 22/284 (8%)
 Frame = +3

Query  24   TLPQ--KSFLRTPLKT*LVPLHT*SVAITFSMGELEISSNLKMDQQ-----PSNSTDRKE  182
            TLP   K+FL+TP      P        T    EL+  +    D Q     P +      
Sbjct  630  TLPNQTKNFLKTPH----FP--------TCPTSELDYPNPKFKDLQSQSDIPHSEKKNSN  677

Query  183  MVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLSSDSHRLSSQ  362
               +F      +T ++ F V GS+GA + G   P+F +     + +    S D   +  +
Sbjct  678  ATPYFWKLVRLNTPEWRFAVLGSLGAILAGMEGPLFALGITHCLTTF--YSPDKLHVKHE  735

Query  363  VSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKKIEFFDTD-TRA  539
            + + +L  V    +      +   F+T  GER TAR+R      +LR ++ +FD D    
Sbjct  736  IERISLIFVGAAVVTLPIYLLQHYFYTWMGERLTARVRSMMFSVILRNEVGWFDLDENNC  795

Query  540  KDIIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLAVVPLIAVA  719
              +  H+++DA LV+ A+ D+I   ++ IS  +  F + F+  W++  V +A  PL+  A
Sbjct  796  GSLTSHLAADATLVRSALADRISTIVQNISLTVTAFTIAFMLTWRMAAVVIATFPLLIGA  855

Query  720  GGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKK  851
                 L +        +AY  A  VA EAI+ +RT+ +F  E +
Sbjct  856  SIGEQLFLRGFGGDYNSAYFRASAVAREAINNIRTIVAFCAEDR  899



>ref|XP_001757525.1| ATP-binding cassette transporter, subfamily B, member 18, group 
MDR/PGP protein PpABCB18 [Physcomitrella patens]
 gb|EDQ77582.1| ATP-binding cassette transporter, subfamily B, member 18, group 
MDR/PGP protein PpABCB18 [Physcomitrella patens]
Length=1251

 Score =   287 bits (734),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 127/250 (51%), Positives = 186/250 (74%), Gaps = 0/250 (0%)
 Frame = +3

Query  150  QQPSNSTDRKEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGH  329
            + P N  +    V ++ L+S AD+ D F +  G++GAC+HG A+PVFF+ FGR+I++ G 
Sbjct  2    EAPKNKKEEPPSVPYYKLYSFADSYDVFLIFLGTLGACVHGVAIPVFFIFFGRLINAFGE  61

Query  330  LSSDSHRLSSQVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKK  509
             + D   +S++VSK ALY ++L  ++ I+AW+ VA W  TGERQ+AR+R+ YL+++L + 
Sbjct  62   YADDPETMSTEVSKNALYFLFLAIVVLIAAWLEVACWMHTGERQSARMRVAYLKAMLAQD  121

Query  510  IEFFDTDTRAKDIIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVT  689
            + FFDTD    + +  ISSD +LVQDAI +K G+ + Y+++F+ GFAVGF SVW+LTLVT
Sbjct  122  VGFFDTDATTGETVSRISSDTLLVQDAISEKAGNYVHYMARFISGFAVGFTSVWQLTLVT  181

Query  690  LAVVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYS  869
            +AVVPLIA+AGG+Y ++M  L+ + + AY++AG++AEEAISQ+RTVYSFVGEKKAV+ YS
Sbjct  182  VAVVPLIAIAGGSYAVVMIGLTSRSQKAYSKAGEIAEEAISQIRTVYSFVGEKKAVKKYS  241

Query  870  KSLNNALVLG  899
             +L   L LG
Sbjct  242  NALETTLQLG  251


 Score = 84.7 bits (208),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 60/233 (26%), Positives = 108/233 (46%), Gaps = 19/233 (8%)
 Frame = +3

Query  216  DTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLSSDSHRLSSQVSKQALYLVYL  395
            +  ++ + V GS+GA + G   P+F +    M+ +    + D   +  +V K  L     
Sbjct  670  NAPEWPYAVLGSLGAIMTGCETPLFALAISEMLVTF--YNPDRDYVEHEVRKICL-----  722

Query  396  GSIIFISAWIGVA--------FWTQTGERQTARLRLRYLQSVLRKKIEFFDTDTRAKDII  551
               IF +A +G          ++   GE  T R+R     S+L +++ +FD ++   +++
Sbjct  723  ---IFSAATVGTVVIYVLQHYYYGLMGEILTMRVRKMLFSSILTQEVGWFDEESNNSNLV  779

Query  552  -FHISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLAVVPLIAVAGGT  728
               +SSDA LV+ A+GD++   ++  S  +  F + F   WK+  V L   PL+  A   
Sbjct  780  SARLSSDATLVKAAVGDRMSTIVQNFSLVVTAFCISFYLQWKVAGVVLLTFPLLVGAAVG  839

Query  729  YTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYSKSLNNA  887
              L +         AY  A  VA EA+  +RTV +F  E K ++ + + L+  
Sbjct  840  EQLFLKGFGGDLGKAYGRASMVAGEAVGNIRTVAAFCAEDKVLDLFIRELDEP  892



>emb|CDY27649.1| BnaA09g27580D [Brassica napus]
Length=1067

 Score =   277 bits (709),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 127/189 (67%), Positives = 155/189 (82%), Gaps = 0/189 (0%)
 Frame = +3

Query  237  MVFGSIGACIHGAALPVFFVLFGRMIDSLGHLSSDSHRLSSQVSKQALYLVYLGSIIFIS  416
            M  G+ G C+HG  LP+FFV FG+M+DSLG+LS+DS  +SS+VSK AL LVYLG +  +S
Sbjct  1    MFLGTFGTCVHGGTLPLFFVFFGKMLDSLGNLSTDSTAISSRVSKNALCLVYLGFVNLVS  60

Query  417  AWIGVAFWTQTGERQTARLRLRYLQSVLRKKIEFFDTDTRAKDIIFHISSDAILVQDAIG  596
            AW+GVA W QTGERQTARLR+ YL+S+L K I FFDT+ R  + IFHISSD ILVQDAIG
Sbjct  61   AWMGVACWMQTGERQTARLRINYLKSILAKDITFFDTEARDSNFIFHISSDTILVQDAIG  120

Query  597  DKIGHTIRYISQFLVGFAVGFISVWKLTLVTLAVVPLIAVAGGTYTLIMSNLSQKGEAAY  776
            DK GH +RY+ QF+ GF +GF+SVW+LTL+TLAVVPLIA+AGG Y LIMS +S+K EAAY
Sbjct  121  DKTGHVLRYLCQFIAGFVIGFLSVWQLTLLTLAVVPLIAIAGGGYALIMSTISKKSEAAY  180

Query  777  AEAGKVAEE  803
            A+AGKVAEE
Sbjct  181  ADAGKVAEE  189


 Score = 91.3 bits (225),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 71/260 (27%), Positives = 119/260 (46%), Gaps = 11/260 (4%)
 Frame = +3

Query  147  DQQPSNSTDRKEMV----SFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFVLFGRMI  314
            DQ+ +N  D  + +    S        +  ++ + + GSIGA + GA   +F      ++
Sbjct  486  DQEKTNEQDSNQEILSSSSMVWELIKLNVPEWSYALLGSIGAVLAGAQPALFSTGIAYVL  545

Query  315  DSLGHLSSDSHRLSSQVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARLRLRYLQS  494
            +     S     +   V K A+  V +G +  +   +   F+T  GER T+R+RL    +
Sbjct  546  NVF--YSPFPSVIKRDVEKVAIVFVGVGIVTPLIYLLQHYFYTLMGERLTSRVRLSLFSA  603

Query  495  VLRKKIEFFD-TDTRAKDIIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVW  671
            VL  ++ +FD  D     +   +++DA LV+ A+ D++   ++ +S      AV F   W
Sbjct  604  VLSNEVGWFDMEDNNTGSLTSILAADATLVRSALADRLSTIVQNLSLTFTALAVAFFYSW  663

Query  672  KLTLVTLAVVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKK  851
            ++  V  A  PL+  A  T  L +         AY++A  VA EAI  +RTV SF  EK 
Sbjct  664  RVAAVVTACFPLLIAASLTEQLFLKGFGGDYTRAYSKATSVAREAIENIRTVASFGAEKT  723

Query  852  AVESYS----KSLNNALVLG  899
              E ++    K   NA + G
Sbjct  724  ISEQFACELRKPTKNAFLRG  743



>ref|XP_002983053.1| hypothetical protein SELMODRAFT_117529 [Selaginella moellendorffii]
 gb|EFJ15862.1| hypothetical protein SELMODRAFT_117529 [Selaginella moellendorffii]
Length=1232

 Score =   278 bits (710),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 133/252 (53%), Positives = 179/252 (71%), Gaps = 1/252 (0%)
 Frame = +3

Query  144  MDQQPSNSTDRKEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSL  323
            +D +P         VS+  LFS AD +DY  +  G++GA +HGAA+P FFV FG+MID  
Sbjct  11   VDDEPVKEQPHA-TVSYLQLFSFADYLDYVLIFLGTVGASVHGAAIPGFFVFFGKMIDEF  69

Query  324  GHLSSDSHRLSSQVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVLR  503
            G   ++ H++  +VSK +LY VYLG +I ++AW+ V+ WT TGERQ++R+R  YL+++L 
Sbjct  70   GKDYNNPHKMGHEVSKYSLYFVYLGLVILVAAWLEVSCWTYTGERQSSRMRTHYLKAMLS  129

Query  504  KKIEFFDTDTRAKDIIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTL  683
            + + FFDTD    +I+  ISSD  LVQ+AIG K G+ + Y+++F  GFAVGF SVW+LTL
Sbjct  130  QDVGFFDTDATTGEIVIGISSDTALVQEAIGPKAGNYVHYMARFFAGFAVGFTSVWQLTL  189

Query  684  VTLAVVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVES  863
            +TLAVVP IAVAGG Y   M  L+ K + AYA AG++AEE ISQVRTVYSFVGE+KA ES
Sbjct  190  LTLAVVPAIAVAGGAYAYTMVGLTTKNQKAYARAGEIAEETISQVRTVYSFVGEEKAQES  249

Query  864  YSKSLNNALVLG  899
            YS++L   L LG
Sbjct  250  YSRALETTLKLG  261


 Score = 97.1 bits (240),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 64/215 (30%), Positives = 109/215 (51%), Gaps = 3/215 (1%)
 Frame = +3

Query  240  VFGSIGACIHGAALPVFFVLFGRMIDSLGHLSSDSHRLSSQVSKQALYLVYLGSIIFISA  419
            V G+ GA + G  +P F   FG     + + + D H +  +V K   +   L  +  ++ 
Sbjct  666  VLGAFGAILAGVEMPFF--AFGLTQVLVTYYNPDKHYVKKEVEKYVFFFTGLTILAVLAN  723

Query  420  WIGVAFWTQTGERQTARLRLRYLQSVLRKKIEFFD-TDTRAKDIIFHISSDAILVQDAIG  596
             +   F+   GE  T R+R     ++L+ ++ +F+  D  +  +   ++SDA LV+ A+G
Sbjct  724  TLEHYFFGYMGECLTMRVRNMMFSAILKNELGWFEKADNYSSLVSSQLASDATLVRAAVG  783

Query  597  DKIGHTIRYISQFLVGFAVGFISVWKLTLVTLAVVPLIAVAGGTYTLIMSNLSQKGEAAY  776
            D++   ++  +  L GF + F+  WKLTL+ LA+ PL+  A     L M          Y
Sbjct  784  DRLSILLQNSALILGGFIIAFVLQWKLTLIVLALFPLLISAHVGEHLFMKGFGVNLSKVY  843

Query  777  AEAGKVAEEAISQVRTVYSFVGEKKAVESYSKSLN  881
            A A  VA EA+S +RTV +F GE K +E +++ L 
Sbjct  844  ARASVVAGEAVSNIRTVAAFCGESKVLELFNRQLE  878



>ref|XP_002965566.1| ATP-binding cassette transporter [Selaginella moellendorffii]
 gb|EFJ32986.1| ATP-binding cassette transporter [Selaginella moellendorffii]
Length=1243

 Score =   275 bits (702),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 132/252 (52%), Positives = 178/252 (71%), Gaps = 1/252 (0%)
 Frame = +3

Query  144  MDQQPSNSTDRKEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSL  323
            +D +P         VS+  LFS AD +DY  +  G++GA +HGAA+P FFV FG+MID  
Sbjct  11   VDDEPVKEQPHA-TVSYLQLFSFADYLDYVLIFLGTVGASVHGAAIPGFFVFFGKMIDEF  69

Query  324  GHLSSDSHRLSSQVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVLR  503
            G   ++ H++  +VSK +LY VYLG +I ++AW+ V+ WT TGERQ++R+R  YL+++L 
Sbjct  70   GKDYNNPHKMGHEVSKYSLYFVYLGLVILVAAWLEVSCWTYTGERQSSRMRTHYLKAMLS  129

Query  504  KKIEFFDTDTRAKDIIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTL  683
            + + FFDTD    +I+  ISSD  LVQ+AIG K G+ + Y+++F  GFAVGF SVW+LTL
Sbjct  130  QDVGFFDTDATTGEIVIGISSDTALVQEAIGPKAGNYVHYMARFFAGFAVGFTSVWQLTL  189

Query  684  VTLAVVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVES  863
            +TLAVVP IAVAGG Y   M  L+ K + AYA AG++AEE ISQVRTVYSFVGE+KA E 
Sbjct  190  LTLAVVPAIAVAGGAYAYTMVGLTTKNQKAYARAGEIAEETISQVRTVYSFVGEEKAQEL  249

Query  864  YSKSLNNALVLG  899
            YS++L   L LG
Sbjct  250  YSRALETTLKLG  261


 Score = 97.1 bits (240),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 64/215 (30%), Positives = 109/215 (51%), Gaps = 3/215 (1%)
 Frame = +3

Query  240  VFGSIGACIHGAALPVFFVLFGRMIDSLGHLSSDSHRLSSQVSKQALYLVYLGSIIFISA  419
            V G+ GA + G  +P F   FG     + + + D H +  +V K   +   L  +  ++ 
Sbjct  677  VLGAFGAILAGVEMPFF--AFGLTQVLVTYYNPDKHYVKKEVEKYVFFFTGLTILAVLAN  734

Query  420  WIGVAFWTQTGERQTARLRLRYLQSVLRKKIEFFD-TDTRAKDIIFHISSDAILVQDAIG  596
             +   F+   GE  T R+R     ++L+ ++ +F+  D  +  +   ++SDA LV+ A+G
Sbjct  735  TLEHYFFGYMGECLTMRVRNMMFSAILKNELGWFEKADNYSSLVSSQLASDATLVRAAVG  794

Query  597  DKIGHTIRYISQFLVGFAVGFISVWKLTLVTLAVVPLIAVAGGTYTLIMSNLSQKGEAAY  776
            D++   ++  +  L GF + F+  WKLTL+ LA+ PL+  A     L M          Y
Sbjct  795  DRLSILLQNSALILGGFIIAFVLQWKLTLIVLALFPLLISAHVGEHLFMKGFGVNLSKVY  854

Query  777  AEAGKVAEEAISQVRTVYSFVGEKKAVESYSKSLN  881
            A A  VA EA+S +RTV +F GE K +E +++ L 
Sbjct  855  ARASVVAGEAVSNIRTVAAFCGESKVLELFNRQLE  889



>ref|XP_004173028.1| PREDICTED: ABC transporter B family member 19-like, partial [Cucumis 
sativus]
Length=848

 Score =   268 bits (685),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 122/248 (49%), Positives = 177/248 (71%), Gaps = 0/248 (0%)
 Frame = +3

Query  156  PSNSTDRKEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLS  335
            P     +++ + F  LFS AD  D+F M+ GS GA IHG+++PVFF+LFG M++  G   
Sbjct  12   PEPEKKKEQSLPFHQLFSFADKYDWFLMILGSFGAIIHGSSMPVFFLLFGEMVNGFGKNQ  71

Query  336  SDSHRLSSQVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKKIE  515
            S+ H+++++VSK ALY VYLG I+  S++  +A W  TGERQ + LR +YL++VL++ + 
Sbjct  72   SNFHKMTAEVSKYALYFVYLGLIVCFSSYAEIACWMYTGERQVSTLRKKYLEAVLKQDVG  131

Query  516  FFDTDTRAKDIIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLA  695
            FFDTD R  D++F +S+D +LVQDAI +K+G+ I Y+S FL G  VGF+S W+L L+++A
Sbjct  132  FFDTDARTGDVVFSVSTDTLLVQDAISEKVGNFIHYLSTFLAGLVVGFVSAWRLALLSIA  191

Query  696  VVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYSKS  875
            V+P IA AGG Y   ++ L+ K   +YA AG +AE+AI+QVRTVYS+VGE KA+ SYS S
Sbjct  192  VIPGIAFAGGLYAYTLTGLTSKSRESYANAGIIAEQAIAQVRTVYSYVGESKALNSYSDS  251

Query  876  LNNALVLG  899
            + N L +G
Sbjct  252  IQNTLKIG  259


 Score = 70.5 bits (171),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 48/205 (23%), Positives = 101/205 (49%), Gaps = 13/205 (6%)
 Frame = +3

Query  114  GELEISSNLKMDQQPSNSTDRKEMVS--FFGLFSAADTVDYFFMVFGSIGACIHGAALPV  287
            G +E+ SN +        TDRK      +F      +  ++ + + G++G+ + G   P 
Sbjct  650  GRIEMVSNAE--------TDRKNPAPDGYFLRLLKLNGPEWPYSIMGAVGSVLSGFISPT  701

Query  288  FFVLFGRMIDSLGHLSSDSHRLSSQVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTA  467
            F ++   MI+   + +S +  +  ++ +     + +G    ++  I   F+T  GE  T 
Sbjct  702  FAIVMSNMIEVFYYRNSSA--MERKIKEFVFIYIGIGVYAVVAYLIQHYFFTIMGENLTT  759

Query  468  RLRLRYLQSVLRKKIEFFDTDTRAKDIIF-HISSDAILVQDAIGDKIGHTIRYISQFLVG  644
            R+R   L ++LR ++ +FD +     ++   +++DA  V+ AI ++I   ++ ++     
Sbjct  760  RVRRMMLAAILRNEVGWFDEEEHNSSLVAARLATDAADVKSAIAERISVILQNMTSLFTS  819

Query  645  FAVGFISVWKLTLVTLAVVPLIAVA  719
            F V FI  W+++L+ LA  PL+ +A
Sbjct  820  FIVAFIVEWRVSLLILAAFPLLVLA  844



>ref|XP_006431131.1| hypothetical protein CICLE_v10010931mg [Citrus clementina]
 gb|ESR44371.1| hypothetical protein CICLE_v10010931mg [Citrus clementina]
Length=1252

 Score =   270 bits (690),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 123/248 (50%), Positives = 177/248 (71%), Gaps = 0/248 (0%)
 Frame = +3

Query  156  PSNSTDRKEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLS  335
            P     +++ + FF LFS AD  D+  M+FGS+GA IHG+++PVFF+LFG M++  G   
Sbjct  14   PEAEKKKEQSLPFFQLFSFADKYDWCLMIFGSLGAVIHGSSMPVFFLLFGEMVNGFGKNQ  73

Query  336  SDSHRLSSQVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKKIE  515
            +D H+++ +V K ALY VYLG I+  S++  +A W  TGERQ + LR +YL++VL++ + 
Sbjct  74   TDIHKMTHEVCKYALYFVYLGLIVCFSSYAEIACWMYTGERQVSTLRKKYLEAVLKQDVG  133

Query  516  FFDTDTRAKDIIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLA  695
            FFDTD R  DI+F +S+D +LVQDAI +K+G+ I Y+S FL G  VGF+S W+L L+++A
Sbjct  134  FFDTDARTGDIVFSVSTDTLLVQDAISEKVGNFIHYLSTFLAGLVVGFVSAWRLALLSIA  193

Query  696  VVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYSKS  875
            V+P IA AGG Y   ++ L+ K   +YA AG +AE+AI+QVRTVYS+VGE KA+ SYS +
Sbjct  194  VIPGIAFAGGLYAYTLTGLTSKSRESYANAGIIAEQAIAQVRTVYSYVGESKALNSYSDA  253

Query  876  LNNALVLG  899
            + N L LG
Sbjct  254  IQNTLKLG  261


 Score = 87.0 bits (214),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 62/260 (24%), Positives = 125/260 (48%), Gaps = 17/260 (7%)
 Frame = +3

Query  114  GELEISSNLKMDQQPSNSTDRKEMVS--FFGLFSAADTVDYFFMVFGSIGACIHGAALPV  287
            G +E+ SN +        TDRK      +F      +  ++ + + G+IG+ + G   P 
Sbjct  652  GRIEMVSNAE--------TDRKNPAPDGYFLRLLKLNAPEWPYSIMGAIGSVLSGFIGPT  703

Query  288  FFVLFGRMIDSLGHLSSDSHRLSSQVSKQALYLVYLGSIIF--ISAWIGVAFWTQTGERQ  461
            F ++   MI+   +     +  S +   +    +Y+G+ ++  ++  I   F++  GE  
Sbjct  704  FAIVMACMIEVFYY----RNPASMERKTKEFVFIYIGAGLYAVVAYLIQHYFFSIMGENL  759

Query  462  TARLRLRYLQSVLRKKIEFFDTDTRAKDIIF-HISSDAILVQDAIGDKIGHTIRYISQFL  638
            T R+R   L ++LR ++ +FD +     ++   +++DA  V+ AI D+I   ++ ++  L
Sbjct  760  TTRVRRMMLAAILRNEVGWFDEEEHNSSLVAARLATDAADVKSAIADRISVILQNMTSLL  819

Query  639  VGFAVGFISVWKLTLVTLAVVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQV  818
              F V FI  W+++L+ L   PL+ +A     L +   +     A+A+   +A E +S +
Sbjct  820  TSFIVAFIVEWRVSLLILGTYPLLVLANFAQQLSLKGFAGDTAKAHAKTSMIAGEGVSNI  879

Query  819  RTVYSFVGEKKAVESYSKSL  878
            RTV +F  + K +  +   L
Sbjct  880  RTVAAFNAQNKILSLFCHEL  899



>ref|XP_006482578.1| PREDICTED: ABC transporter B family member 19-like [Citrus sinensis]
Length=1252

 Score =   270 bits (690),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 123/248 (50%), Positives = 177/248 (71%), Gaps = 0/248 (0%)
 Frame = +3

Query  156  PSNSTDRKEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLS  335
            P     +++ + FF LFS AD  D+  M+FGS+GA IHG+++PVFF+LFG M++  G   
Sbjct  14   PEAEKKKEQSLPFFQLFSFADKYDWCLMIFGSLGAVIHGSSMPVFFLLFGEMVNGFGKNQ  73

Query  336  SDSHRLSSQVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKKIE  515
            +D H+++ +V K ALY VYLG I+  S++  +A W  TGERQ + LR +YL++VL++ + 
Sbjct  74   TDIHKMTHEVCKYALYFVYLGLIVCFSSYAEIACWMYTGERQVSTLRKKYLEAVLKQDVG  133

Query  516  FFDTDTRAKDIIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLA  695
            FFDTD R  DI+F +S+D +LVQDAI +K+G+ I Y+S FL G  VGF+S W+L L+++A
Sbjct  134  FFDTDARTGDIVFSVSTDTLLVQDAISEKVGNFIHYLSTFLAGLVVGFVSAWRLALLSIA  193

Query  696  VVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYSKS  875
            V+P IA AGG Y   ++ L+ K   +YA AG +AE+AI+QVRTVYS+VGE KA+ SYS +
Sbjct  194  VIPGIAFAGGLYAYTLTGLTSKSRESYANAGIIAEQAIAQVRTVYSYVGESKALNSYSDA  253

Query  876  LNNALVLG  899
            + N L LG
Sbjct  254  IQNTLKLG  261


 Score = 87.4 bits (215),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 62/260 (24%), Positives = 125/260 (48%), Gaps = 17/260 (7%)
 Frame = +3

Query  114  GELEISSNLKMDQQPSNSTDRKEMVS--FFGLFSAADTVDYFFMVFGSIGACIHGAALPV  287
            G +E+ SN +        TDRK      +F      +  ++ + + G+IG+ + G   P 
Sbjct  652  GRIEMVSNAE--------TDRKNPAPDGYFLRLLKLNAPEWPYSIMGAIGSVLSGFIGPT  703

Query  288  FFVLFGRMIDSLGHLSSDSHRLSSQVSKQALYLVYLGSIIF--ISAWIGVAFWTQTGERQ  461
            F ++   MI+   +     +  S +   +    +Y+G+ ++  ++  I   F++  GE  
Sbjct  704  FAIVMACMIEVFYY----RNPASMERKTKEFVFIYIGAGLYAVVAYLIQHYFFSIMGENL  759

Query  462  TARLRLRYLQSVLRKKIEFFDTDTRAKDIIF-HISSDAILVQDAIGDKIGHTIRYISQFL  638
            T R+R   L ++LR ++ +FD +     ++   +++DA  V+ AI D+I   ++ ++  L
Sbjct  760  TTRVRRMMLAAILRNEVGWFDEEEHNSSLVAARLATDAADVKSAIADRISVILQNMTSLL  819

Query  639  VGFAVGFISVWKLTLVTLAVVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQV  818
              F V FI  W+++L+ L   PL+ +A     L +   +     A+A+   +A E +S +
Sbjct  820  TSFIVAFIVEWRVSLLILGTYPLLVLANFAQQLSLKGFAGDTAKAHAKTSMIAGEGVSNI  879

Query  819  RTVYSFVGEKKAVESYSKSL  878
            RTV +F  + K +  +   L
Sbjct  880  RTVAAFNAQNKILSLFCHEL  899



>gb|KDO72551.1| hypothetical protein CISIN_1g000856mg [Citrus sinensis]
Length=1252

 Score =   270 bits (690),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 123/248 (50%), Positives = 177/248 (71%), Gaps = 0/248 (0%)
 Frame = +3

Query  156  PSNSTDRKEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLS  335
            P     +++ + FF LFS AD  D+  M+FGS+GA IHG+++PVFF+LFG M++  G   
Sbjct  14   PEAEKKKEQSLPFFQLFSFADKYDWCLMIFGSLGAVIHGSSMPVFFLLFGEMVNGFGKNQ  73

Query  336  SDSHRLSSQVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKKIE  515
            +D H+++ +V K ALY VYLG I+  S++  +A W  TGERQ + LR +YL++VL++ + 
Sbjct  74   TDIHKMTHEVCKYALYFVYLGLIVCFSSYAEIACWMYTGERQVSTLRKKYLEAVLKQDVG  133

Query  516  FFDTDTRAKDIIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLA  695
            FFDTD R  DI+F +S+D +LVQDAI +K+G+ I Y+S FL G  VGF+S W+L L+++A
Sbjct  134  FFDTDARTGDIVFSVSTDTLLVQDAISEKVGNFIHYLSTFLAGLVVGFVSAWRLALLSIA  193

Query  696  VVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYSKS  875
            V+P IA AGG Y   ++ L+ K   +YA AG +AE+AI+QVRTVYS+VGE KA+ SYS +
Sbjct  194  VIPGIAFAGGLYAYTLTGLTSKSRESYANAGIIAEQAIAQVRTVYSYVGESKALNSYSDA  253

Query  876  LNNALVLG  899
            + N L LG
Sbjct  254  IQNTLKLG  261


 Score = 87.4 bits (215),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 62/260 (24%), Positives = 125/260 (48%), Gaps = 17/260 (7%)
 Frame = +3

Query  114  GELEISSNLKMDQQPSNSTDRKEMVS--FFGLFSAADTVDYFFMVFGSIGACIHGAALPV  287
            G +E+ SN +        TDRK      +F      +  ++ + + G+IG+ + G   P 
Sbjct  652  GRIEMVSNAE--------TDRKNPAPDGYFLRLLKLNAPEWPYSIMGAIGSVLSGFIGPT  703

Query  288  FFVLFGRMIDSLGHLSSDSHRLSSQVSKQALYLVYLGSIIF--ISAWIGVAFWTQTGERQ  461
            F ++   MI+   +     +  S +   +    +Y+G+ ++  ++  I   F++  GE  
Sbjct  704  FAIVMACMIEVFYY----RNPASMERKTKEFVFIYIGAGLYAVVAYLIQHYFFSIMGENL  759

Query  462  TARLRLRYLQSVLRKKIEFFDTDTRAKDIIF-HISSDAILVQDAIGDKIGHTIRYISQFL  638
            T R+R   L ++LR ++ +FD +     ++   +++DA  V+ AI D+I   ++ ++  L
Sbjct  760  TTRVRRMMLAAILRNEVGWFDEEEHNSSLVAARLATDAADVKSAIADRISVILQNMTSLL  819

Query  639  VGFAVGFISVWKLTLVTLAVVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQV  818
              F V FI  W+++L+ L   PL+ +A     L +   +     A+A+   +A E +S +
Sbjct  820  TSFIVAFIVEWRVSLLILGTYPLLVLANFAQQLSLKGFAGDTAKAHAKTSMIAGEGVSNI  879

Query  819  RTVYSFVGEKKAVESYSKSL  878
            RTV +F  + K +  +   L
Sbjct  880  RTVAAFNAQNKILSLFCHEL  899



>ref|XP_007032498.1| ATP binding cassette subfamily B19 isoform 2 [Theobroma cacao]
 gb|EOY03424.1| ATP binding cassette subfamily B19 isoform 2 [Theobroma cacao]
Length=1216

 Score =   269 bits (687),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 123/248 (50%), Positives = 178/248 (72%), Gaps = 0/248 (0%)
 Frame = +3

Query  156  PSNSTDRKEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLS  335
            P     +++ + F+ LFS AD  DYF M+ GS+GA IHG+++PVFF+LFG M++  G   
Sbjct  11   PEAEKKKEQSLPFYQLFSFADKYDYFLMISGSLGAIIHGSSMPVFFLLFGEMVNGFGKNQ  70

Query  336  SDSHRLSSQVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKKIE  515
            SD  +++ +V+K ALY VYLG I+ +S++  +A W  TGERQ + LR +YL++VL++ + 
Sbjct  71   SDLSKMTHEVAKYALYFVYLGLIVCLSSYAEIACWMYTGERQVSTLRKKYLEAVLKQDVG  130

Query  516  FFDTDTRAKDIIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLA  695
            FFDTD R  DI+F +S+D +LVQDAI +K+G+ I Y+S FL G  VGF+S W+L L+++A
Sbjct  131  FFDTDARTGDIVFSVSTDTLLVQDAISEKVGNFIHYLSTFLAGLVVGFVSAWRLALLSVA  190

Query  696  VVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYSKS  875
            V+P IA AGG Y   ++ L+ K   +YA AG +AE+AI+QVRTVYS+VGE KA+ SYS +
Sbjct  191  VIPGIAFAGGLYAYTLTGLTSKSRESYANAGIIAEQAIAQVRTVYSYVGESKALNSYSDA  250

Query  876  LNNALVLG  899
            + N L LG
Sbjct  251  IQNTLKLG  258


 Score = 86.7 bits (213),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 61/251 (24%), Positives = 126/251 (50%), Gaps = 17/251 (7%)
 Frame = +3

Query  114  GELEISSNLKMDQQPSNSTDRKEMVS--FFGLFSAADTVDYFFMVFGSIGACIHGAALPV  287
            G +E+ SN +        TDRK      +F      +  ++ + + G++G+ + G   P 
Sbjct  649  GRIEMISNAE--------TDRKNPAPDGYFCRLLKLNAPEWPYSIMGAVGSVLSGFIGPT  700

Query  288  FFVLFGRMIDSLGHLSSDSHRLSSQVSKQALYLVYLGSIIF--ISAWIGVAFWTQTGERQ  461
            F ++   MI+   + +  S     + +K+ ++ +Y+G+ ++  I+  I   F++  GE  
Sbjct  701  FAIVMSNMIEVFYYTNPTSME---RKTKEYVF-IYIGAGLYAVIAYLIQHYFFSIMGENL  756

Query  462  TARLRLRYLQSVLRKKIEFFDTDTRAKDIIF-HISSDAILVQDAIGDKIGHTIRYISQFL  638
            T R+R   L ++LR ++ +FD +     ++   +++DA  V+ AI ++I   ++ ++  L
Sbjct  757  TTRVRRMMLGAILRNEVGWFDEEEHNSSLLAARLATDAADVKSAIAERISVILQNMTSLL  816

Query  639  VGFAVGFISVWKLTLVTLAVVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQV  818
              F V FI  W+++L+ L   PL+ +A     L +   +     A+A+   +A E +S +
Sbjct  817  TSFIVAFIVEWRVSLLILGTFPLLVLANFAQQLSLKGFAGDTAKAHAKTSMIAGEGVSNI  876

Query  819  RTVYSFVGEKK  851
            RTV +F  + K
Sbjct  877  RTVAAFNAQNK  887



>ref|XP_001774240.1| ATP-binding cassette transporter, subfamily B, member 24, group 
MDR protein PpABCB24 [Physcomitrella patens]
 gb|EDQ61016.1| ATP-binding cassette transporter, subfamily B, member 24, group 
MDR protein PpABCB24 [Physcomitrella patens]
Length=1236

 Score =   269 bits (688),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 125/247 (51%), Positives = 174/247 (70%), Gaps = 1/247 (0%)
 Frame = +3

Query  150  QQPSNSTDRKEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGH  329
            + P       E VS+  LFS ADTVDYF M  GS+GAC HG A+P+FFV FGR+I++ G 
Sbjct  5    EDPVKPPPEAE-VSYLKLFSFADTVDYFLMFLGSLGACAHGGAVPIFFVFFGRLINAFGF  63

Query  330  LSSDSHRLSSQVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKK  509
                 ++L  +V K+AL + YLG ++  ++W+ VA W QTGERQ+AR+R+RYLQS+L + 
Sbjct  64   NQHHPNKLGQEVGKEALSMFYLGLVVMFASWLEVACWIQTGERQSARIRVRYLQSILSQD  123

Query  510  IEFFDTDTRAKDIIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVT  689
            + +FDT     D++ H++ D  LVQDAI +K G+ I ++++F+VGFAVGF SVW+L+L T
Sbjct  124  VGYFDTSITTADVVGHVAQDISLVQDAISEKTGNFIHFMAKFIVGFAVGFSSVWQLSLTT  183

Query  690  LAVVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYS  869
            LAVVP I +AG  Y + M+  + K + AY +AGK AE+AI+QVRTVY++VGE   VE+YS
Sbjct  184  LAVVPAIVLAGCAYAMTMTGHATKSQQAYEDAGKKAEQAITQVRTVYAYVGEASEVEAYS  243

Query  870  KSLNNAL  890
            K L N L
Sbjct  244  KELQNTL  250


 Score = 89.0 bits (219),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 55/222 (25%), Positives = 106/222 (48%), Gaps = 3/222 (1%)
 Frame = +3

Query  225  DYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLSSDSHRLSSQVSKQALYLVYLGSI  404
            ++ F + GS GA I G   P+   + G+++ +    S D H +  +V K +        +
Sbjct  660  EWHFGLLGSFGAVIAGCEFPLAAFVIGQVLVTF--YSPDKHFMKKEVEKYSTIFAGAAIV  717

Query  405  IFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKKIEFFDTDTRAKDII-FHISSDAILV  581
            + +   +   F    GE  T R+R   LQ +L+ +I FF+ +    +++   +S+DA  V
Sbjct  718  VLLGHTMQHYFMASMGESLTKRVREVLLQRILQNEIAFFENEENNSNVLGMRLSTDAASV  777

Query  582  QDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLAVVPLIAVAGGTYTLIMSNLSQK  761
            + A+GD++   ++ ++  +   A+ F   W++  V +A  PL+  A     L +   S  
Sbjct  778  RAAVGDRLSTIVQNLALIVTALAIVFALEWRVAWVMIACFPLLIGALVGENLFLKGFSGD  837

Query  762  GEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYSKSLNNA  887
             + +Y     +  +A+S +RTV +F  E K +  Y + L N 
Sbjct  838  LDKSYQRTSMIIGDAVSNIRTVAAFCAEGKVLNLYIRELRNP  879



>ref|XP_007032497.1| ATP binding cassette subfamily B19 isoform 1 [Theobroma cacao]
 gb|EOY03423.1| ATP binding cassette subfamily B19 isoform 1 [Theobroma cacao]
Length=1256

 Score =   269 bits (688),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 123/248 (50%), Positives = 178/248 (72%), Gaps = 0/248 (0%)
 Frame = +3

Query  156  PSNSTDRKEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLS  335
            P     +++ + F+ LFS AD  DYF M+ GS+GA IHG+++PVFF+LFG M++  G   
Sbjct  11   PEAEKKKEQSLPFYQLFSFADKYDYFLMISGSLGAIIHGSSMPVFFLLFGEMVNGFGKNQ  70

Query  336  SDSHRLSSQVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKKIE  515
            SD  +++ +V+K ALY VYLG I+ +S++  +A W  TGERQ + LR +YL++VL++ + 
Sbjct  71   SDLSKMTHEVAKYALYFVYLGLIVCLSSYAEIACWMYTGERQVSTLRKKYLEAVLKQDVG  130

Query  516  FFDTDTRAKDIIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLA  695
            FFDTD R  DI+F +S+D +LVQDAI +K+G+ I Y+S FL G  VGF+S W+L L+++A
Sbjct  131  FFDTDARTGDIVFSVSTDTLLVQDAISEKVGNFIHYLSTFLAGLVVGFVSAWRLALLSVA  190

Query  696  VVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYSKS  875
            V+P IA AGG Y   ++ L+ K   +YA AG +AE+AI+QVRTVYS+VGE KA+ SYS +
Sbjct  191  VIPGIAFAGGLYAYTLTGLTSKSRESYANAGIIAEQAIAQVRTVYSYVGESKALNSYSDA  250

Query  876  LNNALVLG  899
            + N L LG
Sbjct  251  IQNTLKLG  258


 Score = 86.3 bits (212),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 61/251 (24%), Positives = 126/251 (50%), Gaps = 17/251 (7%)
 Frame = +3

Query  114  GELEISSNLKMDQQPSNSTDRKEMVS--FFGLFSAADTVDYFFMVFGSIGACIHGAALPV  287
            G +E+ SN +        TDRK      +F      +  ++ + + G++G+ + G   P 
Sbjct  649  GRIEMISNAE--------TDRKNPAPDGYFCRLLKLNAPEWPYSIMGAVGSVLSGFIGPT  700

Query  288  FFVLFGRMIDSLGHLSSDSHRLSSQVSKQALYLVYLGSIIF--ISAWIGVAFWTQTGERQ  461
            F ++   MI+   + +  S     + +K+ ++ +Y+G+ ++  I+  I   F++  GE  
Sbjct  701  FAIVMSNMIEVFYYTNPTSME---RKTKEYVF-IYIGAGLYAVIAYLIQHYFFSIMGENL  756

Query  462  TARLRLRYLQSVLRKKIEFFDTDTRAKDIIF-HISSDAILVQDAIGDKIGHTIRYISQFL  638
            T R+R   L ++LR ++ +FD +     ++   +++DA  V+ AI ++I   ++ ++  L
Sbjct  757  TTRVRRMMLGAILRNEVGWFDEEEHNSSLLAARLATDAADVKSAIAERISVILQNMTSLL  816

Query  639  VGFAVGFISVWKLTLVTLAVVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQV  818
              F V FI  W+++L+ L   PL+ +A     L +   +     A+A+   +A E +S +
Sbjct  817  TSFIVAFIVEWRVSLLILGTFPLLVLANFAQQLSLKGFAGDTAKAHAKTSMIAGEGVSNI  876

Query  819  RTVYSFVGEKK  851
            RTV +F  + K
Sbjct  877  RTVAAFNAQNK  887



>ref|XP_010692517.1| PREDICTED: uncharacterized protein LOC104905624 [Beta vulgaris 
subsp. vulgaris]
Length=2676

 Score =   271 bits (694),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 131/197 (66%), Positives = 163/197 (83%), Gaps = 7/197 (4%)
 Frame = +3

Query  330   LSSDSHRLSSQVS-------KQALYLVYLGSIIFISAWIGVAFWTQTGERQTARLRLRYL  488
             + +DS+    Q+S       + +LYLVYLG I F  +WIGVAFW QTGERQTARLRL+YL
Sbjct  1495  IKNDSNLWVKQISFICSCHLQNSLYLVYLGLITFACSWIGVAFWMQTGERQTARLRLKYL  1554

Query  489   QSVLRKKIEFFDTDTRAKDIIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISV  668
             Q+VL+K + +FDT+ + ++++F ISSD IL+QDAIGDKIGH++RY+SQF++GF +GF+SV
Sbjct  1555  QAVLKKDMIYFDTEAQNQNLVFQISSDTILIQDAIGDKIGHSLRYLSQFVMGFILGFMSV  1614

Query  669   WKLTLVTLAVVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEK  848
             WKLTLVTL+VVPLIAVAGG YT+IMS LSQK EAAYAE+GKVAEE ISQVRTVYSFVGEK
Sbjct  1615  WKLTLVTLSVVPLIAVAGGAYTVIMSTLSQKAEAAYAESGKVAEEVISQVRTVYSFVGEK  1674

Query  849   KAVESYSKSLNNALVLG  899
             +AVE YS+SL  A+  G
Sbjct  1675  RAVERYSRSLQKAVKFG  1691


 Score = 87.8 bits (216),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 75/260 (29%), Positives = 125/260 (48%), Gaps = 12/260 (5%)
 Frame = +3

Query  117   ELEISSNLKMDQQPSNSTDRKEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFV  296
             E  IS N K D   S +TD K     F      +  ++ + + GSIGA + G   P+F  
Sbjct  2072  EQPISKNNKED---SKTTDYKR--PSFKELVMLNASEFPYAILGSIGAALVGIQAPLFAF  2126

Query  297   LFGRMIDSLGHLSSDSHRLSSQVSKQALYLVYLG-SIIFISAWIGVA-FWTQTGERQTAR  470
                 M+ +    S++  R+   V  Q    V+LG ++I I  ++    F+T  GER TAR
Sbjct  2127  GITYMLTAF--YSNNEARIKHDV--QITAFVFLGVAVITIPIYLMQQYFYTLMGERITAR  2182

Query  471   LRLRYLQSVLRKKIEFFD-TDTRAKDIIFHISSDAILVQDAIGDKIGHTIRYISQFLVGF  647
             +RL    ++L  +I +FD  +     +   ++ DA LV+ A+ D++   ++  +     F
Sbjct  2183  VRLLMFSAILSNEIGWFDLEENNVGSLTSKLAGDATLVRTALVDRLSTIVQNTALITAAF  2242

Query  648   AVGFISVWKLTLVTLAVVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTV  827
             AV F   W++  VT+ + PLI  A     L +        +AY +A  +A EAIS +RTV
Sbjct  2243  AVAFKLSWRIAAVTIVMFPLIIGASVAEQLFLKGFGGDYTSAYYQANSLAREAISNIRTV  2302

Query  828   YSFVGEKKAVESYSKSLNNA  887
              +F  E++  + ++  L   
Sbjct  2303  AAFGVEEQISKQFAMHLKKP  2322



>ref|XP_008459308.1| PREDICTED: ABC transporter B family member 19 [Cucumis melo]
Length=1250

 Score =   268 bits (685),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 122/248 (49%), Positives = 177/248 (71%), Gaps = 0/248 (0%)
 Frame = +3

Query  156  PSNSTDRKEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLS  335
            P     +++ + F  LFS AD  D+F M+ GS GA IHG+++PVFF+LFG M++  G   
Sbjct  12   PEPEKKKEQSLPFHQLFSFADKYDWFLMILGSFGAIIHGSSMPVFFLLFGEMVNGFGKNQ  71

Query  336  SDSHRLSSQVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKKIE  515
            S+ H+++++VSK ALY VYLG I+  S++  +A W  TGERQ + LR +YL++VL++ + 
Sbjct  72   SNFHKMTAEVSKYALYFVYLGLIVCFSSYAEIACWMYTGERQVSTLRKKYLEAVLKQDVG  131

Query  516  FFDTDTRAKDIIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLA  695
            FFDTD R  D++F +S+D +LVQDAI +K+G+ I Y+S FL G  VGF+S W+L L+++A
Sbjct  132  FFDTDARTGDVVFSVSTDTLLVQDAISEKVGNFIHYLSTFLAGLVVGFVSAWRLALLSIA  191

Query  696  VVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYSKS  875
            V+P IA AGG Y   ++ L+ K   +YA AG +AE+AI+QVRTVYS+VGE KA+ SYS S
Sbjct  192  VIPGIAFAGGLYAYTLTGLTSKSRESYANAGIIAEQAIAQVRTVYSYVGESKALNSYSDS  251

Query  876  LNNALVLG  899
            + N L +G
Sbjct  252  IQNTLKIG  259


 Score = 86.7 bits (213),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 60/258 (23%), Positives = 124/258 (48%), Gaps = 13/258 (5%)
 Frame = +3

Query  114  GELEISSNLKMDQQPSNSTDRKEMVS--FFGLFSAADTVDYFFMVFGSIGACIHGAALPV  287
            G +E+ SN +        TDRK      +F      +  ++ + + G++G+ + G   P 
Sbjct  650  GRIEMVSNAE--------TDRKNPAPDGYFLRLLKLNGPEWPYSIMGAVGSVLSGFISPT  701

Query  288  FFVLFGRMIDSLGHLSSDSHRLSSQVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTA  467
            F ++   MI+   + +S +  +  ++ +     + +G    ++  I   F+T  GE  T 
Sbjct  702  FAIVMSNMIEVFYYRNSSA--MERKIKEFVFIYIGIGVYAVVAYLIQHYFFTIMGENLTT  759

Query  468  RLRLRYLQSVLRKKIEFFDTDTRAKDIIF-HISSDAILVQDAIGDKIGHTIRYISQFLVG  644
            R+R   L ++LR ++ +FD +     ++   +++DA  V+ AI ++I   ++ ++     
Sbjct  760  RVRRMMLAAILRNEVGWFDEEEHNSSLVAARLATDAADVKSAIAERISVILQNMTSLFTS  819

Query  645  FAVGFISVWKLTLVTLAVVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRT  824
            F V FI  W+++L+ LA  PL+ +A     L +   +     A+A+   +A E +S +RT
Sbjct  820  FIVAFIVEWRVSLLILAAFPLLVLANMAQQLSLKGFAGDTAKAHAKTSMIAGEGVSNIRT  879

Query  825  VYSFVGEKKAVESYSKSL  878
            V +F  + K +  +   L
Sbjct  880  VAAFNAQDKILSLFRHEL  897



>gb|AAP72956.1| putative MDR-like P-glycoprotein [Lactuca sativa]
Length=1251

 Score =   268 bits (684),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 126/249 (51%), Positives = 179/249 (72%), Gaps = 1/249 (0%)
 Frame = +3

Query  156  PSNSTDRKEM-VSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHL  332
            P+ +  RKE  + F+ LFS AD  DY  M+ GSIGA IHG+++P FF+LFG+MI+  G  
Sbjct  12   PAQAEKRKEQSIPFYQLFSFADKFDYALMILGSIGAIIHGSSMPFFFLLFGQMINGFGKN  71

Query  333  SSDSHRLSSQVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKKI  512
             SD + ++ +VSK ALY VYLG ++ IS++  +  W  TGERQ + LR RYL++VL++ +
Sbjct  72   QSDLNTMTHEVSKYALYFVYLGLVVCISSYAEIGCWMYTGERQVSTLRKRYLEAVLKQDV  131

Query  513  EFFDTDTRAKDIIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTL  692
             F+DTD R  DI+F +S+D +LVQDAI +K+G+ I Y+S FL G  VGF+S WKL L+++
Sbjct  132  GFYDTDARTGDIVFSVSTDTLLVQDAISEKVGNFIHYLSTFLAGLVVGFVSAWKLALLSV  191

Query  693  AVVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYSK  872
            AV+P IA AGG Y   ++ L+ K   +YA AG +AE+AI+QVRTVYS+VGE KA++SYS 
Sbjct  192  AVIPGIAFAGGLYAYTLTGLTSKSRESYANAGIIAEQAIAQVRTVYSYVGETKALDSYSD  251

Query  873  SLNNALVLG  899
            ++ + L LG
Sbjct  252  AIQHTLKLG  260



>ref|XP_002517493.1| multidrug resistance protein 1, 2, putative [Ricinus communis]
 gb|EEF45035.1| multidrug resistance protein 1, 2, putative [Ricinus communis]
Length=1259

 Score =   268 bits (684),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 124/261 (48%), Positives = 181/261 (69%), Gaps = 0/261 (0%)
 Frame = +3

Query  117  ELEISSNLKMDQQPSNSTDRKEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFV  296
            E   +S  K    P     +++ + F+ LFS AD  D+  M+ GS GA IHG+++PVFF+
Sbjct  8    ESNTTSTTKAPLPPEAEKKKEQSLPFYQLFSFADNYDWLLMISGSTGAIIHGSSMPVFFL  67

Query  297  LFGRMIDSLGHLSSDSHRLSSQVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARLR  476
            LFG M++  G   SD  +++ +VSK ALY VYLG ++ +S++  +A W  TGERQ + LR
Sbjct  68   LFGEMVNGFGKNQSDLTKMTHEVSKYALYFVYLGLVVCLSSYAEIACWMYTGERQVSTLR  127

Query  477  LRYLQSVLRKKIEFFDTDTRAKDIIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAVG  656
             +YL++VL++ + FFDTD R  DI+F +S+D +LVQDAI +K+G+ I Y+S FL G  VG
Sbjct  128  KKYLEAVLKQDVGFFDTDARTGDIVFSVSTDTLLVQDAISEKVGNFIHYLSTFLAGLVVG  187

Query  657  FISVWKLTLVTLAVVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSF  836
            F+S W+L L+++AV+P IA AGG Y   ++ L+ K   +YA+AG +AE+AI+QVRTVYS+
Sbjct  188  FVSAWRLALLSVAVIPGIAFAGGLYAYTLTGLTSKSRESYAQAGIIAEQAIAQVRTVYSY  247

Query  837  VGEKKAVESYSKSLNNALVLG  899
            VGE KA+ SYS ++ N L LG
Sbjct  248  VGESKALNSYSDAIQNTLKLG  268


 Score = 85.9 bits (211),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 62/261 (24%), Positives = 131/261 (50%), Gaps = 17/261 (7%)
 Frame = +3

Query  114  GELEISSNLKMDQQPSNSTDRKEMVS--FFGLFSAADTVDYFFMVFGSIGACIHGAALPV  287
            G +E+ SN +        T+RK      +F      +  ++ + + G+IG+ + G   P 
Sbjct  659  GRIEMISNAE--------TERKNPAPDGYFCRLLKLNAPEWPYSIMGAIGSVLSGFIGPT  710

Query  288  FFVLFGRMIDSLGHLSSDSHRLSSQVSKQALYLVYLGSIIF--ISAWIGVAFWTQTGERQ  461
            F ++   MI+   + +  S     + +K+ ++ +Y+G+ ++  ++  I   F++  GE  
Sbjct  711  FAIVMSNMIEVFYYRNPASME---RKTKEYVF-IYIGAGLYAVVAYLIQHYFFSIMGENL  766

Query  462  TARLRLRYLQSVLRKKIEFFDTDTRAKDIIF-HISSDAILVQDAIGDKIGHTIRYISQFL  638
            T R+R   L ++LR ++ +FD +     ++   +++DA  V+ AI ++I   ++ ++  L
Sbjct  767  TTRVRRMMLAAILRNEVGWFDEEEHNSSLVAARLATDAADVKSAIAERISVILQNMTSLL  826

Query  639  VGFAVGFISVWKLTLVTLAVVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQV  818
              F V FI  W+++L+ LA  PL+ +A     L +   +     A+A+   +A E +S +
Sbjct  827  TSFIVAFIVEWRVSLLILATFPLLVLANFAQQLSLKGFAGDTAKAHAKTSMIAGEGVSNI  886

Query  819  RTVYSFVGEKKAVESYSKSLN  881
            RTV +F  + K +  +   L+
Sbjct  887  RTVAAFNAQDKILSLFCHELS  907



>ref|XP_004148691.1| PREDICTED: ABC transporter B family member 19-like [Cucumis sativus]
Length=1250

 Score =   268 bits (684),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 122/248 (49%), Positives = 177/248 (71%), Gaps = 0/248 (0%)
 Frame = +3

Query  156  PSNSTDRKEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLS  335
            P     +++ + F  LFS AD  D+F M+ GS GA IHG+++PVFF+LFG M++  G   
Sbjct  12   PEPEKKKEQSLPFHQLFSFADKYDWFLMILGSFGAIIHGSSMPVFFLLFGEMVNGFGKNQ  71

Query  336  SDSHRLSSQVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKKIE  515
            S+ H+++++VSK ALY VYLG I+  S++  +A W  TGERQ + LR +YL++VL++ + 
Sbjct  72   SNFHKMTAEVSKYALYFVYLGLIVCFSSYAEIACWMYTGERQVSTLRKKYLEAVLKQDVG  131

Query  516  FFDTDTRAKDIIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLA  695
            FFDTD R  D++F +S+D +LVQDAI +K+G+ I Y+S FL G  VGF+S W+L L+++A
Sbjct  132  FFDTDARTGDVVFSVSTDTLLVQDAISEKVGNFIHYLSTFLAGLVVGFLSAWRLALLSIA  191

Query  696  VVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYSKS  875
            V+P IA AGG Y   ++ L+ K   +YA AG +AE+AI+QVRTVYS+VGE KA+ SYS S
Sbjct  192  VIPGIAFAGGLYAYTLTGLTSKSRESYANAGIIAEQAIAQVRTVYSYVGESKALNSYSDS  251

Query  876  LNNALVLG  899
            + N L +G
Sbjct  252  IQNTLKIG  259


 Score = 86.7 bits (213),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 60/258 (23%), Positives = 124/258 (48%), Gaps = 13/258 (5%)
 Frame = +3

Query  114  GELEISSNLKMDQQPSNSTDRKEMVS--FFGLFSAADTVDYFFMVFGSIGACIHGAALPV  287
            G +E+ SN +        TDRK      +F      +  ++ + + G++G+ + G   P 
Sbjct  650  GRIEMVSNAE--------TDRKNPAPDGYFLRLLKLNGPEWPYSIMGAVGSVLSGFISPT  701

Query  288  FFVLFGRMIDSLGHLSSDSHRLSSQVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTA  467
            F ++   MI+   + +S +  +  ++ +     + +G    ++  I   F+T  GE  T 
Sbjct  702  FAIVMSNMIEVFYYRNSSA--MERKIKEFVFIYIGIGVYAVVAYLIQHYFFTIMGENLTT  759

Query  468  RLRLRYLQSVLRKKIEFFDTDTRAKDIIF-HISSDAILVQDAIGDKIGHTIRYISQFLVG  644
            R+R   L ++LR ++ +FD +     ++   +++DA  V+ AI ++I   ++ ++     
Sbjct  760  RVRRMMLAAILRNEVGWFDEEEHNSSLVAARLATDAADVKSAIAERISVILQNMTSLFTS  819

Query  645  FAVGFISVWKLTLVTLAVVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRT  824
            F V FI  W+++L+ LA  PL+ +A     L +   +     A+A+   +A E +S +RT
Sbjct  820  FIVAFIVEWRVSLLILAAFPLLVLANMAQQLSLKGFAGDTAKAHAKTSMIAGEGVSNIRT  879

Query  825  VYSFVGEKKAVESYSKSL  878
            V +F  + K +  +   L
Sbjct  880  VAAFNAQDKILSLFCHEL  897



>ref|XP_002323847.1| multidrug resistance P-glycoprotein [Populus trichocarpa]
 gb|EEF03980.1| multidrug resistance P-glycoprotein [Populus trichocarpa]
Length=1251

 Score =   268 bits (684),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 122/248 (49%), Positives = 179/248 (72%), Gaps = 0/248 (0%)
 Frame = +3

Query  156  PSNSTDRKEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLS  335
            P     +++ + F+ LFS AD  D+  M+ GSIGA IHG+++PVFF+LFG M++  G   
Sbjct  13   PEAEKKKEQSLPFYQLFSFADKYDWLLMISGSIGAIIHGSSMPVFFLLFGEMVNGFGKNQ  72

Query  336  SDSHRLSSQVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKKIE  515
            SD ++++ +VSK ALY VYLG ++ +S++  +A W  TGERQ + LR +YL++VL++ + 
Sbjct  73   SDLYKMTHEVSKYALYFVYLGIVVCLSSYAEIACWMYTGERQVSTLRKKYLEAVLKQDVG  132

Query  516  FFDTDTRAKDIIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLA  695
            FFDTD R  DI+F +S+D +LVQDAI +K+G+ I Y+S FL G  VGF+S W+L L+++A
Sbjct  133  FFDTDARTGDIVFSVSTDTLLVQDAISEKVGNFIHYLSTFLAGLVVGFVSAWRLALLSVA  192

Query  696  VVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYSKS  875
            V+P IA AGG Y   ++ L+ K   +YA+AG +AE+AI+QVRTVYSFVGE KA+ SY+ +
Sbjct  193  VIPGIAFAGGLYAYTLTGLTSKSRESYAQAGIIAEQAIAQVRTVYSFVGESKALSSYTDA  252

Query  876  LNNALVLG  899
            + N L LG
Sbjct  253  IQNTLKLG  260


 Score = 87.4 bits (215),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 62/260 (24%), Positives = 130/260 (50%), Gaps = 17/260 (7%)
 Frame = +3

Query  114  GELEISSNLKMDQQPSNSTDRKEMVS--FFGLFSAADTVDYFFMVFGSIGACIHGAALPV  287
            G +E+ SN +        TDRK      +F      +  ++ + + G++G+ + G   P 
Sbjct  651  GRIEMISNAE--------TDRKNPAPDGYFCRLLKLNAPEWPYSIMGAVGSVLSGFIGPT  702

Query  288  FFVLFGRMIDSLGHLSSDSHRLSSQVSKQALYLVYLGSIIF--ISAWIGVAFWTQTGERQ  461
            F ++   MI+   + +  S     + +K+ ++ +Y+G+ ++  ++  I   F++  GE  
Sbjct  703  FAIVMSNMIEVFYYRNPASME---RKTKEYVF-IYIGAGLYAVVAYLIQHYFFSIMGENL  758

Query  462  TARLRLRYLQSVLRKKIEFFDTDTRAKDIIF-HISSDAILVQDAIGDKIGHTIRYISQFL  638
            T R+R   L ++LR ++ +FD +     ++   +++DA  V+ AI ++I   ++ ++  L
Sbjct  759  TTRVRRMMLAAILRNEVGWFDEEEHNSSLVAARLATDAADVKSAIAERISVILQNMTSLL  818

Query  639  VGFAVGFISVWKLTLVTLAVVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQV  818
              F V FI  W+++L+ LA  PL+ +A     L +   +     A+A+   +A E +S +
Sbjct  819  TSFIVAFIVEWRVSLLILATFPLLVLANFAQQLSLKGFAGDTAKAHAKTSMIAGEGVSNI  878

Query  819  RTVYSFVGEKKAVESYSKSL  878
            RTV +F  + K +  +   L
Sbjct  879  RTVAAFNAQGKVLSLFCHEL  898



>ref|XP_011008935.1| PREDICTED: ABC transporter B family member 19 [Populus euphratica]
Length=1251

 Score =   268 bits (684),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 122/248 (49%), Positives = 179/248 (72%), Gaps = 0/248 (0%)
 Frame = +3

Query  156  PSNSTDRKEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLS  335
            P     +++ + F+ LFS AD  D+  M+ GSIGA IHG+++PVFF+LFG M++  G   
Sbjct  13   PEAEKKKEQSLPFYQLFSFADKYDWLLMISGSIGAIIHGSSMPVFFLLFGEMVNGFGKNQ  72

Query  336  SDSHRLSSQVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKKIE  515
            SD ++++ +VSK ALY VYLG ++ +S++  +A W  TGERQ + LR +YL++VL++ + 
Sbjct  73   SDLYKMTHEVSKYALYFVYLGIVVCLSSYAEIACWMYTGERQVSTLRKKYLEAVLKQDVG  132

Query  516  FFDTDTRAKDIIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLA  695
            FFDTD R  DI+F +S+D +LVQDAI +K+G+ I Y+S FL G  VGF+S W+L L+++A
Sbjct  133  FFDTDARTGDIVFSVSTDTLLVQDAISEKVGNFIHYLSTFLAGLVVGFVSAWRLALLSVA  192

Query  696  VVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYSKS  875
            V+P IA AGG Y   ++ L+ K   +YA+AG +AE+AI+QVRTVYSFVGE KA+ SY+ +
Sbjct  193  VIPGIAFAGGLYAYTLTGLTSKSRESYAQAGIIAEQAIAQVRTVYSFVGESKALSSYTDA  252

Query  876  LNNALVLG  899
            + N L LG
Sbjct  253  IQNTLKLG  260


 Score = 86.7 bits (213),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 62/260 (24%), Positives = 130/260 (50%), Gaps = 17/260 (7%)
 Frame = +3

Query  114  GELEISSNLKMDQQPSNSTDRKEMVS--FFGLFSAADTVDYFFMVFGSIGACIHGAALPV  287
            G +E+ SN +        TDRK      +F      +  ++ + + G+IG+ + G   P 
Sbjct  651  GRIEMISNAE--------TDRKNPAPDGYFCRLLKLNAPEWPYSIMGAIGSVLSGFIGPT  702

Query  288  FFVLFGRMIDSLGHLSSDSHRLSSQVSKQALYLVYLGSIIF--ISAWIGVAFWTQTGERQ  461
            F ++   MI+   + +  S     + +K+ ++ +Y+G+ ++  ++  I   F++  GE  
Sbjct  703  FAIVMSNMIEVFYYRNPASME---RKTKEYVF-IYIGAGLYAVVAYLIQHYFFSIMGENL  758

Query  462  TARLRLRYLQSVLRKKIEFFDTDTRAKDIIF-HISSDAILVQDAIGDKIGHTIRYISQFL  638
            T R+R   L ++L+ ++ +FD +     ++   +++DA  V+ AI ++I   ++ ++  L
Sbjct  759  TTRVRRMMLAAILKNEVGWFDEEEHNSSLVAARLATDAADVKSAIAERISVILQNMTSLL  818

Query  639  VGFAVGFISVWKLTLVTLAVVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQV  818
              F V FI  W+++L+ LA  PL+ +A     L +   +     A+A+   +A E +S +
Sbjct  819  TSFIVAFIVEWRVSLLILATFPLLVLANFAQQLSLKGFAGDTAKAHAKTSMIAGEGVSNI  878

Query  819  RTVYSFVGEKKAVESYSKSL  878
            RTV +F  + K +  +   L
Sbjct  879  RTVAAFNAQGKVLSLFCHEL  898



>gb|KGN52452.1| Multidrug resistance protein 1, 2 [Cucumis sativus]
Length=1361

 Score =   268 bits (685),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 122/248 (49%), Positives = 177/248 (71%), Gaps = 0/248 (0%)
 Frame = +3

Query  156  PSNSTDRKEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLS  335
            P     +++ + F  LFS AD  D+F M+ GS GA IHG+++PVFF+LFG M++  G   
Sbjct  123  PEPEKKKEQSLPFHQLFSFADKYDWFLMILGSFGAIIHGSSMPVFFLLFGEMVNGFGKNQ  182

Query  336  SDSHRLSSQVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKKIE  515
            S+ H+++++VSK ALY VYLG I+  S++  +A W  TGERQ + LR +YL++VL++ + 
Sbjct  183  SNFHKMTAEVSKYALYFVYLGLIVCFSSYAEIACWMYTGERQVSTLRKKYLEAVLKQDVG  242

Query  516  FFDTDTRAKDIIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLA  695
            FFDTD R  D++F +S+D +LVQDAI +K+G+ I Y+S FL G  VGF+S W+L L+++A
Sbjct  243  FFDTDARTGDVVFSVSTDTLLVQDAISEKVGNFIHYLSTFLAGLVVGFVSAWRLALLSIA  302

Query  696  VVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYSKS  875
            V+P IA AGG Y   ++ L+ K   +YA AG +AE+AI+QVRTVYS+VGE KA+ SYS S
Sbjct  303  VIPGIAFAGGLYAYTLTGLTSKSRESYANAGIIAEQAIAQVRTVYSYVGESKALNSYSDS  362

Query  876  LNNALVLG  899
            + N L +G
Sbjct  363  IQNTLKIG  370


 Score = 87.4 bits (215),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 60/258 (23%), Positives = 124/258 (48%), Gaps = 13/258 (5%)
 Frame = +3

Query  114   GELEISSNLKMDQQPSNSTDRKEMVS--FFGLFSAADTVDYFFMVFGSIGACIHGAALPV  287
             G +E+ SN +        TDRK      +F      +  ++ + + G++G+ + G   P 
Sbjct  761   GRIEMVSNAE--------TDRKNPAPDGYFLRLLKLNGPEWPYSIMGAVGSVLSGFISPT  812

Query  288   FFVLFGRMIDSLGHLSSDSHRLSSQVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTA  467
             F ++   MI+   + +S +  +  ++ +     + +G    ++  I   F+T  GE  T 
Sbjct  813   FAIVMSNMIEVFYYRNSSA--MERKIKEFVFIYIGIGVYAVVAYLIQHYFFTIMGENLTT  870

Query  468   RLRLRYLQSVLRKKIEFFDTDTRAKDIIF-HISSDAILVQDAIGDKIGHTIRYISQFLVG  644
             R+R   L ++LR ++ +FD +     ++   +++DA  V+ AI ++I   ++ ++     
Sbjct  871   RVRRMMLAAILRNEVGWFDEEEHNSSLVAARLATDAADVKSAIAERISVILQNMTSLFTS  930

Query  645   FAVGFISVWKLTLVTLAVVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRT  824
             F V FI  W+++L+ LA  PL+ +A     L +   +     A+A+   +A E +S +RT
Sbjct  931   FIVAFIVEWRVSLLILAAFPLLVLANMAQQLSLKGFAGDTAKAHAKTSMIAGEGVSNIRT  990

Query  825   VYSFVGEKKAVESYSKSL  878
             V +F  + K +  +   L
Sbjct  991   VAAFNAQDKILSLFCHEL  1008



>gb|KEH24996.1| ABC transporter B family protein [Medicago truncatula]
Length=1250

 Score =   267 bits (682),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 123/248 (50%), Positives = 177/248 (71%), Gaps = 0/248 (0%)
 Frame = +3

Query  156  PSNSTDRKEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLS  335
            P     +++ + FF LFS AD  D+  M+ GSIGA IHG+++PVFF+LFG+M++  G   
Sbjct  12   PEAEKKKEQSLPFFQLFSFADKYDWILMISGSIGAIIHGSSMPVFFLLFGQMVNGFGKNQ  71

Query  336  SDSHRLSSQVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKKIE  515
             D  +++ +VSK ALY VYLG ++ IS++  +A W  TGERQ + LR +YL++VL++ + 
Sbjct  72   MDLKKMTDEVSKYALYFVYLGLVVCISSYAEIACWMYTGERQVSTLRKKYLEAVLKQDVG  131

Query  516  FFDTDTRAKDIIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLA  695
            FFDTD R  DI+F +S+D +LVQDAI +K+G+ I Y+S FL G  VGF+S W+L L+++A
Sbjct  132  FFDTDARTGDIVFSVSTDTLLVQDAISEKVGNFIHYLSTFLAGLVVGFVSAWRLALLSVA  191

Query  696  VVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYSKS  875
            V+P IA AGG Y   ++ L+ K   +YA AG +AE+AI+QVRTVYS+VGE KA+ SYS +
Sbjct  192  VIPGIAFAGGLYAYTLTGLTSKSRESYANAGIIAEQAIAQVRTVYSYVGESKALNSYSDA  251

Query  876  LNNALVLG  899
            + N L LG
Sbjct  252  IQNTLKLG  259


 Score = 83.6 bits (205),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 62/259 (24%), Positives = 128/259 (49%), Gaps = 15/259 (6%)
 Frame = +3

Query  114  GELEISSNLKMDQQPSNSTDRKEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFF  293
            G +E+ SN + D++ + + D      +F      +  ++ + + G++G  + G   P F 
Sbjct  650  GRIEMISNAETDKK-NPAPD-----GYFFRLLKMNAPEWPYSIMGAVGYVLSGFIGPTFA  703

Query  294  VLFGRMIDSLGHLSSDSHRLSSQVSKQALYL-VYLGSIIF-ISAW-IGVAFWTQTGERQT  464
            ++   MI+   +        +S   K   Y+ +Y+G+ I+ + A+ I   F++  GE  T
Sbjct  704  IVMSNMIEVFYY-----RNYASMEKKTKEYVFIYIGAGIYAVGAYLIQHYFFSIMGENLT  758

Query  465  ARLRLRYLQSVLRKKIEFFDTDTRAKDIIF-HISSDAILVQDAIGDKIGHTIRYISQFLV  641
             R+R   L ++LR ++ +FD +     ++   +++DA  V+ AI ++I   ++ ++  L 
Sbjct  759  TRVRRMMLAAILRNEVGWFDEEEHNSSLVAARLATDAADVKSAIAERISVILQNMTSLLT  818

Query  642  GFAVGFISVWKLTLVTLAVVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVR  821
             F V FI  W+++L+ L   PL+ +A     L +   +     A+A+   +A E +S +R
Sbjct  819  SFIVAFIVEWRVSLLILGTFPLLVLANFAQQLSLKGFAGDTAKAHAKTSMIAGEGVSNIR  878

Query  822  TVYSFVGEKKAVESYSKSL  878
            TV +F  + K +  +   L
Sbjct  879  TVAAFNAQNKMLSIFCHEL  897



>gb|KDP45498.1| hypothetical protein JCGZ_09747 [Jatropha curcas]
Length=1253

 Score =   267 bits (682),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 126/263 (48%), Positives = 181/263 (69%), Gaps = 1/263 (0%)
 Frame = +3

Query  111  MGELEISSNLKMDQQPSNSTDRKEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVF  290
            M   EIS   K    P     +++ + F+ LFS AD  D+  M+ GSIGA IHG+++PVF
Sbjct  1    MAAAEISETNK-PSLPEAEKKKEQSLPFYQLFSFADKYDWLLMISGSIGAIIHGSSMPVF  59

Query  291  FVLFGRMIDSLGHLSSDSHRLSSQVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTAR  470
            F+LFG M++  G   SD  +++ +VSK ALY VYLG ++ +S++  +  W  TGERQ   
Sbjct  60   FLLFGEMVNGFGKNQSDLPKMTDEVSKYALYFVYLGLVVCLSSYAEIGCWMYTGERQVGT  119

Query  471  LRLRYLQSVLRKKIEFFDTDTRAKDIIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFA  650
            LR +YL++VL++ + FFDTD R  DI+F +S+D +LVQDAI +K+G+ I Y+S FL G  
Sbjct  120  LRKKYLEAVLKQDVGFFDTDARTGDIVFSVSTDTLLVQDAISEKVGNFIHYLSTFLAGLV  179

Query  651  VGFISVWKLTLVTLAVVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVY  830
            VGF+S W+L L+++AV+P IA AGG Y   ++ L+ K   +YA+AG +AE+AI+QVRTVY
Sbjct  180  VGFVSAWRLALLSVAVIPGIAFAGGLYAYTLTGLTSKSRESYAQAGIIAEQAIAQVRTVY  239

Query  831  SFVGEKKAVESYSKSLNNALVLG  899
            S+VGE KA+ SYS ++ N L LG
Sbjct  240  SYVGESKALNSYSDAIQNTLKLG  262


 Score = 86.3 bits (212),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 63/260 (24%), Positives = 129/260 (50%), Gaps = 17/260 (7%)
 Frame = +3

Query  114  GELEISSNLKMDQQPSNSTDRKEMVS--FFGLFSAADTVDYFFMVFGSIGACIHGAALPV  287
            G +E+ SN +        TDRK      +F      +  ++ + + G+ G+ + G   P 
Sbjct  653  GRIEMISNAE--------TDRKNPAPHGYFCRLLKLNAPEWPYSIMGAAGSILSGFIGPT  704

Query  288  FFVLFGRMIDSLGHLSSDSHRLSSQVSKQALYLVYLGSIIF--ISAWIGVAFWTQTGERQ  461
            F ++   MI+   + +  S     + +K+ ++ +Y+G+ ++  I+  I   F++  GE  
Sbjct  705  FAIVMSNMIEVFYYRNPASME---RKTKEYVF-IYIGAGLYAVIAYLIQHYFFSIMGENL  760

Query  462  TARLRLRYLQSVLRKKIEFFDTDTRAKDIIF-HISSDAILVQDAIGDKIGHTIRYISQFL  638
            T R+R   L ++LR ++ +FD +     ++   +++DA  V+ AI ++I   ++ ++  L
Sbjct  761  TTRVRRMMLAAILRNEVGWFDEEEHNSSLVAARLATDAADVKSAIAERISVILQNMTSLL  820

Query  639  VGFAVGFISVWKLTLVTLAVVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQV  818
              F V FI  W+++L+ LA  PL+ +A     L +   +     A+A+   +A E +S +
Sbjct  821  TSFIVAFIVEWRVSLLILATFPLLVLANFAQQLSLKGFAGDTAKAHAKTSMIAGEGVSNI  880

Query  819  RTVYSFVGEKKAVESYSKSL  878
            RTV +F  + K +  +   L
Sbjct  881  RTVAAFNAQDKILSLFCHEL  900



>ref|XP_003543769.1| PREDICTED: ABC transporter B family member 19-like isoform X1 
[Glycine max]
 gb|KHN13230.1| ABC transporter B family member 19 [Glycine soja]
Length=1249

 Score =   266 bits (681),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 121/248 (49%), Positives = 176/248 (71%), Gaps = 0/248 (0%)
 Frame = +3

Query  156  PSNSTDRKEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLS  335
            P     +++ + F+ LFS AD  D+  M+ GSIGA +HG+++PVFF+LFG M++  G   
Sbjct  11   PEAEKKKEQTLPFYKLFSFADKCDWMLMISGSIGAIVHGSSMPVFFLLFGEMVNGFGKNQ  70

Query  336  SDSHRLSSQVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKKIE  515
             D  +++ +VSK ALY VYLG ++ IS++  +A W  TGERQ + LR +YL++VL++ + 
Sbjct  71   MDLKKMTEEVSKYALYFVYLGLVVCISSYAEIACWMYTGERQVSTLRKKYLEAVLKQDVG  130

Query  516  FFDTDTRAKDIIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLA  695
            FFDTD R  DI+F +S+D +LVQDAI +K+G+ I Y+S FL G  VGF+S W+L L+++A
Sbjct  131  FFDTDARTGDIVFSVSTDTLLVQDAISEKVGNFIHYLSTFLAGLVVGFVSAWRLALLSVA  190

Query  696  VVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYSKS  875
            V+P IA AGG Y   ++ L+ K   +YA AG +AE+AI+QVRTVYS+VGE KA+ SYS +
Sbjct  191  VIPGIAFAGGLYAYTLTGLTSKSRESYANAGIIAEQAIAQVRTVYSYVGESKALNSYSDA  250

Query  876  LNNALVLG  899
            + N L LG
Sbjct  251  IQNTLKLG  258


 Score = 84.3 bits (207),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 62/259 (24%), Positives = 129/259 (50%), Gaps = 15/259 (6%)
 Frame = +3

Query  114  GELEISSNLKMDQQPSNSTDRKEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFF  293
            G +E+ SN + D++ + + D      +F      +  ++ + + G++G+ + G   P F 
Sbjct  649  GRIEMISNAETDKK-NPAPD-----GYFFRLLKMNAPEWPYSIMGAVGSVLSGFIGPTFA  702

Query  294  VLFGRMIDSLGHLSSDSHRLSSQVSKQALYL-VYLGSIIF-ISAW-IGVAFWTQTGERQT  464
            ++   MI+            +S   K   Y+ +Y+G+ ++ + A+ I   F++  GE  T
Sbjct  703  IVMSNMIEVFYF-----RNYASMERKTKEYVFIYIGAGLYAVGAYLIQHYFFSIMGENLT  757

Query  465  ARLRLRYLQSVLRKKIEFFDTDTRAKDIIF-HISSDAILVQDAIGDKIGHTIRYISQFLV  641
             R+R   L ++LR ++ +FD +     ++   +++DA  V+ AI ++I   ++ ++  L 
Sbjct  758  TRVRRMMLAAILRNEVGWFDEEEHNSSLVAARLATDAADVKSAIAERISVILQNMTSLLT  817

Query  642  GFAVGFISVWKLTLVTLAVVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVR  821
             F V FI  W+++L+ LA  PL+ +A     L +   +     A+A+   +A E +S +R
Sbjct  818  SFIVAFIVEWRVSLLILATFPLLVLANFAQQLSLKGFAGDTAKAHAKTSMIAGEGVSNIR  877

Query  822  TVYSFVGEKKAVESYSKSL  878
            TV +F  + K +  +   L
Sbjct  878  TVAAFNAQNKMLSVFCHEL  896



>ref|XP_008379345.1| PREDICTED: ABC transporter B family member 19 [Malus domestica]
Length=1250

 Score =   266 bits (681),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 119/248 (48%), Positives = 179/248 (72%), Gaps = 0/248 (0%)
 Frame = +3

Query  156  PSNSTDRKEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLS  335
            P     +++ + FF LFS AD  D+  M+FGS+GA +HG+++PVFF++FG M++  G   
Sbjct  12   PEAEKKKEQSLPFFQLFSFADKYDWLLMIFGSLGAVVHGSSMPVFFLMFGEMVNGFGENQ  71

Query  336  SDSHRLSSQVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKKIE  515
             +  +++++V+K ALY VYLG I+ ++++  +A W  TGERQ +RLR +YL++VL++ + 
Sbjct  72   MNLQKMTAEVAKYALYFVYLGLIVCVTSYAEIACWMYTGERQVSRLRKKYLEAVLKQDVG  131

Query  516  FFDTDTRAKDIIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLA  695
            FFDTD R  DI+F IS+D +LVQDAI +K+G+ I Y+S FL G  VGF+S W+L L+++A
Sbjct  132  FFDTDARTGDIVFSISTDTLLVQDAISEKVGNFIHYLSTFLAGLVVGFVSAWRLALLSIA  191

Query  696  VVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYSKS  875
            V+P IA AGG Y   ++ L+ K   +YA AG +A++AI+QVRTVYS+VGE KA+ SYS +
Sbjct  192  VIPGIAFAGGLYAYTLTGLTSKSRQSYANAGIMADQAIAQVRTVYSYVGESKALNSYSDA  251

Query  876  LNNALVLG  899
            + N L LG
Sbjct  252  IQNTLQLG  259


 Score = 88.2 bits (217),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 61/256 (24%), Positives = 125/256 (49%), Gaps = 9/256 (4%)
 Frame = +3

Query  114  GELEISSNLKMDQQPSNSTDRKEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFF  293
            G +E+ SN + D++      R     FF L    +  ++ + +  +IG+ + G   P F 
Sbjct  650  GRIEMISNAETDRK-----TRAPKNYFFRLLKL-NAPEWPYSIMAAIGSVLSGFIGPTFA  703

Query  294  VLFGRMIDSLGHLSSDSHRLSSQVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARL  473
            +L G MI+   + +  S  +  +  +     + +G    ++  I   F++  GE  T R+
Sbjct  704  ILMGNMIEVFYYKNPAS--MERKTKEYVFMYIGVGLYAVVAYLIQHYFFSIMGENLTTRV  761

Query  474  RLRYLQSVLRKKIEFFDTDTRAKDIIF-HISSDAILVQDAIGDKIGHTIRYISQFLVGFA  650
            R   L ++LR ++ +FD +    +++   +++DA  V+ AI ++I   ++ ++  L  F 
Sbjct  762  RRMMLAAILRNEVGWFDEEEHNSNLLTTKLATDAADVKSAISERISVILQNMTSLLTSFI  821

Query  651  VGFISVWKLTLVTLAVVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVY  830
            V FI  W+++L+ LA  PL+ ++     L +   +     A+A+   +A E +S +RTV 
Sbjct  822  VAFIVEWRVSLLILATFPLLVLSNYAQQLSLKGFAGDTAKAHAKTSMIAGEGVSNIRTVA  881

Query  831  SFVGEKKAVESYSKSL  878
            +F  + K +  +   L
Sbjct  882  AFNAQNKILSLFCHEL  897



>emb|CBI22189.3| unnamed protein product [Vitis vinifera]
Length=1088

 Score =   266 bits (679),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 121/248 (49%), Positives = 177/248 (71%), Gaps = 0/248 (0%)
 Frame = +3

Query  156  PSNSTDRKEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLS  335
            P     +++ + F+ LFS AD  D+  MV GS+GA IHG+++PVFF+LFG M++  G   
Sbjct  12   PEAEKKKEQSLPFYQLFSFADKYDWILMVSGSVGAVIHGSSMPVFFLLFGEMVNGFGKNQ  71

Query  336  SDSHRLSSQVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKKIE  515
            +D  +++ +V+K ALY VYLG ++ IS++  +A W  TGERQ + LR +YL++VL++ + 
Sbjct  72   TDLSKMTEEVAKYALYFVYLGVVVCISSYAEIACWMYTGERQVSTLRKKYLEAVLKQDVG  131

Query  516  FFDTDTRAKDIIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLA  695
            FFDTD R  DI+F +S+D +LVQDAI +K+G+ I Y+S FL G  VGF+S W+L L+++A
Sbjct  132  FFDTDARTGDIVFSVSTDTLLVQDAISEKVGNFIHYLSTFLAGLVVGFVSAWRLALLSVA  191

Query  696  VVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYSKS  875
            V+P IA AGG Y   ++ L+ K   +YA AG +AE+AI+QVRTVYS+VGE KA+ SYS +
Sbjct  192  VIPGIAFAGGLYAYTLTGLTSKSRESYANAGIIAEQAIAQVRTVYSYVGESKALNSYSDA  251

Query  876  LNNALVLG  899
            + N L LG
Sbjct  252  IQNTLKLG  259


 Score = 73.6 bits (179),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 40/140 (29%), Positives = 77/140 (55%), Gaps = 1/140 (1%)
 Frame = +3

Query  435  FWTQTGERQTARLRLRYLQSVLRKKIEFFDTDTRAKDIIF-HISSDAILVQDAIGDKIGH  611
            F++  GE  T R+R   L ++LR ++ +FD +     ++   +++DA  V+ AI ++I  
Sbjct  632  FFSIMGENLTTRVRRMMLAAILRNEVGWFDEEENNSSLLAARLATDAADVKSAIAERISV  691

Query  612  TIRYISQFLVGFAVGFISVWKLTLVTLAVVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGK  791
             ++ ++  L  F V FI  W+++L+ LA  PL+ +A     L +   +     A+A+   
Sbjct  692  ILQNMTSLLTSFIVAFIVEWRVSLLILATFPLLVLANFAQQLSLKGFAGDTAKAHAKTSM  751

Query  792  VAEEAISQVRTVYSFVGEKK  851
            +A E +S +RTV +F  ++K
Sbjct  752  IAGEGVSNIRTVAAFNAQEK  771



>gb|KHG20565.1| ABC transporter B family member 19 [Gossypium arboreum]
Length=1249

 Score =   266 bits (681),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 121/248 (49%), Positives = 177/248 (71%), Gaps = 0/248 (0%)
 Frame = +3

Query  156  PSNSTDRKEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLS  335
            P     +++ + F+ LF+ AD  DY  M+ GS+GA IHG+++PVFF+LFG M++  G   
Sbjct  11   PEAEKKKEQSLPFYQLFTFADKYDYLLMITGSLGAIIHGSSMPVFFLLFGEMVNGFGKNQ  70

Query  336  SDSHRLSSQVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKKIE  515
            SD  +++ +V+K ALY VYLG I+ +S++  +A W  TGERQ + LR +YL++VL++ + 
Sbjct  71   SDLPKMTHEVAKYALYFVYLGLIVCLSSYAEIACWMYTGERQVSTLRTKYLEAVLKQDVG  130

Query  516  FFDTDTRAKDIIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLA  695
            FFDTD R  DI+F +S+D +LVQDAI +K+G+ I Y+S FL G  VGF+S W+L L+++A
Sbjct  131  FFDTDARTGDIVFSVSTDTLLVQDAISEKVGNFIHYLSTFLAGLVVGFVSAWRLALLSVA  190

Query  696  VVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYSKS  875
            V+P IA AGG Y   ++ L+ K   +YA AG +AE+AI+QVRTVYS+VGE KA+ SYS +
Sbjct  191  VIPGIAFAGGLYAYTLTGLTSKSRESYANAGIIAEQAIAQVRTVYSYVGESKALNSYSDA  250

Query  876  LNNALVLG  899
            + N L LG
Sbjct  251  IQNTLKLG  258


 Score = 84.3 bits (207),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 60/251 (24%), Positives = 126/251 (50%), Gaps = 17/251 (7%)
 Frame = +3

Query  114  GELEISSNLKMDQQPSNSTDRKEMVS--FFGLFSAADTVDYFFMVFGSIGACIHGAALPV  287
            G +E+ SN +        T+RK      +F      +  ++ + + G+IG+ + G   P 
Sbjct  649  GRIEMISNAE--------TERKNPAPDGYFCRLLKLNAPEWPYSIMGAIGSVLSGFIGPT  700

Query  288  FFVLFGRMIDSLGHLSSDSHRLSSQVSKQALYLVYLGSIIF--ISAWIGVAFWTQTGERQ  461
            F ++   MI+   + +  S     + +K+ ++ +Y+G+ ++  ++  I   F++  GE  
Sbjct  701  FAIVMSNMIEVFYYTNPTSME---RKTKEYVF-IYIGAGLYAVVAYLIQHYFFSIMGENL  756

Query  462  TARLRLRYLQSVLRKKIEFFDTDTRAKDIIF-HISSDAILVQDAIGDKIGHTIRYISQFL  638
            T R+R   L ++LR ++ +FD +     ++   +++DA  V+ AI ++I   ++ ++  L
Sbjct  757  TTRVRRMMLGAILRNEVGWFDEEEHNSSLLAAKLATDAADVKSAIAERISVILQNMTSLL  816

Query  639  VGFAVGFISVWKLTLVTLAVVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQV  818
              F V FI  W+++L+ L   PL+ +A     L +   +     A+A+   +A E +S +
Sbjct  817  TSFIVAFIVEWRVSLLILGTFPLLVLANFAQQLSLKGFAGDTAKAHAKTSMIAGEGVSNI  876

Query  819  RTVYSFVGEKK  851
            RTV +F  + K
Sbjct  877  RTVAAFNAQNK  887



>ref|XP_006338462.1| PREDICTED: ABC transporter B family member 19-like [Solanum tuberosum]
Length=1249

 Score =   266 bits (680),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 122/248 (49%), Positives = 174/248 (70%), Gaps = 0/248 (0%)
 Frame = +3

Query  156  PSNSTDRKEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLS  335
            P     +++ + F+ LFS AD  DY  M  GSIGA +HG+++PVFF+LFG M++  G   
Sbjct  11   PEAEKKKEQSLPFYQLFSFADKYDYLLMTCGSIGAILHGSSMPVFFLLFGEMVNGFGKNQ  70

Query  336  SDSHRLSSQVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKKIE  515
             D H+++ +VSK ALY VYLG I+  S++  +  W  TGERQ + LR +YL++VL++ + 
Sbjct  71   MDLHKMTHEVSKYALYFVYLGLIVCASSYAEIGCWMYTGERQVSTLRKKYLEAVLKQDVG  130

Query  516  FFDTDTRAKDIIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLA  695
            FFDTD R  DI+F +S+D +LVQDAI +K+G+ I Y+S FL G  VGF+S W+L L+++A
Sbjct  131  FFDTDARTGDIVFSVSTDTLLVQDAISEKVGNFIHYLSTFLAGLVVGFVSAWRLALLSVA  190

Query  696  VVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYSKS  875
            V+P IA AGG Y   ++ L+ K   +YA AG +AE+AI+QVRTVYS+VGE KA+ SYS +
Sbjct  191  VIPGIAFAGGLYAYTLTGLTSKSRESYANAGIIAEQAIAQVRTVYSYVGETKALNSYSDA  250

Query  876  LNNALVLG  899
            + N L LG
Sbjct  251  IQNTLKLG  258


 Score = 90.9 bits (224),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 60/261 (23%), Positives = 131/261 (50%), Gaps = 19/261 (7%)
 Frame = +3

Query  114  GELEISSNLKMDQQ---PSNSTDRKEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALP  284
            G +E+ SN + D++   P N         +F      +  ++ + + G++G+ + G   P
Sbjct  649  GRIEMISNAETDRKNPAPQN---------YFCRLLKLNAPEWPYSIMGAVGSVLSGFIGP  699

Query  285  VFFVLFGRMIDSLGHLSSDSHRLSSQVSKQALYLVYLGSIIF--ISAWIGVAFWTQTGER  458
             F ++   MI+   +    ++  + +   +    +Y+G+ ++  ++  I   F++  GE 
Sbjct  700  TFAIVMSNMIEVFYY----TNPATMERKTKEYVFIYIGAGLYAVVAYLIQHYFFSIMGEN  755

Query  459  QTARLRLRYLQSVLRKKIEFFDTDTRAKDIIF-HISSDAILVQDAIGDKIGHTIRYISQF  635
             T R+R   L ++LR ++ +FD +     ++   +++DA  V+ AI ++I   ++ ++  
Sbjct  756  LTTRVRRMMLSAILRNEVGWFDEEENNSSLLAARLATDAADVKSAIAERISVILQNMTSL  815

Query  636  LVGFAVGFISVWKLTLVTLAVVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQ  815
            L  F V FI  W+++L+ LA  PL+ +A     L +   +     A+A+   +A E +S 
Sbjct  816  LTSFIVAFIVEWRVSLLILATFPLLVLANFAQQLSLKGFAGDTAKAHAKTSMIAGEGVSN  875

Query  816  VRTVYSFVGEKKAVESYSKSL  878
            +RTV +F  ++K +  +S+ L
Sbjct  876  IRTVAAFNAQEKIISLFSQEL  896



>ref|XP_009591470.1| PREDICTED: ABC transporter B family member 19 [Nicotiana tomentosiformis]
Length=1249

 Score =   266 bits (680),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 123/248 (50%), Positives = 174/248 (70%), Gaps = 0/248 (0%)
 Frame = +3

Query  156  PSNSTDRKEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLS  335
            P     +++ + F+ LFS AD  DY  M+ GSIGA IHG+++PVFF+LFG M++  G   
Sbjct  11   PEAEKKKEQSLPFYQLFSFADKYDYLLMISGSIGAIIHGSSMPVFFLLFGEMVNGFGKNQ  70

Query  336  SDSHRLSSQVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKKIE  515
             D H++  +VSK ALY VYLG I+  S++  +  W  TGERQ + LR +YL++VL++ + 
Sbjct  71   MDLHKMVHEVSKYALYFVYLGLIVCASSYAEIGCWMYTGERQVSALRKKYLEAVLKQDVG  130

Query  516  FFDTDTRAKDIIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLA  695
            FFDTD R  DI+F +S+D +LVQDAI +K+G+ I Y+S FL G  VGF+S W+L L+++A
Sbjct  131  FFDTDARTGDIVFSVSTDTLLVQDAISEKVGNFIHYLSTFLAGLVVGFVSAWRLALLSVA  190

Query  696  VVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYSKS  875
            V+P IA AGG Y   ++ L+ K   +YA AG +AE+AI+QVRTVYS+VGE KA+ SYS +
Sbjct  191  VIPGIAFAGGLYAYTLTGLTSKSRESYANAGIIAEQAIAQVRTVYSYVGESKALNSYSDA  250

Query  876  LNNALVLG  899
            + N L LG
Sbjct  251  IQNTLKLG  258


 Score = 88.6 bits (218),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 62/260 (24%), Positives = 133/260 (51%), Gaps = 17/260 (7%)
 Frame = +3

Query  114  GELEISSNLKMDQQPSNSTDRKEMVS--FFGLFSAADTVDYFFMVFGSIGACIHGAALPV  287
            G +E+ SN +        T+RK      +F      +  ++ + + G++G+ + G   P 
Sbjct  649  GRIEMISNAE--------TERKNPAPQGYFCRLLKLNAPEWPYSIMGAVGSVLSGFIGPT  700

Query  288  FFVLFGRMIDSLGHLSSDSHRLSSQVSKQALYLVYLGSIIF--ISAWIGVAFWTQTGERQ  461
            F ++   MI+   + +  S     + +K+ ++ +Y+G+ ++  ++  I   F++  GE  
Sbjct  701  FAIVMSNMIEVFYYRNPASME---RKTKEYVF-IYIGAGLYAVVAYLIQHYFFSIMGENL  756

Query  462  TARLRLRYLQSVLRKKIEFFDTDTRAKDIIF-HISSDAILVQDAIGDKIGHTIRYISQFL  638
            T R+R   L ++LR ++ +FD +     ++   +++DA  V+ AI ++I   ++ ++  L
Sbjct  757  TTRVRRMMLAAILRNEVGWFDEEENNSSLLAARLATDAADVKSAIAERISVILQNMTSLL  816

Query  639  VGFAVGFISVWKLTLVTLAVVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQV  818
              F V FI  W+++L+ LA  PL+ +A     L +   +     A+A+   +A E +S +
Sbjct  817  TSFIVAFIVEWRVSLLILATFPLLVLANFAQQLSLKGFAGDTAKAHAKTSMIAGEGVSNI  876

Query  819  RTVYSFVGEKKAVESYSKSL  878
            RTV +F  ++K +  +S+ L
Sbjct  877  RTVAAFNAQEKIISLFSQEL  896



>gb|ABX82929.1| LO4 [Solanum pennellii]
Length=1249

 Score =   266 bits (679),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 122/248 (49%), Positives = 174/248 (70%), Gaps = 0/248 (0%)
 Frame = +3

Query  156  PSNSTDRKEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLS  335
            P     +++ + F+ LFS AD  DY  M  GSIGA +HG+++PVFF+LFG M++  G   
Sbjct  11   PEAEKKKEQSLPFYQLFSFADKYDYLLMTCGSIGAILHGSSMPVFFLLFGEMVNGFGKNQ  70

Query  336  SDSHRLSSQVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKKIE  515
             D H+++ +VSK ALY VYLG I+  S++  +  W  TGERQ + LR +YL++VL++ + 
Sbjct  71   MDLHKMTHEVSKYALYFVYLGLIVCASSYAEIGCWMYTGERQVSALRKKYLEAVLKQDVG  130

Query  516  FFDTDTRAKDIIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLA  695
            FFDTD R  DI+F +S+D +LVQDAI +K+G+ I Y+S FL G  VGF+S W+L L+++A
Sbjct  131  FFDTDARTGDIVFSVSTDTLLVQDAISEKVGNFIHYLSTFLAGLVVGFVSAWRLALLSVA  190

Query  696  VVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYSKS  875
            V+P IA AGG Y   ++ L+ K   +YA AG +AE+AI+QVRTVYS+VGE KA+ SYS +
Sbjct  191  VIPGIAFAGGLYAYTLTGLTSKSRESYANAGIIAEQAIAQVRTVYSYVGETKALNSYSDA  250

Query  876  LNNALVLG  899
            + N L LG
Sbjct  251  IQNTLKLG  258


 Score = 90.5 bits (223),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 60/261 (23%), Positives = 131/261 (50%), Gaps = 19/261 (7%)
 Frame = +3

Query  114  GELEISSNLKMDQQ---PSNSTDRKEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALP  284
            G +E+ SN + D++   P N         +F      +  ++ + + G++G+ + G   P
Sbjct  649  GRIEMISNAETDRKNPAPQN---------YFCRLLKLNAPEWPYSIMGAVGSVLSGFIGP  699

Query  285  VFFVLFGRMIDSLGHLSSDSHRLSSQVSKQALYLVYLGSIIF--ISAWIGVAFWTQTGER  458
             F ++   MI+   +    ++  + +   +    +Y+G+ ++  ++  I   F++  GE 
Sbjct  700  TFAIVMSNMIEVFYY----TNPATMERKTKEYVFIYIGAGLYAVVAYLIQHYFFSIMGEN  755

Query  459  QTARLRLRYLQSVLRKKIEFFDTDTRAKDIIF-HISSDAILVQDAIGDKIGHTIRYISQF  635
             T R+R   L ++LR ++ +FD +     ++   +++DA  V+ AI ++I   ++ ++  
Sbjct  756  LTTRVRRMMLAAILRNEVGWFDEEENNSSLLAARLATDAADVKSAIAERISVILQNMTSL  815

Query  636  LVGFAVGFISVWKLTLVTLAVVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQ  815
            L  F V FI  W+++L+ LA  PL+ +A     L +   +     A+A+   +A E +S 
Sbjct  816  LTSFIVAFIVEWRVSLLILATFPLLVLANFAQQLSLKGFAGDTAKAHAKTSMIAGEGVSN  875

Query  816  VRTVYSFVGEKKAVESYSKSL  878
            +RTV +F  ++K +  +S+ L
Sbjct  876  IRTVAAFNAQEKIISLFSQEL  896



>ref|XP_010693227.1| PREDICTED: ABC transporter B family member 19 [Beta vulgaris 
subsp. vulgaris]
Length=1250

 Score =   266 bits (679),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 125/249 (50%), Positives = 175/249 (70%), Gaps = 1/249 (0%)
 Frame = +3

Query  156  PSNSTDRKEM-VSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHL  332
            P     ++E  + F+ LFS AD  DYF M  GS+GA IHG+++PVFF+LFG M++  G  
Sbjct  11   PEAEKKKEEQTLPFYQLFSFADKYDYFLMSLGSLGAVIHGSSMPVFFLLFGEMVNGFGKN  70

Query  333  SSDSHRLSSQVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKKI  512
             SD   ++ +VSK ALY VYLG I+ +S++  +A W  +GERQ   LR +YL++VLR+ +
Sbjct  71   QSDLQTMTHEVSKYALYFVYLGLIVCVSSYAEIACWMYSGERQAGALREKYLEAVLRQDV  130

Query  513  EFFDTDTRAKDIIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTL  692
             FFDTD R  DI+F +S+D +LVQDAI +K+G+ I Y+S FL G  VGF+S W+L L+++
Sbjct  131  GFFDTDARTGDIVFSVSTDTLLVQDAISEKVGNFIHYLSTFLAGLVVGFVSAWRLALLSV  190

Query  693  AVVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYSK  872
            AV+P IA AGG Y   ++ L+ K   +YA AG +AE+AI+QVRTVYS+VGE KA+ SYS 
Sbjct  191  AVIPGIAFAGGLYAYTLTGLTSKSRQSYANAGIIAEQAIAQVRTVYSYVGETKALNSYSD  250

Query  873  SLNNALVLG  899
            ++ N L LG
Sbjct  251  AIQNTLKLG  259


 Score = 82.8 bits (203),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 59/253 (23%), Positives = 125/253 (49%), Gaps = 13/253 (5%)
 Frame = +3

Query  141  KMDQQPSNSTDRKEMVS---FFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFVLFGRM  311
            +++   S  ++RK       FF L    +  ++ + + G++G+ + G   P F ++   M
Sbjct  651  RIEMVSSAESERKNPAPRGYFFRLLKL-NAPEWPYSIMGAVGSILSGFIGPTFAIVMSNM  709

Query  312  IDSLGHLSSDSHRLSSQVSKQALYL-VYLGSIIF--ISAWIGVAFWTQTGERQTARLRLR  482
            I+   +        +S   K   Y+ +Y+G+ I+  ++  I   F++  GE  T R+R  
Sbjct  710  IEVFYY-----QNYASMEKKTKEYVFIYIGAGIYAVVAYLIQHYFFSIMGENLTTRVRRM  764

Query  483  YLQSVLRKKIEFFDTDTRAKDIIF-HISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGF  659
             L +++R ++ +FD +     ++   +++DA  V+ AI ++I   ++ ++  L  F V F
Sbjct  765  MLAAIMRNEVGWFDEEEHNSSLLAARLATDAADVKSAIAERISVILQNMTSLLTSFIVAF  824

Query  660  ISVWKLTLVTLAVVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFV  839
            I  W+++L+ L   PL+ +A     L +   +     A+A+   +A E +S +RTV +F 
Sbjct  825  IVEWRVSLLILGTFPLLVLANFAQQLSLKGFAGDTAKAHAKTSMIAGEGVSNIRTVAAFN  884

Query  840  GEKKAVESYSKSL  878
             ++K +  +   L
Sbjct  885  AQEKILSLFCHEL  897



>ref|NP_001234209.1| L04 [Solanum lycopersicum]
 gb|ABX82928.1| L04 [Solanum lycopersicum]
Length=1249

 Score =   266 bits (679),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 122/248 (49%), Positives = 174/248 (70%), Gaps = 0/248 (0%)
 Frame = +3

Query  156  PSNSTDRKEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLS  335
            P     +++ + F+ LFS AD  DY  M  GSIGA +HG+++PVFF+LFG M++  G   
Sbjct  11   PEAEKKKEQSLPFYQLFSFADKYDYLLMTCGSIGAILHGSSMPVFFLLFGEMVNGFGKNQ  70

Query  336  SDSHRLSSQVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKKIE  515
             D H+++ +VSK ALY VYLG I+  S++  +  W  TGERQ + LR +YL++VL++ + 
Sbjct  71   MDLHKMTHEVSKYALYFVYLGLIVCASSYAEIGCWMYTGERQVSALRKKYLEAVLKQDVG  130

Query  516  FFDTDTRAKDIIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLA  695
            FFDTD R  DI+F +S+D +LVQDAI +K+G+ I Y+S FL G  VGF+S W+L L+++A
Sbjct  131  FFDTDARTGDIVFSVSTDTLLVQDAISEKVGNFIHYLSTFLAGLVVGFVSAWRLALLSVA  190

Query  696  VVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYSKS  875
            V+P IA AGG Y   ++ L+ K   +YA AG +AE+AI+QVRTVYS+VGE KA+ SYS +
Sbjct  191  VIPGIAFAGGLYAYTLTGLTSKSRESYANAGIIAEQAIAQVRTVYSYVGETKALNSYSDA  250

Query  876  LNNALVLG  899
            + N L LG
Sbjct  251  IQNTLKLG  258


 Score = 90.5 bits (223),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 60/261 (23%), Positives = 131/261 (50%), Gaps = 19/261 (7%)
 Frame = +3

Query  114  GELEISSNLKMDQQ---PSNSTDRKEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALP  284
            G +E+ SN + D++   P N         +F      +  ++ + + G++G+ + G   P
Sbjct  649  GRIEMISNAETDRKNPAPQN---------YFCRLLKLNAPEWPYSIMGAVGSVLSGFIGP  699

Query  285  VFFVLFGRMIDSLGHLSSDSHRLSSQVSKQALYLVYLGSIIF--ISAWIGVAFWTQTGER  458
             F ++   MI+   +    ++  + +   +    +Y+G+ ++  ++  I   F++  GE 
Sbjct  700  TFAIVMSNMIEVFYY----TNPATMERKTKEYVFIYIGAGLYAVVAYLIQHYFFSIMGEN  755

Query  459  QTARLRLRYLQSVLRKKIEFFDTDTRAKDIIF-HISSDAILVQDAIGDKIGHTIRYISQF  635
             T R+R   L ++LR ++ +FD +     ++   +++DA  V+ AI ++I   ++ ++  
Sbjct  756  LTTRVRRMMLAAILRNEVGWFDEEENNSSLLAARLATDAADVKSAIAERISVILQNMTSL  815

Query  636  LVGFAVGFISVWKLTLVTLAVVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQ  815
            L  F V FI  W+++L+ LA  PL+ +A     L +   +     A+A+   +A E +S 
Sbjct  816  LTSFIVAFIVEWRVSLLILATFPLLVLANFAQQLSLKGFAGDTAKAHAKTSMIAGEGVSN  875

Query  816  VRTVYSFVGEKKAVESYSKSL  878
            +RTV +F  ++K +  +S+ L
Sbjct  876  IRTVAAFNAQEKIISLFSQEL  896



>ref|XP_009758464.1| PREDICTED: ABC transporter B family member 19 [Nicotiana sylvestris]
Length=1249

 Score =   266 bits (679),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 123/248 (50%), Positives = 174/248 (70%), Gaps = 0/248 (0%)
 Frame = +3

Query  156  PSNSTDRKEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLS  335
            P     +++ + F+ LFS AD  DY  M+ GSIGA IHG+++PVFF+LFG M++  G   
Sbjct  11   PEAEKKKEQSLPFYQLFSFADKYDYLLMISGSIGAIIHGSSMPVFFLLFGEMVNGFGKNQ  70

Query  336  SDSHRLSSQVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKKIE  515
             D H++  +VSK ALY VYLG I+  S++  +  W  TGERQ + LR +YL++VL++ + 
Sbjct  71   MDLHKMVHEVSKYALYFVYLGLIVCASSYAEIGCWMYTGERQVSALRKKYLEAVLKQDVG  130

Query  516  FFDTDTRAKDIIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLA  695
            FFDTD R  DI+F +S+D +LVQDAI +K+G+ I Y+S FL G  VGF+S W+L L+++A
Sbjct  131  FFDTDARTGDIVFSVSTDTLLVQDAISEKVGNFIHYLSTFLAGLVVGFVSAWRLALLSVA  190

Query  696  VVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYSKS  875
            V+P IA AGG Y   ++ L+ K   +YA AG +AE+AI+QVRTVYS+VGE KA+ SYS +
Sbjct  191  VIPGIAFAGGLYAYTLTGLTSKSRESYANAGIIAEQAIAQVRTVYSYVGESKALNSYSDA  250

Query  876  LNNALVLG  899
            + N L LG
Sbjct  251  IQNTLKLG  258


 Score = 89.0 bits (219),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 62/260 (24%), Positives = 133/260 (51%), Gaps = 17/260 (7%)
 Frame = +3

Query  114  GELEISSNLKMDQQPSNSTDRKEMVS--FFGLFSAADTVDYFFMVFGSIGACIHGAALPV  287
            G +E+ SN +        T+RK      +F      +  ++ + + G++G+ + G   P 
Sbjct  649  GRIEMISNAE--------TERKNPAPQGYFCRLLKLNAPEWPYSIMGAVGSVLSGFIGPT  700

Query  288  FFVLFGRMIDSLGHLSSDSHRLSSQVSKQALYLVYLGSIIF--ISAWIGVAFWTQTGERQ  461
            F ++   MI+   + +  S     + +K+ ++ +Y+G+ ++  ++  I   F++  GE  
Sbjct  701  FAIVMSNMIEVFYYRNPASME---RKTKEYVF-IYIGAGLYAVVAYLIQHYFFSIMGENL  756

Query  462  TARLRLRYLQSVLRKKIEFFDTDTRAKDIIF-HISSDAILVQDAIGDKIGHTIRYISQFL  638
            T R+R   L ++LR ++ +FD +     ++   +++DA  V+ AI ++I   ++ ++  L
Sbjct  757  TTRVRRMMLAAILRNEVGWFDEEENNSSLLAARLATDAADVKSAIAERISVILQNMTSLL  816

Query  639  VGFAVGFISVWKLTLVTLAVVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQV  818
              F V FI  W+++L+ LA  PL+ +A     L +   +     A+A+   +A E +S +
Sbjct  817  TSFIVAFIVEWRVSLLILATFPLLVLANFAQQLSLKGFAGDTAKAHAKTSMIAGEGVSNI  876

Query  819  RTVYSFVGEKKAVESYSKSL  878
            RTV +F  ++K +  +S+ L
Sbjct  877  RTVAAFNAQEKIISLFSQEL  896



>ref|XP_002283051.2| PREDICTED: ABC transporter B family member 19 [Vitis vinifera]
Length=1250

 Score =   266 bits (679),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 121/248 (49%), Positives = 177/248 (71%), Gaps = 0/248 (0%)
 Frame = +3

Query  156  PSNSTDRKEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLS  335
            P     +++ + F+ LFS AD  D+  MV GS+GA IHG+++PVFF+LFG M++  G   
Sbjct  12   PEAEKKKEQSLPFYQLFSFADKYDWILMVSGSVGAVIHGSSMPVFFLLFGEMVNGFGKNQ  71

Query  336  SDSHRLSSQVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKKIE  515
            +D  +++ +V+K ALY VYLG ++ IS++  +A W  TGERQ + LR +YL++VL++ + 
Sbjct  72   TDLSKMTEEVAKYALYFVYLGVVVCISSYAEIACWMYTGERQVSTLRKKYLEAVLKQDVG  131

Query  516  FFDTDTRAKDIIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLA  695
            FFDTD R  DI+F +S+D +LVQDAI +K+G+ I Y+S FL G  VGF+S W+L L+++A
Sbjct  132  FFDTDARTGDIVFSVSTDTLLVQDAISEKVGNFIHYLSTFLAGLVVGFVSAWRLALLSVA  191

Query  696  VVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYSKS  875
            V+P IA AGG Y   ++ L+ K   +YA AG +AE+AI+QVRTVYS+VGE KA+ SYS +
Sbjct  192  VIPGIAFAGGLYAYTLTGLTSKSRESYANAGIIAEQAIAQVRTVYSYVGESKALNSYSDA  251

Query  876  LNNALVLG  899
            + N L LG
Sbjct  252  IQNTLKLG  259


 Score = 86.7 bits (213),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 60/249 (24%), Positives = 130/249 (52%), Gaps = 13/249 (5%)
 Frame = +3

Query  114  GELEISSNLKMDQQPSNSTDRKEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFF  293
            G +E+ SN + D++ + + D      +F      +  ++ + + G++G+ + G   P F 
Sbjct  650  GRIEMVSNAETDKK-NPAPD-----GYFYRLLNLNAPEWPYSIMGAVGSVLSGFIGPTFA  703

Query  294  VLFGRMIDSLGHLSSDSHRLSSQVSKQALYLVYLGSIIF--ISAWIGVAFWTQTGERQTA  467
            ++   MI+   + +  S     + +K+ ++ +Y+G+ ++  I+  I   F++  GE  T 
Sbjct  704  IVMSNMIEVFYYRNPASME---RKTKEYVF-IYIGAGLYAVIAYLIQHYFFSIMGENLTT  759

Query  468  RLRLRYLQSVLRKKIEFFDTDTRAKDIIF-HISSDAILVQDAIGDKIGHTIRYISQFLVG  644
            R+R   L ++LR ++ +FD +     ++   +++DA  V+ AI ++I   ++ ++  L  
Sbjct  760  RVRRMMLAAILRNEVGWFDEEENNSSLLAARLATDAADVKSAIAERISVILQNMTSLLTS  819

Query  645  FAVGFISVWKLTLVTLAVVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRT  824
            F V FI  W+++L+ LA  PL+ +A     L +   +     A+A+   +A E +S +RT
Sbjct  820  FIVAFIVEWRVSLLILATFPLLVLANFAQQLSLKGFAGDTAKAHAKTSMIAGEGVSNIRT  879

Query  825  VYSFVGEKK  851
            V +F  ++K
Sbjct  880  VAAFNAQEK  888



>gb|KHG22495.1| ABC transporter B family member 19 [Gossypium arboreum]
Length=1249

 Score =   265 bits (678),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 121/248 (49%), Positives = 177/248 (71%), Gaps = 0/248 (0%)
 Frame = +3

Query  156  PSNSTDRKEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLS  335
            P     +++ + F+ LF+ AD  DY  M+ GS+GA IHG+++PVFF+LFG M++  G   
Sbjct  11   PEAEKKKEQNLPFYQLFTFADRYDYMLMISGSLGAIIHGSSMPVFFLLFGEMVNGFGKNQ  70

Query  336  SDSHRLSSQVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKKIE  515
            SD  +++ +V+K ALY VYLG I+ +S++  +A W  TGERQ + LR +YL++VL++ + 
Sbjct  71   SDLPKMTHEVAKYALYFVYLGLIVCLSSYAEIACWMYTGERQVSTLRKKYLEAVLKQDVG  130

Query  516  FFDTDTRAKDIIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLA  695
            FFDTD R  DI+F +S+D +LVQDAI +K+G+ I Y+S FL G  VGF+S W+L L+++A
Sbjct  131  FFDTDARTGDIVFSVSTDTLLVQDAISEKVGNFIHYLSTFLAGLVVGFVSAWRLALLSVA  190

Query  696  VVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYSKS  875
            V+P IA AGG Y   ++ L+ K   +YA AG +AE+AI+QVRTVYS+VGE KA+ SYS +
Sbjct  191  VIPGIAFAGGLYAYTLTGLTSKSRESYANAGIIAEQAIAQVRTVYSYVGESKALNSYSDA  250

Query  876  LNNALVLG  899
            + N L LG
Sbjct  251  IQNTLKLG  258


 Score = 76.3 bits (186),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 60/260 (23%), Positives = 129/260 (50%), Gaps = 17/260 (7%)
 Frame = +3

Query  114  GELEISSNLKMDQQPSNSTDRKEMVS--FFGLFSAADTVDYFFMVFGSIGACIHGAALPV  287
            G +E+ SN +        T+RK      +F      +  ++ + + G++G+ + G   P 
Sbjct  649  GRIEMISNAE--------TERKNPAPHGYFCRLLNLNAPEWPYSIMGAVGSVLSGFIGPT  700

Query  288  FFVLFGRMIDSLGHLSSDSHRLSSQVSKQALYLVYLGSIIF--ISAWIGVAFWTQTGERQ  461
            F ++   MI+   + +  S     + +K+ ++ +Y+G+ ++  ++  I   F++  GE  
Sbjct  701  FAIVMSNMIEVFYYTNPTSME---RKTKEYVF-IYIGAGLYAVVAYLIQHYFFSIMGENL  756

Query  462  TARLRLRYLQSVLRKKIEFFDTDT-RAKDIIFHISSDAILVQDAIGDKIGHTIRYISQFL  638
            T R+R   L ++LR ++ +FD +   +  +   +++DA  V+ AI ++I   ++ ++  L
Sbjct  757  TTRVRRMMLGAILRNEVGWFDEEEHNSSLLAAKLAADAADVKSAIAERISVILQNMTSLL  816

Query  639  VGFAVGFISVWKLTLVTLAVVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQV  818
              F V FI  W+++L+ L   PL+ +A     L +   +     A+A+   +A E +S +
Sbjct  817  TSFIVAFIVEWRVSLLILGTFPLLVLANFAQQLSLKGFAGDTAKAHAKTSMIAGEGVSNI  876

Query  819  RTVYSFVGEKKAVESYSKSL  878
            RTV +F  + K +  +   L
Sbjct  877  RTVAAFNAQNKILSLFCHEL  896



>ref|XP_011085762.1| PREDICTED: ABC transporter B family member 19-like [Sesamum indicum]
Length=1250

 Score =   265 bits (678),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 121/248 (49%), Positives = 176/248 (71%), Gaps = 0/248 (0%)
 Frame = +3

Query  156  PSNSTDRKEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLS  335
            P +   +++ + F+ LFS AD  DY  M+ GSIGA IHG+++PVFF+LFG M++  G   
Sbjct  12   PESEKKKEQSLPFYQLFSFADKYDYLLMISGSIGAVIHGSSMPVFFLLFGEMVNGFGKNQ  71

Query  336  SDSHRLSSQVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKKIE  515
             D H+++ +V+K ALY VYLG ++ +S++  +A W  TGERQ   LR +YL++VL++ + 
Sbjct  72   MDLHKMTHEVAKYALYFVYLGLVVCLSSYAEIACWMYTGERQVGALRRKYLEAVLKQDVG  131

Query  516  FFDTDTRAKDIIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLA  695
            FFDTD R  DI+F +S+D +LVQDAI +K+G+ I Y+S FL G  VGF+S WKL L+++A
Sbjct  132  FFDTDARTGDIVFSVSTDTLLVQDAISEKVGNFIHYLSTFLAGLVVGFVSAWKLALLSVA  191

Query  696  VVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYSKS  875
            V+P IA AGG Y   ++ L+ K   +YA AG +AE++I+QVRTVYS+VGE KA+ +YS  
Sbjct  192  VIPGIAFAGGLYAYTLTGLTSKSRESYASAGIIAEQSIAQVRTVYSYVGETKALSAYSDL  251

Query  876  LNNALVLG  899
            + N L LG
Sbjct  252  IQNTLKLG  259


 Score = 87.8 bits (216),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 61/261 (23%), Positives = 130/261 (50%), Gaps = 17/261 (7%)
 Frame = +3

Query  114  GELEISSNLKMDQQPSNSTDRKEMVS--FFGLFSAADTVDYFFMVFGSIGACIHGAALPV  287
            G +E+ SN +        TDRK      +F      +  ++ + + G+IG+ + G   P 
Sbjct  650  GRIEMVSNAE--------TDRKNPAPAGYFCRLLKLNAPEWPYSIMGAIGSVLSGFIGPT  701

Query  288  FFVLFGRMIDSLGHLSSDSHRLSSQVSKQALYLVYLGSIIF--ISAWIGVAFWTQTGERQ  461
            F ++   MI+   +    ++  + +   +    +Y+G+ ++  ++  I   F++  GE  
Sbjct  702  FALVMSNMIEVFYY----TNPAAMERKTKEYVFIYIGAGLYAVVAYLIQHYFFSIMGENL  757

Query  462  TARLRLRYLQSVLRKKIEFFDTDTRAKDIIF-HISSDAILVQDAIGDKIGHTIRYISQFL  638
            T R+R   L ++LR ++ +FD +     ++   +++DA  V+ AI ++I   ++ ++  L
Sbjct  758  TTRVRRMMLAAILRNEVGWFDEEENNSSLLAARLATDAADVKSAIAERISVILQNMTSLL  817

Query  639  VGFAVGFISVWKLTLVTLAVVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQV  818
              F V FI  W+++L+ LA  PL+ +A     L +   +     A+A+   +A E +S +
Sbjct  818  TSFIVAFIVEWRVSLLILATFPLLVLANFAQQLSLKGFAGDTAKAHAKTSMIAGEGVSNI  877

Query  819  RTVYSFVGEKKAVESYSKSLN  881
            RTV +F  ++K +  ++  L+
Sbjct  878  RTVAAFNAQEKILSLFAHELH  898



>ref|XP_003554410.1| PREDICTED: ABC transporter B family member 19-like isoform X1 
[Glycine max]
Length=1250

 Score =   265 bits (678),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 121/248 (49%), Positives = 176/248 (71%), Gaps = 0/248 (0%)
 Frame = +3

Query  156  PSNSTDRKEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLS  335
            P     +++ + F+ LFS AD  D+  M+ GSIGA IHG+++PVFF+LFG M++  G   
Sbjct  12   PEAEKKKEQTLPFYKLFSFADKCDWMLMISGSIGAIIHGSSMPVFFLLFGEMVNGFGKNQ  71

Query  336  SDSHRLSSQVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKKIE  515
             +  +++ +VSK ALY VYLG ++ IS++  +A W  TGERQ + LR +YL++VL++ + 
Sbjct  72   MNLKKMTEEVSKYALYFVYLGLVVCISSYAEIACWMYTGERQVSTLRKKYLEAVLKQDVG  131

Query  516  FFDTDTRAKDIIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLA  695
            FFDTD R  DI+F +S+D +LVQDAI +K+G+ I Y+S FL G  VGF+S W+L L+++A
Sbjct  132  FFDTDARTGDIVFSVSTDTLLVQDAISEKVGNFIHYLSTFLAGLVVGFVSAWRLALLSVA  191

Query  696  VVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYSKS  875
            V+P IA AGG Y   ++ L+ K   +YA AG +AE+AI+QVRTVYS+VGE KA+ SYS +
Sbjct  192  VIPGIAFAGGLYAYTLTGLTSKSRESYANAGIIAEQAIAQVRTVYSYVGESKALNSYSDA  251

Query  876  LNNALVLG  899
            + N L LG
Sbjct  252  IQNTLKLG  259


 Score = 85.9 bits (211),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 61/258 (24%), Positives = 129/258 (50%), Gaps = 13/258 (5%)
 Frame = +3

Query  114  GELEISSNLKMDQQPSNSTDRKEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFF  293
            G +E+ SN + D++ + + D      +F      +  ++ + + G++G+ + G   P F 
Sbjct  650  GRIEMISNAETDKK-NPAPD-----GYFFRLLKMNAPEWPYSIMGAVGSVLSGFIGPTFA  703

Query  294  VLFGRMIDSLGHLSSDSHRLSSQVSKQALYLVYLGSIIF-ISAW-IGVAFWTQTGERQTA  467
            ++   MI+        S+  S +   +    +Y+G+ ++ + A+ I   F++  GE  T 
Sbjct  704  IVMSNMIEVFYF----SNYASMERKTKEYVFIYIGAGLYAVGAYLIQHYFFSIMGENLTT  759

Query  468  RLRLRYLQSVLRKKIEFFDTDTRAKDIIF-HISSDAILVQDAIGDKIGHTIRYISQFLVG  644
            R+R   L ++LR ++ +FD +     ++   +++DA  V+ AI ++I   ++ ++  L  
Sbjct  760  RVRRMMLAAILRNEVGWFDEEEHNSSLVAARLATDAADVKSAIAERISVILQNMTSLLTS  819

Query  645  FAVGFISVWKLTLVTLAVVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRT  824
            F V FI  W+++L+ LA  PL+ +A     L +   +     A+A+   +A E +S +RT
Sbjct  820  FIVAFIVEWRVSLLILATFPLLVLANFAQQLSLKGFAGDTAKAHAKTSMIAGEGVSNIRT  879

Query  825  VYSFVGEKKAVESYSKSL  878
            V +F  + K +  +   L
Sbjct  880  VAAFNAQNKMLSVFCHEL  897



>ref|XP_004489384.1| PREDICTED: ABC transporter B family member 19-like [Cicer arietinum]
Length=1250

 Score =   265 bits (678),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 122/248 (49%), Positives = 177/248 (71%), Gaps = 0/248 (0%)
 Frame = +3

Query  156  PSNSTDRKEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLS  335
            P     +++ + F+ LFS AD  D+  M+ GSIGA IHG+++PVFF+LFG+M++  G   
Sbjct  12   PEAEKKKEQSLPFYQLFSFADKYDWILMISGSIGAIIHGSSMPVFFLLFGQMVNGFGKNQ  71

Query  336  SDSHRLSSQVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKKIE  515
             D  +++ +VSK ALY VYLG ++ IS++  +A W  TGERQ + LR +YL++VL++ + 
Sbjct  72   MDLKKMTDEVSKYALYFVYLGLVVCISSYAEIACWMYTGERQVSTLRKKYLEAVLKQDVG  131

Query  516  FFDTDTRAKDIIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLA  695
            FFDTD R  DI+F +S+D +LVQDAI +K+G+ I Y+S FL G  VGF+S W+L L+++A
Sbjct  132  FFDTDARTGDIVFSVSTDTLLVQDAISEKVGNFIHYLSTFLAGLVVGFVSAWRLALLSVA  191

Query  696  VVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYSKS  875
            V+P IA AGG Y   ++ L+ K   +YA AG +AE+AI+QVRTVYS+VGE KA+ SYS +
Sbjct  192  VIPGIAFAGGLYAYTLTGLTSKSRESYANAGIIAEQAIAQVRTVYSYVGESKALNSYSDA  251

Query  876  LNNALVLG  899
            + N L LG
Sbjct  252  IQNTLKLG  259


 Score = 85.9 bits (211),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 63/259 (24%), Positives = 130/259 (50%), Gaps = 15/259 (6%)
 Frame = +3

Query  114  GELEISSNLKMDQQPSNSTDRKEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFF  293
            G +E+ SN + D++ + + D      +F      +  ++ + + G++G+ + G   P F 
Sbjct  650  GRIEMISNAETDKK-NPAPD-----GYFFRLLKMNAPEWPYSIMGAVGSILSGFIGPTFA  703

Query  294  VLFGRMIDSLGHLSSDSHRLSSQVSKQALYL-VYLGSIIF-ISAW-IGVAFWTQTGERQT  464
            ++   MI+   +        +S   K   Y+ +Y+G+ I+ + A+ I   F++  GE  T
Sbjct  704  IVMSNMIEVFYY-----RNYASMERKTKEYVFIYIGAGIYAVGAYLIQHYFFSIMGENLT  758

Query  465  ARLRLRYLQSVLRKKIEFFDTDTRAKDIIF-HISSDAILVQDAIGDKIGHTIRYISQFLV  641
             R+R   L ++LR ++ +FD +     ++   +++DA  V+ AI ++I   ++ ++  L 
Sbjct  759  TRVRRMMLAAILRNEVGWFDEEEHNSSLVAARLATDAADVKSAIAERISVILQNMTSLLT  818

Query  642  GFAVGFISVWKLTLVTLAVVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVR  821
             F V FI  W+++L+ LA  PL+ +A     L +   +     A+A+   +A E +S +R
Sbjct  819  SFIVAFIVEWRVSLLILATFPLLVLANFAQQLSLKGFAGDTAKAHAKTSMIAGEGVSNIR  878

Query  822  TVYSFVGEKKAVESYSKSL  878
            TV +F  + K +  +   L
Sbjct  879  TVAAFNAQNKMLSIFCHEL  897



>gb|KFK33760.1| hypothetical protein AALP_AA5G056700 [Arabis alpina]
Length=1251

 Score =   265 bits (677),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 124/252 (49%), Positives = 178/252 (71%), Gaps = 1/252 (0%)
 Frame = +3

Query  147  DQQPSNSTDRKEM-VSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSL  323
            D +P  +  +KE  + FF LFS AD  DY  M  G++GA IHG+++PVFF+LFG M++  
Sbjct  9    DAKPVEAEKKKEQSLPFFKLFSFADKFDYLLMSIGTLGAIIHGSSMPVFFLLFGEMVNGF  68

Query  324  GHLSSDSHRLSSQVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVLR  503
            G    D H+++ QVSK ALY VYLG ++  S++  +A W  +GERQ A LR +YL++VL+
Sbjct  69   GKNQMDLHQMTHQVSKYALYFVYLGLVVCFSSYAEIACWMYSGERQVAALRKKYLEAVLK  128

Query  504  KKIEFFDTDTRAKDIIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTL  683
            + + FFDTD R  DI+F +S+D +LVQDAI +K+G+ I Y+S FL G  VGF+S W+L L
Sbjct  129  QDVGFFDTDARTGDIVFSVSTDTLLVQDAISEKVGNFIHYLSTFLAGLVVGFVSAWRLAL  188

Query  684  VTLAVVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVES  863
            +++AV+P IA AGG Y   ++ ++ K   +YA AG +AE+AI+QVRTVYS+VGE KA+ S
Sbjct  189  LSVAVIPGIAFAGGLYAYTLTGITSKSRESYANAGVIAEQAIAQVRTVYSYVGESKALSS  248

Query  864  YSKSLNNALVLG  899
            YS+++   L LG
Sbjct  249  YSEAIQYTLKLG  260


 Score = 90.1 bits (222),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 64/261 (25%), Positives = 132/261 (51%), Gaps = 19/261 (7%)
 Frame = +3

Query  114  GELEISSNLKMDQQ---PSNSTDRKEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALP  284
            G +E+ SN + D++   P N         +F      ++ ++ + + G++G+ + G   P
Sbjct  651  GRIEMISNAETDRKTRAPQN---------YFYRLLKLNSPEWPYSIMGAVGSILSGFIGP  701

Query  285  VFFVLFGRMIDSLGHLSSDSHRLSSQVSKQALYLVYLGSIIF-ISAW-IGVAFWTQTGER  458
             F ++   MI+   +   DS     + +K+ ++ +Y+G+ ++ + A+ I   F++  GE 
Sbjct  702  TFAIVMSNMIEVFYYTDYDSME---RKTKEYVF-IYIGAGLYAVGAYLIQHYFFSIMGEN  757

Query  459  QTARLRLRYLQSVLRKKIEFFDTDTRAKDIIF-HISSDAILVQDAIGDKIGHTIRYISQF  635
             T R+R   L ++LR ++ +FD D     +I   +++DA  V+ AI ++I   ++ ++  
Sbjct  758  LTTRVRRMMLSAILRNEVGWFDEDEHNSSLIAARLATDAADVKSAIAERISVILQNMTSL  817

Query  636  LVGFAVGFISVWKLTLVTLAVVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQ  815
            L  F V FI  W+++L+ L   PL+ +A     L +   +     A+A+   +A E +S 
Sbjct  818  LTSFIVAFIVEWRVSLLILGTFPLLVLANFAQQLSLKGFAGDTAKAHAKTSMIAGEGVSN  877

Query  816  VRTVYSFVGEKKAVESYSKSL  878
            +RTV +F  + K +  +   L
Sbjct  878  IRTVAAFNAQSKILSLFCHEL  898



>emb|CDY00109.1| BnaC09g01920D [Brassica napus]
Length=1245

 Score =   265 bits (676),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 123/249 (49%), Positives = 179/249 (72%), Gaps = 1/249 (0%)
 Frame = +3

Query  156  PSNSTDRKEM-VSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHL  332
            P+ +  +KE  + FF LFS AD  D+  M+ GSIGA IHG+++PVFF+LFG M++  G  
Sbjct  13   PAEAEKKKEQSLPFFKLFSFADKFDHLLMITGSIGAIIHGSSMPVFFLLFGEMVNGFGKN  72

Query  333  SSDSHRLSSQVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKKI  512
              D H+++ +VSK ALY VYLG ++ +S++  +A W  +GERQ A LR +YL++VL++ +
Sbjct  73   QMDLHQMTHEVSKYALYFVYLGLVVCVSSYAEIACWMYSGERQVAALRKKYLEAVLKQDV  132

Query  513  EFFDTDTRAKDIIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTL  692
             FFDTD R  DI+F +S+D +LVQDAI +K+G+ I Y+S FL G  VGF+S W+L L+++
Sbjct  133  GFFDTDARTGDIVFSVSTDTLLVQDAISEKVGNFIHYLSTFLAGLVVGFVSAWRLALLSV  192

Query  693  AVVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYSK  872
            AV+P IA AGG Y   ++ ++ K   +YA AG +AE+AI+QVRTVYS+VGE KA+ SYS+
Sbjct  193  AVIPGIAFAGGLYAYTLTGITSKSRESYANAGVIAEQAIAQVRTVYSYVGESKALSSYSE  252

Query  873  SLNNALVLG  899
            ++   L LG
Sbjct  253  AIQYTLKLG  261


 Score = 90.9 bits (224),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 64/258 (25%), Positives = 128/258 (50%), Gaps = 13/258 (5%)
 Frame = +3

Query  114  GELEISSNLKMDQQPSNSTDRKEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFF  293
            G +E+ SN + D++      R     F+ L    +  ++ + + G++G+ + G   P F 
Sbjct  645  GRIEMISNAESDRK-----TRPPQNYFYRLLKL-NAPEWPYSIMGAVGSVLSGFIGPTFA  698

Query  294  VLFGRMIDSLGHLSSDSHRLSSQVSKQALYLVYLGSIIF--ISAWIGVAFWTQTGERQTA  467
            ++   MI+   +    +  +S +   +    +Y+G+ I+  I+  I   F++  GE  T 
Sbjct  699  IVMSNMIEVFYY----TDYVSMERKTKEYVFIYIGAGIYAVIAYLIQHYFFSIMGENLTT  754

Query  468  RLRLRYLQSVLRKKIEFFDTDTRAKDIIF-HISSDAILVQDAIGDKIGHTIRYISQFLVG  644
            R+R   L ++LR ++ +FD D     +I   +++DA  V+ AI ++I   ++ ++  L  
Sbjct  755  RVRRMMLSAILRNEVGWFDEDEHNSSLIAARLATDAADVKSAIAERISVILQNMTSLLTS  814

Query  645  FAVGFISVWKLTLVTLAVVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRT  824
            F V FI  W+++L+ L   PL+ +A     L +   +     A+A+   +A E +S +RT
Sbjct  815  FIVAFIIEWRVSLLILCTFPLLVLANFAQQLSLKGFAGDTAKAHAKTSMIAGEGVSNIRT  874

Query  825  VYSFVGEKKAVESYSKSL  878
            V +F  + K +  +S  L
Sbjct  875  VAAFNAQSKILSLFSHEL  892



>ref|XP_002976764.1| hypothetical protein SELMODRAFT_105467 [Selaginella moellendorffii]
 gb|EFJ22433.1| hypothetical protein SELMODRAFT_105467 [Selaginella moellendorffii]
Length=1290

 Score =   265 bits (677),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 129/238 (54%), Positives = 175/238 (74%), Gaps = 0/238 (0%)
 Frame = +3

Query  186  VSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLSSDSHRLSSQV  365
            V ++ L+S AD +D   +  G+IGAC HGAA+PVFF+ FG++ID  G    +  +L   V
Sbjct  64   VPYYKLYSFADAMDLGLIFVGAIGACAHGAAIPVFFIFFGKLIDEFGANYDNPTKLGHGV  123

Query  366  SKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKKIEFFDTDTRAKD  545
            SK ALY VYLG  I ++AW+ VA WT TGERQ+AR+R+ YL+++L + + FFDTDT   +
Sbjct  124  SKYALYFVYLGLAILVAAWLEVACWTYTGERQSARMRVAYLKAMLSQDVGFFDTDTTTGE  183

Query  546  IIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLAVVPLIAVAGG  725
            I+  ISSD  LVQ+AIG K G+ + Y+++F+ GFAVGF SVW+LTLVTLAVVP IA+AGG
Sbjct  184  IVNGISSDTALVQEAIGAKAGNYLHYMARFVAGFAVGFSSVWQLTLVTLAVVPGIALAGG  243

Query  726  TYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYSKSLNNALVLG  899
             Y   M  L+ K + AYA+AG VAE++ISQVRTVYSFV E++AV+SY+++L   L +G
Sbjct  244  LYAHTMIGLTTKNQKAYAKAGNVAEQSISQVRTVYSFVQEEQAVDSYARALETTLEIG  301


 Score = 84.3 bits (207),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 67/239 (28%), Positives = 117/239 (49%), Gaps = 18/239 (8%)
 Frame = +3

Query  189  SFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLSSDSHRLSSQVS  368
            S+F L    +  ++ F + G++GA + GA  P F   +G     +   S D      +V 
Sbjct  702  SYFRLLKL-NAPEWPFALAGALGAILAGAETPFF--AYGITQALVTFYSPDQSHQKREVE  758

Query  369  KQALYLVYLGSIIFISAWIGVA-------FWTQTGERQTARLRLRYLQSVLRKKIEFFD-  524
            K       + +I  I+  + V        F+   GER T R+R     ++LR +I +FD 
Sbjct  759  K-------ISTIFAIATVVTVGIYVLEHYFFGVMGERLTMRVRKMMFSNILRNEIGWFDR  811

Query  525  TDTRAKDIIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLAVVP  704
             +  +  +   +SSDA +++ A+GD++    + ++  + GF + F+  WKLTLV +A+ P
Sbjct  812  EENNSSLLASRLSSDATMLRAAVGDRLCTLTQNLALIVTGFVMAFVLQWKLTLVIIALFP  871

Query  705  LIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYSKSLN  881
            L+  A  T  L +         AY  A  VA EA+  +RTV +F  EK+ ++ +++ L 
Sbjct  872  LMIGAHITEHLFLKGFGVNLSKAYHRATMVAGEAVGNIRTVAAFCAEKRVMDLFNRELQ  930



>ref|XP_010032346.1| PREDICTED: ABC transporter B family member 19 [Eucalyptus grandis]
 gb|KCW51754.1| hypothetical protein EUGRSUZ_J01214 [Eucalyptus grandis]
Length=1249

 Score =   265 bits (676),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 121/248 (49%), Positives = 176/248 (71%), Gaps = 0/248 (0%)
 Frame = +3

Query  156  PSNSTDRKEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLS  335
            P     + + + F+ LFS AD  D+  M+ GS+GA IHG+++PVFF+LFG M++  G   
Sbjct  11   PDAEKKKDQSLPFYQLFSFADKYDWLLMISGSLGAIIHGSSMPVFFLLFGEMVNGFGKNQ  70

Query  336  SDSHRLSSQVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKKIE  515
            SD  +++ +VSK ALY VYLG ++ +S++  +A W  TGERQ + LR +YL++VLR+ + 
Sbjct  71   SDLKKMTQEVSKYALYFVYLGLVVCLSSYAEIACWMYTGERQASTLRKKYLEAVLRQDVG  130

Query  516  FFDTDTRAKDIIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLA  695
            FFDTD R  DI+F +S+D +LVQDAI +K+G+ I Y+S FL G  VGF++ W+L L+++A
Sbjct  131  FFDTDARTGDIVFSVSTDTLLVQDAISEKVGNFIHYLSTFLAGLVVGFVAAWRLALLSVA  190

Query  696  VVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYSKS  875
            V+P IA AGG Y   ++ L+ K   +YA AG +AE+AI+QVRTVYS+VGE KA+ SYS +
Sbjct  191  VIPGIAFAGGLYAYTLTGLTSKSRESYANAGIIAEQAIAQVRTVYSYVGECKALNSYSDA  250

Query  876  LNNALVLG  899
            + N L LG
Sbjct  251  IQNTLKLG  258


 Score = 82.4 bits (202),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 58/258 (22%), Positives = 131/258 (51%), Gaps = 13/258 (5%)
 Frame = +3

Query  114  GELEISSNLKMDQQPSNSTDRKEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFF  293
            G +E+ SN + +++ + + D      +F      +  ++ + + G+ G+ + G   P F 
Sbjct  649  GRIEMVSNAETERR-NPAPD-----GYFCRLLKLNAPEWPYSIMGAAGSVLSGFIGPTFA  702

Query  294  VLFGRMIDSLGHLSSDSHRLSSQVSKQALYLVYLGSIIF--ISAWIGVAFWTQTGERQTA  467
            ++   MI+   + +  S     + +K+ ++ +Y+G+ ++  ++  I   F++  GE  T 
Sbjct  703  IVMSNMIEVFYYRNPASME---RKTKEYVF-IYIGAGLYAVVAYLIQHYFFSIMGENLTT  758

Query  468  RLRLRYLQSVLRKKIEFFDTDTRAKDIIF-HISSDAILVQDAIGDKIGHTIRYISQFLVG  644
            R+R   L ++LR ++ +FD +     ++   +++DA  V+ AI ++I   ++ ++  L  
Sbjct  759  RVRRMMLAAILRNEVGWFDEEEHNSSLVAARLATDAADVKSAIAERISVILQNMTSLLTS  818

Query  645  FAVGFISVWKLTLVTLAVVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRT  824
            F V FI  W+++L+ LA  PL+ +A     L +   +     A+A+   +A E +S +RT
Sbjct  819  FIVAFIIEWRVSLLILATFPLLVLANFAQQLSLKGFAGDTAKAHAKTSMIAGEGVSNIRT  878

Query  825  VYSFVGEKKAVESYSKSL  878
            V +F  + + +  +   L
Sbjct  879  VAAFNAQNRILSLFCHEL  896



>gb|KCW51753.1| hypothetical protein EUGRSUZ_J01214 [Eucalyptus grandis]
Length=1250

 Score =   265 bits (676),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 121/248 (49%), Positives = 176/248 (71%), Gaps = 0/248 (0%)
 Frame = +3

Query  156  PSNSTDRKEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLS  335
            P     + + + F+ LFS AD  D+  M+ GS+GA IHG+++PVFF+LFG M++  G   
Sbjct  11   PDAEKKKDQSLPFYQLFSFADKYDWLLMISGSLGAIIHGSSMPVFFLLFGEMVNGFGKNQ  70

Query  336  SDSHRLSSQVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKKIE  515
            SD  +++ +VSK ALY VYLG ++ +S++  +A W  TGERQ + LR +YL++VLR+ + 
Sbjct  71   SDLKKMTQEVSKYALYFVYLGLVVCLSSYAEIACWMYTGERQASTLRKKYLEAVLRQDVG  130

Query  516  FFDTDTRAKDIIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLA  695
            FFDTD R  DI+F +S+D +LVQDAI +K+G+ I Y+S FL G  VGF++ W+L L+++A
Sbjct  131  FFDTDARTGDIVFSVSTDTLLVQDAISEKVGNFIHYLSTFLAGLVVGFVAAWRLALLSVA  190

Query  696  VVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYSKS  875
            V+P IA AGG Y   ++ L+ K   +YA AG +AE+AI+QVRTVYS+VGE KA+ SYS +
Sbjct  191  VIPGIAFAGGLYAYTLTGLTSKSRESYANAGIIAEQAIAQVRTVYSYVGECKALNSYSDA  250

Query  876  LNNALVLG  899
            + N L LG
Sbjct  251  IQNTLKLG  258


 Score = 82.4 bits (202),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 58/258 (22%), Positives = 131/258 (51%), Gaps = 13/258 (5%)
 Frame = +3

Query  114  GELEISSNLKMDQQPSNSTDRKEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFF  293
            G +E+ SN + +++ + + D      +F      +  ++ + + G+ G+ + G   P F 
Sbjct  650  GRIEMVSNAETERR-NPAPD-----GYFCRLLKLNAPEWPYSIMGAAGSVLSGFIGPTFA  703

Query  294  VLFGRMIDSLGHLSSDSHRLSSQVSKQALYLVYLGSIIF--ISAWIGVAFWTQTGERQTA  467
            ++   MI+   + +  S     + +K+ ++ +Y+G+ ++  ++  I   F++  GE  T 
Sbjct  704  IVMSNMIEVFYYRNPASME---RKTKEYVF-IYIGAGLYAVVAYLIQHYFFSIMGENLTT  759

Query  468  RLRLRYLQSVLRKKIEFFDTDTRAKDIIF-HISSDAILVQDAIGDKIGHTIRYISQFLVG  644
            R+R   L ++LR ++ +FD +     ++   +++DA  V+ AI ++I   ++ ++  L  
Sbjct  760  RVRRMMLAAILRNEVGWFDEEEHNSSLVAARLATDAADVKSAIAERISVILQNMTSLLTS  819

Query  645  FAVGFISVWKLTLVTLAVVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRT  824
            F V FI  W+++L+ LA  PL+ +A     L +   +     A+A+   +A E +S +RT
Sbjct  820  FIVAFIIEWRVSLLILATFPLLVLANFAQQLSLKGFAGDTAKAHAKTSMIAGEGVSNIRT  879

Query  825  VYSFVGEKKAVESYSKSL  878
            V +F  + + +  +   L
Sbjct  880  VAAFNAQNRILSLFCHEL  897



>gb|AIU41631.1| ABC transporter family protein [Hevea brasiliensis]
Length=1259

 Score =   264 bits (675),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 121/248 (49%), Positives = 176/248 (71%), Gaps = 0/248 (0%)
 Frame = +3

Query  156  PSNSTDRKEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLS  335
            P     +++ + F+ LFS AD  D+  M+ GS+GA IHG+++PVFF+LFG M++  G   
Sbjct  21   PEAEKKKEQSLPFYHLFSFADKYDWLLMISGSLGAIIHGSSMPVFFLLFGEMVNGFGKNQ  80

Query  336  SDSHRLSSQVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKKIE  515
            SD  +++ +VSK ALY VYLG ++ IS++  +A W  TGERQ   LR +YL++VL++ + 
Sbjct  81   SDLPKMTHEVSKYALYFVYLGLVVCISSYAEIACWMYTGERQVGTLRKKYLEAVLKQDVG  140

Query  516  FFDTDTRAKDIIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLA  695
            FFDTD R  DI+F +S+D +LVQDAI +K+G+ I Y+S FL G  VGF+S W+L L+++A
Sbjct  141  FFDTDARTGDIVFSVSTDTLLVQDAISEKVGNFIHYLSTFLAGLVVGFVSAWRLALLSVA  200

Query  696  VVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYSKS  875
            V+P IA AGG Y   ++ L+ K   +YA+AG +AE+AI+QVR VYS+VGE KA+ SYS +
Sbjct  201  VIPGIAFAGGLYAYTLTGLTSKSRESYAQAGIIAEQAIAQVRAVYSYVGESKALNSYSDA  260

Query  876  LNNALVLG  899
            + N L LG
Sbjct  261  IQNTLKLG  268


 Score = 88.2 bits (217),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 63/251 (25%), Positives = 127/251 (51%), Gaps = 17/251 (7%)
 Frame = +3

Query  114  GELEISSNLKMDQQPSNSTDRKEMVS--FFGLFSAADTVDYFFMVFGSIGACIHGAALPV  287
            G +E+ SN +        TDRK      +F      +  ++ + V G+IG+ + G   P 
Sbjct  659  GRIEMISNAE--------TDRKNPAPDGYFCRLLKLNAPEWPYSVMGAIGSVLSGFIGPT  710

Query  288  FFVLFGRMIDSLGHLSSDSHRLSSQVSKQALYLVYLGSIIF--ISAWIGVAFWTQTGERQ  461
            F ++   MI+   + +  S     + +K+ ++ +Y+G+ ++  ++  I   F++  GE  
Sbjct  711  FAIVMSNMIEVFYYRNPASME---RKTKEYVF-IYIGAGLYAVVAYLIQHYFFSIMGENL  766

Query  462  TARLRLRYLQSVLRKKIEFFDTDTRAKDIIF-HISSDAILVQDAIGDKIGHTIRYISQFL  638
            T R+R   L ++LR ++ +FD +     ++   +++DA  V+ AI ++I   ++ ++  L
Sbjct  767  TTRVRRMMLAAILRNEVGWFDEEEHNSSLVAARLATDAADVKSAIAERISVILQNMTSLL  826

Query  639  VGFAVGFISVWKLTLVTLAVVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQV  818
              F V FI  W+++L+ LA  PL+ +A     L +   +     A+A+   +A E +S +
Sbjct  827  TSFIVAFIVEWRVSLLILATFPLLVLANFAQQLSLKGFAGDTAKAHAKTSMIAGEGVSNI  886

Query  819  RTVYSFVGEKK  851
            RTV +F  + K
Sbjct  887  RTVAAFNAQDK  897



>ref|XP_001779184.1| ATP-binding cassette transporter, subfamily B, member 16, group 
MDR/PGP protein PpABCB16 [Physcomitrella patens]
 gb|EDQ56030.1| ATP-binding cassette transporter, subfamily B, member 16, group 
MDR/PGP protein PpABCB16 [Physcomitrella patens]
Length=1284

 Score =   264 bits (675),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 125/253 (49%), Positives = 177/253 (70%), Gaps = 0/253 (0%)
 Frame = +3

Query  141  KMDQQPSNSTDRKEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDS  320
            K D+           VS F LF  AD+ DY  +  G +GA  HG ALPVFF+ FG+++D 
Sbjct  50   KRDKDSETDVPVGGAVSLFKLFKFADSFDYLLISIGLVGAAAHGCALPVFFLFFGKLLDG  109

Query  321  LGHLSSDSHRLSSQVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVL  500
             G  +++  +++  V + +LY++YLG ++  ++W  VA W Q+GERQ AR+R+RYLQ+++
Sbjct  110  FGANANNPVKMADIVGQYSLYMLYLGIVVCFASWAEVAAWMQSGERQAARIRVRYLQAMM  169

Query  501  RKKIEFFDTDTRAKDIIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLT  680
            ++ + FFDTD R  +I+  ISSD +L+QDAI +K+G+ I Y+  F+ GFA+GF  +WKL 
Sbjct  170  KQDVAFFDTDARTGEIVNSISSDTLLIQDAISEKMGNFIHYLVTFISGFAIGFTLLWKLA  229

Query  681  LVTLAVVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVE  860
            LVTLAVVP IA+AGG Y   ++ L+ K   AYAEAG +AE++I+QVRTVYSFVGEKKA E
Sbjct  230  LVTLAVVPAIAMAGGLYAYSLTGLTSKSNEAYAEAGGIAEQSIAQVRTVYSFVGEKKATE  289

Query  861  SYSKSLNNALVLG  899
            SYS SL+ +L LG
Sbjct  290  SYSSSLHRSLKLG  302


 Score = 84.0 bits (206),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 62/226 (27%), Positives = 102/226 (45%), Gaps = 3/226 (1%)
 Frame = +3

Query  225  DYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLSSDSHRLSSQVSKQALYLVYLGSI  404
            ++ + + G  G+ + G   P F ++   ++    +  +D  ++  +V+K A+  V L   
Sbjct  716  EWGYGLLGCFGSIVSGLMNPAFALIISNVL--YAYYYTDYSKMRKEVAKYAIIFVGLSGA  773

Query  405  IFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKKIEFFDTDTRAK-DIIFHISSDAILV  581
                 ++   F+   GE    R+R      +L  +I +FD D  +   +   +S+DA  V
Sbjct  774  ALAGYFVQHFFFGVMGENLIKRVREMMFSRILTYEISWFDKDENSSGQVSARLSADATTV  833

Query  582  QDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLAVVPLIAVAGGTYTLIMSNLSQK  761
            + AIGD+I   ++  S  +    + FI  W++ LV LA  PL   A     + +   S  
Sbjct  834  RGAIGDRISLVVQNSSLLIATGIIAFILQWQMALVVLATFPLQVFAAMVEQMFLKGFSGD  893

Query  762  GEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYSKSLNNALVLG  899
               A A A  VA EAI  VRTV +F  E K V  + K L   L  G
Sbjct  894  VRGAQARATMVASEAIGNVRTVAAFNAEDKVVNLFQKELEAPLKRG  939



>ref|XP_009111610.1| PREDICTED: ABC transporter B family member 19-like [Brassica 
rapa]
Length=1252

 Score =   264 bits (674),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 122/249 (49%), Positives = 179/249 (72%), Gaps = 1/249 (0%)
 Frame = +3

Query  156  PSNSTDRKEM-VSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHL  332
            P+ +  +KE  + FF LFS AD  D+  M+ GSIGA IHG+++PVFF+LFG M++  G  
Sbjct  13   PAEAEKKKEQSLPFFKLFSFADKFDHLLMITGSIGAIIHGSSMPVFFLLFGEMVNGFGKN  72

Query  333  SSDSHRLSSQVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKKI  512
              D H+++ +VS+ ALY VYLG ++ +S++  +A W  +GERQ A LR +YL++VL++ +
Sbjct  73   QMDLHQMTHEVSRYALYFVYLGLVVCVSSYAEIACWMYSGERQVAALRKKYLEAVLKQDV  132

Query  513  EFFDTDTRAKDIIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTL  692
             FFDTD R  DI+F +S+D +LVQDAI +K+G+ I Y+S FL G  VGF+S W+L L+++
Sbjct  133  GFFDTDARTGDIVFSVSTDTLLVQDAISEKVGNFIHYLSTFLAGLVVGFVSAWRLALLSV  192

Query  693  AVVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYSK  872
            AV+P IA AGG Y   ++ ++ K   +YA AG +AE+AI+QVRTVYS+VGE KA+ SYS+
Sbjct  193  AVIPGIAFAGGLYAYTLTGITSKSRESYANAGVIAEQAIAQVRTVYSYVGESKALSSYSE  252

Query  873  SLNNALVLG  899
            ++   L LG
Sbjct  253  AIQYTLKLG  261


 Score = 90.5 bits (223),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 63/258 (24%), Positives = 128/258 (50%), Gaps = 13/258 (5%)
 Frame = +3

Query  114  GELEISSNLKMDQQPSNSTDRKEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFF  293
            G +E+ SN + D++      R     F+ L    +  ++ + + G++G+ + G   P F 
Sbjct  652  GRIEMISNAESDRK-----TRPPQNYFYRLLKL-NAPEWPYSIMGAVGSVLSGFIGPTFA  705

Query  294  VLFGRMIDSLGHLSSDSHRLSSQVSKQALYLVYLGSIIF--ISAWIGVAFWTQTGERQTA  467
            ++   MI+   +    +  +S +   +    +Y+G+ I+  I+  I   F++  GE  T 
Sbjct  706  IVMSNMIEVFYY----TDYVSMERKTKEYVFIYIGAGIYAVIAYLIQHYFFSIMGENLTT  761

Query  468  RLRLRYLQSVLRKKIEFFDTDTRAKDIIF-HISSDAILVQDAIGDKIGHTIRYISQFLVG  644
            R+R   L ++LR ++ +FD D     ++   +++DA  V+ AI ++I   ++ ++  L  
Sbjct  762  RVRRMMLSAILRNEVGWFDEDEHNSSLVAARLATDAADVKSAIAERISVILQNMTSLLTS  821

Query  645  FAVGFISVWKLTLVTLAVVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRT  824
            F V FI  W+++L+ L   PL+ +A     L +   +     A+A+   +A E +S +RT
Sbjct  822  FIVAFIIEWRVSLLILCTFPLLVLANFAQQLSLKGFAGDTAKAHAKTSMIAGEGVSNIRT  881

Query  825  VYSFVGEKKAVESYSKSL  878
            V +F  + K +  +S  L
Sbjct  882  VAAFNAQSKILSLFSHEL  899



>emb|CDY20012.1| BnaA09g02390D [Brassica napus]
Length=1253

 Score =   264 bits (674),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 122/249 (49%), Positives = 179/249 (72%), Gaps = 1/249 (0%)
 Frame = +3

Query  156  PSNSTDRKEM-VSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHL  332
            P+ +  +KE  + FF LFS AD  D+  M+ GSIGA IHG+++PVFF+LFG M++  G  
Sbjct  13   PAEAEKKKEQSLPFFKLFSFADKFDHLLMITGSIGAIIHGSSMPVFFLLFGEMVNGFGKN  72

Query  333  SSDSHRLSSQVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKKI  512
              D H+++ +VS+ ALY VYLG ++ +S++  +A W  +GERQ A LR +YL++VL++ +
Sbjct  73   QMDLHQMTHEVSRYALYFVYLGLVVCVSSYAEIACWMYSGERQVAALRKKYLEAVLKQDV  132

Query  513  EFFDTDTRAKDIIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTL  692
             FFDTD R  DI+F +S+D +LVQDAI +K+G+ I Y+S FL G  VGF+S W+L L+++
Sbjct  133  GFFDTDARTGDIVFSVSTDTLLVQDAISEKVGNFIHYLSTFLAGLVVGFVSAWRLALLSV  192

Query  693  AVVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYSK  872
            AV+P IA AGG Y   ++ ++ K   +YA AG +AE+AI+QVRTVYS+VGE KA+ SYS+
Sbjct  193  AVIPGIAFAGGLYAYTLTGITSKSRESYANAGVIAEQAIAQVRTVYSYVGESKALSSYSE  252

Query  873  SLNNALVLG  899
            ++   L LG
Sbjct  253  AIQYTLKLG  261


 Score = 90.5 bits (223),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 63/258 (24%), Positives = 128/258 (50%), Gaps = 13/258 (5%)
 Frame = +3

Query  114  GELEISSNLKMDQQPSNSTDRKEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFF  293
            G +E+ SN + D++      R     F+ L    +  ++ + + G++G+ + G   P F 
Sbjct  653  GRIEMISNAESDRK-----TRPPQNYFYRLLKL-NAPEWPYSIMGAVGSVLSGFIGPTFA  706

Query  294  VLFGRMIDSLGHLSSDSHRLSSQVSKQALYLVYLGSIIF--ISAWIGVAFWTQTGERQTA  467
            ++   MI+   +    +  +S +   +    +Y+G+ I+  I+  I   F++  GE  T 
Sbjct  707  IVMSNMIEVFYY----TDYVSMERKTKEYVFIYIGAGIYAVIAYLIQHYFFSIMGENLTT  762

Query  468  RLRLRYLQSVLRKKIEFFDTDTRAKDIIF-HISSDAILVQDAIGDKIGHTIRYISQFLVG  644
            R+R   L ++LR ++ +FD D     ++   +++DA  V+ AI ++I   ++ ++  L  
Sbjct  763  RVRRMMLSAILRNEVGWFDEDEHNSSLVAARLATDAADVKSAIAERISVILQNMTSLLTS  822

Query  645  FAVGFISVWKLTLVTLAVVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRT  824
            F V FI  W+++L+ L   PL+ +A     L +   +     A+A+   +A E +S +RT
Sbjct  823  FIVAFIIEWRVSLLILCTFPLLVLANFAQQLSLKGFAGDTAKAHAKTSMIAGEGVSNIRT  882

Query  825  VYSFVGEKKAVESYSKSL  878
            V +F  + K +  +S  L
Sbjct  883  VAAFNAQSKILSLFSHEL  900



>ref|XP_004304313.1| PREDICTED: ABC transporter B family member 19-like [Fragaria 
vesca subsp. vesca]
Length=1250

 Score =   263 bits (673),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 122/248 (49%), Positives = 176/248 (71%), Gaps = 0/248 (0%)
 Frame = +3

Query  156  PSNSTDRKEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLS  335
            P     +++ + F+ LFS AD  D   MV GSIGA IHG+++PVFF+LFG M++  G   
Sbjct  12   PEAEKKKEQSLPFYQLFSFADKYDCLLMVSGSIGAIIHGSSMPVFFLLFGEMVNGFGKNQ  71

Query  336  SDSHRLSSQVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKKIE  515
             D H+++++V+K ALY VYLG I+ +S++  +A W  TGERQ + LR +YL++VL++ + 
Sbjct  72   MDLHKMTAEVAKYALYFVYLGLIVCVSSYAEIACWMYTGERQVSTLRKKYLEAVLKQDVG  131

Query  516  FFDTDTRAKDIIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLA  695
            FFDTD R  DI+F +S+D +LVQDAI +K+G+ I Y+S FL G  VGF+S W+L L+++A
Sbjct  132  FFDTDARTGDIVFSVSTDTLLVQDAISEKVGNFIHYLSTFLAGLVVGFVSAWRLALLSVA  191

Query  696  VVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYSKS  875
            V+P IA AGG Y   ++ L+ K   +YA AG +AE+AI+QVRTV S+VGE KA+ SYS +
Sbjct  192  VIPGIAFAGGLYAYTLTGLTSKSRESYANAGIMAEQAIAQVRTVKSYVGESKALNSYSDA  251

Query  876  LNNALVLG  899
            + N L LG
Sbjct  252  IQNTLQLG  259


 Score = 86.7 bits (213),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 63/258 (24%), Positives = 131/258 (51%), Gaps = 13/258 (5%)
 Frame = +3

Query  114  GELEISSNLKMDQQPSNSTDRKEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFF  293
            G +E+ SN + D++      R     FF L    +  ++ + + G+IG+ + G   P F 
Sbjct  650  GRIEMISNAETDRK-----TRAPRGYFFRLLKL-NAPEWPYSIMGAIGSVLSGFIGPTFA  703

Query  294  VLFGRMIDSLGHLSSDSHRLSSQVSKQALYLVYLGSIIF--ISAWIGVAFWTQTGERQTA  467
            ++   MI+   + +  S     + +K+ ++ VY+G+ ++  ++  I   F++  GE  T 
Sbjct  704  IVMSNMIEVFYYRNPASME---RKTKEYVF-VYIGAGLYAVVAYLIQHYFFSIMGENLTT  759

Query  468  RLRLRYLQSVLRKKIEFFDTDTRAKDIIF-HISSDAILVQDAIGDKIGHTIRYISQFLVG  644
            R+R   L ++LR ++ ++D +     ++   +++DA  V+ AI ++I   ++ ++  L  
Sbjct  760  RVRRMMLAAILRNEVGWYDEEENNSSLLASKLATDAADVKSAIAERISVILQNMTSLLTS  819

Query  645  FAVGFISVWKLTLVTLAVVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRT  824
            F V FI  W+++L+ LA  PL+ +A     L +   +     A+A+   +A E +S +RT
Sbjct  820  FIVAFIVEWRVSLLILATFPLLVLANFAQQLSLKGFAGDTAKAHAKTSMIAGEGVSNIRT  879

Query  825  VYSFVGEKKAVESYSKSL  878
            V +F  + K +  +   L
Sbjct  880  VAAFNAQDKILSLFCHEL  897



>ref|XP_010552950.1| PREDICTED: ABC transporter B family member 19-like isoform X1 
[Tarenaya hassleriana]
Length=1254

 Score =   263 bits (673),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 121/248 (49%), Positives = 174/248 (70%), Gaps = 0/248 (0%)
 Frame = +3

Query  156  PSNSTDRKEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLS  335
            P     +++ + FF LFS AD  D+  M+ GS+GA +HG+++PVFF+LFG M++  G   
Sbjct  16   PEAEKKKEQSLPFFQLFSFADKYDHLLMITGSLGAVVHGSSMPVFFLLFGEMVNGFGKNQ  75

Query  336  SDSHRLSSQVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKKIE  515
             D  +++S+VSK ALY VYLG ++  S++  +A W  TGERQ   LR RYLQ+VL++ + 
Sbjct  76   MDLQKMTSEVSKYALYFVYLGLVVCFSSYAEIACWMYTGERQVGALRKRYLQAVLKQDVG  135

Query  516  FFDTDTRAKDIIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLA  695
            FFDTD R  DI+F +S+D +LVQDAI +K+G+ I Y+S FL G  VGF+S W+L L+++A
Sbjct  136  FFDTDARTGDIVFSVSTDTLLVQDAISEKVGNFIHYLSTFLAGLVVGFVSAWRLALLSVA  195

Query  696  VVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYSKS  875
            V+P IA AGG Y   ++ ++ K   +YA AG +AE+AI+QVRTVYS+VGE KA+ SYS +
Sbjct  196  VIPGIAFAGGLYAYTLTGITSKSRESYANAGVIAEQAIAQVRTVYSYVGESKALSSYSNA  255

Query  876  LNNALVLG  899
            +   L LG
Sbjct  256  IQYTLKLG  263


 Score = 79.7 bits (195),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 60/259 (23%), Positives = 126/259 (49%), Gaps = 15/259 (6%)
 Frame = +3

Query  114  GELEISSNLKMDQQPSNSTDRKEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFF  293
            G +E+ SN + +++      R     FF L    +  ++ + + G+IG+ + G   P F 
Sbjct  654  GRIEMISNAETERKA-----RAPDGYFFRLLKL-NGPEWPYSIVGAIGSVLSGFIGPTFA  707

Query  294  VLFGRMIDSLGHLSSDSHRLSSQVSKQALYL-VYLGSIIF--ISAWIGVAFWTQTGERQT  464
            ++   MI+   +        +S   K   Y+ VY+G+ ++  ++  I   F++  GE  T
Sbjct  708  IVMSNMIEVFYY-----RNYASMERKTKEYVFVYIGTGLYAVVAYLIQHYFFSIMGENLT  762

Query  465  ARLRLRYLQSVLRKKIEFFDTDTRAKDII-FHISSDAILVQDAIGDKIGHTIRYISQFLV  641
             R+R   L ++LR ++ +FD +     ++   +++DA  V+ A+ ++I   ++ ++  L 
Sbjct  763  TRVRRMMLSAILRNEVGWFDEEEHNSSLVAARLATDAADVKSAMAERISVILQNVTSLLT  822

Query  642  GFAVGFISVWKLTLVTLAVVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVR  821
             F V FI  W+++L+ LA  P + +A     L +   +      +A+   +A E +S +R
Sbjct  823  SFIVAFIVEWRVSLLILAAFPFLVLANFAQQLSLKGFAGDTAKVHAKTSMIAGEGVSNIR  882

Query  822  TVYSFVGEKKAVESYSKSL  878
            TV +F  + + +  +   L
Sbjct  883  TVAAFNAQDRILSLFCHEL  901



>emb|CDP02220.1| unnamed protein product [Coffea canephora]
Length=1250

 Score =   263 bits (672),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 118/248 (48%), Positives = 175/248 (71%), Gaps = 0/248 (0%)
 Frame = +3

Query  156  PSNSTDRKEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLS  335
            P     +++ + F+ LFS AD  D+  M+ GS+GA +HG+++PVFF+LFG M++  G   
Sbjct  12   PEAEKKKEQSLPFYQLFSFADKYDWLLMITGSLGAVVHGSSMPVFFLLFGEMVNGFGKNQ  71

Query  336  SDSHRLSSQVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKKIE  515
            +D H++  +V+K ALY +YLG I+  S++  +A W  +GERQ   LR +YL++VL++ + 
Sbjct  72   TDLHKMIHEVAKYALYFIYLGLIVCFSSYAEIACWMHSGERQAGALRRKYLEAVLKQDVG  131

Query  516  FFDTDTRAKDIIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLA  695
            FFDTD R  DI+F +S+D +LVQDAI +K+G+ I Y+S FL G  VGF+S W+L L+++A
Sbjct  132  FFDTDARTGDIVFSVSTDTLLVQDAISEKVGNFIHYLSTFLAGLVVGFVSAWRLALLSVA  191

Query  696  VVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYSKS  875
            V+P IA AGG Y   ++ L+ K   +YA AG +AE+AI+QVRTVYS+VGE KA+ SYS +
Sbjct  192  VIPGIAFAGGLYAYTLTGLTSKSRESYANAGIIAEQAIAQVRTVYSYVGESKALNSYSDA  251

Query  876  LNNALVLG  899
            + N L LG
Sbjct  252  IQNTLKLG  259


 Score = 94.7 bits (234),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 63/260 (24%), Positives = 132/260 (51%), Gaps = 17/260 (7%)
 Frame = +3

Query  114  GELEISSNLKMDQQPSNSTDRKEMVS--FFGLFSAADTVDYFFMVFGSIGACIHGAALPV  287
            G +E+ SN +        TDRK      +F      +  ++ + + G++G+ + G   P 
Sbjct  650  GRIEMVSNAE--------TDRKNPAPHGYFCRLLKLNAPEWPYSIMGAVGSILSGFIGPT  701

Query  288  FFVLFGRMIDSLGHLSSDSHRLSSQVSKQALYLVYLGSIIF--ISAWIGVAFWTQTGERQ  461
            F ++ G MI+   +    ++  S +   +    +Y+G+ ++  ++  I   F++  GE  
Sbjct  702  FAIVMGNMIEVFYY----TNPASMERKTKEYVFIYIGAGLYAVVAYLIQHYFFSIMGENL  757

Query  462  TARLRLRYLQSVLRKKIEFFDTDTRAKDIIF-HISSDAILVQDAIGDKIGHTIRYISQFL  638
            T R+R   L ++LR ++ +FD +    +++   +++DA  V+ AI ++I   ++ ++  L
Sbjct  758  TTRVRRMMLAAILRNEVGWFDEEEHNSNLLAARLATDAADVKSAIAERISVILQNMTSLL  817

Query  639  VGFAVGFISVWKLTLVTLAVVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQV  818
              F V FI  W+++L+ LA  PL+ +A     L +   +     A+A+   +A E +S +
Sbjct  818  TSFIVAFIVEWRVSLLILATFPLLVLANFAQQLSLKGFAGDTAKAHAKTSMIAGEGVSNI  877

Query  819  RTVYSFVGEKKAVESYSKSL  878
            RTV +F  ++K +  +S+ L
Sbjct  878  RTVAAFNAQEKIISLFSQEL  897



>ref|XP_007151220.1| hypothetical protein PHAVU_004G027800g [Phaseolus vulgaris]
 gb|ESW23214.1| hypothetical protein PHAVU_004G027800g [Phaseolus vulgaris]
Length=1249

 Score =   263 bits (671),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 118/248 (48%), Positives = 175/248 (71%), Gaps = 0/248 (0%)
 Frame = +3

Query  156  PSNSTDRKEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLS  335
            P     +++ + F+ LFS AD  D+  M+ GS+GA +HG+++PVFF+LFG M++  G   
Sbjct  11   PEAEKKKEQTLPFYKLFSFADKCDWMLMISGSLGAIVHGSSMPVFFLLFGEMVNGFGKNQ  70

Query  336  SDSHRLSSQVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKKIE  515
             D  +++ +VSK ALY VYLG ++ +S++  +A W  TGERQ + LR +YL++VL++ + 
Sbjct  71   MDLKKMTEEVSKYALYFVYLGLVVCLSSYAEIACWMYTGERQVSTLRKKYLEAVLKQDVG  130

Query  516  FFDTDTRAKDIIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLA  695
            FFDTD R  DI+F +S+D +LVQDAI +K+G+ I Y+S FL G  VGF+S W+L L+++A
Sbjct  131  FFDTDARTGDIVFSVSTDTLLVQDAISEKVGNFIHYLSTFLAGLVVGFVSAWRLALLSVA  190

Query  696  VVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYSKS  875
            V+P IA AGG Y   ++ L+ K   +YA AG +AE+AI+Q RTVYS+VGE KA+ SYS +
Sbjct  191  VIPGIAFAGGLYAYTLTGLTSKSRESYANAGIIAEQAIAQARTVYSYVGESKALNSYSDA  250

Query  876  LNNALVLG  899
            + N L LG
Sbjct  251  IQNTLKLG  258


 Score = 83.6 bits (205),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 63/259 (24%), Positives = 127/259 (49%), Gaps = 15/259 (6%)
 Frame = +3

Query  114  GELEISSNLKMDQQPSNSTDRKEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFF  293
            G +E+ SN + D++            FF L    +  ++ + + G++G+ + G   P F 
Sbjct  649  GRIEMISNAETDKKNPAPDGY-----FFRLLKL-NAPEWPYSIMGAVGSVLSGFIGPTFA  702

Query  294  VLFGRMIDSLGHLSSDSHRLSSQVSKQALYL-VYLGSIIF-ISAW-IGVAFWTQTGERQT  464
            ++   MI+            +S   K   Y+ +Y+G+ ++ + A+ I   F++  GE  T
Sbjct  703  IVMSNMIEVFYF-----RNYASMERKTKEYVFIYIGAGLYAVGAYLIQHYFFSIMGENLT  757

Query  465  ARLRLRYLQSVLRKKIEFFDTDTRAKDIIF-HISSDAILVQDAIGDKIGHTIRYISQFLV  641
             R+R   L ++LR ++ +FD +     ++   +++DA  V+ AI ++I   ++ ++  L 
Sbjct  758  TRVRRMMLAAILRNEVGWFDEEEHNSSLVAARLATDAADVKSAIAERISVILQNMTSLLT  817

Query  642  GFAVGFISVWKLTLVTLAVVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVR  821
             F V FI  W+++L+ LA  PL+ +A     L +   +     A+A+   +A E +S +R
Sbjct  818  SFIVAFIVEWRVSLLILATFPLLVLANFAQQLSLKGFAGDTAKAHAKTSMIAGEGVSNIR  877

Query  822  TVYSFVGEKKAVESYSKSL  878
            TV +F  + K +  +   L
Sbjct  878  TVAAFNAQTKMLSVFCNEL  896



>ref|XP_010256924.1| PREDICTED: ABC transporter B family member 19 [Nelumbo nucifera]
Length=1249

 Score =   263 bits (671),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 120/248 (48%), Positives = 176/248 (71%), Gaps = 0/248 (0%)
 Frame = +3

Query  156  PSNSTDRKEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLS  335
            P     +++ + F+ LFS AD  D+  M+ GSIGA +HG+A+PVFF+LFG M++  G   
Sbjct  11   PEAEKKKEQSLPFYQLFSFADKYDWVLMIAGSIGAVVHGSAMPVFFLLFGDMVNGFGKNQ  70

Query  336  SDSHRLSSQVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKKIE  515
            SD  +++ +V+K ALY VYLG ++ +S++  +A W  +GERQ   LR +YL++VL++ + 
Sbjct  71   SDLKKMTEEVAKYALYFVYLGLVVCLSSYAEIACWMYSGERQVISLRKKYLEAVLKQDVG  130

Query  516  FFDTDTRAKDIIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLA  695
            FFDTD R  DI+F +S+D +LVQDAI +K+G+ I Y+S FL G  VGF+S W+L L+++A
Sbjct  131  FFDTDARTGDIVFSVSTDTLLVQDAISEKVGNFIHYLSTFLAGLVVGFLSAWRLALLSVA  190

Query  696  VVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYSKS  875
            V+P IA AGG Y   ++ L+ K   +YA AG +AE+AI+QVRTVYS+VGE KA+ SYS +
Sbjct  191  VIPGIAFAGGLYAYTLTGLTSKSRESYANAGIIAEQAIAQVRTVYSYVGESKALNSYSDA  250

Query  876  LNNALVLG  899
            + N L LG
Sbjct  251  IQNTLKLG  258


 Score = 83.2 bits (204),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 65/265 (25%), Positives = 128/265 (48%), Gaps = 27/265 (10%)
 Frame = +3

Query  114  GELEISSNLKMDQQPSNSTDRKEMVS---FFGLFSAADTVDYFFMVFGSIGACIHGAALP  284
            G +E+ SN          TDRK       FF L    +  ++ + + G++G+ + G   P
Sbjct  649  GRIEMISNA--------DTDRKNPAPDGYFFRLLKL-NAPEWPYSIMGAVGSVLSGFIGP  699

Query  285  VFFVLFGRMIDSLGHLSSDSHRLSSQVSKQALYLVYLGSIIFISAWIGVAFWTQ------  446
             F ++   MI+   +     +    + +K+ ++ +Y+G+ ++      VA+ TQ      
Sbjct  700  TFAIVMSNMIEVFYY---RDYTAMERKTKEFVF-IYIGAGLYAV----VAYLTQHYFFSI  751

Query  447  TGERQTARLRLRYLQSVLRKKIEFFDTDTRAKDIIF-HISSDAILVQDAIGDKIGHTIRY  623
             GE  T R+R   L ++LR ++ +FD +     ++   +++DA  V+ AI ++I   ++ 
Sbjct  752  MGENLTTRVRRMMLAAILRNEVGWFDEEENNSSLVAARLATDAADVKSAIAERISVILQN  811

Query  624  ISQFLVGFAVGFISVWKLTLVTLAVVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEE  803
            ++  L  F V FI  W+++L+ LA  PL+ +A     L +   +     A+A+   +A E
Sbjct  812  MTSLLTSFIVAFIIEWRVSLLILATFPLLVLANFAQQLSLKGFAGDTAKAHAKTSMIAGE  871

Query  804  AISQVRTVYSFVGEKKAVESYSKSL  878
             +S +RTV +F  + K +  +   L
Sbjct  872  GVSNIRTVAAFNAQDKILSLFCHEL  896



>ref|XP_010937072.1| PREDICTED: ABC transporter B family member 19 [Elaeis guineensis]
Length=1253

 Score =   263 bits (671),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 122/242 (50%), Positives = 177/242 (73%), Gaps = 0/242 (0%)
 Frame = +3

Query  174  RKEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLSSDSHRL  353
            +++ V+F+ LF+ AD  D   M  GS+GA +HG+A+PVFF+LFG +++  G   +D  ++
Sbjct  19   QEQSVAFYELFTFADRYDLALMAAGSLGAVVHGSAMPVFFLLFGDLVNGFGKNQADLGKM  78

Query  354  SSQVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKKIEFFDTDT  533
            +++VSK ALY VYLG ++ +S++  +A W  TGERQ   LR RYL++VL++ + FFDTD 
Sbjct  79   TNEVSKYALYFVYLGLVVCLSSYAEIACWMYTGERQVGTLRRRYLEAVLKQDVGFFDTDA  138

Query  534  RAKDIIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLAVVPLIA  713
            R  DI+F +S+D +LVQDAI +K+G+ I Y+S FL G  VGFIS W+L L+++AV+P IA
Sbjct  139  RTGDIVFSVSTDTLLVQDAISEKVGNFIHYLSTFLAGLVVGFISAWRLALLSVAVIPGIA  198

Query  714  VAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYSKSLNNALV  893
             AGG Y   ++ L+ KG  +YA AG +AE+AI+QVRTVYSFVGE KA+ SYS+++ N L 
Sbjct  199  FAGGLYAYTLTGLTSKGRESYANAGIIAEQAIAQVRTVYSFVGESKALTSYSEAIQNTLK  258

Query  894  LG  899
            LG
Sbjct  259  LG  260


 Score = 86.3 bits (212),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 61/259 (24%), Positives = 127/259 (49%), Gaps = 15/259 (6%)
 Frame = +3

Query  114  GELEISSNLKMDQQ-PSNSTDRKEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVF  290
            G +E+ SN   D++ P+          FF L    +  ++ + + G++G+ + G   P F
Sbjct  653  GRIEMVSNADNDRKYPAPRG------YFFKLLKL-NAPEWPYSILGAVGSVLSGFIGPTF  705

Query  291  FVLFGRMIDSLGHLSSDSHRLSSQVSKQALYLVYLGSIIF--ISAWIGVAFWTQTGERQT  464
             ++   MI+   +   ++    ++        +Y+G+ ++  ++  +   F++  GE  T
Sbjct  706  AIVMSNMIEVFYYRDPNAMERKTR----EYVFIYIGTGLYAVVAYLVQHYFFSIMGENLT  761

Query  465  ARLRLRYLQSVLRKKIEFFDTDTRAKDIIF-HISSDAILVQDAIGDKIGHTIRYISQFLV  641
             R+R   L ++LR ++ +FD D     ++   +++DA  V+ AI ++I   ++ ++  L 
Sbjct  762  TRVRRMMLAAILRNEVGWFDEDENNSSLLAARLATDAADVKSAIAERISVILQNMTSLLT  821

Query  642  GFAVGFISVWKLTLVTLAVVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVR  821
             F VGFI  W++ L+ LA  PL+ +A     L +   +     A+A+   +A E +S +R
Sbjct  822  SFIVGFIVEWRVALLILATFPLLVLANFAQQLSLKGFAGDTAKAHAKTSMIAGEGVSNIR  881

Query  822  TVYSFVGEKKAVESYSKSL  878
            TV +F  + K +  +   L
Sbjct  882  TVAAFNAQDKILSLFHHEL  900



>ref|XP_010108971.1| ABC transporter B family member 19 [Morus notabilis]
 gb|EXC20611.1| ABC transporter B family member 19 [Morus notabilis]
Length=1249

 Score =   262 bits (670),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 119/248 (48%), Positives = 174/248 (70%), Gaps = 0/248 (0%)
 Frame = +3

Query  156  PSNSTDRKEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLS  335
            P     +++ + F  LFS AD  DY  M+ GS+GA IHG+++P FF+LFG+M++  G   
Sbjct  11   PEAEKKKEQTLPFHQLFSFADKYDYLLMISGSVGAVIHGSSMPFFFLLFGQMVNGFGKNQ  70

Query  336  SDSHRLSSQVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKKIE  515
             D  +++ +VSK +LY VYLG ++ +S++  +A W  TGERQ   LR +YL++VL++ + 
Sbjct  71   MDLRKMTDEVSKYSLYFVYLGLVVCVSSYAEIACWMYTGERQVGTLRKKYLEAVLKQDVG  130

Query  516  FFDTDTRAKDIIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLA  695
            FFDTD R  DI+F +S+D +LVQDAI +K+G+ I Y+S FL G  VGF+S W+L L+++A
Sbjct  131  FFDTDARTGDIVFSVSTDTLLVQDAISEKVGNFIHYLSTFLAGLVVGFVSAWRLALLSVA  190

Query  696  VVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYSKS  875
            V+P IA AGG Y   ++ L+ K   +YA AG +AE+AI+QVRTVYS+VGE KA+ SYS +
Sbjct  191  VIPGIAFAGGLYAYTLTGLTSKSRQSYANAGVIAEQAIAQVRTVYSYVGESKALNSYSDA  250

Query  876  LNNALVLG  899
            + N L LG
Sbjct  251  IQNTLKLG  258


 Score = 85.1 bits (209),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 63/261 (24%), Positives = 131/261 (50%), Gaps = 19/261 (7%)
 Frame = +3

Query  114  GELEISSNLKMDQQPSNSTDRKEMVS---FFGLFSAADTVDYFFMVFGSIGACIHGAALP  284
            G +E+ SN +        T+RK       FF L    +  ++ + + G++G+ + G   P
Sbjct  649  GRIEMISNAE--------TERKNPAPDGYFFRLLKL-NAPEWPYSIMGAVGSVLSGFIGP  699

Query  285  VFFVLFGRMIDSLGHLSSDSHRLSSQVSKQALYLVYLGSIIF--ISAWIGVAFWTQTGER  458
             F ++   MI+   + +  S     + +K+ ++ +Y+G+ ++  ++  I   F++  GE 
Sbjct  700  TFAIVMSNMIEVFYYRNPASME---RKTKEYVF-IYIGAGLYAVVAYLIQHYFFSIMGEN  755

Query  459  QTARLRLRYLQSVLRKKIEFFDTDTRAKDIIF-HISSDAILVQDAIGDKIGHTIRYISQF  635
             T R+R   L ++LR ++ +FD +     ++   +++DA  V+ AI ++I   ++ ++  
Sbjct  756  LTTRVRRMMLAAILRNEVGWFDEEEHNSSLVAARLATDASDVKSAIAERISVILQNMTSL  815

Query  636  LVGFAVGFISVWKLTLVTLAVVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQ  815
            L  F V FI  W+++L+ LA  PL+ +A     L +   +     A+A+   +A E +S 
Sbjct  816  LTSFIVAFIVEWRVSLLILATFPLLVLANFAQQLSLKGFAGDTAKAHAKTSMIAGEGVSN  875

Query  816  VRTVYSFVGEKKAVESYSKSL  878
            +RTV +F  + K +  +   L
Sbjct  876  IRTVAAFNAQNKILSLFCHEL  896



>ref|XP_008230752.1| PREDICTED: ABC transporter B family member 19 [Prunus mume]
 ref|XP_008230753.1| PREDICTED: ABC transporter B family member 19 [Prunus mume]
Length=1249

 Score =   262 bits (670),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 121/248 (49%), Positives = 176/248 (71%), Gaps = 0/248 (0%)
 Frame = +3

Query  156  PSNSTDRKEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLS  335
            P     +++ + F+ LFS AD  D+  M+ GSIGA IHG+++PVFF+LFG M++  G   
Sbjct  11   PEADKKKEQSLPFYQLFSFADKYDWLLMISGSIGAIIHGSSMPVFFLLFGEMVNGFGKNQ  70

Query  336  SDSHRLSSQVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKKIE  515
             D  +++++V+K ALY VYLG I+  S++  +A W  TGERQ + LR +YL++VL++ + 
Sbjct  71   MDLKKMTAEVAKYALYFVYLGLIVCFSSYAEIACWMYTGERQVSTLRKKYLEAVLKQDVG  130

Query  516  FFDTDTRAKDIIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLA  695
            FFDTD R  DI+F +S+D +LVQDAI +K+G+ I Y+S FL G  VGF+S W+L L+++A
Sbjct  131  FFDTDARTGDIVFSVSTDTLLVQDAISEKVGNFIHYLSTFLAGLVVGFVSAWRLALLSVA  190

Query  696  VVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYSKS  875
            V+P IA AGG Y   ++ L+ K   +YA AG +AE+AI+QVRTVYS+VGE KA+ SYS +
Sbjct  191  VIPGIAFAGGLYAYTLTGLTSKSRESYANAGIMAEQAIAQVRTVYSYVGESKALNSYSDA  250

Query  876  LNNALVLG  899
            + N L LG
Sbjct  251  IQNTLQLG  258


 Score = 86.7 bits (213),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 64/258 (25%), Positives = 133/258 (52%), Gaps = 13/258 (5%)
 Frame = +3

Query  114  GELEISSNLKMDQQPSNSTDRKEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFF  293
            G +E+ SN + D++      R     FF L    +  ++ + + G+IG+ + G   P F 
Sbjct  649  GRIEMISNAETDRK-----TRAPDGYFFRLLKL-NAPEWPYSIMGAIGSVLSGFIGPTFA  702

Query  294  VLFGRMIDSLGHLSSDSHRLSSQVSKQALYLVYLGSIIF-ISAW-IGVAFWTQTGERQTA  467
            ++   MI+   + +  S     + +K+ ++ +Y+G+ ++ ++A+ I   F++  GE  T 
Sbjct  703  IVMSNMIEVFYYRNPASME---RKTKEYVF-IYIGAGLYAVAAYLIQHYFFSIMGENLTT  758

Query  468  RLRLRYLQSVLRKKIEFFDTDTRAKDIIF-HISSDAILVQDAIGDKIGHTIRYISQFLVG  644
            R+R   L ++LR ++ +FD +     ++   +++DA  V+ AI ++I   ++ ++  L  
Sbjct  759  RVRRMMLAAILRNEVGWFDEEEHNSSLLAARLATDASDVKSAIAERISVILQNMTSLLTS  818

Query  645  FAVGFISVWKLTLVTLAVVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRT  824
            F V FI  W+++L+ LA  PL+ +A     L +   +     A+A+   +A E +S +RT
Sbjct  819  FIVAFIVEWRVSLLILATFPLLVLANFAQQLSLKGFAGDTAKAHAKTSMIAGEGVSNIRT  878

Query  825  VYSFVGEKKAVESYSKSL  878
            V +F  + K +  +   L
Sbjct  879  VAAFNAQNKILSLFCHEL  896



>ref|XP_007217651.1| hypothetical protein PRUPE_ppa000359mg [Prunus persica]
 gb|EMJ18850.1| hypothetical protein PRUPE_ppa000359mg [Prunus persica]
Length=1249

 Score =   262 bits (670),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 121/248 (49%), Positives = 176/248 (71%), Gaps = 0/248 (0%)
 Frame = +3

Query  156  PSNSTDRKEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLS  335
            P     +++ + F+ LFS AD  D+  M+ GSIGA IHG+++PVFF+LFG M++  G   
Sbjct  11   PEADKKKEQSLPFYQLFSFADKYDWLLMISGSIGAIIHGSSMPVFFLLFGEMVNGFGKNQ  70

Query  336  SDSHRLSSQVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKKIE  515
             D  +++++V+K ALY VYLG I+  S++  +A W  TGERQ + LR +YL++VL++ + 
Sbjct  71   MDLKKMTAEVAKYALYFVYLGLIVCFSSYAEIACWMYTGERQVSTLRKKYLEAVLKQDVG  130

Query  516  FFDTDTRAKDIIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLA  695
            FFDTD R  DI+F +S+D +LVQDAI +K+G+ I Y+S FL G  VGF+S W+L L+++A
Sbjct  131  FFDTDARTGDIVFSVSTDTLLVQDAISEKVGNFIHYLSTFLAGLVVGFVSAWRLALLSVA  190

Query  696  VVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYSKS  875
            V+P IA AGG Y   ++ L+ K   +YA AG +AE+AI+QVRTVYS+VGE KA+ SYS +
Sbjct  191  VIPGIAFAGGLYAYTLTGLTSKSRESYANAGIMAEQAIAQVRTVYSYVGESKALNSYSDA  250

Query  876  LNNALVLG  899
            + N L LG
Sbjct  251  IQNTLQLG  258


 Score = 87.8 bits (216),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 64/258 (25%), Positives = 130/258 (50%), Gaps = 13/258 (5%)
 Frame = +3

Query  114  GELEISSNLKMDQQPSNSTDRKEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFF  293
            G +E+ SN + D++      R     FF L    +  ++ + + G+IG+ + G   P F 
Sbjct  649  GRIEMISNAETDRK-----TRAPDGYFFRLLKL-NAPEWPYSIMGAIGSVLSGFIGPTFA  702

Query  294  VLFGRMIDSLGHLSSDSHRLSSQVSKQALYLVYLGSIIF-ISAW-IGVAFWTQTGERQTA  467
            ++   MI+   +    S+  S +   +    +Y+G+ ++ ++A+ I   F++  GE  T 
Sbjct  703  IVMSNMIEVFYY----SNPASMERKTKEYVFIYIGAGLYAVAAYLIQHYFFSIMGENLTT  758

Query  468  RLRLRYLQSVLRKKIEFFDTDTRAKDIIF-HISSDAILVQDAIGDKIGHTIRYISQFLVG  644
            R+R   L ++LR ++ +FD +     ++   +++DA  V+ AI ++I   ++ ++  L  
Sbjct  759  RVRRMMLAAILRNEVGWFDEEEHNSSLLAARLATDASDVKSAIAERISVILQNMTSLLTS  818

Query  645  FAVGFISVWKLTLVTLAVVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRT  824
            F V FI  W+++L+ LA  PL+ +A     L +   +     A+A+   +A E +S +RT
Sbjct  819  FIVAFIVEWRVSLLILATFPLLVLANFAQQLSLKGFAGDTAKAHAKTSMIAGEGVSNIRT  878

Query  825  VYSFVGEKKAVESYSKSL  878
            V +F  + K +  +   L
Sbjct  879  VAAFNAQNKILSLFCHEL  896



>ref|XP_008341564.1| PREDICTED: LOW QUALITY PROTEIN: ABC transporter B family member 
19-like [Malus domestica]
Length=1250

 Score =   262 bits (670),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 117/248 (47%), Positives = 177/248 (71%), Gaps = 0/248 (0%)
 Frame = +3

Query  156  PSNSTDRKEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLS  335
            P     +++ + FF LFS AD  D+  M+FGS+GA +HG+++P+FF++FG M++  G   
Sbjct  12   PEAEKKKEQSLPFFQLFSFADKYDWMLMIFGSLGAVVHGSSMPLFFLMFGEMVNGFGENQ  71

Query  336  SDSHRLSSQVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKKIE  515
             +  +++++V+K ALY VYLG I+ ++++  +A W  TGERQ + LR +YL++VL++ + 
Sbjct  72   MNLQKMTAEVAKYALYFVYLGLIVCVTSYAEIACWMYTGERQVSTLRKKYLEAVLKQDVG  131

Query  516  FFDTDTRAKDIIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLA  695
            FFDTD R  DI+F IS+D +LVQDAI +K+G+ I Y+S FL G  VGF+S W+L L+++A
Sbjct  132  FFDTDARTGDIVFSISTDTLLVQDAISEKVGNFIHYLSTFLAGLVVGFVSAWRLALLSIA  191

Query  696  VVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYSKS  875
            V+P I  AGG Y   ++ L+ K   +YA AG VA++AI+QVRTVYS+VGE KA+ SYS +
Sbjct  192  VIPGIVFAGGLYAYTLTGLTSKSRQSYANAGIVADQAIAQVRTVYSYVGESKALNSYSDA  251

Query  876  LNNALVLG  899
            + N L LG
Sbjct  252  IQNTLQLG  259


 Score = 88.2 bits (217),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 63/261 (24%), Positives = 126/261 (48%), Gaps = 9/261 (3%)
 Frame = +3

Query  114  GELEISSNLKMDQQPSNSTDRKEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFF  293
            G +E+ SN + D++      R     FF L    +  ++ + +  +IG+ + G   P F 
Sbjct  650  GRIEMISNAETDRK-----TRAPKNYFFRLLKL-NAPEWPYSIMAAIGSLLSGFIGPTFA  703

Query  294  VLFGRMIDSLGHLSSDSHRLSSQVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARL  473
            +L G MI+   + +  S  +  +  +     V +G    ++  I   F +  GE  T R+
Sbjct  704  ILMGNMIEVFYYRNPAS--MERKTKEYVFMYVGVGLYAVVAYLIQHYFXSIMGENLTTRV  761

Query  474  RLRYLQSVLRKKIEFFDTDTRAKDIIF-HISSDAILVQDAIGDKIGHTIRYISQFLVGFA  650
            R   L ++LR ++ +FD +    +++   +++DA  V+ A+ ++I   ++ ++  L  F 
Sbjct  762  RRMMLAAILRNEVGWFDEEEHNSNLLTAKLATDAADVKSAVSERISVILQNMTSLLTSFI  821

Query  651  VGFISVWKLTLVTLAVVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVY  830
            V FI  W+++L+ LA  PL+ +A     L +   +     A+A+   +A E +S +RTV 
Sbjct  822  VAFIVEWRVSLLILATFPLLVLANFAQQLSLKGFAGDTAKAHAKTSMIAGEGVSNIRTVA  881

Query  831  SFVGEKKAVESYSKSLNNALV  893
            +F  + K +  +   L   L+
Sbjct  882  AFNXQNKILSLFCHELRLPLL  902



>emb|CDY65012.1| BnaCnng45670D [Brassica napus]
Length=1253

 Score =   262 bits (669),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 122/259 (47%), Positives = 179/259 (69%), Gaps = 0/259 (0%)
 Frame = +3

Query  123  EISSNLKMDQQPSNSTDRKEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFVLF  302
            E +++ K          ++E + FF LFS AD  DY  M+ G++GA +HG+++PVFF+LF
Sbjct  3    ETTADPKPVPPAEAEKKKEESLPFFKLFSFADKFDYLLMITGTLGAIVHGSSMPVFFLLF  62

Query  303  GRMIDSLGHLSSDSHRLSSQVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARLRLR  482
            G M++  G    D H+++ +VSK ALY VYLG I+  S++  +A W  +GERQ A LR +
Sbjct  63   GEMVNGFGKNQMDLHQMTHEVSKYALYFVYLGLIVCFSSYAEIACWMYSGERQVAALRKK  122

Query  483  YLQSVLRKKIEFFDTDTRAKDIIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFI  662
            YL++VL++ + FFDTD R  DI+F +S+D +LVQDAI +K+G+ I Y+S FL G  VGF+
Sbjct  123  YLEAVLKQDVGFFDTDARTGDIVFSVSTDTLLVQDAISEKVGNFIHYLSTFLAGLVVGFV  182

Query  663  SVWKLTLVTLAVVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVG  842
            S W+L L+++AV+P IA AGG Y   ++ ++ K   +YA AG +AE+AI+QVRTVYS+VG
Sbjct  183  SAWRLALLSVAVIPGIAFAGGLYAYTLTGITSKSRESYANAGVIAEQAIAQVRTVYSYVG  242

Query  843  EKKAVESYSKSLNNALVLG  899
            E KA+ SYS ++   L LG
Sbjct  243  ESKALSSYSDAIQYTLKLG  261


 Score = 93.6 bits (231),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 66/261 (25%), Positives = 131/261 (50%), Gaps = 19/261 (7%)
 Frame = +3

Query  114  GELEISSNLKMDQQ---PSNSTDRKEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALP  284
            G +E+ SN + D++   P N         +F      +  ++ + + G++G+ + G   P
Sbjct  653  GRIEMISNAETDRKTRAPQN---------YFYRLLKLNAPEWPYSIMGAVGSVLSGFIGP  703

Query  285  VFFVLFGRMIDSLGHLSSDSHRLSSQVSKQALYLVYLGSIIF--ISAWIGVAFWTQTGER  458
             F ++   MI+   +   DS     + +K+ ++ +Y+G+ I+  I+  I   F++  GE 
Sbjct  704  TFAIVMSNMIEVFYYTDYDSME---RKTKEYVF-IYIGAGIYAVIAYLIQHYFFSIMGEN  759

Query  459  QTARLRLRYLQSVLRKKIEFFDTDTRAKDIIF-HISSDAILVQDAIGDKIGHTIRYISQF  635
             T R+R   L ++LR ++ +FD D     +I   +++DA  V+ AI ++I   ++ ++  
Sbjct  760  LTTRVRRMMLSAILRNEVGWFDEDEHNSSLIAARLATDAADVKSAIAERISVILQNMTSL  819

Query  636  LVGFAVGFISVWKLTLVTLAVVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQ  815
            L  F V FI  W+++L+ LA  PL+ +A     L +   +     A+A+   +A E +S 
Sbjct  820  LTSFIVAFIVEWRVSLLILATFPLLVLANFAQQLSLKGFAGDTAKAHAKTSMIAGEGVSN  879

Query  816  VRTVYSFVGEKKAVESYSKSL  878
            +RTV +F  + K +  +   L
Sbjct  880  IRTVAAFNAQSKILSLFCHEL  900



>ref|XP_009347047.1| PREDICTED: ABC transporter B family member 19 [Pyrus x bretschneideri]
Length=1250

 Score =   262 bits (669),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 117/248 (47%), Positives = 177/248 (71%), Gaps = 0/248 (0%)
 Frame = +3

Query  156  PSNSTDRKEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLS  335
            P     +++ + FF LFS AD  D+  M+FGS+GA +HG+++P+FF++FG M++  G   
Sbjct  12   PEAEKKKEQSLPFFQLFSFADKYDWMLMIFGSLGAVVHGSSMPLFFLMFGEMVNGFGENQ  71

Query  336  SDSHRLSSQVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKKIE  515
             +  +++++V+K ALY VYLG I+ ++++  +A W  TGERQ + LR +YL++VL++ + 
Sbjct  72   MNLQKMTAEVAKYALYFVYLGLIVCVTSYAEIACWMYTGERQVSTLRKKYLEAVLKQDVG  131

Query  516  FFDTDTRAKDIIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLA  695
            FFDTD R  DI+F IS+D +LVQDAI +K+G+ I Y+S FL G  VGF+S W+L L+++A
Sbjct  132  FFDTDARTGDIVFSISTDTLLVQDAISEKVGNFIHYLSTFLAGLVVGFVSAWRLALLSIA  191

Query  696  VVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYSKS  875
            V+P I  AGG Y   ++ L+ K   +YA AG VA++AI+QVRTVYS+VGE KA+ SYS +
Sbjct  192  VIPGIVFAGGLYAYTLTGLTSKSRQSYANAGIVADQAIAQVRTVYSYVGESKALNSYSDA  251

Query  876  LNNALVLG  899
            + N L LG
Sbjct  252  IQNTLQLG  259


 Score = 90.1 bits (222),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 63/261 (24%), Positives = 127/261 (49%), Gaps = 9/261 (3%)
 Frame = +3

Query  114  GELEISSNLKMDQQPSNSTDRKEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFF  293
            G +E+ SN + D++      R     FF L    +  ++ + +  +IG+ + G   P F 
Sbjct  650  GRIEMISNAETDRK-----TRAPKNYFFRLLKL-NAPEWPYSIMAAIGSVLSGFIGPTFA  703

Query  294  VLFGRMIDSLGHLSSDSHRLSSQVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARL  473
            +L G MI+   + +  S  +  +  +     V +G    ++  I   F++  GE  T R+
Sbjct  704  ILMGNMIEVFYYRNPAS--MERKTKEYVFMYVGVGLYAVVAYLIQHYFFSIMGENLTTRV  761

Query  474  RLRYLQSVLRKKIEFFDTDTRAKDIIF-HISSDAILVQDAIGDKIGHTIRYISQFLVGFA  650
            R   L ++LR ++ +FD +    +++   +++DA  V+ A+ ++I   ++ ++  L  F 
Sbjct  762  RRMMLAAILRNEVGWFDEEEHNSNLLTAKLATDAADVKSAVSERISVILQNMTSLLTSFI  821

Query  651  VGFISVWKLTLVTLAVVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVY  830
            V FI  W+++L+ LA  PL+ +A     L +   +     A+A+   +A E +S +RTV 
Sbjct  822  VAFIVEWRVSLLILATFPLLVLANFAQQLSLKGFAGDTAKAHAKTSMIAGEGVSNIRTVA  881

Query  831  SFVGEKKAVESYSKSLNNALV  893
            +F  + K +  +   L   L+
Sbjct  882  AFNAQNKVLSLFCHELRLPLL  902



>ref|XP_010554005.1| PREDICTED: ABC transporter B family member 19-like [Tarenaya 
hassleriana]
Length=1250

 Score =   261 bits (667),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 118/248 (48%), Positives = 174/248 (70%), Gaps = 0/248 (0%)
 Frame = +3

Query  156  PSNSTDRKEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLS  335
            P     +++ + +F LFS AD  D  FM+ GS+GA +HG+++PVFF++FG M++  G   
Sbjct  12   PETEKKKEQSLPYFKLFSFADKYDCLFMITGSLGAIVHGSSMPVFFLIFGEMVNGFGKNQ  71

Query  336  SDSHRLSSQVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKKIE  515
             D H+L+ +VSK ALY +YLG ++  S++  +A W  TGERQ   LR +YL++VL++ + 
Sbjct  72   MDLHKLTDEVSKYALYFIYLGLVVCFSSYAEIACWMYTGERQVGALRKKYLEAVLKQDVG  131

Query  516  FFDTDTRAKDIIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLA  695
            FFDTD R  DI+F +S+D +LVQDAI +K+G+ I Y S FL G  VGF+S W+L L+++A
Sbjct  132  FFDTDARTGDIVFSVSTDTLLVQDAISEKVGNFIHYQSTFLAGLVVGFVSAWRLALLSIA  191

Query  696  VVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYSKS  875
            V+P IA AGG Y   ++ ++ K   +YA AG +AE+AI+QVRTVYS+VGE KA+ SYS +
Sbjct  192  VIPGIAFAGGLYAYTLTGITSKSRESYANAGVIAEQAIAQVRTVYSYVGESKALSSYSDA  251

Query  876  LNNALVLG  899
            + + L LG
Sbjct  252  IQHTLKLG  259


 Score = 90.9 bits (224),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 63/258 (24%), Positives = 130/258 (50%), Gaps = 13/258 (5%)
 Frame = +3

Query  114  GELEISSNLKMDQQPSNSTDRKEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFF  293
            G +E+ SN + D++     D      FF L    ++ ++ + + G+IG+ + G   P F 
Sbjct  650  GRIEMVSNAETDRKARAPDDY-----FFRLLKL-NSPEWPYSIMGAIGSVLSGFIGPTFA  703

Query  294  VLFGRMIDSLGHLSSDSHRLSSQVSKQALYLVYLGSIIF--ISAWIGVAFWTQTGERQTA  467
            ++   MI+   +    S+  S +   +    +++G+ ++  ++  I   F++  GE  T 
Sbjct  704  IVMSNMIEVFYY----SNYGSMERKTKEFVFIFIGTGLYAVVAYLIQHYFFSIMGENLTT  759

Query  468  RLRLRYLQSVLRKKIEFFDTDTRAKDIIF-HISSDAILVQDAIGDKIGHTIRYISQFLVG  644
            R+R   L ++LR ++ +FD +     ++   +++DA  V+ AI ++I   ++ ++  L  
Sbjct  760  RVRRMMLSAILRNEVGWFDEEEHNSSLVAARLATDAADVKSAIAERISVILQNMTSLLTS  819

Query  645  FAVGFISVWKLTLVTLAVVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRT  824
            F V FI  W+++L+ LA  PL+ +A     L +   +     A+A+   +A E +S +RT
Sbjct  820  FIVAFIVEWRVSLLILATFPLLVLANFAQQLSLKGFAGDTAKAHAKTSMIAGEGVSNIRT  879

Query  825  VYSFVGEKKAVESYSKSL  878
            V +F  + K +  +S  L
Sbjct  880  VAAFNAQDKILSLFSHEL  897



>ref|XP_006652374.1| PREDICTED: ABC transporter B family member 19-like [Oryza brachyantha]
Length=1255

 Score =   261 bits (667),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 121/240 (50%), Positives = 171/240 (71%), Gaps = 0/240 (0%)
 Frame = +3

Query  180  EMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLSSDSHRLSS  359
            + V+F  LF  AD +D+  M  GS GA +HGAA+PVFF+LFG +I+  G       R++ 
Sbjct  23   QSVAFHELFGFADPLDWLLMAAGSAGAVVHGAAMPVFFLLFGELINGFGKNQHSLRRMTD  82

Query  360  QVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKKIEFFDTDTRA  539
            +VSK +LY VYLG ++  S+++ +A W  TGERQ   LR RYL++VLR+ + FFDTD R 
Sbjct  83   EVSKYSLYFVYLGLVVCASSYLEIACWMYTGERQVGALRRRYLEAVLRQDVGFFDTDART  142

Query  540  KDIIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLAVVPLIAVA  719
             D++F +S+D +LVQDAIG+K+G+ I Y+S FL G  VGF+S W+L L+++AV+P IA A
Sbjct  143  GDVVFSVSTDTLLVQDAIGEKVGNFIHYLSTFLAGLVVGFVSAWRLALLSIAVIPGIAFA  202

Query  720  GGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYSKSLNNALVLG  899
            GG Y   ++ L+ K   +YA AG +AE+AI+QVRTVYS+VGE KA+ SYS+++ N L LG
Sbjct  203  GGLYAYTLTGLTSKSRESYANAGIIAEQAIAQVRTVYSYVGESKALNSYSEAIQNTLKLG  262


 Score = 87.4 bits (215),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 62/257 (24%), Positives = 121/257 (47%), Gaps = 11/257 (4%)
 Frame = +3

Query  114  GELEISSNLKMDQQ-PSNSTDRKEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVF  290
            G +E+ SN   D++ P+          FF L    +  ++ + + G+IG+ + G   P F
Sbjct  655  GRIEMVSNADNDRKYPAPKG------YFFKLLKL-NAPEWPYTILGAIGSILSGFIGPTF  707

Query  291  FVLFGRMIDSLGHLSSDSHRLSSQVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTAR  470
             ++   MI+       D + +  +  +     +  G    ++  +   F++  GE  T R
Sbjct  708  AIVMSNMIEVF--YFRDPNAMERKTREYVFIYIGTGLYAVVAYLVQHYFFSIMGENLTTR  765

Query  471  LRLRYLQSVLRKKIEFFDTDTRAKDIIF-HISSDAILVQDAIGDKIGHTIRYISQFLVGF  647
            +R   L ++LR  + +FD +     ++   +S+DA  V+ AI ++I   ++ ++  LV F
Sbjct  766  VRRMMLAAILRNDVGWFDQEENNSSLVAARLSTDAADVKSAIAERISVILQNMTSLLVSF  825

Query  648  AVGFISVWKLTLVTLAVVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTV  827
             VGFI  W++ ++ L   PL+ +A     L M   +     A+A+   +A E +S +RTV
Sbjct  826  VVGFIIEWRVAILILVTFPLLVLANFAQQLSMKGFAGDTAKAHAKTSMIAGEGVSNIRTV  885

Query  828  YSFVGEKKAVESYSKSL  878
             +F  + K +  +   L
Sbjct  886  AAFNAQDKVLSLFCTEL  902



>ref|XP_002877137.1| P-glycoprotein 19 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH53396.1| P-glycoprotein 19 [Arabidopsis lyrata subsp. lyrata]
Length=1252

 Score =   261 bits (667),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 122/249 (49%), Positives = 176/249 (71%), Gaps = 1/249 (0%)
 Frame = +3

Query  156  PSNSTDRKEM-VSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHL  332
            P+ +  +KE  + FF LFS AD  DY  M  GS+GA +HG+++PVFF+LFG+M++  G  
Sbjct  13   PTEAEKKKEQSLPFFKLFSFADKFDYLLMFVGSLGAIVHGSSMPVFFLLFGQMVNGFGKN  72

Query  333  SSDSHRLSSQVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKKI  512
              D H++  +VSK +LY VYLG ++  S++  +A W  +GERQ A LR +YL++VL++ +
Sbjct  73   QMDLHQMVHEVSKYSLYFVYLGLVVCFSSYAEIACWMYSGERQVAALRKKYLEAVLKQDV  132

Query  513  EFFDTDTRAKDIIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTL  692
             FFDTD R  DI+F +S+D +LVQDAI +K+G+ I Y+S FL G  VGF+S WKL L+++
Sbjct  133  GFFDTDARTGDIVFSVSTDTLLVQDAISEKVGNFIHYLSTFLAGLVVGFVSAWKLALLSV  192

Query  693  AVVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYSK  872
            AV+P IA AGG Y   ++ ++ K   +YA AG +AE+AI+QVRTVYS+VGE KA+ SYS 
Sbjct  193  AVIPGIAFAGGLYAYTLTGITSKSRESYANAGVIAEQAIAQVRTVYSYVGESKALSSYSD  252

Query  873  SLNNALVLG  899
            ++   L LG
Sbjct  253  AIQYTLKLG  261


 Score = 89.0 bits (219),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 64/261 (25%), Positives = 132/261 (51%), Gaps = 19/261 (7%)
 Frame = +3

Query  114  GELEISSNLKMDQQ---PSNSTDRKEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALP  284
            G +E+ SN + D++   P N         +F      ++ ++ + + G+IG+ + G   P
Sbjct  652  GRIEMISNAETDRKTRAPEN---------YFYRLLKLNSPEWPYSIMGAIGSILSGFIGP  702

Query  285  VFFVLFGRMIDSLGHLSSDSHRLSSQVSKQALYLVYLGSIIF-ISAW-IGVAFWTQTGER  458
             F ++   MI+   +   +S     + +K+ ++ +Y+G+ ++ + A+ I   F++  GE 
Sbjct  703  TFAIVMSNMIEVFYYTDYNSME---RKTKEYVF-IYIGAGLYAVGAYLIQHYFFSIMGEN  758

Query  459  QTARLRLRYLQSVLRKKIEFFDTDTRAKDIIF-HISSDAILVQDAIGDKIGHTIRYISQF  635
             T R+R   L ++LR ++ +FD D     +I   +++DA  V+ AI ++I   ++ ++  
Sbjct  759  LTTRVRRMMLSAILRNEVGWFDEDEHNSSLIAARLATDAADVKSAIAERISVILQNMTSL  818

Query  636  LVGFAVGFISVWKLTLVTLAVVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQ  815
            L  F V FI  W+++L+ L   PL+ +A     L +   +     A+A+   +A E +S 
Sbjct  819  LTSFIVAFIVEWRVSLLILGTFPLLVLANFAQQLSLKGFAGDTAKAHAKTSMIAGEGVSN  878

Query  816  VRTVYSFVGEKKAVESYSKSL  878
            +RTV +F  + K +  +   L
Sbjct  879  IRTVAAFNAQSKILSLFCHEL  899



>ref|NP_001052982.1| Os04g0459000 [Oryza sativa Japonica Group]
 dbj|BAF14896.1| Os04g0459000 [Oryza sativa Japonica Group]
 gb|EEE61119.1| hypothetical protein OsJ_15045 [Oryza sativa Japonica Group]
Length=1259

 Score =   261 bits (666),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 121/240 (50%), Positives = 171/240 (71%), Gaps = 0/240 (0%)
 Frame = +3

Query  180  EMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLSSDSHRLSS  359
            + V+F  LF  AD +D+  M  GS GA +HGAA+PVFF+LFG +I+  G       R++ 
Sbjct  27   QSVAFHELFGFADPLDWLLMAAGSAGAVVHGAAMPVFFLLFGELINGFGKNQHSLRRMTD  86

Query  360  QVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKKIEFFDTDTRA  539
            +VSK +LY VYLG ++  S+++ +A W  TGERQ   LR RYL++VLR+ + FFDTD R 
Sbjct  87   EVSKYSLYFVYLGLVVCASSYLEIACWMYTGERQVGALRRRYLEAVLRQDVGFFDTDART  146

Query  540  KDIIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLAVVPLIAVA  719
             D++F +S+D +LVQDAIG+K+G+ I Y+S FL G  VGF+S W+L L+++AV+P IA A
Sbjct  147  GDVVFSVSTDTLLVQDAIGEKVGNFIHYLSTFLAGLVVGFVSAWRLALLSIAVIPGIAFA  206

Query  720  GGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYSKSLNNALVLG  899
            GG Y   ++ L+ K   +YA AG +AE+AI+QVRTVYS+VGE KA+ SYS+++ N L LG
Sbjct  207  GGLYAYTLTGLTSKSRDSYANAGIIAEQAIAQVRTVYSYVGESKALNSYSEAIQNTLKLG  266


 Score = 87.0 bits (214),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 62/257 (24%), Positives = 121/257 (47%), Gaps = 11/257 (4%)
 Frame = +3

Query  114  GELEISSNLKMDQQ-PSNSTDRKEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVF  290
            G +E+ SN   D++ P+          FF L    +  ++ + + G+IG+ + G   P F
Sbjct  659  GRIEMVSNADNDRKYPAPKG------YFFKLLKL-NAPEWPYTILGAIGSILSGFIGPTF  711

Query  291  FVLFGRMIDSLGHLSSDSHRLSSQVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTAR  470
             ++   MI+       D + +  +  +     +  G    ++  +   F++  GE  T R
Sbjct  712  AIVMSNMIEVF--YFRDPNAMERKTREYVFIYIGTGLYAVVAYLVQHYFFSIMGENLTTR  769

Query  471  LRLRYLQSVLRKKIEFFDTDTRAKDIIF-HISSDAILVQDAIGDKIGHTIRYISQFLVGF  647
            +R   L ++LR  + +FD +     ++   +S+DA  V+ AI ++I   ++ ++  LV F
Sbjct  770  VRRMMLAAILRNDVGWFDQEENNSSLVAARLSTDAADVKSAIAERISVILQNMTSLLVSF  829

Query  648  AVGFISVWKLTLVTLAVVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTV  827
             VGFI  W++ ++ L   PL+ +A     L M   +     A+A+   +A E +S +RTV
Sbjct  830  VVGFIIEWRVAVLILVTFPLLVLANFAQQLSMKGFAGDTAKAHAKTSMIAGEGVSNIRTV  889

Query  828  YSFVGEKKAVESYSKSL  878
             +F  + K +  +   L
Sbjct  890  AAFNAQDKVLSLFCTEL  906



>ref|XP_006395333.1| hypothetical protein EUTSA_v10003528mg [Eutrema salsugineum]
 gb|ESQ32619.1| hypothetical protein EUTSA_v10003528mg [Eutrema salsugineum]
Length=1255

 Score =   261 bits (666),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 122/249 (49%), Positives = 176/249 (71%), Gaps = 1/249 (0%)
 Frame = +3

Query  156  PSNSTDRKEM-VSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHL  332
            P+ +  +KE  + FF LFS AD  DY  M+ GS+GA IHG+++PVFF+LFG M++  G  
Sbjct  16   PAEAEKKKEQSLPFFKLFSFADKFDYLLMITGSLGAIIHGSSMPVFFLLFGEMVNGFGKN  75

Query  333  SSDSHRLSSQVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKKI  512
              D  +++ +VSK ALY VYLG ++  S++  +A W  +GERQ A LR +YL++VL++ +
Sbjct  76   QMDLQQMTHEVSKYALYFVYLGLVVCFSSYAEIACWMYSGERQVAALRKKYLEAVLKQDV  135

Query  513  EFFDTDTRAKDIIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTL  692
             FFDTD R  DI+F +S+D +LVQDAI +K+G+ I Y+S FL G  VGF+S W+L L+++
Sbjct  136  GFFDTDARTGDIVFSVSTDTLLVQDAISEKVGNFIHYLSTFLAGLVVGFVSAWRLALLSV  195

Query  693  AVVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYSK  872
            AV+P IA AGG Y   ++ ++ K   +YA AG +AE+AI+QVRTVYS+VGE KA+ SYS 
Sbjct  196  AVIPGIAFAGGLYAYTLTGITSKSRESYANAGVIAEQAIAQVRTVYSYVGESKALSSYSD  255

Query  873  SLNNALVLG  899
            ++   L LG
Sbjct  256  AIQYTLKLG  264


 Score = 89.0 bits (219),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 63/261 (24%), Positives = 131/261 (50%), Gaps = 19/261 (7%)
 Frame = +3

Query  114  GELEISSNLKMDQQ---PSNSTDRKEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALP  284
            G +E+ SN + D++   P N         +F      +  ++ + + G++G+ + G   P
Sbjct  655  GRIEMISNAETDRKTRAPQN---------YFYRLLKLNAPEWPYSIMGAVGSVLSGFIGP  705

Query  285  VFFVLFGRMIDSLGHLSSDSHRLSSQVSKQALYLVYLGSIIF-ISAW-IGVAFWTQTGER  458
             F ++   MI+   +   DS     + +K+ ++ +Y+G+ ++ + A+ I   F++  GE 
Sbjct  706  TFAIVMSNMIEVFYYTDYDSME---RKTKEYVF-IYIGAGLYAVGAYLIQHYFFSIMGEN  761

Query  459  QTARLRLRYLQSVLRKKIEFFDTDTRAKDIIF-HISSDAILVQDAIGDKIGHTIRYISQF  635
             T R+R   L ++LR ++ +FD D     ++   +++DA  V+ AI ++I   ++ ++  
Sbjct  762  LTTRVRRMMLSAILRNEVGWFDEDEHNSSLVAARLATDAADVKSAIAERISVILQNMTSL  821

Query  636  LVGFAVGFISVWKLTLVTLAVVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQ  815
            L  F V FI  W+++L+ L   PL+ +A     L +   +     A+A+   +A E +S 
Sbjct  822  LTSFIVAFIVEWRVSLLILGTFPLLVLANFAQQLSLKGFAGDTAKAHAKTSMIAGEGVSN  881

Query  816  VRTVYSFVGEKKAVESYSKSL  878
            +RTV +F  + K +  +   L
Sbjct  882  IRTVAAFNAQSKILSLFCHEL  902



>ref|XP_004975845.1| PREDICTED: ABC transporter B family member 19-like [Setaria italica]
Length=1258

 Score =   261 bits (666),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 119/241 (49%), Positives = 173/241 (72%), Gaps = 0/241 (0%)
 Frame = +3

Query  177  KEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLSSDSHRLS  356
            ++ V+F  LF  AD +D+  M  GS GA +HGAA+PVFF+LFG +++  G    +  R++
Sbjct  27   EQSVAFHELFGFADPLDWLLMAAGSAGAVVHGAAMPVFFLLFGELVNGFGKNQHNLRRMT  86

Query  357  SQVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKKIEFFDTDTR  536
             +VSK +LY VYLG ++  S+++ +A W  TGERQ   LR RYL++VLR+ + FFDTD R
Sbjct  87   DEVSKYSLYFVYLGLVVCASSYLEIACWMYTGERQVGALRRRYLEAVLRQDVGFFDTDAR  146

Query  537  AKDIIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLAVVPLIAV  716
              D++F +S+D +LVQDAIG+K+G+ I Y++ FL G  VGF+S W+L L+++AV+P IA 
Sbjct  147  TGDVVFSVSTDTLLVQDAIGEKVGNFIHYLATFLAGLVVGFVSAWRLALLSIAVIPGIAF  206

Query  717  AGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYSKSLNNALVL  896
            AGG Y   ++ L+ K   +YA AG +AE+AI+QVRTVYS+VGE KA+ SYS+++ N L L
Sbjct  207  AGGLYAYTLTGLTSKSRDSYANAGIIAEQAIAQVRTVYSYVGETKALNSYSEAIQNTLKL  266

Query  897  G  899
            G
Sbjct  267  G  267


 Score = 87.4 bits (215),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 62/257 (24%), Positives = 123/257 (48%), Gaps = 11/257 (4%)
 Frame = +3

Query  114  GELEISSNLKMDQQ-PSNSTDRKEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVF  290
            G +E+ SN   D++ P+          FF L    +  ++ + + G+IG+ + G   P F
Sbjct  658  GRIEMVSNADNDRKYPAPRG------YFFKLLKL-NAPEWPYTILGAIGSILSGFIGPTF  710

Query  291  FVLFGRMIDSLGHLSSDSHRLSSQVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTAR  470
             ++   MI+   +   + +++ S+  +     +  G    ++  +   F++  GE  T R
Sbjct  711  AIVMSNMIEVFYY--RNPNKMESKTREYVFIYIGTGLYAVVAYLVQHYFFSIMGENLTTR  768

Query  471  LRLRYLQSVLRKKIEFFDTDTRAKDIIF-HISSDAILVQDAIGDKIGHTIRYISQFLVGF  647
            +R   L  +LR  + +FD +     ++   +++DA  V+ AI ++I   ++ ++  LV F
Sbjct  769  VRRMMLAVILRNDVGWFDQEENNSSLVAARLATDAADVKSAIAERISVILQNMTSLLVSF  828

Query  648  AVGFISVWKLTLVTLAVVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTV  827
             VGFI  W++ L+ L   PL+ +A     L M   +     A+A+   +A E +S +RTV
Sbjct  829  VVGFIIEWRVALLILITFPLLVLANFAQQLSMKGFAGDTAKAHAKTSMIAGEGVSNIRTV  888

Query  828  YSFVGEKKAVESYSKSL  878
             +F  + K +  +   L
Sbjct  889  AAFNAQDKILSLFCGEL  905



>ref|NP_001054045.1| Os04g0642000 [Oryza sativa Japonica Group]
 dbj|BAF15959.1| Os04g0642000 [Oryza sativa Japonica Group]
Length=612

 Score =   253 bits (646),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 125/265 (47%), Positives = 179/265 (68%), Gaps = 3/265 (1%)
 Frame = +3

Query  114  GELEISSNLKMDQQPSNSTDRK---EMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALP  284
            G++E ++N  ++   +    +K   + V+F  LF+ AD  D   M  GS+GA  HGAA+P
Sbjct  12   GKVEKAANGGVNGCDAAGEGKKRADQAVAFHELFTFADKWDLVLMAAGSLGALAHGAAMP  71

Query  285  VFFVLFGRMIDSLGHLSSDSHRLSSQVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQT  464
            +FF+LFG +I+  G   +D   ++ +VSK ALY VYLG ++  S++  +A W  TGERQ 
Sbjct  72   LFFLLFGDLINGFGKNQTDLRTMTDEVSKYALYFVYLGLVVCASSYAEIACWMYTGERQV  131

Query  465  ARLRLRYLQSVLRKKIEFFDTDTRAKDIIFHISSDAILVQDAIGDKIGHTIRYISQFLVG  644
              LR  YL +VLR+ + FFDTD R  DI+F +S+D +LVQDAIG+K+G+ I YI+ FL G
Sbjct  132  IALRKAYLDAVLRQDVGFFDTDARTGDIVFGVSTDTLLVQDAIGEKVGNFIHYIATFLAG  191

Query  645  FAVGFISVWKLTLVTLAVVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRT  824
              VGF++ W+L L+++AV+P IA AGG Y   ++ L+ K   +YA AG VAE+AI+QVRT
Sbjct  192  LVVGFVAAWRLALLSVAVIPAIAFAGGLYAYTLTGLTSKSRESYANAGVVAEQAIAQVRT  251

Query  825  VYSFVGEKKAVESYSKSLNNALVLG  899
            VYSF GE KA+ SYS+++ N L LG
Sbjct  252  VYSFAGESKALNSYSEAIQNTLKLG  276



>ref|XP_002447959.1| hypothetical protein SORBIDRAFT_06g018860 [Sorghum bicolor]
 gb|EES12287.1| hypothetical protein SORBIDRAFT_06g018860 [Sorghum bicolor]
Length=1262

 Score =   260 bits (665),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 119/241 (49%), Positives = 173/241 (72%), Gaps = 0/241 (0%)
 Frame = +3

Query  177  KEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLSSDSHRLS  356
            ++ V+F  LF  AD +D+  M  GS GA +HGAA+PVFF+LFG +++  G    +  R++
Sbjct  31   EQSVAFHELFGFADPLDWLLMAAGSAGAVVHGAAMPVFFLLFGELVNGFGKNQHNLRRMT  90

Query  357  SQVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKKIEFFDTDTR  536
             +VSK +LY VYLG ++  S+++ +A W  TGERQ   LR RYL++VLR+ + FFDTD R
Sbjct  91   DEVSKYSLYFVYLGLVVCASSYLEIACWMYTGERQVGALRRRYLEAVLRQDVGFFDTDAR  150

Query  537  AKDIIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLAVVPLIAV  716
              D++F +S+D +LVQDAIG+K+G+ I Y++ FL G  VGF+S W+L L+++AV+P IA 
Sbjct  151  TGDVVFSVSTDTLLVQDAIGEKVGNFIHYLATFLAGLVVGFVSAWRLALLSIAVIPGIAF  210

Query  717  AGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYSKSLNNALVL  896
            AGG Y   ++ L+ K   +YA AG +AE+AI+QVRTVYS+VGE KA+ SYS+++ N L L
Sbjct  211  AGGLYAYTLTGLTSKSRDSYANAGIIAEQAIAQVRTVYSYVGETKALNSYSEAIQNTLKL  270

Query  897  G  899
            G
Sbjct  271  G  271


 Score = 90.1 bits (222),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 63/257 (25%), Positives = 124/257 (48%), Gaps = 11/257 (4%)
 Frame = +3

Query  114  GELEISSNLKMDQQ-PSNSTDRKEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVF  290
            G +E+ SN   D++ P+          FF L    +  ++ + + G+IG+ + G   P F
Sbjct  662  GRIEMVSNADNDRKYPAPRG------YFFKLLKL-NAPEWPYTILGAIGSILSGFIGPTF  714

Query  291  FVLFGRMIDSLGHLSSDSHRLSSQVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTAR  470
             ++   MI+   +   + +++ S+  +     +  G    ++  +   F++  GE  T R
Sbjct  715  AIVMSNMIEVFYY--RNPNKMESKTREYVFIYIGTGLYAVVAYLVQHYFFSIMGENLTTR  772

Query  471  LRLRYLQSVLRKKIEFFDTDTRAKDIIF-HISSDAILVQDAIGDKIGHTIRYISQFLVGF  647
            +R   L  +LR  + +FD +    +++   +S+DA  V+ AI ++I   ++ ++  LV F
Sbjct  773  VRRMMLAVILRNDVGWFDQEENNSNLVTARLSTDAADVKSAIAERISVILQNMTSLLVSF  832

Query  648  AVGFISVWKLTLVTLAVVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTV  827
             VGFI  W++ L+ L   PL+ +A     L M   +     A+A+   +A E +S +RTV
Sbjct  833  VVGFIIEWRVALLILVTFPLLVLANFAQQLSMKGFAGDTAKAHAKTSMIAGEGVSNIRTV  892

Query  828  YSFVGEKKAVESYSKSL  878
             +F  + K +  +   L
Sbjct  893  AAFNAQDKILSLFCSEL  909



>ref|NP_001169660.1| uncharacterized protein LOC100383541 [Zea mays]
 gb|ACN34410.1| unknown [Zea mays]
 gb|AFW58473.1| hypothetical protein ZEAMMB73_248443 [Zea mays]
Length=1264

 Score =   260 bits (665),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 119/241 (49%), Positives = 173/241 (72%), Gaps = 0/241 (0%)
 Frame = +3

Query  177  KEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLSSDSHRLS  356
            ++ V+F  LF  AD +D+  M  GS GA +HGAA+PVFF+LFG +++  G    +  R++
Sbjct  33   EQSVAFHELFGFADPLDWLLMAAGSAGAVVHGAAMPVFFLLFGELVNGFGKNQHNLRRMT  92

Query  357  SQVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKKIEFFDTDTR  536
             +VSK +LY VYLG ++  S+++ +A W  TGERQ   LR RYL++VLR+ + FFDTD R
Sbjct  93   DEVSKYSLYFVYLGLVVCASSYLEIACWMYTGERQVGALRRRYLEAVLRQDVGFFDTDAR  152

Query  537  AKDIIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLAVVPLIAV  716
              D++F +S+D +LVQDAIG+K+G+ I Y++ FL G  VGF+S W+L L+++AV+P IA 
Sbjct  153  TGDVVFSVSTDTLLVQDAIGEKVGNFIHYLATFLAGLVVGFVSAWRLALLSIAVIPGIAF  212

Query  717  AGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYSKSLNNALVL  896
            AGG Y   ++ L+ K   +YA AG +AE+AI+QVRTVYS+VGE KA+ SYS+++ N L L
Sbjct  213  AGGLYAYTLTGLTSKSRDSYANAGIIAEQAIAQVRTVYSYVGETKALNSYSEAIQNTLKL  272

Query  897  G  899
            G
Sbjct  273  G  273


 Score = 89.4 bits (220),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 66/260 (25%), Positives = 128/260 (49%), Gaps = 17/260 (7%)
 Frame = +3

Query  114  GELEISSNLKMDQQ-PSNSTDRKEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVF  290
            G +E+ SN   D++ P+          FF L    +  ++ + + G++G+ + G   P F
Sbjct  664  GRIEMVSNADNDRKYPAPRG------YFFKLLKL-NAPEWPYTILGAVGSVLSGFIGPTF  716

Query  291  FVLFGRMIDSLGHLSSDSHRLSSQVSKQALYL-VYLGSIIF--ISAWIGVAFWTQTGERQ  461
             ++   MI+   + +      S   SK   Y+ +Y+G+ ++  ++  +   F++  GE  
Sbjct  717  AIVMSNMIEVFYYRNP-----SKMESKTREYVFIYIGTGLYAVVAYLVQHYFFSIMGENL  771

Query  462  TARLRLRYLQSVLRKKIEFFDTDTRAKDIIF-HISSDAILVQDAIGDKIGHTIRYISQFL  638
            T R+R   L  +LR  + +FD +    +++   +S+DA  V+ AI ++I   ++ ++  L
Sbjct  772  TTRVRRMMLAVILRNDVGWFDQEENNSNLVAARLSTDAADVKSAIAERISVILQNMTSLL  831

Query  639  VGFAVGFISVWKLTLVTLAVVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQV  818
            V F VGFI  W++ L+ L   PL+ +A     L M   +     A+A+   +A E +S +
Sbjct  832  VSFVVGFIIEWRVALLILVTFPLLVLANFAQQLSMKGFAGDTAKAHAKTSMIAGEGVSNI  891

Query  819  RTVYSFVGEKKAVESYSKSL  878
            RTV +F  + K +  +   L
Sbjct  892  RTVAAFNAQDKILSLFCSEL  911



>ref|XP_006290510.1| hypothetical protein CARUB_v10016588mg [Capsella rubella]
 gb|EOA23408.1| hypothetical protein CARUB_v10016588mg [Capsella rubella]
Length=1252

 Score =   260 bits (665),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 121/249 (49%), Positives = 175/249 (70%), Gaps = 1/249 (0%)
 Frame = +3

Query  156  PSNSTDRKEM-VSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHL  332
            P  +  +KE  + FF LFS AD  DY  M  GS+GA +HG+++PVFF+LFG+M++  G  
Sbjct  13   PQEAEKKKEQSLPFFKLFSFADRFDYLLMFVGSLGAIVHGSSMPVFFLLFGQMVNGFGKN  72

Query  333  SSDSHRLSSQVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKKI  512
              D H++  +VS+ +LY +YLG ++  S++  +A W  +GERQ A LR +YL++VLR+ +
Sbjct  73   QMDLHQMVHEVSRYSLYFIYLGLVVCFSSYAEIACWMYSGERQVAALRKKYLEAVLRQDV  132

Query  513  EFFDTDTRAKDIIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTL  692
             FFDTD R  DI+F +S+D +LVQDAI +K+G+ I Y+S FL G  VGF+S WKL L+++
Sbjct  133  GFFDTDARTGDIVFSVSTDTLLVQDAISEKVGNFIHYLSTFLAGLVVGFVSAWKLALLSI  192

Query  693  AVVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYSK  872
            AV+P IA AGG Y   ++ ++ K   +YA AG +AE+AI+QVRTVYS+VGE KA+ SYS 
Sbjct  193  AVIPGIAFAGGLYAYTLTGITSKSRESYANAGVIAEQAIAQVRTVYSYVGESKALSSYSD  252

Query  873  SLNNALVLG  899
            ++   L LG
Sbjct  253  AIQYTLKLG  261


 Score = 91.7 bits (226),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 65/261 (25%), Positives = 133/261 (51%), Gaps = 19/261 (7%)
 Frame = +3

Query  114  GELEISSNLKMDQQ---PSNSTDRKEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALP  284
            G +E+ SN + D++   P N         +F      ++ ++ + + G++G+ + G   P
Sbjct  652  GRIEMISNAETDRKTRAPEN---------YFYRLLKLNSPEWPYSIMGAVGSILSGFIGP  702

Query  285  VFFVLFGRMIDSLGHLSSDSHRLSSQVSKQALYLVYLGSIIF-ISAW-IGVAFWTQTGER  458
             F ++   MI+   +   DS     + +K+ ++ +Y+G+ ++ + A+ I   F++  GE 
Sbjct  703  TFAIVMSNMIEVFYYTDYDSME---RKTKEYVF-IYIGAGLYAVGAYLIQHYFFSIMGEN  758

Query  459  QTARLRLRYLQSVLRKKIEFFDTDTRAKDIIF-HISSDAILVQDAIGDKIGHTIRYISQF  635
             T R+R   L ++LR ++ +FD D     +I   +++DA  V+ AI ++I   ++ ++  
Sbjct  759  LTTRVRRMMLSAILRNEVGWFDEDEHNSSLIAARLATDAADVKSAIAERISVILQNMTSL  818

Query  636  LVGFAVGFISVWKLTLVTLAVVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQ  815
            L  F V FI  W+++L+ L   PL+ +A     L +   +     A+A+   +A E +S 
Sbjct  819  LTSFIVAFIVEWRVSLLILGTFPLLVLANFAQQLSLKGFAGDTAKAHAKTSMIAGEGVSN  878

Query  816  VRTVYSFVGEKKAVESYSKSL  878
            +RTV +F  + K +  +S  L
Sbjct  879  IRTVAAFNAQSKILSLFSHEL  899



>ref|XP_010502886.1| PREDICTED: ABC transporter B family member 19-like [Camelina 
sativa]
Length=1255

 Score =   260 bits (664),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 123/262 (47%), Positives = 182/262 (69%), Gaps = 3/262 (1%)
 Frame = +3

Query  123  EISSNLKMDQQ--PSNSTDRKEM-VSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFF  293
            E ++N   D +  P+ +  +KE  + FF LFS AD  DY  M  GS+GA +HG+++PVFF
Sbjct  3    EANNNNTADAKTVPAEAEKKKEQSLPFFKLFSFADRFDYLLMFVGSLGAIVHGSSMPVFF  62

Query  294  VLFGRMIDSLGHLSSDSHRLSSQVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARL  473
            +LFG+M++  G    D H++  +VS+ +LY +YLG ++  S++  +A W  +GERQ A L
Sbjct  63   LLFGQMVNGFGKNQMDLHQMVHEVSRYSLYFIYLGLVVCFSSYAEIACWMYSGERQVAAL  122

Query  474  RLRYLQSVLRKKIEFFDTDTRAKDIIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAV  653
            R +YL++VL++ + FFDTD R  DI+F +S+D +LVQDAI +K+G+ I Y+S FL G  V
Sbjct  123  RKKYLEAVLKQDVGFFDTDARTGDIVFSVSTDTLLVQDAISEKVGNFIHYLSTFLAGLVV  182

Query  654  GFISVWKLTLVTLAVVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYS  833
            GF+S WKL L+++AV+P IA AGG Y   ++ ++ K   +YA AG +AE+AI+QVRTVYS
Sbjct  183  GFVSAWKLALLSVAVIPGIAFAGGLYAYTLTGITSKSRESYANAGVIAEQAIAQVRTVYS  242

Query  834  FVGEKKAVESYSKSLNNALVLG  899
            +VGE KA+ SYS ++   L LG
Sbjct  243  YVGESKALSSYSDAIQYTLKLG  264


 Score = 90.1 bits (222),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 65/261 (25%), Positives = 132/261 (51%), Gaps = 19/261 (7%)
 Frame = +3

Query  114  GELEISSNLKMDQQ---PSNSTDRKEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALP  284
            G +E+ SN + D++   P N         +F      ++ ++ + + G++G+ + G   P
Sbjct  655  GRIEMISNAETDRKTRAPEN---------YFYRLLKLNSPEWPYSLMGAVGSILSGFIGP  705

Query  285  VFFVLFGRMIDSLGHLSSDSHRLSSQVSKQALYLVYLGSIIF-ISAW-IGVAFWTQTGER  458
             F ++   MI+   +   DS     + +K+ ++ +Y+G+ ++ + A+ I   F++  GE 
Sbjct  706  TFAIVMSNMIEVFYYTDYDSME---RKTKEYVF-IYIGAGLYAVGAYLIQHYFFSIMGEN  761

Query  459  QTARLRLRYLQSVLRKKIEFFDTDTRAKDIIF-HISSDAILVQDAIGDKIGHTIRYISQF  635
             T R+R   L ++LR ++ +FD D     +I   +++DA  V+ AI ++I   ++ ++  
Sbjct  762  LTTRVRRMMLSAILRNEVGWFDEDEHNSSLIAARLATDAADVKSAIAERISVILQNMTSL  821

Query  636  LVGFAVGFISVWKLTLVTLAVVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQ  815
            L  F V FI  WK++L+ L   PL+ +A     L +   +     A+A+   +A E +S 
Sbjct  822  LTSFIVAFIVEWKVSLLILGTFPLLVLANFAQQLSLKGFAGDTAKAHAKTSMIAGEGVSN  881

Query  816  VRTVYSFVGEKKAVESYSKSL  878
            +RTV +F  + K +  +   L
Sbjct  882  IRTVAAFNAQSKILSLFCHEL  902



>emb|CDX86408.1| BnaA06g31250D [Brassica napus]
Length=1237

 Score =   259 bits (662),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 120/259 (46%), Positives = 178/259 (69%), Gaps = 0/259 (0%)
 Frame = +3

Query  123  EISSNLKMDQQPSNSTDRKEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFVLF  302
            E +++ K          ++E + FF LFS AD  DY  M  G++GA +HG+++PVFF+LF
Sbjct  3    ETTADTKPVPPAEAEKKKEESLPFFKLFSFADKFDYLLMTTGTLGAIVHGSSMPVFFLLF  62

Query  303  GRMIDSLGHLSSDSHRLSSQVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARLRLR  482
            G M++  G    D H+++ +VSK +LY VYLG ++  S++  +A W  +GERQ A LR +
Sbjct  63   GEMVNGFGKNQMDLHQMTHEVSKYSLYFVYLGLVVCFSSYAEIACWMYSGERQVAALRKK  122

Query  483  YLQSVLRKKIEFFDTDTRAKDIIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFI  662
            YL++VL++ + FFDTD R  DI+F +S+D +LVQDAI +K+G+ I Y+S FL G  VGF+
Sbjct  123  YLEAVLKQDVGFFDTDARTGDIVFSVSTDTLLVQDAISEKVGNFIHYLSTFLAGLVVGFV  182

Query  663  SVWKLTLVTLAVVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVG  842
            S W+L L+++AV+P IA AGG Y   ++ ++ K   +YA AG +AE+AI+QVRTVYS+VG
Sbjct  183  SAWRLALLSVAVIPGIAFAGGLYAYTLTGITSKSRESYANAGVIAEQAIAQVRTVYSYVG  242

Query  843  EKKAVESYSKSLNNALVLG  899
            E KA+ SYS ++   L LG
Sbjct  243  ESKALSSYSDAIQYTLKLG  261


 Score = 93.2 bits (230),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 66/261 (25%), Positives = 131/261 (50%), Gaps = 19/261 (7%)
 Frame = +3

Query  114  GELEISSNLKMDQQ---PSNSTDRKEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALP  284
            G +E+ SN + D++   P N         +F      +  ++ + + G++G+ + G   P
Sbjct  637  GRIEMISNAETDRKTRAPQN---------YFYRLLKLNAPEWPYSIMGAVGSVLSGFIGP  687

Query  285  VFFVLFGRMIDSLGHLSSDSHRLSSQVSKQALYLVYLGSIIF--ISAWIGVAFWTQTGER  458
             F ++   MI+   +   DS     + +K+ ++ +Y+G+ I+  I+  I   F++  GE 
Sbjct  688  TFAIVMSNMIEVFYYTDYDSME---RKTKEYVF-IYIGAGIYAVIAYLIQHYFFSIMGEN  743

Query  459  QTARLRLRYLQSVLRKKIEFFDTDTRAKDIIF-HISSDAILVQDAIGDKIGHTIRYISQF  635
             T R+R   L ++LR ++ +FD D     +I   +++DA  V+ AI ++I   ++ ++  
Sbjct  744  LTTRVRRMMLSAILRNEVGWFDEDEHNSSLIAARLATDAADVKSAIAERISVILQNMTSL  803

Query  636  LVGFAVGFISVWKLTLVTLAVVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQ  815
            L  F V FI  W+++L+ LA  PL+ +A     L +   +     A+A+   +A E +S 
Sbjct  804  LTSFIVAFIVEWRVSLLILATFPLLVLANFAQQLSLKGFAGDTAKAHAKTSMIAGEGVSN  863

Query  816  VRTVYSFVGEKKAVESYSKSL  878
            +RTV +F  + K +  +   L
Sbjct  864  IRTVAAFNAQSKILSLFCHEL  884



>ref|XP_009151836.1| PREDICTED: ABC transporter B family member 19 [Brassica rapa]
Length=1252

 Score =   259 bits (663),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 120/259 (46%), Positives = 178/259 (69%), Gaps = 0/259 (0%)
 Frame = +3

Query  123  EISSNLKMDQQPSNSTDRKEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFVLF  302
            E +++ K          ++E + FF LFS AD  DY  M  G++GA +HG+++PVFF+LF
Sbjct  3    ETTADTKPVPPAEAEKKKEESLPFFKLFSFADKFDYLLMTTGTLGAIVHGSSMPVFFLLF  62

Query  303  GRMIDSLGHLSSDSHRLSSQVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARLRLR  482
            G M++  G    D H+++ +VSK +LY VYLG ++  S++  +A W  +GERQ A LR +
Sbjct  63   GEMVNGFGKNQMDLHQMTHEVSKYSLYFVYLGLVVCFSSYAEIACWMYSGERQVAALRKK  122

Query  483  YLQSVLRKKIEFFDTDTRAKDIIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFI  662
            YL++VL++ + FFDTD R  DI+F +S+D +LVQDAI +K+G+ I Y+S FL G  VGF+
Sbjct  123  YLEAVLKQDVGFFDTDARTGDIVFSVSTDTLLVQDAISEKVGNFIHYLSTFLAGLVVGFV  182

Query  663  SVWKLTLVTLAVVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVG  842
            S W+L L+++AV+P IA AGG Y   ++ ++ K   +YA AG +AE+AI+QVRTVYS+VG
Sbjct  183  SAWRLALLSVAVIPGIAFAGGLYAYTLTGITSKSRESYANAGVIAEQAIAQVRTVYSYVG  242

Query  843  EKKAVESYSKSLNNALVLG  899
            E KA+ SYS ++   L LG
Sbjct  243  ESKALSSYSDAIQYTLKLG  261


 Score = 93.2 bits (230),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 66/261 (25%), Positives = 131/261 (50%), Gaps = 19/261 (7%)
 Frame = +3

Query  114  GELEISSNLKMDQQ---PSNSTDRKEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALP  284
            G +E+ SN + D++   P N         +F      +  ++ + + G++G+ + G   P
Sbjct  652  GRIEMISNAETDRKTRAPQN---------YFYRLLKLNAPEWPYSIMGAVGSVLSGFIGP  702

Query  285  VFFVLFGRMIDSLGHLSSDSHRLSSQVSKQALYLVYLGSIIF--ISAWIGVAFWTQTGER  458
             F ++   MI+   +   DS     + +K+ ++ +Y+G+ I+  I+  I   F++  GE 
Sbjct  703  TFAIVMSNMIEVFYYTDYDSME---RKTKEYVF-IYIGAGIYAVIAYLIQHYFFSIMGEN  758

Query  459  QTARLRLRYLQSVLRKKIEFFDTDTRAKDIIF-HISSDAILVQDAIGDKIGHTIRYISQF  635
             T R+R   L ++LR ++ +FD D     +I   +++DA  V+ AI ++I   ++ ++  
Sbjct  759  LTTRVRRMMLSAILRNEVGWFDEDEHNSSLIAARLATDAADVKSAIAERISVILQNMTSL  818

Query  636  LVGFAVGFISVWKLTLVTLAVVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQ  815
            L  F V FI  W+++L+ LA  PL+ +A     L +   +     A+A+   +A E +S 
Sbjct  819  LTSFIVAFIVEWRVSLLILATFPLLVLANFAQQLSLKGFAGDTAKAHAKTSMIAGEGVSN  878

Query  816  VRTVYSFVGEKKAVESYSKSL  878
            +RTV +F  + K +  +   L
Sbjct  879  IRTVAAFNAQSKILSLFCHEL  899



>ref|XP_011098607.1| PREDICTED: ABC transporter B family member 19 [Sesamum indicum]
Length=1250

 Score =   259 bits (662),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 118/248 (48%), Positives = 174/248 (70%), Gaps = 0/248 (0%)
 Frame = +3

Query  156  PSNSTDRKEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLS  335
            P +   +++ + F+ LFS AD  D   M+ GS+GA IHG+++PVFF+LFG M++  G   
Sbjct  11   PESEKKKEQSLPFYQLFSFADKYDIILMISGSLGAIIHGSSMPVFFLLFGEMVNGFGKNQ  70

Query  336  SDSHRLSSQVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKKIE  515
             D H+++ +V+K ALY VYLG ++  S++  +A W  TGERQ   LR +YL++VL++ + 
Sbjct  71   MDLHKMTHEVAKYALYFVYLGLVVCFSSYAEIACWMYTGERQVGALRKKYLEAVLKQDVG  130

Query  516  FFDTDTRAKDIIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLA  695
            FFDTD R  DI+F +S+D +LVQDAI +K+G+ I Y+S FL G  VGF+S W+L L+++A
Sbjct  131  FFDTDARTGDIVFSVSTDTLLVQDAISEKVGNFIHYLSTFLAGLVVGFVSAWRLALLSVA  190

Query  696  VVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYSKS  875
            V+P IA AGG Y   ++ L+ K   +YA AG +AE++I+QVRTVYS+VGE KA+ +YS  
Sbjct  191  VIPGIAFAGGLYAYTLTGLTSKSRESYANAGIIAEQSIAQVRTVYSYVGESKALSAYSDL  250

Query  876  LNNALVLG  899
            + N L LG
Sbjct  251  IQNTLKLG  258


 Score = 87.8 bits (216),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 63/260 (24%), Positives = 130/260 (50%), Gaps = 17/260 (7%)
 Frame = +3

Query  114  GELEISSNLKMDQQPSNSTDRKEMVS--FFGLFSAADTVDYFFMVFGSIGACIHGAALPV  287
            G LE+ SN +        TDRK      +F      +  ++ + + G+IG+ + G   P 
Sbjct  650  GRLEMVSNAE--------TDRKNPAPAGYFCRLLKLNAPEWPYSIMGAIGSILSGFIGPT  701

Query  288  FFVLFGRMIDSLGHLSSDSHRLSSQVSKQALYLVYLGSIIF--ISAWIGVAFWTQTGERQ  461
            F ++   MI+   + +  +     + +K+ ++ +Y+G+ ++  ++  I   F++  GE  
Sbjct  702  FAIVMSNMIEVFYYRNPAAME---RKTKEYVF-IYIGAGLYAVVAYLIQHYFFSIMGENL  757

Query  462  TARLRLRYLQSVLRKKIEFFDTDTRAKDIIF-HISSDAILVQDAIGDKIGHTIRYISQFL  638
            T R+R   L ++LR ++ +FD +     ++   +++DA  V+ AI ++I   ++ ++  L
Sbjct  758  TTRVRRMMLAAILRNEVGWFDEEENNSSLLAARLATDAADVKSAIAERISVILQNMTSLL  817

Query  639  VGFAVGFISVWKLTLVTLAVVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQV  818
              F V FI  W+++L+ LA  PL+ +A     L +   +     A+A+   +A E +S +
Sbjct  818  TSFIVAFIVEWRVSLLILATFPLLVLANFAQQLSLKGFAGDTAKAHAKTSMIAGEGVSNI  877

Query  819  RTVYSFVGEKKAVESYSKSL  878
            RTV +F  + K +  +   L
Sbjct  878  RTVAAFNAQDKILSLFCHEL  897



>ref|XP_010514603.1| PREDICTED: ABC transporter B family member 19-like [Camelina 
sativa]
Length=1254

 Score =   259 bits (662),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 120/249 (48%), Positives = 176/249 (71%), Gaps = 1/249 (0%)
 Frame = +3

Query  156  PSNSTDRKEM-VSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHL  332
            P+ +  +KE  + FF LFS AD  DY  M  GS+GA +HG+++PVFF+LFG+M++  G  
Sbjct  15   PAEAEKKKEQSLPFFKLFSFADRFDYLLMFVGSLGAIVHGSSMPVFFLLFGQMVNGFGKN  74

Query  333  SSDSHRLSSQVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKKI  512
              D H++  +VS+ +LY +YLG ++  S++  +A W  +GERQ A LR +YL++VL++ +
Sbjct  75   QMDLHQMVHEVSRYSLYFIYLGLVVCFSSYAEIACWMYSGERQVAALRKKYLEAVLKQDV  134

Query  513  EFFDTDTRAKDIIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTL  692
             FFDTD R  DI+F +S+D +LVQDAI +K+G+ I Y+S FL G  VGF+S WKL L+++
Sbjct  135  GFFDTDARTGDIVFSVSTDTLLVQDAISEKVGNFIHYLSTFLAGLVVGFVSAWKLALLSV  194

Query  693  AVVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYSK  872
            AV+P IA AGG Y   ++ ++ K   +YA AG +AE+AI+QVRTVYS+VGE KA+ SYS 
Sbjct  195  AVIPGIAFAGGLYAYTLTGITSKSRESYANAGVIAEQAIAQVRTVYSYVGESKALSSYSD  254

Query  873  SLNNALVLG  899
            ++   L LG
Sbjct  255  AIQYTLKLG  263


 Score = 90.5 bits (223),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 65/261 (25%), Positives = 132/261 (51%), Gaps = 19/261 (7%)
 Frame = +3

Query  114  GELEISSNLKMDQQ---PSNSTDRKEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALP  284
            G +E+ SN + D++   P N         +F      ++ ++ + + G++G+ + G   P
Sbjct  654  GRIEMISNAETDRKTRAPEN---------YFYRLLKLNSPEWPYSLMGAVGSILSGFIGP  704

Query  285  VFFVLFGRMIDSLGHLSSDSHRLSSQVSKQALYLVYLGSIIF-ISAW-IGVAFWTQTGER  458
             F ++   MI+   +   DS     + +K+ ++ +Y+G+ ++ + A+ I   F++  GE 
Sbjct  705  TFAIVMSNMIEVFYYTDYDSME---RKTKEYVF-IYIGAGLYAVGAYLIQHYFFSIMGEN  760

Query  459  QTARLRLRYLQSVLRKKIEFFDTDTRAKDIIF-HISSDAILVQDAIGDKIGHTIRYISQF  635
             T R+R   L ++LR ++ +FD D     +I   +++DA  V+ AI ++I   ++ ++  
Sbjct  761  LTTRVRRMMLSAILRNEVGWFDEDEHNSSLIAARLATDAADVKSAIAERISVILQNMTSL  820

Query  636  LVGFAVGFISVWKLTLVTLAVVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQ  815
            L  F V FI  WK++L+ L   PL+ +A     L +   +     A+A+   +A E +S 
Sbjct  821  LTSFIVAFIVEWKVSLLILGTFPLLVLANFAQQLSLKGFAGDTAKAHAKTSMIAGEGVSN  880

Query  816  VRTVYSFVGEKKAVESYSKSL  878
            +RTV +F  + K +  +   L
Sbjct  881  IRTVAAFNAQSKILSLFCHEL  901



>ref|XP_010425667.1| PREDICTED: ABC transporter B family member 19 [Camelina sativa]
Length=1254

 Score =   259 bits (661),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 120/249 (48%), Positives = 176/249 (71%), Gaps = 1/249 (0%)
 Frame = +3

Query  156  PSNSTDRKEM-VSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHL  332
            P+ +  +KE  + FF LFS AD  DY  M  GS+GA +HG+++PVFF+LFG+M++  G  
Sbjct  15   PAEAEKKKEQSLPFFKLFSFADRFDYLLMFVGSLGAIVHGSSMPVFFLLFGQMVNGFGKN  74

Query  333  SSDSHRLSSQVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKKI  512
              D H++  +VS+ +LY +YLG ++  S++  +A W  +GERQ A LR +YL++VL++ +
Sbjct  75   QMDLHQMVHEVSRYSLYFIYLGLVVCFSSYAEIACWMYSGERQVAALRKKYLEAVLKQDV  134

Query  513  EFFDTDTRAKDIIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTL  692
             FFDTD R  DI+F +S+D +LVQDAI +K+G+ I Y+S FL G  VGF+S WKL L+++
Sbjct  135  GFFDTDARTGDIVFSVSTDTLLVQDAISEKVGNFIHYLSTFLAGLVVGFVSAWKLALLSV  194

Query  693  AVVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYSK  872
            AV+P IA AGG Y   ++ ++ K   +YA AG +AE+AI+QVRTVYS+VGE KA+ SYS 
Sbjct  195  AVIPGIAFAGGLYAYTLTGITSKSRESYANAGVIAEQAIAQVRTVYSYVGESKALSSYSD  254

Query  873  SLNNALVLG  899
            ++   L LG
Sbjct  255  AIQYTLKLG  263


 Score = 90.5 bits (223),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 65/261 (25%), Positives = 132/261 (51%), Gaps = 19/261 (7%)
 Frame = +3

Query  114  GELEISSNLKMDQQ---PSNSTDRKEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALP  284
            G +E+ SN + D++   P N         +F      ++ ++ + + G++G+ + G   P
Sbjct  654  GRIEMISNAETDRKTRAPEN---------YFYRLLKLNSPEWPYSLMGAVGSILSGFIGP  704

Query  285  VFFVLFGRMIDSLGHLSSDSHRLSSQVSKQALYLVYLGSIIF-ISAW-IGVAFWTQTGER  458
             F ++   MI+   +   DS     + +K+ ++ +Y+G+ ++ + A+ I   F++  GE 
Sbjct  705  TFAIVMSNMIEVFYYTDYDSME---RKTKEYVF-IYIGAGLYAVGAYLIQHYFFSIMGEN  760

Query  459  QTARLRLRYLQSVLRKKIEFFDTDTRAKDIIF-HISSDAILVQDAIGDKIGHTIRYISQF  635
             T R+R   L ++LR ++ +FD D     +I   +++DA  V+ AI ++I   ++ ++  
Sbjct  761  LTTRVRRMMLSAILRNEVGWFDEDEHNSSLIAARLATDAADVKSAIAERISVILQNMTSL  820

Query  636  LVGFAVGFISVWKLTLVTLAVVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQ  815
            L  F V FI  WK++L+ L   PL+ +A     L +   +     A+A+   +A E +S 
Sbjct  821  LTSFIVAFIVEWKVSLLILGTFPLLVLANFAQQLSLKGFAGDTAKAHAKTSMIAGEGVSN  880

Query  816  VRTVYSFVGEKKAVESYSKSL  878
            +RTV +F  + K +  +   L
Sbjct  881  IRTVAAFNAQSKILSLFCHEL  901



>dbj|BAG91391.1| unnamed protein product [Oryza sativa Japonica Group]
Length=649

 Score =   252 bits (644),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 125/265 (47%), Positives = 179/265 (68%), Gaps = 3/265 (1%)
 Frame = +3

Query  114  GELEISSNLKMDQQPSNSTDRK---EMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALP  284
            G++E ++N  ++   +    +K   + V+F  LF+ AD  D   M  GS+GA  HGAA+P
Sbjct  12   GKVEKAANGGVNGCDAAGEGKKRADQAVAFHELFTFADKWDLVLMAAGSLGALAHGAAMP  71

Query  285  VFFVLFGRMIDSLGHLSSDSHRLSSQVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQT  464
            +FF+LFG +I+  G   +D   ++ +VSK ALY VYLG ++  S++  +A W  TGERQ 
Sbjct  72   LFFLLFGDLINGFGKNQTDLRTMTDEVSKYALYFVYLGLVVCASSYAEIACWMYTGERQV  131

Query  465  ARLRLRYLQSVLRKKIEFFDTDTRAKDIIFHISSDAILVQDAIGDKIGHTIRYISQFLVG  644
              LR  YL +VLR+ + FFDTD R  DI+F +S+D +LVQDAIG+K+G+ I YI+ FL G
Sbjct  132  IALRKAYLDAVLRQDVGFFDTDARTGDIVFGVSTDTLLVQDAIGEKVGNFIHYIATFLAG  191

Query  645  FAVGFISVWKLTLVTLAVVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRT  824
              VGF++ W+L L+++AV+P IA AGG Y   ++ L+ K   +YA AG VAE+AI+QVRT
Sbjct  192  LVVGFVAAWRLALLSVAVIPAIAFAGGLYAYTLTGLTSKSRESYANAGVVAEQAIAQVRT  251

Query  825  VYSFVGEKKAVESYSKSLNNALVLG  899
            VYSF GE KA+ SYS+++ N L LG
Sbjct  252  VYSFAGESKALNSYSEAIQNTLKLG  276



>ref|NP_189528.1| ABC transporter B family member 19 [Arabidopsis thaliana]
 sp|Q9LJX0.1|AB19B_ARATH RecName: Full=ABC transporter B family member 19; Short=ABC transporter 
ABCB.19; Short=AtABCB19; AltName: Full=Multidrug 
resistance protein 11; AltName: Full=P-glycoprotein 19 [Arabidopsis 
thaliana]
 dbj|BAB02129.1| P-glycoprotein; multi-drug resistance related; ABC transporter-like 
protein [Arabidopsis thaliana]
 gb|AEE77498.1| ABC transporter B family member 19 [Arabidopsis thaliana]
Length=1252

 Score =   259 bits (661),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 120/249 (48%), Positives = 176/249 (71%), Gaps = 1/249 (0%)
 Frame = +3

Query  156  PSNSTDRKEM-VSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHL  332
            P+ +  +KE  + FF LFS AD  DY  M  GS+GA +HG+++PVFF+LFG+M++  G  
Sbjct  13   PAEAEKKKEQSLPFFKLFSFADKFDYLLMFVGSLGAIVHGSSMPVFFLLFGQMVNGFGKN  72

Query  333  SSDSHRLSSQVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKKI  512
              D H++  +VS+ +LY VYLG ++  S++  +A W  +GERQ A LR +YL++VL++ +
Sbjct  73   QMDLHQMVHEVSRYSLYFVYLGLVVCFSSYAEIACWMYSGERQVAALRKKYLEAVLKQDV  132

Query  513  EFFDTDTRAKDIIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTL  692
             FFDTD R  DI+F +S+D +LVQDAI +K+G+ I Y+S FL G  VGF+S WKL L+++
Sbjct  133  GFFDTDARTGDIVFSVSTDTLLVQDAISEKVGNFIHYLSTFLAGLVVGFVSAWKLALLSV  192

Query  693  AVVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYSK  872
            AV+P IA AGG Y   ++ ++ K   +YA AG +AE+AI+QVRTVYS+VGE KA+ +YS 
Sbjct  193  AVIPGIAFAGGLYAYTLTGITSKSRESYANAGVIAEQAIAQVRTVYSYVGESKALNAYSD  252

Query  873  SLNNALVLG  899
            ++   L LG
Sbjct  253  AIQYTLKLG  261


 Score = 90.1 bits (222),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 64/261 (25%), Positives = 132/261 (51%), Gaps = 19/261 (7%)
 Frame = +3

Query  114  GELEISSNLKMDQQ---PSNSTDRKEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALP  284
            G +E+ SN + D++   P N         +F      ++ ++ + + G++G+ + G   P
Sbjct  652  GRIEMISNAETDRKTRAPEN---------YFYRLLKLNSPEWPYSIMGAVGSILSGFIGP  702

Query  285  VFFVLFGRMIDSLGHLSSDSHRLSSQVSKQALYLVYLGSIIF-ISAW-IGVAFWTQTGER  458
             F ++   MI+   +   DS     + +K+ ++ +Y+G+ ++ + A+ I   F++  GE 
Sbjct  703  TFAIVMSNMIEVFYYTDYDSME---RKTKEYVF-IYIGAGLYAVGAYLIQHYFFSIMGEN  758

Query  459  QTARLRLRYLQSVLRKKIEFFDTDTRAKDIIF-HISSDAILVQDAIGDKIGHTIRYISQF  635
             T R+R   L ++LR ++ +FD D     +I   +++DA  V+ AI ++I   ++ ++  
Sbjct  759  LTTRVRRMMLSAILRNEVGWFDEDEHNSSLIAARLATDAADVKSAIAERISVILQNMTSL  818

Query  636  LVGFAVGFISVWKLTLVTLAVVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQ  815
            L  F V FI  W+++L+ L   PL+ +A     L +   +     A+A+   +A E +S 
Sbjct  819  LTSFIVAFIVEWRVSLLILGTFPLLVLANFAQQLSLKGFAGDTAKAHAKTSMIAGEGVSN  878

Query  816  VRTVYSFVGEKKAVESYSKSL  878
            +RTV +F  + K +  +   L
Sbjct  879  IRTVAAFNAQSKILSLFCHEL  899



>gb|AAN28720.2| MDR-like p-glycoprotein [Arabidopsis thaliana]
Length=1252

 Score =   259 bits (661),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 120/249 (48%), Positives = 176/249 (71%), Gaps = 1/249 (0%)
 Frame = +3

Query  156  PSNSTDRKEM-VSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHL  332
            P+ +  +KE  + FF LFS AD  DY  M  GS+GA +HG+++PVFF+LFG+M++  G  
Sbjct  13   PAEAEKKKEQSLPFFKLFSFADKFDYLLMFVGSLGAIVHGSSMPVFFLLFGQMVNGFGKN  72

Query  333  SSDSHRLSSQVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKKI  512
              D H++  +VS+ +LY VYLG ++  S++  +A W  +GERQ A LR +YL++VL++ +
Sbjct  73   QMDLHQMVHEVSRYSLYFVYLGLVVCFSSYAEIACWMYSGERQVAALRKKYLEAVLKQDV  132

Query  513  EFFDTDTRAKDIIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTL  692
             FFDTD R  DI+F +S+D +LVQDAI +K+G+ I Y+S FL G  VGF+S WKL L+++
Sbjct  133  GFFDTDARTGDIVFSVSTDTLLVQDAISEKVGNFIHYLSTFLAGLVVGFVSAWKLALLSV  192

Query  693  AVVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYSK  872
            AV+P IA AGG Y   ++ ++ K   +YA AG +AE+AI+QVRTVYS+VGE KA+ +YS 
Sbjct  193  AVIPGIAFAGGLYAYTLTGITSKSRESYANAGVIAEQAIAQVRTVYSYVGESKALNAYSD  252

Query  873  SLNNALVLG  899
            ++   L LG
Sbjct  253  AIQYTLKLG  261


 Score = 90.1 bits (222),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 64/261 (25%), Positives = 132/261 (51%), Gaps = 19/261 (7%)
 Frame = +3

Query  114  GELEISSNLKMDQQ---PSNSTDRKEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALP  284
            G +E+ SN + D++   P N         +F      ++ ++ + + G++G+ + G   P
Sbjct  652  GRIEMISNAETDRKTRAPEN---------YFYRLLKLNSPEWPYSIMGAVGSILSGFIGP  702

Query  285  VFFVLFGRMIDSLGHLSSDSHRLSSQVSKQALYLVYLGSIIF-ISAW-IGVAFWTQTGER  458
             F ++   MI+   +   DS     + +K+ ++ +Y+G+ ++ + A+ I   F++  GE 
Sbjct  703  TFAIVMSNMIEVFYYTDYDSME---RKTKEYVF-IYIGAGLYAVGAYLIQHYFFSIMGEN  758

Query  459  QTARLRLRYLQSVLRKKIEFFDTDTRAKDIIF-HISSDAILVQDAIGDKIGHTIRYISQF  635
             T R+R   L ++LR ++ +FD D     +I   +++DA  V+ AI ++I   ++ ++  
Sbjct  759  LTTRVRRMMLSAILRNEVGWFDEDEHNSSLIAARLATDAADVKSAIAERISVILQNMTSL  818

Query  636  LVGFAVGFISVWKLTLVTLAVVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQ  815
            L  F V FI  W+++L+ L   PL+ +A     L +   +     A+A+   +A E +S 
Sbjct  819  LTSFIVAFIVEWRVSLLILGTFPLLVLANFAQQLSLKGFAGDTAKAHAKTSMIAGEGVSN  878

Query  816  VRTVYSFVGEKKAVESYSKSL  878
            +RTV +F  + K +  +   L
Sbjct  879  IRTVAAFNAQSKILSLFCHEL  899



>dbj|BAC41846.1| putative P-glycoprotein [Arabidopsis thaliana]
Length=1252

 Score =   259 bits (661),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 120/249 (48%), Positives = 176/249 (71%), Gaps = 1/249 (0%)
 Frame = +3

Query  156  PSNSTDRKEM-VSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHL  332
            P+ +  +KE  + FF LFS AD  DY  M  GS+GA +HG+++PVFF+LFG+M++  G  
Sbjct  13   PAEAEKKKEQSLPFFKLFSFADKFDYLLMFVGSLGAIVHGSSMPVFFLLFGQMVNGFGKN  72

Query  333  SSDSHRLSSQVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKKI  512
              D H++  +VS+ +LY VYLG ++  S++  +A W  +GERQ A LR +YL++VL++ +
Sbjct  73   QMDLHQMVHEVSRYSLYFVYLGLVVCFSSYAEIACWMYSGERQVAALRKKYLEAVLKQDV  132

Query  513  EFFDTDTRAKDIIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTL  692
             FFDTD R  DI+F +S+D +LVQDAI +K+G+ I Y+S FL G  VGF+S WKL L+++
Sbjct  133  GFFDTDARTGDIVFSVSTDTLLVQDAISEKVGNFIHYLSTFLAGLVVGFVSAWKLALLSV  192

Query  693  AVVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYSK  872
            AV+P IA AGG Y   ++ ++ K   +YA AG +AE+AI+QVRTVYS+VGE KA+ +YS 
Sbjct  193  AVIPGIAFAGGLYAYTLTGITSKSRESYANAGVIAEQAIAQVRTVYSYVGESKALNAYSD  252

Query  873  SLNNALVLG  899
            ++   L LG
Sbjct  253  AIQYTLKLG  261


 Score = 90.1 bits (222),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 64/261 (25%), Positives = 132/261 (51%), Gaps = 19/261 (7%)
 Frame = +3

Query  114  GELEISSNLKMDQQ---PSNSTDRKEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALP  284
            G +E+ SN + D++   P N         +F      ++ ++ + + G++G+ + G   P
Sbjct  652  GRIEMISNAETDRKTRAPEN---------YFYRLLKLNSPEWPYSIMGAVGSILSGFIGP  702

Query  285  VFFVLFGRMIDSLGHLSSDSHRLSSQVSKQALYLVYLGSIIF-ISAW-IGVAFWTQTGER  458
             F ++   MI+   +   DS     + +K+ ++ +Y+G+ ++ + A+ I   F++  GE 
Sbjct  703  TFAIVMSNMIEVFYYTDYDSME---RKTKEYVF-IYIGAGLYAVGAYLIQHYFFSIMGEN  758

Query  459  QTARLRLRYLQSVLRKKIEFFDTDTRAKDIIF-HISSDAILVQDAIGDKIGHTIRYISQF  635
             T R+R   L ++LR ++ +FD D     +I   +++DA  V+ AI ++I   ++ ++  
Sbjct  759  LTTRVRRMMLSAILRNEVGWFDEDEHNSSLIAARLATDAADVKSAIAERISVILQNMTSL  818

Query  636  LVGFAVGFISVWKLTLVTLAVVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQ  815
            L  F V FI  W+++L+ L   PL+ +A     L +   +     A+A+   +A E +S 
Sbjct  819  LTSFIVAFIVEWRVSLLILGTFPLLVLANFAQQLSLKGFAGDTAKAHAKTSMIAGEGVSN  878

Query  816  VRTVYSFVGEKKAVESYSKSL  878
            +RTV +F  + K +  +   L
Sbjct  879  IRTVAAFNAQSKILSLFCHEL  899



>ref|XP_008784383.1| PREDICTED: ABC transporter B family member 19 [Phoenix dactylifera]
Length=1253

 Score =   259 bits (661),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 120/242 (50%), Positives = 175/242 (72%), Gaps = 0/242 (0%)
 Frame = +3

Query  174  RKEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLSSDSHRL  353
            +++ V+F+ LF+ AD  D   M  GS+GA +HG+A+PVFF+LFG +++  G   +D   +
Sbjct  19   QEQSVAFYELFTFADRYDLALMGAGSLGAVVHGSAMPVFFLLFGDLVNGFGKNQADLGTM  78

Query  354  SSQVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKKIEFFDTDT  533
            +++VSK ALY +YLG ++ +S++  +A W  TGERQ    R RYL++VL++ + FFDTD 
Sbjct  79   TNEVSKYALYFIYLGLVVCVSSYAEIACWMYTGERQVGTFRRRYLEAVLKQDVGFFDTDA  138

Query  534  RAKDIIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLAVVPLIA  713
            R  DI+F +S+D +LVQDAI +K+G+ I Y+S FL G  VGFIS W+L L+++AV+P IA
Sbjct  139  RTGDIVFSVSTDTLLVQDAISEKVGNFIHYLSTFLAGLVVGFISAWRLALLSVAVIPGIA  198

Query  714  VAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYSKSLNNALV  893
             AGG Y   ++ L+ KG  +YA AG +AE+AI+QVRTVYSFVGE KA+ SYS+++ N L 
Sbjct  199  FAGGLYAYTLTGLTSKGRESYANAGIIAEQAIAQVRTVYSFVGESKALNSYSEAIQNTLK  258

Query  894  LG  899
            LG
Sbjct  259  LG  260


 Score = 87.4 bits (215),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 62/259 (24%), Positives = 127/259 (49%), Gaps = 15/259 (6%)
 Frame = +3

Query  114  GELEISSNLKMDQQ-PSNSTDRKEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVF  290
            G +E+ SN   D++ P+          FF L    +  ++ + + G+IG+ + G   P F
Sbjct  653  GRIEMVSNADNDRKYPAPRG------YFFKLLKL-NAPEWPYSILGAIGSVLSGFIGPTF  705

Query  291  FVLFGRMIDSLGHLSSDSHRLSSQVSKQALYLVYLGSIIF--ISAWIGVAFWTQTGERQT  464
             ++   MI+   +   ++    ++        +Y+G+ ++  ++  +   F++  GE  T
Sbjct  706  AIVMSNMIEVFYYRDPNAMERKTR----EYVFIYIGTGLYAVVAYLVQHYFFSIMGENLT  761

Query  465  ARLRLRYLQSVLRKKIEFFDTDTRAKDIIF-HISSDAILVQDAIGDKIGHTIRYISQFLV  641
             R+R   L ++LR ++ +FD D     ++   +++DA  V+ AI ++I   ++ ++  L 
Sbjct  762  TRVRRMMLAAILRNEVGWFDEDENNSSLLAARLATDAADVKSAIAERISVILQNMTSLLT  821

Query  642  GFAVGFISVWKLTLVTLAVVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVR  821
             F VGFI  W++ L+ LA  PL+ +A     L +   +     A+A+   +A E +S +R
Sbjct  822  SFIVGFIVEWRVALLILATFPLLVLANFAQQLSLKGFAGDTAKAHAKTSMIAGEGVSNIR  881

Query  822  TVYSFVGEKKAVESYSKSL  878
            TV +F  + K +  +   L
Sbjct  882  TVAAFNAQDKILSLFHHEL  900



>ref|XP_006827168.1| hypothetical protein AMTR_s00010p00254310 [Amborella trichopoda]
 gb|ERM94405.1| hypothetical protein AMTR_s00010p00254310 [Amborella trichopoda]
Length=1252

 Score =   258 bits (660),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 118/248 (48%), Positives = 180/248 (73%), Gaps = 1/248 (0%)
 Frame = +3

Query  159  SNSTDRKEM-VSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLS  335
            +++  +KE+ + F+ LFS +D+ D+F M  G++GA +HG+++PVFF+ FG +++  G   
Sbjct  11   ADAEKKKELSLPFYKLFSFSDSYDWFVMTIGTVGAVVHGSSMPVFFLFFGDLVNGFGKNQ  70

Query  336  SDSHRLSSQVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKKIE  515
             D  +++ +VSK ALY VYLG I+  S++  +A W  TGERQ + LR +YL++VL++ + 
Sbjct  71   MDLRKMTEEVSKYALYFVYLGLIVCASSYAEIACWMYTGERQVSALRKKYLEAVLKQDVG  130

Query  516  FFDTDTRAKDIIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLA  695
            FFDTD R  DI+F +S+D +LVQDAI +K+G+ I Y+S FL G  VGF+S W+L L+++A
Sbjct  131  FFDTDARTGDIVFSVSTDTLLVQDAISEKVGNFIHYMSTFLAGLVVGFVSAWRLALLSIA  190

Query  696  VVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYSKS  875
            V+P IA AGG Y   ++ L+ K + +YA AG +AEEAI+Q+RTVYS+VGE KA+ SYS++
Sbjct  191  VIPGIAFAGGLYAYTLTGLTSKSQQSYASAGIIAEEAIAQIRTVYSYVGESKALGSYSEA  250

Query  876  LNNALVLG  899
            + N L LG
Sbjct  251  IQNTLKLG  258


 Score = 85.5 bits (210),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 61/258 (24%), Positives = 126/258 (49%), Gaps = 13/258 (5%)
 Frame = +3

Query  114  GELEISSNLKMDQQPSNSTDRKEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFF  293
            G +E+ SN   D    N   +   +    L    +  ++ + + G++G+ + G   P F 
Sbjct  650  GRIEMISN--ADSGKRNPVPKGYFIRLLKL----NMPEWPYALLGAVGSVLSGFIGPTFA  703

Query  294  VLFGRMIDSLGHLSSDSHRLSSQVSKQALYLVYLGSIIF--ISAWIGVAFWTQTGERQTA  467
            ++   MI+   +   D   + S+  +     +Y+G+ ++  I+  +   F++  GE  T 
Sbjct  704  IIMSNMIEVFYY--RDPAAMESKTRE--FVFMYIGAGLYAVIAYLVQHYFFSIMGENLTT  759

Query  468  RLRLRYLQSVLRKKIEFFDTD-TRAKDIIFHISSDAILVQDAIGDKIGHTIRYISQFLVG  644
            R+R   L ++LR ++ +FD +   +  +   +++DA  V+ AI +++   ++ ++  L  
Sbjct  760  RVRRMMLAAILRNEVGWFDEEENNSSQVASRLATDATTVKSAIAERMSVILQNMTSLLTS  819

Query  645  FAVGFISVWKLTLVTLAVVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRT  824
            F V FI  W+++L+ LA  PL+  A     L +   +     A+A+A  VA E +S +RT
Sbjct  820  FIVAFIIEWRVSLLILATFPLLVFANFAQQLSLKGFAGDTAKAHAKASMVAGEGVSNIRT  879

Query  825  VYSFVGEKKAVESYSKSL  878
            V +F  + K +  + + L
Sbjct  880  VAAFNAQSKLLALFRREL  897



>ref|XP_010528330.1| PREDICTED: ABC transporter B family member 19 [Tarenaya hassleriana]
Length=1256

 Score =   258 bits (660),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 118/248 (48%), Positives = 173/248 (70%), Gaps = 0/248 (0%)
 Frame = +3

Query  156  PSNSTDRKEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLS  335
            P     +++ + FF LFS AD  DY  M+ GS+GA +HG+++PVFF+LFG M++  G   
Sbjct  18   PEAEKKKEQSLPFFKLFSFADRYDYLLMITGSLGAIVHGSSMPVFFLLFGEMVNGFGKNQ  77

Query  336  SDSHRLSSQVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKKIE  515
             D  +++++VSK ALY VYLG ++  S++  +A W  TGERQ   LR +YL++VL++ + 
Sbjct  78   MDLQKMTNEVSKYALYFVYLGLVVCFSSYAEIACWMYTGERQVGTLRKKYLEAVLKQDVG  137

Query  516  FFDTDTRAKDIIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLA  695
            FFDTD R  DI+F +S+D +LVQDAI +K+G+ I Y+S FL G  VGF+S W+L L+++A
Sbjct  138  FFDTDARTGDIVFSVSTDTLLVQDAISEKVGNFIHYLSTFLAGLVVGFVSAWRLALLSVA  197

Query  696  VVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYSKS  875
            V+P IA AGG Y   ++ ++ K   +YA AG +AE+AI+QVRTVYS+VGE KA+  YS +
Sbjct  198  VIPGIAFAGGLYAYTLTGITSKSRESYANAGVIAEQAIAQVRTVYSYVGESKALSLYSDA  257

Query  876  LNNALVLG  899
            +   L LG
Sbjct  258  IQYTLKLG  265


 Score = 89.0 bits (219),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 60/259 (23%), Positives = 134/259 (52%), Gaps = 13/259 (5%)
 Frame = +3

Query  114  GELEISSNLKMDQQPSNSTDRKEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFF  293
            G +E+ SN + D++ + + D      +F      +  ++ + + G++G+ + G   P F 
Sbjct  656  GRIEMVSNAESDRK-TRAPD-----GYFCRLLKLNAPEWPYSIMGAVGSVLSGFIGPTFA  709

Query  294  VLFGRMIDSLGHLSSDSHRLSSQVSKQALYLVYLGSIIF--ISAWIGVAFWTQTGERQTA  467
            ++   MI+   + + DS     + +K+ ++ +Y+G+ ++  ++  I   F++  GE  T 
Sbjct  710  IVMSNMIEVFYYRNYDSME---RKTKEYVF-IYIGAGLYAVVAYLIQHYFFSIMGENLTT  765

Query  468  RLRLRYLQSVLRKKIEFFDTDTRAKDIIF-HISSDAILVQDAIGDKIGHTIRYISQFLVG  644
            R+R   L ++LR ++ +FD +     ++   +++DA  V+ A+ ++I   ++ ++  L  
Sbjct  766  RVRRMMLSAILRNEVGWFDEEEHNSSLVAARLATDAADVKSAMAERISVILQNMTSLLTS  825

Query  645  FAVGFISVWKLTLVTLAVVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRT  824
            F V FI  W+++L+ LA  PL+ +A     L +   +     A+A+   +A E +S +RT
Sbjct  826  FIVAFIVEWRVSLLILATFPLLVLANFAQQLSLKGFAGDTAKAHAKTSMIAGEGVSNIRT  885

Query  825  VYSFVGEKKAVESYSKSLN  881
            V +F  + K +  +   L+
Sbjct  886  VAAFNAQDKILSLFCHELH  904



>ref|XP_010939542.1| PREDICTED: LOW QUALITY PROTEIN: ABC transporter B family member 
19-like [Elaeis guineensis]
Length=1253

 Score =   256 bits (654),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 119/242 (49%), Positives = 176/242 (73%), Gaps = 0/242 (0%)
 Frame = +3

Query  174  RKEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLSSDSHRL  353
            +++ ++F+ LF+ AD  D   M  GS+GA +HG+A+PVFF+LFG +++  G   +D  ++
Sbjct  19   QEQSLAFYELFAFADRCDLALMAAGSVGAVVHGSAMPVFFLLFGDLVNGFGKNQADLGKM  78

Query  354  SSQVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKKIEFFDTDT  533
            +++VSK ALY VYLG I+ +S++  +A W  TGERQ   LR RYL++VL++ + FFDTD 
Sbjct  79   TNEVSKYALYFVYLGLIVCLSSYAEIACWMYTGERQAGALRRRYLEAVLKQDVGFFDTDA  138

Query  534  RAKDIIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLAVVPLIA  713
            R  DI+F +S+D +LVQDAI +K+G+ I Y+S FL G  VGF+S W+L L+++AV+P IA
Sbjct  139  RTGDIVFSVSTDTLLVQDAISEKVGNFIHYLSTFLAGLVVGFMSAWRLALLSVAVIPGIA  198

Query  714  VAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYSKSLNNALV  893
             AGG Y   ++ L+ K   +YA AG +AE+AI+QVRTVYSFVGE KA+ SYS+++ + L 
Sbjct  199  FAGGLYAYTLTGLTSKSRESYANAGILAEQAIAQVRTVYSFVGESKALSSYSEAIQSTLK  258

Query  894  LG  899
            LG
Sbjct  259  LG  260


 Score = 80.5 bits (197),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 60/259 (23%), Positives = 125/259 (48%), Gaps = 15/259 (6%)
 Frame = +3

Query  114  GELEISSNLKMDQQ-PSNSTDRKEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVF  290
            G +E+ SN   D++ P+          FF L    +  ++   + G+IG+ + G   P F
Sbjct  653  GRIEMVSNADNDRKYPAPRG------YFFKLLKL-NAPEWQCGILGAIGSVLSGFIGPTF  705

Query  291  FVLFGRMIDSLGHLSSDSHRLSSQVSKQALYLVYLGSIIF--ISAWIGVAFWTQTGERQT  464
             ++   MI+   +   ++    ++        +Y+G+ ++  ++  +   F++  GE  T
Sbjct  706  AIVMSNMIEVFYYRDPNAMERKTR----EYVFIYIGTGLYAVVAYLVQHYFFSIMGENLT  761

Query  465  ARLRLRYLQSVLRKKIEFFDTDTRAKDIIF-HISSDAILVQDAIGDKIGHTIRYISQFLV  641
             R+R   L ++LR ++ +FD +     ++   +++DA  V+ AI ++I   ++ ++  L 
Sbjct  762  TRVRRMMLTAMLRNEVGWFDEEENNSSLVAARLATDAADVKSAIAERISVILQNMTSLLT  821

Query  642  GFAVGFISVWKLTLVTLAVVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVR  821
             F VGFI  W++  + LA  PL+ +A     L +   +     A+A+   +A E +S +R
Sbjct  822  SFIVGFIVEWRVAFLILATFPLLVLANFAQQLSLKGFAGDMAKAHAKTSMIAGEGVSNIR  881

Query  822  TVYSFVGEKKAVESYSKSL  878
            TV +F  + K +  +   L
Sbjct  882  TVAAFNAQDKILSLFHHEL  900



>dbj|BAK05967.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=1266

 Score =   256 bits (654),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 118/241 (49%), Positives = 172/241 (71%), Gaps = 0/241 (0%)
 Frame = +3

Query  177  KEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLSSDSHRLS  356
            ++ V+F  LFS AD +D+  M  GS GA +HGAA+PVFF+LFG +++  G       R++
Sbjct  33   EQSVAFHELFSFADPLDWLLMAAGSAGAVVHGAAMPVFFLLFGELVNGFGKNQHHLRRMT  92

Query  357  SQVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKKIEFFDTDTR  536
             +VSK +LY VYLG ++  S+++ +A W  TGERQ   LR RYL++VLR+ + FFDTD R
Sbjct  93   DEVSKYSLYFVYLGLVVCASSYLEIACWMYTGERQVGALRRRYLEAVLRQDVGFFDTDAR  152

Query  537  AKDIIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLAVVPLIAV  716
              D++F +S+D +LVQDAIG+K+G+ I Y++ FL G  VGF+S W+L L+++AV+P IA 
Sbjct  153  TGDVVFSVSTDTLLVQDAIGEKVGNFIHYLATFLAGLVVGFVSAWRLALLSIAVIPGIAF  212

Query  717  AGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYSKSLNNALVL  896
            AGG Y   ++  + K   +YA AG +AE+AI+QVRTVYS+VGE KA+ SYS+++ + L L
Sbjct  213  AGGLYAYTLTGPTSKSRESYANAGIIAEQAIAQVRTVYSYVGETKALNSYSEAIQSTLKL  272

Query  897  G  899
            G
Sbjct  273  G  273


 Score = 82.8 bits (203),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 62/257 (24%), Positives = 120/257 (47%), Gaps = 11/257 (4%)
 Frame = +3

Query  114  GELEISSNLKMDQQ-PSNSTDRKEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVF  290
            G +E+ SN   D++ P+          FF L    +  ++ + V G+IG+ + G   P F
Sbjct  666  GRIEMVSNADNDRKYPAPKG------YFFKLLKL-NAPEWPYTVLGAIGSIMSGFIGPTF  718

Query  291  FVLFGRMIDSLGHLSSDSHRLSSQVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTAR  470
             ++   MI+       D + +  +  +     +  G    ++  I   F++  GE  T R
Sbjct  719  AIVMSNMIEVF--YFRDPNAMERKTREYVFIYIGTGFYAVVAYLIQHYFFSIMGENLTTR  776

Query  471  LRLRYLQSVLRKKIEFFDTDTRAKDIIF-HISSDAILVQDAIGDKIGHTIRYISQFLVGF  647
            +R   L  +LR  + +FD +     ++   ++++A  V+ AI ++I   ++ ++  LV F
Sbjct  777  VRRMMLAVILRNDVGWFDEEENNSSLVAARLNTEAADVKSAIAERISVILQNMTSLLVSF  836

Query  648  AVGFISVWKLTLVTLAVVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTV  827
             VGFI  W++ ++ L   PL+ +A     L M   +     A+A+   +A E +S +RTV
Sbjct  837  IVGFIIEWRVAILILVTFPLLVLANFAQQLSMKGFAGDTAKAHAKTSMIAGEGVSNIRTV  896

Query  828  YSFVGEKKAVESYSKSL  878
             +F  + K +  +   L
Sbjct  897  AAFNAQDKILSLFCSEL  913



>ref|XP_004977001.1| PREDICTED: ABC transporter B family member 19-like [Setaria italica]
Length=1264

 Score =   256 bits (654),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 123/240 (51%), Positives = 169/240 (70%), Gaps = 0/240 (0%)
 Frame = +3

Query  180  EMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLSSDSHRLSS  359
            + V+F  LFS AD  D   M  GS+GA  HGAA+P+FF+LFG +I+  G   +D   ++ 
Sbjct  32   QAVAFHELFSFADKWDLMLMAAGSLGALAHGAAMPLFFLLFGDLINGFGKNQTDLRTMTD  91

Query  360  QVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKKIEFFDTDTRA  539
            +V+K ALY VYLG ++ +S++  +A W  TGERQ   LR  YL +VLR+ + FFDTD R 
Sbjct  92   EVAKYALYFVYLGLVVCVSSYAEIACWMYTGERQVIALRKAYLDAVLRQDVGFFDTDART  151

Query  540  KDIIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLAVVPLIAVA  719
             DI+F +S+D +LVQDAIG+K+G+ I YI+ FL G  VGF+S W+L L+++AV+P IA A
Sbjct  152  GDIVFGVSTDTLLVQDAIGEKVGNFIHYIATFLAGLVVGFVSAWRLALLSVAVIPAIAFA  211

Query  720  GGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYSKSLNNALVLG  899
            GG Y   ++ L+ K   +YA AG VAE+AI+QVRTVYSFVGE KA+ SYS+++ N L LG
Sbjct  212  GGLYAYTLTGLTSKSRESYANAGVVAEQAIAQVRTVYSFVGESKALNSYSEAIQNTLKLG  271


 Score = 94.4 bits (233),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 67/260 (26%), Positives = 131/260 (50%), Gaps = 17/260 (7%)
 Frame = +3

Query  114  GELEISSNLKMDQQ-PSNSTDRKEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVF  290
            G +E+ SN   D++ P+          +F      +  ++ + V G+IG+ + G   P F
Sbjct  664  GRIEMISNADNDRKYPAPR-------GYFLKLLKLNAPEWPYAVLGAIGSVLSGFIGPTF  716

Query  291  FVLFGRMIDSLGHLSSDSHRLSSQVSKQALYL-VYLGSIIF--ISAWIGVAFWTQTGERQ  461
             ++ G M+D   +   D + +     K  LY+ +Y+G+ I+  ++  +   F++  GE  
Sbjct  717  AIVMGEMLDVFYY--RDPNEMEK---KTKLYVFIYIGTGIYAVVAYLVQHYFFSIMGENL  771

Query  462  TARLRLRYLQSVLRKKIEFFDTDTRAKDIIF-HISSDAILVQDAIGDKIGHTIRYISQFL  638
            T R+R   L ++LR ++ +FD +     ++   ++ DA  V+ AI ++I   ++ ++  +
Sbjct  772  TTRVRRMMLSAILRNEVGWFDEEENNSSLVAARLAVDAADVKSAIAERISVILQNMTSLM  831

Query  639  VGFAVGFISVWKLTLVTLAVVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQV  818
              F VGFI  W++ L+ LA  PL+ +A     + M   +     A+A++  VA E +S +
Sbjct  832  TSFVVGFIIEWRVALLILATFPLLVLANFAQQISMKGFAGDTAKAHAKSSMVAGEGVSNI  891

Query  819  RTVYSFVGEKKAVESYSKSL  878
            RTV +F  + K +  +S  L
Sbjct  892  RTVAAFNAQSKILSLFSHEL  911



>ref|XP_010439807.1| PREDICTED: ABC transporter B family member 14-like isoform X3 
[Camelina sativa]
Length=1157

 Score =   255 bits (651),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 120/172 (70%), Positives = 144/172 (84%), Gaps = 0/172 (0%)
 Frame = +3

Query  372  QALYLVYLGSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKKIEFFDTDTRAKDII  551
             ALYLVYLG +  +SAWIGVA W QTGERQT RLR+ YL+S+L K I FFDT+TR  + I
Sbjct  3    NALYLVYLGLVNLVSAWIGVACWMQTGERQTRRLRISYLKSILAKDITFFDTETRDSNFI  62

Query  552  FHISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLAVVPLIAVAGGTY  731
            FHISSDAILVQDAIGDK GH +RY+ QF+ GF +GF+SVW+LTL+TL VVPLIAVA G Y
Sbjct  63   FHISSDAILVQDAIGDKTGHVLRYLCQFIAGFVIGFLSVWQLTLLTLGVVPLIAVAVGGY  122

Query  732  TLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYSKSLNNA  887
             ++MS +S+K EAAYA+AGK+AEE +SQVRTVY+FVGE+KAV+SYSKSL  A
Sbjct  123  AIVMSTISEKSEAAYADAGKIAEEVMSQVRTVYAFVGEEKAVKSYSKSLKEA  174


 Score = 88.2 bits (217),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 68/233 (29%), Positives = 109/233 (47%), Gaps = 7/233 (3%)
 Frame = +3

Query  216  DTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLSSDSHRLSSQVSKQALYLVYL  395
            +  ++ + + GS+GA + G+  P  F + G     +   S     +  QV K  +  V  
Sbjct  586  NAPEWLYALLGSVGAVLAGSQ-PALFSM-GVAYVLITFYSPSPSLIKRQVEKVIVIFVGA  643

Query  396  GSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKKIEFFDTDTRAKDIIFHI-SSDA  572
            G I      +   F+T  GER T+R+RL    ++L  +I +FD +      +  I S+DA
Sbjct  644  GVITTPIYLLQHYFYTLMGERLTSRVRLSLFSAILSNEIGWFDLEENNTGSLTSILSADA  703

Query  573  ILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLAVVPLIAVAGGTYTLIMSNL  752
             LV+ AI D++   ++ IS  +    + F   W++  V  A  PLI  A  T  L +   
Sbjct  704  TLVRSAIADRLSTIVQNISLTVTSLGLAFFYCWRVAAVVTACFPLIITASLTEQLFLKGF  763

Query  753  SQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESY----SKSLNNALVLG  899
                  AY+ A  +A EAI  +RTV +F  EK+  E +    +K   NAL+ G
Sbjct  764  GGDYTRAYSRATSLAREAIVNIRTVAAFGAEKQISEQFTSELTKPTKNALLKG  816



>ref|XP_008804465.1| PREDICTED: ABC transporter B family member 19-like isoform X1 
[Phoenix dactylifera]
Length=1275

 Score =   256 bits (653),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 121/242 (50%), Positives = 173/242 (71%), Gaps = 0/242 (0%)
 Frame = +3

Query  174  RKEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLSSDSHRL  353
            +++ ++F+ LF  AD  D   M  GS+GA +HG+A+PVFF+LFG +++  G    D  ++
Sbjct  41   QEKSLAFYELFVFADRCDLALMAAGSLGAVVHGSAMPVFFLLFGDLVNGFGKNQEDLGKM  100

Query  354  SSQVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKKIEFFDTDT  533
            +++VSK ALY VYLG I+ +S++  +A W  TGERQ   LR RYL++VL++ + FFDTD 
Sbjct  101  TNEVSKYALYFVYLGVIVCLSSYAEIACWMYTGERQAGALRRRYLEAVLKQDVGFFDTDA  160

Query  534  RAKDIIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLAVVPLIA  713
            R  DI+F +S+D + VQDAI +K G+ I Y+S FL G  VGFIS W+L L+++AV+P IA
Sbjct  161  RTGDIVFSVSTDTLSVQDAISEKFGNFIHYLSTFLAGLVVGFISAWRLALLSVAVIPGIA  220

Query  714  VAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYSKSLNNALV  893
             AGG Y   ++ L+ K   +YA AG VAE+AI+QVRTVYSFVGE KA++SYS+++ N L 
Sbjct  221  FAGGLYAYTLTGLTSKSRESYANAGIVAEQAIAQVRTVYSFVGESKALDSYSEAIQNTLK  280

Query  894  LG  899
            LG
Sbjct  281  LG  282


 Score = 90.9 bits (224),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 61/246 (25%), Positives = 117/246 (48%), Gaps = 7/246 (3%)
 Frame = +3

Query  156  PSNSTDRKEMVS---FFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLG  326
            P+   DRK  V    FF L    +  ++ + + G+IG+ + G   P F ++   MI+   
Sbjct  681  PNADNDRKYPVPRGYFFKLLKL-NAPEWPYSILGAIGSVLSGFIGPTFAIVMSNMIEVFY  739

Query  327  HLSSDSHRLSSQVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVLRK  506
            +   D + +  +  +     V  G    +S  +   F++  GE  T R+R   L ++LR 
Sbjct  740  Y--RDPNAMERKTRQYVFMYVGTGLYAVVSYLVQHYFFSIMGENLTTRVRRMMLAAILRN  797

Query  507  KIEFFDTDTRAKDIIF-HISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTL  683
            ++ +FD +     ++  H+++DA  V+  I ++I   ++ ++  L  F VGFI  W++ L
Sbjct  798  ELGWFDEEENNSSLVAAHLATDAADVKSVIAERISVILQNMTSLLTSFIVGFIVEWRVAL  857

Query  684  VTLAVVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVES  863
            + +A  PL+ +A     L +   +     A+A    +A E +S +RTV +F  + K +  
Sbjct  858  LIIATFPLLVLANFAQQLSLKGFAGDMAKAHARTSMIAGEGVSNIRTVAAFNAQDKILSL  917

Query  864  YSKSLN  881
            +   L 
Sbjct  918  FHHELE  923



>ref|XP_002973102.1| ATP-binding cassette transporter [Selaginella moellendorffii]
 gb|EFJ25476.1| ATP-binding cassette transporter [Selaginella moellendorffii]
Length=1214

 Score =   255 bits (651),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 124/226 (55%), Positives = 168/226 (74%), Gaps = 0/226 (0%)
 Frame = +3

Query  222  VDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLSSDSHRLSSQVSKQALYLVYLGS  401
            +D+  +  G+IGAC HGAA+PVFF+ FG++ID  G    +  +L   VSK ALY VYLG 
Sbjct  1    MDWGLIFVGAIGACAHGAAIPVFFIFFGKLIDEFGANYDNPTKLGHGVSKYALYFVYLGL  60

Query  402  IIFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKKIEFFDTDTRAKDIIFHISSDAILV  581
             I ++AW+ VA WT TGERQ+AR+R+ YL+++L + + FFDTDT   +I+  ISSD  LV
Sbjct  61   AILVAAWLEVACWTYTGERQSARMRVAYLKAMLSQDVGFFDTDTTTGEIVNGISSDTALV  120

Query  582  QDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLAVVPLIAVAGGTYTLIMSNLSQK  761
            Q+AIG K G+ + Y+++F+ GFAVGF SVW+LTLVTLAVVP IA+AGG Y   M  L+ K
Sbjct  121  QEAIGAKAGNYLHYMARFVAGFAVGFSSVWQLTLVTLAVVPGIALAGGLYAHTMIGLTTK  180

Query  762  GEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYSKSLNNALVLG  899
             + AYA+AG VAE++ISQVRTVYSFV E++AV+SY+++L   L +G
Sbjct  181  NQKAYAKAGNVAEQSISQVRTVYSFVQEEQAVDSYARALETTLEIG  226


 Score = 84.3 bits (207),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 67/239 (28%), Positives = 117/239 (49%), Gaps = 18/239 (8%)
 Frame = +3

Query  189  SFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLSSDSHRLSSQVS  368
            S+F L    +  ++ F + G++GA + GA  P F   +G     +   S D      +V 
Sbjct  626  SYFRLLKL-NAPEWPFALAGALGAILAGAETPFF--AYGITQALVTFYSPDQSHQKREVE  682

Query  369  KQALYLVYLGSIIFISAWIGVA-------FWTQTGERQTARLRLRYLQSVLRKKIEFFD-  524
            K       + +I  I+  + V        F+   GER T R+R     ++LR +I +FD 
Sbjct  683  K-------ISTIFAIATVVTVGIYVLEHYFFGVMGERLTMRVRKMMFSNILRNEIGWFDR  735

Query  525  TDTRAKDIIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLAVVP  704
             +  +  +   +SSDA +++ A+GD++    + ++  + GF + F+  WKLTLV +A+ P
Sbjct  736  EENNSSLLASRLSSDATMLRAAVGDRLCTLTQNLALIVTGFVMAFVLQWKLTLVIIALFP  795

Query  705  LIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYSKSLN  881
            L+  A  T  L +         AY  A  VA EA+  +RTV +F  EK+ ++ +++ L 
Sbjct  796  LMIGAHITEHLFLKGFGVNLSKAYHRATMVAGEAVGNIRTVAAFCAEKRVMDLFNRELQ  854



>ref|XP_003579896.1| PREDICTED: ABC transporter B family member 19-like [Brachypodium 
distachyon]
Length=1263

 Score =   254 bits (650),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 117/241 (49%), Positives = 172/241 (71%), Gaps = 0/241 (0%)
 Frame = +3

Query  177  KEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLSSDSHRLS  356
            ++ V+F  LF  AD +D+  M  G+ GA +HGAA+PVFF+LFG +++  G       R++
Sbjct  30   EQSVAFHELFIFADPLDWLLMAAGTAGAVVHGAAMPVFFLLFGELVNGFGKNQHHLRRMT  89

Query  357  SQVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKKIEFFDTDTR  536
             +VSK +LY VYLG ++  S+++ +A W  TGERQ   LR RYL++VLR+ + FFDTD R
Sbjct  90   DEVSKYSLYFVYLGLVVCASSYLEIACWMYTGERQVGALRRRYLEAVLRQDVGFFDTDAR  149

Query  537  AKDIIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLAVVPLIAV  716
              D++F +S+D +LVQDAIG+K+G+ I Y++ FL G  VGF+S W+L L+++AV+P IA 
Sbjct  150  TGDVVFSVSTDTLLVQDAIGEKVGNFIHYLATFLAGLVVGFVSAWRLALLSIAVIPGIAF  209

Query  717  AGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYSKSLNNALVL  896
            AGG Y   ++ L+ K   +YA AG +AE+AI+QVRTVYS+VGE KA+ SYS+++ + L L
Sbjct  210  AGGLYAYTLTGLTSKSRDSYANAGIIAEQAIAQVRTVYSYVGESKALNSYSEAIQSTLKL  269

Query  897  G  899
            G
Sbjct  270  G  270


 Score = 83.6 bits (205),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 60/259 (23%), Positives = 125/259 (48%), Gaps = 15/259 (6%)
 Frame = +3

Query  114  GELEISSNLKMDQQ-PSNSTDRKEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVF  290
            G +E+ SN   D++ P+          FF L    +  ++ + V G+IG+ + G   P F
Sbjct  663  GRIEMVSNADNDRKYPAPKG------YFFKLLKL-NAPEWPYTVLGAIGSIMSGFIGPTF  715

Query  291  FVLFGRMIDSLGHLSSDSHRLSSQVSKQALYLVYLGSIIF--ISAWIGVAFWTQTGERQT  464
             ++   MI+   +   ++    ++        +Y+G+ ++  ++  +   F++  GE  T
Sbjct  716  AIVMSNMIEVFYYRDPNAMERKTR----EYVFIYIGTGLYAVVAYLVQHYFFSIMGENLT  771

Query  465  ARLRLRYLQSVLRKKIEFFDTDTRAKDIIF-HISSDAILVQDAIGDKIGHTIRYISQFLV  641
             R+R   L  +LR  + +FD +     ++   ++++A  V+ AI ++I   ++ ++  +V
Sbjct  772  TRVRRMMLAVILRNDVGWFDEEENNSSLVAARLATEAADVKSAIAERISVILQNMTSLMV  831

Query  642  GFAVGFISVWKLTLVTLAVVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVR  821
             F VGFI  W++ ++ L   PL+ +A     L M   +     A+A+   +A E +S +R
Sbjct  832  SFVVGFIIEWRVAILILVTFPLLVLANFAQQLSMKGFAGDTAKAHAKTSMIAGEGVSNIR  891

Query  822  TVYSFVGEKKAVESYSKSL  878
            TV +F  + K +  +   L
Sbjct  892  TVAAFNAQDKILSLFCSEL  910



>ref|XP_002448624.1| hypothetical protein SORBIDRAFT_06g030350 [Sorghum bicolor]
 gb|EES12952.1| hypothetical protein SORBIDRAFT_06g030350 [Sorghum bicolor]
Length=1266

 Score =   254 bits (649),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 122/240 (51%), Positives = 168/240 (70%), Gaps = 0/240 (0%)
 Frame = +3

Query  180  EMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLSSDSHRLSS  359
            + V+F  LFS AD  D   M  GS+GA  HGAA+P FF+LFG +I+  G   +D   ++ 
Sbjct  34   QAVAFHELFSFADKWDLMLMAAGSLGALAHGAAMPFFFLLFGDLINGFGKNQTDLRTMTD  93

Query  360  QVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKKIEFFDTDTRA  539
            +V+K ALY VYLG ++ +S++  +A W  TGERQ   LR  YL +VLR+ + FFDTD R 
Sbjct  94   EVAKYALYFVYLGLVVCVSSYAEIACWMYTGERQVIALRKAYLDAVLRQDVGFFDTDART  153

Query  540  KDIIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLAVVPLIAVA  719
             DI+F +S+D +LVQDAIG+K+G+ + YI+ FL G  VGF+S W+L L+++AV+P IA A
Sbjct  154  GDIVFGVSTDTLLVQDAIGEKVGNFMHYIATFLAGLVVGFVSAWRLALLSVAVIPAIAFA  213

Query  720  GGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYSKSLNNALVLG  899
            GG Y   ++ L+ K   +YA AG VAE+AI+QVRTVYSFVGE KA+ SYS+++ N L LG
Sbjct  214  GGLYAYTLTGLTSKSRESYANAGVVAEQAIAQVRTVYSFVGESKALNSYSEAIQNTLKLG  273


 Score = 94.7 bits (234),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 69/260 (27%), Positives = 132/260 (51%), Gaps = 17/260 (7%)
 Frame = +3

Query  114  GELEISSNLKMDQQ-PSNSTDRKEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVF  290
            G +E+ SN   D++ P+          FF L    +  ++ + V G+IG+ + G   P F
Sbjct  666  GRIEMISNADNDRKYPAPRG------YFFKLLKL-NAPEWPYAVLGAIGSVLSGFIGPTF  718

Query  291  FVLFGRMIDSLGHLSSDSHRLSSQVSKQALYL-VYLGSIIF--ISAWIGVAFWTQTGERQ  461
             ++ G M+D   +   D + +     K  LY+ +Y+G+ I+  ++  +   F++  GE  
Sbjct  719  AIVMGEMLDVFYY--RDPNEMEK---KTKLYVFIYIGTGIYAVVAYLVQHYFFSIMGENL  773

Query  462  TARLRLRYLQSVLRKKIEFFDTDTRAKDIIF-HISSDAILVQDAIGDKIGHTIRYISQFL  638
            T R+R   L ++LR ++ +FD +     ++   ++ DA  V+ AI ++I   ++ ++  +
Sbjct  774  TTRVRRMMLSAILRNEVGWFDEEENNSSLVAARLAVDAADVKSAIAERISVILQNMTSLM  833

Query  639  VGFAVGFISVWKLTLVTLAVVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQV  818
              F VGFI  W++ ++ LA  PL+ +A     L M   +     A+A++  VA E +S +
Sbjct  834  TSFVVGFIIEWRVAILILATFPLLVLANFAQQLSMKGFAGDTAKAHAKSSMVAGEGVSNI  893

Query  819  RTVYSFVGEKKAVESYSKSL  878
            RTV +F  + K +  +S  L
Sbjct  894  RTVAAFNAQSKILSLFSHEL  913



>emb|CAC09461.2| H0423H10.7 [Oryza sativa Indica Group]
 gb|EAY95758.1| hypothetical protein OsI_17633 [Oryza sativa Indica Group]
Length=1269

 Score =   254 bits (648),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 126/265 (48%), Positives = 180/265 (68%), Gaps = 3/265 (1%)
 Frame = +3

Query  114  GELEISSNLKMDQQPSNSTDRK---EMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALP  284
            G++E ++N  ++   +    +K   + V+F  LF+ AD  D   M  GS+GA  HGAA+P
Sbjct  13   GKVEKAANGGVNGCDAAGEGKKRADQAVAFHELFTFADKWDLVLMAAGSLGALAHGAAMP  72

Query  285  VFFVLFGRMIDSLGHLSSDSHRLSSQVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQT  464
            +FF+LFG +I+  G   +D   ++ +VSK ALY VYLG ++  S++  +A W  TGERQ 
Sbjct  73   LFFLLFGDLINGFGKNQTDLRTMTDEVSKYALYFVYLGLVVCASSYAEIACWMYTGERQV  132

Query  465  ARLRLRYLQSVLRKKIEFFDTDTRAKDIIFHISSDAILVQDAIGDKIGHTIRYISQFLVG  644
              LR  YL +VLR+ + FFDTD R  DI+F +S+D +LVQDAIG+K+G+ I YI+ FL G
Sbjct  133  IALRKAYLDAVLRQDVGFFDTDARTGDIVFGVSTDTLLVQDAIGEKVGNFIHYIATFLAG  192

Query  645  FAVGFISVWKLTLVTLAVVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRT  824
              VGF++ W+L L+++AV+P IA AGG Y   ++ L+ K   +YA AG VAE+AI+QVRT
Sbjct  193  LVVGFVAAWRLALLSVAVIPAIAFAGGLYAYTLTGLTSKSRESYANAGVVAEQAIAQVRT  252

Query  825  VYSFVGEKKAVESYSKSLNNALVLG  899
            VYSFVGE KA+ SYS+++ N L LG
Sbjct  253  VYSFVGESKALNSYSEAIQNTLKLG  277


 Score = 90.1 bits (222),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 67/260 (26%), Positives = 131/260 (50%), Gaps = 17/260 (7%)
 Frame = +3

Query  114  GELEISSNLKMDQQ-PSNSTDRKEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVF  290
            G +E+ SN   D++ P+          FF L    +  ++ + V G++G+ + G   P F
Sbjct  670  GRIEMISNADNDRKYPAPRG------YFFKLLKL-NAPEWPYAVLGAVGSVLSGFIGPTF  722

Query  291  FVLFGRMIDSLGHLSSDSHRLSSQVSKQALYL-VYLGSIIF--ISAWIGVAFWTQTGERQ  461
             ++ G M+D   +   D + +     K  LY+ +Y+G+ ++  ++  +   F++  GE  
Sbjct  723  AIVMGEMLDVFYY--RDPNEMEK---KTKLYVFIYIGTGLYAVVAYLVQHYFFSIMGENL  777

Query  462  TARLRLRYLQSVLRKKIEFFDTDTRAKDIIF-HISSDAILVQDAIGDKIGHTIRYISQFL  638
            T R+R   L ++L  ++ +FD +     ++   ++ DA  V+ AI ++I   ++ ++  +
Sbjct  778  TTRVRRMMLSAILTNEVGWFDEEENNSSLVAARLAVDAADVKSAIAERISVILQNMTSLM  837

Query  639  VGFAVGFISVWKLTLVTLAVVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQV  818
              F VGFI  W++ L+ LA  PL+ +A     L M   +     A+A++  VA E +S +
Sbjct  838  TSFIVGFIIEWRVALLILATFPLLVLANFAQQLSMKGFAGDTAKAHAKSSMVAGEGVSNI  897

Query  819  RTVYSFVGEKKAVESYSKSL  878
            RTV +F  + K +  +S  L
Sbjct  898  RTVAAFNAQNKILSLFSYEL  917



>emb|CAD59581.1| MDR-like ABC transporter [Oryza sativa Japonica Group]
Length=1256

 Score =   253 bits (646),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 119/240 (50%), Positives = 168/240 (70%), Gaps = 3/240 (1%)
 Frame = +3

Query  180  EMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLSSDSHRLSS  359
            + V+F  LF  AD +D+  M  GS GA +HGAA+PVFF+LFG +I+  G    + H L  
Sbjct  27   QSVAFHELFGFADPLDWLLMAAGSAGAVVHGAAMPVFFLLFGELINGFG---KNQHSLRR  83

Query  360  QVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKKIEFFDTDTRA  539
               + +LY VYLG ++  S+++ +A W  TGERQ   LR RYL++VLR+ + FFDTD R 
Sbjct  84   MTDEYSLYFVYLGLVVCASSYLEIACWMYTGERQVGALRRRYLEAVLRQDVGFFDTDART  143

Query  540  KDIIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLAVVPLIAVA  719
             D++F +S+D +LVQDAIG+K+G+ I Y+S FL G  VGF+S W+L L+++AV+P IA A
Sbjct  144  GDVVFSVSTDTLLVQDAIGEKVGNFIHYLSTFLAGLVVGFVSAWRLALLSIAVIPGIAFA  203

Query  720  GGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYSKSLNNALVLG  899
            GG Y   ++ L+ K   +YA AG +AE+AI+QVRTVYS+VGE KA+ SYS+++ N L LG
Sbjct  204  GGLYAYTLTGLTSKSRDSYANAGIIAEQAIAQVRTVYSYVGESKALNSYSEAIQNTLKLG  263


 Score = 87.0 bits (214),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 62/257 (24%), Positives = 121/257 (47%), Gaps = 11/257 (4%)
 Frame = +3

Query  114  GELEISSNLKMDQQ-PSNSTDRKEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVF  290
            G +E+ SN   D++ P+          FF L    +  ++ + + G+IG+ + G   P F
Sbjct  656  GRIEMVSNADNDRKYPAPKG------YFFKLLKL-NAPEWPYTILGAIGSILSGFIGPTF  708

Query  291  FVLFGRMIDSLGHLSSDSHRLSSQVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTAR  470
             ++   MI+       D + +  +  +     +  G    ++  +   F++  GE  T R
Sbjct  709  AIVMSNMIEVF--YFRDPNAMERKTREYVFIYIGTGLYAVVAYLVQHYFFSIMGENLTTR  766

Query  471  LRLRYLQSVLRKKIEFFDTDTRAKDIIF-HISSDAILVQDAIGDKIGHTIRYISQFLVGF  647
            +R   L ++LR  + +FD +     ++   +S+DA  V+ AI ++I   ++ ++  LV F
Sbjct  767  VRRMMLAAILRNDVGWFDQEENNSSLVAARLSTDAADVKSAIAERISVILQNMTSLLVSF  826

Query  648  AVGFISVWKLTLVTLAVVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTV  827
             VGFI  W++ ++ L   PL+ +A     L M   +     A+A+   +A E +S +RTV
Sbjct  827  VVGFIIEWRVAVLILVTFPLLVLANFAQQLSMKGFAGDTAKAHAKTSMIAGEGVSNIRTV  886

Query  828  YSFVGEKKAVESYSKSL  878
             +F  + K +  +   L
Sbjct  887  AAFNAQDKVLSLFCTEL  903



>ref|XP_009415585.1| PREDICTED: ABC transporter B family member 19 [Musa acuminata 
subsp. malaccensis]
Length=1255

 Score =   253 bits (646),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 121/247 (49%), Positives = 172/247 (70%), Gaps = 0/247 (0%)
 Frame = +3

Query  159  SNSTDRKEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLSS  338
            S    +++  +F  LFS AD  D   M  GS+GA +HG+A+PVFF+LFG +++  G    
Sbjct  16   SEKKRQEQSAAFHELFSFADRWDCLLMAAGSVGAVVHGSAMPVFFLLFGDLVNGFGKNQH  75

Query  339  DSHRLSSQVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKKIEF  518
                ++ +VSK ALY VYLG ++ +S++  +A W  TGERQ + LR +YL++VLR+ + F
Sbjct  76   HLMVMTHEVSKYALYFVYLGLVVCLSSYAEIACWMYTGERQASALRRKYLEAVLRQDVGF  135

Query  519  FDTDTRAKDIIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLAV  698
            FDTD R  DI+F +S+D +LVQDAI +K+G+ I Y+S FL G  VGF+S W+L L+++AV
Sbjct  136  FDTDARTGDIVFSVSTDTLLVQDAISEKVGNFIHYLSTFLAGLVVGFVSAWRLALLSVAV  195

Query  699  VPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYSKSL  878
            +P IA AGG Y   ++ L+ K   +YA AG VAE+AI+QVRTVYSFVGE KA+ SYS+++
Sbjct  196  IPGIAFAGGLYAYTLTGLTSKSRESYANAGIVAEQAIAQVRTVYSFVGESKALNSYSEAI  255

Query  879  NNALVLG  899
             N L LG
Sbjct  256  QNTLKLG  262


 Score = 85.9 bits (211),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 56/232 (24%), Positives = 116/232 (50%), Gaps = 8/232 (3%)
 Frame = +3

Query  192  FFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLSSDSHRLSSQVSK  371
            FF L    +  ++ + + G+IG+ + G   P F ++   MI+   +   ++    ++   
Sbjct  676  FFKLLKL-NAPEWPYTIMGAIGSVLSGFIGPTFAIVMSNMIEVFYYRDPNAMERKTR---  731

Query  372  QALYLVYLGSIIF--ISAWIGVAFWTQTGERQTARLRLRYLQSVLRKKIEFFDTDTRAKD  545
                 VY+G+ ++  ++  +   F++  GE  T R+R   L ++LR ++ +FD +     
Sbjct  732  -EYVFVYIGTGLYAVVAYLVQHYFFSIMGENLTTRVRRMMLSAILRNEVGWFDEEENNSS  790

Query  546  IIF-HISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLAVVPLIAVAG  722
            ++   +++DA  V+ AI ++I   ++ ++  L  F VGFI  W++ L+ LA  PL+ +A 
Sbjct  791  LVAARLANDAADVKSAIAERISVILQNMTSLLTSFIVGFIVEWRVALLILATFPLLVLAN  850

Query  723  GTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYSKSL  878
                L +   +     A+A+   +A E +S +RTV +F  + K +  +   L
Sbjct  851  FAQQLSLKGFAGDTAKAHAKTSMIAGEGVSNIRTVAAFNAQSKILSLFCSEL  902



>ref|XP_009395922.1| PREDICTED: ABC transporter B family member 19-like [Musa acuminata 
subsp. malaccensis]
Length=1256

 Score =   253 bits (645),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 120/242 (50%), Positives = 170/242 (70%), Gaps = 0/242 (0%)
 Frame = +3

Query  174  RKEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLSSDSHRL  353
            +++  +F  LFS AD  D   M  GS+GA +HG+A+PVFF+LFG +++  G   +    +
Sbjct  22   QEQSAAFHELFSFADRWDCLLMAAGSVGAVVHGSAMPVFFLLFGDLVNGFGKNQTHLSVM  81

Query  354  SSQVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKKIEFFDTDT  533
            + +VSK ALY VYLG ++ +S++  +  W  TGERQ + LR RYL++VLR+ + FFDTD 
Sbjct  82   THEVSKYALYFVYLGLVVCLSSYAEIGCWMYTGERQASALRRRYLEAVLRQDVGFFDTDA  141

Query  534  RAKDIIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLAVVPLIA  713
            R  DI+F +S+D +LVQDAI +K+G+ I Y+S FL G  VGFIS W+L L+++AV+P IA
Sbjct  142  RTGDIVFSVSTDTLLVQDAISEKVGNFIHYLSTFLAGLVVGFISAWRLALLSVAVIPGIA  201

Query  714  VAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYSKSLNNALV  893
             AGG Y   ++ L+ K   +YA AG VAE+ I+QVRTVYSFVGE KA+ SYS+++ N L 
Sbjct  202  FAGGLYAYTLTGLTSKSRESYANAGIVAEQTIAQVRTVYSFVGENKALNSYSEAIQNTLK  261

Query  894  LG  899
            LG
Sbjct  262  LG  263


 Score = 84.7 bits (208),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 54/232 (23%), Positives = 116/232 (50%), Gaps = 8/232 (3%)
 Frame = +3

Query  192  FFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLSSDSHRLSSQVSK  371
            FF L    +  ++ + + G+IG+ + G   P F ++   MI+   +   ++    ++   
Sbjct  677  FFKLLKL-NAPEWPYTIMGAIGSVLSGFIGPTFAIVMSNMIEVFYYRDPNAMERKTR---  732

Query  372  QALYLVYLGSIIF--ISAWIGVAFWTQTGERQTARLRLRYLQSVLRKKIEFFDTDTRAKD  545
                 +Y+G+ ++  ++  +   F++  GE  T R+R   L ++LR ++ +FD +     
Sbjct  733  -EYVFIYIGTGLYAVVAYLVQHYFFSIMGENLTTRVRRMMLAAILRNEVGWFDEEENNSS  791

Query  546  IIF-HISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLAVVPLIAVAG  722
            ++   +++DA  V+ AI ++I   ++ ++  L  F VGF+  W++ L+ LA  PL+ +A 
Sbjct  792  LVAARLANDAADVKSAIAERISVILQNMTSLLTSFIVGFVVEWRVALLILATFPLLVLAN  851

Query  723  GTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYSKSL  878
                L +   +     A+A+   +A E +S +RTV +F  + K +  +   L
Sbjct  852  FAQQLSLKGFAGDTAKAHAKTSMIAGEGVSNIRTVAAFNAQAKILSLFCNEL  903



>dbj|BAJ53110.1| JHL20J20.17 [Jatropha curcas]
Length=1135

 Score =   251 bits (642),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 120/154 (78%), Positives = 137/154 (89%), Gaps = 0/154 (0%)
 Frame = +3

Query  429  VAFWTQTGERQTARLRLRYLQSVLRKKIEFFDTDTRAKDIIFHISSDAILVQDAIGDKIG  608
            VAFW QTGERQT+RLRL+YLQSVL+K + FFDT+    +IIFHISSDAILVQDAIGDK G
Sbjct  1    VAFWMQTGERQTSRLRLKYLQSVLKKDMNFFDTEAGDSNIIFHISSDAILVQDAIGDKTG  60

Query  609  HTIRYISQFLVGFAVGFISVWKLTLVTLAVVPLIAVAGGTYTLIMSNLSQKGEAAYAEAG  788
            H IRY+SQF+VGFAVGF SVW+LTL+TLAVVPLIAVAGG YT+IMS LS+KGEAAYAEAG
Sbjct  61   HAIRYLSQFVVGFAVGFASVWQLTLLTLAVVPLIAVAGGAYTIIMSTLSEKGEAAYAEAG  120

Query  789  KVAEEAISQVRTVYSFVGEKKAVESYSKSLNNAL  890
            KVA+E ISQ+RTVYSFVGE KA+E+YS+ L  AL
Sbjct  121  KVADEVISQIRTVYSFVGEDKAIETYSRYLKKAL  154


 Score = 84.0 bits (206),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 64/261 (25%), Positives = 125/261 (48%), Gaps = 14/261 (5%)
 Frame = +3

Query  132  SNLKMDQQPSNSTDRKEMVS-FFGLFSAADTV---------DYFFMVFGSIGACIHGAAL  281
            S+ + +QQ   S  ++E  S    ++SA  T+         ++ + + GS+GA + G   
Sbjct  523  SHGQNNQQDFKSISKREGQSDHESMYSATPTIGELVKLNAPEWPYALLGSVGAILGGMEA  582

Query  282  PVFFVLFGRMIDSLGHLSSDSHRLSSQVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQ  461
            P+F +L   ++ +    S D   +  ++ + A   V L  +      +   F+T  GER 
Sbjct  583  PLFALLISHVLTAF--YSPDVSEMKHEIRRVAFIFVGLAVVTIPIYLLQHYFYTLMGERL  640

Query  462  TARLRLRYLQSVLRKKIEFFDTD-TRAKDIIFHISSDAILVQDAIGDKIGHTIRYISQFL  638
            TAR+RL    ++L  +I +FD D      +   +++DA LV+ A+ D++   ++ ++   
Sbjct  641  TARVRLSMFTAILSNEIGWFDLDENNTGSLTSTLAADATLVRSALADRLSTIVQNVALTA  700

Query  639  VGFAVGFISVWKLTLVTLAVVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQV  818
                + F   W++  V +A  PL+  A     L +       + AY++A  +A EA++ +
Sbjct  701  TACVIAFTLSWRIAAVVVASFPLLIGASIAELLFLKGFGGDYQ-AYSKATSLAREALTNI  759

Query  819  RTVYSFVGEKKAVESYSKSLN  881
            RTV +F  E++    ++  LN
Sbjct  760  RTVAAFGAEERISFEFASQLN  780



>ref|XP_008663648.1| PREDICTED: ABC transporter B family member 19-like [Zea mays]
 gb|AFW59637.1| hypothetical protein ZEAMMB73_350646 [Zea mays]
Length=1266

 Score =   252 bits (644),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 121/240 (50%), Positives = 167/240 (70%), Gaps = 0/240 (0%)
 Frame = +3

Query  180  EMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLSSDSHRLSS  359
            + V+F  LFS AD  D   M  GS+GA  HGAA+P FF+LFG +I+  G   +D   ++ 
Sbjct  34   QAVAFHELFSFADKWDLMLMAAGSLGALAHGAAMPFFFLLFGDLINGFGKNQTDLRTMTD  93

Query  360  QVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKKIEFFDTDTRA  539
            +V+K ALY VYLG ++ +S++  +A W  TGERQ   LR  YL +VLR+ + FFDTD R 
Sbjct  94   EVAKYALYFVYLGLVVCVSSYAEIACWMYTGERQVIALRKAYLDAVLRQDVGFFDTDART  153

Query  540  KDIIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLAVVPLIAVA  719
             DI+F +S+D +LVQDAIG+K+G+ + YI+ FL G  VGF+S W+L L+++AV+P IA A
Sbjct  154  GDIVFGVSTDTLLVQDAIGEKVGNFMHYIATFLAGLVVGFVSAWRLALLSVAVIPAIAFA  213

Query  720  GGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYSKSLNNALVLG  899
            GG Y   ++ L+ K   +Y  AG VAE+AI+QVRTVYSFVGE KA+ SYS+++ N L LG
Sbjct  214  GGLYAYTLTGLTSKSRESYTNAGVVAEQAIAQVRTVYSFVGESKALNSYSEAIQNTLKLG  273


 Score = 97.8 bits (242),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 70/260 (27%), Positives = 133/260 (51%), Gaps = 17/260 (7%)
 Frame = +3

Query  114  GELEISSNLKMDQQ-PSNSTDRKEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVF  290
            G +E+ SN   D++ P+          FF L    +  ++ + V G+IG+ + G   P F
Sbjct  666  GRIEMISNADNDRKYPAPRG------YFFKLLKL-NAPEWPYAVLGAIGSVLSGFIGPTF  718

Query  291  FVLFGRMIDSLGHLSSDSHRLSSQVSKQALYL-VYLGSIIF--ISAWIGVAFWTQTGERQ  461
             ++ G M+D   +   D + +     K  LY+ +Y+G+ I+  ++  +   F++  GE  
Sbjct  719  AIVMGEMLDVFYY--RDPNEMEK---KTKLYVFIYIGTGIYAVVAYLVQHYFFSIMGENL  773

Query  462  TARLRLRYLQSVLRKKIEFFDTDTRAKDIIF-HISSDAILVQDAIGDKIGHTIRYISQFL  638
            T R+R   L ++LR ++ +FD +     ++  H++ DA  V+ AI ++I   ++ ++  +
Sbjct  774  TTRVRRMMLSAILRNEVGWFDEEENNSSLVAAHLAVDAADVKSAIAERISVILQNMTSLM  833

Query  639  VGFAVGFISVWKLTLVTLAVVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQV  818
              F VGFI  W++ ++ LA  PL+ +A     L M   +     A+A++  VA E +S +
Sbjct  834  TSFVVGFIIEWRVAILILATFPLLVLANFAQQLSMKGFAGDTAKAHAKSSMVAGEGVSNI  893

Query  819  RTVYSFVGEKKAVESYSKSL  878
            RTV +F  + K +  +S  L
Sbjct  894  RTVAAFNAQSKILSLFSHEL  913



>emb|CAD59582.1| MDR-like ABC transporter [Oryza sativa Japonica Group]
 emb|CAD41854.2| OSJNBb0079B02.13 [Oryza sativa Japonica Group]
 emb|CAE05967.2| OSJNBa0063C18.8 [Oryza sativa Japonica Group]
Length=1268

 Score =   252 bits (644),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 125/265 (47%), Positives = 179/265 (68%), Gaps = 3/265 (1%)
 Frame = +3

Query  114  GELEISSNLKMDQQPSNSTDRK---EMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALP  284
            G++E ++N  ++   +    +K   + V+F  LF+ AD  D   M  GS+GA  HGAA+P
Sbjct  12   GKVEKAANGGVNGCDAAGEGKKRADQAVAFHELFTFADKWDLVLMAAGSLGALAHGAAMP  71

Query  285  VFFVLFGRMIDSLGHLSSDSHRLSSQVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQT  464
            +FF+LFG +I+  G   +D   ++ +VSK ALY VYLG ++  S++  +A W  TGERQ 
Sbjct  72   LFFLLFGDLINGFGKNQTDLRTMTDEVSKYALYFVYLGLVVCASSYAEIACWMYTGERQV  131

Query  465  ARLRLRYLQSVLRKKIEFFDTDTRAKDIIFHISSDAILVQDAIGDKIGHTIRYISQFLVG  644
              LR  YL +VLR+ + FFDTD R  DI+F +S+D +LVQDAIG+K+G+ I YI+ FL G
Sbjct  132  IALRKAYLDAVLRQDVGFFDTDARTGDIVFGVSTDTLLVQDAIGEKVGNFIHYIATFLAG  191

Query  645  FAVGFISVWKLTLVTLAVVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRT  824
              VGF++ W+L L+++AV+P IA AGG Y   ++ L+ K   +YA AG VAE+AI+QVRT
Sbjct  192  LVVGFVAAWRLALLSVAVIPAIAFAGGLYAYTLTGLTSKSRESYANAGVVAEQAIAQVRT  251

Query  825  VYSFVGEKKAVESYSKSLNNALVLG  899
            VYSF GE KA+ SYS+++ N L LG
Sbjct  252  VYSFAGESKALNSYSEAIQNTLKLG  276


 Score = 90.5 bits (223),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 68/264 (26%), Positives = 133/264 (50%), Gaps = 17/264 (6%)
 Frame = +3

Query  102  TFSMGELEISSNLKMDQQ-PSNSTDRKEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAA  278
            T + G +E+ SN   D++ P+          FF L    +  ++ + V G++G+ + G  
Sbjct  665  TGANGRIEMISNADNDRKYPAPRG------YFFKLLKL-NAPEWPYAVLGAVGSVLSGFI  717

Query  279  LPVFFVLFGRMIDSLGHLSSDSHRLSSQVSKQALYL-VYLGSIIF--ISAWIGVAFWTQT  449
             P F ++ G M+D   +   D + +     K  LY+ +Y+G+ ++  ++  +   F++  
Sbjct  718  GPTFAIVMGEMLDVFYY--RDPNEMEK---KTKLYVFIYIGTGLYAVVAYLVQHYFFSIM  772

Query  450  GERQTARLRLRYLQSVLRKKIEFFDTDTRAKDIIF-HISSDAILVQDAIGDKIGHTIRYI  626
            GE  T R+R   L ++L  ++ +FD +     ++   ++ DA  V+ AI ++I   ++ +
Sbjct  773  GENLTTRVRRMMLSAILTNEVGWFDEEENNSSLVAARLAVDAADVKSAIAERISVILQNM  832

Query  627  SQFLVGFAVGFISVWKLTLVTLAVVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEA  806
            +  +  F VGFI  W++ L+ LA  PL+ +A     L M   +     A+A++  VA E 
Sbjct  833  TSLMTSFIVGFIIEWRVALLILATFPLLVLANFAQQLSMKGFAGDTAKAHAKSSMVAGEG  892

Query  807  ISQVRTVYSFVGEKKAVESYSKSL  878
            +S +RTV +F  + K +  +S  L
Sbjct  893  VSNIRTVAAFNAQNKILSLFSYEL  916



>ref|XP_008668793.1| PREDICTED: ABC transporter B family member 19-like [Zea mays]
 tpg|DAA35746.1| TPA: hypothetical protein ZEAMMB73_634725 [Zea mays]
Length=1266

 Score =   252 bits (643),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 121/240 (50%), Positives = 166/240 (69%), Gaps = 0/240 (0%)
 Frame = +3

Query  180  EMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLSSDSHRLSS  359
            + V+F  LFS AD  D   M  GS+GA  HGAA+P FF+LFG +I+  G   +D   ++ 
Sbjct  34   QAVAFHELFSFADKWDLMLMAAGSMGALAHGAAMPFFFLLFGDLINGFGKNQTDLRTMTD  93

Query  360  QVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKKIEFFDTDTRA  539
            +V+K ALY VYLG ++ +S++  +A W  TGERQ   LR  YL +VLR+ + FFDTD R 
Sbjct  94   EVAKYALYFVYLGLVVCVSSYAEIACWMYTGERQVIALRKAYLDAVLRQDVGFFDTDART  153

Query  540  KDIIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLAVVPLIAVA  719
             DI+F +S+D +LVQD IG+K+G+ + YI+ FL G  VGF+S W+L L+++AV+P IA A
Sbjct  154  GDIVFGVSTDTLLVQDGIGEKVGNFMHYIATFLAGLVVGFVSAWRLALLSVAVIPAIAFA  213

Query  720  GGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYSKSLNNALVLG  899
            GG Y   ++ L+ K   +YA AG VAE+AI QVRTVYSFVGE KA+ SYS+++ N L LG
Sbjct  214  GGLYAYTLTGLTSKSRESYANAGVVAEQAIGQVRTVYSFVGESKALNSYSEAIQNTLKLG  273


 Score = 95.9 bits (237),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 70/261 (27%), Positives = 133/261 (51%), Gaps = 19/261 (7%)
 Frame = +3

Query  114  GELEISSNLKMDQQ-PSNSTDRKEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVF  290
            G +E+ SN   D++ P+          FF L    +  ++ + V G+IG+ + G   P F
Sbjct  666  GRIEMISNADNDRKYPAPRG------YFFKLLKL-NAPEWPYAVLGAIGSVLSGFIGPTF  718

Query  291  FVLFGRMIDSLGHLSSDSHRLSSQVSKQA-LYL-VYLGSIIF--ISAWIGVAFWTQTGER  458
             ++ G M+D         +R  +++ K+  LY+ +Y+G+ I+  ++  +   F++  GE 
Sbjct  719  AIVMGEMLDVF------YYRDPNEIEKKTKLYVFIYIGTGIYAVVAYLVQHYFFSIMGEN  772

Query  459  QTARLRLRYLQSVLRKKIEFFDTDTRAKDIIF-HISSDAILVQDAIGDKIGHTIRYISQF  635
             T R+R   L ++LR ++ +FD +     ++   +  DA  V+ AI ++I   ++ ++  
Sbjct  773  LTTRVRRMMLSAILRNEVGWFDEEENNSSLVAARLGVDAADVKSAIAERISVILQNMTSL  832

Query  636  LVGFAVGFISVWKLTLVTLAVVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQ  815
            +  F VGFI  W++ ++ LA  PL+ +A     L M   +     A+A +  VA EA+S 
Sbjct  833  MTSFVVGFIIEWRVAILILATFPLLVLANFAQQLSMKGFAGDTAKAHARSSMVAGEAVSN  892

Query  816  VRTVYSFVGEKKAVESYSKSL  878
            +RTV +F  + K +  +S  L
Sbjct  893  IRTVAAFNAQSKILSLFSHEL  913



>gb|ABG75919.1| MDR-like ABC transporter [Ginkgo biloba]
Length=1279

 Score =   250 bits (638),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 116/245 (47%), Positives = 171/245 (70%), Gaps = 0/245 (0%)
 Frame = +3

Query  165  STDRKEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLSSDS  344
            ++ + + V+F+ LFS AD  DY  M  GSIGAC HGA++PVFF+ FG++I+ +G    D 
Sbjct  50   ASSQPQKVAFYKLFSYADGWDYLLMAVGSIGACAHGASVPVFFIFFGKLINCIGLAYLDP  109

Query  345  HRLSSQVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKKIEFFD  524
              ++  V+  +L  VYLG ++  S+W  VA W  TGERQ  R+RL YL+++L + + FFD
Sbjct  110  PAVTHTVAMYSLDFVYLGVVVLFSSWTEVACWMYTGERQATRMRLTYLRAMLNQDVSFFD  169

Query  525  TDTRAKDIIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLAVVP  704
            TD    +++  I+SD I+VQDAIG+K+G+ + Y+ +F+ GFAVGF +VW+L+LVTLA+VP
Sbjct  170  TDATGGEVVAAITSDTIVVQDAIGEKVGNFLHYMGRFVAGFAVGFSAVWQLSLVTLAIVP  229

Query  705  LIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYSKSLNN  884
            LIA+AGG Y  +++ L+ +   AY +AG +AEE I  VRTVY+FVGE++AV SY  +L  
Sbjct  230  LIALAGGLYAFVVTGLTSRSRNAYIKAGGIAEEVIGNVRTVYAFVGEERAVRSYKTALME  289

Query  885  ALVLG  899
               +G
Sbjct  290  TYKIG  294


 Score = 82.0 bits (201),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 46/146 (32%), Positives = 79/146 (54%), Gaps = 1/146 (1%)
 Frame = +3

Query  450  GERQTARLRLRYLQSVLRKKIEFFD-TDTRAKDIIFHISSDAILVQDAIGDKIGHTIRYI  626
            GER T R+R     ++LR ++ +FD  D  +  +   ++SDA LV+  + D++   I+ I
Sbjct  785  GERLTLRVREMMFGAILRNEVGWFDDNDNNSGLVSSRLASDATLVRTLVVDRVTILIQNI  844

Query  627  SQFLVGFAVGFISVWKLTLVTLAVVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEA  806
            +  +  F + FI  W++TLV LA  PL+  +  +    M         AY +A  +A EA
Sbjct  845  ALIVTSFTIAFIEQWRITLVILATYPLLIASHMSERFFMHGYGGNLSKAYLKANMLATEA  904

Query  807  ISQVRTVYSFVGEKKAVESYSKSLNN  884
            +S +RTV +F  E+K ++ +S+ L  
Sbjct  905  VSNIRTVAAFCAEEKVIDLFSRELEE  930



>ref|XP_009764894.1| PREDICTED: ABC transporter B family member 2-like [Nicotiana 
sylvestris]
Length=1260

 Score =   249 bits (637),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 122/262 (47%), Positives = 177/262 (68%), Gaps = 3/262 (1%)
 Frame = +3

Query  114  GELEISSNLKMDQQPSNSTDRKEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFF  293
            GE  +SS +K  ++ S    +   VS   LFS AD  DYF M FGSIGAC+HGA++PVFF
Sbjct  10   GEGGVSSKMKQKEEDSKKPGK---VSLLKLFSFADVYDYFLMFFGSIGACVHGASVPVFF  66

Query  294  VLFGRMIDSLGHLSSDSHRLSSQVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARL  473
            + FG++I+ +G         S +V+K AL  VYL  ++  S+WI VA W  +GERQ A++
Sbjct  67   IFFGKLINIIGLAYLFPAETSHKVAKYALDFVYLSVVVLFSSWIEVACWMHSGERQAAKM  126

Query  474  RLRYLQSVLRKKIEFFDTDTRAKDIIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAV  653
            R+ YL+S+L + I FFDT+    ++I  I+SD I+VQDAI +K+G+ + Y+S+F  GF +
Sbjct  127  RMAYLKSMLNQDISFFDTEASTGEVISAITSDIIIVQDAISEKVGNFMHYVSRFFAGFTI  186

Query  654  GFISVWKLTLVTLAVVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYS  833
            GFI VW+++LVTL++VPLIA+AGG Y  I + L  +   +Y +AG++AEE ++ VRTV +
Sbjct  187  GFIRVWQISLVTLSIVPLIALAGGIYAYIATGLIARVRKSYIKAGEIAEEVVANVRTVQA  246

Query  834  FVGEKKAVESYSKSLNNALVLG  899
            F GE+KAV+SY  +L N    G
Sbjct  247  FTGEEKAVKSYKGALLNTYKYG  268


 Score = 85.1 bits (209),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 61/220 (28%), Positives = 110/220 (50%), Gaps = 6/220 (3%)
 Frame = +3

Query  225  DYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLSSDSHRLSSQVSKQALYLVYLGSI  404
            D+++ V G+I A I GA +P+F +   + + S  ++  D+ R      K+  +L   G++
Sbjct  691  DWYYGVIGTICAFIAGAQMPLFALGVSQALVSY-YMDWDTTR---HEVKRICFLFCGGAV  746

Query  405  IFISAW-IGVAFWTQTGERQTARLRLRYLQSVLRKKIEFFDT-DTRAKDIIFHISSDAIL  578
            + +    I    +   GER T R+R     ++LR +I +FD  +  +  +   + SDA L
Sbjct  747  LTVVVHAIAHTCFGIIGERLTLRVREMMFSAMLRNEIGWFDEMNNSSSTLASRLESDATL  806

Query  579  VQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLAVVPLIAVAGGTYTLIMSNLSQ  758
            ++  + D+    ++ +   +  F + FI  W+LTL+ +A+ PLI     +  L M     
Sbjct  807  LRTVVVDRSTILLQNVGLVVTSFIIAFILNWRLTLIVMAMYPLIVSGHISEKLFMQGFGG  866

Query  759  KGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYSKSL  878
                AY  A   A EA+S +RTV +F  E+K  + Y++ L
Sbjct  867  DLSKAYLRANMFAGEAVSNIRTVAAFCAEEKVTDHYAREL  906



>dbj|BAJ96840.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=1271

 Score =   249 bits (637),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 118/240 (49%), Positives = 167/240 (70%), Gaps = 0/240 (0%)
 Frame = +3

Query  180  EMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLSSDSHRLSS  359
            + V+F  LFS AD  D   M  G++GA  HGAA+P FF+LFG +I+  G   +D   ++ 
Sbjct  39   QAVAFHELFSFADRWDLALMSLGTVGALAHGAAMPCFFLLFGDLINGFGKNQTDLRTMTD  98

Query  360  QVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKKIEFFDTDTRA  539
            +V+K ALY VYLG ++ ++++  +A W  TGERQ   LR  YL +VLR+ + FFDTD R 
Sbjct  99   EVAKYALYFVYLGLVVCVASYAEIACWMYTGERQVIALRKAYLDAVLRQDVGFFDTDART  158

Query  540  KDIIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLAVVPLIAVA  719
             DI+F +S+D +LVQDAIG+K+G+ + Y++ F  G  VGF+S W+L L+++AV+P IA A
Sbjct  159  GDIVFGVSTDTLLVQDAIGEKVGNFMHYLATFFAGLVVGFVSAWRLALLSVAVIPAIAFA  218

Query  720  GGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYSKSLNNALVLG  899
            GG Y   ++ L+ K   +YA AG VAE+AI+QVRTVYSFVGE KA+ SYS+++ N L LG
Sbjct  219  GGLYAYTLTGLTSKSRESYANAGVVAEQAIAQVRTVYSFVGESKALNSYSEAIQNTLKLG  278


 Score = 85.1 bits (209),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 61/233 (26%), Positives = 116/233 (50%), Gaps = 10/233 (4%)
 Frame = +3

Query  192  FFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLSSDSHRLSSQVSK  371
            FF L    +  ++ + V G+IG+ + G   P F ++ G M+D   +   D   +     K
Sbjct  692  FFKLLKL-NAPEWPYAVLGAIGSVLSGFIGPTFAIVMGEMLDVFYY--KDPVEMEK---K  745

Query  372  QALYL-VYLGSIIF--ISAWIGVAFWTQTGERQTARLRLRYLQSVLRKKIEFFDTDTRAK  542
              LY+ +Y+G+ I+  ++  +   F++  GE  T R+R   L ++LR ++ +FD +    
Sbjct  746  TKLYVFIYIGTGIYAVVAYLVQHYFFSIMGENLTTRVRRMMLSAILRNEVGWFDEEENNS  805

Query  543  DIIFHISSDAILV-QDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLAVVPLIAVA  719
             ++    +      + AI ++I   ++ I+  +  F VGFI  W++ ++ LA  PL+ +A
Sbjct  806  SLVAARVAVDAADVKSAIAERISVILQNITSLMTSFIVGFIIEWRVAILILATFPLLVLA  865

Query  720  GGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYSKSL  878
                 L M   +     A+A++  VA E +S +RTV +F  + K +  +S  L
Sbjct  866  NFAQQLSMKGFAGDTAKAHAKSSMVAGEGVSNIRTVAAFNAQNKVMSLFSHEL  918



>ref|XP_003579371.1| PREDICTED: ABC transporter B family member 19-like [Brachypodium 
distachyon]
Length=1266

 Score =   249 bits (637),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 119/240 (50%), Positives = 167/240 (70%), Gaps = 0/240 (0%)
 Frame = +3

Query  180  EMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLSSDSHRLSS  359
            + V+F  LFS AD  D   M  GS+GA  HGAA+P FF+LFG +I+  G   +D   ++ 
Sbjct  34   QAVAFHELFSFADRWDLALMAAGSLGALAHGAAMPCFFLLFGDLINGFGKNQTDLRTMTD  93

Query  360  QVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKKIEFFDTDTRA  539
            +V+K ALY VYLG ++ ++++  +A W  TGERQ   LR  YL +VLR+ + FFDTD R 
Sbjct  94   EVAKYALYFVYLGLVVCVASYSEIACWMYTGERQVIALRKAYLDAVLRQDVGFFDTDART  153

Query  540  KDIIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLAVVPLIAVA  719
             DI+F +S+D +LVQDAIG+K+G+ I Y++ F  G  VGF+S W+L L+++AV+P IA A
Sbjct  154  GDIVFGVSTDTLLVQDAIGEKVGNFIHYLATFFAGLVVGFVSAWRLALLSVAVIPAIAFA  213

Query  720  GGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYSKSLNNALVLG  899
            GG Y   ++ L+ +   +YA AG VAE+AI+QVRTVYSFVGE KA+ SYS+++ N L LG
Sbjct  214  GGLYAYTLTGLTSRSRESYANAGVVAEQAIAQVRTVYSFVGESKALNSYSEAIQNTLKLG  273


 Score = 87.0 bits (214),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 62/251 (25%), Positives = 121/251 (48%), Gaps = 9/251 (4%)
 Frame = +3

Query  138  LKMDQQPSNSTDRKEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFVLFGRMID  317
            ++M     NS        +F      +  ++ + V G+IG+ + G   P F ++ G M+D
Sbjct  668  IEMISNADNSLKYPAPRGYFFKLLKLNAPEWPYAVLGAIGSVLSGFIGPTFAIVMGEMLD  727

Query  318  SLGHLSSDSHRLSSQVSKQALYL-VYLGSIIF--ISAWIGVAFWTQTGERQTARLRLRYL  488
               +   D + +     K  LY+ +Y+G+ I+  ++  +   F++  GE  T R+R   L
Sbjct  728  VFYY--KDPNEMEK---KTKLYVFIYIGTGIYAVVAYLVQHYFFSIMGENLTTRVRRMML  782

Query  489  QSVLRKKIEFFDTDTRAKDIIFHISSDAILV-QDAIGDKIGHTIRYISQFLVGFAVGFIS  665
             ++LR ++ +FD +     ++    +      + AI ++I   ++ I+  +  F VGF+ 
Sbjct  783  SAILRNEVGWFDEEENNSSLVAARVAVDAADVKSAIAERISVILQNITSLMTSFIVGFVI  842

Query  666  VWKLTLVTLAVVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGE  845
             W++ L+ LA  PL+ +A     L M   +     A+A++  VA E +S +RTV +F  +
Sbjct  843  EWRVALLILATFPLLVLANFAQQLSMKGFAGDTAKAHAKSSMVAGEGVSNIRTVAAFNAQ  902

Query  846  KKAVESYSKSL  878
             K +  +S  L
Sbjct  903  NKIMSLFSHEL  913



>ref|XP_007032499.1| ATP binding cassette subfamily B19 isoform 3 [Theobroma cacao]
 gb|EOY03425.1| ATP binding cassette subfamily B19 isoform 3 [Theobroma cacao]
Length=1213

 Score =   247 bits (630),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 113/221 (51%), Positives = 163/221 (74%), Gaps = 0/221 (0%)
 Frame = +3

Query  237  MVFGSIGACIHGAALPVFFVLFGRMIDSLGHLSSDSHRLSSQVSKQALYLVYLGSIIFIS  416
            M+ GS+GA IHG+++PVFF+LFG M++  G   SD  +++ +V+K ALY VYLG I+ +S
Sbjct  1    MISGSLGAIIHGSSMPVFFLLFGEMVNGFGKNQSDLSKMTHEVAKYALYFVYLGLIVCLS  60

Query  417  AWIGVAFWTQTGERQTARLRLRYLQSVLRKKIEFFDTDTRAKDIIFHISSDAILVQDAIG  596
            ++  +A W  TGERQ + LR +YL++VL++ + FFDTD R  DI+F +S+D +LVQDAI 
Sbjct  61   SYAEIACWMYTGERQVSTLRKKYLEAVLKQDVGFFDTDARTGDIVFSVSTDTLLVQDAIS  120

Query  597  DKIGHTIRYISQFLVGFAVGFISVWKLTLVTLAVVPLIAVAGGTYTLIMSNLSQKGEAAY  776
            +K+G+ I Y+S FL G  VGF+S W+L L+++AV+P IA AGG Y   ++ L+ K   +Y
Sbjct  121  EKVGNFIHYLSTFLAGLVVGFVSAWRLALLSVAVIPGIAFAGGLYAYTLTGLTSKSRESY  180

Query  777  AEAGKVAEEAISQVRTVYSFVGEKKAVESYSKSLNNALVLG  899
            A AG +AE+AI+QVRTVYS+VGE KA+ SYS ++ N L LG
Sbjct  181  ANAGIIAEQAIAQVRTVYSYVGESKALNSYSDAIQNTLKLG  221


 Score = 84.0 bits (206),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 65/256 (25%), Positives = 128/256 (50%), Gaps = 26/256 (10%)
 Frame = +3

Query  114  GELEISSNLKMDQQPSNSTDRKEMVS--FFGLFSAADTVDYFFMVFGSIGACIHGAALPV  287
            G +E+ SN +        TDRK      +F      +  ++ + + G++G+ + G   P 
Sbjct  612  GRIEMISNAE--------TDRKNPAPDGYFCRLLKLNAPEWPYSIMGAVGSVLSGFIGPT  663

Query  288  FFVLFGRMIDSLGHLSSDSHRLSSQVSKQALYLVYLGSIIF--ISAWIGVAFWTQTGERQ  461
            F ++   MI+   + +  S     + +K+ ++ +Y+G+ ++  I+  I   F++  GE  
Sbjct  664  FAIVMSNMIEVFYYTNPTSME---RKTKEYVF-IYIGAGLYAVIAYLIQHYFFSIMGENL  719

Query  462  TARLRLRYLQSVLRKKIEFFDTDTRAKDIIF-HISSDAILVQDAIGDKIGHTIRYISQFL  638
            T R+R   L ++LR ++ +FD +     ++   +++DA  V+ AI ++I   ++ ++  L
Sbjct  720  TTRVRRMMLGAILRNEVGWFDEEEHNSSLLAARLATDAADVKSAIAERISVILQNMTSLL  779

Query  639  VGFAVGFISVWKLTLVTLAVVPLIAVAGGTYTLIMSNLSQKGEA-----AYAEAGKVAEE  803
              F V FI  W+++L+ L   PL+ +A          LS KG A     A+A+   +A E
Sbjct  780  TSFIVAFIVEWRVSLLILGTFPLLVLA----NFAQQQLSLKGFAGDTAKAHAKTSMIAGE  835

Query  804  AISQVRTVYSFVGEKK  851
             +S +RTV +F  + K
Sbjct  836  GVSNIRTVAAFNAQNK  851



>gb|KHN45492.1| ABC transporter B family member 19 [Glycine soja]
Length=1214

 Score =   246 bits (629),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 113/223 (51%), Positives = 162/223 (73%), Gaps = 0/223 (0%)
 Frame = +3

Query  231  FFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLSSDSHRLSSQVSKQALYLVYLGSIIF  410
              M+ GSIGA IHG+++PVFF+LFG M++  G    +  +++ +VSK ALY VYLG ++ 
Sbjct  1    MLMISGSIGAIIHGSSMPVFFLLFGEMVNGFGKNQMNLKKMTEEVSKYALYFVYLGLVVC  60

Query  411  ISAWIGVAFWTQTGERQTARLRLRYLQSVLRKKIEFFDTDTRAKDIIFHISSDAILVQDA  590
            IS++  +A W  TGERQ + LR +YL++VL++ + FFDTD R  DI+F +S+D +LVQDA
Sbjct  61   ISSYAEIACWMYTGERQVSTLRKKYLEAVLKQDVGFFDTDARTGDIVFSVSTDTLLVQDA  120

Query  591  IGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLAVVPLIAVAGGTYTLIMSNLSQKGEA  770
            I +K+G+ I Y+S FL G  VGF+S W+L L+++AV+P IA AGG Y   ++ L+ K   
Sbjct  121  ISEKVGNFIHYLSTFLAGLVVGFVSAWRLALLSVAVIPGIAFAGGLYAYTLTGLTSKSRE  180

Query  771  AYAEAGKVAEEAISQVRTVYSFVGEKKAVESYSKSLNNALVLG  899
            +YA AG +AE+AI+QVRTVYS+VGE KA+ SYS ++ N L LG
Sbjct  181  SYANAGIIAEQAIAQVRTVYSYVGESKALNSYSDAIQNTLKLG  223


 Score = 85.9 bits (211),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 62/258 (24%), Positives = 127/258 (49%), Gaps = 13/258 (5%)
 Frame = +3

Query  114  GELEISSNLKMDQQPSNSTDRKEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFF  293
            G +E+ SN + D++            FF L    +  ++ + + G++G+ + G   P F 
Sbjct  614  GRIEMISNAETDKKNPAPDGY-----FFRLLKM-NAPEWPYSIMGAVGSVLSGFIGPTFA  667

Query  294  VLFGRMIDSLGHLSSDSHRLSSQVSKQALYLVYLGSIIF-ISAW-IGVAFWTQTGERQTA  467
            ++   MI+        S+  S +   +    +Y+G+ ++ + A+ I   F++  GE  T 
Sbjct  668  IVMSNMIEVFYF----SNYASMERKTKEYVFIYIGAGLYAVGAYLIQHYFFSIMGENLTT  723

Query  468  RLRLRYLQSVLRKKIEFFDTDTRAKDIIF-HISSDAILVQDAIGDKIGHTIRYISQFLVG  644
            R+R   L ++LR ++ +FD +     ++   +++DA  V+ AI ++I   ++ ++  L  
Sbjct  724  RVRRMMLAAILRNEVGWFDEEEHNSSLVAARLATDAADVKSAIAERISVILQNMTSLLTS  783

Query  645  FAVGFISVWKLTLVTLAVVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRT  824
            F V FI  W+++L+ LA  PL+ +A     L +   +     A+A+   +A E +S +RT
Sbjct  784  FIVAFIVEWRVSLLILATFPLLVLANFAQQLSLKGFAGDTAKAHAKTSMIAGEGVSNIRT  843

Query  825  VYSFVGEKKAVESYSKSL  878
            V +F  + K +  +   L
Sbjct  844  VAAFNAQNKMLSVFCHEL  861



>gb|EMT07148.1| ABC transporter B family member 19 [Aegilops tauschii]
Length=1237

 Score =   246 bits (629),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 118/240 (49%), Positives = 166/240 (69%), Gaps = 0/240 (0%)
 Frame = +3

Query  180  EMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLSSDSHRLSS  359
            + V+F  LFS AD  D   M  G++GA  HGAA+P FF+LFG +I+  G   +D   ++ 
Sbjct  39   QAVAFHELFSFADRWDLALMSLGTLGALAHGAAMPCFFLLFGDLINGFGKNQTDLRAMTD  98

Query  360  QVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKKIEFFDTDTRA  539
            +V+K ALY VYLG ++ ++++  +A W  TGERQ   LR  YL +VLR+ + FFDTD R 
Sbjct  99   EVAKYALYFVYLGLVVCVASYAEIACWMYTGERQVIALRKAYLDAVLRQDVGFFDTDART  158

Query  540  KDIIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLAVVPLIAVA  719
             DI+F +S+D +LVQDAIG+K G+ + Y++ F  G  VGF+S W+L L+++AV+P IA A
Sbjct  159  GDIVFGVSTDTLLVQDAIGEKGGNFMHYLATFFAGLIVGFVSAWRLALLSVAVIPAIAFA  218

Query  720  GGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYSKSLNNALVLG  899
            GG Y   ++ L+ K   +YA AG VAE+AI+QVRTVYSFVGE KA+ SYS+++ N L LG
Sbjct  219  GGLYAYTLTGLTSKSRESYANAGVVAEQAIAQVRTVYSFVGESKALNSYSEAIQNTLKLG  278


 Score = 84.7 bits (208),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 58/222 (26%), Positives = 112/222 (50%), Gaps = 9/222 (4%)
 Frame = +3

Query  225  DYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLSSDSHRLSSQVSKQALYL-VYLGS  401
            ++ + V G+IG+ + G   P F ++ G M+D   +   D   +     K  LY+ +Y+G+
Sbjct  702  EWPYAVLGAIGSVLSGFIGPTFAIVMGEMLDVFYY--KDPVEMEK---KTKLYVFIYIGT  756

Query  402  IIF--ISAWIGVAFWTQTGERQTARLRLRYLQSVLRKKIEFFDTDTRAKDIIFHISSDAI  575
             I+  ++  +   F++  GE  T R+R   L ++LR ++ +FD +     ++    +   
Sbjct  757  GIYAVVAYLVQHYFFSIMGENLTTRVRRMMLSAILRNEVGWFDEEENNSSLVAARVAVDA  816

Query  576  LV-QDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLAVVPLIAVAGGTYTLIMSNL  752
               + AI ++I   ++ I+  +  F VGFI  W++ ++ LA  PL+ +A     L M   
Sbjct  817  ADVKSAIAERISVILQNITSLMTSFIVGFIIEWRVAILILATFPLLVLANFAQQLSMKGF  876

Query  753  SQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYSKSL  878
            +     A+A++  VA E +S +RTV +F  + K +  +S  L
Sbjct  877  AGDTAKAHAKSSMVAGEGVSNIRTVAAFNAQNKVMSLFSHEL  918



>ref|XP_009595706.1| PREDICTED: ABC transporter B family member 2-like [Nicotiana 
tomentosiformis]
Length=1256

 Score =   246 bits (627),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 119/261 (46%), Positives = 174/261 (67%), Gaps = 3/261 (1%)
 Frame = +3

Query  117  ELEISSNLKMDQQPSNSTDRKEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFV  296
            EL +   +K  ++ S    +   VS   LFS AD  DYF M FGSIGAC+HGA++PVFF+
Sbjct  7    ELSVEGGVKQKEEESKKPGK---VSLLKLFSFADVYDYFLMFFGSIGACVHGASVPVFFI  63

Query  297  LFGRMIDSLGHLSSDSHRLSSQVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARLR  476
             FG++I+ +G         S +V+K AL  VYL  ++  S+WI VA W  +GERQ A++R
Sbjct  64   FFGKLINIIGLAYLFPAETSHKVAKYALDFVYLSVVVLFSSWIEVACWMHSGERQAAKMR  123

Query  477  LRYLQSVLRKKIEFFDTDTRAKDIIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAVG  656
            + YL+S+L + I  FDT+    ++I  I+SD I+VQDAI +K+G+ + Y+S+F  GF +G
Sbjct  124  MAYLKSILNQDISLFDTEASTGEVISAITSDIIIVQDAISEKVGNFMHYVSRFFAGFTIG  183

Query  657  FISVWKLTLVTLAVVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSF  836
            FI VW+++LVTL++VPLIA+AGG Y  I + L  +   +Y +AG++AEE ++ VRTV +F
Sbjct  184  FIRVWQISLVTLSIVPLIALAGGIYAYIATGLIARVRKSYIKAGEIAEEVVANVRTVQAF  243

Query  837  VGEKKAVESYSKSLNNALVLG  899
             GE+KAV+SY  +L N    G
Sbjct  244  TGEEKAVKSYKGALLNTYKYG  264


 Score = 83.6 bits (205),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 61/220 (28%), Positives = 109/220 (50%), Gaps = 6/220 (3%)
 Frame = +3

Query  225  DYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLSSDSHRLSSQVSKQALYLVYLGSI  404
            D+++ V G+I A I GA +P+F +   + + S  ++  D+ R      K+  +L   G++
Sbjct  687  DWYYGVIGTICAFIAGAQMPLFALGVSQALVSY-YMDWDTTR---HEVKRICFLFCGGAV  742

Query  405  IFISAW-IGVAFWTQTGERQTARLRLRYLQSVLRKKIEFFDT-DTRAKDIIFHISSDAIL  578
            + +    I    +   GER T R+R     ++LR +I +FD  +  +  +   + SDA L
Sbjct  743  LTVVVHAIAHTCFGIIGERLTLRVREMMFSAMLRNEIGWFDEMNNSSSTLASRLESDATL  802

Query  579  VQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLAVVPLIAVAGGTYTLIMSNLSQ  758
            ++  + D+    ++ +   +  F + FI  W+LTLV +A+ PLI     +    M     
Sbjct  803  LRTVVVDRSTILLQNVGLVVTSFIIAFILNWRLTLVVMAMYPLIVSGHISEKFFMQGFGG  862

Query  759  KGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYSKSL  878
                AY  A   A EA+S +RTV +F  E+K  + Y++ L
Sbjct  863  DLSKAYLRANMFAGEAVSNIRTVVAFCAEEKVTDLYAREL  902



>ref|XP_001759716.1| ATP-binding cassette transporter, subfamily B, member 26, group 
MDR/PGP protein PpABCB26 [Physcomitrella patens]
 gb|EDQ75628.1| ATP-binding cassette transporter, subfamily B, member 26, group 
MDR/PGP protein PpABCB26 [Physcomitrella patens]
Length=1301

 Score =   245 bits (625),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 117/263 (44%), Positives = 175/263 (67%), Gaps = 6/263 (2%)
 Frame = +3

Query  111  MGELEISSNLKMDQQPSNSTDRKEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVF  290
            +G+   S + K +++P  S      VS F LF+ AD +D F +  G++ A +HG ++P+F
Sbjct  64   VGKESESDSAKGEKRPEGS------VSLFRLFTYADLLDCFLIATGALAAVVHGLSMPIF  117

Query  291  FVLFGRMIDSLGHLSSDSHRLSSQVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTAR  470
             +  G +ID  G   ++  R +  V K A+Y+VYLG +++ ++W  VA W QTGERQ AR
Sbjct  118  LLFLGDLIDGFGANINNPKRTAEDVDKYAVYMVYLGIVVWFASWAEVAAWMQTGERQAAR  177

Query  471  LRLRYLQSVLRKKIEFFDTDTRAKDIIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFA  650
            +R+ YLQS+L+K I +FD D R  +++  IS+D +L+QDAI +K+G  + YIS  + GFA
Sbjct  178  IRVLYLQSMLKKDISYFDVDARTGEVVDSISTDTLLIQDAISEKMGQFLHYISTCIGGFA  237

Query  651  VGFISVWKLTLVTLAVVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVY  830
            VGF  +WKL LVTLAV P IA+ GG+Y  I++N + +   AY EAG + E+ ++ VRTVY
Sbjct  238  VGFSMLWKLGLVTLAVAPAIAIVGGSYAYIITNFTARNRKAYEEAGNIVEQNLANVRTVY  297

Query  831  SFVGEKKAVESYSKSLNNALVLG  899
            SFVGE+KA+E++S +L   L LG
Sbjct  298  SFVGEQKALEAFSHALRGTLKLG  320


 Score = 70.1 bits (170),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 50/217 (23%), Positives = 99/217 (46%), Gaps = 3/217 (1%)
 Frame = +3

Query  252  IGACIHGAALPVFFVLFGRMIDSLGHLSSDSHRLSSQVSKQALYLVYLGSIIFISAWIGV  431
            +G+ I G   P F ++   ++    +  + +H +  ++ K  L ++ LG    I +++  
Sbjct  740  VGSVIMGLVNPGFSLVISNVV--YIYYGTSNHHMKQEIDKFILIVISLGVAALIGSFLQH  797

Query  432  AFWTQTGERQTARLRLRYLQSVLRKKIEFFDTD-TRAKDIIFHISSDAILVQDAIGDKIG  608
             F+   GE    R+R      +L  ++ +FD D   +  +   +++DA  V+ AIGD+I 
Sbjct  798  TFFGVMGENLVKRIREMMFARILTNEVGWFDADENNSSQVSARLAADATTVKGAIGDRIS  857

Query  609  HTIRYISQFLVGFAVGFISVWKLTLVTLAVVPLIAVAGGTYTLIMSNLSQKGEAAYAEAG  788
              ++  +  +    + F   WK+  V L  +PL   A     L +   S    +A A A 
Sbjct  858  IIVQNFTLMVAICIIAFSLQWKMAFVVLCTLPLQVFATFVEHLFLKGFSGDVASAQARAS  917

Query  789  KVAEEAISQVRTVYSFVGEKKAVESYSKSLNNALVLG  899
             VA E +  +RT+ +F  + + V+ + + L   +  G
Sbjct  918  MVAGEGVINIRTIAAFNSQDRIVKLFEQELRAPMRRG  954



>ref|XP_009113725.1| PREDICTED: ABC transporter B family member 13 isoform X4 [Brassica 
rapa]
Length=1153

 Score =   244 bits (622),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 115/158 (73%), Positives = 137/158 (87%), Gaps = 0/158 (0%)
 Frame = +3

Query  423  IGVAFWTQTGERQTARLRLRYLQSVLRKKIEFFDTDTRAKDIIFHISSDAILVQDAIGDK  602
            +GVA WTQTGERQTARLR++YL+++L K I FFDT+ R  ++IFHISSDAILVQDAIGDK
Sbjct  9    VGVACWTQTGERQTARLRIKYLKAILAKDITFFDTEARDSNLIFHISSDAILVQDAIGDK  68

Query  603  IGHTIRYISQFLVGFAVGFISVWKLTLVTLAVVPLIAVAGGTYTLIMSNLSQKGEAAYAE  782
             GH +RY+SQF+ GF VGF+SVW+LTL+TLAVVPLIA+AGG Y +IMS +S+K EAAYA+
Sbjct  69   TGHVLRYLSQFVAGFVVGFLSVWQLTLLTLAVVPLIAIAGGGYAIIMSTISEKSEAAYAD  128

Query  783  AGKVAEEAISQVRTVYSFVGEKKAVESYSKSLNNALVL  896
            AGKVAEE ISQVRTVY+FVGE+KAV SYS SL  AL L
Sbjct  129  AGKVAEEVISQVRTVYAFVGEEKAVNSYSNSLKKALKL  166


 Score = 90.1 bits (222),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 62/223 (28%), Positives = 108/223 (48%), Gaps = 3/223 (1%)
 Frame = +3

Query  216  DTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLSSDSHRLSSQVSKQALYLVYL  395
            +  ++ + + GSIGA + GA  P+F +    ++ +    S     +   V K A+  V +
Sbjct  574  NAPEWPYALLGSIGAVLAGAQTPLFSMGIAYVLTAF--YSPSPSVIKRDVDKVAIVFVGI  631

Query  396  GSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKKIEFFDTDTRAKDIIFHI-SSDA  572
              +      +   F+T  GER T+R+RL    ++L  +I +FD D      +  I ++DA
Sbjct  632  AVVTAPIYLLQHYFYTLMGERLTSRVRLSLFSAILSNEIGWFDLDENNTGSLTSILAADA  691

Query  573  ILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLAVVPLIAVAGGTYTLIMSNL  752
             LV+ A+ D++   ++ +S  +   A+ F   W++  V  +  PL+  A  T  L +   
Sbjct  692  TLVRSALADRLSTIVQNLSLTVTALAIAFYYSWRVAAVVTSCFPLLIAAALTEQLFLKGF  751

Query  753  SQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYSKSLN  881
                  AY+ A  VA EAI  +RTV SF  EK+  E ++  L+
Sbjct  752  GGDYTRAYSRATSVAREAIENIRTVASFGAEKQISEQFACELS  794



>gb|EMT32511.1| ABC transporter B family member 19 [Aegilops tauschii]
Length=1274

 Score =   244 bits (624),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 116/252 (46%), Positives = 172/252 (68%), Gaps = 11/252 (4%)
 Frame = +3

Query  177  KEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLSSDSHRLS  356
            ++ V+F  LFS AD +D+  M  GS GA +HGAA+PVFF+LFG +++  G       R++
Sbjct  30   EQSVAFHQLFSFADPLDWLLMAAGSAGAVVHGAAMPVFFLLFGELVNGFGKNQHHLRRMT  89

Query  357  SQVS-----------KQALYLVYLGSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVLR  503
             ++            + +LY VYLG ++  S+++ +A W  TGERQ   LR RYL++VLR
Sbjct  90   DELLTLNLTASLCALQYSLYFVYLGLVVCASSYLEIACWMYTGERQVGALRRRYLEAVLR  149

Query  504  KKIEFFDTDTRAKDIIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTL  683
            + + FFDTD R  D++F +S+D +LVQDAIG+K+G+ I Y++ FL G  VGF+S W+L L
Sbjct  150  QDVGFFDTDARTGDVVFSVSTDTLLVQDAIGEKVGNFIHYLATFLAGLVVGFVSAWRLAL  209

Query  684  VTLAVVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVES  863
            +++AV+P IA AGG Y   ++ L+ K   +YA AG +AE+AI+QVRTVYS+VGE KA+ S
Sbjct  210  LSIAVIPGIAFAGGLYAYTLTGLTSKSRDSYANAGIIAEQAIAQVRTVYSYVGESKALNS  269

Query  864  YSKSLNNALVLG  899
            YS+++ + L LG
Sbjct  270  YSEAIQSTLKLG  281


 Score = 82.8 bits (203),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 62/257 (24%), Positives = 120/257 (47%), Gaps = 11/257 (4%)
 Frame = +3

Query  114  GELEISSNLKMDQQ-PSNSTDRKEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVF  290
            G +E+ SN   D++ P+          FF L    +  ++ + V G+IG+ + G   P F
Sbjct  674  GRIEMVSNADNDRKYPAPKG------YFFKLLKL-NAPEWPYTVLGAIGSIMSGFIGPTF  726

Query  291  FVLFGRMIDSLGHLSSDSHRLSSQVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTAR  470
             ++   MI+       D + +  +  +     +  G    ++  I   F++  GE  T R
Sbjct  727  AIVMSNMIEVF--YFRDPNAMERKTREYVFIYIGTGFYAVVAYLIQHYFFSIMGENLTTR  784

Query  471  LRLRYLQSVLRKKIEFFDTDTRAKDIIF-HISSDAILVQDAIGDKIGHTIRYISQFLVGF  647
            +R   L  +LR  + +FD +     ++   ++++A  V+ AI ++I   ++ ++  LV F
Sbjct  785  VRRMMLAVILRNDVGWFDEEENNSSLVAARLNTEAADVKSAIAERISVILQNMTSLLVSF  844

Query  648  AVGFISVWKLTLVTLAVVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTV  827
             VGFI  W++ ++ L   PL+ +A     L M   +     A+A+   +A E +S +RTV
Sbjct  845  IVGFIIEWRVAILILVTFPLLVLANFAQQLSMKGFAGDTAKAHAKTSMIAGEGVSNIRTV  904

Query  828  YSFVGEKKAVESYSKSL  878
             +F  + K +  +   L
Sbjct  905  AAFNAQDKILSLFCSEL  921



>ref|XP_004173771.1| PREDICTED: ABC transporter B family member 1-like [Cucumis sativus]
Length=384

 Score =   231 bits (590),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 106/246 (43%), Positives = 169/246 (69%), Gaps = 3/246 (1%)
 Frame = +3

Query  171  DRKEMVSFFG---LFSAADTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLSSD  341
            ++ E V+  G   LF  AD +DY  M  GS+GA +HG +LP+F   F  +++S G  ++D
Sbjct  90   EKPEAVTAIGFGELFRFADGLDYVLMAIGSVGALVHGCSLPLFLRFFADLVNSFGSYAND  149

Query  342  SHRLSSQVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKKIEFF  521
              ++  +V K A Y + +G+ I+ S+W  ++ W  TGERQ+ ++R++YL++ L + I++F
Sbjct  150  VDKMMQEVLKYAFYFLVVGAAIWASSWAEISCWMWTGERQSTKMRIKYLEAALDQDIQYF  209

Query  522  DTDTRAKDIIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLAVV  701
            DT+ R  D++F I++DA++VQDAI +K+G+ I Y++ F+ GF VGF +VW+L LVTLAVV
Sbjct  210  DTEVRTSDVVFAINTDAVMVQDAISEKLGNFIHYMATFVSGFVVGFTAVWQLALVTLAVV  269

Query  702  PLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYSKSLN  881
            PLIAV GG YT  ++ LS K + A +EAG + E+ I Q+R V++FVGE +A++ YS +L 
Sbjct  270  PLIAVIGGIYTTTIAKLSAKTQEALSEAGNIVEQTIVQIRVVFAFVGESRALQRYSAALK  329

Query  882  NALVLG  899
             +  +G
Sbjct  330  ISQKIG  335



>ref|XP_010908483.1| PREDICTED: ABC transporter B family member 2-like [Elaeis guineensis]
Length=1249

 Score =   243 bits (621),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 121/258 (47%), Positives = 175/258 (68%), Gaps = 7/258 (3%)
 Frame = +3

Query  126  ISSNLKMDQQPSNSTDRK-------EMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALP  284
            +SS +  D+     T++K       + VSFF LF+ AD  DYF M  GSIGAC+HGA++P
Sbjct  1    MSSVVGPDKNHEEGTNKKDGEGKKVQKVSFFKLFAFADAWDYFLMALGSIGACVHGASVP  60

Query  285  VFFVLFGRMIDSLGHLSSDSHRLSSQVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQT  464
            VFF+ FG++I+ +G        ++ +V+K +L  VYLG +I  S+WI VA W  TGERQ 
Sbjct  61   VFFIFFGKLINIIGVAYLFPTSVTHRVAKYSLDFVYLGIVILFSSWIEVACWMHTGERQA  120

Query  465  ARLRLRYLQSVLRKKIEFFDTDTRAKDIIFHISSDAILVQDAIGDKIGHTIRYISQFLVG  644
            A++RL YL+S+L + I  FDT+    ++I  I+SD I+VQDAI +K+G+ + YIS+F+ G
Sbjct  121  AKMRLAYLRSMLDQDIGVFDTEASTGEVISAITSDIIVVQDAISEKVGNFMHYISRFIGG  180

Query  645  FAVGFISVWKLTLVTLAVVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRT  824
            FA+GF  +W++ LVTL++VPLIA+AGG Y  I + L  +   +Y +AG++AEE I  VRT
Sbjct  181  FAIGFARIWQIGLVTLSIVPLIAIAGGIYAYIATGLIARVRKSYVKAGEIAEEVIGNVRT  240

Query  825  VYSFVGEKKAVESYSKSL  878
            V +FVGE KAV +Y  +L
Sbjct  241  VQAFVGEDKAVRAYRNAL  258


 Score = 90.5 bits (223),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 69/244 (28%), Positives = 117/244 (48%), Gaps = 5/244 (2%)
 Frame = +3

Query  159  SNSTDRKEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLSS  338
            SN + +   VS   L+S     D+ F VFG+IGA + G+ +P+F +   + + S      
Sbjct  659  SNDSPKVRRVSVKRLYSMV-APDWIFGVFGTIGALVAGSQMPLFALGVTQALVSYYMGWE  717

Query  339  DSHRLSSQVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKKIEF  518
             + R   +V K A+       +  I   I    +   GER T R+R +   ++LR +I +
Sbjct  718  TTQR---EVKKIAILFCCGAVLTVIFHVIEHLNFGIMGERLTLRVREKMFGAILRNEIGW  774

Query  519  FD-TDTRAKDIIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLA  695
            FD T+  +  +   + +DA L++  + D+    ++ I   +    + FI  W+LTLV LA
Sbjct  775  FDDTNNTSAMLSSRLETDATLLRTIVVDRSTILLQNIGMIVTSLIIAFILNWRLTLVVLA  834

Query  696  VVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYSKS  875
              PL+     +  L M         AY +A  +A EA+S +RTV +F  E+K ++ Y+  
Sbjct  835  TYPLMVSGHISEKLFMQGYGGNLNKAYLKANMLAAEAVSNIRTVAAFCSEEKVIDLYANE  894

Query  876  LNNA  887
            L   
Sbjct  895  LKEP  898



>ref|XP_006352948.1| PREDICTED: ABC transporter B family member 2-like [Solanum tuberosum]
Length=1257

 Score =   243 bits (621),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 123/263 (47%), Positives = 180/263 (68%), Gaps = 6/263 (2%)
 Frame = +3

Query  129  SSNL-KMDQQPSNS--TDRKEM---VSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVF  290
            SSN+ KM Q+ +N+   +RK++   VS   LFS AD+ DY  M+ GSIGAC+HGA++PVF
Sbjct  13   SSNISKMKQKNNNNGEEERKKIHQKVSLLKLFSFADSYDYLLMILGSIGACLHGASVPVF  72

Query  291  FVLFGRMIDSLGHLSSDSHRLSSQVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTAR  470
            F+ FG+MI+  G       + S +V+K +L  VYL  +I  S+WI VA W  +GERQ A+
Sbjct  73   FIFFGKMINIAGLAYLFPAQTSHKVAKYSLDFVYLSVVILFSSWIEVACWMHSGERQAAK  132

Query  471  LRLRYLQSVLRKKIEFFDTDTRAKDIIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFA  650
            +R+ YL+S+L + I  FDT+    ++I  I+SD I+VQDAI +K G+ + YIS+FL GF 
Sbjct  133  IRMAYLKSMLNQDISLFDTEASTGEVISAITSDIIIVQDAISEKAGNFLHYISRFLAGFT  192

Query  651  VGFISVWKLTLVTLAVVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVY  830
            +GFI VW+++LVTL++VPLIA+AGG Y  +   L  +   +Y +AG++AEE ++ +RTV 
Sbjct  193  IGFIRVWQISLVTLSIVPLIALAGGIYAYVTIGLIARVRKSYIKAGEIAEEVVANIRTVQ  252

Query  831  SFVGEKKAVESYSKSLNNALVLG  899
            +F GE+KAV+SY  +L N    G
Sbjct  253  AFTGEEKAVKSYKGALLNTYKYG  275


 Score = 86.7 bits (213),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 62/220 (28%), Positives = 111/220 (50%), Gaps = 6/220 (3%)
 Frame = +3

Query  225  DYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLSSDSHRLSSQVSKQALYLVYLGSI  404
            ++ + V G++ A I GA +P+F +   + + S  ++  D+ R      K+  +L  +G++
Sbjct  690  EWHYGVIGTVCAFIAGAQMPLFALGVSQALVSY-YMDWDTTR---HEVKKICFLFCVGAV  745

Query  405  IFISAW-IGVAFWTQTGERQTARLRLRYLQSVLRKKIEFFDT-DTRAKDIIFHISSDAIL  578
            + +    I    +   GER T R+R R   ++LR +I +FD  +  +  +   + SDA L
Sbjct  746  LTVVVHAIAHTCFGIIGERLTLRMRERMFSAMLRNEIGWFDEMNNSSSTLASRLESDATL  805

Query  579  VQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLAVVPLIAVAGGTYTLIMSNLSQ  758
            ++  + D+    ++ +      F + FI  W+LTLV +A+ PLI     +  L MS    
Sbjct  806  LRTVVVDRSTILLQNVGLVATSFIIAFILNWRLTLVVIAMYPLIVSGHISEKLFMSGFGG  865

Query  759  KGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYSKSL  878
                AY  A   A EA+S +RTV +F  E+K  + Y++ L
Sbjct  866  DLSKAYLRANMFAGEAVSNIRTVAAFCAEEKVTDLYAREL  905



>gb|AIU41630.1| ABC transporter family protein [Hevea brasiliensis]
Length=1135

 Score =   242 bits (617),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 115/152 (76%), Positives = 134/152 (88%), Gaps = 0/152 (0%)
 Frame = +3

Query  444  QTGERQTARLRLRYLQSVLRKKIEFFDTDTRAKDIIFHISSDAILVQDAIGDKIGHTIRY  623
            QTGERQTARLRL Y QSVL+K + FFDT+    +II+HISSDAILVQDAIGDK GH IRY
Sbjct  2    QTGERQTARLRLEYFQSVLKKDMNFFDTEAGDSNIIYHISSDAILVQDAIGDKTGHAIRY  61

Query  624  ISQFLVGFAVGFISVWKLTLVTLAVVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEE  803
            + QF+VGFA+GF SVW+LTL+TLAVVPLIA+AGG YT+IMS LS+KGEAAYAEAGKVA+E
Sbjct  62   LCQFIVGFAIGFASVWQLTLLTLAVVPLIAIAGGAYTVIMSTLSEKGEAAYAEAGKVADE  121

Query  804  AISQVRTVYSFVGEKKAVESYSKSLNNALVLG  899
             ISQ+RTVYSFVGE KA+E+YS+SL +AL LG
Sbjct  122  VISQIRTVYSFVGEHKAIEAYSRSLTSALKLG  153


 Score = 78.6 bits (192),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 55/223 (25%), Positives = 108/223 (48%), Gaps = 4/223 (2%)
 Frame = +3

Query  216  DTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLSSDSHRLSSQVSKQALYLVYL  395
            +  ++   + GS+GA + G   P+F +    ++ +    S D+  +  ++ + +L  V L
Sbjct  561  NAPEWPCALLGSLGAILAGMEAPLFALGITHVLTAF--YSHDASEMRHEIQRVSLIFVGL  618

Query  396  GSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKKIEFFD-TDTRAKDIIFHISSDA  572
              +      +   F+T  GER T R+RL    ++L  +I +FD  +     +   +S+DA
Sbjct  619  AVVTVPIYLLQHYFYTLMGERLTTRVRLSMFSAILCNEIGWFDLEENNTGSLTSALSADA  678

Query  573  ILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLAVVPLIAVAGGTYTLIMSNL  752
             LV+ A+ D++   ++  +  +   A+ F   W++  V +A +PL+  A     L +   
Sbjct  679  TLVRSALSDRLSTIVQNAALTVTACAIAFTLSWRIAAVVVASLPLLVGASIAEQLFLKGF  738

Query  753  SQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYSKSLN  881
                  AY+ A  VA EA++ +RTV +F  E++    ++  LN
Sbjct  739  GGDYH-AYSRATAVAREALTNIRTVAAFGAEERISVQFASELN  780



>gb|EAZ32166.1| hypothetical protein OsJ_16371 [Oryza sativa Japonica Group]
Length=1213

 Score =   241 bits (614),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 114/221 (52%), Positives = 157/221 (71%), Gaps = 0/221 (0%)
 Frame = +3

Query  237  MVFGSIGACIHGAALPVFFVLFGRMIDSLGHLSSDSHRLSSQVSKQALYLVYLGSIIFIS  416
            M  GS+GA  HGAA+P+FF+LFG +I+  G   +D   ++ +VSK ALY VYLG ++  S
Sbjct  1    MAAGSLGALAHGAAMPLFFLLFGDLINGFGKNQTDLRTMTDEVSKYALYFVYLGLVVCAS  60

Query  417  AWIGVAFWTQTGERQTARLRLRYLQSVLRKKIEFFDTDTRAKDIIFHISSDAILVQDAIG  596
            ++  +A W  TGERQ   LR  YL +VLR+ + FFDTD R  DI+F +S+D +LVQDAIG
Sbjct  61   SYAEIACWMYTGERQVIALRKAYLDAVLRQDVGFFDTDARTGDIVFGVSTDTLLVQDAIG  120

Query  597  DKIGHTIRYISQFLVGFAVGFISVWKLTLVTLAVVPLIAVAGGTYTLIMSNLSQKGEAAY  776
            +K+G+ I YI+ FL G  VGF++ W+L L+++AV+P IA AGG Y   ++ L+ K   +Y
Sbjct  121  EKVGNFIHYIATFLAGLVVGFVAAWRLALLSVAVIPAIAFAGGLYAYTLTGLTSKSRESY  180

Query  777  AEAGKVAEEAISQVRTVYSFVGEKKAVESYSKSLNNALVLG  899
            A AG VAE+AI+QVRTVYSF GE KA+ SYS+++ N L LG
Sbjct  181  ANAGVVAEQAIAQVRTVYSFAGESKALNSYSEAIQNTLKLG  221


 Score = 90.5 bits (223),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 68/264 (26%), Positives = 133/264 (50%), Gaps = 17/264 (6%)
 Frame = +3

Query  102  TFSMGELEISSNLKMDQQ-PSNSTDRKEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAA  278
            T + G +E+ SN   D++ P+          FF L    +  ++ + V G++G+ + G  
Sbjct  610  TGANGRIEMISNADNDRKYPAPRG------YFFKLLKL-NAPEWPYAVLGAVGSVLSGFI  662

Query  279  LPVFFVLFGRMIDSLGHLSSDSHRLSSQVSKQALYL-VYLGSIIF--ISAWIGVAFWTQT  449
             P F ++ G M+D   +   D + +     K  LY+ +Y+G+ ++  ++  +   F++  
Sbjct  663  GPTFAIVMGEMLDVFYY--RDPNEMEK---KTKLYVFIYIGTGLYAVVAYLVQHYFFSIM  717

Query  450  GERQTARLRLRYLQSVLRKKIEFFDTDTRAKDIIF-HISSDAILVQDAIGDKIGHTIRYI  626
            GE  T R+R   L ++L  ++ +FD +     ++   ++ DA  V+ AI ++I   ++ +
Sbjct  718  GENLTTRVRRMMLSAILTNEVGWFDEEENNSSLVAARLAVDAADVKSAIAERISVILQNM  777

Query  627  SQFLVGFAVGFISVWKLTLVTLAVVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEA  806
            +  +  F VGFI  W++ L+ LA  PL+ +A     L M   +     A+A++  VA E 
Sbjct  778  TSLMTSFIVGFIIEWRVALLILATFPLLVLANFAQQLSMKGFAGDTAKAHAKSSMVAGEG  837

Query  807  ISQVRTVYSFVGEKKAVESYSKSL  878
            +S +RTV +F  + K +  +S  L
Sbjct  838  VSNIRTVAAFNAQNKILSLFSYEL  861



>emb|CDX92739.1| BnaC07g39970D [Brassica napus]
Length=1241

 Score =   241 bits (614),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 121/262 (46%), Positives = 175/262 (67%), Gaps = 5/262 (2%)
 Frame = +3

Query  120  LEISSNL--KMDQQPSNSTDRKEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFF  293
            +E S +L  +M+++   +T     VSF  LFS AD  D   M  GSIGACIHGA++PVFF
Sbjct  1    MEPSHDLATEMEKEKKAATPN---VSFLKLFSFADFNDCVLMTLGSIGACIHGASVPVFF  57

Query  294  VLFGRMIDSLGHLSSDSHRLSSQVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARL  473
            + FG++I+ +G    D H+ S +V+K +L  VYL  +I  S+WI VA W  TGERQ A++
Sbjct  58   IFFGKLINIIGTAYMDRHQASHKVAKYSLDFVYLSVVILFSSWIEVACWMHTGERQAAKM  117

Query  474  RLRYLQSVLRKKIEFFDTDTRAKDIIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAV  653
            R  YL+S+L + I  FDT+    ++I  I+SD ++VQDA+ +K+G+ + YIS+F+ GFA+
Sbjct  118  RRAYLRSMLSQDISLFDTEASTGEVISAITSDMLVVQDALSEKVGNFLHYISRFIAGFAI  177

Query  654  GFISVWKLTLVTLAVVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYS  833
            GF SVW+++LVTLA+VPLIA+AGG Y  +   L  +   +Y +AG+VAEE I  VRTV +
Sbjct  178  GFTSVWQISLVTLAIVPLIALAGGIYAFVAIGLIARVRKSYIKAGQVAEEVIGNVRTVQA  237

Query  834  FVGEKKAVESYSKSLNNALVLG  899
            F GE++A + Y  +L N    G
Sbjct  238  FTGEERAAKLYRGALKNTYKYG  259


 Score = 87.0 bits (214),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 60/219 (27%), Positives = 109/219 (50%), Gaps = 3/219 (1%)
 Frame = +3

Query  225  DYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLSSDSHRLSSQVSKQALYLVYLGSI  404
            D+ + + G++ A I G+ +P+F +     + S      D+ +   +V K A+   +  +I
Sbjct  666  DWMYGICGTLCAFIAGSLMPLFALGVSHSLVSYYEKGWDNTQ--KEVKKIAILFCFASAI  723

Query  405  IFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKKIEFFD-TDTRAKDIIFHISSDAILV  581
              I   I    +   GER T R+R +   ++L+ ++ +FD  D  +  +   + SDA L+
Sbjct  724  TLIVHTIEHLCFGIMGERLTRRVREKMFLAILKNEMGWFDEVDNTSSMLASRLESDATLL  783

Query  582  QDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLAVVPLIAVAGGTYTLIMSNLSQK  761
            +  + D+    ++ +   +  F + F+  W+LTLV LA  PL+     +  L M      
Sbjct  784  KTIVVDRSTILLQNLGLVVTSFVISFMLNWRLTLVVLATYPLVISGHISEKLFMQGYGGN  843

Query  762  GEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYSKSL  878
               AY +A  +A E++S +RTV +F  E+K +E YSK L
Sbjct  844  LSKAYLKANMLAGESVSNIRTVAAFCAEEKVLELYSKEL  882



>ref|XP_003625677.1| ABC transporter-like protein, partial [Medicago truncatula]
Length=658

 Score =   235 bits (600),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 106/273 (39%), Positives = 182/273 (67%), Gaps = 3/273 (1%)
 Frame = +3

Query  90   SVAITFSMGELEISSNLKMDQQPSNSTDR---KEMVSFFGLFSAADTVDYFFMVFGSIGA  260
            +  ++ S  ++++S  ++  ++   S ++      V F  LF  AD +DY  M  G++GA
Sbjct  50   TATVSDSQNQVQVSKEMEEHKKDGGSKEKVKSAPAVGFGELFRFADGLDYILMTIGTVGA  109

Query  261  CIHGAALPVFFVLFGRMIDSLGHLSSDSHRLSSQVSKQALYLVYLGSIIFISAWIGVAFW  440
             +HG +LP+F   F  +++S G  +++  +++ +V K A Y + +G+ I+ S+W  ++ W
Sbjct  110  IVHGCSLPLFLRFFADLVNSFGSNANNLDKMTQEVVKYAFYFLVVGAAIWASSWAEISCW  169

Query  441  TQTGERQTARLRLRYLQSVLRKKIEFFDTDTRAKDIIFHISSDAILVQDAIGDKIGHTIR  620
              TGERQ+ ++R++YL++ L++ IEFFDT+ R  D++F I++DA++VQDAI +K+G+ I 
Sbjct  170  MWTGERQSTKMRIKYLEAALKQDIEFFDTEVRTSDVVFAINTDAVMVQDAISEKLGNFIH  229

Query  621  YISQFLVGFAVGFISVWKLTLVTLAVVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAE  800
            Y++ F+ GF VGF +VW+L LVTLAVVP+IAV GG +T  ++ LS K + A ++AG + E
Sbjct  230  YMATFVSGFVVGFTAVWQLALVTLAVVPMIAVIGGIHTTTLAKLSSKSQEALSQAGNIVE  289

Query  801  EAISQVRTVYSFVGEKKAVESYSKSLNNALVLG  899
            + + Q+R V +FVGE +A++ YS +L  A  LG
Sbjct  290  QTVVQIRVVLAFVGESRALQGYSSALKVAQKLG  322



>ref|XP_009396844.1| PREDICTED: ABC transporter B family member 2-like [Musa acuminata 
subsp. malaccensis]
Length=1241

 Score =   240 bits (612),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 119/243 (49%), Positives = 168/243 (69%), Gaps = 2/243 (1%)
 Frame = +3

Query  162  NSTDRKEM--VSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLS  335
            +   +KE+  V F  LF+ ADT DYF M  GSIGAC HGA++PVFF+ FG++I+ +G   
Sbjct  13   DGASKKEVHKVPFLKLFAFADTWDYFLMALGSIGACAHGASVPVFFIFFGKLINIIGVAF  72

Query  336  SDSHRLSSQVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKKIE  515
                 +S +V+K +L  VYLG  I  S+W  VA W  TGERQ A++RL YL+S+L + I 
Sbjct  73   LFPTTVSHRVAKYSLDFVYLGIAILFSSWTEVACWMHTGERQAAKMRLAYLRSMLDQDIA  132

Query  516  FFDTDTRAKDIIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLA  695
             FDT+    ++I  I+SD I+VQDAI +K+G+ + YIS+F+ GFA+GF  VW+++LVTL+
Sbjct  133  VFDTEASTGEVIAAITSDIIVVQDAISEKVGNFMHYISRFIAGFAIGFARVWQISLVTLS  192

Query  696  VVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYSKS  875
            +VPLIA+AGG Y  + + L  +   +Y +AG++AEE I  VRTV +FVGE+KAV SY  +
Sbjct  193  IVPLIAIAGGIYAYVATGLIARVRKSYVKAGEIAEEVIGNVRTVQAFVGEEKAVRSYRSA  252

Query  876  LNN  884
            L N
Sbjct  253  LMN  255


 Score = 80.1 bits (196),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 67/241 (28%), Positives = 116/241 (48%), Gaps = 9/241 (4%)
 Frame = +3

Query  174  RKEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLSSDSHRL  353
            + + VS   L+S     D+ F V G++GA + GA +P+F +   + + S   +   + R 
Sbjct  660  KAKPVSLKKLYSMVRP-DWIFGVIGTLGAFVAGAQMPLFALGVTQALVSYYMVWETTQR-  717

Query  354  SSQVSKQALYLVYLGSI--IFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKKIEFFDT  527
              +V K AL L   G++  +F      + F    GER T R+R R    +LR +I +FD 
Sbjct  718  --EVKKIAL-LFCGGAVLTVFFHVIEHLNFGIM-GERLTLRVRERMFGVILRNEIGWFDD  773

Query  528  DTRAKDIIF-HISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLAVVP  704
             +    ++   + +DA L++  + D+    ++ I   +    + FI  W++TLV LA  P
Sbjct  774  MSNTSAMLTSRLETDATLLRTIVVDRSTILLQNIGMIVTSLIIAFILNWRITLVVLATYP  833

Query  705  LIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYSKSLNN  884
            L+     +  L M          Y +A  +A EA+S +RTV +F  E+K ++ Y + L  
Sbjct  834  LMVSGHISEKLFMRGYGGNLSKTYLKANMLAAEAVSNIRTVAAFCSEQKVIDLYVEELRE  893

Query  885  A  887
             
Sbjct  894  P  894



>ref|XP_010055294.1| PREDICTED: ABC transporter B family member 2-like isoform X1 
[Eucalyptus grandis]
 gb|KCW71762.1| hypothetical protein EUGRSUZ_E00260 [Eucalyptus grandis]
Length=1255

 Score =   239 bits (610),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 117/259 (45%), Positives = 171/259 (66%), Gaps = 2/259 (1%)
 Frame = +3

Query  114  GELEISSNLKMDQQPSNSTDRK--EMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPV  287
            GE+    ++K  +   +  +RK  + VS   LFS AD  D   M  GS+GAC+HG ++PV
Sbjct  11   GEVPDDDDVKKKRTGEDKAERKKPQRVSLLKLFSFADFYDCVLMAVGSVGACVHGVSVPV  70

Query  288  FFVLFGRMIDSLGHLSSDSHRLSSQVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTA  467
            FF+ FG++I+ +G         S +V+K +L  VYL   I  S+WI VA W  TGERQ A
Sbjct  71   FFIFFGKLINVIGMAYLFPKEASHKVAKYSLDFVYLSVAILFSSWIEVACWMHTGERQAA  130

Query  468  RLRLRYLQSVLRKKIEFFDTDTRAKDIIFHISSDAILVQDAIGDKIGHTIRYISQFLVGF  647
            ++R+ YL+S+L + I  FDT+    ++I  I+SD ILVQDA+ +K+G+ I YIS+FL GF
Sbjct  131  KMRMAYLRSMLSQDISIFDTEASTGEVISAITSDIILVQDALSEKVGNFIHYISRFLGGF  190

Query  648  AVGFISVWKLTLVTLAVVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTV  827
             +GF+ VW++TLVTL++VPLIA+AGG Y  + + L  +   +Y +AG++AEE I  VRTV
Sbjct  191  IIGFVRVWQITLVTLSIVPLIAIAGGLYAYVATGLIARARKSYVKAGEIAEEVIGNVRTV  250

Query  828  YSFVGEKKAVESYSKSLNN  884
            ++F GE++AV SY  +L N
Sbjct  251  HAFAGEERAVRSYRSALIN  269


 Score = 82.0 bits (201),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 58/219 (26%), Positives = 109/219 (50%), Gaps = 4/219 (2%)
 Frame = +3

Query  225  DYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLSSDSHRLSSQVSKQALYLVYLGSI  404
            D+ + +FG+I A I GA +P+F +   + + S  ++  ++ +   +V K +L       +
Sbjct  689  DWIYGMFGTICALIAGAQMPLFALGVSQALVSY-YMGWETTK--HEVKKISLLFCGAAVV  745

Query  405  IFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKKIEFFD-TDTRAKDIIFHISSDAILV  581
              I   I    +   GER T R+R R   ++L+ +I +FD  +  +  +   + +DA L+
Sbjct  746  TVIVHAIEHCCFGIMGERLTLRVRERMFAAILKNEIGWFDDVNNTSAMLSSRLETDATLL  805

Query  582  QDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLAVVPLIAVAGGTYTLIMSNLSQK  761
            +  + D+    ++ +   L  F + FI  W++TLV +A  PLI     +  + M      
Sbjct  806  RTVVVDRATILLQNMGLVLGSFVIAFILNWRITLVVIATYPLIISGHISEKMFMRGYGGN  865

Query  762  GEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYSKSL  878
               AY  A  +A EA+S +RT+ +F  E+K ++ Y+  L
Sbjct  866  LSKAYLRANMLAGEAVSNIRTIAAFCSEEKVIDLYASEL  904



>ref|XP_008238211.1| PREDICTED: ABC transporter B family member 2-like [Prunus mume]
Length=1271

 Score =   239 bits (610),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 113/242 (47%), Positives = 165/242 (68%), Gaps = 0/242 (0%)
 Frame = +3

Query  159  SNSTDRKEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLSS  338
            +NS D++  VS   LFS AD+ DYF M  GS+GAC+HGA++PVFF+ FG++I+ +G    
Sbjct  39   NNSKDKQRKVSLLKLFSFADSYDYFLMAIGSVGACVHGASVPVFFIFFGKLINIIGMAYL  98

Query  339  DSHRLSSQVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKKIEF  518
                 SS+V+K +L  VYL   I  S+W  VA W  TGERQ A++R+ YL+++L + I  
Sbjct  99   FPKEASSKVAKYSLDFVYLSVAILFSSWTEVACWMHTGERQAAKMRMAYLRAMLNQDISL  158

Query  519  FDTDTRAKDIIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLAV  698
            FDT+    ++I  I+SD I+VQDA+ +K+G+ + YIS+FL GF +GF+ VW+++LVTL++
Sbjct  159  FDTEASTGEVISAITSDIIVVQDALSEKVGNFMHYISRFLAGFIIGFVRVWQISLVTLSI  218

Query  699  VPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYSKSL  878
            VPLIA+AGG Y  +   L  +   +Y +AG++AEE I  VRTV +F  E+KAV  Y  +L
Sbjct  219  VPLIALAGGLYAYVTIGLIARVRKSYVKAGEIAEEVIGNVRTVQAFAAEEKAVREYKTAL  278

Query  879  NN  884
             N
Sbjct  279  LN  280


 Score = 90.9 bits (224),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 64/219 (29%), Positives = 111/219 (51%), Gaps = 4/219 (2%)
 Frame = +3

Query  225  DYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLSSDSHRLSSQVSKQALYLVYLGSI  404
            D+++ V G+IGA I GA +P+F +   + + S  ++  D+     ++ K +L       +
Sbjct  700  DWYYGVIGTIGALIAGAQMPLFALGVSQALVSF-YMDWDT--TCREIKKISLLFCGAAVL  756

Query  405  IFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKKIEFFD-TDTRAKDIIFHISSDAILV  581
              I   I    +   GER T R+R +   ++LR +I +FD T+  +  +   + SDA L+
Sbjct  757  TVIVHAIEHLCFGIMGERLTLRVREKMFSAILRNEIGWFDDTNNTSSMLSSRLESDATLL  816

Query  582  QDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLAVVPLIAVAGGTYTLIMSNLSQK  761
            +  + D+    ++ +   +  F + FI  W++TLV LA  PLI     +  L M      
Sbjct  817  RTIVVDRSTILLQNVGLVVASFIIAFILNWRITLVVLATYPLIISGHISEKLFMQGYGGN  876

Query  762  GEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYSKSL  878
               AY  A  +A EA+S +RTV +F  E+K ++ YS+ L
Sbjct  877  LSKAYLRANMLAGEAVSNMRTVAAFCSEEKVIDLYSREL  915



>ref|XP_007210429.1| hypothetical protein PRUPE_ppa000340mg [Prunus persica]
 gb|EMJ11628.1| hypothetical protein PRUPE_ppa000340mg [Prunus persica]
Length=1267

 Score =   238 bits (608),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 113/242 (47%), Positives = 164/242 (68%), Gaps = 0/242 (0%)
 Frame = +3

Query  159  SNSTDRKEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLSS  338
            +NS D+   VS   LFS AD+ DYF M  GS+GAC+HGA++PVFF+ FG++I+ +G    
Sbjct  38   NNSKDKLRKVSLLKLFSFADSYDYFLMAIGSVGACVHGASVPVFFIFFGKLINIIGMAYL  97

Query  339  DSHRLSSQVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKKIEF  518
                 SS+V+K +L  VYL   I  S+W  VA W  TGERQ A++R+ YL+++L + I  
Sbjct  98   FPKEASSKVAKYSLDFVYLSVAILFSSWTEVACWMHTGERQAAKMRMAYLRAMLNQDISL  157

Query  519  FDTDTRAKDIIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLAV  698
            FDT+    ++I  I+SD I+VQDA+ +K+G+ + YIS+FL GF +GF+ VW+++LVTL++
Sbjct  158  FDTEASTGEVISAITSDIIVVQDALSEKVGNFMHYISRFLAGFIIGFVRVWQISLVTLSI  217

Query  699  VPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYSKSL  878
            VPLIA+AGG Y  +   L  +   +Y +AG++AEE I  VRTV +F  E+KAV  Y  +L
Sbjct  218  VPLIALAGGVYAYVTIGLIARVRKSYVKAGEIAEEVIGNVRTVQAFAAEEKAVREYKTAL  277

Query  879  NN  884
             N
Sbjct  278  LN  279


 Score = 91.3 bits (225),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 64/219 (29%), Positives = 112/219 (51%), Gaps = 4/219 (2%)
 Frame = +3

Query  225  DYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLSSDSHRLSSQVSKQALYLVYLGSI  404
            D+++ V G+IGA I GA +P+F +   + + S  ++  D+     ++ K +L       +
Sbjct  699  DWYYGVIGTIGALIAGAQMPLFALGVSQALVSF-YMDWDT--TCREIKKISLLFCGAAVL  755

Query  405  IFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKKIEFFD-TDTRAKDIIFHISSDAILV  581
              I   I    +   GER T R+R +   ++LR +I +FD T+  +  +   + SDA L+
Sbjct  756  TVIVHAIEHLCFGIMGERLTLRVREKMFSAILRNEIGWFDDTNNTSSMLSSRLESDATLL  815

Query  582  QDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLAVVPLIAVAGGTYTLIMSNLSQK  761
            +  + D+    ++ +   +  F + FI  W++TLV LA  PLI     +  L M      
Sbjct  816  RTIVVDRSTILLQNVGLVVASFIIAFILNWRITLVVLATYPLIISGHISEKLFMQGYGGN  875

Query  762  GEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYSKSL  878
               AY +A  +A EA+S +RTV +F  E+K ++ YS+ L
Sbjct  876  LSKAYLKANMLAGEAVSNMRTVAAFCSEEKVIDLYSREL  914



>ref|XP_009789853.1| PREDICTED: ABC transporter B family member 1 isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009789854.1| PREDICTED: ABC transporter B family member 1 isoform X2 [Nicotiana 
sylvestris]
 ref|XP_009789855.1| PREDICTED: ABC transporter B family member 1 isoform X3 [Nicotiana 
sylvestris]
Length=1337

 Score =   239 bits (609),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 109/260 (42%), Positives = 178/260 (68%), Gaps = 2/260 (1%)
 Frame = +3

Query  120  LEISSNLKMDQQPSNSTDRKEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFVL  299
            +E+S   K   +  N+  + E V F  LF  AD++DY  M  GS+GA +HG +LP+F   
Sbjct  57   MEVSEGKKEGNEKPNT--QPEAVGFGELFRFADSLDYVLMAIGSLGAFVHGCSLPLFLRF  114

Query  300  FGRMIDSLGHLSSDSHRLSSQVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARLRL  479
            F  +++S G  ++D  +++ +V K A Y + +G+ I+ S+W  ++ W  TGERQT ++R+
Sbjct  115  FADLVNSFGSYANDVDKMTQEVLKYAFYFLVVGAAIWASSWAEISCWMWTGERQTTKMRI  174

Query  480  RYLQSVLRKKIEFFDTDTRAKDIIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGF  659
            +YL++ L + I++FDT+ R  D++F I++DA++VQDAI +K+G+ I Y++ F+ GF VGF
Sbjct  175  KYLEAALNQDIQYFDTEVRTSDVVFAINTDAVMVQDAISEKLGNFIHYMATFVSGFVVGF  234

Query  660  ISVWKLTLVTLAVVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFV  839
             +VW+L LVTLAVVPLIAV G  +T+ ++ LS K + A ++AG + E+ + Q+RTV +FV
Sbjct  235  TAVWQLALVTLAVVPLIAVIGAIHTITLAKLSGKSQEALSKAGNIVEQTVVQIRTVLAFV  294

Query  840  GEKKAVESYSKSLNNALVLG  899
            GE KA+++YS +L  +  +G
Sbjct  295  GESKAMQAYSAALKVSQKIG  314


 Score =   110 bits (274),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 75/239 (31%), Positives = 127/239 (53%), Gaps = 3/239 (1%)
 Frame = +3

Query  177  KEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLSSDSHRLS  356
            K+  S FG  +  ++ ++ + + GSIG+ I G+ L  FF      + S+ + + D   +S
Sbjct  729  KDQASSFGRLAKMNSPEWSYALVGSIGSVICGS-LSAFFAYVLSAVLSV-YYNPDHTYMS  786

Query  357  SQVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKKIEFFDTDTR  536
             Q++K    L+ + S   I   +   FW   GE  T R+R + L +VL+ ++ +FD +  
Sbjct  787  KQIAKYCYLLIGVSSAALIFNTLQHFFWDVVGENLTKRVREKMLDAVLKMEMAWFDQEEN  846

Query  537  -AKDIIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLAVVPLIA  713
             +  I   ++ DA  V+ AIGD+I   ++  +  LV    GF+  W+L LV +AV P++ 
Sbjct  847  DSSRIAARLALDANNVRSAIGDRISVIMQNSALMLVACTAGFVLQWRLALVLIAVFPVVV  906

Query  714  VAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYSKSLNNAL  890
             A     + M+  S   EAA+A+A ++A EA++ VRTV +F  E K V  ++ SL   L
Sbjct  907  AATVLQKMFMTGFSGDLEAAHAKATQLAGEAVANVRTVAAFNSETKIVNLFNSSLQTPL  965



>ref|XP_010540773.1| PREDICTED: ABC transporter B family member 2-like [Tarenaya hassleriana]
Length=1250

 Score =   238 bits (607),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 117/233 (50%), Positives = 160/233 (69%), Gaps = 0/233 (0%)
 Frame = +3

Query  186  VSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLSSDSHRLSSQV  365
            VS   LFS AD  DY  M  GSIGAC+HGA++PVFF+ FG++I+ +G         S QV
Sbjct  29   VSLVKLFSFADFYDYVLMAIGSIGACVHGASVPVFFIFFGKLINIIGIAYLFPKEASPQV  88

Query  366  SKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKKIEFFDTDTRAKD  545
            +K +L  VYL   I  S+WI VA W  TGERQ A++R+ YL S+LR+ I  FDT+    +
Sbjct  89   AKYSLDFVYLSVAILFSSWIEVACWMHTGERQAAKMRMAYLSSMLRQDISVFDTEASTGE  148

Query  546  IIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLAVVPLIAVAGG  725
            +I  I+SD I+VQDA+ +K+G+ + YIS+F  GFA+GF  VW+++LVTL++VPLIA+AGG
Sbjct  149  VISAITSDIIVVQDALSEKVGNFLHYISRFTAGFAIGFARVWQISLVTLSIVPLIALAGG  208

Query  726  TYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYSKSLNN  884
             Y  I + L  +   +Y +AG++AEE I  VRTV +FVGE+KAV SY  +L N
Sbjct  209  LYAYIATGLLARVRKSYVKAGEIAEEVIGNVRTVQAFVGEEKAVRSYRDALKN  261


 Score = 84.7 bits (208),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 66/243 (27%), Positives = 114/243 (47%), Gaps = 4/243 (2%)
 Frame = +3

Query  153  QPSNSTDRKEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHL  332
            +P  +   K +    G   +    D+ + V G IGA I GA +P+F +     + S  ++
Sbjct  655  RPETTDPTKRVKVTAGRLYSMIRPDWPYGVSGMIGALIAGAQMPLFALGVSHALVSY-YM  713

Query  333  SSDSHRLSSQVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKKI  512
              D+ R   +V + ++       +  I   I    +   GER T R+R     +VL+ +I
Sbjct  714  DWDTTR--HEVRRISILFCCAAIVTVIVHTIEHTSFGIMGERLTLRVREMMFSAVLKNEI  771

Query  513  EFFDTDTRAKDIIF-HISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVT  689
             +FD       ++   + SDA L++  + D+    ++ +   +  F + FI  W+LTLV 
Sbjct  772  GWFDDMNNTSSMLASRLESDATLMRTIVVDRSTILLQNVGLVVASFIISFILNWRLTLVV  831

Query  690  LAVVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYS  869
            LA  PL+     +  L M         AY +A  +A EA+S +RTV +F  E+K ++ YS
Sbjct  832  LATYPLVISGHISEKLFMQGYGGNLSKAYLKANMIAGEAVSNIRTVAAFCSEEKVLDLYS  891

Query  870  KSL  878
            + L
Sbjct  892  REL  894



>gb|KEH42187.1| ABC transporter B family protein [Medicago truncatula]
Length=1321

 Score =   238 bits (608),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 112/271 (41%), Positives = 185/271 (68%), Gaps = 5/271 (2%)
 Frame = +3

Query  102  TFSMGELEISSNLKMDQQP--SNSTDRKEMVS---FFGLFSAADTVDYFFMVFGSIGACI  266
            + S  ++E  ++L  D+    SN  ++ + V+   F  LF  AD +DY  M+ GS+GA +
Sbjct  25   SLSKEQMEEEASLPKDKSCDVSNGNEKVKNVASVGFCELFRFADGLDYVLMIIGSLGAVV  84

Query  267  HGAALPVFFVLFGRMIDSLGHLSSDSHRLSSQVSKQALYLVYLGSIIFISAWIGVAFWTQ  446
            HG +LP+F   F  +++S G  +++  +++ +V+K ALY + +G+ I+ S+W  ++ W  
Sbjct  85   HGCSLPLFLRFFADLVNSFGSNANNLDKMTQEVAKYALYFLIVGAAIWASSWAEISCWMW  144

Query  447  TGERQTARLRLRYLQSVLRKKIEFFDTDTRAKDIIFHISSDAILVQDAIGDKIGHTIRYI  626
            TGERQ+ ++R++YL++ L + I+FFDT+ R  D++F I+SDA++VQDAI +K+G+ + Y+
Sbjct  145  TGERQSTKMRIKYLEAALDQDIQFFDTEVRTSDVVFAINSDAVMVQDAISEKLGNFVHYM  204

Query  627  SQFLVGFAVGFISVWKLTLVTLAVVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEA  806
            + F+ GFAVGF +VW+L LVTLAVVP+IAV GG +T+ +  LS K + A ++AG + E+ 
Sbjct  205  ATFVSGFAVGFTAVWQLALVTLAVVPMIAVIGGIHTITLGKLSGKSQEALSQAGNIVEQT  264

Query  807  ISQVRTVYSFVGEKKAVESYSKSLNNALVLG  899
            I Q+R V +FVGE KA++ YS +L  A  +G
Sbjct  265  IVQIRVVLAFVGETKALQGYSSALRVAQKIG  295


 Score = 95.9 bits (237),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 73/239 (31%), Positives = 125/239 (52%), Gaps = 3/239 (1%)
 Frame = +3

Query  177  KEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLSSDSHRLS  356
            K+  S F   +  ++ ++ + + GSIG+ + G+ L  FF      + S+ +  S  H + 
Sbjct  711  KDQASSFWRLAKMNSPEWLYALIGSIGSIVCGS-LSAFFAYVLSAVLSVYYNPSHKHMIR  769

Query  357  SQVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKKIEFFD-TDT  533
             ++ K    L+ L S   +   +   FW   GE  T R+R + L +VL+ ++ +FD  + 
Sbjct  770  -EIEKYCYLLIGLSSAALVFNTLQHFFWDTVGENLTKRVREKMLSAVLKNEMAWFDREEN  828

Query  534  RAKDIIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLAVVPLIA  713
             +  I   ++ DA  V+ AIGD+I   ++  +  LV    GF+  W+L LV +AV P++ 
Sbjct  829  ESARIAARLALDANNVRSAIGDRISVIVQNTALLLVACTAGFVLQWRLALVLVAVFPVVV  888

Query  714  VAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYSKSLNNAL  890
             A     + M+  S   EAA+A+A ++A EAI+ VRTV +F  EKK V  ++ +L   L
Sbjct  889  AATVLQKMFMTGFSGDLEAAHAKATQLAGEAIANVRTVAAFNSEKKIVGLFASNLETPL  947



>ref|XP_003572841.1| PREDICTED: ABC transporter B family member 2-like [Brachypodium 
distachyon]
Length=1256

 Score =   238 bits (606),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 115/233 (49%), Positives = 163/233 (70%), Gaps = 0/233 (0%)
 Frame = +3

Query  180  EMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLSSDSHRLSS  359
            E V F  LFS AD  DY  M  GS+GAC HGA++PVFF+ FG++I+ +G        +S 
Sbjct  22   EKVPFLKLFSFADRWDYVLMAVGSLGACAHGASVPVFFIFFGKLINIIGIAYLFPTEVSG  81

Query  360  QVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKKIEFFDTDTRA  539
            +V+K +L  VYLG +I  S+W  VA W  TGERQ A++RL YL+S+L + I  FDT+   
Sbjct  82   RVAKYSLDFVYLGVVILFSSWTEVACWMHTGERQAAKMRLAYLRSMLEQDIAVFDTEAST  141

Query  540  KDIIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLAVVPLIAVA  719
             ++I  I+SD ++VQDAI +K+G+ + YIS+F+ GFA+GF  VW+++LVTLA+VPLIA+A
Sbjct  142  GEVINAITSDILVVQDAISEKVGNFMHYISRFVAGFAIGFSQVWQISLVTLAIVPLIAIA  201

Query  720  GGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYSKSL  878
            GG Y  +   L  +   +Y +AG++AEEAI  VRTV +FVGE+KAV +Y ++L
Sbjct  202  GGVYAYVTIGLMARVRKSYVKAGEIAEEAIGNVRTVQAFVGEEKAVRAYREAL  254


 Score = 78.2 bits (191),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 57/221 (26%), Positives = 109/221 (49%), Gaps = 4/221 (2%)
 Frame = +3

Query  225  DYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLSSDSHRLSSQVSKQALYLVYLGSI  404
            D+ F + G+I A + GA +P+F +   + + S  ++  D+ +   +V K A+       +
Sbjct  681  DWMFGLSGTISAFVAGAQMPLFALGVTQALVSY-YMGWDTTK--KEVRKIAILFCCGAVL  737

Query  405  IFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKKIEFFDTDTRAKDIIF-HISSDAILV  581
              I   I    +   GER T R+R +   ++LR +I +FD+ +    ++   + +DA LV
Sbjct  738  TVIFHAIEHLSFGIMGERLTLRVREKMFAAILRNEIGWFDSTSHTSAMLSSRLETDATLV  797

Query  582  QDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLAVVPLIAVAGGTYTLIMSNLSQK  761
            +  + D+    ++ +   +    + FI  W++TLV LA  PL+     +  + M      
Sbjct  798  RTIVVDRSTILLQNVGMIVTSLIIAFILNWRITLVVLATYPLMVSGHISEKMFMKGYGGN  857

Query  762  GEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYSKSLNN  884
               +Y +A  +A EA+S +RTV +F  E+K ++ Y+  L  
Sbjct  858  LGKSYLKANMLAAEAVSNIRTVAAFCAEEKVIKLYADELKE  898



>ref|XP_010274279.1| PREDICTED: ABC transporter B family member 2-like isoform X1 
[Nelumbo nucifera]
Length=1252

 Score =   237 bits (605),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 116/257 (45%), Positives = 172/257 (67%), Gaps = 0/257 (0%)
 Frame = +3

Query  129  SSNLKMDQQPSNSTDRKEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFVLFGR  308
             S+ K +++ +    + E V F  LF+ AD+ DY  M+ GS+GAC+HGA++PVFF+ FG+
Sbjct  8    PSHDKEEKKEATDEKKTEKVPFTKLFAFADSWDYVLMLLGSVGACVHGASVPVFFIFFGK  67

Query  309  MIDSLGHLSSDSHRLSSQVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARLRLRYL  488
            +I+ +G        +S +V+  AL  VYL  ++  S+WI V+ W  TGERQ A++RL YL
Sbjct  68   LINIIGVAYLFPTLVSHKVAMYALDFVYLSIVVMFSSWIEVSCWMYTGERQAAKMRLVYL  127

Query  489  QSVLRKKIEFFDTDTRAKDIIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISV  668
            +S+L + I  FDT+    ++I  I+SD I+VQDAI +KIG+ + YIS+F+ GFA+GF  V
Sbjct  128  KSMLNQDISLFDTEASTAEVISAITSDVIVVQDAISEKIGNFMHYISRFIAGFAIGFARV  187

Query  669  WKLTLVTLAVVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEK  848
            W+++LVTL++VPLIA+AGG Y  I   L  +   +Y +AG++AEE I  VRTV +FVGE+
Sbjct  188  WQISLVTLSIVPLIAIAGGVYAYIAIGLMARVRKSYVKAGEIAEEVIGNVRTVQAFVGEE  247

Query  849  KAVESYSKSLNNALVLG  899
            KAV+ Y  +L      G
Sbjct  248  KAVKMYKDALAKTYTYG  264


 Score = 86.7 bits (213),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 64/241 (27%), Positives = 118/241 (49%), Gaps = 5/241 (2%)
 Frame = +3

Query  168  TDRKEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLSSDSH  347
            T+R++ VS   + S     D+ ++++G  GA + GA +P+F +   + + +  ++  D+ 
Sbjct  661  TERRKPVSMRRMISMV-LPDWVYIIYGVTGAIMSGAQMPLFALGVTQALVAY-YMDWDTT  718

Query  348  RLSSQVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKKIEFFD-  524
            R   Q+ K A        +  I   I    +   GER T R+R +   ++LR +I +FD 
Sbjct  719  R--HQIKKIAFLFCGGAVVTVIFHSIEHLSFGIIGERLTLRVREKMFAAILRNEIGWFDD  776

Query  525  TDTRAKDIIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLAVVP  704
            T+  +  +   + +DA L++  + D+    I  IS  +  F + F+  W++TLV +A  P
Sbjct  777  TNNTSSMLSSRLEADATLLRTIVVDRYSILIMNISMIVTSFIIAFLLNWRITLVIMATYP  836

Query  705  LIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYSKSLNN  884
            LI     +  L M         AY +A  +A EA+S +RTV +F  +   ++ Y++ L  
Sbjct  837  LIVSGHISEKLFMKGYGGNLNQAYLKANMLAGEAVSNIRTVAAFCSQDTVIDLYARELEE  896

Query  885  A  887
             
Sbjct  897  P  897



>ref|XP_004512509.1| PREDICTED: ABC transporter B family member 2-like [Cicer arietinum]
Length=1237

 Score =   237 bits (605),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 115/253 (45%), Positives = 168/253 (66%), Gaps = 1/253 (0%)
 Frame = +3

Query  144  MDQQPSNSTDRKE-MVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDS  320
            M+ + S    +KE  V    LF+ AD+ DY  M  GSIGACIHGA++PVFF+ FG++I+ 
Sbjct  1    MESKESGEERKKEHKVPLLKLFTFADSYDYVLMFIGSIGACIHGASVPVFFIFFGKLINV  60

Query  321  LGHLSSDSHRLSSQVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVL  500
            +G         S +V+K ++  VYL   I  S+W  VA W  TGERQ A++R+ YL+S+L
Sbjct  61   IGLAYLFPKEASHEVAKYSMDFVYLSIAILFSSWTEVACWMHTGERQAAKMRMAYLKSML  120

Query  501  RKKIEFFDTDTRAKDIIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLT  680
             + I  FDT+    ++I  I+SD I+VQDA+ +K+G+ + YIS+F+ GF +GF+ VW+++
Sbjct  121  NQDISLFDTEASTGEVISAITSDIIIVQDALSEKVGNFMHYISRFIAGFTIGFVRVWQIS  180

Query  681  LVTLAVVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVE  860
            LVTL++VPLIA+AGG Y  +   L  K   +Y +AG++AEE I  VRTV++F GE+KAV 
Sbjct  181  LVTLSIVPLIALAGGLYAYVTIGLIAKVRKSYVKAGEIAEEVIGNVRTVHAFAGEEKAVR  240

Query  861  SYSKSLNNALVLG  899
            SY  +L N  + G
Sbjct  241  SYKAALLNTYIYG  253


 Score = 86.3 bits (212),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 62/219 (28%), Positives = 108/219 (49%), Gaps = 4/219 (2%)
 Frame = +3

Query  225  DYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLSSDSHRLSSQVSKQALYLVYLGSI  404
            D+ + VFG++ A I GA +P+F +     + S  ++  D+ R   +V K A        +
Sbjct  668  DWPYGVFGTLCAFIAGAQMPLFALGISHALVSY-YMDWDTTR--HEVKKIAFLFCGAAVV  724

Query  405  IFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKKIEFFDTDTRAKDIIF-HISSDAILV  581
                  I   F+   GER T R+R +   ++L+ +I +FD  T    ++   + SDA L+
Sbjct  725  TITVHAIEHLFFGIMGERLTLRVREKMFTAILKNEIGWFDDTTNTSSMLSSRLESDATLL  784

Query  582  QDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLAVVPLIAVAGGTYTLIMSNLSQK  761
            +  + D+    ++ +   +  F + F+  W++TLV LA  PLI     +  L M      
Sbjct  785  RTIVVDRSTILLQNVGLVVASFIIAFLLNWRITLVVLATYPLIISGHISEKLFMKGYGGN  844

Query  762  GEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYSKSL  878
               AY +A  +A EA+S +RTV +F  E+K ++ Y+  L
Sbjct  845  LSKAYLKANMLAGEAVSNIRTVAAFCSEEKVLDLYANEL  883



>ref|XP_008800115.1| PREDICTED: ABC transporter B family member 2-like [Phoenix dactylifera]
Length=1250

 Score =   237 bits (605),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 114/236 (48%), Positives = 164/236 (69%), Gaps = 0/236 (0%)
 Frame = +3

Query  171  DRKEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLSSDSHR  350
            ++ + V F  LF+ AD  DYF M  GSIGAC+HGA++PVFF+ FG++I+ +G        
Sbjct  23   NKVQQVPFLKLFAFADAWDYFLMALGSIGACVHGASVPVFFIFFGKLINIIGIAYLFPTS  82

Query  351  LSSQVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKKIEFFDTD  530
            ++ +V+K +L  VYLG +I  S+W  VA W  TGERQ A++RL YL+S+L + I  FDT+
Sbjct  83   VTHRVAKYSLDFVYLGIVILFSSWTEVACWMHTGERQAAKMRLAYLRSMLDQDIGVFDTE  142

Query  531  TRAKDIIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLAVVPLI  710
                ++I  I+SD I+VQDAI +K+G+ + YIS+F+ GFAVGF  +W++ LVTL++VPLI
Sbjct  143  ASTGEVIAAITSDIIVVQDAISEKVGNFLHYISRFVAGFAVGFAHIWQIGLVTLSIVPLI  202

Query  711  AVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYSKSL  878
            A+AGG Y  I + L  +   +Y +AG++AEE I  VRTV +FVGE KAV +Y  +L
Sbjct  203  AIAGGIYAYIATGLIARVRKSYVKAGEIAEEVIGNVRTVQAFVGEDKAVRAYRNAL  258


 Score = 86.7 bits (213),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 68/244 (28%), Positives = 114/244 (47%), Gaps = 5/244 (2%)
 Frame = +3

Query  159  SNSTDRKEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLSS  338
            SN + +   VS   L+S     D+ F  FG+IGA + G+ +P+F +   + + S      
Sbjct  660  SNDSPKVRHVSVKRLYSMVRP-DWIFGAFGTIGALVAGSQMPLFALGVTQALVSYYMGWE  718

Query  339  DSHRLSSQVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKKIEF  518
             + R   +V K A+       +  I   I    +   GER T R+R     ++LR +I +
Sbjct  719  TTQR---EVKKIAILFCGGAVLTVIFHVIEHLNFGIMGERLTVRVREEMFGAILRNEIGW  775

Query  519  FD-TDTRAKDIIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLA  695
            FD T+  +  +   + +DA L++  + D+    ++ I   +    + FI  W+LTLV LA
Sbjct  776  FDDTNNTSAMLSSRLETDATLLRTIVVDRSTILLQNIGMIVTSLIIAFILNWRLTLVVLA  835

Query  696  VVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYSKS  875
              PL+     +  L M         AY +A  +A EA+S +RTV +F  E K ++ Y+  
Sbjct  836  TYPLMVSGHISEKLFMQGYGGNLNKAYLKANMLAAEAVSNIRTVAAFCSEGKVIDLYANE  895

Query  876  LNNA  887
            L   
Sbjct  896  LKEP  899



>ref|XP_006843046.1| hypothetical protein AMTR_s00076p00195870 [Amborella trichopoda]
 gb|ERN04721.1| hypothetical protein AMTR_s00076p00195870 [Amborella trichopoda]
Length=1332

 Score =   237 bits (605),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 109/238 (46%), Positives = 167/238 (70%), Gaps = 0/238 (0%)
 Frame = +3

Query  186  VSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLSSDSHRLSSQV  365
            V F  LF  AD +D   MV G+ GA +HG++LP+F   F  +++S G  + +  ++  +V
Sbjct  77   VGFMKLFRYADGLDCVLMVLGTAGAIVHGSSLPIFLRFFADLVNSFGSNADNPDKMMQEV  136

Query  366  SKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKKIEFFDTDTRAKD  545
             K A Y + +G+ I+ S+W  ++ W  TGERQT ++R++YL++ L + I++FDTD R  D
Sbjct  137  LKYAFYFLVVGAAIWGSSWAEISCWMWTGERQTTKMRIKYLEAALYQDIQYFDTDVRTSD  196

Query  546  IIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLAVVPLIAVAGG  725
            II+ I+SDA++VQDAI +K+G+ I Y++ F+ GF VGF +VW+L LVTLAVVPLIA+ GG
Sbjct  197  IIYAINSDAVMVQDAISEKLGNFIHYMATFVTGFIVGFTAVWQLALVTLAVVPLIAIIGG  256

Query  726  TYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYSKSLNNALVLG  899
             +   ++ LS K + A +EAG +AEE ISQ+RTV+S+VGE +A+++YS +L  A  +G
Sbjct  257  IHATTLTKLSSKTQDALSEAGNIAEETISQIRTVFSYVGESRALQAYSSALKVAQRIG  314


 Score = 86.3 bits (212),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 65/239 (27%), Positives = 123/239 (51%), Gaps = 3/239 (1%)
 Frame = +3

Query  177  KEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLSSDSHRLS  356
            K+  S F      ++ ++ + + GS+G+ + G+   +F  +   ++    + S D+  + 
Sbjct  730  KDQASSFWRLLKMNSPEWGYALLGSVGSVVCGSLSALFAYVLSAVLSV--YYSRDNSYMK  787

Query  357  SQVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKKIEFFDTDTR  536
             +++K    L+ + S   +   +   FW   GE  T R+R + L +VLR ++ +FD D  
Sbjct  788  REINKYCYLLIGVSSAALLFNTMQHFFWDIVGENLTKRVREKMLAAVLRNELTWFDQDEN  847

Query  537  -AKDIIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLAVVPLIA  713
             +  +   ++ DA  V+ AIGD+I   ++  +  LV  + GF+  W+L LV +AV P++ 
Sbjct  848  LSSRVAARLALDASNVRSAIGDRISVIMQNSALMLVACSAGFVLQWRLALVLVAVFPVVV  907

Query  714  VAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYSKSLNNAL  890
             A     + M   S   E A+++A ++A EA++ VRTV +F  E K V  ++  L + L
Sbjct  908  AATVLQKMFMKGFSGDLEGAHSKATQIAGEAVANVRTVAAFNSEAKIVGLFASKLQSPL  966



>ref|XP_003628784.1| ABC transporter B family member [Medicago truncatula]
 gb|AET03260.1| ABC transporter transmembrane region protein [Medicago truncatula]
Length=488

 Score =   228 bits (580),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 113/242 (47%), Positives = 160/242 (66%), Gaps = 0/242 (0%)
 Frame = +3

Query  159  SNSTDRKEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLSS  338
            S    R + V    LFS AD  DY  M  GS+GACIHGA++PVFF+ FG++I+ +G    
Sbjct  2    SKRASRGKKVPLLKLFSFADFYDYVLMAVGSVGACIHGASVPVFFIFFGKIINVVGLAYL  61

Query  339  DSHRLSSQVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKKIEF  518
                 S QV+K AL  VYL  II  S+W  VA W  TGERQ A++R+ YL+S+L + I  
Sbjct  62   FPKEASHQVAKYALDFVYLSIIILFSSWAEVACWMHTGERQVAKMRMAYLRSMLNQDISL  121

Query  519  FDTDTRAKDIIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLAV  698
            FDT+    ++I  I+SD I+VQ+A+ +K+G+ + +IS+F+ GF +GF+ VW+++LVTLA+
Sbjct  122  FDTEGSTGEVISSITSDIIVVQEALSEKVGNFMHFISRFIAGFIIGFLRVWQISLVTLAI  181

Query  699  VPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYSKSL  878
            VPLIA+AGG Y  +   L  K   +Y  AG++A+E I  VRTV +F GE++AV SY  +L
Sbjct  182  VPLIAIAGGLYAYVTFGLIAKVRKSYLRAGEIAQEVIGNVRTVQAFGGEQRAVISYKVAL  241

Query  879  NN  884
             N
Sbjct  242  RN  243



>ref|XP_009137566.1| PREDICTED: ABC transporter B family member 2-like [Brassica rapa]
Length=1241

 Score =   236 bits (603),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 118/262 (45%), Positives = 176/262 (67%), Gaps = 5/262 (2%)
 Frame = +3

Query  120  LEISSNL--KMDQQPSNSTDRKEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFF  293
            +E S +L  +++++   +T +   VSF  LFS AD  D   M  GSIGACIHGA++PVFF
Sbjct  1    MEPSDDLATEVEKEKKAATPK---VSFLKLFSFADFNDCVLMTLGSIGACIHGASVPVFF  57

Query  294  VLFGRMIDSLGHLSSDSHRLSSQVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARL  473
            + FG++I+ +G    D H+ S +V+K +L  VYL   I  S+W+  A W  TGERQ A++
Sbjct  58   IFFGKLINIIGIAYMDRHQASHKVAKYSLDFVYLSVAILFSSWLEAACWMHTGERQAAKM  117

Query  474  RLRYLQSVLRKKIEFFDTDTRAKDIIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAV  653
            R  YL+S+L + I  FDT+  + ++I  I+SD ++VQDA+ +K+G+ + YIS+F+ GFA+
Sbjct  118  RRAYLRSILSQDISLFDTEASSGEVISAITSDILVVQDALSEKVGNFLHYISRFIAGFAI  177

Query  654  GFISVWKLTLVTLAVVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYS  833
            GF SVW+++LVTLA+VPLIA+AGG Y  +   L  +   +Y +AG+VAEE I  VRTV +
Sbjct  178  GFTSVWQISLVTLAIVPLIALAGGFYAFVAIGLISRVRKSYIKAGQVAEEVIGNVRTVQA  237

Query  834  FVGEKKAVESYSKSLNNALVLG  899
            F GE++A + Y ++L N    G
Sbjct  238  FTGEERAAKLYREALKNTYKYG  259


 Score = 87.4 bits (215),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 60/219 (27%), Positives = 110/219 (50%), Gaps = 3/219 (1%)
 Frame = +3

Query  225  DYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLSSDSHRLSSQVSKQALYLVYLGSI  404
            D+ + + G++ A I G+ +P+F +     + S      D+ ++  +V K A+   +  +I
Sbjct  666  DWLYGICGTLCAFIAGSLMPLFALGVSHSLVSYYEKGWDNTQI--EVKKIAILFCFASAI  723

Query  405  IFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKKIEFFD-TDTRAKDIIFHISSDAILV  581
              I   I    +   GER T R+R +   ++L+ ++ +FD  D  +  +   + SDA L+
Sbjct  724  TLIVYTIEHLCFGIMGERLTRRVREKMFLAILKNEMGWFDEVDNTSSMLASRLESDATLL  783

Query  582  QDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLAVVPLIAVAGGTYTLIMSNLSQK  761
            +  + D+    ++ +   +  F + F+  W+LTLV LA  PL+     +  L M      
Sbjct  784  KTIVVDRSTILLQNLGLVVTSFVISFMLNWRLTLVVLATYPLVISGHISEKLFMQGYGGN  843

Query  762  GEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYSKSL  878
               AY +A  +A E++S +RTV +F  E+K +E YSK L
Sbjct  844  LSKAYLKANMLAGESVSNIRTVAAFCAEEKVLELYSKEL  882



>ref|XP_010677330.1| PREDICTED: ABC transporter B family member 2-like [Beta vulgaris 
subsp. vulgaris]
Length=1256

 Score =   236 bits (603),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 112/242 (46%), Positives = 167/242 (69%), Gaps = 0/242 (0%)
 Frame = +3

Query  174  RKEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLSSDSHRL  353
            R + VSF  LF+ AD++DY  M FG+IGA  HGA++PVFF+ FG++I+ +G         
Sbjct  35   RSKNVSFLKLFTFADSLDYLLMFFGTIGAIAHGASVPVFFIFFGKLINLIGVAYLFPRET  94

Query  354  SSQVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKKIEFFDTDT  533
            S  V+K +L  VYL  +I  S+W+ VA W QTGERQ A++R+ YL+S+L + I  FDT+ 
Sbjct  95   SHDVAKYSLDFVYLSVVILFSSWVEVACWMQTGERQAAKMRMAYLRSMLNQDISLFDTEA  154

Query  534  RAKDIIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLAVVPLIA  713
               ++I  I+SD ++VQDAI +K+G  + YIS+F+ GFA+GF  VW+++L+TL++VP IA
Sbjct  155  STGEVINAITSDILIVQDAISEKVGKILHYISRFIAGFAIGFARVWQISLITLSIVPAIA  214

Query  714  VAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYSKSLNNALV  893
             AGG Y  + + L  +   +Y +AG++AEE I+ VRTV +FVGE++AV+SY ++L N   
Sbjct  215  FAGGIYAYVATGLIARVRKSYVKAGEIAEEVIANVRTVQAFVGEERAVKSYREALLNTYK  274

Query  894  LG  899
             G
Sbjct  275  YG  276


 Score = 78.2 bits (191),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 61/221 (28%), Positives = 109/221 (49%), Gaps = 8/221 (4%)
 Frame = +3

Query  225  DYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLSSDSHRLSSQVSKQALYLVYLGSI  404
            D+ + VFG+I   + GA +P+F +   + + S   +        ++V  + + L++ G  
Sbjct  689  DWIYGVFGTIFCLLSGAEMPLFALGVTQALVSYYEVWD-----VTKVEVRKIALLFCGGA  743

Query  405  IFISAWIGVAF--WTQTGERQTARLRLRYLQSVLRKKIEFFD-TDTRAKDIIFHISSDAI  575
            +   A  G+A   +   GER T R+R +   ++L  +I +FD +   +  I   + SDA 
Sbjct  744  VVCIANHGLAHSCFGIMGERLTLRVRQKMFSAILSNEIGWFDDSRNSSSTISSRLESDAT  803

Query  576  LVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLAVVPLIAVAGGTYTLIMSNLS  755
            L++  + D+    +      +  F + F+  W+LTLV L++ PLI     +  L M    
Sbjct  804  LLKSIVVDRTTILLLNCGFVITAFIIAFMLNWRLTLVVLSMYPLIISGHFSEKLFMQGFG  863

Query  756  QKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYSKSL  878
                 AY  A  +A EA+S +RTV +F  E+K V+ Y++ L
Sbjct  864  GNLSKAYLGANMLAGEAVSNMRTVAAFCAEEKVVDLYAREL  904



>ref|XP_002981381.1| hypothetical protein SELMODRAFT_114581 [Selaginella moellendorffii]
 gb|EFJ17569.1| hypothetical protein SELMODRAFT_114581 [Selaginella moellendorffii]
Length=1239

 Score =   236 bits (602),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 110/243 (45%), Positives = 169/243 (70%), Gaps = 1/243 (0%)
 Frame = +3

Query  171  DRKEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLSSDSHR  350
            +++  V    +F+ AD VD  FM  G+IGA  HG ALP+F +LFG++++S G L+SD   
Sbjct  4    EKQASVPLLKIFAFADGVDCAFMFGGTIGAVAHGVALPIFLLLFGKLLNSFGSLASDPQE  63

Query  351  LSSQVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKKIEFFDTD  530
            +  QVS+ +LY VYLG  I  ++W  VA W Q GERQ +R+R+ YL+++L++ I +FD +
Sbjct  64   MYRQVSQYSLYFVYLGIAILFASWAEVALWMQAGERQVSRMRIVYLEAMLKQDISYFDLE  123

Query  531  TRAKDIIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLAVVPLI  710
             R  DI+ ++S + + +Q+AIG+K+G  + ++S F+ GF VGF +VW+L LVTLA++P+I
Sbjct  124  ARTGDIVDNLSGNMLTIQEAIGEKMGGFLHFVSTFIGGFVVGFATVWQLGLVTLAILPVI  183

Query  711  AVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYSKSLNNAL  890
            AV GG YT  ++ ++ KG+A   E G + EE  +Q+RTVYSFVGE KA+ +Y+ +L  +L
Sbjct  184  AVVGGFYTKAITGIASKGQAD-TEPGNIVEEMTAQIRTVYSFVGETKALAAYTNALKKSL  242

Query  891  VLG  899
             LG
Sbjct  243  KLG  245


 Score = 89.4 bits (220),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 63/233 (27%), Positives = 117/233 (50%), Gaps = 5/233 (2%)
 Frame = +3

Query  189  SFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLSSDSHRLSSQVS  368
            S+F      +  ++ F++ GS  A + G   PVF ++   ++    + + D   + S+V 
Sbjct  655  SYFFRLLKLNAAEWPFLLLGSAAAVVAGLVNPVFAMIISSVLSI--YYNPDKSYMKSEVQ  712

Query  369  KQALYLVYLG-SIIFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKKIEFFDTDTR-AK  542
            K ++  V +G S+  I + +  +F   TGE  T R+R     +V R ++ +FD D   + 
Sbjct  713  KYSIIFVCIGVSVGMIHSLLHYSFGV-TGESLTKRIRELMFTAVTRFEVSWFDRDENGSS  771

Query  543  DIIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLAVVPLIAVAG  722
             I   +S++A  V+  +GD++   ++  S  +  F + FI  W++ LV  A +PL+  +G
Sbjct  772  QIASKLSTNAGFVRATMGDRVAIILQNSSLLVSAFLIAFIVEWRIALVVTASLPLLVASG  831

Query  723  GTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYSKSLN  881
             +  + +   +   E A+  A K+  EA+S +RTV +F  E K VE  +  L 
Sbjct  832  ISEQMFLKGFAGNIEKAHERATKLTGEAVSNIRTVAAFNAEAKMVELVTDELE  884



>ref|NP_001047803.1| Os02g0693700 [Oryza sativa Japonica Group]
 emb|CAD59583.1| MDR-like ABC transporter [Oryza sativa Japonica Group]
 dbj|BAD07906.1| MDR-like ABC transporter [Oryza sativa Japonica Group]
 dbj|BAD07706.1| MDR-like ABC transporter [Oryza sativa Japonica Group]
 dbj|BAF09717.1| Os02g0693700 [Oryza sativa Japonica Group]
 gb|EEE57613.1| hypothetical protein OsJ_08005 [Oryza sativa Japonica Group]
Length=1264

 Score =   236 bits (602),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 116/246 (47%), Positives = 166/246 (67%), Gaps = 0/246 (0%)
 Frame = +3

Query  141  KMDQQPSNSTDRKEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDS  320
            K +Q    +  + E V F  LFS AD  DY  M  GS+GAC HGA++PVFF+ FG++I+ 
Sbjct  20   KAEQGEKEAAAKVEKVPFLKLFSFADRWDYVLMAVGSLGACAHGASVPVFFIFFGKLINI  79

Query  321  LGHLSSDSHRLSSQVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVL  500
            +G        +S +V+K +L  VYLG +I  S+W  VA W  TGERQ A++R  YL+S+L
Sbjct  80   IGLAYLFPTTVSGRVAKYSLDFVYLGIVILFSSWTEVACWMHTGERQAAKMRQAYLRSML  139

Query  501  RKKIEFFDTDTRAKDIIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLT  680
             + I  FDT+    ++I  I+SD ++VQDAI +K+G+ + YIS+FL GFA+GF  VW+++
Sbjct  140  DQDIAVFDTEASTGEVINAITSDILVVQDAISEKVGNFMHYISRFLAGFAIGFSQVWQIS  199

Query  681  LVTLAVVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVE  860
            LVTLA+VPLIA+AGG Y  +   L  +   +Y +AG++AEE I  VRTV +FVGE+KAV 
Sbjct  200  LVTLAIVPLIAIAGGIYAYVTIGLMARVRKSYVKAGEIAEEVIGNVRTVQAFVGEEKAVR  259

Query  861  SYSKSL  878
            +Y ++L
Sbjct  260  TYREAL  265


 Score = 79.3 bits (194),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 58/221 (26%), Positives = 106/221 (48%), Gaps = 4/221 (2%)
 Frame = +3

Query  225  DYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLSSDSHRLSSQVSKQALYLVYLGSI  404
            D+FF V G++ A + G+ +P+F +   + + S       + R   +V K A+       +
Sbjct  690  DWFFGVSGTVSAFVAGSQMPLFALGVTQALVSYYMGWETTKR---EVRKIAVLFCCGAVL  746

Query  405  IFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKKIEFFDTDTRAKDIIF-HISSDAILV  581
              +   I    +   GER T R+R R   ++LR +I +FD  +    ++   + +DA LV
Sbjct  747  TVVFHAIEHLSFGIMGERLTLRVRERMFAAILRNEIGWFDDTSHTSSMLSSRLETDATLV  806

Query  582  QDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLAVVPLIAVAGGTYTLIMSNLSQK  761
            +  + D+    ++ I   +    + FI  W++TLV LA  PL+     +  + M      
Sbjct  807  RTIVVDRSTILLQNIGMIVTSLIIAFIINWRITLVVLATYPLMVSGHISEKMFMKGYGGN  866

Query  762  GEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYSKSLNN  884
               +Y +A  +A EA+S +RTV +F  E+K ++ Y+  L  
Sbjct  867  LGKSYLKANMLAAEAVSNIRTVAAFCAEEKVIKLYADELKE  907



>gb|EEC73824.1| hypothetical protein OsI_08549 [Oryza sativa Indica Group]
Length=1264

 Score =   236 bits (602),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 116/246 (47%), Positives = 166/246 (67%), Gaps = 0/246 (0%)
 Frame = +3

Query  141  KMDQQPSNSTDRKEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDS  320
            K +Q    +  + E V F  LFS AD  DY  M  GS+GAC HGA++PVFF+ FG++I+ 
Sbjct  20   KAEQGEKEAAAKVEKVPFLKLFSFADRWDYVLMAVGSLGACAHGASVPVFFIFFGKLINI  79

Query  321  LGHLSSDSHRLSSQVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVL  500
            +G        +S +V+K +L  VYLG +I  S+W  VA W  TGERQ A++R  YL+S+L
Sbjct  80   IGLAYLFPTTVSGRVAKYSLDFVYLGIVILFSSWTEVACWMHTGERQAAKMRQAYLRSML  139

Query  501  RKKIEFFDTDTRAKDIIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLT  680
             + I  FDT+    ++I  I+SD ++VQDAI +K+G+ + YIS+FL GFA+GF  VW+++
Sbjct  140  DQDIAVFDTEASTGEVINAITSDILVVQDAISEKVGNFMHYISRFLAGFAIGFSQVWQIS  199

Query  681  LVTLAVVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVE  860
            LVTLA+VPLIA+AGG Y  +   L  +   +Y +AG++AEE I  VRTV +FVGE+KAV 
Sbjct  200  LVTLAIVPLIAIAGGIYAYVTIGLMARVRKSYVKAGEIAEEVIGNVRTVQAFVGEEKAVR  259

Query  861  SYSKSL  878
            +Y ++L
Sbjct  260  TYREAL  265


 Score = 79.3 bits (194),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 58/221 (26%), Positives = 106/221 (48%), Gaps = 4/221 (2%)
 Frame = +3

Query  225  DYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLSSDSHRLSSQVSKQALYLVYLGSI  404
            D+FF V G++ A + G+ +P+F +   + + S       + R   +V K A+       +
Sbjct  690  DWFFGVSGTVSAFVAGSQMPLFALGVTQALVSYYMGWETTKR---EVRKIAVLFCCGAVL  746

Query  405  IFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKKIEFFDTDTRAKDIIF-HISSDAILV  581
              +   I    +   GER T R+R R   ++LR +I +FD  +    ++   + +DA LV
Sbjct  747  TVVFHTIEHLSFGIMGERLTLRVRERMFAAILRNEIGWFDDTSHTSSMLSSRLETDATLV  806

Query  582  QDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLAVVPLIAVAGGTYTLIMSNLSQK  761
            +  + D+    ++ I   +    + FI  W++TLV LA  PL+     +  + M      
Sbjct  807  RTIVVDRSTILLQNIGMIVTSLIIAFIINWRITLVVLATYPLMVSGHISEKMFMKGYGGN  866

Query  762  GEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYSKSLNN  884
               +Y +A  +A EA+S +RTV +F  E+K ++ Y+  L  
Sbjct  867  LGKSYLKANMLAAEAVSNIRTVAAFCAEEKVIKLYADELKE  907



>ref|XP_002969904.1| ATP-binding cassette transporter [Selaginella moellendorffii]
 gb|EFJ29028.1| ATP-binding cassette transporter [Selaginella moellendorffii]
Length=1239

 Score =   236 bits (602),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 110/243 (45%), Positives = 169/243 (70%), Gaps = 1/243 (0%)
 Frame = +3

Query  171  DRKEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLSSDSHR  350
            +++  +    +F+ AD VD  FM  G+IGA  HG ALP+F +LFG++++S G L+SD   
Sbjct  4    EKQASIPLHKIFAFADGVDCAFMFGGTIGAVAHGLALPIFLLLFGKLLNSFGSLASDPQE  63

Query  351  LSSQVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKKIEFFDTD  530
            +  QVSK +LY VYLG  I  ++W  VA W Q GERQ +R+R+ YL+++L++ I +FD +
Sbjct  64   MYRQVSKYSLYFVYLGIAILFASWAEVALWMQAGERQVSRMRIVYLEAMLKQDISYFDLE  123

Query  531  TRAKDIIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLAVVPLI  710
             R  DI+ ++S + + +Q+AIG+K+G  + ++S F+ GF VGF +VW+L LVTLA++P+I
Sbjct  124  ARTGDIVDNLSGNMLTIQEAIGEKMGGFLHFVSTFIGGFVVGFATVWQLGLVTLAILPVI  183

Query  711  AVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYSKSLNNAL  890
            AV GG YT  ++ ++ KG+A   E G + EE  +Q+RTVYSFVGE KA+ +Y+ +L  +L
Sbjct  184  AVVGGFYTKAITGIASKGQAD-TEPGNIVEEMTAQIRTVYSFVGETKALAAYTNALKKSL  242

Query  891  VLG  899
             LG
Sbjct  243  KLG  245


 Score = 89.4 bits (220),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 63/233 (27%), Positives = 117/233 (50%), Gaps = 5/233 (2%)
 Frame = +3

Query  189  SFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLSSDSHRLSSQVS  368
            S+F      +  ++ F++ GS  A + G   PVF ++   ++    + + D   + S+V 
Sbjct  655  SYFFRLLKLNAAEWPFLLLGSAAAVVAGLVNPVFAMIISSVLSI--YYNPDKSYMKSEVQ  712

Query  369  KQALYLVYLG-SIIFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKKIEFFDTDTR-AK  542
            K ++  V +G S+  I + +  +F   TGE  T R+R     +V R ++ +FD D   + 
Sbjct  713  KYSIIFVCIGVSVGMIHSLLHYSFGV-TGESLTKRIRELMFTAVTRFEVSWFDRDENGSS  771

Query  543  DIIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLAVVPLIAVAG  722
             I   +S++A  V+  +GD++   ++  S  +  F + FI  W++ LV  A +PL+  +G
Sbjct  772  QIASKLSTNAGFVRATMGDRVAIILQNSSLLVSAFLIAFIVEWRIALVVTASLPLLVASG  831

Query  723  GTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYSKSLN  881
             +  + +   +   E A+  A K+  EA+S +RTV +F  E K VE  +  L 
Sbjct  832  ISEQMFLKGFAGNIEKAHERATKLTGEAVSNIRTVAAFNAEAKMVELVTDELE  884



>ref|XP_002277547.1| PREDICTED: ABC transporter B family member 2 [Vitis vinifera]
 emb|CBI33860.3| unnamed protein product [Vitis vinifera]
Length=1243

 Score =   236 bits (601),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 113/242 (47%), Positives = 164/242 (68%), Gaps = 0/242 (0%)
 Frame = +3

Query  174  RKEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLSSDSHRL  353
            +   V    LF+ AD  D F M  GS+GACIHGA++PVFF+ FG++ID +G         
Sbjct  19   KPRRVPLLKLFAFADLYDCFLMAVGSVGACIHGASVPVFFIFFGKLIDIIGLAYLFPAAA  78

Query  354  SSQVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKKIEFFDTDT  533
            S +V+K +L  VYL  +I  S+W  VA W  TGERQ A++R+ Y++S+L + I  FDT+ 
Sbjct  79   SHKVAKYSLDFVYLSLVILFSSWAEVACWMHTGERQAAKMRMAYVRSMLNQDISLFDTEA  138

Query  534  RAKDIIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLAVVPLIA  713
               ++I  I+SD I+VQDA+ +K+G+ + YIS+F+ GFA+GFI VW+++LVTLA+VPLIA
Sbjct  139  TTGEVISAITSDIIVVQDALSEKVGNFMHYISRFIAGFAIGFIRVWQISLVTLAIVPLIA  198

Query  714  VAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYSKSLNNALV  893
            +AGG Y  I + L  +   +Y +AG++AEE I  VRTV +F GE+KAV+ Y  +L+N  +
Sbjct  199  IAGGVYAYIATGLIARVRKSYVKAGEIAEEVIGNVRTVQAFAGEEKAVKLYKTALSNTYI  258

Query  894  LG  899
             G
Sbjct  259  YG  260


 Score = 84.3 bits (207),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 66/219 (30%), Positives = 105/219 (48%), Gaps = 4/219 (2%)
 Frame = +3

Query  225  DYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLSSDSHRLSSQVSKQALYLVYLGSI  404
            D+++ + G+I A I GA +P+F +     + S  ++  D+ R   QV K A        I
Sbjct  675  DWYYGLVGTICALIAGAQMPLFALGVTEALVSY-YMDWDTTR--HQVKKIAFLFCGGAFI  731

Query  405  IFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKKIEFFDTDTRAKDIIF-HISSDAILV  581
              I   I    +   GER T R+R     ++L  +I +FD       ++   + SDA L 
Sbjct  732  TVIVHAIEHTCFGIMGERLTLRIREMLFSAILGNEIGWFDDANNTSSMLSSRLESDATLF  791

Query  582  QDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLAVVPLIAVAGGTYTLIMSNLSQK  761
            +  I D+    I+ +   +  F + FI  W++TLV LA  PLI     +  L M      
Sbjct  792  RTIIVDRSTILIQNLGLVVTSFIIAFILNWRITLVVLATYPLIISGHISEKLFMQGYGGN  851

Query  762  GEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYSKSL  878
               AY +A  +A EA+S +RTV +F  E+K ++ YS+ L
Sbjct  852  LSKAYLKANMIAGEAVSNMRTVAAFCSEEKVLDLYSREL  890



>emb|CDY42770.1| BnaA03g47690D [Brassica napus]
Length=1135

 Score =   235 bits (599),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 118/262 (45%), Positives = 176/262 (67%), Gaps = 5/262 (2%)
 Frame = +3

Query  120  LEISSNL--KMDQQPSNSTDRKEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFF  293
            +E S +L  +++++   +T +   VSF  LFS AD  D   M  GSIGACIHGA++PVFF
Sbjct  1    MEPSDDLATEVEKEKKAATPK---VSFLKLFSFADFNDCVLMTLGSIGACIHGASVPVFF  57

Query  294  VLFGRMIDSLGHLSSDSHRLSSQVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARL  473
            + FG++I+ +G    D H+ S +V+K +L  VYL   I  S+W+ VA W  TGERQ A++
Sbjct  58   IFFGKLINIIGIAYMDRHQASHKVAKYSLDFVYLSVAILFSSWLEVACWMHTGERQAAKM  117

Query  474  RLRYLQSVLRKKIEFFDTDTRAKDIIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAV  653
            R  YL+S+L + I  FDT+  + ++I  I+SD ++VQDA+ +K+G+ + YIS+F+ GFA+
Sbjct  118  RRAYLRSILSQDISLFDTEASSGEVISAITSDILVVQDALSEKVGNFLHYISRFIAGFAI  177

Query  654  GFISVWKLTLVTLAVVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYS  833
            GF SVW+++LVTLA+VPLIA+AGG Y  +   L  +   +Y +AG+VAEE I  VRTV +
Sbjct  178  GFTSVWQISLVTLAIVPLIALAGGMYAFVAIGLIARVRKSYIKAGQVAEEVIGNVRTVQA  237

Query  834  FVGEKKAVESYSKSLNNALVLG  899
            F GE++A + Y  +L +    G
Sbjct  238  FTGEERAAKLYRGALKSTYKYG  259


 Score = 75.1 bits (183),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 57/218 (26%), Positives = 102/218 (47%), Gaps = 18/218 (8%)
 Frame = +3

Query  225  DYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLSSDSHRLSSQVSKQALYLVYLGSI  404
            D+ + + G++ A I G+ +P+F +     + S      D+ +   +V K A+   +  +I
Sbjct  577  DWLYGICGTLCAFIAGSLMPLFALGVSHSLVSYYEKGWDNTQ--KEVKKIAILFCFASAI  634

Query  405  IFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKKIEFFDTDTRAKDIIFHISSDAILVQ  584
              I   I    +   GER T R+R +   ++L+ ++ +FD       ++    +  IL+Q
Sbjct  635  TLIVYSIEHLCFGIMGERLTRRVREKMFLAILKNEMGWFDEVDNTSSML----ASTILLQ  690

Query  585  DAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLAVVPLIAVAGGTYTLIMSNLSQKG  764
            +            +   +  F + F+  W+LTLV LA  PL+     +  L M       
Sbjct  691  N------------LGLVVTSFVISFMLNWRLTLVVLATYPLVISGHISEKLFMQGYGGNL  738

Query  765  EAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYSKSL  878
              AY +A  +A E++S +RTV +F  E+K +E YSK L
Sbjct  739  SKAYLKANMLAGESVSNIRTVAAFCAEEKVLELYSKEL  776



>ref|XP_006647720.1| PREDICTED: ABC transporter B family member 2-like [Oryza brachyantha]
Length=1261

 Score =   235 bits (600),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 115/235 (49%), Positives = 162/235 (69%), Gaps = 0/235 (0%)
 Frame = +3

Query  174  RKEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLSSDSHRL  353
            + E V F  LFS AD  DY  M  GS+GAC HGA++PVFF+ FG++I+ +G        +
Sbjct  30   KAEKVPFLKLFSFADRWDYVLMAMGSLGACAHGASVPVFFIFFGKLINIIGLAYLFPTTV  89

Query  354  SSQVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKKIEFFDTDT  533
            S +V+K +L  VYLG +I  S+W  VA W  TGERQ A++R  YL+S+L + I  FDT+ 
Sbjct  90   SGRVAKYSLDFVYLGVVILFSSWTEVACWMHTGERQAAKMRQAYLRSMLDQDIAVFDTEA  149

Query  534  RAKDIIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLAVVPLIA  713
               ++I  I+SD ++VQDAI +K+G+ + YIS+FL GFA+GF  VW+++LVTLA+VPLIA
Sbjct  150  STGEVINAITSDILVVQDAISEKVGNFMHYISRFLAGFAIGFSQVWQISLVTLAIVPLIA  209

Query  714  VAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYSKSL  878
            +AGG Y  +   L  +   +Y +AG++AEE I  VRTV +FVGE+KAV SY ++L
Sbjct  210  IAGGIYAYVTIGLMARVRKSYVKAGEIAEEVIGNVRTVQAFVGEEKAVRSYREAL  264


 Score = 81.3 bits (199),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 62/238 (26%), Positives = 117/238 (49%), Gaps = 5/238 (2%)
 Frame = +3

Query  174  RKEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLSSDSHRL  353
            +++ VS   L+S     D+FF V G+I A + G+ +P+F +   + + S  ++  ++ R 
Sbjct  673  KRKPVSMKKLYSMIRP-DWFFGVSGTISAFVAGSQMPLFALGVTQALVSY-YMGWETTR-  729

Query  354  SSQVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKKIEFFDTDT  533
              +V K A+       +  +   I    +   GER T R+R R   ++LR +I +FD  +
Sbjct  730  -REVRKIAVLFCCGAVLTVVFHAIEHLSFGIMGERLTLRVRERMFAAILRNEIGWFDDTS  788

Query  534  RAKDIIF-HISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLAVVPLI  710
                ++   + +DA LV+  + D+    ++ +   +    + FI  W++TLV LA  PL+
Sbjct  789  HTSSMLSSRLETDATLVRTIVVDRSTILLQNVGMIVTSLIIAFIINWRITLVVLATYPLM  848

Query  711  AVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYSKSLNN  884
                 +  + M         +Y +A  +A EA+S +RTV +F  E+K ++ Y+  L  
Sbjct  849  VSGHISEKMFMKGYGGNLGKSYLKANMLAAEAVSNIRTVAAFCAEEKVIKLYADELKE  906



>emb|CDP13052.1| unnamed protein product [Coffea canephora]
Length=1261

 Score =   235 bits (600),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 112/238 (47%), Positives = 160/238 (67%), Gaps = 0/238 (0%)
 Frame = +3

Query  186  VSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLSSDSHRLSSQV  365
            +    LF  AD  DYF M  G+IGAC+HGA++PVFF+ FG+MID +G         S +V
Sbjct  32   IPLIKLFKFADAYDYFLMFVGAIGACVHGASVPVFFIFFGKMIDIIGLAYLFPAEASHKV  91

Query  366  SKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKKIEFFDTDTRAKD  545
             K +L  VYL  +I  S+W  VA W  TGERQ A++R+ YL+++L + I  FDT+    +
Sbjct  92   GKYSLDFVYLSVVILFSSWTEVACWMHTGERQAAKMRMAYLRAMLNQDISLFDTEASTGE  151

Query  546  IIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLAVVPLIAVAGG  725
            +I  I+SD I+VQDAI +K+G+ + YIS+F  GFA+GF+ VW+++LVTL++VPLIA+AGG
Sbjct  152  VISAITSDIIVVQDAISEKVGNFMHYISRFFAGFAIGFVRVWQISLVTLSIVPLIALAGG  211

Query  726  TYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYSKSLNNALVLG  899
             Y  + + L  +   +Y +AG++AEE I+ VRTV +F GE KAV+SY  +L N    G
Sbjct  212  VYAYVATGLIARVRKSYVKAGEIAEEVIANVRTVQAFAGEDKAVKSYRGALLNTYTYG  269


 Score = 83.2 bits (204),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 63/219 (29%), Positives = 106/219 (48%), Gaps = 4/219 (2%)
 Frame = +3

Query  225  DYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLSSDSHRLSSQVSKQALYLVYLGSI  404
            D+ +   G++ A I GA +P+F +   + + S  ++  D+ R   +V K A        I
Sbjct  692  DWIYGFVGTVCAFICGAQMPLFALGVTQALVSY-YMDWDTTR--HEVKKIAFLFCGGAVI  748

Query  405  IFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKKIEFFD-TDTRAKDIIFHISSDAILV  581
              I   I    +   GER T R+R +   ++LR +I +FD  D  +  +   + SDA L+
Sbjct  749  TVIFHSITHLCFGIMGERLTLRVREKMFSAILRNEIGWFDDMDNTSSMLASRLESDATLL  808

Query  582  QDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLAVVPLIAVAGGTYTLIMSNLSQK  761
            +  + D+    ++ +   +  F + FI  W+LTLV +A  PLI     +  L M      
Sbjct  809  RTVVVDRSTILLQNVGLAVTAFIIAFILNWRLTLVVMATYPLIVSGHISEKLFMKGYGGD  868

Query  762  GEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYSKSL  878
               AY +A  +A EA+S +RTV +F  E+K ++ Y   L
Sbjct  869  LNKAYLKANMLAGEAVSNIRTVAAFCSEEKVIDLYGHEL  907



>ref|XP_010906448.1| PREDICTED: ABC transporter B family member 2-like [Elaeis guineensis]
Length=1235

 Score =   235 bits (599),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 112/250 (45%), Positives = 174/250 (70%), Gaps = 5/250 (2%)
 Frame = +3

Query  144  MDQQPSNS-----TDRKEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFVLFGR  308
            MDQ+ S +       R + +SFF LF+ +D  DY  M  GS+GAC+HGA+LPVFF+ FG+
Sbjct  1    MDQEGSKNGHEGEERRTQKISFFKLFAFSDAWDYVLMALGSVGACVHGASLPVFFLFFGK  60

Query  309  MIDSLGHLSSDSHRLSSQVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARLRLRYL  488
            +++     S     +S +V++ AL  +YLG    +SAWI V+ W  TGERQ +++RL YL
Sbjct  61   LVNVAAVASLYPASVSHKVAEYALDFLYLGFATLVSAWIEVSCWMHTGERQVSKIRLAYL  120

Query  489  QSVLRKKIEFFDTDTRAKDIIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISV  668
            +++L + I  FDT+    ++I  I++D I++QDAI +K+G+T+ ++++F+VGFA+GF +V
Sbjct  121  RAMLNQDIGVFDTEASTAEVIASITNDIIVIQDAISEKVGNTMHFMARFIVGFAMGFSNV  180

Query  669  WKLTLVTLAVVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEK  848
            W+++LVTL+VVPLIA+  GTY    ++L  +   +Y +AG++AEE I  VRTV +FVGE+
Sbjct  181  WQVSLVTLSVVPLIAITAGTYVYFETSLIARVRKSYVKAGEIAEEVIGNVRTVQAFVGEE  240

Query  849  KAVESYSKSL  878
            KAV+SY  +L
Sbjct  241  KAVKSYKTAL  250


 Score = 76.3 bits (186),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 68/236 (29%), Positives = 110/236 (47%), Gaps = 9/236 (4%)
 Frame = +3

Query  186  VSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLSSDSHRLSSQV  365
            VS   L+S A   D+ F +FG+I A + G  +P+F +    +  +L     D      ++
Sbjct  659  VSLRRLYSMARP-DWIFGLFGTISAFVVGVQIPLFGL---GVTQALVAYYMDWETTKREI  714

Query  366  SKQALYLVYLGSI-IFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKKIEFFDTDTRAK  542
             K  +       + IF  +   ++F    G+R T R+R R    +LR +I +FD D R  
Sbjct  715  RKLVILFCCAAVLSIFSHSAEHLSFGV-LGQRLTLRVRERMFAVMLRNEIGWFD-DMRNT  772

Query  543  DIIF--HISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLAVVPLIAV  716
              +    + +DA L+Q  + D+    I+ I   +   A+ F+  W++TLV LA  PL+  
Sbjct  773  CSMLSSRLETDATLLQTIVVDRSLILIQSIGMIVSSVAIAFVLNWRITLVVLATYPLMIT  832

Query  717  AGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYSKSLNN  884
            A  +  L +          Y +A  +A EA S +RTV +F  E K VE Y + L  
Sbjct  833  AQISEALFLRGFGLNLSKVYLKANTLAAEAASNIRTVAAFCLEDKIVELYGRELKE  888



>ref|XP_002892589.1| P-glycoprotein 10 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH68848.1| P-glycoprotein 10 [Arabidopsis lyrata subsp. lyrata]
Length=1229

 Score =   234 bits (598),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 114/247 (46%), Positives = 166/247 (67%), Gaps = 0/247 (0%)
 Frame = +3

Query  144  MDQQPSNSTDRKEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSL  323
            +D   +    ++  VSF  LFS AD  D   M  GSIGACIHGA++PVFF+ FG++I+ +
Sbjct  11   VDMAVAEKEKKRPSVSFLKLFSFADFYDCVLMALGSIGACIHGASVPVFFIFFGKLINII  70

Query  324  GHLSSDSHRLSSQVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVLR  503
            G         S +V+K +L  VYL  +I  S+W+ VA W  TGERQ A++R  YL+S+L 
Sbjct  71   GLAYLFPQEASHKVAKYSLDFVYLSVVILFSSWLEVACWMHTGERQAAKMRKAYLRSMLS  130

Query  504  KKIEFFDTDTRAKDIIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTL  683
            + I  FDT+T   ++I  I+SD ++VQDAI +K+G+ + +IS+F+ GFA+GF SVW+++L
Sbjct  131  QDISLFDTETSTGEVISAITSDILVVQDAISEKVGNFLHFISRFIAGFAIGFASVWQISL  190

Query  684  VTLAVVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVES  863
            VTL++VPLIA+AGG Y  + + L  +   +Y +A ++AEE I  VRTV +F GE+KAV S
Sbjct  191  VTLSIVPLIALAGGIYAFVGTGLIVRVRKSYVKANEIAEEVIGNVRTVQAFTGEEKAVSS  250

Query  864  YSKSLNN  884
            Y  +L N
Sbjct  251  YQGALKN  257


 Score = 85.5 bits (210),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 70/270 (26%), Positives = 125/270 (46%), Gaps = 7/270 (3%)
 Frame = +3

Query  81   HT*SVAITFS-MGELEISSN--LKMDQQPSNSTDRKEMVSFFGLFSAADTVDYFFMVFGS  251
            HT S+ ++   + EL I+      ++Q  +     K+     G   +    D+ + + G+
Sbjct  609  HTPSLPVSTKFLPELPIAETTLCPINQSINQPDTTKQAKVTLGRLYSMIRPDWKYGLCGT  668

Query  252  IGACIHGAALPVFFVLFGRMIDSLGHLSSDSHRLSSQVSKQALYLVYLGSIIFISAWIGV  431
            +G+ I G+ +P+F +   + + S      D     ++V + ++       I  I   I  
Sbjct  669  LGSFIAGSQMPLFALGIAQALVSY---YMDWETTQNEVKRISILFCCGSVITVIVHTIEH  725

Query  432  AFWTQTGERQTARLRLRYLQSVLRKKIEFFD-TDTRAKDIIFHISSDAILVQDAIGDKIG  608
              +   GER T R+R     ++LR +I +FD  D  +  +   + SDA L++  + D+  
Sbjct  726  TTFGIMGERLTLRVRQNMFSAILRNEIGWFDKVDNTSSMLALRLESDATLLRTIVVDRST  785

Query  609  HTIRYISQFLVGFAVGFISVWKLTLVTLAVVPLIAVAGGTYTLIMSNLSQKGEAAYAEAG  788
              +  +   +  F + FI  W+LTLV LA  PLI     +  + M         AY +A 
Sbjct  786  ILLENLGLVVTSFIISFILNWRLTLVVLATYPLIISGHISEKIFMQGYGGNLSKAYLKAN  845

Query  789  KVAEEAISQVRTVYSFVGEKKAVESYSKSL  878
             +A E+IS +RTV +F  E+K ++ YSK L
Sbjct  846  MLAGESISNIRTVAAFCAEEKVLDLYSKEL  875



>ref|XP_006303653.1| hypothetical protein CARUB_v10011664mg [Capsella rubella]
 gb|EOA36551.1| hypothetical protein CARUB_v10011664mg [Capsella rubella]
Length=1229

 Score =   234 bits (598),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 113/237 (48%), Positives = 162/237 (68%), Gaps = 0/237 (0%)
 Frame = +3

Query  174  RKEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLSSDSHRL  353
             +  VSF  LFS AD  D   M  GSI ACIHGA++PVFF+ FG++I+ +G         
Sbjct  21   ERPSVSFLKLFSFADLYDCVLMALGSIAACIHGASVPVFFIFFGKLINIIGLAYLFPQEA  80

Query  354  SSQVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKKIEFFDTDT  533
            S +V+K +L  VYL  +I  S+WI VA W  TGERQ A++R  YL+S+L + I  FDT++
Sbjct  81   SHKVAKYSLDFVYLSVVILFSSWIEVACWMHTGERQAAKMRKAYLRSMLSQDISLFDTES  140

Query  534  RAKDIIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLAVVPLIA  713
               ++I  I+SD ++VQDAI +K+G+ + YIS+F+ GFA+GF SVW+++LVTL++VPLIA
Sbjct  141  STGEVISAITSDILVVQDAISEKVGNFLHYISRFIAGFAIGFTSVWQISLVTLSIVPLIA  200

Query  714  VAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYSKSLNN  884
            +AGG Y  + + L+ +   +Y +A ++AEE I  VRTV +F GE+KAV SY  +L N
Sbjct  201  LAGGIYAFVGTGLTVRVRKSYVKANEIAEEVIGNVRTVQAFTGEEKAVNSYQGALKN  257


 Score = 91.3 bits (225),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 71/244 (29%), Positives = 119/244 (49%), Gaps = 7/244 (3%)
 Frame = +3

Query  150  QQPSNSTDRKEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGH  329
            +QP  S   K  V+   L+S     D+ +   G++G+ + GA +P+F +    + D+L  
Sbjct  638  KQPDTSKHAK--VTLGRLYSMIRP-DWKYGFCGTLGSFVSGAQMPLFAL---GISDALVS  691

Query  330  LSSDSHRLSSQVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKK  509
               D     ++V + ++       I  IS  I    +   GER T R+R +   ++LR +
Sbjct  692  YYMDWDTTRNEVKRISILFCCASVITVISHIIEHTSFGIVGERLTLRVRQKMFTAILRNE  751

Query  510  IEFFD-TDTRAKDIIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLV  686
            I +FD  D  +  +   + SDA L++  + D+    +  ++  +  F + FI  W+LTLV
Sbjct  752  IGWFDKVDNTSSMLASRLESDATLLKTIVVDRSTILLENLALVVTSFIISFILNWRLTLV  811

Query  687  TLAVVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESY  866
             LA  PLI     +  L M         AY +A  +A E+IS +RTV +F  E+K ++ Y
Sbjct  812  VLATYPLIISGHISEKLFMQGYGGNLSKAYLKANMLAGESISNIRTVAAFCAEEKVLDLY  871

Query  867  SKSL  878
            SK L
Sbjct  872  SKEL  875



>emb|CAD40903.1| OSJNBa0036B21.21 [Oryza sativa Japonica Group]
 emb|CBW45777.1| ORW1943Ba0077G13.5 [Oryza rufipogon]
Length=1252

 Score =   235 bits (599),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 114/240 (48%), Positives = 158/240 (66%), Gaps = 17/240 (7%)
 Frame = +3

Query  180  EMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLSSDSHRLSS  359
            + V+F  LF  AD +D+  M  GS GA +HGAA+PVFF+LFG +I+  G       R++ 
Sbjct  27   QSVAFHELFGFADPLDWLLMAAGSAGAVVHGAAMPVFFLLFGELINGFGKNQHSLRRMTD  86

Query  360  QVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKKIEFFDTDTRA  539
            +VSK                   +A W  TGERQ   LR RYL++VLR+ + FFDTD R 
Sbjct  87   EVSKAQ-----------------IACWMYTGERQVGALRRRYLEAVLRQDVGFFDTDART  129

Query  540  KDIIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLAVVPLIAVA  719
             D++F +S+D +LVQDAIG+K+G+ I Y+S FL G  VGF+S W+L L+++AV+P IA A
Sbjct  130  GDVVFSVSTDTLLVQDAIGEKVGNFIHYLSTFLAGLVVGFVSAWRLALLSIAVIPGIAFA  189

Query  720  GGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYSKSLNNALVLG  899
            GG Y   ++ L+ K   +YA AG +AE+AI+QVRTVYS+VGE KA+ SYS+++ N L LG
Sbjct  190  GGLYAYTLTGLTSKSRDSYANAGIIAEQAIAQVRTVYSYVGESKALNSYSEAIQNTLKLG  249


 Score = 80.1 bits (196),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 62/267 (23%), Positives = 121/267 (45%), Gaps = 21/267 (8%)
 Frame = +3

Query  114  GELEISSNLKMDQQ-PSNSTDRKEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVF  290
            G +E+ SN   D++ P+          FF L    +  ++ + + G+IG+ + G   P F
Sbjct  642  GRIEMVSNADNDRKYPAPKG------YFFKLLKL-NAPEWPYTILGAIGSILSGFIGPTF  694

Query  291  FVLFGRMIDSLGHLSSDSHRLSSQVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTAR  470
             ++   MI+       D + +  +  +     +  G    ++  +   F++  GE  T R
Sbjct  695  AIVMSNMIEVF--YFRDPNAMERKTREYVFIYIGTGLYAVVAYLVQHYFFSIMGENLTTR  752

Query  471  LRL----------RYLQSVLRKKIEFFDTDTRAKDIIF-HISSDAILVQDAIGDKIGHTI  617
            +R           R   ++LR  + +FD +     ++   +S+DA  V+ AI ++I   +
Sbjct  753  VRRMMLAVALFDQRLFSAILRNDVGWFDQEENNSSLVAARLSTDAADVKSAIAERISVIL  812

Query  618  RYISQFLVGFAVGFISVWKLTLVTLAVVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVA  797
            + ++  LV F VGFI  W++ ++ L   PL+ +A     L M   +     A+A+   +A
Sbjct  813  QNMTSLLVSFVVGFIIEWRVAVLILVTFPLLVLANFAQQLSMKGFAGDTAKAHAKTSMIA  872

Query  798  EEAISQVRTVYSFVGEKKAVESYSKSL  878
             E +S +RTV +F  + K +  +   L
Sbjct  873  GEGVSNIRTVAAFNAQDKVLSLFCTEL  899



>gb|EEC77398.1| hypothetical protein OsI_16157 [Oryza sativa Indica Group]
Length=1248

 Score =   235 bits (599),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 114/240 (48%), Positives = 158/240 (66%), Gaps = 17/240 (7%)
 Frame = +3

Query  180  EMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLSSDSHRLSS  359
            + V+F  LF  AD +D+  M  GS GA +HGAA+PVFF+LFG +I+  G       R++ 
Sbjct  27   QSVAFHELFGFADPLDWLLMAAGSAGAVVHGAAMPVFFLLFGELINGFGKNQHSLRRMTD  86

Query  360  QVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKKIEFFDTDTRA  539
            +VSK                   +A W  TGERQ   LR RYL++VLR+ + FFDTD R 
Sbjct  87   EVSKAQ-----------------IACWMYTGERQVGALRRRYLEAVLRQDVGFFDTDART  129

Query  540  KDIIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLAVVPLIAVA  719
             D++F +S+D +LVQDAIG+K+G+ I Y+S FL G  VGF+S W+L L+++AV+P IA A
Sbjct  130  GDVVFSVSTDTLLVQDAIGEKVGNFIHYLSTFLAGLVVGFVSAWRLALLSIAVIPGIAFA  189

Query  720  GGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYSKSLNNALVLG  899
            GG Y   ++ L+ K   +YA AG +AE+AI+QVRTVYS+VGE KA+ SYS+++ N L LG
Sbjct  190  GGLYAYTLTGLTSKSRDSYANAGIIAEQAIAQVRTVYSYVGESKALNSYSEAIQNTLKLG  249


 Score = 87.0 bits (214),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 62/257 (24%), Positives = 121/257 (47%), Gaps = 11/257 (4%)
 Frame = +3

Query  114  GELEISSNLKMDQQ-PSNSTDRKEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVF  290
            G +E+ SN   D++ P+          FF L    +  ++ + + G+IG+ + G   P F
Sbjct  648  GRIEMVSNADNDRKYPAPKG------YFFKLLKL-NAPEWPYTILGAIGSILSGFIGPTF  700

Query  291  FVLFGRMIDSLGHLSSDSHRLSSQVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTAR  470
             ++   MI+       D + +  +  +     +  G    ++  +   F++  GE  T R
Sbjct  701  AIVMSNMIEVF--YFRDPNAMERKTREYVFIYIGTGLYAVVAYLVQHYFFSIMGENLTTR  758

Query  471  LRLRYLQSVLRKKIEFFDTDTRAKDIIF-HISSDAILVQDAIGDKIGHTIRYISQFLVGF  647
            +R   L ++LR  + +FD +     ++   +S+DA  V+ AI ++I   ++ ++  LV F
Sbjct  759  VRRMMLAAILRNDVGWFDQEENNSSLVAARLSTDAADVKSAIAERISVILQNMTSLLVSF  818

Query  648  AVGFISVWKLTLVTLAVVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTV  827
             VGFI  W++ ++ L   PL+ +A     L M   +     A+A+   +A E +S +RTV
Sbjct  819  VVGFIIEWRVAVLILVTFPLLVLANFAQQLSMKGFAGDTAKAHAKTSMIAGEGVSNIRTV  878

Query  828  YSFVGEKKAVESYSKSL  878
             +F  + K +  +   L
Sbjct  879  AAFNAQDKVLSLFCTEL  895



>ref|XP_004497537.1| PREDICTED: ABC transporter B family member 1-like [Cicer arietinum]
Length=1335

 Score =   235 bits (599),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 112/272 (41%), Positives = 181/272 (67%), Gaps = 11/272 (4%)
 Frame = +3

Query  117  ELEI-SSNLKMDQQPSNSTDRKEM----------VSFFGLFSAADTVDYFFMVFGSIGAC  263
            ELE  +SN +M++  S   ++K            V F  LF  AD +DY  M  G++GA 
Sbjct  37   ELERGNSNEQMEEASSEVPNKKSCDFSKQESVPSVGFGELFRFADGLDYILMTIGTLGAI  96

Query  264  IHGAALPVFFVLFGRMIDSLGHLSSDSHRLSSQVSKQALYLVYLGSIIFISAWIGVAFWT  443
            +HG +LP+F   F  +++S G  ++D  +++ +V K A Y + +G+ I+ S+W  ++ W 
Sbjct  97   VHGCSLPLFLRFFADLVNSFGSNANDLDKMTQEVVKYAFYFLVVGAAIWASSWAEISCWM  156

Query  444  QTGERQTARLRLRYLQSVLRKKIEFFDTDTRAKDIIFHISSDAILVQDAIGDKIGHTIRY  623
             TGERQ+ R+R++YL++VL + I+FFDT+ R  D++F I++DA++VQDAI +K+G+ + Y
Sbjct  157  WTGERQSTRMRIKYLEAVLDQDIQFFDTEVRTSDVVFAINTDAVMVQDAISEKLGNFVHY  216

Query  624  ISQFLVGFAVGFISVWKLTLVTLAVVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEE  803
            ++ F+ GFAVGF +VW+L LVTLAVVP+IAV GG +T  ++ L+ K + A ++AG + E+
Sbjct  217  MATFVSGFAVGFSAVWQLALVTLAVVPMIAVIGGIHTTTLAKLTGKSQEALSQAGNIVEQ  276

Query  804  AISQVRTVYSFVGEKKAVESYSKSLNNALVLG  899
             + Q+R V +FVGE KA++ YS +L  A  +G
Sbjct  277  TVVQIRVVLAFVGETKALQGYSSALRIAQKIG  308


 Score = 97.1 bits (240),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 74/239 (31%), Positives = 125/239 (52%), Gaps = 3/239 (1%)
 Frame = +3

Query  177  KEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLSSDSHRLS  356
            KE  S F   +  ++ ++ + + GSIG+ + G+ L  FF      + S+ +  +  H + 
Sbjct  724  KEQASSFWRLAKMNSPEWLYALIGSIGSVVCGS-LSAFFAYVLSAVLSVYYNPNHKHMIR  782

Query  357  SQVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKKIEFFDTD-T  533
             ++ K    L+ L S   +   +   FW   GE  T R+R + L +VL+ ++ +FD +  
Sbjct  783  -EIEKYCYLLIGLSSAALLFNTLQHFFWDIVGENLTKRVREKMLSAVLKNEMAWFDQEEN  841

Query  534  RAKDIIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLAVVPLIA  713
             +  I   ++ DA  V+ AIGD+I   ++  +  LV    GF+  W+L LV +AV P++ 
Sbjct  842  ESARIAARLALDANNVRSAIGDRISIIVQNTALMLVACTAGFVLQWRLALVLVAVFPVVV  901

Query  714  VAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYSKSLNNAL  890
             A     + MS  S   EAA+A+A ++A EAI+ VRTV +F  EKK V  ++ +L   L
Sbjct  902  AATVLQKMFMSGFSGDLEAAHAKATQLAGEAIANVRTVAAFNSEKKIVRLFASNLETPL  960



>gb|AES81895.2| ABC transporter B family protein [Medicago truncatula]
Length=1338

 Score =   235 bits (599),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 106/273 (39%), Positives = 182/273 (67%), Gaps = 3/273 (1%)
 Frame = +3

Query  90   SVAITFSMGELEISSNLKMDQQPSNSTDR---KEMVSFFGLFSAADTVDYFFMVFGSIGA  260
            +  ++ S  ++++S  ++  ++   S ++      V F  LF  AD +DY  M  G++GA
Sbjct  50   TATVSDSQNQVQVSKEMEEHKKDGGSKEKVKSAPAVGFGELFRFADGLDYILMTIGTVGA  109

Query  261  CIHGAALPVFFVLFGRMIDSLGHLSSDSHRLSSQVSKQALYLVYLGSIIFISAWIGVAFW  440
             +HG +LP+F   F  +++S G  +++  +++ +V K A Y + +G+ I+ S+W  ++ W
Sbjct  110  IVHGCSLPLFLRFFADLVNSFGSNANNLDKMTQEVVKYAFYFLVVGAAIWASSWAEISCW  169

Query  441  TQTGERQTARLRLRYLQSVLRKKIEFFDTDTRAKDIIFHISSDAILVQDAIGDKIGHTIR  620
              TGERQ+ ++R++YL++ L++ IEFFDT+ R  D++F I++DA++VQDAI +K+G+ I 
Sbjct  170  MWTGERQSTKMRIKYLEAALKQDIEFFDTEVRTSDVVFAINTDAVMVQDAISEKLGNFIH  229

Query  621  YISQFLVGFAVGFISVWKLTLVTLAVVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAE  800
            Y++ F+ GF VGF +VW+L LVTLAVVP+IAV GG +T  ++ LS K + A ++AG + E
Sbjct  230  YMATFVSGFVVGFTAVWQLALVTLAVVPMIAVIGGIHTTTLAKLSSKSQEALSQAGNIVE  289

Query  801  EAISQVRTVYSFVGEKKAVESYSKSLNNALVLG  899
            + + Q+R V +FVGE +A++ YS +L  A  LG
Sbjct  290  QTVVQIRVVLAFVGESRALQGYSSALKVAQKLG  322


 Score =   103 bits (258),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 71/239 (30%), Positives = 122/239 (51%), Gaps = 3/239 (1%)
 Frame = +3

Query  177  KEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLSSDSHRLS  356
            K+    F      ++ ++ + + GSIG+ + G+ L  FF      + S+ + + D   + 
Sbjct  737  KDQAGSFWRLVKMNSPEWLYALLGSIGSIVCGS-LSAFFAYVLSAVLSV-YYNPDHKHMI  794

Query  357  SQVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKKIEFFD-TDT  533
             ++ K    L+ L S   I   +   FW   GE  T R+R + L +VL+ ++ +FD  + 
Sbjct  795  REIDKYCYLLIGLSSTALIFNTLQHFFWDIVGENLTKRVREKMLTAVLKNEMAWFDQEEN  854

Query  534  RAKDIIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLAVVPLIA  713
             +  I   ++ DA  V+ AIGD+I   ++  +  LV    GF+  W+L LV +AV P++ 
Sbjct  855  ESARISARLALDANNVRSAIGDRISVIVQNTALMLVACTAGFVLQWRLALVLIAVFPVVV  914

Query  714  VAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYSKSLNNAL  890
             A     + M+  S   EAA+A+A ++A EAI+ VRTV +F  E K V  ++ +L   L
Sbjct  915  AATVLQKMFMTGFSGDLEAAHAKATQLAGEAIANVRTVAAFNSESKIVRLFASNLETPL  973



>ref|XP_002266505.1| PREDICTED: ABC transporter B family member 1 [Vitis vinifera]
Length=1354

 Score =   235 bits (600),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 111/250 (44%), Positives = 176/250 (70%), Gaps = 3/250 (1%)
 Frame = +3

Query  159  SNSTDRKEMV--SFFG-LFSAADTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGH  329
            S S ++ E+V  S FG LF  AD +DY  M  GSIGA +HG++LP+F   F  +++S G 
Sbjct  79   SGSGEKTELVPSSGFGELFRFADGLDYVLMTIGSIGAIVHGSSLPIFLRFFADLVNSFGS  138

Query  330  LSSDSHRLSSQVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKK  509
             +++  ++  +V K A Y + +G+ I+ S+W  ++ W  TGERQ+ ++R++YL++ L + 
Sbjct  139  NANNIDKMMQEVLKYAFYFLVVGAAIWASSWAEISCWMWTGERQSTKMRIKYLEAALNQD  198

Query  510  IEFFDTDTRAKDIIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVT  689
            I+FFDT+ R  D++F +++DA++VQDAI +K+G+ I Y++ F+ GF VGF +VW+L LVT
Sbjct  199  IQFFDTEVRTSDVVFAVNTDAVMVQDAISEKLGNFIHYMATFVSGFVVGFTAVWQLALVT  258

Query  690  LAVVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYS  869
            LAVVPLIAV GG +T  ++ LS K + A +EAG +AE+ I Q+R V++FVGE +A+++YS
Sbjct  259  LAVVPLIAVIGGIHTATLAKLSAKSQEALSEAGNIAEQTIVQIRVVFAFVGESRALQAYS  318

Query  870  KSLNNALVLG  899
             +L  +  LG
Sbjct  319  AALRISQRLG  328


 Score =   103 bits (256),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 71/239 (30%), Positives = 124/239 (52%), Gaps = 3/239 (1%)
 Frame = +3

Query  177  KEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLSSDSHRLS  356
            KE  S F   +  ++ ++ + +FG+IG+ + G+ +  FF      + S+ + + +   +S
Sbjct  743  KEQASSFWRLAKMNSPEWVYALFGTIGSVVCGS-ISAFFAYVLSAVLSV-YYNQNHAYMS  800

Query  357  SQVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKKIEFFD-TDT  533
             Q+ K    L+ + S   +   +   FW   GE  T R+R + L +VL+ ++ +FD  + 
Sbjct  801  KQIGKYCYLLIGVSSAALLFNTLQHFFWDVVGENLTKRVREKMLAAVLKNEMAWFDQEEN  860

Query  534  RAKDIIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLAVVPLIA  713
             +  I   ++ DA  V+ AIGD+I   ++  +  LV    GF+  W+L LV +AV P++ 
Sbjct  861  ESARIAARLALDANNVRSAIGDRISVIMQNSALMLVACTAGFVLQWRLALVLIAVFPVVV  920

Query  714  VAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYSKSLNNAL  890
             A     + M   S   E A+A+A ++A EAI+ VRTV +F  E K V  +S +L   L
Sbjct  921  AATVLQKMFMQGFSGDLEGAHAKATQLAGEAIANVRTVAAFNSEAKIVGLFSTNLQTPL  979



>ref|XP_006471591.1| PREDICTED: ABC transporter B family member 2-like isoform X1 
[Citrus sinensis]
 ref|XP_006471592.1| PREDICTED: ABC transporter B family member 2-like isoform X2 
[Citrus sinensis]
Length=1265

 Score =   234 bits (598),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 115/251 (46%), Positives = 166/251 (66%), Gaps = 0/251 (0%)
 Frame = +3

Query  147  DQQPSNSTDRKEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLG  326
            DQ+ S    +K  VS F LF+ AD  DY  M  GSIGAC+HG ++PVFF+ FG++I+ +G
Sbjct  28   DQESSKKQQQKRSVSLFKLFAFADFYDYILMSLGSIGACVHGVSVPVFFIFFGKLINIIG  87

Query  327  HLSSDSHRLSSQVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVLRK  506
                     S +V+K +L  VYL   I  S+WI V+ W  TGERQ A++R+ YL+S+L +
Sbjct  88   LAYLFPKTASHKVAKYSLDFVYLSVAILFSSWIEVSCWMYTGERQAAKMRMAYLRSMLNQ  147

Query  507  KIEFFDTDTRAKDIIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLV  686
             I  FDT+    ++I  I+SD I+VQDA+ +K+G+ + YIS+FL GF +GF  VW+++LV
Sbjct  148  DISLFDTEASTGEVISAITSDIIVVQDALSEKVGNFMHYISRFLGGFIIGFARVWQISLV  207

Query  687  TLAVVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESY  866
            TL++VPLIA+AGG Y  +   L  +   +Y +AG++AEE I  VRTV +F GE KAV+ Y
Sbjct  208  TLSIVPLIALAGGMYAYVTIGLIARVRKSYVKAGEIAEEVIGNVRTVQAFAGEDKAVKVY  267

Query  867  SKSLNNALVLG  899
             ++L+N    G
Sbjct  268  KEALSNTYKYG  278


 Score = 78.6 bits (192),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 63/219 (29%), Positives = 100/219 (46%), Gaps = 4/219 (2%)
 Frame = +3

Query  225  DYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLSSDSHRLSSQVSKQALYLVYLGSI  404
            D+ + V G+I A I GA +P+F +   +   +L     D      +V K  +       I
Sbjct  694  DWTYGVCGTICAIIAGAQMPLFALGVSQ---ALVAYYMDWDTTQREVKKITILFCCAAVI  750

Query  405  IFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKKIEFFDT-DTRAKDIIFHISSDAILV  581
              I   I    +   GER T R+R +   ++L  +I +FD  D  +  +   + SDA L+
Sbjct  751  TVIVHAIEHLSFGIMGERLTLRVREKMFSAILSNEIGWFDEMDNSSSILASRLESDATLL  810

Query  582  QDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLAVVPLIAVAGGTYTLIMSNLSQK  761
            +  + D+    I+        F + FI  W++TLV +A  PLI     +  L        
Sbjct  811  RTIVVDRSTILIQNFGLVAASFVIAFILNWRITLVVVATYPLIISGHISEKLFFQGYGGN  870

Query  762  GEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYSKSL  878
               AY +A  +A EA+S +RTV +F  E K +E YS+ L
Sbjct  871  LSKAYLKANMLAAEAVSNIRTVAAFCSEDKVLELYSREL  909



>ref|XP_010458427.1| PREDICTED: ABC transporter B family member 10-like [Camelina 
sativa]
Length=1226

 Score =   234 bits (597),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 118/258 (46%), Positives = 169/258 (66%), Gaps = 8/258 (3%)
 Frame = +3

Query  126  ISSNLKMDQQPSNSTDRKEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFVLFG  305
            +++  K  ++PS        VSF  LFS AD  D   M  GSIGACIHGA++PVFF+ FG
Sbjct  12   LAATKKKKERPS--------VSFLKLFSFADFYDCVLMALGSIGACIHGASVPVFFIFFG  63

Query  306  RMIDSLGHLSSDSHRLSSQVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARLRLRY  485
            ++I+ +G         S +V+K +L  VYL  +I  S+WI VA W  TGERQ A++R  Y
Sbjct  64   KLINIIGLAYLFPREASHKVAKYSLDFVYLSVVILFSSWIEVACWMHTGERQAAKMRKAY  123

Query  486  LQSVLRKKIEFFDTDTRAKDIIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFIS  665
            L+S+L + I  FDT++   ++I  I+SD ++VQDAI +K+G+ + YIS+F+ GF +GF S
Sbjct  124  LRSMLSQDISLFDTESSTGEVISAITSDILVVQDAISEKVGNFLHYISRFIAGFVIGFTS  183

Query  666  VWKLTLVTLAVVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGE  845
            VW+++LVTLA+VPLIA+AGG Y  + + L  +   +Y +A ++AEE I  VRTV +F GE
Sbjct  184  VWQISLVTLAIVPLIALAGGIYAFVGTGLIARVRKSYVKANEIAEEVIGNVRTVQAFTGE  243

Query  846  KKAVESYSKSLNNALVLG  899
            +KAV SY  +L N    G
Sbjct  244  EKAVSSYLGALKNTYTYG  261


 Score = 89.7 bits (221),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 70/244 (29%), Positives = 118/244 (48%), Gaps = 7/244 (3%)
 Frame = +3

Query  150  QQPSNSTDRKEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGH  329
            +QP   T R   V+   L+S     D+ + + G++G+ + GA +P+F +    + ++L  
Sbjct  637  KQPD--TSRHAKVTLGRLYSMIRP-DWKYGICGTLGSFVAGALMPLFAL---GISEALVS  690

Query  330  LSSDSHRLSSQVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKK  509
               D      +V + ++       I  IS  I    +   GER T R+R +   ++LR +
Sbjct  691  YYMDWDTTQHEVKRISILFCCASVITVISHAIEHTSFGIMGERLTLRVRQKMFSAILRNE  750

Query  510  IEFFD-TDTRAKDIIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLV  686
            I +FD  D  +  +   + SDA L++  + D+    +  +   +  F + FI  W+LTLV
Sbjct  751  IGWFDKVDNTSSMLASRLESDAALLKTIVVDRSTILLENLGLVVTSFIISFILNWRLTLV  810

Query  687  TLAVVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESY  866
             LA  PLI     +  L M         AY +A  +A E+IS +RTV +F  E+K ++ Y
Sbjct  811  VLATYPLIISGHISEKLFMQGYGGNLSKAYLKANMLAGESISNIRTVAAFCAEEKVLDLY  870

Query  867  SKSL  878
            SK L
Sbjct  871  SKEL  874



>ref|XP_008789538.1| PREDICTED: LOW QUALITY PROTEIN: ABC transporter B family member 
1-like [Phoenix dactylifera]
Length=1363

 Score =   235 bits (599),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 115/285 (40%), Positives = 180/285 (63%), Gaps = 10/285 (4%)
 Frame = +3

Query  72   VPLHT*SVAITFSMGELEISSNLKMDQQPSNSTDRKEM---------VSFFGLFSAADTV  224
            VP  T +  +T S+ E+E+S+  +  + P  +    E+         V F  L   AD +
Sbjct  64   VPPPTSNSVVTHSL-EMEVSNGKQEGESPETAAGGGEVEKPSPPAPSVGFGELLRFADGL  122

Query  225  DYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLSSDSHRLSSQVSKQALYLVYLGSI  404
            DY  M  G+ GA +HG ALPVF   F  ++DS G  + D   +  QV K A Y + +G+ 
Sbjct  123  DYILMAIGTAGAIVHGCALPVFLRFFADLVDSFGSNADDPDAMVRQVVKYAFYFLVVGAA  182

Query  405  IFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKKIEFFDTDTRAKDIIFHISSDAILVQ  584
            I+ S+W  ++ W  TGERQT ++R+ YL++ L + + +FDT+ R  D+++ I++DA++VQ
Sbjct  183  IWASSWAEISCWMWTGERQTTKMRIEYLEAALNQDVRYFDTEVRTSDVVYAINADAVIVQ  242

Query  585  DAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLAVVPLIAVAGGTYTLIMSNLSQKG  764
            DAI +K+G+ I Y++ F+ GF VGF +VW+L LVTLAV PLIAV GG +T  ++ LS K 
Sbjct  243  DAISEKLGNFIHYMATFVSGFVVGFTAVWQLALVTLAVAPLIAVIGGIHTATLAKLSSKS  302

Query  765  EAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYSKSLNNALVLG  899
            + A ++A  +AE+A++Q+RTV SFVGE + +++YS +L  A  +G
Sbjct  303  QNALSQASSIAEQALAQIRTVQSFVGESRVLQAYSSALKLAQRIG  347


 Score = 86.7 bits (213),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 66/239 (28%), Positives = 122/239 (51%), Gaps = 3/239 (1%)
 Frame = +3

Query  177  KEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLSSDSHRLS  356
            ++  S F   +  ++ ++ + + GSIG+ + G+   +F  +   ++    + + D   + 
Sbjct  759  RDQASSFWRLAKMNSPEWTYALIGSIGSMVCGSISALFAYVLSAVLSI--YYAQDHRYMR  816

Query  357  SQVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKKIEFFDTDTR  536
             +++K    L+ + S   +   +   FW   GE  T R+R + L +VLR +I +FD +  
Sbjct  817  REIAKYCYLLIGVSSAALLFNTLQHLFWDVVGENLTKRVREKMLFAVLRNEIAWFDQEEN  876

Query  537  AK-DIIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLAVVPLIA  713
            A   I   +S DA  V+ AIGD+I   ++  +  LV    GF+  W+L LV +AV P++ 
Sbjct  877  ASARIAARLSLDAHNVRSAIGDRISVIVQNSALMLVACTAGFVLQWRLALVLVAVFPVVV  936

Query  714  VAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYSKSLNNAL  890
             A     + +   S   E A+A+A ++A EA++ VRTV +F  E K    ++ +L + L
Sbjct  937  AATVLQKMFLKGFSGDLEKAHAKATQIAGEAVANVRTVAAFNSEAKIARLFAANLQSPL  995



>ref|XP_011018526.1| PREDICTED: ABC transporter B family member 2-like isoform X1 
[Populus euphratica]
Length=1253

 Score =   234 bits (597),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 115/264 (44%), Positives = 173/264 (66%), Gaps = 2/264 (1%)
 Frame = +3

Query  108  SMGELEISSNLKMDQQPSNSTDRKEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPV  287
            S   +E + +++  +Q      +K  V F+ LF+ AD  D   M  GS+GAC+HGA++PV
Sbjct  3    SQSNIEEADDVEKKRQEEKRKQQK--VPFWKLFAFADFYDCLLMGLGSLGACVHGASVPV  60

Query  288  FFVLFGRMIDSLGHLSSDSHRLSSQVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTA  467
            FF+ FG++I+ +G         S +V+K +L  VYL ++I  ++WI VA W  TGERQ A
Sbjct  61   FFIFFGKLINIIGMAYLFPKEASHKVAKYSLDFVYLSAVILFASWIEVACWMHTGERQAA  120

Query  468  RLRLRYLQSVLRKKIEFFDTDTRAKDIIFHISSDAILVQDAIGDKIGHTIRYISQFLVGF  647
            ++R+ YL+S+L + I  FDT+    ++I  I+SD I+VQDAI +K+G+ + Y+S+FL GF
Sbjct  121  KMRMAYLKSMLSQDISLFDTEASTGEVIAAITSDIIVVQDAISEKVGNFMHYVSRFLGGF  180

Query  648  AVGFISVWKLTLVTLAVVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTV  827
             +GF+ +W+++LVTL++VPLIA+AGG Y  I   L  K   +Y +AG++AEE I  VRTV
Sbjct  181  IIGFVRIWQISLVTLSIVPLIALAGGIYAYITIGLIAKVRKSYVKAGQIAEEVIGNVRTV  240

Query  828  YSFVGEKKAVESYSKSLNNALVLG  899
             +F GE+KAV SY  +L N    G
Sbjct  241  QAFAGEEKAVRSYVDALRNTYQYG  264


 Score = 83.6 bits (205),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 67/238 (28%), Positives = 118/238 (50%), Gaps = 9/238 (4%)
 Frame = +3

Query  174  RKEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLSSDSHRL  353
            R + VS   L+S     D+ + + G+IGA + G+ +P+F +    +  +L     D    
Sbjct  660  RTKKVSLKRLYSMVGP-DWIYGIVGTIGAFVAGSLMPLFAL---GVTQALVAFYMDWDMT  715

Query  354  SSQVSKQALYLVYLGSIIFISAWIGVAFWT--QTGERQTARLRLRYLQSVLRKKIEFFDT  527
              +V K A+ L   G++I +  + G+   +    GER T R+R     ++LR +I +FD 
Sbjct  716  RHEVKKIAI-LFCCGAVISV-IFYGIEHLSFGIMGERLTLRVREMMFSAILRNEIGWFDD  773

Query  528  -DTRAKDIIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLAVVP  704
             +  +  +   + SDA L++  + D+    +  +   +  F + FI  W++TLV +A  P
Sbjct  774  FNNTSSMLTSRLESDATLLRTIVVDRSTVLLHNVGLVVTSFVIAFILSWRITLVVIATYP  833

Query  705  LIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYSKSL  878
            LI     +  L M         AY +A  +A EA+S +RTV +F  E+K V+ Y++ L
Sbjct  834  LIISGHISEKLFMKGYGGNLSKAYLKANMLAGEAVSNIRTVAAFCAEEKIVDLYAREL  891



>ref|XP_009609959.1| PREDICTED: ABC transporter B family member 1 [Nicotiana tomentosiformis]
Length=1342

 Score =   234 bits (597),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 109/261 (42%), Positives = 179/261 (69%), Gaps = 4/261 (2%)
 Frame = +3

Query  120  LEISSNLKM-DQQPSNSTDRKEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFV  296
            +E+S   K  +++PS    + + V F  LF  AD +DY  M  GS+GA +HG +LP+F  
Sbjct  62   MEVSEGKKEGNEKPST---QPQAVGFGELFRFADGLDYVLMSIGSLGAFVHGCSLPLFLR  118

Query  297  LFGRMIDSLGHLSSDSHRLSSQVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARLR  476
             F  +++S G  ++D  +++ +V K A Y + +G+ I+ S+W  ++ W  TGERQT ++R
Sbjct  119  FFADLVNSFGSYANDVDKMTQEVLKYAFYFLVVGAAIWASSWAEISCWMWTGERQTTKMR  178

Query  477  LRYLQSVLRKKIEFFDTDTRAKDIIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAVG  656
            ++YL++ L + I++FDT+ R  D++F I++DA++VQDAI +K+G+ I Y++ F+ GF VG
Sbjct  179  IKYLEAALNQDIQYFDTEVRTSDVVFAINTDAVMVQDAISEKLGNFIHYMATFVSGFVVG  238

Query  657  FISVWKLTLVTLAVVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSF  836
            F +VW+L LVTLAVVPLIAV G  +T+ ++ LS K + A ++AG + E+ + Q+RTV +F
Sbjct  239  FTAVWQLALVTLAVVPLIAVIGAIHTITLAKLSGKSQEALSKAGNIVEQTVVQIRTVLAF  298

Query  837  VGEKKAVESYSKSLNNALVLG  899
            VGE KA+++YS +L  +  +G
Sbjct  299  VGESKAMQAYSAALKVSQKIG  319


 Score =   110 bits (274),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 75/239 (31%), Positives = 127/239 (53%), Gaps = 3/239 (1%)
 Frame = +3

Query  177  KEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLSSDSHRLS  356
            K+  S FG  +  ++ ++ + + GSIG+ I G+ L  FF      + S+ + + D   +S
Sbjct  734  KDQASSFGRLAKMNSPEWTYALVGSIGSVICGS-LSAFFAYVLSAVLSV-YYNPDHAYMS  791

Query  357  SQVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKKIEFFDTDTR  536
             Q++K    L+ + S   I   +   FW   GE  T R+R + L +VL+ ++ +FD +  
Sbjct  792  KQIAKYCYLLIGVSSAALIFNTLQHFFWDVVGENLTKRVREKMLDAVLKMEMAWFDQEEN  851

Query  537  -AKDIIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLAVVPLIA  713
             +  I   ++ DA  V+ AIGD+I   ++  +  LV    GF+  W+L LV +AV P++ 
Sbjct  852  DSSRIAARLALDANNVRSAIGDRISVIMQNSALMLVACTAGFVLQWRLALVLIAVFPVVV  911

Query  714  VAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYSKSLNNAL  890
             A     + M+  S   EAA+A+A ++A EA++ VRTV +F  E K V  ++ SL   L
Sbjct  912  AATVLQKMFMTGFSGDLEAAHAKATQLAGEAVANVRTVAAFNSETKIVNLFNSSLQTPL  970



>ref|XP_008676453.1| PREDICTED: uncharacterized protein LOC100191944 isoform X1 [Zea 
mays]
 gb|ACN33264.1| unknown [Zea mays]
 gb|AFW63454.1| hypothetical protein ZEAMMB73_169648 [Zea mays]
Length=1262

 Score =   234 bits (596),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 114/229 (50%), Positives = 161/229 (70%), Gaps = 0/229 (0%)
 Frame = +3

Query  192  FFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLSSDSHRLSSQVSK  371
            F  LFS AD  D   M  GS+GAC HGA++PVFF+ FG++I+ +G        +S +V+K
Sbjct  31   FLKLFSFADRWDCVLMAVGSLGACAHGASVPVFFIFFGKLINIIGLAYLFPTTVSGRVAK  90

Query  372  QALYLVYLGSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKKIEFFDTDTRAKDII  551
             +L  VYLG +IF S+W  VA W  TGERQ A++RL YL+++L + I  FDT+    ++I
Sbjct  91   YSLDFVYLGIVIFFSSWTEVACWMHTGERQAAKMRLAYLRAMLDQDIAVFDTEASTGEVI  150

Query  552  FHISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLAVVPLIAVAGGTY  731
              I+SD ++VQDAI +K+G+ + YIS+FL GFA+GF  VW+++LVTLA+VPLIA+AGGTY
Sbjct  151  NAITSDILVVQDAISEKVGNFMHYISRFLAGFAIGFSQVWQISLVTLAIVPLIAIAGGTY  210

Query  732  TLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYSKSL  878
              +   L  +   +Y +AG++AEE I  VRTV +FVGE+KAV SY ++L
Sbjct  211  AYVTIGLMARVRKSYVKAGEIAEEVIGNVRTVQAFVGEEKAVRSYREAL  259


 Score = 77.8 bits (190),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 56/221 (25%), Positives = 110/221 (50%), Gaps = 4/221 (2%)
 Frame = +3

Query  225  DYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLSSDSHRLSSQVSKQALYLVYLGSI  404
            D+FF + G+I A + G+ +P+F +   + + S  ++  ++ +L  +V K A+       +
Sbjct  685  DWFFGLSGTISAFVAGSQMPLFALGVTQALVSY-YMGWETTKL--EVRKIAVLFCCGAVL  741

Query  405  IFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKKIEFFDTDTRAKDIIF-HISSDAILV  581
              +   I    +   GER T R+R +   ++LR +I +FD  +    ++   + +DA LV
Sbjct  742  TVVFHVIEHLSFGIMGERLTLRVREKMFSAILRNEIGWFDDTSNTSAMLSSRLEADATLV  801

Query  582  QDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLAVVPLIAVAGGTYTLIMSNLSQK  761
            +  + D+    ++ +   +    + FI  W++TLV LA  PL+     +  + M      
Sbjct  802  RTIVVDRSTILLQNVGMIVTSLIIAFILNWRITLVVLATYPLMVSGHISEKMFMKGYGGN  861

Query  762  GEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYSKSLNN  884
               +Y +A  +A EA+S +RTV +F  E+K ++ Y+  L  
Sbjct  862  LGKSYLKANMLAAEAVSNIRTVAAFCSEEKVIKLYADELRE  902



>gb|KFK43347.1| hypothetical protein AALP_AA1G113900 [Arabis alpina]
Length=1230

 Score =   233 bits (595),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 112/238 (47%), Positives = 163/238 (68%), Gaps = 0/238 (0%)
 Frame = +3

Query  186  VSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLSSDSHRLSSQV  365
            VS F LFS AD  D   M  GSIGACIHGA++PVFF+ FG++I+ +G         S +V
Sbjct  23   VSMFKLFSFADFYDCILMALGSIGACIHGASVPVFFIFFGKLINIIGLAYFFPQEASHKV  82

Query  366  SKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKKIEFFDTDTRAKD  545
            +K +L  VYL  ++  S+WI VA W  TGERQ A++R  Y++S+L + I  FDT++   +
Sbjct  83   AKYSLDFVYLSVVVLFSSWIEVACWMHTGERQAAKMRKAYIRSMLSQDISLFDTESSTGE  142

Query  546  IIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLAVVPLIAVAGG  725
            +I  I+SD ++VQDA+ +K+G+ +  +S+F+ GFA+GF SVW++TLVTLA+VP IA+AGG
Sbjct  143  VISAITSDILVVQDALSEKVGNFLHCLSRFIAGFAIGFTSVWQITLVTLAIVPFIALAGG  202

Query  726  TYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYSKSLNNALVLG  899
             Y  + + L  +   +Y +AG++AEE I  VRTV +F GE+KAV SY ++L+N    G
Sbjct  203  LYAFVSTGLIARIRKSYVKAGEIAEEVIGNVRTVQAFTGEEKAVRSYREALSNTYAYG  260


 Score = 87.4 bits (215),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 65/244 (27%), Positives = 117/244 (48%), Gaps = 5/244 (2%)
 Frame = +3

Query  150  QQPSNSTDRKEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGH  329
             QP  +   +E V+   LFS     D+ + + G++ + I G+ +P+F +   + + S  +
Sbjct  637  NQPDATKQEQEKVTLGRLFSMIRP-DWKYGICGTLSSLIGGSQMPLFALGITQALVSY-Y  694

Query  330  LSSDSHRLSSQVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKK  509
            +  D+ +   +V + ++       +  ++  I    +   GER T R+R     ++LR +
Sbjct  695  MEWDTTQ--KEVKRISILFCCASVLTVVAHAIEHTTYGIMGERLTLRVRQMMFSAILRNE  752

Query  510  IEFFD-TDTRAKDIIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLV  686
            I +FD  D  +  +   + SDA L++  + D+    +      +  F + FI  W+LTLV
Sbjct  753  IGWFDKVDNTSSMLASRLESDATLLKSIVVDRSTILLENFGLIVTSFIISFILNWRLTLV  812

Query  687  TLAVVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESY  866
             LA  PLI     +  L M         AY +A  +A E++S +RTV +F  E+K +E Y
Sbjct  813  VLATYPLIISGHISERLFMQGYGGNLSKAYLKANMLAGESVSNIRTVAAFCAEEKVLELY  872

Query  867  SKSL  878
            S  L
Sbjct  873  SNEL  876



>ref|XP_007040642.1| Multidrug/pheromone exporter, MDR family, ABC transporter family 
isoform 2, partial [Theobroma cacao]
 gb|EOY25143.1| Multidrug/pheromone exporter, MDR family, ABC transporter family 
isoform 2, partial [Theobroma cacao]
Length=1075

 Score =   232 bits (591),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 113/253 (45%), Positives = 168/253 (66%), Gaps = 5/253 (2%)
 Frame = +3

Query  135  NLKMDQQPSNSTDRKE-----MVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFVL  299
            +L  +Q    +  +KE      V    LFS AD  DY  M  GS+GAC+HGA++PVFF+ 
Sbjct  6    SLSGNQDSEGTKKKKEGMKQHKVPLLKLFSFADFYDYVLMALGSLGACVHGASVPVFFIF  65

Query  300  FGRMIDSLGHLSSDSHRLSSQVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARLRL  479
            FG++I+ +G         S +V+K +L  VYL   I  S+WI VA W  TGERQ A++R+
Sbjct  66   FGKLINIIGMAYLFPKEASHKVAKYSLDFVYLSVAILFSSWIEVACWMHTGERQAAKIRM  125

Query  480  RYLQSVLRKKIEFFDTDTRAKDIIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGF  659
             YL+S+L + I  FDT+    ++I  I+SD I+VQDA+ +K+G+ + YIS+F+ GF++GF
Sbjct  126  AYLKSMLNQDISLFDTEASTGEVISAITSDIIVVQDALSEKVGNFMHYISRFIAGFSIGF  185

Query  660  ISVWKLTLVTLAVVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFV  839
              VW+++LVTL++VPLIA+AGG Y  + + L  +   +Y +AG++AEE I  VRTV +F 
Sbjct  186  ARVWQISLVTLSIVPLIALAGGIYAYVATGLIARVRNSYVKAGEIAEEVIGNVRTVQAFA  245

Query  840  GEKKAVESYSKSL  878
            GE+KAV+SY ++L
Sbjct  246  GEEKAVKSYKEAL  258


 Score = 91.3 bits (225),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 64/219 (29%), Positives = 107/219 (49%), Gaps = 4/219 (2%)
 Frame = +3

Query  225  DYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLSSDSHRLSSQVSKQALYLVYLGSI  404
            D+++ VFG+I A I GA +P+F +   +   +L     D      +V K A+       I
Sbjct  681  DWYYGVFGTIAALIAGAQMPLFALGVSQ---ALVAYYMDWDTTCREVKKIAILFSCAAVI  737

Query  405  IFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKKIEFFDTDTRAKDIIF-HISSDAILV  581
              I   I    +   GER T R+R     ++L+ +I +FD    A  ++  H+ +DA  +
Sbjct  738  TVIVHAIEHLCFGIMGERLTLRVREGMFSAILKNEIGWFDDLNNASSMLASHLETDATFL  797

Query  582  QDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLAVVPLIAVAGGTYTLIMSNLSQK  761
            +  + D+    I+ +   +  F + FI  W++TLV LA  PLI     +  L M      
Sbjct  798  KGVVVDRSAILIQNVGLLVASFIIAFILNWRITLVVLATYPLIISGHISEKLFMQGYGGN  857

Query  762  GEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYSKSL  878
               AY +A  +A EA+S +RTV +F  E+K ++ Y++ L
Sbjct  858  LSKAYLKANMLAAEAVSNIRTVAAFCAEEKILDLYAREL  896



>emb|CDX89380.1| BnaA01g15130D [Brassica napus]
Length=1275

 Score =   233 bits (595),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 114/258 (44%), Positives = 170/258 (66%), Gaps = 3/258 (1%)
 Frame = +3

Query  135  NLKMDQQPSNSTDRKEM---VSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFVLFG  305
            N++    P+   ++++    VS   LFS AD  D   M  GSIGACIHGA++PVFF+ FG
Sbjct  41   NMEASSDPATKKEKQKATPKVSLLKLFSFADFYDCVLMTLGSIGACIHGASVPVFFIFFG  100

Query  306  RMIDSLGHLSSDSHRLSSQVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARLRLRY  485
            ++I+ +G      H  S +V+K +L  VYL   I  S+W+ VA W  TGERQ A++R  Y
Sbjct  101  KLINIIGLAYLYPHLASHKVAKYSLDFVYLSVAILFSSWLEVACWMHTGERQAAKMRRAY  160

Query  486  LQSVLRKKIEFFDTDTRAKDIIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFIS  665
            L+S+L + I  FDT+    ++I  I+SD ++VQDA+ +K+G+ + YIS+F+ GFA+GF S
Sbjct  161  LRSMLSQDISLFDTEASTGEVISAITSDILVVQDALSEKVGNFLHYISRFIAGFAIGFSS  220

Query  666  VWKLTLVTLAVVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGE  845
            VW+++LVTL++VPLIA+AGG Y  +   L  +   +Y +AG++AEE I  VRTV +F GE
Sbjct  221  VWQISLVTLSIVPLIALAGGIYAFVAIGLIARVRKSYIKAGEIAEEVIGNVRTVQAFTGE  280

Query  846  KKAVESYSKSLNNALVLG  899
            ++AV+ Y ++L N    G
Sbjct  281  ERAVKLYREALQNTFKYG  298


 Score = 87.0 bits (214),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 66/244 (27%), Positives = 114/244 (47%), Gaps = 4/244 (2%)
 Frame = +3

Query  150  QQPSNSTDRKEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGH  329
            +Q      +K  V+   L+S     D+ + + G+I A I G+ +P+F    G     + +
Sbjct  683  RQDGAEPTKKTKVTVGRLYSMIRP-DWMYGLCGTICAFIAGSQMPLF--ALGVSHSLVSY  739

Query  330  LSSDSHRLSSQVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKK  509
               D      +V K A+      +I  I   I    +   GER T R+R +   ++LR +
Sbjct  740  YEKDWVDTQKEVKKIAILFCCASAITLIVYTIEHICFGTMGERLTLRVREKMFSAILRNE  799

Query  510  IEFFD-TDTRAKDIIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLV  686
            I +FD  D  +  +   + SDA L++  + D+    ++ +   +  F + F+  W+LTLV
Sbjct  800  IGWFDEVDNTSSMLASRLESDATLLKTIVVDRSTILLQNLGLVVTSFVISFMLNWRLTLV  859

Query  687  TLAVVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESY  866
             +A  PL+     +  L M         AY +A  +A E++S +RTV +F  E K +E Y
Sbjct  860  VVATYPLVISGHISEKLFMQGYGGNLSKAYLKANMLAGESVSNIRTVAAFCAEDKILELY  919

Query  867  SKSL  878
            S+ L
Sbjct  920  SREL  923



>ref|XP_010475946.1| PREDICTED: ABC transporter B family member 10-like [Camelina 
sativa]
Length=1224

 Score =   233 bits (594),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 117/253 (46%), Positives = 165/253 (65%), Gaps = 8/253 (3%)
 Frame = +3

Query  141  KMDQQPSNSTDRKEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDS  320
            K  ++PS        VSF  LFS AD  D   M  GS GACIHGA++PVFF+ FG++I+ 
Sbjct  16   KKKERPS--------VSFLKLFSFADFYDCVLMALGSTGACIHGASVPVFFIFFGKLINI  67

Query  321  LGHLSSDSHRLSSQVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVL  500
            +G         S +V+K +L  VYL  +I  S+WI VA W  TGERQ A++R  YL+S+L
Sbjct  68   IGLAYLFPQEASPKVAKYSLDFVYLSVVILFSSWIEVACWMHTGERQAAKMRKAYLRSML  127

Query  501  RKKIEFFDTDTRAKDIIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLT  680
             + I  FDT++   ++I  I+SD ++VQDAI +K+G+ + YIS+F+ GF +GF SVW+++
Sbjct  128  SQDISLFDTESSTGEVISAITSDILVVQDAISEKVGNFLHYISRFIAGFVIGFTSVWQIS  187

Query  681  LVTLAVVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVE  860
            LVTLA+VPLIA+AGG Y  + + L  +   +Y +A ++AEE I  VRTV +F GE+KAV 
Sbjct  188  LVTLAIVPLIALAGGIYAFVGTGLIARVRKSYVKANEIAEEVIGNVRTVQAFTGEEKAVS  247

Query  861  SYSKSLNNALVLG  899
            SY  +L N    G
Sbjct  248  SYLGALKNTYTYG  260


 Score = 92.8 bits (229),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 71/244 (29%), Positives = 119/244 (49%), Gaps = 7/244 (3%)
 Frame = +3

Query  150  QQPSNSTDRKEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGH  329
            +QP   T R   V+   L+S     D+ + + G++G+ + GA +P+F +    + ++L  
Sbjct  636  KQPD--TSRHAKVTLGRLYSMIRP-DWKYGICGTLGSFVAGALMPLFAL---GISEALVS  689

Query  330  LSSDSHRLSSQVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKK  509
               D      +V + ++       I  IS  IG   +   GER T R+R +   ++LR +
Sbjct  690  YYMDWDTTQHEVKRISILFCCASVITVISHTIGHTSFGIMGERLTLRVRQKMFSAILRNE  749

Query  510  IEFFD-TDTRAKDIIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLV  686
            I +FD  D  +  +   + SDA L++  + D+    +  +   +  F + FI  W+LTLV
Sbjct  750  IGWFDKVDNTSSMLASRLESDAALLKTIVVDRSTILLENLGLVVTSFIISFILNWRLTLV  809

Query  687  TLAVVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESY  866
             LA  PLI     +  L M         AY +A  +A E+IS +RTV +F  E+K ++ Y
Sbjct  810  VLATYPLIISGHISEKLFMQGYGGNLSKAYLKANMLAGESISNIRTVAAFCAEEKVLDLY  869

Query  867  SKSL  878
            SK L
Sbjct  870  SKEL  873



>ref|XP_011077318.1| PREDICTED: ABC transporter B family member 1 [Sesamum indicum]
 ref|XP_011077319.1| PREDICTED: ABC transporter B family member 1 [Sesamum indicum]
 ref|XP_011077320.1| PREDICTED: ABC transporter B family member 1 [Sesamum indicum]
Length=1349

 Score =   233 bits (595),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 104/249 (42%), Positives = 172/249 (69%), Gaps = 0/249 (0%)
 Frame = +3

Query  153  QPSNSTDRKEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHL  332
            +P     +   V F  LF  AD +DY  M  G++GA +HG++LP+F   F  +++S G  
Sbjct  85   EPEKPGSQPPSVGFGELFRFADGLDYVLMTIGTVGAVVHGSSLPLFLRFFADLVNSFGSN  144

Query  333  SSDSHRLSSQVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKKI  512
            +++  +++ +V K A Y + +G+ I+ S+W  ++ W  TGERQ+ ++R++YL++ L + I
Sbjct  145  ANNVDKMTQEVLKYAFYFLIVGAAIWASSWAEISCWMWTGERQSTKMRIKYLEAALNQDI  204

Query  513  EFFDTDTRAKDIIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTL  692
            EFFDT+ R  D++F I+++A++VQDAI +K+G+ + Y++ F+ GF VGF +VW+L LVTL
Sbjct  205  EFFDTEVRTSDVVFAINTEAVMVQDAISEKLGNFLHYMATFVSGFVVGFTAVWQLALVTL  264

Query  693  AVVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYSK  872
            AVVPLIAV G  +T+ ++ LS K + A ++AG +AE+ I Q+RTV +FVGE +A+++YS 
Sbjct  265  AVVPLIAVIGAIHTVTLAKLSGKSQEALSQAGNIAEQTIVQIRTVLAFVGESRALQAYSA  324

Query  873  SLNNALVLG  899
            +L  A  +G
Sbjct  325  ALKVAQKIG  333


 Score =   101 bits (251),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 71/239 (30%), Positives = 125/239 (52%), Gaps = 3/239 (1%)
 Frame = +3

Query  177  KEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLSSDSHRLS  356
            KE  S F   +  ++ ++ + + GS+G+ I G+ L  FF      + S+ + + D   + 
Sbjct  748  KEQASSFWRLAKMNSPEWAYALVGSVGSVICGS-LSAFFAYVLSAVLSV-YYNPDHAYMI  805

Query  357  SQVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKKIEFFD-TDT  533
             +++K    L+ + S   I   +   FW   GE  T R+R + L +VL+ ++ +FD  + 
Sbjct  806  REIAKYCYLLIGVSSAALIFNTLQHFFWDVVGENLTKRVREKMLVAVLKNEMAWFDREEN  865

Query  534  RAKDIIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLAVVPLIA  713
             +  I   ++ DA  V+ AIGD+I   ++  +  LV    GF+  W+L LV +AV P++ 
Sbjct  866  ESSRIAARLALDANNVRSAIGDRISVIMQNSALMLVACTAGFVLQWRLALVLIAVFPVVV  925

Query  714  VAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYSKSLNNAL  890
             A     + M+  S   EAA+++A ++A EA++ VRTV +F  E K V  ++ SL   L
Sbjct  926  AATVLQKMFMNGFSGDLEAAHSKATQLAGEAVANVRTVAAFNSESKIVGLFTSSLQPPL  984



>ref|XP_006854029.1| hypothetical protein AMTR_s00048p00046670 [Amborella trichopoda]
 gb|ERN15496.1| hypothetical protein AMTR_s00048p00046670 [Amborella trichopoda]
Length=1263

 Score =   233 bits (594),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 111/231 (48%), Positives = 162/231 (70%), Gaps = 0/231 (0%)
 Frame = +3

Query  186  VSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLSSDSHRLSSQV  365
            V FF LF+ AD  D+  M  GS+GAC HGA++PVFF+ FG++I+ +G        +S +V
Sbjct  35   VPFFKLFAFADKWDWVLMAIGSLGACAHGASVPVFFIFFGKLINIIGIAYLFPRSVSDRV  94

Query  366  SKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKKIEFFDTDTRAKD  545
            +K +L  VYLG  I  S+W  VA W  TGERQ  ++RL Y++S+L + I  FDT+    +
Sbjct  95   AKYSLDFVYLGIAILFSSWTEVACWMYTGERQARKMRLAYVRSMLNQDISLFDTEASTGE  154

Query  546  IIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLAVVPLIAVAGG  725
            +I  I++D ++VQDAI +K+G+ + YIS+F+ GFA+GF+ VW+L+LVTL++VPLIA+AGG
Sbjct  155  VISAITTDILVVQDAISEKVGNFMHYISRFIAGFAIGFMHVWQLSLVTLSIVPLIAIAGG  214

Query  726  TYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYSKSL  878
             Y  I + L  +   +Y +AG++AEE I  VRTV +FVGE+KAV SY ++L
Sbjct  215  IYAYIATGLMARVRKSYVKAGEIAEEVIGNVRTVQAFVGEEKAVRSYRRAL  265


 Score = 84.7 bits (208),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 65/243 (27%), Positives = 117/243 (48%), Gaps = 13/243 (5%)
 Frame = +3

Query  174  RKEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFVLFGRMI----DSLGHLSSD  341
            + + VS   L+S A   D+ F  FG+IGA   GA +P+F +   + +            +
Sbjct  671  KPKPVSLRRLYSMA-APDWVFGTFGTIGAIFAGAQMPLFALGVSQALVVYYSDWDTTRRE  729

Query  342  SHRLSSQVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKKIEFF  521
              R++      A   V+  +I  +S  I        GER T R+R +   ++LR +I +F
Sbjct  730  IRRIALLFCAAAALTVFFHTIEHLSFGI-------MGERLTLRVREKMFGAILRNEIGWF  782

Query  522  D-TDTRAKDIIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLAV  698
            D T+  +  +   + SDA L++  + D+    ++ I+  +  F + F+  W++ L+ +A 
Sbjct  783  DNTNNNSAMLASRLESDATLLRTIVVDRSTILLQNIALVITSFIIAFMLNWRIALLMIAT  842

Query  699  VPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYSKSL  878
             PL+     +  L M         AY +A  +A EA+S +RTV +F  E K +  Y++SL
Sbjct  843  YPLLISGHISEKLFMQGYGGNLSKAYLQANMLAGEAVSNIRTVTAFCAEDKVIHLYTESL  902

Query  879  NNA  887
            ++ 
Sbjct  903  SSP  905



>ref|XP_009139729.1| PREDICTED: ABC transporter B family member 2 [Brassica rapa]
Length=1234

 Score =   233 bits (594),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 116/260 (45%), Positives = 171/260 (66%), Gaps = 3/260 (1%)
 Frame = +3

Query  120  LEISSNLKMDQQPSNSTDRKEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFVL  299
            +E SS+    ++   +T +   VS   LFS AD  D   M  GSIGACIHGA++PVFF+ 
Sbjct  1    MEASSDPATKKEKQKATPK---VSLLKLFSFADFYDCVLMTLGSIGACIHGASVPVFFIF  57

Query  300  FGRMIDSLGHLSSDSHRLSSQVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARLRL  479
            FG++I+ +G      H  S +V+K +L  VYL   I  S+W+ VA W  TGERQ A++R 
Sbjct  58   FGKLINIIGLAYLYPHLASHKVAKYSLDFVYLSVAILFSSWLEVACWMHTGERQAAKMRR  117

Query  480  RYLQSVLRKKIEFFDTDTRAKDIIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGF  659
             YL+S+L + I  FDT+    ++I  I+SD ++VQDA+ +K+G+ + YIS+F+ GFA+GF
Sbjct  118  AYLRSMLSQDISLFDTEASTGEVISAITSDILVVQDALSEKVGNFLHYISRFIAGFAIGF  177

Query  660  ISVWKLTLVTLAVVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFV  839
             SVW+++LVTL++VPLIA+AGG Y  +   L  +   +Y +AG++AEE I  VRTV +F 
Sbjct  178  SSVWQISLVTLSIVPLIALAGGIYAFVAIGLIARVRKSYIKAGEIAEEVIGNVRTVQAFT  237

Query  840  GEKKAVESYSKSLNNALVLG  899
            GE++AV+ Y ++L N    G
Sbjct  238  GEERAVKLYREALQNTFKYG  257


 Score = 86.7 bits (213),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 66/244 (27%), Positives = 114/244 (47%), Gaps = 4/244 (2%)
 Frame = +3

Query  150  QQPSNSTDRKEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGH  329
            +Q      +K  V+   L+S     D+ + + G+I A I G+ +P+F    G     + +
Sbjct  642  RQDGAEPTKKTKVTVGRLYSMIRP-DWMYGLCGTICAFIAGSQMPLF--ALGVSHSLVSY  698

Query  330  LSSDSHRLSSQVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKK  509
               D      +V K A+      +I  I   I    +   GER T R+R +   ++LR +
Sbjct  699  YEKDWVDTQKEVKKIAILFCCASAITLIVYTIEHICFGTMGERLTLRVREKMFSAILRNE  758

Query  510  IEFFD-TDTRAKDIIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLV  686
            I +FD  D  +  +   + SDA L++  + D+    ++ +   +  F + F+  W+LTLV
Sbjct  759  IGWFDEVDNTSSMLASRLESDATLLKTIVVDRSTILLQNLGLVVTSFVISFMLNWRLTLV  818

Query  687  TLAVVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESY  866
             +A  PL+     +  L M         AY +A  +A E++S +RTV +F  E K +E Y
Sbjct  819  VVATYPLVISGHISEKLFMQGYGGNLSKAYLKANMLAGESVSNIRTVAAFCAEDKILELY  878

Query  867  SKSL  878
            S+ L
Sbjct  879  SREL  882



>gb|KFK36572.1| hypothetical protein AALP_AA4G140900 [Arabis alpina]
Length=1329

 Score =   233 bits (594),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 107/238 (45%), Positives = 167/238 (70%), Gaps = 0/238 (0%)
 Frame = +3

Query  186  VSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLSSDSHRLSSQV  365
            V+F  LF  AD +DY  M  GS+GA +HG +LP+F   F  +++S G  S++  ++  +V
Sbjct  70   VAFKELFRFADGLDYVLMGIGSVGAFVHGCSLPLFLRFFADLVNSFGSNSNNVDKMMQEV  129

Query  366  SKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKKIEFFDTDTRAKD  545
             K ALY + +G+ I+ S+W  ++ W  TGERQT ++R++YL++ L + I+FFDT+ R  D
Sbjct  130  LKYALYFLVVGAAIWASSWAEISCWMWTGERQTTKMRIKYLEAALNQDIQFFDTEVRTSD  189

Query  546  IIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLAVVPLIAVAGG  725
            ++F I++DA++VQDAI +K+G+ I Y++ F+ GF VGF +VW+L LVTLAVVPLIAV GG
Sbjct  190  VVFAINTDAVMVQDAISEKLGNFIHYMATFVSGFIVGFTAVWQLALVTLAVVPLIAVIGG  249

Query  726  TYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYSKSLNNALVLG  899
             +T  +S LS K + + ++AG + E+ + Q+R V +FVGE +A+++YS +L  A  LG
Sbjct  250  IHTTTLSKLSNKSQESLSQAGNIVEQTVVQIRVVMAFVGESRALQAYSSALKIAQKLG  307


 Score = 92.4 bits (228),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 70/239 (29%), Positives = 124/239 (52%), Gaps = 3/239 (1%)
 Frame = +3

Query  177  KEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLSSDSHRLS  356
            K+  + F   +  ++ ++ + + GS+G+ + G+ L  FF      + S+ + + +   + 
Sbjct  723  KDQANSFWRLAKMNSPEWKYALLGSVGSVVCGS-LSAFFAYVLSAVLSI-YYNPNHEYMI  780

Query  357  SQVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKKIEFFD-TDT  533
             Q+ K    L+ L S   I   +  +FW   GE  T R+R + L +VL+ ++ +FD  + 
Sbjct  781  KQIDKYCYLLIGLSSAALIFNTLQHSFWDIVGENLTKRVREKMLSAVLKNEMAWFDQEEN  840

Query  534  RAKDIIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLAVVPLIA  713
             +  I   ++ DA  V+ AIGD+I   ++  +  LV    GF+  W+L LV +AV P++ 
Sbjct  841  ESARIAARLALDANNVRSAIGDRISVIVQNTALMLVACTAGFVLQWRLALVLVAVFPVVV  900

Query  714  VAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYSKSLNNAL  890
             A     + M+  S   EAA+A+  ++A EAI+ VRTV +F  E K V  Y+ +L   L
Sbjct  901  AATVLQKMFMTGFSGDLEAAHAKGTQLAGEAIANVRTVAAFNSEAKIVRLYTANLEPPL  959



>ref|XP_010491749.1| PREDICTED: ABC transporter B family member 10 [Camelina sativa]
Length=1226

 Score =   233 bits (593),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 117/258 (45%), Positives = 169/258 (66%), Gaps = 8/258 (3%)
 Frame = +3

Query  126  ISSNLKMDQQPSNSTDRKEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFVLFG  305
            +++  K  ++PS        VSF  LFS AD  D   M  GSIGACIHGA++PVFF+ FG
Sbjct  12   LAATKKKKERPS--------VSFLKLFSFADFYDCVLMALGSIGACIHGASVPVFFIFFG  63

Query  306  RMIDSLGHLSSDSHRLSSQVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARLRLRY  485
            ++I+ +G         S +V+K +L  VYL  +I  S+WI VA W  TGERQ A++R  Y
Sbjct  64   KLINIIGLAYLFPREASHKVAKYSLDFVYLSVVILFSSWIEVACWMHTGERQAAKMRKAY  123

Query  486  LQSVLRKKIEFFDTDTRAKDIIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFIS  665
            L+S+L + I  FDT++   ++I  I+SD ++V+DAI +K+G+ + YIS+F+ GF +GF S
Sbjct  124  LRSMLSQDISLFDTESSTGEVISAITSDILVVRDAISEKVGNFLHYISRFIAGFVIGFTS  183

Query  666  VWKLTLVTLAVVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGE  845
            VW+++LVTLA+VPLIA+AGG Y  + + L  +   +Y +A ++AEE I  VRTV +F GE
Sbjct  184  VWQISLVTLAIVPLIALAGGIYAFVGTGLIARVRKSYVKANEIAEEVIGNVRTVQAFTGE  243

Query  846  KKAVESYSKSLNNALVLG  899
            +KAV SY  +L N    G
Sbjct  244  EKAVSSYLGALKNTYTYG  261


 Score = 89.7 bits (221),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 70/244 (29%), Positives = 118/244 (48%), Gaps = 7/244 (3%)
 Frame = +3

Query  150  QQPSNSTDRKEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGH  329
            +QP   T R   V+   L+S     D+ + + G++G+ + GA +P+F +    + ++L  
Sbjct  637  KQPD--TSRHAKVTLGRLYSMIRP-DWKYGICGTLGSFVAGALMPLFAL---GISEALVS  690

Query  330  LSSDSHRLSSQVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKK  509
               D      +V + ++       I  IS  I    +   GER T R+R +   ++LR +
Sbjct  691  YYMDWDTTQHEVKRISILFCCASVITVISHAIEHTSFGIMGERLTLRVRQKMFSAILRNE  750

Query  510  IEFFD-TDTRAKDIIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLV  686
            I +FD  D  +  +   + SDA L++  + D+    +  +   +  F + FI  W+LTLV
Sbjct  751  IGWFDKVDNTSSMLASRLESDAALLKTIVVDRSTILLENLGLVVTSFIISFILNWRLTLV  810

Query  687  TLAVVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESY  866
             LA  PLI     +  L M         AY +A  +A E+IS +RTV +F  E+K ++ Y
Sbjct  811  VLATYPLIISGHISEKLFMQGYGGNLSKAYLKANMLAGESISNIRTVAAFCAEEKVLDLY  870

Query  867  SKSL  878
            SK L
Sbjct  871  SKEL  874



>ref|XP_011094609.1| PREDICTED: ABC transporter B family member 1-like [Sesamum indicum]
Length=1378

 Score =   233 bits (594),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 102/233 (44%), Positives = 168/233 (72%), Gaps = 0/233 (0%)
 Frame = +3

Query  201  LFSAADTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLSSDSHRLSSQVSKQAL  380
            LF  AD +DY  M  GS+GA +HG++LP+F   F  +++S G  ++D  +++ +V K AL
Sbjct  118  LFRFADGLDYVLMAIGSVGAIVHGSSLPLFLRFFADLVNSFGSNANDVDKMTQEVLKYAL  177

Query  381  YLVYLGSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKKIEFFDTDTRAKDIIFHI  560
            Y + +G+ I+ S+W  ++ W  TGERQ+ ++R++YL++ L + I++FDT+ R  D++F I
Sbjct  178  YFLVVGAAIWASSWAEISCWMWTGERQSTKMRIKYLEAALNQDIQYFDTEVRTSDVVFAI  237

Query  561  SSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLAVVPLIAVAGGTYTLI  740
            ++DA++VQDAI +K+G+ + Y++ F+ GF VGF +VW+L LVTLAVVPLIAV GG +T +
Sbjct  238  NTDAVMVQDAISEKLGNFLHYMATFVSGFVVGFTAVWQLALVTLAVVPLIAVIGGIHTAM  297

Query  741  MSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYSKSLNNALVLG  899
            ++  S K + A ++AG + E+ ++Q+RTV +FVGE +A++SYS +L  A  +G
Sbjct  298  LAKFSSKSQEALSQAGNIVEQTVAQIRTVLAFVGESRALQSYSAALRVAQKIG  350


 Score = 99.0 bits (245),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 68/239 (28%), Positives = 124/239 (52%), Gaps = 3/239 (1%)
 Frame = +3

Query  177   KEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLSSDSHRLS  356
             KE  S F   +  ++ ++ + + GSIG+ + G+ L  FF      + S+ + + D   + 
Sbjct  765   KEQASSFLRLAKMNSPEWAYALVGSIGSVVCGS-LSAFFAYVLSAVLSV-YYNPDHAYMI  822

Query  357   SQVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKKIEFFD-TDT  533
              +++K    L+ + S   I   +   FW   GE  T R+R +   +VL+ ++ +FD  + 
Sbjct  823   REIAKYCYLLIGVSSAALIFNTLQHYFWDTVGENLTKRVREKMFAAVLKNEMAWFDQEEN  882

Query  534   RAKDIIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLAVVPLIA  713
              +  +   ++ DA  V+ AIGD+I   ++  +  LV    GF+  W+L LV +AV P++ 
Sbjct  883   ESSRVSARLALDANNVRSAIGDRISVIMQNSALMLVACTAGFVLQWRLALVLIAVFPVVV  942

Query  714   VAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYSKSLNNAL  890
              A     + M+  S   EAA+A+A ++A E+++ +RTV +F  E K V  ++ SL   L
Sbjct  943   AATVLQKMFMNGFSGDLEAAHAKATQLAGESVANIRTVAAFNSEAKIVGLFTSSLQTPL  1001



>emb|CDX94395.1| BnaC01g17890D [Brassica napus]
Length=1234

 Score =   232 bits (592),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 115/260 (44%), Positives = 171/260 (66%), Gaps = 3/260 (1%)
 Frame = +3

Query  120  LEISSNLKMDQQPSNSTDRKEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFVL  299
            +E SS+    ++   +T +   VS   LFS AD  D   M  GSIGACIHGA++P+FF+ 
Sbjct  1    MEASSDPATKKEKQKATPK---VSLLKLFSFADFYDCVLMTLGSIGACIHGASVPIFFIF  57

Query  300  FGRMIDSLGHLSSDSHRLSSQVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARLRL  479
            FG++I+ +G      H  S +V+K +L  VYL   I  S+W+ VA W  TGERQ A++R 
Sbjct  58   FGKLINIIGLAYLYPHLASHKVAKYSLDFVYLSVAILFSSWLEVACWMHTGERQAAKMRR  117

Query  480  RYLQSVLRKKIEFFDTDTRAKDIIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGF  659
             YL+S+L + I  FDT+    ++I  I+SD ++VQDA+ +K+G+ + YIS+F+ GFA+GF
Sbjct  118  AYLRSMLSQDISLFDTEASTGEVISAITSDILVVQDALSEKVGNFLHYISRFIAGFAIGF  177

Query  660  ISVWKLTLVTLAVVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFV  839
             SVW+++LVTL++VPLIA+AGG Y  +   L  +   +Y +AG++AEE I  VRTV +F 
Sbjct  178  SSVWQISLVTLSIVPLIALAGGIYAFVAIGLIARVRKSYIKAGEIAEEVIGNVRTVQAFT  237

Query  840  GEKKAVESYSKSLNNALVLG  899
            GE++AV+ Y ++L N    G
Sbjct  238  GEERAVKLYREALQNTFKYG  257


 Score = 86.7 bits (213),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 66/244 (27%), Positives = 114/244 (47%), Gaps = 4/244 (2%)
 Frame = +3

Query  150  QQPSNSTDRKEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGH  329
            +Q      +K  V+   L+S     D+ + + G+I A I G+ +P+F    G     + +
Sbjct  642  RQDGAEPTKKTKVTVGRLYSMIRP-DWMYGLCGTICAFIAGSQMPLF--ALGVSHSLVSY  698

Query  330  LSSDSHRLSSQVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKK  509
               D      +V K A+      +I  I   I    +   GER T R+R +   ++LR +
Sbjct  699  YEKDWVDTQKEVKKIAILFCCASAITLIVYTIEHICFGTMGERLTLRVREKMFSAILRNE  758

Query  510  IEFFD-TDTRAKDIIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLV  686
            I +FD  D  +  +   + SDA L++  + D+    ++ +   +  F + F+  W+LTLV
Sbjct  759  IGWFDEVDNTSSMLASRLESDATLLKTIVVDRSTILLQNLGLVVTSFVISFMLNWRLTLV  818

Query  687  TLAVVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESY  866
             +A  PL+     +  L M         AY +A  +A E++S +RTV +F  E K +E Y
Sbjct  819  VVATFPLVISGHISEKLFMQGYGGNLSKAYLKANMLAGESVSNIRTVAAFCAEDKILELY  878

Query  867  SKSL  878
            S+ L
Sbjct  879  SREL  882



>ref|XP_010538383.1| PREDICTED: ABC transporter B family member 2-like [Tarenaya hassleriana]
Length=1256

 Score =   232 bits (592),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 112/232 (48%), Positives = 159/232 (69%), Gaps = 0/232 (0%)
 Frame = +3

Query  189  SFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLSSDSHRLSSQVS  368
            S   LFS AD  DY  M  GS+GAC+HGA++PVFF+ FG++I+ +G       + S QV+
Sbjct  32   SLVKLFSFADFYDYVLMAVGSMGACVHGASVPVFFIFFGKLINIIGIAYLFPKQASPQVA  91

Query  369  KQALYLVYLGSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKKIEFFDTDTRAKDI  548
            K +L  VYL   I  S+WI VA W  TGERQ A++R  YL+S+L + I  FDT+    ++
Sbjct  92   KYSLDFVYLSVAILFSSWIEVACWMHTGERQAAKMRRAYLRSMLSQDISLFDTEASTGEV  151

Query  549  IFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLAVVPLIAVAGGT  728
            I  I+SD I+VQDA+ +K+G+ + YIS+F+ GFA+GF  VW+++LVTL++VPLIA+AGG 
Sbjct  152  ISAITSDIIVVQDALSEKVGNFLHYISRFIAGFAIGFARVWQISLVTLSIVPLIALAGGI  211

Query  729  YTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYSKSLNN  884
            Y  + + L  +   +Y +AG++AEE I  VRTV +F GE+KAV SY  +L N
Sbjct  212  YAFVATGLLARVRKSYVKAGEIAEEVIGNVRTVQAFAGEEKAVRSYRDALKN  263


 Score = 80.1 bits (196),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 60/219 (27%), Positives = 107/219 (49%), Gaps = 4/219 (2%)
 Frame = +3

Query  225  DYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLSSDSHRLSSQVSKQALYLVYLGSI  404
            D+ + V G+ GA + GA +P+F +   + + S  ++  D+ +   +V + A+       +
Sbjct  681  DWPYGVSGTFGALVAGAQMPLFALGVSQALVSY-YMDWDTTQ--HEVKRIAVLFCCASVV  737

Query  405  IFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKKIEFFD-TDTRAKDIIFHISSDAILV  581
              I   I    +   GER T R+R     ++LR +I +FD  +  +  +   +  DA L+
Sbjct  738  TVIVYTIEHLSFGIMGERLTLRVREMMFSAILRNEIGWFDDVNNTSSMLASRLEGDATLL  797

Query  582  QDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLAVVPLIAVAGGTYTLIMSNLSQK  761
            +  + D+    ++ +      F + FI  W+LTLV LA  PL+     +  L M      
Sbjct  798  KTIVVDRSTILLQNVGLVATSFIIAFILNWRLTLVVLATYPLVISGHISEKLFMQGYGGN  857

Query  762  GEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYSKSL  878
               AY +A  +A EA+S +RTV +F  E+K ++ YS+ L
Sbjct  858  LSKAYLKANMLAGEAVSNIRTVAAFCAEEKVLDLYSREL  896



>gb|AFP44695.1| hypothetical protein [Eragrostis tef]
Length=1354

 Score =   233 bits (593),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 112/256 (44%), Positives = 168/256 (66%), Gaps = 5/256 (2%)
 Frame = +3

Query  147  DQQPSNSTDRKEMVSFF-----GLFSAADTVDYFFMVFGSIGACIHGAALPVFFVLFGRM  311
            +Q       +K+ VS        LF  AD +D   M  G++GA +HG +LPVF   F  +
Sbjct  84   EQNKEQENTKKKGVSLAPAPLGSLFRFADGLDCVLMSVGTLGALVHGCSLPVFLRFFADL  143

Query  312  IDSLGHLSSDSHRLSSQVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARLRLRYLQ  491
            +DS G  + D   +   V+K ALY + +G+ I+ S+W  ++ W  TGERQ+ R+R+RYL+
Sbjct  144  VDSFGSHADDPDTMVRLVAKYALYFLVVGAAIWASSWAEISCWMWTGERQSTRMRIRYLE  203

Query  492  SVLRKKIEFFDTDTRAKDIIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVW  671
            S LR+ + FFDTD R  D+I+ I++DA++VQDAI +K+G+ I Y++ F+ GF VGF + W
Sbjct  204  SALRQDVSFFDTDVRTSDVIYAINADAVIVQDAISEKLGNLIHYMATFVAGFVVGFTAAW  263

Query  672  KLTLVTLAVVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKK  851
            +L LVTLAVVPLIAV GG     ++ LS + + A AEA  +AE+A++Q+RTV +FVGE++
Sbjct  264  QLALVTLAVVPLIAVIGGLSAAALAKLSSRSQDALAEASNIAEQAVAQIRTVQAFVGEER  323

Query  852  AVESYSKSLNNALVLG  899
            A+ +YS +L  A  +G
Sbjct  324  AMRAYSLALAAAQRIG  339


 Score =   102 bits (253),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 73/260 (28%), Positives = 127/260 (49%), Gaps = 6/260 (2%)
 Frame = +3

Query  114  GELEISSNLKMDQQPSNSTDRKEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFF  293
            GEL   +  KM  Q      R    SF  L +  ++ ++ + + GS+G+ + G+   +F 
Sbjct  743  GELPEGNTKKMIHQ--RVAFRAGASSFLRL-AKMNSPEWGYALVGSLGSMVCGSFSAIFA  799

Query  294  VLFGRMIDSLGHLSSDSHRLSSQVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARL  473
             +   ++    + + D   +  +++K    L+ + S   +   +   FW   GE  T R+
Sbjct  800  YVLSAVLSV--YYAPDPGHMRREIAKYCYLLMGMSSAALVCNTVQHVFWDTVGENLTKRV  857

Query  474  RLRYLQSVLRKKIEFFDTDTRAK-DIIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFA  650
            R R L +VLR ++ +FD +  A   +   ++ DA  V+ AIGD+I   ++  +  LV   
Sbjct  858  RERMLGAVLRNEMAWFDAEENASARVAARLALDAQNVRSAIGDRISVIVQNSALLLVACT  917

Query  651  VGFISVWKLTLVTLAVVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVY  830
             GF+  W+L LV L V PL+  A     + M   S   EAA+A A ++A EA++ +RTV 
Sbjct  918  AGFVLQWRLALVLLGVFPLVVAATVLQKMFMKGFSGDLEAAHARATQIAGEAVANLRTVA  977

Query  831  SFVGEKKAVESYSKSLNNAL  890
            +F  E K    ++ +L   L
Sbjct  978  AFNAEAKIAGLFAGNLRGPL  997



>ref|XP_004953524.1| PREDICTED: ABC transporter B family member 2-like [Setaria italica]
Length=1257

 Score =   232 bits (592),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 113/231 (49%), Positives = 161/231 (70%), Gaps = 0/231 (0%)
 Frame = +3

Query  186  VSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLSSDSHRLSSQV  365
            V F  LFS AD  D   M  GS+GAC HGA++PVFF+ FG++I+ +G        +S +V
Sbjct  27   VPFLKLFSFADQWDCVLMAVGSLGACAHGASVPVFFIFFGKLINIIGLAYLFPTTVSGRV  86

Query  366  SKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKKIEFFDTDTRAKD  545
            +K +L  VYLG +I  S+W  VA W  TGERQ A++RL YL+++L + I  FDT+    +
Sbjct  87   AKYSLDFVYLGIVILFSSWTEVACWMHTGERQAAKMRLAYLRAMLDQDIAVFDTEASTGE  146

Query  546  IIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLAVVPLIAVAGG  725
            +I  I+SD ++VQDAI +K+G+ + YIS+F+ GFA+GF  VW+++LVTLA+VPLIA+AGG
Sbjct  147  VINAITSDILVVQDAISEKVGNFMHYISRFVAGFAIGFSQVWQISLVTLAIVPLIAIAGG  206

Query  726  TYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYSKSL  878
            TY  +   L  +   +Y +AG++AEE I  VRTV +FVGE+KAV SY ++L
Sbjct  207  TYAYVTIGLMARVRKSYVKAGEIAEEVIGNVRTVQAFVGEEKAVRSYREAL  257


 Score = 77.8 bits (190),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 60/230 (26%), Positives = 113/230 (49%), Gaps = 22/230 (10%)
 Frame = +3

Query  225  DYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLSS-DSHRLSSQVSKQALYLVYLGS  401
            D+FF V G++ A + G+ +P+F         +LG   +  S+ +  + +KQ +  +   S
Sbjct  682  DWFFGVSGTLSAFVAGSQMPLF---------ALGVTQALVSYYMGWETTKQEVRKI---S  729

Query  402  IIFIS-AWIGVAF-------WTQTGERQTARLRLRYLQSVLRKKIEFFDTDTRAKDIIF-  554
            ++F   A + V F       +   GER T R+R +   ++LR +I +FD  +    ++  
Sbjct  730  VLFCCGAVLTVVFHVIEHLSFGIMGERLTLRVREKMFSAILRNEIGWFDDTSNTSAMLSS  789

Query  555  HISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLAVVPLIAVAGGTYT  734
             + +DA LV+  + D+    ++ +   +    + FI  W++TLV LA  PL+     +  
Sbjct  790  RLEADATLVRTIVVDRSTILLQNVGMIVTSLIIAFILNWRITLVVLATYPLMVSGHISEK  849

Query  735  LIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYSKSLNN  884
            + M         +Y +A  +A EA+S +RTV +F  E+K ++ Y+  L  
Sbjct  850  MFMKGYGGNLGKSYLKANMLAAEAVSNIRTVAAFCSEEKVIKLYADELKE  899



>gb|AFP44681.1| hypothetical protein [Eragrostis tef]
Length=1347

 Score =   233 bits (593),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 110/251 (44%), Positives = 168/251 (67%), Gaps = 5/251 (2%)
 Frame = +3

Query  162  NSTDRKEMVSFF-----GLFSAADTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLG  326
            N  ++K+ V+        LF  AD +D   M  G++GA +HG +LPVF   F  ++DS G
Sbjct  84   NKEEKKKGVALAPAPLGSLFRFADGLDCVLMSVGTLGALVHGCSLPVFLRFFAELVDSFG  143

Query  327  HLSSDSHRLSSQVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVLRK  506
              + D   +   V++ ALY + +G+ I+ S+W  ++ W  TGERQ+ R+R+RYL+S LR+
Sbjct  144  SHADDPDTMVRLVARYALYFLVVGAAIWASSWAEISCWMWTGERQSTRMRIRYLESALRQ  203

Query  507  KIEFFDTDTRAKDIIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLV  686
             + FFDTD R  D+I+ I++DA++VQDAI +K+G+ I Y++ F+ GF VGF + W+L LV
Sbjct  204  DVSFFDTDVRTSDVIYAINADAVIVQDAISEKLGNLIHYMATFVAGFVVGFTAAWQLALV  263

Query  687  TLAVVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESY  866
            TLAVVPLIAV GG     ++ LS + + A AEA  +AE+A++Q+RTV +FVGE++A+ +Y
Sbjct  264  TLAVVPLIAVIGGLSAAALAKLSSRSQDALAEASNIAEQAVAQIRTVQAFVGEERAMRAY  323

Query  867  SKSLNNALVLG  899
            S +L  A  +G
Sbjct  324  SLALGMAQRIG  334


 Score =   104 bits (259),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 76/260 (29%), Positives = 128/260 (49%), Gaps = 5/260 (2%)
 Frame = +3

Query  114  GELEISSNLKMDQQPSNSTDRKEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFF  293
            GEL I SN K   Q      R    SF+ L +  ++ ++ + + GS+G+ + G+   +F 
Sbjct  736  GEL-IESNNKAHHQRRRIAFRAGASSFWRL-AKMNSPEWGYALVGSLGSMVCGSFSAIFA  793

Query  294  VLFGRMIDSLGHLSSDSHRLSSQVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARL  473
                 ++    + + D   +  Q+ K    L+ + S   +   +  AFW   GE  T R+
Sbjct  794  YALSAVLSV--YYAPDPGYMRRQIGKYCYLLMGMSSAALVFNTVQHAFWDTVGENLTKRV  851

Query  474  RLRYLQSVLRKKIEFFDTDTRAK-DIIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFA  650
            R R   +VLR ++ +FD +  A   +   ++ DA  V+ AIGD+I   ++  +  LV   
Sbjct  852  RERMFGAVLRNEVAWFDAEENASARVAARLALDAQNVRSAIGDRISVIVQNSALLLVACT  911

Query  651  VGFISVWKLTLVTLAVVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVY  830
             GF+  W+L LV LAV PL+  A     + M   S   EAA+A A ++A EA++ +RTV 
Sbjct  912  AGFVLQWRLALVLLAVFPLVVAATVLQKMFMKGFSGDLEAAHARATQIAGEAVANLRTVA  971

Query  831  SFVGEKKAVESYSKSLNNAL  890
            +F  + K    ++ +L   L
Sbjct  972  AFNAQAKIAGLFAANLRGPL  991



>ref|XP_007040641.1| Multidrug/pheromone exporter, MDR family, ABC transporter family 
isoform 1 [Theobroma cacao]
 gb|EOY25142.1| Multidrug/pheromone exporter, MDR family, ABC transporter family 
isoform 1 [Theobroma cacao]
Length=1251

 Score =   232 bits (592),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 113/253 (45%), Positives = 168/253 (66%), Gaps = 5/253 (2%)
 Frame = +3

Query  135  NLKMDQQPSNSTDRKE-----MVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFVL  299
            +L  +Q    +  +KE      V    LFS AD  DY  M  GS+GAC+HGA++PVFF+ 
Sbjct  6    SLSGNQDSEGTKKKKEGMKQHKVPLLKLFSFADFYDYVLMALGSLGACVHGASVPVFFIF  65

Query  300  FGRMIDSLGHLSSDSHRLSSQVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARLRL  479
            FG++I+ +G         S +V+K +L  VYL   I  S+WI VA W  TGERQ A++R+
Sbjct  66   FGKLINIIGMAYLFPKEASHKVAKYSLDFVYLSVAILFSSWIEVACWMHTGERQAAKIRM  125

Query  480  RYLQSVLRKKIEFFDTDTRAKDIIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGF  659
             YL+S+L + I  FDT+    ++I  I+SD I+VQDA+ +K+G+ + YIS+F+ GF++GF
Sbjct  126  AYLKSMLNQDISLFDTEASTGEVISAITSDIIVVQDALSEKVGNFMHYISRFIAGFSIGF  185

Query  660  ISVWKLTLVTLAVVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFV  839
              VW+++LVTL++VPLIA+AGG Y  + + L  +   +Y +AG++AEE I  VRTV +F 
Sbjct  186  ARVWQISLVTLSIVPLIALAGGIYAYVATGLIARVRNSYVKAGEIAEEVIGNVRTVQAFA  245

Query  840  GEKKAVESYSKSL  878
            GE+KAV+SY ++L
Sbjct  246  GEEKAVKSYKEAL  258


 Score = 90.9 bits (224),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 64/219 (29%), Positives = 107/219 (49%), Gaps = 4/219 (2%)
 Frame = +3

Query  225  DYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLSSDSHRLSSQVSKQALYLVYLGSI  404
            D+++ VFG+I A I GA +P+F +   +   +L     D      +V K A+       I
Sbjct  681  DWYYGVFGTIAALIAGAQMPLFALGVSQ---ALVAYYMDWDTTCREVKKIAILFSCAAVI  737

Query  405  IFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKKIEFFDTDTRAKDIIF-HISSDAILV  581
              I   I    +   GER T R+R     ++L+ +I +FD    A  ++  H+ +DA  +
Sbjct  738  TVIVHAIEHLCFGIMGERLTLRVREGMFSAILKNEIGWFDDLNNASSMLASHLETDATFL  797

Query  582  QDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLAVVPLIAVAGGTYTLIMSNLSQK  761
            +  + D+    I+ +   +  F + FI  W++TLV LA  PLI     +  L M      
Sbjct  798  KGVVVDRSAILIQNVGLLVASFIIAFILNWRITLVVLATYPLIISGHISEKLFMQGYGGN  857

Query  762  GEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYSKSL  878
               AY +A  +A EA+S +RTV +F  E+K ++ Y++ L
Sbjct  858  LSKAYLKANMLAAEAVSNIRTVAAFCAEEKILDLYAREL  896



>ref|XP_010684039.1| PREDICTED: ABC transporter B family member 1 [Beta vulgaris subsp. 
vulgaris]
Length=1339

 Score =   233 bits (593),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 112/261 (43%), Positives = 171/261 (66%), Gaps = 8/261 (3%)
 Frame = +3

Query  117  ELEISSNLKMDQQPSNSTDRKEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFV  296
            E+E+S   K    P+        V+F  LF  AD +D   M  GS+GA +HG ALP+F  
Sbjct  61   EMEVSEGKKEGLPPA--------VAFKELFRFADGLDCILMTIGSLGAFVHGCALPLFLR  112

Query  297  LFGRMIDSLGHLSSDSHRLSSQVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARLR  476
             F  +++S G  +++  ++  +V K A Y + +G+ I+ S+W  +A W  TGERQ+ ++R
Sbjct  113  FFADLVNSFGSYANNPDKMMQEVLKYAYYFLVVGAAIWASSWAEIACWMWTGERQSTKMR  172

Query  477  LRYLQSVLRKKIEFFDTDTRAKDIIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAVG  656
            ++YL++ L + I++FDT  R+ DI+F I++DA LVQDAI +K+G  I Y++ F+ GF VG
Sbjct  173  IKYLEAALSQDIQYFDTQVRSSDIVFAINTDAALVQDAISEKLGSFIHYLATFVTGFVVG  232

Query  657  FISVWKLTLVTLAVVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSF  836
            F +VW+L LVTLAVVPLIAV GG +T  ++ LS K + A ++AG + E+ I Q+R V++F
Sbjct  233  FTAVWQLALVTLAVVPLIAVIGGIHTTTLAKLSTKSQGAMSQAGNIVEQTIVQIRVVFAF  292

Query  837  VGEKKAVESYSKSLNNALVLG  899
            VGE +A++ YS +L  A  LG
Sbjct  293  VGESRALQGYSAALKIAQKLG  313


 Score = 97.8 bits (242),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 69/239 (29%), Positives = 123/239 (51%), Gaps = 3/239 (1%)
 Frame = +3

Query  177  KEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLSSDSHRLS  356
            KE  + F   +  +  ++ + + GS+G+ I G+ L  FF      + S+ + + D   + 
Sbjct  728  KEQANSFWRLAKMNAPEWPYALIGSVGSVICGS-LSAFFAYVLSAVLSV-YYNPDHAFMI  785

Query  357  SQVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKKIEFFDTD-T  533
             +++K    L+ L S   I   +   FW   GE  T R+R + + +V++ ++ +FD +  
Sbjct  786  REIAKYCYLLIGLSSAALIFNTLQHFFWDVVGENLTKRVREKMMAAVIKNEMAWFDQEEN  845

Query  534  RAKDIIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLAVVPLIA  713
             +  I   ++ DA  V+ AIGD+I   ++  +  LV    GF+  W+L LV +AV P++ 
Sbjct  846  ESARIATRLALDANNVRSAIGDRISVIMQNSALMLVACTAGFVLQWRLALVLIAVFPVVV  905

Query  714  VAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYSKSLNNAL  890
             A     + +   S   EAA+A+A ++A EA+S VRTV +F  E K V  ++ +L   L
Sbjct  906  AATVLQKMFLKGFSGDLEAAHAKATQLAGEAVSNVRTVAAFNSEVKIVGLFTSNLETPL  964



>ref|XP_007162774.1| hypothetical protein PHAVU_001G179300g [Phaseolus vulgaris]
 gb|ESW34768.1| hypothetical protein PHAVU_001G179300g [Phaseolus vulgaris]
Length=1338

 Score =   232 bits (592),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 110/270 (41%), Positives = 179/270 (66%), Gaps = 11/270 (4%)
 Frame = +3

Query  90   SVAITFSMGELEISSNLKMDQQPSNSTDRKEMVSFFGLFSAADTVDYFFMVFGSIGACIH  269
            + A+T + G +   S  K +  PS        V F  LF  AD +DY  M  G++GA +H
Sbjct  55   AAAVTMNGGSI---SGEKAESVPS--------VGFGELFRFADGLDYVLMGIGTVGAVVH  103

Query  270  GAALPVFFVLFGRMIDSLGHLSSDSHRLSSQVSKQALYLVYLGSIIFISAWIGVAFWTQT  449
            G +LP+F   F  +++S G  ++D  +++ +V K A Y + +G+ I+ S+W  ++ W  +
Sbjct  104  GCSLPLFLRFFADLVNSFGSNANDVDKMTQEVVKYAFYFLVVGAAIWASSWAEISCWMWS  163

Query  450  GERQTARLRLRYLQSVLRKKIEFFDTDTRAKDIIFHISSDAILVQDAIGDKIGHTIRYIS  629
            GERQ+ R+R++YL++ L + I+FFDTD R  D++F I++DA++VQDAI +K+G+ I Y++
Sbjct  164  GERQSTRMRIKYLEAALNQDIQFFDTDVRTSDVVFAINTDAVMVQDAISEKLGNFIHYMA  223

Query  630  QFLVGFAVGFISVWKLTLVTLAVVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAI  809
             F+ GF VGF +VW+L LVTLAVVP+IAV GG +T  ++ LS K + A ++AG + E+ +
Sbjct  224  TFVSGFVVGFTAVWQLALVTLAVVPMIAVIGGIHTTTLAKLSGKSQEALSQAGNIVEQTV  283

Query  810  SQVRTVYSFVGEKKAVESYSKSLNNALVLG  899
            +Q+R V +FVGE +A+++YS +L  +  LG
Sbjct  284  AQIRVVLAFVGESRALQAYSSALRVSQKLG  313


 Score =   105 bits (263),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 73/239 (31%), Positives = 124/239 (52%), Gaps = 3/239 (1%)
 Frame = +3

Query  177  KEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLSSDSHRLS  356
            KE  S F   +  ++ ++ + + GSIG+ I G+ L  FF      + S+ + + D   + 
Sbjct  728  KEQASSFWRLAKMNSPEWLYALIGSIGSVICGS-LSAFFAYVLSAVLSV-YYNPDHRYMI  785

Query  357  SQVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKKIEFFD-TDT  533
             ++ K    L+ L S   +   +   FW   GE  T R+R + L +VL+ ++ +FD  + 
Sbjct  786  REIEKYCYLLIGLSSTALLFNTLQHFFWDIVGENLTKRVREKMLTAVLKNEMAWFDQEEN  845

Query  534  RAKDIIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLAVVPLIA  713
             +  I   ++ DA  V+ AIGD+I   ++  +  LV    GF+  W+L LV +AV P++ 
Sbjct  846  ESARIAARLALDANNVRSAIGDRISVIVQNTALMLVACTAGFVLQWRLALVLVAVFPIVV  905

Query  714  VAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYSKSLNNAL  890
             A     + M+  S   EAA+A+A ++A EAI+ VRTV +F  E K V  ++ +L   L
Sbjct  906  AATVLQKMFMTGFSGDLEAAHAKATQLAGEAIANVRTVAAFNSETKIVGLFTSNLQAPL  964



>gb|EYU29874.1| hypothetical protein MIMGU_mgv1a000299mg [Erythranthe guttata]
Length=1279

 Score =   232 bits (592),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 103/233 (44%), Positives = 167/233 (72%), Gaps = 0/233 (0%)
 Frame = +3

Query  201  LFSAADTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLSSDSHRLSSQVSKQAL  380
            LF  AD +DYF M  G++GA +HG++LP+F   F  +++S G  + +  +++ +V K A 
Sbjct  30   LFRFADGLDYFLMTVGTVGAVVHGSSLPLFLRFFADLVNSFGSNADNLDKMTQEVLKYAF  89

Query  381  YLVYLGSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKKIEFFDTDTRAKDIIFHI  560
            Y + +G+ I+ S+W  ++ W  TGERQ+ ++R++YL++ L + I++FDTD R  D++F I
Sbjct  90   YFLVVGAAIWASSWAEISCWMWTGERQSTKMRIKYLEAALNQDIQYFDTDVRTSDVVFAI  149

Query  561  SSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLAVVPLIAVAGGTYTLI  740
            ++DA++VQDAI  K+G+ + Y++ F+ GF VGF +VW+L LVTLAVVPLIA+ GG +T  
Sbjct  150  NTDAVMVQDAISVKLGNFLHYMATFVSGFVVGFTAVWQLALVTLAVVPLIAIIGGIHTTT  209

Query  741  MSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYSKSLNNALVLG  899
            ++ LS K + A ++AG +AE+ I+Q+RTV ++VGE +A++SYS SL  A  +G
Sbjct  210  LAKLSGKSQDALSQAGNIAEQTIAQIRTVLAYVGESRALQSYSSSLRVAQKIG  262


 Score = 90.1 bits (222),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 71/239 (30%), Positives = 125/239 (52%), Gaps = 3/239 (1%)
 Frame = +3

Query  177  KEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLSSDSHRLS  356
            KE  S F   +  ++ ++   + GSIG+ I G+ L  FF      + S+ + + D   + 
Sbjct  677  KEQASSFLRLAKMNSPEWVHALIGSIGSVICGS-LSAFFAYVLSAVLSV-YYNPDHKFMI  734

Query  357  SQVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKKIEFFD-TDT  533
             +++K    L+ + S   I   +   FW   GE  T R+R + L++VL+ ++ +FD  + 
Sbjct  735  KEIAKYCYLLIGVSSAALIFNTLQHYFWDTVGENLTKRVREKMLEAVLKNEMAWFDQEEN  794

Query  534  RAKDIIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLAVVPLIA  713
             +  +   ++ DA  V+ AIGD+I   ++  +  LV    GF+  W+L LV +AV P++ 
Sbjct  795  ESSRVSARLALDANNVRSAIGDRISVIMQNSALMLVACTAGFVLQWRLALVLVAVFPVVV  854

Query  714  VAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYSKSLNNAL  890
             A     + M+  S   EAA+A+A ++A EA++ +RTV +F  E K V  ++ SL   L
Sbjct  855  AATVLQKMFMTGFSGDLEAAHAKATQLAGEAVANMRTVAAFNSEAKIVGLFTSSLQTPL  913



>ref|XP_006413247.1| hypothetical protein EUTSA_v10024237mg [Eutrema salsugineum]
 gb|ESQ54700.1| hypothetical protein EUTSA_v10024237mg [Eutrema salsugineum]
Length=1239

 Score =   232 bits (591),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 112/238 (47%), Positives = 161/238 (68%), Gaps = 0/238 (0%)
 Frame = +3

Query  186  VSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLSSDSHRLSSQV  365
            V    LFS AD  D   M  GSIGACIHGA++PVFF+ FG++I+ +G      H+ S +V
Sbjct  24   VPLLKLFSFADFYDCVLMALGSIGACIHGASVPVFFIFFGKLINIIGLAYLFPHQASHKV  83

Query  366  SKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKKIEFFDTDTRAKD  545
            +K +L  VYL   I  S+W+ VA W  TGERQ A++R  YL+S+L + I  FDT+    +
Sbjct  84   AKYSLDFVYLSVAILFSSWLEVACWMHTGERQAAKMRRAYLRSMLSQDISLFDTEASTGE  143

Query  546  IIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLAVVPLIAVAGG  725
            +I  I+SD ++VQDA+ +K+G+ + YIS+F+ GFA+GF SVW+++LVTL++VPLIA+AGG
Sbjct  144  VISAITSDILVVQDALSEKVGNFLHYISRFIAGFAIGFTSVWQISLVTLSIVPLIALAGG  203

Query  726  TYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYSKSLNNALVLG  899
             Y  +   L  +   +Y +AG++AEE I  VRTV +F GE++AV+ Y K+L N    G
Sbjct  204  IYAFVAIGLIARVRKSYIKAGEIAEEVIGNVRTVQAFTGEERAVKLYKKALENTYAYG  261


 Score = 86.7 bits (213),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 62/243 (26%), Positives = 113/243 (47%), Gaps = 3/243 (1%)
 Frame = +3

Query  153  QPSNSTDRKEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHL  332
            +P  +   K++    G   +    D+ + + G++ A I G+ +P+F    G     + + 
Sbjct  646  RPDETDPSKKVKVTMGRLYSMIRPDWMYGLCGTLCAFIAGSQMPLF--ALGVSHSLVSYY  703

Query  333  SSDSHRLSSQVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKKI  512
              D      +V K A+       I  +   I    +   GER T R+R +   ++L+ +I
Sbjct  704  EMDWGTTQKEVKKIAILFCCASFITLVVYTIEHVCFGTMGERLTLRVREKMFSAILKNEI  763

Query  513  EFFD-TDTRAKDIIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVT  689
             +FD  D  +  +   + SDA L++  + D+    ++ +   +  F + FI  W+LTLV 
Sbjct  764  GWFDEVDNTSSMLASRLESDATLLKTIVVDRSTILLQNLGLVVTSFVISFILNWRLTLVV  823

Query  690  LAVVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYS  869
            +A  PL+     +  L M         AY +A  +A E++S +RTV +F  E+K +E YS
Sbjct  824  IATYPLVISGHISEKLFMQGYGGNLSKAYLKANMLAGESVSNIRTVAAFCAEEKVLELYS  883

Query  870  KSL  878
            + L
Sbjct  884  REL  886



>ref|XP_006410867.1| hypothetical protein EUTSA_v10016150mg [Eutrema salsugineum]
 gb|ESQ52320.1| hypothetical protein EUTSA_v10016150mg [Eutrema salsugineum]
Length=1321

 Score =   232 bits (591),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 108/250 (43%), Positives = 171/250 (68%), Gaps = 2/250 (1%)
 Frame = +3

Query  150  QQPSNSTDRKEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGH  329
            ++P  +  R   V+F  LF  AD +DY  M  GS+GA +HG +LP+F   F  +++S G 
Sbjct  52   EEPKKAEIRG--VAFKELFRFADGLDYVLMGVGSVGAFVHGCSLPLFLRFFADLVNSFGS  109

Query  330  LSSDSHRLSSQVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKK  509
             +++  ++  +V K ALY + +G+ I+ S+W  ++ W  TGERQT ++R++YL++ L + 
Sbjct  110  NANNVDKMMQEVLKYALYFLVVGAAIWASSWAEISCWMWTGERQTTKMRIKYLEAALNQD  169

Query  510  IEFFDTDTRAKDIIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVT  689
            I+FFDT+ R  D++F I++DA++VQDAI +K+G+ I Y++ F+ GF VGF +VW+L LVT
Sbjct  170  IQFFDTEVRTSDVVFAINTDAVMVQDAISEKLGNFIHYMATFVSGFIVGFTAVWQLALVT  229

Query  690  LAVVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYS  869
            LAVVPLIAV GG +T  +S LS K + + ++AG + E+ + Q+R V +FVGE +A ++YS
Sbjct  230  LAVVPLIAVIGGIHTTTLSKLSNKSQESLSQAGNIVEQTVVQIRVVMAFVGESRASQAYS  289

Query  870  KSLNNALVLG  899
             +L  A  LG
Sbjct  290  SALKTAQKLG  299


 Score = 91.3 bits (225),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 70/239 (29%), Positives = 124/239 (52%), Gaps = 3/239 (1%)
 Frame = +3

Query  177  KEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLSSDSHRLS  356
            K+  + F   +  ++ ++ + + GS+G+ + G+ L  FF      + S+ + + +   + 
Sbjct  715  KDQANSFCRLAKMNSPEWKYALLGSVGSVVCGS-LSAFFAYVLSAVLSV-YYNPNHDYMI  772

Query  357  SQVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKKIEFFD-TDT  533
             Q+ K    L+ L S   I   +  +FW   GE  T R+R + L +VL+ ++ +FD  + 
Sbjct  773  KQIDKYCYLLIGLSSAALIFNTLQHSFWDIVGENLTKRVREKMLTAVLKNEMAWFDQEEN  832

Query  534  RAKDIIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLAVVPLIA  713
             +  I   ++ DA  V+ AIGD+I   ++  +  LV    GF+  W+L LV +AV P++ 
Sbjct  833  ESARISARLALDANNVRSAIGDRISVIVQNTALMLVACTAGFVLQWRLALVLVAVFPVVV  892

Query  714  VAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYSKSLNNAL  890
             A     + M+  S   EAA+A+  ++A EAI+ VRTV +F  E K V  Y+ +L   L
Sbjct  893  AATVLQKMFMTGFSGDLEAAHAKGTQLAGEAIANVRTVAAFNSEAKIVRLYTANLEPPL  951



>ref|XP_006417431.1| hypothetical protein EUTSA_v10009914mg [Eutrema salsugineum]
 gb|ESQ35784.1| hypothetical protein EUTSA_v10009914mg [Eutrema salsugineum]
Length=1226

 Score =   231 bits (590),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 114/251 (45%), Positives = 170/251 (68%), Gaps = 3/251 (1%)
 Frame = +3

Query  156  PSNSTDR---KEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLG  326
            P+ + ++   +  VS F LFS AD  D   MV GSIGACIHGA++PVFF+ FG++I+ +G
Sbjct  7    PATAAEKEKERPSVSVFKLFSFADFYDCVLMVLGSIGACIHGASVPVFFIFFGKLINIIG  66

Query  327  HLSSDSHRLSSQVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVLRK  506
                   + S +V+K +L  VYL  +I  S+W+ VA W  TGERQ A++R  YL+S+L +
Sbjct  67   LAYLFPQQASHKVAKYSLDFVYLSVVILFSSWLEVACWMHTGERQAAKMRKAYLRSMLSQ  126

Query  507  KIEFFDTDTRAKDIIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLV  686
             I  FDT++   ++I  I+SD ++VQDA+ +K+G+ +  +S+F+ GF +GF SVW+++LV
Sbjct  127  DISLFDTESSTGEVISAITSDILVVQDALSEKVGNFLHCMSRFIAGFVIGFTSVWQISLV  186

Query  687  TLAVVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESY  866
            TL++VPLIA+AGG Y  I + L  +   +Y +AG++AEE I  VRTV +F GE+KAV SY
Sbjct  187  TLSIVPLIALAGGIYAFIGTGLVVRVRKSYVKAGEIAEEVIGNVRTVQAFTGEEKAVGSY  246

Query  867  SKSLNNALVLG  899
             ++L N    G
Sbjct  247  REALKNTYSYG  257


 Score = 92.8 bits (229),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 78/271 (29%), Positives = 130/271 (48%), Gaps = 9/271 (3%)
 Frame = +3

Query  81   HT*SVAI-TFSMGELEISS-NLKMDQQPSNSTDRKEM--VSFFGLFSAADTVDYFFMVFG  248
            HT S+ I T S+ E +I   NL    Q +N  D  +   V+   L+S     D+ + +FG
Sbjct  604  HTPSLPISTESLPEQQIPKRNLCSFHQSANQLDTTQQGKVTLRRLYSMIRP-DWKYGIFG  662

Query  249  SIGACIHGAALPVFFVLFGRMIDSLGHLSSDSHRLSSQVSKQALYLVYLGSIIFISAWIG  428
            ++G+ I G+ +P+F +   + + S      D      +V + +++      I  I+  I 
Sbjct  663  TLGSLIAGSQMPLFALGISQALVSY---YMDWETTQHEVKRISIFFCCASVITVIAHAIE  719

Query  429  VAFWTQTGERQTARLRLRYLQSVLRKKIEFFD-TDTRAKDIIFHISSDAILVQDAIGDKI  605
               +   GER T R+R     ++LR +I +FD  D  +  +   + SDA L++  + D+ 
Sbjct  720  HTTFGIMGERLTLRVRQMMFSAILRNEIGWFDKVDNTSSMLASRLESDATLLRTIVVDRS  779

Query  606  GHTIRYISQFLVGFAVGFISVWKLTLVTLAVVPLIAVAGGTYTLIMSNLSQKGEAAYAEA  785
               +      +  F + FI  W+LTLV LA  PLI     +  L M         AY +A
Sbjct  780  TILLENFGLVVTSFIISFILNWRLTLVVLATYPLIISGHISEKLFMQGYGGNLSKAYMKA  839

Query  786  GKVAEEAISQVRTVYSFVGEKKAVESYSKSL  878
              +A E++S +RTV +F  E+K ++ YSK L
Sbjct  840  NMLAGESVSNIRTVAAFCAEEKVLDLYSKEL  870



>ref|XP_010267196.1| PREDICTED: LOW QUALITY PROTEIN: ABC transporter B family member 
1-like [Nelumbo nucifera]
Length=1349

 Score =   232 bits (591),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 110/262 (42%), Positives = 172/262 (66%), Gaps = 2/262 (1%)
 Frame = +3

Query  114  GELEISSNLKMDQQPSNSTDRKEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFF  293
            G++E S   K  ++ S  T     V F  L   AD +D   M  GS GA IHG +LP+F 
Sbjct  64   GKMEPSEGKKDTEEKSGRT--PPSVGFRELLRFADGLDCVLMAIGSTGAIIHGCSLPLFL  121

Query  294  VLFGRMIDSLGHLSSDSHRLSSQVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARL  473
              F  +++S G  ++D  ++  +V K A Y + +G+ I+ S+W  ++ W  TGERQ+ ++
Sbjct  122  RFFADLVNSFGSNANDQDKMVQEVVKYAFYFLVVGAAIWTSSWAEISCWMWTGERQSTKM  181

Query  474  RLRYLQSVLRKKIEFFDTDTRAKDIIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAV  653
            R++YL++ L + ++FFDT  R  D++F I++DA+LVQDAI +K+G+ + Y++ F+ GF V
Sbjct  182  RIKYLEAALNQDVQFFDTQVRTSDVVFAINTDAVLVQDAISEKLGNFLHYLATFVSGFVV  241

Query  654  GFISVWKLTLVTLAVVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYS  833
            GF +VW+L LVTLA+VP+IA+ G  +T  ++ LS K + A ++AG +AE+ I Q+RTV S
Sbjct  242  GFTAVWQLALVTLAIVPIIALIGAIHTTTLAKLSSKSQEALSQAGNIAEQTIVQIRTVLS  301

Query  834  FVGEKKAVESYSKSLNNALVLG  899
            FVGE +A+E+YS +L  A  LG
Sbjct  302  FVGESRALEAYSSALRVAQKLG  323


 Score =   107 bits (266),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 70/239 (29%), Positives = 127/239 (53%), Gaps = 3/239 (1%)
 Frame = +3

Query  177  KEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLSSDSHRLS  356
            KE  S F   +  ++ ++ + + GS+G+ + G+   +F  +   ++    + + D   +S
Sbjct  738  KEQASSFWRLAKMNSPEWAYALVGSVGSVVCGSISALFAYVLSAVLSV--YYNPDHAYMS  795

Query  357  SQVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKKIEFFD-TDT  533
             ++ K    L+ + S + +   +   FW   GE  T R+R + L++VL+ +I +FD  + 
Sbjct  796  REIGKYCYLLIGVSSAVLLFNTLQHFFWDVVGENLTKRVREKMLKAVLKNEIAWFDREEN  855

Query  534  RAKDIIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLAVVPLIA  713
             +  I   ++ DA  V+ AIGD+I   ++  +  LV    GFI  W+L+LV +AV P++ 
Sbjct  856  ESARIAARLALDANNVRSAIGDRISVIMQNSALMLVACTAGFILQWRLSLVLIAVFPVVV  915

Query  714  VAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYSKSLNNAL  890
             A     + M   S   EAA+A+A ++A EA++ VRTV +F  E   V  +S SL++ L
Sbjct  916  AATVLQKMFMKGFSGDLEAAHAKATQLAGEAVANVRTVAAFNSEANIVGLFSSSLDSPL  974



>ref|XP_004245909.2| PREDICTED: ABC transporter B family member 2-like [Solanum lycopersicum]
Length=1257

 Score =   231 bits (590),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 111/238 (47%), Positives = 162/238 (68%), Gaps = 0/238 (0%)
 Frame = +3

Query  186  VSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLSSDSHRLSSQV  365
            VS   LFS AD+ DY  M  GSIGAC+HGA++PVFF+ FG+MI+  G       + S ++
Sbjct  38   VSLLKLFSFADSYDYLLMFLGSIGACLHGASVPVFFIFFGKMINIAGLAYLFPAQTSHKI  97

Query  366  SKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKKIEFFDTDTRAKD  545
            +K +L  VYL  +I  ++WI VA W  +GERQ A++R+ YL+S+L + I  FDT+    +
Sbjct  98   AKYSLDFVYLSVVILFASWIEVACWMHSGERQAAKIRMAYLKSMLNQDISLFDTEASTGE  157

Query  546  IIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLAVVPLIAVAGG  725
            +I  I+SD I+VQDAI +K G+ + YIS+FL GF +GFI VW+++LVTL++VPLIA+AGG
Sbjct  158  VIAAITSDIIIVQDAISEKAGNFLHYISRFLAGFTIGFIRVWQISLVTLSIVPLIALAGG  217

Query  726  TYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYSKSLNNALVLG  899
             Y  +   L  +   +Y +AG++AEE ++ +RTV +F GE+ AV+SY  +L N    G
Sbjct  218  IYAYVTIGLIARVRKSYIKAGEIAEEVVANIRTVQAFTGEENAVKSYKGALLNTYKYG  275


 Score = 84.0 bits (206),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 62/220 (28%), Positives = 110/220 (50%), Gaps = 6/220 (3%)
 Frame = +3

Query  225  DYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLSSDSHRLSSQVSKQALYLVYLGSI  404
            ++ + V G+I A I GA +P+F +   + + S  ++  D+ R      K+  +L  +G++
Sbjct  690  EWHYGVIGTICAFIAGAQMPLFALGVSQALVSY-YMDWDTTR---HEVKKICFLFCVGAV  745

Query  405  IFISAW-IGVAFWTQTGERQTARLRLRYLQSVLRKKIEFFD-TDTRAKDIIFHISSDAIL  578
            + +    I    +   GER T R+R     ++LR +I +FD  +  +  +   + SDA L
Sbjct  746  LTVVVHAIAHTCFGIIGERLTLRVREMMFSAMLRNEIGWFDEVNNSSSTLASRLESDATL  805

Query  579  VQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLAVVPLIAVAGGTYTLIMSNLSQ  758
            ++  + D+    ++ +      F + FI  W+LTLV +A+ PLI     +  L MS    
Sbjct  806  LRTVVVDRSTILLQNVGLVATSFIIAFILNWRLTLVVMAMYPLIVSGHISEKLFMSGFGG  865

Query  759  KGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYSKSL  878
                AY  A   A EA+S +RTV +F  E+K  + Y++ L
Sbjct  866  DLSKAYLRANMFAGEAVSNIRTVAAFCAEEKVTDLYAREL  905



>ref|NP_181228.1| ABC transporter B family member 1 [Arabidopsis thaliana]
 sp|Q9ZR72.1|AB1B_ARATH RecName: Full=ABC transporter B family member 1; Short=ABC transporter 
ABCB.1; Short=AtABCB1; AltName: Full=Multidrug resistance 
protein 1; AltName: Full=P-glycoprotein 1; Short=AtPgp1 
[Arabidopsis thaliana]
 emb|CAA43646.1| P-glycoprotein [Arabidopsis thaliana]
 gb|AAD31576.1| putative ABC transporter [Arabidopsis thaliana]
 gb|AEC09320.1| ABC transporter B family member 1 [Arabidopsis thaliana]
Length=1286

 Score =   231 bits (590),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 108/250 (43%), Positives = 171/250 (68%), Gaps = 2/250 (1%)
 Frame = +3

Query  150  QQPSNSTDRKEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGH  329
            ++P  +  R   V+F  LF  AD +DY  M  GS+GA +HG +LP+F   F  +++S G 
Sbjct  17   EEPKKAEIRG--VAFKELFRFADGLDYVLMGIGSVGAFVHGCSLPLFLRFFADLVNSFGS  74

Query  330  LSSDSHRLSSQVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKK  509
             S++  ++  +V K ALY + +G+ I+ S+W  ++ W  +GERQT ++R++YL++ L + 
Sbjct  75   NSNNVEKMMEEVLKYALYFLVVGAAIWASSWAEISCWMWSGERQTTKMRIKYLEAALNQD  134

Query  510  IEFFDTDTRAKDIIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVT  689
            I+FFDT+ R  D++F I++DA++VQDAI +K+G+ I Y++ F+ GF VGF +VW+L LVT
Sbjct  135  IQFFDTEVRTSDVVFAINTDAVMVQDAISEKLGNFIHYMATFVSGFIVGFTAVWQLALVT  194

Query  690  LAVVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYS  869
            LAVVPLIAV GG +T  +S LS K + + ++AG + E+ + Q+R V +FVGE +A ++YS
Sbjct  195  LAVVPLIAVIGGIHTTTLSKLSNKSQESLSQAGNIVEQTVVQIRVVMAFVGESRASQAYS  254

Query  870  KSLNNALVLG  899
             +L  A  LG
Sbjct  255  SALKIAQKLG  264


 Score = 94.0 bits (232),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 71/239 (30%), Positives = 124/239 (52%), Gaps = 3/239 (1%)
 Frame = +3

Query  177  KEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLSSDSHRLS  356
            K+  + F   +  ++ ++ + + GS+G+ I G+ L  FF      + S+ + + D   + 
Sbjct  680  KDQANSFWRLAKMNSPEWKYALLGSVGSVICGS-LSAFFAYVLSAVLSV-YYNPDHEYMI  737

Query  357  SQVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKKIEFFD-TDT  533
             Q+ K    L+ L S   +   +  +FW   GE  T R+R + L +VL+ ++ +FD  + 
Sbjct  738  KQIDKYCYLLIGLSSAALVFNTLQHSFWDIVGENLTKRVREKMLSAVLKNEMAWFDQEEN  797

Query  534  RAKDIIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLAVVPLIA  713
             +  I   ++ DA  V+ AIGD+I   ++  +  LV    GF+  W+L LV +AV P++ 
Sbjct  798  ESARIAARLALDANNVRSAIGDRISVIVQNTALMLVACTAGFVLQWRLALVLVAVFPVVV  857

Query  714  VAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYSKSLNNAL  890
             A     + M+  S   EAA+A+  ++A EAI+ VRTV +F  E K V  Y+ +L   L
Sbjct  858  AATVLQKMFMTGFSGDLEAAHAKGTQLAGEAIANVRTVAAFNSEAKIVRLYTANLEPPL  916



>ref|XP_010240898.1| PREDICTED: ABC transporter B family member 2-like [Nelumbo nucifera]
Length=1246

 Score =   231 bits (589),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 112/233 (48%), Positives = 160/233 (69%), Gaps = 0/233 (0%)
 Frame = +3

Query  180  EMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLSSDSHRLSS  359
            + V F  LFS AD  DY  M  GS+GAC+HGA++PVFF+ FG++I+ +G        +S 
Sbjct  25   QKVPFSKLFSFADFWDYVLMFLGSVGACVHGASVPVFFIFFGKLINIIGIGYLFPELVSH  84

Query  360  QVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKKIEFFDTDTRA  539
            +V K +L  VYL  ++  S+WI V  W  TGERQ A++RL YL+++L + I  FDT+   
Sbjct  85   KVGKYSLDFVYLSIVMLFSSWIEVGCWMHTGERQAAKMRLAYLRAMLNQDISLFDTEAST  144

Query  540  KDIIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLAVVPLIAVA  719
             ++I  I+SD I+VQDAI +K+G+ I YIS+F+ GFA+GF  VW+++LVTL++VPLIA+A
Sbjct  145  AEVIAAITSDVIVVQDAISEKVGNFIHYISRFIAGFAIGFARVWQISLVTLSIVPLIAIA  204

Query  720  GGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYSKSL  878
            GG Y  I   L  +   +Y +AG++AEE I  VRTV +FVGE+KAV+ Y  +L
Sbjct  205  GGLYAYIAIGLMARVRKSYVKAGEIAEEVIGNVRTVQAFVGEEKAVKMYKDAL  257


 Score = 89.4 bits (220),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 68/248 (27%), Positives = 117/248 (47%), Gaps = 9/248 (4%)
 Frame = +3

Query  147  DQQPSNSTDRKEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLG  326
            D +P    ++K+ VS   +FS     D+ ++++G  GA + GA +P+F +    + ++L 
Sbjct  657  DGEP----EKKKPVSMRRMFSMV-LPDWIYIIYGVTGAIMSGAQMPLFAL---GVTEALV  708

Query  327  HLSSDSHRLSSQVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVLRK  506
                D +    Q+ K A       +   I   I    +   GER T R+R +   ++LR 
Sbjct  709  AYYMDWNTTRHQIKKIAFLFCGGAAATIIFHSIEHLSFGIIGERLTLRVREKMFAAILRN  768

Query  507  KIEFFDTDTRAKDIIF-HISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTL  683
            +I +FD  +    ++   + SDA L++  + D+    I  IS     F + F   W++TL
Sbjct  769  EIGWFDDTSNTSSMLSSRLESDATLLRTIVVDRSTILIMNISMIFTSFIIAFNLNWRVTL  828

Query  684  VTLAVVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVES  863
            V LA  PLI     +  L M         AY +A  +A EA+  +RTV +F  E K ++ 
Sbjct  829  VVLATFPLIVSGHISEKLFMKGYGGDLNKAYLKANMLAGEAVGNIRTVAAFCSEDKVIDL  888

Query  864  YSKSLNNA  887
            Y++ L+  
Sbjct  889  YARELDEP  896



>ref|XP_004494063.1| PREDICTED: ABC transporter B family member 1-like, partial [Cicer 
arietinum]
Length=1283

 Score =   231 bits (589),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 104/244 (43%), Positives = 167/244 (68%), Gaps = 0/244 (0%)
 Frame = +3

Query  168  TDRKEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLSSDSH  347
            T+    V F  LF  AD +DY  M  G++GA +HG +LP+F   F  +++S G  +++  
Sbjct  88   TESVPSVGFGELFRFADGLDYILMTIGTVGAIVHGCSLPIFLRFFADLVNSFGSNANNLD  147

Query  348  RLSSQVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKKIEFFDT  527
            +++ +V K A Y + +G+ I+ S+W  ++ W  TGERQ+ ++R++YL++ L++ IEFFDT
Sbjct  148  KMTHEVVKYAFYFLVVGAAIWASSWAEISCWMWTGERQSTKMRIKYLEAALKQDIEFFDT  207

Query  528  DTRAKDIIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLAVVPL  707
            + R  D++F I++DA++VQDAI +K+G+ I Y++ F+ GF VGF +VW+L LVTLAVVP+
Sbjct  208  EVRTSDVVFAINTDAVMVQDAISEKLGNFIHYMATFVSGFVVGFTAVWQLALVTLAVVPM  267

Query  708  IAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYSKSLNNA  887
            IAV G  +T  ++ LS K + A ++AG + E+ + Q+R V SFVGE +A++ YS +L  A
Sbjct  268  IAVIGAIHTTTLAKLSSKSQEALSQAGNIVEQTVLQIRVVLSFVGESRALQGYSSALKVA  327

Query  888  LVLG  899
              LG
Sbjct  328  QKLG  331


 Score =   107 bits (267),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 73/239 (31%), Positives = 124/239 (52%), Gaps = 3/239 (1%)
 Frame = +3

Query  177  KEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLSSDSHRLS  356
            K+  S F      ++ ++ + + GSIG+ + G+ L  FF      + S+ + + D   + 
Sbjct  746  KDQASSFWRLVKMNSPEWLYALIGSIGSVVCGS-LSAFFAYVLSAVLSV-YYNPDHKHMI  803

Query  357  SQVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKKIEFFD-TDT  533
             ++ K    L+ L S  FI   +   FW   GE  T R+R + L +VL+ ++ +FD  + 
Sbjct  804  REIDKYCYLLIGLSSTAFIFNTLQHFFWDIVGENLTKRVREKMLTAVLKNEMAWFDQEEN  863

Query  534  RAKDIIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLAVVPLIA  713
             +  I   ++ DA  V+ AIGD+I   ++  +  LV    GF+  W+L LV +AV P++ 
Sbjct  864  ESARISARLALDANNVRSAIGDRISVIVQNTALMLVACTAGFVLQWRLALVLIAVFPVVV  923

Query  714  VAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYSKSLNNAL  890
             A     + M+  S   EAA+A+A ++A EAI+ VRTV +F  E K V  ++ +L   L
Sbjct  924  AATVLQKMFMTGFSGDLEAAHAKATQLAGEAIANVRTVAAFNSESKIVRLFAYNLETPL  982



>gb|AAM98246.1| putative ABC transporter [Arabidopsis thaliana]
Length=1286

 Score =   231 bits (589),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 108/250 (43%), Positives = 171/250 (68%), Gaps = 2/250 (1%)
 Frame = +3

Query  150  QQPSNSTDRKEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGH  329
            ++P  +  R   V+F  LF  AD +DY  M  GS+GA +HG +LP+F   F  +++S G 
Sbjct  17   EEPKKAEIRG--VAFKELFRFADGLDYVLMGIGSVGAFVHGCSLPLFLRFFADLVNSFGS  74

Query  330  LSSDSHRLSSQVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKK  509
             S++  ++  +V K ALY + +G+ I+ S+W  ++ W  +GERQT ++R++YL++ L + 
Sbjct  75   NSNNVEKMMEEVLKYALYFLVVGAAIWASSWAEISCWMWSGERQTTKMRIKYLEAALNQD  134

Query  510  IEFFDTDTRAKDIIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVT  689
            I+FFDT+ R  D++F I++DA++VQDAI +K+G+ I Y++ F+ GF VGF +VW+L LVT
Sbjct  135  IQFFDTEVRTSDVVFAINTDAVMVQDAISEKLGNFIHYMATFVSGFIVGFTAVWQLALVT  194

Query  690  LAVVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYS  869
            LAVVPLIAV GG +T  +S LS K + + ++AG + E+ + Q+R V +FVGE +A ++YS
Sbjct  195  LAVVPLIAVIGGIHTTTLSKLSNKSQESLSQAGNIVEQTVVQIRVVMAFVGESRASQAYS  254

Query  870  KSLNNALVLG  899
             +L  A  LG
Sbjct  255  SALKIAQKLG  264


 Score = 94.0 bits (232),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 71/239 (30%), Positives = 124/239 (52%), Gaps = 3/239 (1%)
 Frame = +3

Query  177  KEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLSSDSHRLS  356
            K+  + F   +  ++ ++ + + GS+G+ I G+ L  FF      + S+ + + D   + 
Sbjct  680  KDQANSFWRLAKMNSPEWKYALLGSVGSVICGS-LSAFFAYVLSAVLSV-YYNPDHEYMI  737

Query  357  SQVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKKIEFFD-TDT  533
             Q+ K    L+ L S   +   +  +FW   GE  T R+R + L +VL+ ++ +FD  + 
Sbjct  738  KQIDKYCYLLIGLSSAALVFNTLQHSFWDIVGENLTKRVREKMLSAVLKNEMAWFDQEEN  797

Query  534  RAKDIIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLAVVPLIA  713
             +  I   ++ DA  V+ AIGD+I   ++  +  LV    GF+  W+L LV +AV P++ 
Sbjct  798  ESARIAARLALDANNVRSAIGDRISVIVQNTALMLVACTAGFVLQWRLALVLVAVFPVVV  857

Query  714  VAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYSKSLNNAL  890
             A     + M+  S   EAA+A+  ++A EAI+ VRTV +F  E K V  Y+ +L   L
Sbjct  858  AATVLQKMFMTGFSGDLEAAHAKGTQLAGEAIANVRTVAAFNSEAKIVRLYTANLEPPL  916



>ref|XP_002452712.1| hypothetical protein SORBIDRAFT_04g031170 [Sorghum bicolor]
 gb|EES05688.1| hypothetical protein SORBIDRAFT_04g031170 [Sorghum bicolor]
Length=1260

 Score =   231 bits (589),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 113/231 (49%), Positives = 160/231 (69%), Gaps = 0/231 (0%)
 Frame = +3

Query  186  VSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLSSDSHRLSSQV  365
            V F  LFS AD  D   M  GS+GAC HGA++PVFF+ FG++I+ +G        +S +V
Sbjct  32   VPFLKLFSFADRWDCVLMAVGSLGACAHGASVPVFFIFFGKLINIIGLAYLFPTTVSGRV  91

Query  366  SKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKKIEFFDTDTRAKD  545
            +K +L  VYLG +I  S+W  VA W  TGERQ A++R  YL+++L + I  FDT+    +
Sbjct  92   AKYSLDFVYLGVVILFSSWTEVACWMHTGERQAAKMRQAYLRAMLDQDIAVFDTEASTGE  151

Query  546  IIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLAVVPLIAVAGG  725
            +I  I+SD ++VQDAI +K+G+ + YIS+FL GFA+GF  VW+++LVTLA+VPLIA+AGG
Sbjct  152  VINAITSDILVVQDAISEKVGNFMHYISRFLAGFAIGFSQVWQISLVTLAIVPLIAIAGG  211

Query  726  TYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYSKSL  878
            TY  +   L  +   +Y +AG++AEE I  VRTV +FVGE+KAV SY ++L
Sbjct  212  TYAYVTIGLMARVRKSYVKAGEIAEEVIGNVRTVQAFVGEEKAVRSYREAL  262


 Score = 80.5 bits (197),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 58/221 (26%), Positives = 110/221 (50%), Gaps = 4/221 (2%)
 Frame = +3

Query  225  DYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLSSDSHRLSSQVSKQALYLVYLGSI  404
            D+FF V G+I A + G+ +P+F +   + + S  ++  ++ +L  +V K A+       +
Sbjct  687  DWFFGVSGTISAFVAGSQMPLFALGVTQALVSY-YMGWETTKL--EVRKIAVLFCCGAVL  743

Query  405  IFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKKIEFFDTDTRAKDIIF-HISSDAILV  581
              +   I    +   GER T R+R +   ++LR +I +FD  +    ++   + +DA LV
Sbjct  744  TVVFHVIEHLSFGIMGERLTLRVREKMFSAILRNEIGWFDDTSNTSAMLSSRLEADATLV  803

Query  582  QDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLAVVPLIAVAGGTYTLIMSNLSQK  761
            +  + D+    ++ I   +    + FI  W++TLV LA  PL+     +  + M      
Sbjct  804  RTIVVDRSTILLQNIGMIVTSLIIAFILNWRITLVVLATYPLMVSGHISEKMFMKGYGGN  863

Query  762  GEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYSKSLNN  884
               +Y +A  +A EA+S +RTV +F  E+K ++ Y+  L  
Sbjct  864  LSKSYLKANMLAAEAVSNIRTVAAFCSEEKVIKLYADELKE  904



>ref|XP_010509416.1| PREDICTED: ABC transporter B family member 1-like [Camelina sativa]
Length=1345

 Score =   231 bits (590),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 106/238 (45%), Positives = 166/238 (70%), Gaps = 0/238 (0%)
 Frame = +3

Query  186  VSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLSSDSHRLSSQV  365
            V+F  LF  AD +DY  M  GS+GA +HG +LP+F   F  +++S G  ++D  ++  +V
Sbjct  86   VAFKELFRFADGLDYILMGIGSVGAFVHGCSLPLFLRFFADLVNSFGSNANDVDKMMQEV  145

Query  366  SKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKKIEFFDTDTRAKD  545
             K ALY + +G+ I+ S+W  ++ W  +GERQT ++R++YL++ L + I+FFDT+ R  D
Sbjct  146  LKYALYFLVVGAAIWASSWAEISCWMWSGERQTTKMRIKYLEAALNQDIQFFDTEVRTSD  205

Query  546  IIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLAVVPLIAVAGG  725
            ++F I++DA++VQDAI +K+G+ I Y++ F+ GF VGF +VW+L LVTLAVVPLIAV GG
Sbjct  206  VVFAINTDAVMVQDAISEKLGNFIHYMATFVSGFIVGFTAVWQLALVTLAVVPLIAVIGG  265

Query  726  TYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYSKSLNNALVLG  899
             +T  +S LS K + + ++AG + E+ + Q+R V +FVGE +A ++YS +L  A  LG
Sbjct  266  IHTTTLSKLSNKSQESLSQAGNIVEQTVVQIRVVMAFVGETRASQAYSSALKIAQKLG  323


 Score = 94.0 bits (232),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 71/239 (30%), Positives = 124/239 (52%), Gaps = 3/239 (1%)
 Frame = +3

Query  177  KEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLSSDSHRLS  356
            K+  + F   +  ++ ++ + + GS+G+ + G+ L  FF      + S+ + + D   + 
Sbjct  739  KDQANSFWRLAKMNSPEWKYALLGSVGSVVCGS-LSAFFAYVLSAVLSI-YYNPDHEYMI  796

Query  357  SQVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKKIEFFD-TDT  533
             Q+ K    L+ L S   I   +  +FW   GE  T R+R + L +VL+ ++ +FD  + 
Sbjct  797  KQIDKYCYLLIGLSSAALIFNTLQHSFWDIVGENLTKRVREKMLTAVLKNEMAWFDQEEN  856

Query  534  RAKDIIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLAVVPLIA  713
             +  I   ++ DA  V+ AIGD+I   ++  +  LV    GF+  W+L LV +AV P++ 
Sbjct  857  ESARIAARLALDANNVRSAIGDRISVIVQNTALMLVACTAGFVLQWRLALVLVAVFPVVV  916

Query  714  VAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYSKSLNNAL  890
             A     + M+  S   EAA+A+  ++A EAI+ VRTV +F  E K V  Y+ +L   L
Sbjct  917  AATVLQKMFMTGFSGDLEAAHAKGTQLAGEAIANVRTVAAFNSEAKIVRLYTANLEPPL  975



>ref|XP_003533440.1| PREDICTED: ABC transporter B family member 2-like [Glycine max]
Length=1245

 Score =   231 bits (589),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 117/258 (45%), Positives = 166/258 (64%), Gaps = 2/258 (1%)
 Frame = +3

Query  126  ISSNLKMDQQPSNSTDRKEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFVLFG  305
            +S +  MD   SN  + K  VS   LFS AD  DY  M  GS+GA +HGA++PVFF+ FG
Sbjct  7    LSGDSAMDDAKSNKKEHK--VSLLKLFSFADFYDYVLMGVGSVGAIVHGASVPVFFIFFG  64

Query  306  RMIDSLGHLSSDSHRLSSQVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARLRLRY  485
            ++I+ +G         S +V+K +L  VYL   I  S+W  VA W  TGERQ A++R+ Y
Sbjct  65   KLINVIGLAYLFPKEASHKVAKYSLDFVYLSIAILFSSWTEVACWMHTGERQAAKMRMAY  124

Query  486  LQSVLRKKIEFFDTDTRAKDIIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFIS  665
            L+S+L + I  FDT+    ++I  I+SD I+VQDA+ +K+G+ + YIS+F+ GF +GF+ 
Sbjct  125  LKSMLNQDISLFDTEASTGEVISAITSDIIIVQDALSEKVGNFMHYISRFVAGFVIGFVR  184

Query  666  VWKLTLVTLAVVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGE  845
            VW+++LVTL++VPLIA+AGG Y  +   L  K   AY  AG++AEE I  VRTV +F GE
Sbjct  185  VWQISLVTLSIVPLIALAGGLYAYVTIGLIAKVRKAYVRAGEIAEEVIGNVRTVQAFAGE  244

Query  846  KKAVESYSKSLNNALVLG  899
            ++AV SY  +L    V G
Sbjct  245  ERAVRSYKAALMKTYVNG  262


 Score = 80.5 bits (197),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 65/243 (27%), Positives = 113/243 (47%), Gaps = 5/243 (2%)
 Frame = +3

Query  153  QPSNSTDRKEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHL  332
            + + +  +K  VS   L+S     D+F+ V G++ A I GA +P+F +     + S    
Sbjct  655  EETENAGKKRHVSAARLYSMVGP-DWFYGVAGTLCAFIAGAQMPLFALGISHALVSY---  710

Query  333  SSDSHRLSSQVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKKI  512
              D      +V K A        I      I    +   GER T R+R     ++L+ +I
Sbjct  711  YMDWETTCHEVKKIAFLFCGAAVITVTVHAIEHLSFGIMGERLTLRVREMMFSAILKNEI  770

Query  513  EFFD-TDTRAKDIIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVT  689
             +FD T+  +  +   + +DA L++  + D+    ++ I   +  F + FI  W++TLV 
Sbjct  771  GWFDDTNNTSSMLSSQLETDATLLRTIVVDRSTILLQNIGLVIASFIIAFILNWRITLVV  830

Query  690  LAVVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYS  869
            +A  PL+     +  L M         AY +A  +A EA+S +RTV +F  E+K ++ Y+
Sbjct  831  IATYPLVISGHISEKLFMKGYGGNLSKAYLKANMLAGEAVSNIRTVAAFCSEEKVLDLYA  890

Query  870  KSL  878
              L
Sbjct  891  NEL  893



>ref|XP_010101619.1| ABC transporter B family member 1 [Morus notabilis]
 gb|EXB89000.1| ABC transporter B family member 1 [Morus notabilis]
Length=1377

 Score =   231 bits (590),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 106/238 (45%), Positives = 166/238 (70%), Gaps = 0/238 (0%)
 Frame = +3

Query  186  VSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLSSDSHRLSSQV  365
            V F  LF  AD +DY  M  GS+GA +HG +LP+F   F  +++S G  +++  ++  +V
Sbjct  97   VGFGELFRFADGLDYVLMTIGSVGAIVHGCSLPLFLRFFADLVNSFGSNANNVDKMMQEV  156

Query  366  SKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKKIEFFDTDTRAKD  545
             K ALY + +G+ I+ S+W  ++ W  TGERQ+ R+R++YL++ L + I++FDT+ R  D
Sbjct  157  LKYALYFLVVGAAIWASSWAEISCWMWTGERQSTRMRIKYLEAALNQDIQYFDTEVRTSD  216

Query  546  IIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLAVVPLIAVAGG  725
            ++F I++DA+LVQDAI +K+G+ + Y++ F+ GF VGF +VW+L LVTLAVVPLIAV GG
Sbjct  217  VVFAINTDAVLVQDAISEKLGNFVHYMATFVSGFVVGFTAVWQLALVTLAVVPLIAVIGG  276

Query  726  TYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYSKSLNNALVLG  899
             +T  ++ LS K + A ++AG V E+ + Q+R V +FVGE +A+++YS +L  A  LG
Sbjct  277  IHTTTLAKLSGKSQDALSQAGNVVEQTVVQIRVVMAFVGESRALQAYSSALRIAQRLG  334


 Score = 90.9 bits (224),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 71/239 (30%), Positives = 124/239 (52%), Gaps = 3/239 (1%)
 Frame = +3

Query  177   KEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLSSDSHRLS  356
             KE  S F   +  ++ ++ + + GSIG+ + G+ L  FF      + S+ + + D   + 
Sbjct  765   KEQASSFWRLAKMNSPEWVYALVGSIGSIVCGS-LSAFFAYVLSAVLSV-YYNPDHAYMI  822

Query  357   SQVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKKIEFFD-TDT  533
              Q+ K    L+ L S   +   +   FW   GE  T R+R + L +VL+ ++ +FD  + 
Sbjct  823   KQIGKYCYLLIGLSSAALLFNTLQHFFWDIVGENLTKRVREKMLAAVLKNEMAWFDQEEN  882

Query  534   RAKDIIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLAVVPLIA  713
              +  +   ++ DA  V+ AIGD+I   ++  +  LV    GF+  W+L LV +AV P++ 
Sbjct  883   ESARVAARLALDANNVRSAIGDRISVIVQNTALMLVACTAGFVLQWRLALVLVAVFPVVV  942

Query  714   VAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYSKSLNNAL  890
              A     + M+  S   EAA+A+  ++A EAI+ VRTV +F  E+K V  ++ +L   L
Sbjct  943   AATVLQKMFMTGFSGDLEAAHAKGTQLAGEAIANVRTVAAFNSEEKIVGLFTTNLETPL  1001



>ref|XP_010530473.1| PREDICTED: ABC transporter B family member 1 [Tarenaya hassleriana]
Length=1339

 Score =   231 bits (589),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 106/238 (45%), Positives = 168/238 (71%), Gaps = 3/238 (1%)
 Frame = +3

Query  174  RKEM---VSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLSSDS  344
            RKE    V+F  LF  AD++DY  M  GS+GA +HG +LP+F   F  +++S G  +++ 
Sbjct  69   RKEEIPGVAFKELFRFADSLDYVLMGIGSVGAFVHGCSLPLFLRFFADLVNSFGSNANNV  128

Query  345  HRLSSQVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKKIEFFD  524
             ++  +V K ALY + +G+ I+ S+W  ++ W  TGERQT ++R++YL++ L + I+FFD
Sbjct  129  DKMMQEVLKYALYFLVVGAAIWASSWAEISCWMWTGERQTTKMRIKYLEAALNQDIQFFD  188

Query  525  TDTRAKDIIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLAVVP  704
            T+ R  D++F I++DA++VQDAI +K+G+ I Y++ F+ GF VGF +VW+L LVTLAVVP
Sbjct  189  TEVRTSDVVFAINTDAVMVQDAISEKLGNFIHYMATFVSGFVVGFTAVWQLALVTLAVVP  248

Query  705  LIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYSKSL  878
            LIAV GG +T  ++ LS K + A ++AG + E+ + Q+R V +FVGE +A+++YS +L
Sbjct  249  LIAVIGGIHTATLAKLSNKSQDALSQAGNIVEQTVVQIRVVLAFVGESRALQAYSSAL  306


 Score =   102 bits (253),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 69/239 (29%), Positives = 124/239 (52%), Gaps = 3/239 (1%)
 Frame = +3

Query  177  KEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLSSDSHRLS  356
            K+  S F   +  ++ ++ + + GS+G+ I G+ L  FF      + S+ + + +   + 
Sbjct  729  KDQASSFWRLAKMNSPEWKYALVGSVGSVICGS-LSAFFAYVLSAVLSI-YYNPNHEYMI  786

Query  357  SQVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKKIEFFD-TDT  533
             ++ K    L+ L S   +   +  +FW   GE  T R+R + L +VL+ ++ +FD  + 
Sbjct  787  REIDKYCYLLIGLSSSALLFNTLQHSFWDIVGENLTKRVREKMLAAVLKNEMAWFDQEEN  846

Query  534  RAKDIIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLAVVPLIA  713
             +  I   ++ DA  V+ AIGD+I   ++  +  LV    GF+  W+L LV +AV P++ 
Sbjct  847  ESARIAARLALDANNVRSAIGDRISVIVQNTALMLVACTAGFVLQWRLALVLIAVFPVVV  906

Query  714  VAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYSKSLNNAL  890
             A     + M   S   EAA+A+  ++A EAI+ VRTV +F  E K V  ++++L   L
Sbjct  907  AATVLQKMFMKGFSGDLEAAHAKGTQLAGEAIANVRTVAAFNSESKIVRLFTENLEPPL  965



>ref|XP_010505240.1| PREDICTED: ABC transporter B family member 1 [Camelina sativa]
 ref|XP_010505241.1| PREDICTED: ABC transporter B family member 1 [Camelina sativa]
Length=1343

 Score =   231 bits (589),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 106/238 (45%), Positives = 166/238 (70%), Gaps = 0/238 (0%)
 Frame = +3

Query  186  VSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLSSDSHRLSSQV  365
            V+F  LF  AD +DY  M  GS+GA +HG +LP+F   F  +++S G  ++D  ++  +V
Sbjct  84   VAFRELFRFADGLDYVLMGIGSVGAFVHGCSLPLFLRFFADLVNSFGSNANDVDKMMQEV  143

Query  366  SKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKKIEFFDTDTRAKD  545
             K ALY + +G+ I+ S+W  ++ W  +GERQT ++R++YL++ L + I+FFDT+ R  D
Sbjct  144  LKYALYFLVVGAAIWASSWAEISCWMWSGERQTTKMRIKYLEAALNQDIQFFDTEVRTSD  203

Query  546  IIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLAVVPLIAVAGG  725
            ++F I++DA++VQDAI +K+G+ I Y++ F+ GF VGF +VW+L LVTLAVVPLIAV GG
Sbjct  204  VVFAINTDAVMVQDAISEKLGNFIHYMATFVSGFIVGFTAVWQLALVTLAVVPLIAVIGG  263

Query  726  TYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYSKSLNNALVLG  899
             +T  +S LS K + + ++AG + E+ + Q+R V +FVGE +A ++YS +L  A  LG
Sbjct  264  IHTTTLSKLSNKSQESLSQAGNIVEQTVVQIRVVMAFVGETRASQAYSSALKIAQKLG  321


 Score = 94.0 bits (232),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 71/239 (30%), Positives = 124/239 (52%), Gaps = 3/239 (1%)
 Frame = +3

Query  177  KEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLSSDSHRLS  356
            K+  + F   +  ++ ++ + + GS+G+ + G+ L  FF      + S+ + + D   + 
Sbjct  737  KDQANSFWRLAKMNSPEWKYALLGSVGSVVCGS-LSAFFAYVLSAVLSI-YYNPDHEYMI  794

Query  357  SQVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKKIEFFD-TDT  533
             Q+ K    L+ L S   I   +  +FW   GE  T R+R + L +VL+ ++ +FD  + 
Sbjct  795  KQIDKYCYLLIGLSSAALIFNTLQHSFWDIVGENLTKRVREKMLTAVLKNEMAWFDQEEN  854

Query  534  RAKDIIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLAVVPLIA  713
             +  I   ++ DA  V+ AIGD+I   ++  +  LV    GF+  W+L LV +AV P++ 
Sbjct  855  ESARIAARLALDANNVRSAIGDRISVIVQNTALMLVACTAGFVLQWRLALVLVAVFPVVV  914

Query  714  VAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYSKSLNNAL  890
             A     + M+  S   EAA+A+  ++A EAI+ VRTV +F  E K V  Y+ +L   L
Sbjct  915  AATVLQKMFMTGFSGDLEAAHAKGTQLAGEAIANVRTVAAFNSEAKIVRLYTANLEPPL  973



>ref|XP_010241797.1| PREDICTED: ABC transporter B family member 1 [Nelumbo nucifera]
Length=1356

 Score =   231 bits (589),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 112/263 (43%), Positives = 174/263 (66%), Gaps = 4/263 (2%)
 Frame = +3

Query  114  GELEISS-NLKMDQQPSNSTDRKEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVF  290
            G++E S  N    ++P +S      V F  LF  AD +D   M  GS GA +HG +LP+F
Sbjct  64   GKMEASEGNKDTGEKPGSSPPS---VGFGELFRFADGLDCVLMAIGSAGAIVHGCSLPLF  120

Query  291  FVLFGRMIDSLGHLSSDSHRLSSQVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTAR  470
               F  +++S G  +++  ++  +V K A Y + +G+ I+ S+W  ++ W  TGERQ+ +
Sbjct  121  LRFFADLVNSFGSNANNQDKMVQEVVKYAFYFLVVGAAIWASSWAEISCWMWTGERQSTK  180

Query  471  LRLRYLQSVLRKKIEFFDTDTRAKDIIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFA  650
            LR++YL++ L + ++FFDT+ R  DIIF I++DA+LVQDAI +K+G+ + Y++ F+ GF 
Sbjct  181  LRIKYLEATLNQDVQFFDTEVRTSDIIFAINTDAVLVQDAISEKLGNFLHYLATFVSGFV  240

Query  651  VGFISVWKLTLVTLAVVPLIAVAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVY  830
            VGF +VW+L LVTLAVVPLIA+ G  +T  ++ LS K + A ++ G +AE+ I Q+RTV 
Sbjct  241  VGFTAVWQLALVTLAVVPLIALIGAIHTTTLAKLSSKSQEALSQGGNIAEQTIVQIRTVM  300

Query  831  SFVGEKKAVESYSKSLNNALVLG  899
            S+VGE +A+E+YS +L  A  LG
Sbjct  301  SYVGESRALEAYSSALRVAQKLG  323


 Score =   111 bits (278),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 74/239 (31%), Positives = 129/239 (54%), Gaps = 3/239 (1%)
 Frame = +3

Query  177  KEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLSSDSHRLS  356
            KE  + F   +  ++ ++ + +FGS+G+ + G+ L  FF      + S+ + + D   +S
Sbjct  738  KEQANSFLRLAKMNSPEWTYALFGSVGSVVCGS-LSAFFAYVLSAVLSI-YYNPDHAYMS  795

Query  357  SQVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKKIEFFDTD-T  533
             ++ K    L+ + S   +   +   FW   GE  T R+R + L++V++ +I +FD +  
Sbjct  796  REIGKYCYLLIGVSSAALLFNTLQHFFWDVVGENLTKRVREKMLEAVMKNEIAWFDQEEN  855

Query  534  RAKDIIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLAVVPLIA  713
             +  I   +S DA  V+ AIGD+I   ++  +  LV    GF+  W+L+LV LAV P++ 
Sbjct  856  ESARIAARLSLDANNVRSAIGDRISVIMQNSALMLVACTAGFVLQWRLSLVLLAVFPVVV  915

Query  714  VAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYSKSLNNAL  890
             A     + M+  S   EAA+A+A ++A EA+S VRTV +F  E K V  +S +L + L
Sbjct  916  AATVLQKMFMNGFSGDLEAAHAKATQLAGEAVSNVRTVAAFNSEAKIVSLFSSNLESPL  974



>ref|XP_010516925.1| PREDICTED: ABC transporter B family member 1-like [Camelina sativa]
Length=1350

 Score =   231 bits (589),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 106/238 (45%), Positives = 166/238 (70%), Gaps = 0/238 (0%)
 Frame = +3

Query  186  VSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLSSDSHRLSSQV  365
            V+F  LF  AD +DY  M  GS+GA +HG +LP+F   F  +++S G  ++D  ++  +V
Sbjct  91   VAFRELFRFADGLDYVLMGIGSVGAFVHGCSLPLFLRFFADLVNSFGSNANDVDKMMQEV  150

Query  366  SKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKKIEFFDTDTRAKD  545
             K ALY + +G+ I+ S+W  ++ W  +GERQT ++R++YL++ L + I+FFDT+ R  D
Sbjct  151  LKYALYFLVVGAAIWASSWAEISCWMWSGERQTTKMRIKYLEAALNQDIQFFDTEVRTSD  210

Query  546  IIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLAVVPLIAVAGG  725
            ++F I++DA++VQDAI +K+G+ I Y++ F+ GF VGF +VW+L LVTLAVVPLIAV GG
Sbjct  211  VVFAINTDAVMVQDAISEKLGNFIHYMATFVSGFIVGFTAVWQLALVTLAVVPLIAVIGG  270

Query  726  TYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYSKSLNNALVLG  899
             +T  +S LS K + + ++AG + E+ + Q+R V +FVGE +A ++YS +L  A  LG
Sbjct  271  IHTTTLSKLSNKSQESLSQAGNIVEQTVVQIRVVMAFVGESRASQAYSSALKIAQKLG  328


 Score = 94.7 bits (234),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 72/239 (30%), Positives = 124/239 (52%), Gaps = 3/239 (1%)
 Frame = +3

Query  177  KEMVSFFGLFSAADTVDYFFMVFGSIGACIHGAALPVFFVLFGRMIDSLGHLSSDSHRLS  356
            K+  + F   +  ++ ++ + + GS+G+ + G+ L  FF      + S+ + + D   + 
Sbjct  744  KDQANSFWRLAKMNSPEWKYALLGSVGSVVCGS-LSAFFAYVLSAVLSI-YYNPDHEYMI  801

Query  357  SQVSKQALYLVYLGSIIFISAWIGVAFWTQTGERQTARLRLRYLQSVLRKKIEFFD-TDT  533
             Q+ K    L+ L S   I   +  +FW   GE  T R+R + L +VL+ ++ +FD  + 
Sbjct  802  KQIDKYCYLLIGLSSAALIFNTLQHSFWDIVGENLTKRVREKMLTAVLKNEMAWFDQEEN  861

Query  534  RAKDIIFHISSDAILVQDAIGDKIGHTIRYISQFLVGFAVGFISVWKLTLVTLAVVPLIA  713
             +  I   ++ DA  V+ AIGD+I   ++  +  LV    GF+  W+L LV +AV P++ 
Sbjct  862  ESARIAARLALDANNVRSAIGDRISVIVQNTALMLVACTAGFVLQWRLALVLVAVFPVVV  921

Query  714  VAGGTYTLIMSNLSQKGEAAYAEAGKVAEEAISQVRTVYSFVGEKKAVESYSKSLNNAL  890
             A     + MS  S   EAA+A+  ++A EAI+ VRTV +F  E K V  Y+ +L   L
Sbjct  922  AATVLQKMFMSGFSGDLEAAHAKGTQLAGEAIANVRTVAAFNSEAKIVRLYTANLEPPL  980



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1838885864684