BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c98534_g1_i1 len=310 path=[318:0-309]

Length=310
                                                                      Score     E

ref|XP_009616743.1|  PREDICTED: subtilisin-like protease SDD1           172   5e-48   
gb|EYU46392.1|  hypothetical protein MIMGU_mgv1a001666mg                170   6e-47   
ref|XP_006355907.1|  PREDICTED: subtilisin-like protease SDD1-like      169   7e-47   
ref|XP_010068435.1|  PREDICTED: subtilisin-like protease SDD1           169   7e-47   
ref|XP_004247312.2|  PREDICTED: subtilisin-like protease SDD1           169   1e-46   
ref|XP_009803381.1|  PREDICTED: subtilisin-like protease SDD1           168   2e-46   
gb|KDO60343.1|  hypothetical protein CISIN_1g004101mg                   167   5e-46   
ref|XP_006479431.1|  PREDICTED: subtilisin-like protease SDD1-like      167   8e-46   
ref|XP_011080122.1|  PREDICTED: subtilisin-like protease SDD1           165   3e-45   
ref|XP_002526537.1|  Cucumisin precursor, putative                      162   4e-44   Ricinus communis
ref|XP_010262465.1|  PREDICTED: subtilisin-like protease SDD1           162   5e-44   
ref|XP_011024491.1|  PREDICTED: subtilisin-like protease SDD1           161   9e-44   
ref|XP_009370534.1|  PREDICTED: subtilisin-like protease SDD1           159   3e-43   
ref|XP_002301847.2|  STOMATAL DENSITY AND DISTRIBUTION family pro...    159   3e-43   Populus trichocarpa [western balsam poplar]
ref|XP_007201801.1|  hypothetical protein PRUPE_ppa001773mg             159   5e-43   
ref|XP_008382710.1|  PREDICTED: subtilisin-like protease SDD1           158   7e-43   
ref|XP_008235585.1|  PREDICTED: subtilisin-like protease SDD1           158   7e-43   
ref|XP_007050153.1|  Subtilase family protein isoform 1                 158   9e-43   
ref|XP_008356216.1|  PREDICTED: subtilisin-like protease SDD1           157   2e-42   
gb|KDP26457.1|  hypothetical protein JCGZ_17615                         154   1e-41   
ref|XP_010652423.1|  PREDICTED: subtilisin-like protease SDD1           155   1e-41   
ref|XP_010475053.1|  PREDICTED: subtilisin-like protease SDD1           155   1e-41   
ref|XP_010483084.1|  PREDICTED: subtilisin-like protease SDD1           155   1e-41   
ref|XP_010457444.1|  PREDICTED: subtilisin-like protease SDD1           155   2e-41   
ref|NP_563701.1|  subtilisin-like protease SDD1                         154   2e-41   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009335230.1|  PREDICTED: subtilisin-like protease SDD1           154   2e-41   
ref|XP_006304967.1|  hypothetical protein CARUB_v10012040mg             154   2e-41   
ref|XP_006418166.1|  hypothetical protein EUTSA_v10006861mg             153   7e-41   
ref|XP_009790649.1|  PREDICTED: subtilisin-like protease SDD1 iso...    152   9e-41   
gb|KFK42754.1|  hypothetical protein AALP_AA1G035200                    153   9e-41   
ref|XP_002892197.1|  hypothetical protein ARALYDRAFT_470387             153   1e-40   
ref|XP_009790650.1|  PREDICTED: subtilisin-like protease SDD1 iso...    152   1e-40   
emb|CBI37197.3|  unnamed protein product                                154   1e-40   
ref|XP_009790648.1|  PREDICTED: subtilisin-like protease SDD1 iso...    152   1e-40   
ref|XP_010684867.1|  PREDICTED: subtilisin-like protease SDD1           152   1e-40   
ref|XP_009590434.1|  PREDICTED: subtilisin-like protease SDD1           150   6e-40   
ref|XP_010091819.1|  Subtilisin-like protease SDD1                      150   6e-40   
ref|XP_008447369.1|  PREDICTED: subtilisin-like protease SDD1           150   8e-40   
ref|XP_004242535.1|  PREDICTED: subtilisin-like protease SDD1           149   2e-39   
gb|ABD64827.1|  putative subtilisin serine protease of stomatal d...    149   2e-39   Isatis tinctoria [woad]
ref|XP_004289987.1|  PREDICTED: subtilisin-like protease SDD1-like      149   2e-39   
ref|XP_004493834.1|  PREDICTED: subtilisin-like protease SDD1-like      149   3e-39   
ref|XP_006352831.1|  PREDICTED: subtilisin-like protease SDD1-like      149   3e-39   
gb|AES81608.2|  subtilisin-like serine protease                         147   1e-38   
ref|XP_003625390.1|  Subtilisin-like protease                           148   1e-38   
gb|KHN10783.1|  Subtilisin-like protease SDD1                           145   2e-38   
emb|CDP03800.1|  unnamed protein product                                146   2e-38   
ref|XP_003520616.1|  PREDICTED: subtilisin-like protease SDD1-like      145   3e-38   
ref|XP_009391664.1|  PREDICTED: subtilisin-like protease SDD1           145   4e-38   
emb|CDY18206.1|  BnaC05g02290D                                          145   5e-38   
emb|CDX89843.1|  BnaA10g02390D                                          145   8e-38   
ref|XP_010933213.1|  PREDICTED: subtilisin-like protease SDD1           145   8e-38   
ref|XP_004985741.1|  PREDICTED: subtilisin-like protease SDD1-like      144   1e-37   
ref|XP_007162604.1|  hypothetical protein PHAVU_001G165300g             145   2e-37   
ref|XP_008810058.1|  PREDICTED: subtilisin-like protease SDD1           143   3e-37   
gb|EAZ25541.1|  hypothetical protein OsJ_09366                          143   3e-37   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003554304.1|  PREDICTED: subtilisin-like protease SDD1-like      143   3e-37   
gb|EAY88497.1|  hypothetical protein OsI_09968                          143   4e-37   Oryza sativa Indica Group [Indian rice]
gb|ABF93923.1|  subtilase family protein, putative                      143   4e-37   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002468524.1|  hypothetical protein SORBIDRAFT_01g047390          142   4e-37   Sorghum bicolor [broomcorn]
ref|XP_004166310.1|  PREDICTED: subtilisin-like protease SDD1-like      142   5e-37   
gb|KGN58306.1|  hypothetical protein Csa_3G610820                       142   5e-37   
ref|XP_009119332.1|  PREDICTED: subtilisin-like protease SDD1           142   5e-37   
ref|XP_004152066.1|  PREDICTED: subtilisin-like protease SDD1-like      142   6e-37   
ref|XP_008650951.1|  PREDICTED: subtilisin-like protease SDD1           141   2e-36   
ref|XP_010230283.1|  PREDICTED: subtilisin-like protease SDD1           138   3e-35   
ref|XP_009343175.1|  PREDICTED: subtilisin-like protease                125   1e-30   
ref|XP_009345959.1|  PREDICTED: subtilisin-like protease                124   1e-30   
emb|CDP17236.1|  unnamed protein product                                122   6e-30   
ref|XP_010912031.1|  PREDICTED: subtilisin-like protease                122   6e-30   
ref|XP_010690381.1|  PREDICTED: subtilisin-like protease                120   3e-29   
ref|XP_006854360.1|  hypothetical protein AMTR_s00039p00160190          120   3e-29   
ref|XP_004252763.1|  PREDICTED: subtilisin-like protease                119   8e-29   
ref|XP_011074394.1|  PREDICTED: subtilisin-like protease                119   8e-29   
ref|XP_008793983.1|  PREDICTED: subtilisin-like protease                119   1e-28   
ref|XP_010558849.1|  PREDICTED: subtilisin-like protease SDD1           119   1e-28   
ref|XP_011074393.1|  PREDICTED: subtilisin-like protease                119   1e-28   
ref|XP_010647877.1|  PREDICTED: subtilisin-like protease                119   1e-28   
gb|KCW63761.1|  hypothetical protein EUGRSUZ_G01423                     119   1e-28   
ref|XP_007017195.1|  Subtilisin-like serine endopeptidase family ...    119   2e-28   
ref|XP_010233560.1|  PREDICTED: subtilisin-like protease                118   2e-28   
ref|XP_010263511.1|  PREDICTED: subtilisin-like protease                117   4e-28   
ref|XP_009610212.1|  PREDICTED: subtilisin-like protease                117   7e-28   
ref|XP_006342632.1|  PREDICTED: subtilisin-like protease-like           117   7e-28   
ref|XP_010927456.1|  PREDICTED: subtilisin-like protease                117   7e-28   
ref|XP_006855695.1|  hypothetical protein AMTR_s00044p00139080          112   7e-28   
ref|XP_006425911.1|  hypothetical protein CICLE_v10024929mg             117   8e-28   
ref|XP_004975630.1|  PREDICTED: subtilisin-like protease-like           116   9e-28   
gb|KDO79191.1|  hypothetical protein CISIN_1g004824mg                   116   1e-27   
ref|XP_010066012.1|  PREDICTED: subtilisin-like protease                116   1e-27   
gb|KDP41709.1|  hypothetical protein JCGZ_16116                         116   1e-27   
ref|XP_010927458.1|  PREDICTED: subtilisin-like protease                116   1e-27   
ref|XP_011069660.1|  PREDICTED: subtilisin-like protease                116   1e-27   
ref|XP_006466594.1|  PREDICTED: subtilisin-like protease-like           116   1e-27   
ref|XP_008657904.1|  PREDICTED: subtilisin-like protease                116   1e-27   
ref|XP_010059919.1|  PREDICTED: subtilisin-like protease                116   1e-27   
ref|XP_006434738.1|  hypothetical protein CICLE_v10000411mg             116   1e-27   
ref|XP_004972264.1|  PREDICTED: subtilisin-like protease-like           116   1e-27   
gb|KCW44171.1|  hypothetical protein EUGRSUZ_L024072                    110   1e-27   
ref|XP_009611962.1|  PREDICTED: subtilisin-like protease                116   1e-27   
gb|KDO84130.1|  hypothetical protein CISIN_1g004809mg                   116   1e-27   
ref|XP_002282841.2|  PREDICTED: uncharacterized protein LOC100259061    117   1e-27   Vitis vinifera
gb|KCW66398.1|  hypothetical protein EUGRSUZ_F00212                     116   1e-27   
ref|XP_006495263.1|  PREDICTED: subtilisin-like protease-like           116   1e-27   
gb|KDP41712.1|  hypothetical protein JCGZ_16119                         115   1e-27   
gb|EYU25440.1|  hypothetical protein MIMGU_mgv1a0017511mg               115   1e-27   
gb|EEE55729.1|  hypothetical protein OsJ_04215                          115   1e-27   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002446493.1|  hypothetical protein SORBIDRAFT_06g016860          115   2e-27   Sorghum bicolor [broomcorn]
ref|XP_010025755.1|  PREDICTED: subtilisin-like protease                115   2e-27   
dbj|BAD82002.1|  putative subtilase                                     115   2e-27   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006487124.1|  PREDICTED: subtilisin-like protease-like           115   2e-27   
gb|KCW62487.1|  hypothetical protein EUGRSUZ_H05125                     115   2e-27   
gb|EYU36342.1|  hypothetical protein MIMGU_mgv1a001789mg                115   2e-27   
ref|XP_010068463.1|  PREDICTED: subtilisin-like protease                115   2e-27   
ref|XP_011000657.1|  PREDICTED: subtilisin-like protease                115   2e-27   
gb|EYU25438.1|  hypothetical protein MIMGU_mgv1a001996mg                115   2e-27   
ref|XP_002313857.1|  hypothetical protein POPTR_0009s10340g             115   2e-27   Populus trichocarpa [western balsam poplar]
ref|XP_010687642.1|  PREDICTED: subtilisin-like protease                115   2e-27   
ref|XP_004291093.1|  PREDICTED: subtilisin-like protease-like           115   3e-27   
ref|XP_006847080.1|  hypothetical protein AMTR_s00017p00213920          110   3e-27   
gb|KCW66392.1|  hypothetical protein EUGRSUZ_F00206                     115   3e-27   
ref|XP_010059916.1|  PREDICTED: subtilisin-like protease                115   3e-27   
ref|XP_010059917.1|  PREDICTED: subtilisin-like protease                115   3e-27   
ref|XP_010068464.1|  PREDICTED: subtilisin-like protease                115   3e-27   
gb|KDP41710.1|  hypothetical protein JCGZ_16117                         114   3e-27   
gb|KCW63975.1|  hypothetical protein EUGRSUZ_G01657                     115   3e-27   
ref|XP_007042045.1|  Subtilase family protein, putative isoform 4       113   3e-27   
ref|XP_010068558.1|  PREDICTED: subtilisin-like protease                115   4e-27   
gb|EYU36340.1|  hypothetical protein MIMGU_mgv1a001790mg                114   4e-27   
ref|XP_006422999.1|  hypothetical protein CICLE_v10027863mg             115   4e-27   
ref|XP_006342631.1|  PREDICTED: subtilisin-like protease-like           114   4e-27   
ref|XP_010112177.1|  Subtilisin-like protease                           114   4e-27   
ref|XP_002284864.1|  PREDICTED: subtilisin-like protease                114   5e-27   Vitis vinifera
ref|XP_007041871.1|  Subtilisin-like serine protease 2                  114   5e-27   
gb|EYU45084.1|  hypothetical protein MIMGU_mgv1a001942mg                114   5e-27   
gb|ABR16566.1|  unknown                                                 112   6e-27   Picea sitchensis
ref|XP_011029640.1|  PREDICTED: subtilisin-like protease                114   6e-27   
ref|XP_010068466.1|  PREDICTED: subtilisin-like protease                114   6e-27   
ref|XP_010266807.1|  PREDICTED: subtilisin-like protease                114   6e-27   
ref|XP_011017184.1|  PREDICTED: subtilisin-like protease                114   6e-27   
ref|XP_008669405.1|  PREDICTED: subtilisin-like protease                114   7e-27   
ref|XP_010092449.1|  Subtilisin-like protease SDD1                      111   7e-27   
ref|XP_006487123.1|  PREDICTED: subtilisin-like protease-like           114   7e-27   
ref|XP_006857970.1|  hypothetical protein AMTR_s00069p00178060          114   7e-27   
ref|XP_006487074.1|  PREDICTED: subtilisin-like protease-like           113   7e-27   
gb|AFW84453.1|  putative subtilase family protein                       114   7e-27   
ref|XP_006487073.1|  PREDICTED: subtilisin-like protease-like           114   7e-27   
ref|XP_009790288.1|  PREDICTED: subtilisin-like protease                114   8e-27   
ref|XP_009800439.1|  PREDICTED: subtilisin-like protease                114   8e-27   
ref|XP_006422997.1|  hypothetical protein CICLE_v10027850mg             114   8e-27   
gb|EYU36336.1|  hypothetical protein MIMGU_mgv1a019012mg                114   9e-27   
ref|XP_009799242.1|  PREDICTED: subtilisin-like protease                114   9e-27   
ref|XP_002282304.3|  PREDICTED: subtilisin-like protease                114   9e-27   Vitis vinifera
ref|XP_006487072.1|  PREDICTED: subtilisin-like protease-like           114   9e-27   
ref|XP_010059918.1|  PREDICTED: subtilisin-like protease                113   1e-26   
ref|XP_008785865.1|  PREDICTED: subtilisin-like protease                113   1e-26   
emb|CAN64996.1|  hypothetical protein VITISV_001780                     113   1e-26   Vitis vinifera
emb|CAN60787.1|  hypothetical protein VITISV_034533                     113   1e-26   Vitis vinifera
ref|XP_011069662.1|  PREDICTED: subtilisin-like protease                113   1e-26   
ref|XP_006848886.1|  hypothetical protein AMTR_s00420p00013050          108   1e-26   
ref|XP_002284869.3|  PREDICTED: subtilisin-like protease                113   1e-26   Vitis vinifera
ref|XP_007042042.1|  Subtilase family protein, putative isoform 1       113   1e-26   
ref|XP_002523606.1|  Cucumisin precursor, putative                      113   1e-26   Ricinus communis
ref|XP_007042044.1|  Subtilase family protein, putative isoform 3       113   1e-26   
gb|EYU45081.1|  hypothetical protein MIMGU_mgv1a002217mg                113   2e-26   
ref|XP_008357385.1|  PREDICTED: subtilisin-like protease                113   2e-26   
emb|CDP17956.1|  unnamed protein product                                112   2e-26   
gb|KDP41714.1|  hypothetical protein JCGZ_16121                         112   2e-26   
ref|XP_008785920.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    112   2e-26   
ref|XP_010093626.1|  Subtilisin-like protease                           112   2e-26   
ref|XP_001755716.1|  predicted protein                                  112   2e-26   
gb|EYU19442.1|  hypothetical protein MIMGU_mgv1a001731mg                112   2e-26   
ref|XP_010484555.1|  PREDICTED: subtilisin-like protease                112   2e-26   
ref|XP_009762584.1|  PREDICTED: subtilisin-like protease isoform X4     112   2e-26   
ref|XP_009762581.1|  PREDICTED: subtilisin-like protease isoform X1     112   2e-26   
ref|XP_006345404.1|  PREDICTED: subtilisin-like protease-like           112   2e-26   
ref|XP_009359804.1|  PREDICTED: subtilisin-like protease                112   2e-26   
ref|XP_002518750.1|  Xylem serine proteinase 1 precursor, putative      112   3e-26   Ricinus communis
gb|KDP41723.1|  hypothetical protein JCGZ_26741                         112   3e-26   
gb|KDO59722.1|  hypothetical protein CISIN_1g037455mg                   112   3e-26   
ref|XP_008220243.1|  PREDICTED: subtilisin-like protease                112   3e-26   
ref|XP_001774001.1|  predicted protein                                  112   3e-26   
gb|EYU25437.1|  hypothetical protein MIMGU_mgv1a002005mg                112   3e-26   
emb|CAN60788.1|  hypothetical protein VITISV_034534                     112   3e-26   Vitis vinifera
ref|XP_002282856.2|  PREDICTED: subtilisin-like protease                112   3e-26   Vitis vinifera
ref|XP_007017191.1|  Subtilisin-like serine protease 2, putative        112   4e-26   
ref|XP_011046353.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    112   5e-26   
ref|XP_011069659.1|  PREDICTED: subtilisin-like protease                112   5e-26   
gb|KFK30136.1|  hypothetical protein AALP_AA7G221600                    111   5e-26   
ref|XP_002977794.1|  hypothetical protein SELMODRAFT_107394             111   5e-26   
ref|XP_007221958.1|  hypothetical protein PRUPE_ppa001770mg             111   5e-26   
gb|EYU36339.1|  hypothetical protein MIMGU_mgv1a001782mg                111   5e-26   
ref|XP_002313716.1|  hypothetical protein POPTR_0009s13590g             111   5e-26   Populus trichocarpa [western balsam poplar]
ref|XP_009595649.1|  PREDICTED: subtilisin-like protease                111   6e-26   
ref|XP_004492811.1|  PREDICTED: subtilisin-like protease-like           111   6e-26   
ref|XP_006374911.1|  subtilase family protein                           111   6e-26   
gb|ACT34764.1|  subtilisin-like protease preproenzyme                   111   6e-26   Nicotiana tabacum [American tobacco]
gb|ABK95622.1|  unknown                                                 111   6e-26   Populus trichocarpa [western balsam poplar]
ref|NP_001051353.1|  Os03g0761500                                       111   6e-26   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006407132.1|  hypothetical protein EUTSA_v10022348mg             112   6e-26   
ref|XP_002986914.1|  hypothetical protein SELMODRAFT_425830             111   6e-26   
ref|XP_009351978.1|  PREDICTED: subtilisin-like protease SBT5.3         111   6e-26   
ref|XP_008377749.1|  PREDICTED: subtilisin-like protease                111   7e-26   
gb|EYU36338.1|  hypothetical protein MIMGU_mgv1a002690mg                110   7e-26   
ref|XP_008220244.1|  PREDICTED: subtilisin-like protease                111   8e-26   
ref|XP_003523496.1|  PREDICTED: subtilisin-like protease-like           111   8e-26   
ref|XP_010246830.1|  PREDICTED: subtilisin-like protease                111   8e-26   
gb|EPS63009.1|  subtilisin-like protease preproenzyme                   110   8e-26   
ref|XP_006359680.1|  PREDICTED: subtilisin-like protease-like           111   9e-26   
ref|XP_008241490.1|  PREDICTED: subtilisin-like protease                110   9e-26   
ref|XP_009789823.1|  PREDICTED: subtilisin-like protease                111   9e-26   
emb|CDP01318.1|  unnamed protein product                                110   9e-26   
ref|XP_002533857.1|  Cucumisin precursor, putative                      110   1e-25   Ricinus communis
ref|XP_009419397.1|  PREDICTED: subtilisin-like protease                110   1e-25   
ref|XP_010464539.1|  PREDICTED: subtilisin-like protease                110   1e-25   
ref|XP_002267740.1|  PREDICTED: subtilisin-like protease                110   1e-25   Vitis vinifera
ref|XP_011074591.1|  PREDICTED: subtilisin-like protease                110   1e-25   
ref|XP_008393790.1|  PREDICTED: subtilisin-like protease                110   1e-25   
ref|XP_008351993.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    110   1e-25   
ref|XP_006374912.1|  hypothetical protein POPTR_0014s02640g             110   1e-25   
ref|XP_010320531.1|  PREDICTED: subtilisin-like protease                110   1e-25   
ref|XP_004231026.1|  PREDICTED: subtilisin-like protease                110   1e-25   
ref|XP_010646965.1|  PREDICTED: subtilisin-like protease                110   1e-25   
ref|XP_002865029.1|  subtilase family protein                           110   1e-25   
ref|NP_001046517.1|  Os02g0269600                                       110   1e-25   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006374913.1|  subtilase family protein                           110   1e-25   
ref|XP_004229661.1|  PREDICTED: subtilisin-like protease                110   1e-25   
ref|XP_007017194.1|  Subtilisin-like serine endopeptidase family ...    110   1e-25   
ref|XP_011029618.1|  PREDICTED: subtilisin-like protease                110   1e-25   
ref|XP_010540359.1|  PREDICTED: subtilisin-like protease                110   1e-25   
ref|XP_011029629.1|  PREDICTED: subtilisin-like protease                110   1e-25   
ref|XP_010090327.1|  Subtilisin-like protease                           110   1e-25   
ref|XP_003558354.1|  PREDICTED: subtilisin-like protease                110   2e-25   
ref|XP_008342302.1|  PREDICTED: subtilisin-like protease                110   2e-25   
emb|CDO96926.1|  unnamed protein product                                110   2e-25   
ref|XP_002886065.1|  predicted protein                                  110   2e-25   
ref|XP_009593174.1|  PREDICTED: subtilisin-like protease                110   2e-25   
ref|NP_566473.2|  Subtilase family protein                              110   2e-25   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007047286.1|  Subtilisin-like serine endopeptidase family ...    110   2e-25   
ref|XP_011001974.1|  PREDICTED: subtilisin-like protease                110   2e-25   
ref|XP_002310134.2|  subtilase family protein                           110   2e-25   Populus trichocarpa [western balsam poplar]
gb|KDP25228.1|  hypothetical protein JCGZ_20384                         107   2e-25   
ref|XP_011001975.1|  PREDICTED: subtilisin-like protease                109   2e-25   
ref|XP_007051967.1|  Subtilase family protein                           109   2e-25   
ref|XP_010320328.1|  PREDICTED: subtilisin-like protease                109   2e-25   
ref|XP_008221259.1|  PREDICTED: subtilisin-like protease                109   3e-25   
ref|NP_001052820.1|  Os04g0430700                                       109   3e-25   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007199629.1|  hypothetical protein PRUPE_ppa001754mg             109   3e-25   
ref|NP_569044.1|  Subtilisin-like serine endopeptidase family pro...    109   3e-25   Arabidopsis thaliana [mouse-ear cress]
emb|CAH67004.1|  OSIGBa0160I14.2                                        109   3e-25   Oryza sativa [red rice]
emb|CAE03027.1|  OSJNBa0084A10.2                                        109   3e-25   Oryza sativa [red rice]
gb|KEH42928.1|  subtilisin-like serine protease                         109   3e-25   
ref|XP_002510194.1|  Xylem serine proteinase 1 precursor, putative      109   3e-25   Ricinus communis
gb|KDO84129.1|  hypothetical protein CISIN_1g004265mg                   109   3e-25   
ref|XP_006434737.1|  hypothetical protein CICLE_v10000364mg             109   3e-25   
ref|XP_002305511.2|  hypothetical protein POPTR_0004s17960g             109   3e-25   Populus trichocarpa [western balsam poplar]
ref|XP_002317660.2|  hypothetical protein POPTR_0011s15400g             109   3e-25   Populus trichocarpa [western balsam poplar]
ref|XP_004961962.1|  PREDICTED: subtilisin-like protease-like           109   3e-25   
ref|XP_007208070.1|  hypothetical protein PRUPE_ppa001701mg             109   3e-25   
ref|XP_008236002.1|  PREDICTED: subtilisin-like protease                109   3e-25   
emb|CAN64995.1|  hypothetical protein VITISV_001779                     109   4e-25   Vitis vinifera
gb|KEH18574.1|  subtilisin-like serine protease                         109   4e-25   
ref|XP_002986912.1|  hypothetical protein SELMODRAFT_425827             109   4e-25   
ref|XP_006856781.1|  hypothetical protein AMTR_s00055p00107870          109   4e-25   
ref|XP_009360421.1|  PREDICTED: subtilisin-like protease                109   4e-25   
ref|XP_006369092.1|  subtilase family protein                           109   4e-25   
ref|XP_011069661.1|  PREDICTED: subtilisin-like protease                109   4e-25   
dbj|BAE98521.1|  putative subtilisin-like serine proteinase             109   4e-25   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006386505.1|  hypothetical protein POPTR_0002s12610g             108   4e-25   
ref|XP_008238402.1|  PREDICTED: subtilisin-like protease                109   4e-25   
ref|XP_007131701.1|  hypothetical protein PHAVU_011G034700g             109   4e-25   
ref|XP_003581342.1|  PREDICTED: subtilisin-like protease SBT3.3         108   4e-25   
ref|XP_011043530.1|  PREDICTED: subtilisin-like protease                108   4e-25   
ref|XP_006828664.1|  hypothetical protein AMTR_s00129p00121180          109   4e-25   
ref|XP_007046423.1|  Subtilisin-like serine endopeptidase family ...    107   4e-25   
ref|XP_008357007.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    108   5e-25   
emb|CDX75758.1|  BnaC03g38410D                                          105   5e-25   
ref|XP_004148149.1|  PREDICTED: subtilisin-like protease-like           108   5e-25   
ref|XP_010647741.1|  PREDICTED: subtilisin-like protease                108   5e-25   
ref|XP_003552427.1|  PREDICTED: subtilisin-like protease-like           108   5e-25   
ref|XP_004505786.1|  PREDICTED: subtilisin-like protease-like           108   5e-25   
ref|XP_002885009.1|  subtilase family protein                           108   6e-25   
ref|XP_007039328.1|  Subtilase family protein, putative isoform 2       108   6e-25   
ref|XP_006847103.1|  hypothetical protein AMTR_s00017p00218470          105   6e-25   
ref|XP_010263869.1|  PREDICTED: subtilisin-like protease SBT3.5         108   6e-25   
ref|XP_008371534.1|  PREDICTED: subtilisin-like protease                108   6e-25   
ref|XP_010446286.1|  PREDICTED: subtilisin-like protease                107   7e-25   
ref|XP_010489238.1|  PREDICTED: subtilisin-like protease                108   7e-25   
ref|XP_008785921.1|  PREDICTED: subtilisin-like protease                108   7e-25   
ref|XP_007143987.1|  hypothetical protein PHAVU_007G119500g             108   7e-25   
gb|KGN57311.1|  hypothetical protein Csa_3G178520                       108   7e-25   
ref|XP_008367646.1|  PREDICTED: subtilisin-like protease                108   7e-25   
ref|XP_008351977.1|  PREDICTED: subtilisin-like protease                108   7e-25   
ref|XP_011096454.1|  PREDICTED: subtilisin-like protease                108   8e-25   
ref|XP_002982080.1|  hypothetical protein SELMODRAFT_233912             108   8e-25   
ref|XP_006651839.1|  PREDICTED: subtilisin-like protease-like           108   8e-25   
ref|XP_008393753.1|  PREDICTED: subtilisin-like protease                108   8e-25   
ref|XP_002966443.1|  hypothetical protein SELMODRAFT_143697             108   8e-25   
ref|XP_009351288.1|  PREDICTED: subtilisin-like protease SBT5.3 i...    108   8e-25   
ref|XP_008245809.1|  PREDICTED: subtilisin-like protease SDD1           108   8e-25   
ref|XP_002510119.1|  Xylem serine proteinase 1 precursor, putative      108   9e-25   
ref|XP_009351289.1|  PREDICTED: subtilisin-like protease SBT5.3 i...    108   9e-25   
ref|XP_007204261.1|  hypothetical protein PRUPE_ppa001828mg             108   9e-25   
gb|KEH30495.1|  subtilisin-like serine protease                         108   9e-25   
ref|XP_009350566.1|  PREDICTED: subtilisin-like protease                108   9e-25   
ref|XP_008352138.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    107   1e-24   
gb|KEH18578.1|  subtilisin-like serine protease                         107   1e-24   
ref|XP_006847082.1|  hypothetical protein AMTR_s00017p00214530          107   1e-24   
ref|XP_007139763.1|  hypothetical protein PHAVU_008G057000g             107   1e-24   
ref|XP_007039327.1|  Subtilase family protein, putative isoform 1       108   1e-24   
gb|KDO59723.1|  hypothetical protein CISIN_1g046220mg                   107   1e-24   
ref|XP_002977793.1|  hypothetical protein SELMODRAFT_107351             107   1e-24   
ref|XP_006339499.1|  PREDICTED: subtilisin-like protease-like           107   1e-24   
ref|XP_004287692.1|  PREDICTED: subtilisin-like protease-like           107   1e-24   
gb|KDP29636.1|  hypothetical protein JCGZ_18798                         107   1e-24   
emb|CDY40653.1|  BnaA03g53100D                                          107   1e-24   
ref|NP_001049524.2|  Os03g0242900                                       107   1e-24   
ref|XP_004496012.1|  PREDICTED: subtilisin-like protease-like           107   1e-24   
ref|XP_009771086.1|  PREDICTED: subtilisin-like protease                107   1e-24   
ref|XP_004981675.1|  PREDICTED: subtilisin-like protease-like           107   1e-24   
ref|XP_002465573.1|  hypothetical protein SORBIDRAFT_01g041350          107   1e-24   
ref|XP_004249504.1|  PREDICTED: subtilisin-like protease                107   1e-24   
emb|CDP01315.1|  unnamed protein product                                107   1e-24   
ref|XP_010467397.1|  PREDICTED: subtilisin-like protease isoform X2     107   1e-24   
ref|XP_007046422.1|  Subtilisin-like serine endopeptidase family ...    107   1e-24   
ref|XP_009138332.1|  PREDICTED: subtilisin-like protease                107   1e-24   
gb|KEH18575.1|  subtilisin-like serine protease                         107   1e-24   
ref|XP_010277120.1|  PREDICTED: subtilisin-like protease                107   1e-24   
ref|XP_010467396.1|  PREDICTED: subtilisin-like protease isoform X1     107   1e-24   
ref|XP_003538985.1|  PREDICTED: subtilisin-like protease-like           107   1e-24   
gb|KDO84128.1|  hypothetical protein CISIN_1g047470mg                   107   2e-24   
ref|XP_006473885.1|  PREDICTED: subtilisin-like protease-like           107   2e-24   
ref|XP_010320326.1|  PREDICTED: subtilisin-like protease                107   2e-24   
ref|XP_010100157.1|  Subtilisin-like protease SDD1                      107   2e-24   
ref|XP_007137352.1|  hypothetical protein PHAVU_009G120000g             107   2e-24   
gb|KFK38761.1|  hypothetical protein AALP_AA3G157200                    107   2e-24   
ref|XP_006652296.1|  PREDICTED: subtilisin-like protease-like           107   2e-24   
ref|XP_006412166.1|  hypothetical protein EUTSA_v10026999mg             107   2e-24   
ref|XP_008225402.1|  PREDICTED: subtilisin-like protease                107   2e-24   
ref|XP_002534008.1|  Xylem serine proteinase 1 precursor, putative      107   2e-24   
gb|EYU36350.1|  hypothetical protein MIMGU_mgv1a001799mg                107   2e-24   
emb|CDX97540.1|  BnaA05g25390D                                          103   2e-24   
ref|XP_007213640.1|  hypothetical protein PRUPE_ppa001689mg             107   2e-24   
ref|XP_006847104.1|  hypothetical protein AMTR_s00017p00218650          107   2e-24   
ref|XP_011048615.1|  PREDICTED: subtilisin-like protease                107   2e-24   
gb|KHG30296.1|  Subtilisin-like protease                                107   2e-24   
emb|CDY39093.1|  BnaA01g29630D                                          107   2e-24   
ref|XP_004967678.1|  PREDICTED: subtilisin-like protease-like           107   2e-24   
ref|XP_010059854.1|  PREDICTED: subtilisin-like protease                107   2e-24   
ref|XP_009117189.1|  PREDICTED: subtilisin-like protease                107   2e-24   
emb|CDY33251.1|  BnaC01g37240D                                          107   2e-24   
ref|XP_006847097.1|  hypothetical protein AMTR_s00017p00216950          107   2e-24   
ref|XP_008439131.1|  PREDICTED: subtilisin-like protease                107   2e-24   
ref|XP_006345494.1|  PREDICTED: subtilisin-like protease-like           107   2e-24   
ref|XP_006649720.1|  PREDICTED: subtilisin-like protease-like           107   2e-24   
ref|XP_011036534.1|  PREDICTED: subtilisin-like protease                107   2e-24   
ref|XP_006655358.1|  PREDICTED: subtilisin-like protease-like           107   2e-24   
ref|XP_004512211.1|  PREDICTED: subtilisin-like protease-like           107   2e-24   
gb|EYU37942.1|  hypothetical protein MIMGU_mgv1a001727mg                107   3e-24   
ref|XP_009416811.1|  PREDICTED: subtilisin-like protease                107   3e-24   
ref|XP_006651591.1|  PREDICTED: subtilisin-like protease-like           104   3e-24   
ref|XP_009362303.1|  PREDICTED: subtilisin-like protease                107   3e-24   
ref|XP_003540860.1|  PREDICTED: subtilisin-like protease-like           107   3e-24   
ref|XP_006280074.1|  hypothetical protein CARUB_v10025957mg             106   3e-24   
ref|XP_006434736.1|  hypothetical protein CICLE_v10003898mg             107   3e-24   
gb|EMT29371.1|  Cucumisin                                               103   3e-24   
ref|XP_008780900.1|  PREDICTED: subtilisin-like protease                106   3e-24   
ref|XP_009400347.1|  PREDICTED: subtilisin-like protease                106   3e-24   
ref|XP_003572346.1|  PREDICTED: subtilisin-like protease SBT3.5         106   3e-24   
ref|XP_004985040.1|  PREDICTED: subtilisin-like protease-like           106   3e-24   
ref|XP_008372210.1|  PREDICTED: subtilisin-like protease                106   3e-24   
gb|ABR17987.1|  unknown                                                 106   3e-24   
gb|EMT29812.1|  hypothetical protein F775_42283                         106   3e-24   
gb|ACN39811.1|  unknown                                                 106   3e-24   
ref|XP_007209077.1|  hypothetical protein PRUPE_ppa001674mg             106   3e-24   
dbj|BAJ96698.1|  predicted protein                                      106   3e-24   
ref|XP_002305456.2|  hypothetical protein POPTR_0004s16850g             106   3e-24   
gb|KDP40640.1|  hypothetical protein JCGZ_24639                         105   3e-24   
ref|XP_010437545.1|  PREDICTED: subtilisin-like protease                106   3e-24   
ref|XP_010033628.1|  PREDICTED: subtilisin-like protease SBT5.4         106   4e-24   
gb|KCW53325.1|  hypothetical protein EUGRSUZ_J02574                     106   4e-24   
ref|NP_567972.1|  subtilisin-like serine protease 2                     106   4e-24   
ref|XP_008363295.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    106   4e-24   
dbj|BAJ90426.1|  predicted protein                                      106   4e-24   
ref|XP_004229864.1|  PREDICTED: subtilisin-like protease                106   4e-24   
gb|KCW53326.1|  hypothetical protein EUGRSUZ_J02574                     106   4e-24   
ref|XP_004954566.1|  PREDICTED: LOW QUALITY PROTEIN: xylem serine...    106   4e-24   
ref|XP_004958128.1|  PREDICTED: subtilisin-like protease-like           106   4e-24   
ref|XP_011037192.1|  PREDICTED: subtilisin-like protease SBT3.5         106   4e-24   
ref|XP_010518867.1|  PREDICTED: subtilisin-like protease SBT5.3         106   4e-24   
ref|XP_010272631.1|  PREDICTED: subtilisin-like protease                106   4e-24   
ref|XP_003572336.1|  PREDICTED: subtilisin-like protease SBT3.5         106   4e-24   
ref|XP_002965730.1|  hypothetical protein SELMODRAFT_407350             106   4e-24   
ref|XP_007204641.1|  hypothetical protein PRUPE_ppa001800mg             106   4e-24   
ref|XP_006476262.1|  PREDICTED: subtilisin-like protease SDD1-like      106   4e-24   
dbj|BAJ86110.1|  predicted protein                                      106   4e-24   
dbj|BAJ88882.1|  predicted protein                                      106   4e-24   
ref|XP_008383532.1|  PREDICTED: subtilisin-like protease                106   4e-24   
dbj|BAJ88973.1|  predicted protein                                      106   5e-24   
dbj|BAJ87233.1|  predicted protein                                      106   5e-24   
ref|XP_006439186.1|  hypothetical protein CICLE_v10018942mg             106   5e-24   
ref|XP_008232840.1|  PREDICTED: subtilisin-like protease                106   5e-24   
ref|XP_008457681.1|  PREDICTED: subtilisin-like protease                106   5e-24   
gb|KHG28029.1|  Subtilisin-like protease SDD1                           106   5e-24   
ref|XP_010530892.1|  PREDICTED: subtilisin-like protease                106   5e-24   
ref|XP_011040612.1|  PREDICTED: subtilisin-like protease SBT3.5         106   5e-24   
ref|XP_004287970.1|  PREDICTED: subtilisin-like protease-like           106   5e-24   
ref|XP_002528535.1|  Cucumisin precursor, putative                      106   5e-24   
dbj|BAJ88205.1|  predicted protein                                      106   5e-24   
ref|XP_004147036.1|  PREDICTED: subtilisin-like protease-like           106   5e-24   
ref|XP_006847107.1|  hypothetical protein AMTR_s00017p00219220          105   5e-24   
ref|XP_009359651.1|  PREDICTED: subtilisin-like protease SBT5.4         105   5e-24   
emb|CDM85158.1|  unnamed protein product                                105   5e-24   
emb|CDX72509.1|  BnaC07g45310D                                          105   5e-24   
ref|XP_006370742.1|  hypothetical protein POPTR_0001s460001g            103   5e-24   
gb|KDP41713.1|  hypothetical protein JCGZ_16120                         105   6e-24   
ref|XP_010104911.1|  Subtilisin-like protease SDD1                      105   6e-24   
ref|XP_002272824.2|  PREDICTED: subtilisin-like protease                105   6e-24   
ref|XP_004158378.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    105   6e-24   
ref|XP_007051968.1|  Subtilase family protein                           105   6e-24   
gb|KCW76039.1|  hypothetical protein EUGRSUZ_D00408                     105   6e-24   
ref|XP_009146419.1|  PREDICTED: subtilisin-like protease                105   6e-24   
tpg|DAA44340.1|  TPA: putative subtilase family protein                 105   6e-24   
ref|XP_006829160.1|  hypothetical protein AMTR_s00001p00269990          105   6e-24   
ref|XP_010052139.1|  PREDICTED: subtilisin-like protease SBT5.3         105   7e-24   
tpg|DAA51518.1|  TPA: putative subtilase family protein                 105   7e-24   
ref|XP_002518939.1|  Cucumisin precursor, putative                      105   7e-24   
ref|XP_006467138.1|  PREDICTED: subtilisin-like protease-like iso...    105   7e-24   
ref|XP_010248001.1|  PREDICTED: subtilisin-like protease                105   7e-24   
gb|KDO68023.1|  hypothetical protein CISIN_1g004010mg                   105   8e-24   
ref|NP_001151463.1|  LOC100285096 precursor                             105   8e-24   
gb|KDO68024.1|  hypothetical protein CISIN_1g004010mg                   105   8e-24   
ref|XP_006425216.1|  hypothetical protein CICLE_v10024941mg             105   8e-24   
ref|XP_011102178.1|  PREDICTED: subtilisin-like protease                105   8e-24   
gb|KFK31536.1|  hypothetical protein AALP_AA6G125100                    105   8e-24   
ref|XP_010432360.1|  PREDICTED: subtilisin-like protease                105   8e-24   
ref|XP_006859003.1|  hypothetical protein AMTR_s00068p00149940          105   8e-24   
ref|XP_006857977.1|  hypothetical protein AMTR_s00069p00178740          105   8e-24   
ref|XP_009608286.1|  PREDICTED: subtilisin-like protease                105   8e-24   
ref|XP_002463844.1|  hypothetical protein SORBIDRAFT_01g007310          105   8e-24   
ref|XP_009604890.1|  PREDICTED: subtilisin-like protease                105   8e-24   
gb|ABF70004.1|  subtilisin-like serine proteinase, putative             105   9e-24   
gb|KDO71607.1|  hypothetical protein CISIN_1g004205mg                   105   9e-24   
ref|XP_008382901.1|  PREDICTED: subtilisin-like protease                104   9e-24   
ref|XP_006486757.1|  PREDICTED: subtilisin-like protease-like           105   9e-24   
ref|XP_011092912.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    105   9e-24   
ref|XP_002451014.1|  hypothetical protein SORBIDRAFT_05g022620          105   9e-24   
ref|XP_006283144.1|  hypothetical protein CARUB_v10004172mg             105   9e-24   
ref|XP_006296785.1|  hypothetical protein CARUB_v10016006mg             105   9e-24   
ref|XP_006422621.1|  hypothetical protein CICLE_v10027859mg             105   9e-24   
emb|CDX99895.1|  BnaC09g28100D                                          105   1e-23   
ref|XP_004290953.1|  PREDICTED: subtilisin-like protease-like           105   1e-23   
ref|XP_007201744.1|  hypothetical protein PRUPE_ppa001956mg             105   1e-23   
ref|XP_004292169.1|  PREDICTED: subtilisin-like protease-like           105   1e-23   
ref|XP_009771925.1|  PREDICTED: subtilisin-like protease                105   1e-23   
ref|XP_010271938.1|  PREDICTED: subtilisin-like protease                105   1e-23   
gb|KCW53324.1|  hypothetical protein EUGRSUZ_J02574                     105   1e-23   
ref|XP_010056250.1|  PREDICTED: subtilisin-like protease                105   1e-23   
gb|KCW72879.1|  hypothetical protein EUGRSUZ_E01327                     105   1e-23   
ref|XP_010042589.1|  PREDICTED: subtilisin-like protease                105   1e-23   
ref|XP_007051971.1|  Subtilase family protein                           105   1e-23   
ref|XP_011038086.1|  PREDICTED: subtilisin-like protease SBT3.5         105   1e-23   
gb|KHN40450.1|  Subtilisin-like protease                                105   1e-23   
ref|XP_002867098.1|  hypothetical protein ARALYDRAFT_491159             105   1e-23   
ref|XP_010494681.1|  PREDICTED: subtilisin-like protease SBT5.4         105   1e-23   
ref|XP_010447014.1|  PREDICTED: subtilisin-like protease                105   1e-23   
emb|CBI38832.3|  unnamed protein product                                105   1e-23   
gb|EMT18650.1|  Subtilisin-like protease                                104   1e-23   
ref|XP_010051409.1|  PREDICTED: subtilisin-like protease                105   1e-23   
ref|XP_006393907.1|  hypothetical protein EUTSA_v10005646mg             105   1e-23   
gb|ACN40199.1|  unknown                                                 105   1e-23   
gb|ABR18065.1|  unknown                                                 105   1e-23   
ref|XP_003590866.1|  Subtilisin-like protease                           105   1e-23   
ref|XP_010271498.1|  PREDICTED: subtilisin-like protease SBT3.5 i...    105   1e-23   
ref|XP_010920139.1|  PREDICTED: subtilisin-like protease                105   1e-23   
ref|XP_010271499.1|  PREDICTED: subtilisin-like protease SBT3.5 i...    105   1e-23   
gb|AES61117.2|  subtilisin-like serine protease                         105   1e-23   
ref|XP_006580141.1|  PREDICTED: subtilisin-like protease SDD1-lik...    105   1e-23   
ref|NP_199378.1|  subtilase family protein                              105   1e-23   
gb|EMS48839.1|  Subtilisin-like protease                                105   1e-23   
gb|KCW81959.1|  hypothetical protein EUGRSUZ_C03325                     105   1e-23   
ref|XP_007131420.1|  hypothetical protein PHAVU_011G012100g             103   1e-23   
ref|XP_010049348.1|  PREDICTED: subtilisin-like protease                104   1e-23   
ref|XP_009407416.1|  PREDICTED: subtilisin-like protease                104   1e-23   
ref|XP_006423459.1|  hypothetical protein CICLE_v10027857mg             104   1e-23   
ref|XP_002976152.1|  hypothetical protein SELMODRAFT_416154             103   1e-23   
ref|XP_004504377.1|  PREDICTED: subtilisin-like protease SDD1-lik...    104   1e-23   
ref|XP_003524182.2|  PREDICTED: subtilisin-like protease SDD1-lik...    104   2e-23   
ref|XP_006580142.1|  PREDICTED: subtilisin-like protease SDD1-lik...    104   2e-23   
ref|XP_003535388.1|  PREDICTED: subtilisin-like protease-like           104   2e-23   
gb|EMS46832.1|  Cucumisin                                               102   2e-23   
ref|XP_004249811.1|  PREDICTED: subtilisin-like protease                104   2e-23   
gb|EAY84890.1|  hypothetical protein OsI_06255                          104   2e-23   
ref|XP_002304129.2|  hypothetical protein POPTR_0003s06530g             104   2e-23   
ref|XP_007024651.1|  Subtilase family protein                           104   2e-23   
ref|NP_001046210.1|  Os02g0198700                                       104   2e-23   
ref|XP_009135372.1|  PREDICTED: subtilisin-like protease                104   2e-23   
ref|XP_010939822.1|  PREDICTED: subtilisin-like protease                104   2e-23   
ref|XP_002863463.1|  subtilase family protein                           104   2e-23   
emb|CDX82491.1|  BnaA03g33300D                                          104   2e-23   



>ref|XP_009616743.1| PREDICTED: subtilisin-like protease SDD1 [Nicotiana tomentosiformis]
Length=769

 Score =   172 bits (437),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 82/104 (79%), Positives = 89/104 (86%), Gaps = 1/104 (1%)
 Frame = -1

Query  310  YKFLGLSVT-EGAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQG  134
            YKFLGLS T EGAW+KS FG G IIG+LDTGVWPESPSFDD GMPP P KW+G+CQ GQ 
Sbjct  112  YKFLGLSATREGAWLKSGFGRGAIIGVLDTGVWPESPSFDDHGMPPVPQKWRGICQGGQD  171

Query  133  FNSSSCNRKLIGARFFSKGHVAASPDYSPHLVEEYISPRDSHGH  2
            FNSSSCNRK+IGARFFSKGH  AS  +SP LVEEY+SPRDSHGH
Sbjct  172  FNSSSCNRKIIGARFFSKGHRVASMTWSPDLVEEYVSPRDSHGH  215



>gb|EYU46392.1| hypothetical protein MIMGU_mgv1a001666mg [Erythranthe guttata]
Length=777

 Score =   170 bits (430),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 75/105 (71%), Positives = 90/105 (86%), Gaps = 2/105 (2%)
 Frame = -1

Query  310  YKFLGLSVT--EGAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQ  137
            YKFLGLS T   GAW+KS FG G+IIG+LDTG+WPE+PSFDD GMPP P KW+G+CQ G+
Sbjct  120  YKFLGLSPTAQNGAWIKSSFGRGSIIGVLDTGIWPENPSFDDRGMPPVPQKWRGICQSGE  179

Query  136  GFNSSSCNRKLIGARFFSKGHVAASPDYSPHLVEEYISPRDSHGH  2
            GF+S++CNRKLIGARFFS+GH  +SP+YSP  V EY+SPRDSHGH
Sbjct  180  GFDSTNCNRKLIGARFFSRGHRVSSPEYSPEAVAEYVSPRDSHGH  224



>ref|XP_006355907.1| PREDICTED: subtilisin-like protease SDD1-like [Solanum tuberosum]
Length=770

 Score =   169 bits (429),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 83/104 (80%), Positives = 87/104 (84%), Gaps = 1/104 (1%)
 Frame = -1

Query  310  YKFLGLSVT-EGAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQG  134
            YKFLGLS T EGAW+KS FG G IIG+LDTGVWPESPSFDD GMPPAP KW+GVCQ GQ 
Sbjct  114  YKFLGLSPTREGAWLKSGFGRGAIIGVLDTGVWPESPSFDDHGMPPAPQKWRGVCQGGQD  173

Query  133  FNSSSCNRKLIGARFFSKGHVAASPDYSPHLVEEYISPRDSHGH  2
            FNSSSCNRKLIGARFF KGH  AS   SP  VEEY+SPRDSHGH
Sbjct  174  FNSSSCNRKLIGARFFRKGHRVASMTSSPDAVEEYVSPRDSHGH  217



>ref|XP_010068435.1| PREDICTED: subtilisin-like protease SDD1 [Eucalyptus grandis]
 gb|KCW88990.1| hypothetical protein EUGRSUZ_A01319 [Eucalyptus grandis]
Length=771

 Score =   169 bits (429),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 81/103 (79%), Positives = 87/103 (84%), Gaps = 0/103 (0%)
 Frame = -1

Query  310  YKFLGLSVTEGAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQGF  131
            YKFLGL+ + GAW +SRFG GTIIGLLDTGVWPESPSF+D GMPP P KWKG CQEGQGF
Sbjct  118  YKFLGLNPSGGAWSESRFGRGTIIGLLDTGVWPESPSFNDWGMPPVPKKWKGTCQEGQGF  177

Query  130  NSSSCNRKLIGARFFSKGHVAASPDYSPHLVEEYISPRDSHGH  2
            NSS+CNRKLIGARFF+KGH  ASP  S   V EYISPRDSHGH
Sbjct  178  NSSNCNRKLIGARFFTKGHRMASPSPSADDVVEYISPRDSHGH  220



>ref|XP_004247312.2| PREDICTED: subtilisin-like protease SDD1 [Solanum lycopersicum]
Length=774

 Score =   169 bits (428),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 82/104 (79%), Positives = 87/104 (84%), Gaps = 1/104 (1%)
 Frame = -1

Query  310  YKFLGLSVT-EGAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQG  134
            YKFLGLS T EGAW+KS FG G IIG+LDTGVWPESPSFDD GMPPAP KW+G+CQ GQ 
Sbjct  118  YKFLGLSPTREGAWLKSGFGRGAIIGVLDTGVWPESPSFDDHGMPPAPQKWRGICQGGQD  177

Query  133  FNSSSCNRKLIGARFFSKGHVAASPDYSPHLVEEYISPRDSHGH  2
            FNSSSCNRKLIGARFF KGH  AS   SP  VEEY+SPRDSHGH
Sbjct  178  FNSSSCNRKLIGARFFRKGHRVASMTSSPDAVEEYVSPRDSHGH  221



>ref|XP_009803381.1| PREDICTED: subtilisin-like protease SDD1 [Nicotiana sylvestris]
Length=768

 Score =   168 bits (426),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 80/104 (77%), Positives = 88/104 (85%), Gaps = 1/104 (1%)
 Frame = -1

Query  310  YKFLGLSVTE-GAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQG  134
            YKFLGLS T  GAW+KS FG G+IIG+LDTGVWPESPSFDD GMPP P KW+G+CQ GQ 
Sbjct  112  YKFLGLSPTRAGAWLKSGFGRGSIIGVLDTGVWPESPSFDDHGMPPVPQKWRGICQGGQV  171

Query  133  FNSSSCNRKLIGARFFSKGHVAASPDYSPHLVEEYISPRDSHGH  2
            FNSSSCNRK+IGARFFSKGH  AS  +SP  VEEY+SPRDSHGH
Sbjct  172  FNSSSCNRKIIGARFFSKGHRVASKTWSPDFVEEYVSPRDSHGH  215



>gb|KDO60343.1| hypothetical protein CISIN_1g004101mg [Citrus sinensis]
Length=773

 Score =   167 bits (423),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 76/104 (73%), Positives = 89/104 (86%), Gaps = 1/104 (1%)
 Frame = -1

Query  310  YKFLGLSVTEG-AWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQG  134
            YKFLGLS T G AW +S+FG G+IIG+LDTG+WPESPSFDD GMPP P KW+GVCQEGQ 
Sbjct  130  YKFLGLSPTNGGAWYESQFGHGSIIGVLDTGIWPESPSFDDHGMPPVPKKWRGVCQEGQS  189

Query  133  FNSSSCNRKLIGARFFSKGHVAASPDYSPHLVEEYISPRDSHGH  2
            FNSS+CNRKLIGARFF+KGH  AS   SP++++EY+SPRDS GH
Sbjct  190  FNSSNCNRKLIGARFFTKGHRVASTTMSPNIIQEYVSPRDSTGH  233



>ref|XP_006479431.1| PREDICTED: subtilisin-like protease SDD1-like [Citrus sinensis]
Length=784

 Score =   167 bits (422),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 76/104 (73%), Positives = 89/104 (86%), Gaps = 1/104 (1%)
 Frame = -1

Query  310  YKFLGLSVTEG-AWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQG  134
            YKFLGLS T G AW +S+FG G+IIG+LDTG+WPESPSFDD GMPP P KW+GVCQEGQ 
Sbjct  130  YKFLGLSPTNGGAWYESQFGHGSIIGVLDTGIWPESPSFDDHGMPPVPKKWRGVCQEGQS  189

Query  133  FNSSSCNRKLIGARFFSKGHVAASPDYSPHLVEEYISPRDSHGH  2
            FNSS+CNRKLIGARFF+KGH  AS   SP++++EY+SPRDS GH
Sbjct  190  FNSSNCNRKLIGARFFTKGHRVASTTVSPNIIQEYVSPRDSTGH  233



>ref|XP_011080122.1| PREDICTED: subtilisin-like protease SDD1 [Sesamum indicum]
Length=769

 Score =   165 bits (417),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 80/105 (76%), Positives = 87/105 (83%), Gaps = 2/105 (2%)
 Frame = -1

Query  310  YKFLGLSVTE--GAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQ  137
            YKFLGLS T   GAW++S FG G+IIGLLDTGVWPESPSFDD GMPP P KWKG+CQEGQ
Sbjct  113  YKFLGLSPTREGGAWMESGFGRGSIIGLLDTGVWPESPSFDDRGMPPVPRKWKGICQEGQ  172

Query  136  GFNSSSCNRKLIGARFFSKGHVAASPDYSPHLVEEYISPRDSHGH  2
             FN+SSCNRKLIGAR+FSKGH  AS   SP  V EY+SPRDSHGH
Sbjct  173  DFNASSCNRKLIGARYFSKGHRVASLMSSPDTVVEYVSPRDSHGH  217



>ref|XP_002526537.1| Cucumisin precursor, putative [Ricinus communis]
 gb|EEF35815.1| Cucumisin precursor, putative [Ricinus communis]
Length=769

 Score =   162 bits (410),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 74/105 (70%), Positives = 88/105 (84%), Gaps = 2/105 (2%)
 Frame = -1

Query  310  YKFLGLSVT--EGAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQ  137
            YKFLGL+ T  + +W KSRFG GTIIG+LDTGVWPESPSF+D GMPP P KW+G+CQEGQ
Sbjct  113  YKFLGLNPTSNQDSWYKSRFGRGTIIGVLDTGVWPESPSFNDQGMPPVPKKWRGICQEGQ  172

Query  136  GFNSSSCNRKLIGARFFSKGHVAASPDYSPHLVEEYISPRDSHGH  2
             F+SS+CNRKLIGARFF+KGH  AS   S ++ +EY+SPRDSHGH
Sbjct  173  DFSSSNCNRKLIGARFFTKGHRVASISLSSNMYQEYVSPRDSHGH  217



>ref|XP_010262465.1| PREDICTED: subtilisin-like protease SDD1 [Nelumbo nucifera]
Length=767

 Score =   162 bits (409),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 75/104 (72%), Positives = 88/104 (85%), Gaps = 1/104 (1%)
 Frame = -1

Query  310  YKFLGLSVTE-GAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQG  134
            YKFLGLS TE G+W++S FG GT+IG+LDTGVWPESPSF+D  MPP P KWKG+CQEG+ 
Sbjct  112  YKFLGLSPTEDGSWLRSGFGRGTVIGVLDTGVWPESPSFNDHLMPPVPKKWKGICQEGEN  171

Query  133  FNSSSCNRKLIGARFFSKGHVAASPDYSPHLVEEYISPRDSHGH  2
            FNSS+CNRKLIGARF++KGH+ +SP   P  V EYISPRDSHGH
Sbjct  172  FNSSNCNRKLIGARFYTKGHMTSSPLPKPTEVTEYISPRDSHGH  215



>ref|XP_011024491.1| PREDICTED: subtilisin-like protease SDD1 [Populus euphratica]
Length=769

 Score =   161 bits (407),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 78/104 (75%), Positives = 84/104 (81%), Gaps = 1/104 (1%)
 Frame = -1

Query  310  YKFLGLSVT-EGAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQG  134
            YKFLGLS T E AW KS FG G IIGLLDTGVWPES SF+D GMPP P KW+G+CQEGQ 
Sbjct  116  YKFLGLSPTRENAWYKSGFGRGVIIGLLDTGVWPESLSFNDQGMPPVPKKWRGICQEGQD  175

Query  133  FNSSSCNRKLIGARFFSKGHVAASPDYSPHLVEEYISPRDSHGH  2
            FNSS+CNRKLIGARFF+KGH  AS   SP  V+EY SPRDSHGH
Sbjct  176  FNSSNCNRKLIGARFFTKGHRIASTSASPENVQEYASPRDSHGH  219



>ref|XP_009370534.1| PREDICTED: subtilisin-like protease SDD1 [Pyrus x bretschneideri]
Length=768

 Score =   159 bits (403),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 76/106 (72%), Positives = 87/106 (82%), Gaps = 5/106 (5%)
 Frame = -1

Query  310  YKFLGLSVT---EGAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEG  140
            YKFLGLS++   EGAW KS FG GTIIG+LDTGVWPESPSF+D GMP  P KW+G+CQEG
Sbjct  115  YKFLGLSLSASREGAWYKSAFGRGTIIGVLDTGVWPESPSFNDRGMPAVPKKWRGICQEG  174

Query  139  QGFNSSSCNRKLIGARFFSKGHVAASPDYSPHLVEEYISPRDSHGH  2
            Q FNSS+CNRKLIGARFF+KGH  A+  Y+P    EY+SPRDSHGH
Sbjct  175  QNFNSSNCNRKLIGARFFTKGHRVAT--YTPDGGREYVSPRDSHGH  218



>ref|XP_002301847.2| STOMATAL DENSITY AND DISTRIBUTION family protein [Populus trichocarpa]
 gb|EEE81120.2| STOMATAL DENSITY AND DISTRIBUTION family protein [Populus trichocarpa]
Length=769

 Score =   159 bits (403),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 76/104 (73%), Positives = 84/104 (81%), Gaps = 1/104 (1%)
 Frame = -1

Query  310  YKFLGLSVT-EGAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQG  134
            YKFLGL  T E AW KS FG G IIG+LDTGVWPESPSF+D GMPP P KW+G+CQ+GQ 
Sbjct  116  YKFLGLGPTREDAWYKSGFGRGVIIGVLDTGVWPESPSFNDQGMPPVPKKWRGICQKGQD  175

Query  133  FNSSSCNRKLIGARFFSKGHVAASPDYSPHLVEEYISPRDSHGH  2
            FNSS+CNRKLIGARFF+KGH  AS   SP  V+EY SPRDSHGH
Sbjct  176  FNSSNCNRKLIGARFFTKGHRMASTSASPENVQEYASPRDSHGH  219



>ref|XP_007201801.1| hypothetical protein PRUPE_ppa001773mg [Prunus persica]
 gb|EMJ03000.1| hypothetical protein PRUPE_ppa001773mg [Prunus persica]
Length=767

 Score =   159 bits (402),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 75/106 (71%), Positives = 88/106 (83%), Gaps = 3/106 (3%)
 Frame = -1

Query  310  YKFLGLSV--TEGAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQ  137
            YKFLGL+   ++GAW KS FG GTIIG+LDTGVWPESPSF+D GMPP P KW+G+CQEGQ
Sbjct  112  YKFLGLNTASSDGAWHKSAFGRGTIIGVLDTGVWPESPSFNDRGMPPVPRKWRGICQEGQ  171

Query  136  GFNSSSCNRKLIGARFFSKGH-VAASPDYSPHLVEEYISPRDSHGH  2
             FNSS+CN+KLIGARFF++GH VA+   YSP    EY+SPRDSHGH
Sbjct  172  NFNSSNCNKKLIGARFFTEGHRVASVSSYSPDAGHEYVSPRDSHGH  217



>ref|XP_008382710.1| PREDICTED: subtilisin-like protease SDD1 [Malus domestica]
Length=766

 Score =   158 bits (400),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 75/104 (72%), Positives = 86/104 (83%), Gaps = 3/104 (3%)
 Frame = -1

Query  310  YKFLGL-SVTEGAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQG  134
            YKFLGL + +EGAW KS FG GTIIG+LDTGVWPESPSFDD GMP  P KW+G+CQEGQ 
Sbjct  115  YKFLGLGASSEGAWYKSAFGRGTIIGVLDTGVWPESPSFDDRGMPAVPKKWRGICQEGQN  174

Query  133  FNSSSCNRKLIGARFFSKGHVAASPDYSPHLVEEYISPRDSHGH  2
            FN+S+CNRKLIGARFF++GH  AS  Y+P    EY+SPRDSHGH
Sbjct  175  FNTSNCNRKLIGARFFTEGHRVAS--YTPDGGREYVSPRDSHGH  216



>ref|XP_008235585.1| PREDICTED: subtilisin-like protease SDD1 [Prunus mume]
Length=767

 Score =   158 bits (400),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 75/106 (71%), Positives = 87/106 (82%), Gaps = 3/106 (3%)
 Frame = -1

Query  310  YKFLGLSV--TEGAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQ  137
            YKFLGL+   + GAW KS FG GTIIG+LDTGVWPESPSF+D GMPP P KW+G+CQEGQ
Sbjct  112  YKFLGLNTASSNGAWHKSAFGRGTIIGVLDTGVWPESPSFNDRGMPPVPRKWRGICQEGQ  171

Query  136  GFNSSSCNRKLIGARFFSKGH-VAASPDYSPHLVEEYISPRDSHGH  2
             FNSS+CN+KLIGARFF++GH VA+   YSP    EY+SPRDSHGH
Sbjct  172  NFNSSNCNKKLIGARFFTEGHRVASVSSYSPDAGHEYVSPRDSHGH  217



>ref|XP_007050153.1| Subtilase family protein isoform 1 [Theobroma cacao]
 ref|XP_007050154.1| Subtilase family protein isoform 1 [Theobroma cacao]
 gb|EOX94310.1| Subtilase family protein isoform 1 [Theobroma cacao]
 gb|EOX94311.1| Subtilase family protein isoform 1 [Theobroma cacao]
Length=765

 Score =   158 bits (400),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 73/104 (70%), Positives = 85/104 (82%), Gaps = 1/104 (1%)
 Frame = -1

Query  310  YKFLGLSVT-EGAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQG  134
            YKFLGLS T +GAW KS  G GTIIG+LDTGVWPESPSF+D GMPP P KW+G+CQEGQ 
Sbjct  112  YKFLGLSTTRDGAWFKSGLGRGTIIGVLDTGVWPESPSFNDQGMPPVPKKWRGICQEGQS  171

Query  133  FNSSSCNRKLIGARFFSKGHVAASPDYSPHLVEEYISPRDSHGH  2
            FN+ +CNRKLIGARFF KGH  +S   S ++++EYISPRDS GH
Sbjct  172  FNALNCNRKLIGARFFIKGHHVSSVSRSANMIQEYISPRDSSGH  215



>ref|XP_008356216.1| PREDICTED: subtilisin-like protease SDD1 [Malus domestica]
Length=768

 Score =   157 bits (398),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 75/106 (71%), Positives = 86/106 (81%), Gaps = 5/106 (5%)
 Frame = -1

Query  310  YKFLGLSVT---EGAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEG  140
            YKFLGL ++   EGAW KS FG GTIIG+LDTGVWPESPSF+D GMP  P KW+G+CQEG
Sbjct  115  YKFLGLGLSASREGAWYKSAFGRGTIIGVLDTGVWPESPSFNDRGMPAVPKKWRGICQEG  174

Query  139  QGFNSSSCNRKLIGARFFSKGHVAASPDYSPHLVEEYISPRDSHGH  2
            Q FNSS+CNRKLIGARFF+KGH  A+  Y+P    EY+SPRDSHGH
Sbjct  175  QNFNSSNCNRKLIGARFFTKGHRVAT--YTPDGGREYVSPRDSHGH  218



>gb|KDP26457.1| hypothetical protein JCGZ_17615 [Jatropha curcas]
Length=693

 Score =   154 bits (390),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 73/104 (70%), Positives = 85/104 (82%), Gaps = 2/104 (2%)
 Frame = -1

Query  310  YKFLGLSVT-EGAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQG  134
            YKFLGL+     AW KS+FG G IIG+LDTGVWPESPSF+D GMPP P KW+GVCQEGQ 
Sbjct  39   YKFLGLNPNGADAWYKSKFGRGMIIGVLDTGVWPESPSFNDQGMPPVPKKWRGVCQEGQD  98

Query  133  FNSSSCNRKLIGARFFSKGHVAASPDYSPHLVEEYISPRDSHGH  2
            FNSS+CN+KLIGARFF+KGH  AS   S ++++EY SPRDSHGH
Sbjct  99   FNSSNCNKKLIGARFFTKGHRVASAS-SSNIIQEYASPRDSHGH  141



>ref|XP_010652423.1| PREDICTED: subtilisin-like protease SDD1 [Vitis vinifera]
Length=766

 Score =   155 bits (391),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 75/104 (72%), Positives = 82/104 (79%), Gaps = 1/104 (1%)
 Frame = -1

Query  310  YKFLGLS-VTEGAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQG  134
            YKFLGLS  + G W +S FG GTI+G+LDTGVWPESPSF D GMPP P KW+GVCQEGQ 
Sbjct  112  YKFLGLSPASRGGWFQSGFGHGTIVGVLDTGVWPESPSFSDHGMPPVPKKWRGVCQEGQD  171

Query  133  FNSSSCNRKLIGARFFSKGHVAASPDYSPHLVEEYISPRDSHGH  2
            FNSS+CNRKLIGARFFSKGH  AS   S   V EY+S RDSHGH
Sbjct  172  FNSSNCNRKLIGARFFSKGHRVASISPSSDTVVEYVSARDSHGH  215



>ref|XP_010475053.1| PREDICTED: subtilisin-like protease SDD1 [Camelina sativa]
Length=778

 Score =   155 bits (392),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 75/106 (71%), Positives = 84/106 (79%), Gaps = 3/106 (3%)
 Frame = -1

Query  310  YKFLGLSV--TEGAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQ  137
            YKFLGL      G W KSRFG GTI+G+LDTGVWPESPSFDD GMP  P KWKG+CQEG+
Sbjct  121  YKFLGLDGLGNSGVWSKSRFGQGTIVGVLDTGVWPESPSFDDTGMPSVPRKWKGICQEGE  180

Query  136  GFNSSSCNRKLIGARFFSKGH-VAASPDYSPHLVEEYISPRDSHGH  2
             F+SSSCNRKLIGARFF +GH VA SP+ SP++  EYIS RDS GH
Sbjct  181  NFSSSSCNRKLIGARFFIRGHRVANSPEESPNMPREYISARDSTGH  226



>ref|XP_010483084.1| PREDICTED: subtilisin-like protease SDD1 [Camelina sativa]
Length=775

 Score =   155 bits (391),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 75/106 (71%), Positives = 84/106 (79%), Gaps = 3/106 (3%)
 Frame = -1

Query  310  YKFLGLSV--TEGAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQ  137
            YKFLGL      G W KSRFG GTI+G+LDTGVWPESPSFDD GMP  P KWKG+CQEG+
Sbjct  118  YKFLGLDGLGNSGVWSKSRFGQGTIVGVLDTGVWPESPSFDDTGMPSVPRKWKGICQEGE  177

Query  136  GFNSSSCNRKLIGARFFSKGH-VAASPDYSPHLVEEYISPRDSHGH  2
             F+SSSCNRKLIGARFF +GH VA SP+ SP++  EYIS RDS GH
Sbjct  178  NFSSSSCNRKLIGARFFIRGHRVANSPEESPNMPREYISARDSTGH  223



>ref|XP_010457444.1| PREDICTED: subtilisin-like protease SDD1 [Camelina sativa]
Length=776

 Score =   155 bits (391),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 75/106 (71%), Positives = 84/106 (79%), Gaps = 3/106 (3%)
 Frame = -1

Query  310  YKFLGLSV--TEGAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQ  137
            YKFLGL      G W KSRFG GTI+G+LDTGVWPESPSFDD GMP  P KWKG+CQEG+
Sbjct  119  YKFLGLDGIGNSGVWSKSRFGQGTIVGVLDTGVWPESPSFDDTGMPSVPRKWKGICQEGE  178

Query  136  GFNSSSCNRKLIGARFFSKGH-VAASPDYSPHLVEEYISPRDSHGH  2
             F+SSSCNRKLIGARFF +GH VA SP+ SP++  EYIS RDS GH
Sbjct  179  NFSSSSCNRKLIGARFFIRGHRVANSPEESPNMPREYISARDSTGH  224



>ref|NP_563701.1| subtilisin-like protease SDD1 [Arabidopsis thaliana]
 sp|O64495.1|SDD1_ARATH RecName: Full=Subtilisin-like protease SDD1; AltName: Full=Cucumisin-like 
serine protease SDD1; AltName: Full=Protein STOMATAL 
DENSITY AND DISTRIBUTION 1; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAC16749.1| Strong similarity to protein SBT1 gb|X98929 from Lycopersicum 
esculentum [Arabidopsis thaliana]
 gb|AEE27657.1| Subtilase-like protein [Arabidopsis thaliana]
Length=775

 Score =   154 bits (390),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 76/106 (72%), Positives = 84/106 (79%), Gaps = 3/106 (3%)
 Frame = -1

Query  310  YKFLGLSV--TEGAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQ  137
            YKFLGL      G W KSRFG GTIIG+LDTGVWPESPSFDD GMP  P KWKG+CQEG+
Sbjct  117  YKFLGLDGFGNSGVWSKSRFGQGTIIGVLDTGVWPESPSFDDTGMPSIPRKWKGICQEGE  176

Query  136  GFNSSSCNRKLIGARFFSKGH-VAASPDYSPHLVEEYISPRDSHGH  2
             F+SSSCNRKLIGARFF +GH VA SP+ SP++  EYIS RDS GH
Sbjct  177  SFSSSSCNRKLIGARFFIRGHRVANSPEESPNMPREYISARDSTGH  222



>ref|XP_009335230.1| PREDICTED: subtilisin-like protease SDD1 [Pyrus x bretschneideri]
Length=766

 Score =   154 bits (390),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 73/104 (70%), Positives = 85/104 (82%), Gaps = 3/104 (3%)
 Frame = -1

Query  310  YKFLGL-SVTEGAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQG  134
            YKFLGL + +EGAW KS FG GTIIG+LDTGVWPESPSF+D GMP  P KW+G+CQEGQ 
Sbjct  115  YKFLGLGASSEGAWYKSAFGRGTIIGVLDTGVWPESPSFNDRGMPAVPKKWRGICQEGQN  174

Query  133  FNSSSCNRKLIGARFFSKGHVAASPDYSPHLVEEYISPRDSHGH  2
            FN+S+CNRKLIGARFF++GH  A   Y+P    EY+SPRDSHGH
Sbjct  175  FNTSNCNRKLIGARFFTEGHRVAL--YTPDGGREYVSPRDSHGH  216



>ref|XP_006304967.1| hypothetical protein CARUB_v10012040mg [Capsella rubella]
 gb|EOA37865.1| hypothetical protein CARUB_v10012040mg [Capsella rubella]
Length=779

 Score =   154 bits (390),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 75/106 (71%), Positives = 84/106 (79%), Gaps = 3/106 (3%)
 Frame = -1

Query  310  YKFLGLSV--TEGAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQ  137
            YKFLGL      G W KSRFG GTI+G+LDTGVWPESPSFDD GMP  P KWKG+CQEG+
Sbjct  120  YKFLGLDGLGNSGVWSKSRFGQGTIVGVLDTGVWPESPSFDDTGMPSVPRKWKGICQEGE  179

Query  136  GFNSSSCNRKLIGARFFSKGH-VAASPDYSPHLVEEYISPRDSHGH  2
             F+SSSCNRKLIGARFF +GH VA SP+ SP++  EYIS RDS GH
Sbjct  180  NFSSSSCNRKLIGARFFIRGHRVANSPEDSPNMPREYISARDSTGH  225



>ref|XP_006418166.1| hypothetical protein EUTSA_v10006861mg [Eutrema salsugineum]
 gb|ESQ36519.1| hypothetical protein EUTSA_v10006861mg [Eutrema salsugineum]
Length=778

 Score =   153 bits (387),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 75/106 (71%), Positives = 83/106 (78%), Gaps = 3/106 (3%)
 Frame = -1

Query  310  YKFLGLSV--TEGAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQ  137
            YKFLGL      G W KSRFG GTIIG+LDTGVWPESPSFDD GMP  P KW+G+CQEG+
Sbjct  120  YKFLGLDGLGNSGVWSKSRFGQGTIIGVLDTGVWPESPSFDDTGMPSIPRKWRGICQEGE  179

Query  136  GFNSSSCNRKLIGARFFSKGH-VAASPDYSPHLVEEYISPRDSHGH  2
             F+SSSCNRKLIGARFF +GH VA SP  SP++  EYIS RDS GH
Sbjct  180  SFSSSSCNRKLIGARFFIRGHRVANSPQESPNMPREYISARDSTGH  225



>ref|XP_009790649.1| PREDICTED: subtilisin-like protease SDD1 isoform X2 [Nicotiana 
sylvestris]
Length=715

 Score =   152 bits (384),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 76/105 (72%), Positives = 84/105 (80%), Gaps = 2/105 (2%)
 Frame = -1

Query  310  YKFLGLSVT-EGAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQG  134
            YKFLGLS T EG W+KS FG G+IIG+LDTGVWPESPSF D GM P P KWKG CQEGQ 
Sbjct  58   YKFLGLSPTKEGTWLKSGFGRGSIIGVLDTGVWPESPSFSDHGMLPIPKKWKGTCQEGQD  117

Query  133  FNSSSCNRKLIGARFFSKGHVAASPDYSP-HLVEEYISPRDSHGH  2
            FNSSSCNRKLIGARFF  GH+ AS   +P  L++EY+SPRDS GH
Sbjct  118  FNSSSCNRKLIGARFFHIGHMVASKASTPLDLMDEYLSPRDSQGH  162



>gb|KFK42754.1| hypothetical protein AALP_AA1G035200 [Arabis alpina]
Length=781

 Score =   153 bits (386),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 76/108 (70%), Positives = 83/108 (77%), Gaps = 5/108 (5%)
 Frame = -1

Query  310  YKFLGLSV----TEGAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQE  143
            YKFLGL        G W KSRFG GTIIG+LDTGVWPESPSFDD GMP  P KWKG+CQE
Sbjct  121  YKFLGLDDDGVGNSGLWSKSRFGQGTIIGVLDTGVWPESPSFDDTGMPSVPRKWKGICQE  180

Query  142  GQGFNSSSCNRKLIGARFFSKGH-VAASPDYSPHLVEEYISPRDSHGH  2
            G+ F+SSSCNRKLIGARFF +GH VA SP  SP++  EYIS RDS GH
Sbjct  181  GENFSSSSCNRKLIGARFFIRGHRVANSPLESPNMPREYISARDSTGH  228



>ref|XP_002892197.1| hypothetical protein ARALYDRAFT_470387 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68456.1| hypothetical protein ARALYDRAFT_470387 [Arabidopsis lyrata subsp. 
lyrata]
Length=778

 Score =   153 bits (386),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 75/106 (71%), Positives = 83/106 (78%), Gaps = 3/106 (3%)
 Frame = -1

Query  310  YKFLGLSV--TEGAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQ  137
            YKFLGL        W KSRFG GTIIG+LDTGVWPESPSFDD GMP  P KWKG+CQEG+
Sbjct  120  YKFLGLDGFGNSSVWSKSRFGQGTIIGVLDTGVWPESPSFDDTGMPSIPRKWKGICQEGE  179

Query  136  GFNSSSCNRKLIGARFFSKGH-VAASPDYSPHLVEEYISPRDSHGH  2
             F+SSSCNRKLIGARFF +GH VA SP+ SP++  EYIS RDS GH
Sbjct  180  NFSSSSCNRKLIGARFFIRGHRVANSPEESPNMPREYISARDSTGH  225



>ref|XP_009790650.1| PREDICTED: subtilisin-like protease SDD1 isoform X3 [Nicotiana 
sylvestris]
Length=690

 Score =   152 bits (383),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 76/105 (72%), Positives = 84/105 (80%), Gaps = 2/105 (2%)
 Frame = -1

Query  310  YKFLGLSVT-EGAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQG  134
            YKFLGLS T EG W+KS FG G+IIG+LDTGVWPESPSF D GM P P KWKG CQEGQ 
Sbjct  33   YKFLGLSPTKEGTWLKSGFGRGSIIGVLDTGVWPESPSFSDHGMLPIPKKWKGTCQEGQD  92

Query  133  FNSSSCNRKLIGARFFSKGHVAASPDYSP-HLVEEYISPRDSHGH  2
            FNSSSCNRKLIGARFF  GH+ AS   +P  L++EY+SPRDS GH
Sbjct  93   FNSSSCNRKLIGARFFHIGHMVASKASTPLDLMDEYLSPRDSQGH  137



>emb|CBI37197.3| unnamed protein product [Vitis vinifera]
Length=1318

 Score =   154 bits (389),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 75/104 (72%), Positives = 82/104 (79%), Gaps = 1/104 (1%)
 Frame = -1

Query  310  YKFLGLS-VTEGAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQG  134
            YKFLGLS  + G W +S FG GTI+G+LDTGVWPESPSF D GMPP P KW+GVCQEGQ 
Sbjct  684  YKFLGLSPASRGGWFQSGFGHGTIVGVLDTGVWPESPSFSDHGMPPVPKKWRGVCQEGQD  743

Query  133  FNSSSCNRKLIGARFFSKGHVAASPDYSPHLVEEYISPRDSHGH  2
            FNSS+CNRKLIGARFFSKGH  AS   S   V EY+S RDSHGH
Sbjct  744  FNSSNCNRKLIGARFFSKGHRVASISPSSDTVVEYVSARDSHGH  787



>ref|XP_009790648.1| PREDICTED: subtilisin-like protease SDD1 isoform X1 [Nicotiana 
sylvestris]
Length=770

 Score =   152 bits (385),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 76/105 (72%), Positives = 84/105 (80%), Gaps = 2/105 (2%)
 Frame = -1

Query  310  YKFLGLSVT-EGAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQG  134
            YKFLGLS T EG W+KS FG G+IIG+LDTGVWPESPSF D GM P P KWKG CQEGQ 
Sbjct  113  YKFLGLSPTKEGTWLKSGFGRGSIIGVLDTGVWPESPSFSDHGMLPIPKKWKGTCQEGQD  172

Query  133  FNSSSCNRKLIGARFFSKGHVAASPDYSP-HLVEEYISPRDSHGH  2
            FNSSSCNRKLIGARFF  GH+ AS   +P  L++EY+SPRDS GH
Sbjct  173  FNSSSCNRKLIGARFFHIGHMVASKASTPLDLMDEYLSPRDSQGH  217



>ref|XP_010684867.1| PREDICTED: subtilisin-like protease SDD1 [Beta vulgaris subsp. 
vulgaris]
Length=773

 Score =   152 bits (385),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 76/105 (72%), Positives = 82/105 (78%), Gaps = 2/105 (2%)
 Frame = -1

Query  310  YKFLGLSVT-EGAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQG  134
            YKFLGL     GAW ++ FG GTIIG+LDTGVWPESPSF D GMP  P KWKGVCQEGQ 
Sbjct  118  YKFLGLDAPGVGAWSRTGFGRGTIIGVLDTGVWPESPSFSDQGMPAPPRKWKGVCQEGQN  177

Query  133  FNSSSCNRKLIGARFFSKG-HVAASPDYSPHLVEEYISPRDSHGH  2
            FN++SCNRKLIGARFF KG HVA SP  SP L  EY+SPRDS GH
Sbjct  178  FNATSCNRKLIGARFFIKGHHVANSPSQSPDLNPEYVSPRDSSGH  222



>ref|XP_009590434.1| PREDICTED: subtilisin-like protease SDD1 [Nicotiana tomentosiformis]
Length=770

 Score =   150 bits (380),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 75/105 (71%), Positives = 84/105 (80%), Gaps = 2/105 (2%)
 Frame = -1

Query  310  YKFLGLSVT-EGAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQG  134
            YKFLGLS + EG W+KS FG G+IIG+LDTG+WPESPSF D GM P P KWKG CQEGQ 
Sbjct  113  YKFLGLSPSREGTWLKSGFGRGSIIGVLDTGIWPESPSFVDRGMLPIPKKWKGTCQEGQD  172

Query  133  FNSSSCNRKLIGARFFSKGHVAASPD-YSPHLVEEYISPRDSHGH  2
            FNSSSCNRKLIGARFF  GH+ AS +  S  L+EEY+SPRDS GH
Sbjct  173  FNSSSCNRKLIGARFFHIGHMVASKETTSLDLMEEYLSPRDSQGH  217



>ref|XP_010091819.1| Subtilisin-like protease SDD1 [Morus notabilis]
 gb|EXB46027.1| Subtilisin-like protease SDD1 [Morus notabilis]
Length=771

 Score =   150 bits (380),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 72/106 (68%), Positives = 83/106 (78%), Gaps = 3/106 (3%)
 Frame = -1

Query  310  YKFLGLSVT-EGAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQG  134
            YKFLGL+ T E +W K++FG G IIG+LDTGVWPES SF D GMP  P +W+G+CQ+GQ 
Sbjct  114  YKFLGLNPTRENSWYKAKFGGGAIIGVLDTGVWPESSSFSDRGMPAVPKRWRGICQQGQD  173

Query  133  FNSSSCNRKLIGARFFSKGHVAA--SPDYSPHLVEEYISPRDSHGH  2
            FNSSSCNRKLIGARFF KGH  A  S   SP  V+EY+SPRDSHGH
Sbjct  174  FNSSSCNRKLIGARFFIKGHRVASGSASASPESVQEYVSPRDSHGH  219



>ref|XP_008447369.1| PREDICTED: subtilisin-like protease SDD1 [Cucumis melo]
Length=768

 Score =   150 bits (379),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 72/104 (69%), Positives = 82/104 (79%), Gaps = 2/104 (2%)
 Frame = -1

Query  310  YKFLGLSV-TEGAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQG  134
            +KFLGLSV T+G W KS  G G I+GLLDTGVWPESPSF D+ MPP P KW+G CQEGQ 
Sbjct  115  HKFLGLSVGTQGVWQKSSMGQGAIVGLLDTGVWPESPSFSDSKMPPIPQKWRGACQEGQD  174

Query  133  FNSSSCNRKLIGARFFSKGHVAASPDYSPHLVEEYISPRDSHGH  2
            FNSS+CNRKLIGA+FF KGH  AS      +V+EY+SPRDSHGH
Sbjct  175  FNSSNCNRKLIGAKFFIKGHHVAS-SLPSDVVQEYVSPRDSHGH  217



>ref|XP_004242535.1| PREDICTED: subtilisin-like protease SDD1 [Solanum lycopersicum]
Length=771

 Score =   149 bits (377),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 74/105 (70%), Positives = 82/105 (78%), Gaps = 2/105 (2%)
 Frame = -1

Query  310  YKFLGLSVT-EGAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQG  134
            YKFLGLS T EG W+KS FG G IIG+LDTG+WPESPSF D GM P P KWKG+CQEG+ 
Sbjct  114  YKFLGLSPTKEGTWLKSGFGRGAIIGVLDTGIWPESPSFVDHGMSPIPKKWKGICQEGKN  173

Query  133  FNSSSCNRKLIGARFFSKGHVAASP-DYSPHLVEEYISPRDSHGH  2
            FNSSSCNRKLIGARFF  GH+ AS    S   VE+Y+SPRDS GH
Sbjct  174  FNSSSCNRKLIGARFFQIGHMMASKISKSIDFVEDYVSPRDSEGH  218



>gb|ABD64827.1| putative subtilisin serine protease of stomatal density and distribution 
[Isatis tinctoria]
Length=778

 Score =   149 bits (377),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 75/106 (71%), Positives = 82/106 (77%), Gaps = 3/106 (3%)
 Frame = -1

Query  310  YKFLGLSV--TEGAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQ  137
            YKFLGL      G W +SRFG GTIIG+LDTGVWPESPSF D GMP  P KWKGVCQEG+
Sbjct  120  YKFLGLDGLGNSGVWSQSRFGQGTIIGVLDTGVWPESPSFGDTGMPSIPRKWKGVCQEGE  179

Query  136  GFNSSSCNRKLIGARFFSKGH-VAASPDYSPHLVEEYISPRDSHGH  2
             F+SSSCNRKLIGARFF +GH VA SP  SP++  EYIS RDS GH
Sbjct  180  NFSSSSCNRKLIGARFFIRGHRVANSPLESPNMPREYISARDSTGH  225



>ref|XP_004289987.1| PREDICTED: subtilisin-like protease SDD1-like [Fragaria vesca 
subsp. vesca]
Length=770

 Score =   149 bits (376),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 71/105 (68%), Positives = 82/105 (78%), Gaps = 2/105 (2%)
 Frame = -1

Query  310  YKFLGL--SVTEGAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQ  137
            YKFLGL  +  + AW KS FG GTIIG+LDTGVWPESPSF+D GMP  P KW+G+CQ G 
Sbjct  114  YKFLGLNPASKQSAWHKSSFGRGTIIGVLDTGVWPESPSFNDHGMPRVPKKWRGICQHGV  173

Query  136  GFNSSSCNRKLIGARFFSKGHVAASPDYSPHLVEEYISPRDSHGH  2
             FNSS+CNRKLIGARFF++GH  AS   SP  V+EY SPRD+HGH
Sbjct  174  DFNSSNCNRKLIGARFFTRGHRVASMPNSPDGVQEYASPRDTHGH  218



>ref|XP_004493834.1| PREDICTED: subtilisin-like protease SDD1-like [Cicer arietinum]
Length=763

 Score =   149 bits (375),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 71/104 (68%), Positives = 81/104 (78%), Gaps = 5/104 (5%)
 Frame = -1

Query  310  YKFLGLS-VTEGAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQG  134
            YKFLGL+   E +W +S FG GTIIG+LDTGVWPESPSF+D  MPP P KWKG+CQ GQ 
Sbjct  112  YKFLGLNPARENSWYQSGFGRGTIIGVLDTGVWPESPSFNDHDMPPVPKKWKGICQSGQA  171

Query  133  FNSSSCNRKLIGARFFSKGHVAASPDYSPHLVEEYISPRDSHGH  2
            FNSS+CNRKLIGAR+F+KGH A SP   P    EY+SPRDS GH
Sbjct  172  FNSSNCNRKLIGARYFTKGHFAVSPTRIP----EYLSPRDSSGH  211



>ref|XP_006352831.1| PREDICTED: subtilisin-like protease SDD1-like [Solanum tuberosum]
Length=771

 Score =   149 bits (375),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 73/105 (70%), Positives = 82/105 (78%), Gaps = 2/105 (2%)
 Frame = -1

Query  310  YKFLGLSVT-EGAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQG  134
            YKFLGLS T EG W+KS FG G IIG+LDTG+WPESPSF D GM P P KWKG+CQEG+ 
Sbjct  114  YKFLGLSPTKEGTWLKSGFGRGAIIGVLDTGIWPESPSFVDHGMSPIPKKWKGICQEGKN  173

Query  133  FNSSSCNRKLIGARFFSKGHVAAS-PDYSPHLVEEYISPRDSHGH  2
            FNSSSCNRKLIGARFF  GH+ AS    S   +E+Y+SPRDS GH
Sbjct  174  FNSSSCNRKLIGARFFQIGHMMASKTSKSIDFMEDYVSPRDSQGH  218



>gb|AES81608.2| subtilisin-like serine protease [Medicago truncatula]
Length=874

 Score =   147 bits (372),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 70/104 (67%), Positives = 81/104 (78%), Gaps = 5/104 (5%)
 Frame = -1

Query  310  YKFLGLS-VTEGAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQG  134
            YKFLGL+   +  W +S FG GTIIG+LDTGVWPESPSF+D  MPP P KWKG+CQ GQ 
Sbjct  112  YKFLGLNPAKQNGWYQSGFGRGTIIGVLDTGVWPESPSFNDHDMPPVPKKWKGICQTGQA  171

Query  133  FNSSSCNRKLIGARFFSKGHVAASPDYSPHLVEEYISPRDSHGH  2
            FNSS+CNRKLIGAR+F+KGH+A SP   P    EY+SPRDS GH
Sbjct  172  FNSSNCNRKLIGARYFTKGHLAISPSRIP----EYLSPRDSSGH  211



>ref|XP_003625390.1| Subtilisin-like protease [Medicago truncatula]
Length=932

 Score =   148 bits (373),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 70/104 (67%), Positives = 81/104 (78%), Gaps = 5/104 (5%)
 Frame = -1

Query  310  YKFLGLS-VTEGAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQG  134
            YKFLGL+   +  W +S FG GTIIG+LDTGVWPESPSF+D  MPP P KWKG+CQ GQ 
Sbjct  112  YKFLGLNPAKQNGWYQSGFGRGTIIGVLDTGVWPESPSFNDHDMPPVPKKWKGICQTGQA  171

Query  133  FNSSSCNRKLIGARFFSKGHVAASPDYSPHLVEEYISPRDSHGH  2
            FNSS+CNRKLIGAR+F+KGH+A SP   P    EY+SPRDS GH
Sbjct  172  FNSSNCNRKLIGARYFTKGHLAISPSRIP----EYLSPRDSSGH  211



>gb|KHN10783.1| Subtilisin-like protease SDD1 [Glycine soja]
Length=693

 Score =   145 bits (367),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 69/104 (66%), Positives = 81/104 (78%), Gaps = 5/104 (5%)
 Frame = -1

Query  310  YKFLGLS-VTEGAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQG  134
            YKFLGL+   E  W +S FG GTIIG+LDTGVWPESPSF+D GMPP P KWKG+CQ G+ 
Sbjct  39   YKFLGLNPARENGWYQSGFGRGTIIGVLDTGVWPESPSFNDQGMPPIPQKWKGICQAGKA  98

Query  133  FNSSSCNRKLIGARFFSKGHVAASPDYSPHLVEEYISPRDSHGH  2
            FNS++CNRKLIGAR+F+KGH + SP   P    EY+SPRDS GH
Sbjct  99   FNSTNCNRKLIGARYFTKGHFSVSPFRDP----EYLSPRDSSGH  138



>emb|CDP03800.1| unnamed protein product [Coffea canephora]
Length=773

 Score =   146 bits (369),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 70/108 (65%), Positives = 82/108 (76%), Gaps = 5/108 (5%)
 Frame = -1

Query  310  YKFLGLSVTE-----GAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQ  146
            YKFLGL+ T      GA +KS FG G IIG+LDTG+WPESPSF D GMPP P KW+G+CQ
Sbjct  113  YKFLGLNPTANGNAIGAILKSGFGRGAIIGVLDTGIWPESPSFSDDGMPPVPKKWRGICQ  172

Query  145  EGQGFNSSSCNRKLIGARFFSKGHVAASPDYSPHLVEEYISPRDSHGH  2
            +G+ FNSSSCNRKLIGARFF+KG+ AAS   S  +  EY+SPRD  GH
Sbjct  173  QGEDFNSSSCNRKLIGARFFTKGYRAASKSLSTDVAVEYVSPRDGQGH  220



>ref|XP_003520616.1| PREDICTED: subtilisin-like protease SDD1-like [Glycine max]
Length=768

 Score =   145 bits (367),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 69/104 (66%), Positives = 81/104 (78%), Gaps = 5/104 (5%)
 Frame = -1

Query  310  YKFLGLS-VTEGAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQG  134
            YKFLGL+   E  W +S FG GTIIG+LDTGVWPESPSF+D GMPP P KWKG+CQ G+ 
Sbjct  114  YKFLGLNPARENGWYQSGFGRGTIIGVLDTGVWPESPSFNDQGMPPIPQKWKGICQAGKA  173

Query  133  FNSSSCNRKLIGARFFSKGHVAASPDYSPHLVEEYISPRDSHGH  2
            FNS++CNRKLIGAR+F+KGH + SP   P    EY+SPRDS GH
Sbjct  174  FNSTNCNRKLIGARYFTKGHFSVSPFRDP----EYLSPRDSSGH  213



>ref|XP_009391664.1| PREDICTED: subtilisin-like protease SDD1 [Musa acuminata subsp. 
malaccensis]
Length=772

 Score =   145 bits (367),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 69/105 (66%), Positives = 83/105 (79%), Gaps = 2/105 (2%)
 Frame = -1

Query  310  YKFLGLSVTEG-AWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQG  134
            Y FLGL+   G AW +SRFG GTIIG+LDTGVWPESPSF D  MPP P +W+GVCQEG+ 
Sbjct  117  YTFLGLNFAPGGAWSRSRFGQGTIIGVLDTGVWPESPSFRDDRMPPVPTRWRGVCQEGEH  176

Query  133  FNSSSCNRKLIGARFFSKGHVAASPDYSPHL-VEEYISPRDSHGH  2
            FNSS+CNRKLIGARF++KGH    P+ S  + + EY+SPRD+HGH
Sbjct  177  FNSSNCNRKLIGARFYAKGHRINYPEKSSSVSLLEYVSPRDAHGH  221



>emb|CDY18206.1| BnaC05g02290D [Brassica napus]
Length=777

 Score =   145 bits (366),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 73/106 (69%), Positives = 81/106 (76%), Gaps = 3/106 (3%)
 Frame = -1

Query  310  YKFLGLSVT--EGAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQ  137
            YKFLGL+       W KSR G GTIIG+LDTGVWPESPSFDD GMP  P KWKGVCQEG+
Sbjct  117  YKFLGLNGPGPSSVWSKSRSGQGTIIGVLDTGVWPESPSFDDTGMPSVPSKWKGVCQEGE  176

Query  136  GFNSSSCNRKLIGARFFSKGH-VAASPDYSPHLVEEYISPRDSHGH  2
             F SS+CN+KLIGARFF +GH VA SP  SP++  EYIS RDS GH
Sbjct  177  SFTSSNCNKKLIGARFFIRGHRVANSPLDSPNMPREYISARDSTGH  222



>emb|CDX89843.1| BnaA10g02390D [Brassica napus]
Length=778

 Score =   145 bits (365),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 73/106 (69%), Positives = 81/106 (76%), Gaps = 3/106 (3%)
 Frame = -1

Query  310  YKFLGLSVT--EGAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQ  137
            YKFLGL+       W KSR G GTIIG+LDTGVWPESPSFDD GMP  P KWKGVCQEG+
Sbjct  118  YKFLGLNGPGPSSVWSKSRSGQGTIIGVLDTGVWPESPSFDDTGMPSIPSKWKGVCQEGE  177

Query  136  GFNSSSCNRKLIGARFFSKGH-VAASPDYSPHLVEEYISPRDSHGH  2
             F SS+CN+KLIGARFF +GH VA SP  SP++  EYIS RDS GH
Sbjct  178  SFTSSNCNKKLIGARFFIRGHRVANSPLDSPNMPREYISARDSTGH  223



>ref|XP_010933213.1| PREDICTED: subtilisin-like protease SDD1 [Elaeis guineensis]
Length=776

 Score =   145 bits (365),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 70/106 (66%), Positives = 83/106 (78%), Gaps = 4/106 (4%)
 Frame = -1

Query  310  YKFLGLSVTEG-AWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQG  134
            YKFLGL+   G AW +S FG GTIIG+LDTGVWPESPSF D  MPP P +W+G CQEG+ 
Sbjct  122  YKFLGLNFAPGGAWTRSGFGMGTIIGVLDTGVWPESPSFSDQRMPPVPPRWRGACQEGES  181

Query  133  FNSSSCNRKLIGARFFSKGHVAASPD--YSPHLVEEYISPRDSHGH  2
            FNSS+CNRKLIGARF++KGH A  P+   S  L+ EY+SPRD+HGH
Sbjct  182  FNSSNCNRKLIGARFYTKGHRANMPEKPASASLL-EYVSPRDAHGH  226



>ref|XP_004985741.1| PREDICTED: subtilisin-like protease SDD1-like [Setaria italica]
Length=778

 Score =   144 bits (364),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 69/106 (65%), Positives = 82/106 (77%), Gaps = 3/106 (3%)
 Frame = -1

Query  310  YKFLGLSVT-EGAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQG  134
            Y+FLGL+    GAW +S +G GTI+G+LDTGVWPESPSFDD GMPPAP +W GVCQ G+ 
Sbjct  120  YRFLGLNFCPAGAWARSGYGRGTIVGVLDTGVWPESPSFDDRGMPPAPVRWTGVCQGGEH  179

Query  133  FNSSSCNRKLIGARFFSKGHVAASPDYSPHLVE--EYISPRDSHGH  2
            FN+S+CNRKLIGARF+SKGH A  P      V   EY+SPRD+HGH
Sbjct  180  FNTSNCNRKLIGARFYSKGHRANYPTNPSEAVSLLEYVSPRDAHGH  225



>ref|XP_007162604.1| hypothetical protein PHAVU_001G165300g, partial [Phaseolus vulgaris]
 gb|ESW34598.1| hypothetical protein PHAVU_001G165300g, partial [Phaseolus vulgaris]
Length=1214

 Score =   145 bits (365),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 70/104 (67%), Positives = 81/104 (78%), Gaps = 5/104 (5%)
 Frame = -1

Query  310  YKFLGLS-VTEGAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQG  134
            YKFLGL+   E  W +S FG GTIIG+LDTGVWPESPSF+D GMPP P KWKG+CQ G+ 
Sbjct  581  YKFLGLNPARENGWYQSGFGRGTIIGVLDTGVWPESPSFNDQGMPPVPKKWKGICQAGKA  640

Query  133  FNSSSCNRKLIGARFFSKGHVAASPDYSPHLVEEYISPRDSHGH  2
            FNSS+CNRKLIGAR+F+KGH + SP   P    EY+SPRDS GH
Sbjct  641  FNSSNCNRKLIGARYFTKGHSSVSPFRIP----EYLSPRDSSGH  680



>ref|XP_008810058.1| PREDICTED: subtilisin-like protease SDD1 [Phoenix dactylifera]
Length=771

 Score =   143 bits (361),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 69/105 (66%), Positives = 82/105 (78%), Gaps = 2/105 (2%)
 Frame = -1

Query  310  YKFLGLSVTEG-AWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQG  134
            YKFLGL+   G AW +S FG GTIIG+LDTGVWPESPSF D  MPP P +W+G CQEG+ 
Sbjct  117  YKFLGLNFAPGGAWARSGFGKGTIIGVLDTGVWPESPSFGDRRMPPVPRRWRGACQEGES  176

Query  133  FNSSSCNRKLIGARFFSKGHVAASPDY-SPHLVEEYISPRDSHGH  2
            FNSS+CNRKLIGARF+SKGH A  P+  +   + EY+SPRD+HGH
Sbjct  177  FNSSNCNRKLIGARFYSKGHRANMPEKPAAASLLEYMSPRDAHGH  221



>gb|EAZ25541.1| hypothetical protein OsJ_09366 [Oryza sativa Japonica Group]
Length=757

 Score =   143 bits (360),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 67/106 (63%), Positives = 81/106 (76%), Gaps = 3/106 (3%)
 Frame = -1

Query  310  YKFLGLSVT-EGAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQG  134
            Y+FLGL     GAW +S +G GTIIG+LDTGVWPE+PSFDD GMPP P +W+GVCQ G+ 
Sbjct  126  YRFLGLDFCPTGAWARSGYGGGTIIGVLDTGVWPENPSFDDRGMPPVPARWQGVCQGGEH  185

Query  133  FNSSSCNRKLIGARFFSKGHVAASPDYSPHLVE--EYISPRDSHGH  2
            FN+++CNRKLIGARF+SKGH A  P      V   EY+SPRD+HGH
Sbjct  186  FNATNCNRKLIGARFYSKGHRANYPTNPSDAVSLMEYVSPRDAHGH  231



>ref|XP_003554304.1| PREDICTED: subtilisin-like protease SDD1-like [Glycine max]
 gb|KHN02462.1| Subtilisin-like protease SDD1 [Glycine soja]
Length=768

 Score =   143 bits (360),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 69/104 (66%), Positives = 80/104 (77%), Gaps = 5/104 (5%)
 Frame = -1

Query  310  YKFLGLS-VTEGAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQG  134
            YKFLGL+   E  W +S FG  TIIG+LDTGVWPESPSF+D GMPP P +WKGVCQ G+ 
Sbjct  114  YKFLGLNPARENGWYQSGFGRRTIIGVLDTGVWPESPSFNDQGMPPIPKRWKGVCQAGKA  173

Query  133  FNSSSCNRKLIGARFFSKGHVAASPDYSPHLVEEYISPRDSHGH  2
            FNSS+CNRKLIGAR+F+KGH + SP   P    EY+SPRDS GH
Sbjct  174  FNSSNCNRKLIGARYFTKGHFSVSPFRIP----EYLSPRDSSGH  213



>gb|EAY88497.1| hypothetical protein OsI_09968 [Oryza sativa Indica Group]
Length=796

 Score =   143 bits (360),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 67/106 (63%), Positives = 81/106 (76%), Gaps = 3/106 (3%)
 Frame = -1

Query  310  YKFLGLSVT-EGAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQG  134
            Y+FLGL     GAW +S +G GTIIG+LDTGVWPE+PSFDD GMPP P +W+GVCQ G+ 
Sbjct  126  YRFLGLDFCPTGAWARSGYGGGTIIGVLDTGVWPENPSFDDRGMPPVPARWQGVCQGGEH  185

Query  133  FNSSSCNRKLIGARFFSKGHVAASPDYSPHLVE--EYISPRDSHGH  2
            FN+++CNRKLIGARF+SKGH A  P      V   EY+SPRD+HGH
Sbjct  186  FNATNCNRKLIGARFYSKGHRANYPTNPSDAVSLMEYVSPRDAHGH  231



>gb|ABF93923.1| subtilase family protein, putative [Oryza sativa Japonica Group]
Length=783

 Score =   143 bits (360),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 67/106 (63%), Positives = 81/106 (76%), Gaps = 3/106 (3%)
 Frame = -1

Query  310  YKFLGLSVT-EGAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQG  134
            Y+FLGL     GAW +S +G GTIIG+LDTGVWPE+PSFDD GMPP P +W+GVCQ G+ 
Sbjct  126  YRFLGLDFCPTGAWARSGYGGGTIIGVLDTGVWPENPSFDDRGMPPVPARWQGVCQGGEH  185

Query  133  FNSSSCNRKLIGARFFSKGHVAASPDYSPHLVE--EYISPRDSHGH  2
            FN+++CNRKLIGARF+SKGH A  P      V   EY+SPRD+HGH
Sbjct  186  FNATNCNRKLIGARFYSKGHRANYPTNPSDAVSLMEYVSPRDAHGH  231



>ref|XP_002468524.1| hypothetical protein SORBIDRAFT_01g047390 [Sorghum bicolor]
 gb|EER95522.1| hypothetical protein SORBIDRAFT_01g047390 [Sorghum bicolor]
Length=744

 Score =   142 bits (359),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 69/107 (64%), Positives = 85/107 (79%), Gaps = 5/107 (5%)
 Frame = -1

Query  310  YKFLGLSVT-EGAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQG  134
            Y+FLGL+    GAW +S +G GTIIG+LDTGVWPE+PSFDD GMPPAP +W GVCQ G+ 
Sbjct  127  YRFLGLNFCPTGAWARSGYGRGTIIGVLDTGVWPENPSFDDRGMPPAPVRWAGVCQGGEH  186

Query  133  FNSSSCNRKLIGARFFSKGHVA---ASPDYSPHLVEEYISPRDSHGH  2
            FN+S+CNRKLIGARF+SKGH A    +P  +  L+ EY+SPRD+HGH
Sbjct  187  FNASNCNRKLIGARFYSKGHRANYPTNPSEAASLL-EYVSPRDAHGH  232



>ref|XP_004166310.1| PREDICTED: subtilisin-like protease SDD1-like [Cucumis sativus]
Length=768

 Score =   142 bits (359),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 69/104 (66%), Positives = 80/104 (77%), Gaps = 2/104 (2%)
 Frame = -1

Query  310  YKFLGLSV-TEGAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQG  134
            +KFLGLSV T+G   KS  G G I+G+LDTGVWPESPSF D+ MPP P KW+G CQEGQ 
Sbjct  115  HKFLGLSVGTQGLRQKSSMGQGAIVGVLDTGVWPESPSFSDSKMPPVPQKWRGACQEGQD  174

Query  133  FNSSSCNRKLIGARFFSKGHVAASPDYSPHLVEEYISPRDSHGH  2
            FNSS+CNRKLIGA+FF KGH  AS      + +EY+SPRDSHGH
Sbjct  175  FNSSNCNRKLIGAKFFIKGHHVAS-SLPSDVAQEYVSPRDSHGH  217



>gb|KGN58306.1| hypothetical protein Csa_3G610820 [Cucumis sativus]
Length=768

 Score =   142 bits (359),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 69/104 (66%), Positives = 80/104 (77%), Gaps = 2/104 (2%)
 Frame = -1

Query  310  YKFLGLSV-TEGAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQG  134
            +KFLGLSV T+G   KS  G G I+G+LDTGVWPESPSF D+ MPP P KW+G CQEGQ 
Sbjct  115  HKFLGLSVGTQGLRQKSSMGQGAIVGVLDTGVWPESPSFSDSKMPPVPQKWRGACQEGQD  174

Query  133  FNSSSCNRKLIGARFFSKGHVAASPDYSPHLVEEYISPRDSHGH  2
            FNSS+CNRKLIGA+FF KGH  AS      + +EY+SPRDSHGH
Sbjct  175  FNSSNCNRKLIGAKFFIKGHHVAS-SLPSDVAQEYVSPRDSHGH  217



>ref|XP_009119332.1| PREDICTED: subtilisin-like protease SDD1 [Brassica rapa]
Length=778

 Score =   142 bits (359),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 72/106 (68%), Positives = 80/106 (75%), Gaps = 3/106 (3%)
 Frame = -1

Query  310  YKFLGLSVT--EGAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQ  137
            YKFLGL+       W KSR G GTIIG+LDTGVWPESPSFDD GMP  P KWKGVCQEG+
Sbjct  118  YKFLGLNGPGPSSVWSKSRSGQGTIIGVLDTGVWPESPSFDDTGMPSIPSKWKGVCQEGE  177

Query  136  GFNSSSCNRKLIGARFFSKGH-VAASPDYSPHLVEEYISPRDSHGH  2
             F  S+CN+KLIGARFF +GH VA SP  SP++  EYIS RDS GH
Sbjct  178  SFTPSNCNKKLIGARFFIRGHRVANSPLDSPNMPREYISARDSTGH  223



>ref|XP_004152066.1| PREDICTED: subtilisin-like protease SDD1-like [Cucumis sativus]
Length=770

 Score =   142 bits (358),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 69/104 (66%), Positives = 80/104 (77%), Gaps = 2/104 (2%)
 Frame = -1

Query  310  YKFLGLSV-TEGAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQG  134
            +KFLGLSV T+G   KS  G G I+G+LDTGVWPESPSF D+ MPP P KW+G CQEGQ 
Sbjct  117  HKFLGLSVGTQGLRQKSSMGQGAIVGVLDTGVWPESPSFSDSKMPPVPQKWRGACQEGQD  176

Query  133  FNSSSCNRKLIGARFFSKGHVAASPDYSPHLVEEYISPRDSHGH  2
            FNSS+CNRKLIGA+FF KGH  AS      + +EY+SPRDSHGH
Sbjct  177  FNSSNCNRKLIGAKFFIKGHHVAS-SLPSDVAQEYVSPRDSHGH  219



>ref|XP_008650951.1| PREDICTED: subtilisin-like protease SDD1 [Zea mays]
 tpg|DAA43320.1| TPA: putative subtilase family protein [Zea mays]
Length=793

 Score =   141 bits (355),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 69/107 (64%), Positives = 83/107 (78%), Gaps = 5/107 (5%)
 Frame = -1

Query  310  YKFLGLSVT-EGAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQG  134
            Y+FLGL     GAW +S +G GTIIG+LDTGVWPESPSFDD GMPPAP +W G CQ G+ 
Sbjct  127  YRFLGLGFCPTGAWARSGYGRGTIIGVLDTGVWPESPSFDDRGMPPAPVRWSGACQGGEH  186

Query  133  FNSSSCNRKLIGARFFSKGHVA---ASPDYSPHLVEEYISPRDSHGH  2
            FN+S+CNRKLIGARF+SKGH A    +P  +  L+ EY+SPRD+HGH
Sbjct  187  FNASNCNRKLIGARFYSKGHRANYPTNPSEAAALL-EYVSPRDAHGH  232



>ref|XP_010230283.1| PREDICTED: subtilisin-like protease SDD1 [Brachypodium distachyon]
Length=817

 Score =   138 bits (347),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 63/103 (61%), Positives = 80/103 (78%), Gaps = 3/103 (3%)
 Frame = -1

Query  307  KFLGLSVT-EGAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQGF  131
            KFLGL++   GAW ++ +G GTIIG+LDTGVWPESPSFDD GMPP P +W+G C+ G+ F
Sbjct  144  KFLGLNLCPTGAWARTGYGRGTIIGVLDTGVWPESPSFDDRGMPPVPDRWRGACEAGEHF  203

Query  130  NSSSCNRKLIGARFFSKGHVAASPDYSPHLVEEYISPRDSHGH  2
             +S+CNRKL+GARF+SKGH AA  ++      EY SPRD+HGH
Sbjct  204  EASNCNRKLVGARFYSKGHRAA--NHPTDTAREYASPRDAHGH  244



>ref|XP_009343175.1| PREDICTED: subtilisin-like protease [Pyrus x bretschneideri]
Length=761

 Score =   125 bits (313),  Expect = 1e-30, Method: Composition-based stats.
 Identities = 62/105 (59%), Positives = 72/105 (69%), Gaps = 10/105 (10%)
 Frame = -1

Query  307  KFLGLSVTEGAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQGFN  128
            +FLGL+ + GAW  S +G G IIGLLDTGVWPES SF D GM   P KWKG C  G  FN
Sbjct  124  QFLGLTSSSGAWPASNYGEGVIIGLLDTGVWPESDSFKDEGMTEVPSKWKGKCVSGTQFN  183

Query  127  SSSCNRKLIGARFFSKGHVAASPDYSPHLVEEYI---SPRDSHGH  2
            SS CN+KLIGARFF+KG++A +P       EE I   SPRD+ GH
Sbjct  184  SSLCNKKLIGARFFNKGYIANNP-------EETITMNSPRDTDGH  221



>ref|XP_009345959.1| PREDICTED: subtilisin-like protease [Pyrus x bretschneideri]
Length=767

 Score =   124 bits (312),  Expect = 1e-30, Method: Composition-based stats.
 Identities = 62/105 (59%), Positives = 72/105 (69%), Gaps = 10/105 (10%)
 Frame = -1

Query  307  KFLGLSVTEGAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQGFN  128
            +FLGL+ + GAW  S +G G IIGLLDTGVWPES SF D GM   P KWKG C  G  FN
Sbjct  124  QFLGLTSSSGAWPASNYGEGVIIGLLDTGVWPESDSFKDEGMTEVPSKWKGECVSGTQFN  183

Query  127  SSSCNRKLIGARFFSKGHVAASPDYSPHLVEEYI---SPRDSHGH  2
            SS CN+KLIGARFF+KG++A +P       EE I   SPRD+ GH
Sbjct  184  SSLCNKKLIGARFFNKGYIANNP-------EETITMNSPRDTDGH  221



>emb|CDP17236.1| unnamed protein product [Coffea canephora]
Length=761

 Score =   122 bits (307),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 59/103 (57%), Positives = 70/103 (68%), Gaps = 4/103 (4%)
 Frame = -1

Query  310  YKFLGLSVTEGAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQGF  131
            Y FL L+ T G W  S FG   I+G++DTGVWPESPS+ D GM P P KWKG C+ GQ F
Sbjct  122  YNFLSLNPTNGLWPASDFGKDVIVGVIDTGVWPESPSYKDDGMTPIPSKWKGTCEAGQDF  181

Query  130  NSSSCNRKLIGARFFSKGHVAASPDYSPHLVEEYISPRDSHGH  2
            NSS CN KLIGAR+F+KG VAA    +P +V    S RD+ GH
Sbjct  182  NSSLCNLKLIGARYFNKGLVAA----NPKIVISMNSTRDTFGH  220



>ref|XP_010912031.1| PREDICTED: subtilisin-like protease [Elaeis guineensis]
Length=765

 Score =   122 bits (307),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 58/102 (57%), Positives = 73/102 (72%), Gaps = 4/102 (4%)
 Frame = -1

Query  307  KFLGLSVTEGAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQGFN  128
            +FL LS   G W  S FG   IIG++DTG+WPES SF+D GM P P +WKGVC++G  F+
Sbjct  124  EFLHLSPNSGLWPASNFGKDVIIGVVDTGIWPESQSFNDDGMTPVPARWKGVCEQGTDFS  183

Query  127  SSSCNRKLIGARFFSKGHVAASPDYSPHLVEEYISPRDSHGH  2
            SS+CNRKLIGARFF+KG +AA+P+    L     SPRD+ GH
Sbjct  184  SSACNRKLIGARFFNKGLLAANPN----LTIAVNSPRDTDGH  221



>ref|XP_010690381.1| PREDICTED: subtilisin-like protease [Beta vulgaris subsp. vulgaris]
Length=774

 Score =   120 bits (302),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 57/105 (54%), Positives = 72/105 (69%), Gaps = 3/105 (3%)
 Frame = -1

Query  307  KFLGLSVTEGAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQGFN  128
            +FLGL +  G W +S +G   IIG+LDTG+WPE  SF D  + P P +WKGVCQ G+ F+
Sbjct  110  QFLGLRIQRGLWSESDYGSDVIIGVLDTGIWPERRSFSDQNLGPIPKRWKGVCQVGERFS  169

Query  127  SSSCNRKLIGARFFSKGHVAASPDY---SPHLVEEYISPRDSHGH  2
            S +CNRK+IGARFFSKGH AA P     +   V E+ SPRD+ GH
Sbjct  170  SKNCNRKIIGARFFSKGHEAAFPGIGVGNTTSVTEFKSPRDADGH  214



>ref|XP_006854360.1| hypothetical protein AMTR_s00039p00160190 [Amborella trichopoda]
 gb|ERN15827.1| hypothetical protein AMTR_s00039p00160190 [Amborella trichopoda]
Length=794

 Score =   120 bits (302),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 60/112 (54%), Positives = 75/112 (67%), Gaps = 9/112 (8%)
 Frame = -1

Query  310  YKFLGLSVTE--GAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQ  137
            YKFLGL+  +  G W +S FG GT++G+LDTGVWPES SF D GMPP P +W+GVCQ G+
Sbjct  118  YKFLGLNSYQRSGPWGESGFGEGTVVGVLDTGVWPESSSFLDNGMPPVPKRWRGVCQVGE  177

Query  136  GFNSSSCNRKLIGARFFSKGHVAASPDYSPHLVE-------EYISPRDSHGH  2
             F+ S CNRKLIGARF+ +GH    P  +            EY+S RD+HGH
Sbjct  178  SFDPSLCNRKLIGARFYGRGHRVEEPTSNSGKSRWPAGTNGEYVSARDAHGH  229



>ref|XP_004252763.1| PREDICTED: subtilisin-like protease [Solanum lycopersicum]
Length=775

 Score =   119 bits (299),  Expect = 8e-29, Method: Composition-based stats.
 Identities = 56/102 (55%), Positives = 72/102 (71%), Gaps = 4/102 (4%)
 Frame = -1

Query  307  KFLGLSVTEGAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQGFN  128
            +FLGLS   GAW KS +G   IIGL+DTGVWPES S++D GM   P +WKG C+ G  FN
Sbjct  135  QFLGLSSNSGAWPKSDYGRDVIIGLVDTGVWPESKSYNDNGMNDVPSRWKGECESGTQFN  194

Query  127  SSSCNRKLIGARFFSKGHVAASPDYSPHLVEEYISPRDSHGH  2
            SS CN+KLIGAR+F+KG +A++P+    +  E  S RD+ GH
Sbjct  195  SSMCNKKLIGARYFNKGLIASNPN----ITIEMNSARDTEGH  232



>ref|XP_011074394.1| PREDICTED: subtilisin-like protease [Sesamum indicum]
Length=761

 Score =   119 bits (299),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 55/103 (53%), Positives = 71/103 (69%), Gaps = 4/103 (4%)
 Frame = -1

Query  310  YKFLGLSVTEGAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQGF  131
            YKFL L+   G W  S++G   IIG++D+G+WPESPSF D GM   P +WKG+CQEG+ F
Sbjct  117  YKFLSLNTATGLWPASKYGKDVIIGVVDSGIWPESPSFRDDGMTEIPARWKGICQEGEQF  176

Query  130  NSSSCNRKLIGARFFSKGHVAASPDYSPHLVEEYISPRDSHGH  2
            NSSSCN+K+IGAR+F+ G  A +PD    L  +  S RD  GH
Sbjct  177  NSSSCNKKIIGARYFNNGFQAGNPD----LPIDVNSARDMDGH  215



>ref|XP_008793983.1| PREDICTED: subtilisin-like protease [Phoenix dactylifera]
Length=769

 Score =   119 bits (298),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 60/102 (59%), Positives = 69/102 (68%), Gaps = 2/102 (2%)
 Frame = -1

Query  307  KFLGLSVTEGAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQGFN  128
            KFLGLS   G W  S FG   IIGL+D+G+WPES SFDD GMPP P +WKG C+ G  FN
Sbjct  119  KFLGLSRHSGLWPMSGFGDDMIIGLVDSGIWPESDSFDDKGMPPIPERWKGTCETGTKFN  178

Query  127  SSSCNRKLIGARFFSKGHVAASPDYSPHLVEEYISPRDSHGH  2
            SS+CNRKLIGAR+F KG      + S  L  +Y SPRD  GH
Sbjct  179  SSNCNRKLIGARYFGKGQRQRGLNVSKTL--DYDSPRDFLGH  218



>ref|XP_010558849.1| PREDICTED: subtilisin-like protease SDD1 [Tarenaya hassleriana]
Length=742

 Score =   119 bits (298),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 55/68 (81%), Positives = 60/68 (88%), Gaps = 1/68 (1%)
 Frame = -1

Query  262  RFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQGFNSSSCNRKLIGARFFS  83
            + G GTIIG+LDTGVWPESPSFDD GMPP P KW+G+CQEGQ FNSSSCNRKLIGARFF 
Sbjct  132  QLGRGTIIGVLDTGVWPESPSFDDHGMPPVPSKWQGICQEGQSFNSSSCNRKLIGARFFI  191

Query  82   KGH-VAAS  62
            +GH VAAS
Sbjct  192  RGHRVAAS  199



>ref|XP_011074393.1| PREDICTED: subtilisin-like protease [Sesamum indicum]
Length=767

 Score =   119 bits (298),  Expect = 1e-28, Method: Composition-based stats.
 Identities = 56/103 (54%), Positives = 70/103 (68%), Gaps = 4/103 (4%)
 Frame = -1

Query  310  YKFLGLSVTEGAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQGF  131
            YKFL L+   G W  S +G   IIG++DTG+WPESPSF D GM   P +WKG+CQEG+ F
Sbjct  121  YKFLSLNTATGLWPASNYGKDVIIGVIDTGIWPESPSFRDDGMTEIPARWKGICQEGEQF  180

Query  130  NSSSCNRKLIGARFFSKGHVAASPDYSPHLVEEYISPRDSHGH  2
            NSSSCN+K+IGAR+F++G  A  PD S  +     S RD  GH
Sbjct  181  NSSSCNKKIIGARYFNEGFRAQLPDLSIGVN----SARDVDGH  219



>ref|XP_010647877.1| PREDICTED: subtilisin-like protease [Vitis vinifera]
Length=693

 Score =   119 bits (297),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 61/108 (56%), Positives = 71/108 (66%), Gaps = 13/108 (12%)
 Frame = -1

Query  307  KFLGLSVTEGAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQGFN  128
            KFLGL    GAW + +FG   IIG+LDTGVWPES SF D GM P P +W+G C+ G  FN
Sbjct  115  KFLGLEKNSGAWPEGKFGEDMIIGILDTGVWPESESFRDKGMGPVPKRWRGACESGVAFN  174

Query  127  SSSCNRKLIGARFFSKG------HVAASPDYSPHLVEEYISPRDSHGH  2
            SS CNRKLIGAR FS+G      +V+A PD       +Y SPRD HGH
Sbjct  175  SSYCNRKLIGARSFSEGLKRRGLNVSAPPD-------DYDSPRDFHGH  215



>gb|KCW63761.1| hypothetical protein EUGRSUZ_G01423 [Eucalyptus grandis]
Length=740

 Score =   119 bits (297),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 56/102 (55%), Positives = 72/102 (71%), Gaps = 2/102 (2%)
 Frame = -1

Query  307  KFLGLSVTEGAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQGFN  128
            KFLGL+  +G W +++FG G I+G++DTG+WPES SF D GM P P +W+G C+ G  FN
Sbjct  111  KFLGLNRQKGLWPRAKFGDGVIVGIVDTGIWPESESFKDKGMSPVPERWRGSCESGVDFN  170

Query  127  SSSCNRKLIGARFFSKGHVAASPDYSPHLVEEYISPRDSHGH  2
            SS+CNRKLIGAR FSKG      + S    ++Y SPRDS GH
Sbjct  171  SSNCNRKLIGARSFSKGMKQHGLNIS--TTDDYDSPRDSFGH  210



>ref|XP_007017195.1| Subtilisin-like serine endopeptidase family protein [Theobroma 
cacao]
 gb|EOY14420.1| Subtilisin-like serine endopeptidase family protein [Theobroma 
cacao]
Length=760

 Score =   119 bits (297),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 57/103 (55%), Positives = 72/103 (70%), Gaps = 4/103 (4%)
 Frame = -1

Query  310  YKFLGLSVTEGAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQGF  131
            +KFLGL+ + GAW  S FG   IIG++DTGVWPES SF+D GM   P KWKG C+ G  F
Sbjct  120  FKFLGLNSSTGAWPVSNFGKDVIIGVIDTGVWPESGSFNDNGMTDVPSKWKGGCENGTQF  179

Query  130  NSSSCNRKLIGARFFSKGHVAASPDYSPHLVEEYISPRDSHGH  2
            NSS CN+KLIGAR F+KG +A    ++P++     SPRD+ GH
Sbjct  180  NSSLCNKKLIGARSFNKGLIA----HNPNITISMNSPRDTEGH  218



>ref|XP_010233560.1| PREDICTED: subtilisin-like protease [Brachypodium distachyon]
Length=799

 Score =   118 bits (296),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 57/102 (56%), Positives = 72/102 (71%), Gaps = 4/102 (4%)
 Frame = -1

Query  307  KFLGLSVTEGAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQGFN  128
            +FLGLS   G    ++ G G I+G++DTGVWPES SFDDAGM PAP KW+G C+ GQ F 
Sbjct  241  EFLGLSPLAGLLPAAKLGEGVIVGMIDTGVWPESASFDDAGMSPAPSKWRGTCEPGQAFT  300

Query  127  SSSCNRKLIGARFFSKGHVAASPDYSPHLVEEYISPRDSHGH  2
            ++ CNRKLIGAR+F+KG VAA+P  +  +     S RDS GH
Sbjct  301  AAMCNRKLIGARYFNKGLVAANPGITLTMN----STRDSEGH  338



>ref|XP_010263511.1| PREDICTED: subtilisin-like protease [Nelumbo nucifera]
Length=768

 Score =   117 bits (294),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 56/102 (55%), Positives = 68/102 (67%), Gaps = 4/102 (4%)
 Frame = -1

Query  307  KFLGLSVTEGAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQGFN  128
            +FLGL+   GAW  S +G   IIGL+DTG+WPES +F D GM   P +WKG C  G  FN
Sbjct  118  EFLGLNSDYGAWPASNYGADVIIGLVDTGIWPESATFRDDGMTQVPKRWKGECMNGTDFN  177

Query  127  SSSCNRKLIGARFFSKGHVAASPDYSPHLVEEYISPRDSHGH  2
            SS CNRKLIGARFF+KG  A +P +S  +     SPRD+ GH
Sbjct  178  SSMCNRKLIGARFFNKGLAANTPSFSTSMN----SPRDTDGH  215



>ref|XP_009610212.1| PREDICTED: subtilisin-like protease [Nicotiana tomentosiformis]
Length=756

 Score =   117 bits (292),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 56/101 (55%), Positives = 69/101 (68%), Gaps = 4/101 (4%)
 Frame = -1

Query  304  FLGLSVTEGAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQGFNS  125
            FLGL+   G+W KS +G G IIG++DTGVWPES SFDD GM   P +WKG+CQ G  FNS
Sbjct  121  FLGLNSMSGSWPKSNYGKGVIIGVVDTGVWPESKSFDDDGMTQVPSRWKGLCQTGTQFNS  180

Query  124  SSCNRKLIGARFFSKGHVAASPDYSPHLVEEYISPRDSHGH  2
            S CN+KLIGAR+F+KG +A   +    L     S RD+ GH
Sbjct  181  SLCNKKLIGARYFNKGLLAKVKN----LTITINSARDTEGH  217



>ref|XP_006342632.1| PREDICTED: subtilisin-like protease-like [Solanum tuberosum]
Length=749

 Score =   117 bits (292),  Expect = 7e-28, Method: Composition-based stats.
 Identities = 56/102 (55%), Positives = 72/102 (71%), Gaps = 4/102 (4%)
 Frame = -1

Query  307  KFLGLSVTEGAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQGFN  128
            +FLGL+   GAW KS +G   IIGL+DTGVWPES S++D GM   P +WKG C+ G  FN
Sbjct  109  QFLGLNSNSGAWPKSDYGRDVIIGLVDTGVWPESKSYNDNGMTDVPSRWKGECESGTQFN  168

Query  127  SSSCNRKLIGARFFSKGHVAASPDYSPHLVEEYISPRDSHGH  2
            SSSCN+KLIGAR F+KG +A++P+    +  E  S RD+ GH
Sbjct  169  SSSCNKKLIGARSFNKGLIASNPN----ITIEMNSARDTAGH  206



>ref|XP_010927456.1| PREDICTED: subtilisin-like protease [Elaeis guineensis]
Length=762

 Score =   117 bits (292),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 59/103 (57%), Positives = 69/103 (67%), Gaps = 9/103 (9%)
 Frame = -1

Query  307  KFLGLSVTEGAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQGFN  128
            KFLGL+   G W  S FG   IIG++D+G+WPES SFDD GMPP P +WKG C+ G  FN
Sbjct  119  KFLGLNKHLGLWPMSHFGDDMIIGMVDSGIWPESDSFDDKGMPPIPERWKGTCETGTKFN  178

Query  127  SSSCNRKLIGARFFSKG-HVAASPDYSPHLVEEYISPRDSHGH  2
            SS CNRKLIGARFF KG +V+ + DY         SPRD  GH
Sbjct  179  SSDCNRKLIGARFFGKGLNVSKTLDYD--------SPRDFLGH  213



>ref|XP_006855695.1| hypothetical protein AMTR_s00044p00139080 [Amborella trichopoda]
 gb|ERN17162.1| hypothetical protein AMTR_s00044p00139080 [Amborella trichopoda]
Length=241

 Score =   112 bits (280),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 58/103 (56%), Positives = 68/103 (66%), Gaps = 7/103 (7%)
 Frame = -1

Query  307  KFLGLSVTEGAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQE-GQGF  131
            +FLGLS  +G W  +R G GTIIG+LD G+WPE PS +D GMPP P KWKG C + GQ F
Sbjct  111  RFLGLSPEQGLWHDTRLGSGTIIGVLDGGIWPEHPSLNDTGMPPPPKKWKGWCVDAGQDF  170

Query  130  NSSSCNRKLIGARFFSKGHVAASPDYSPHLVEEYISPRDSHGH  2
            NSS CN KLIGA+ FSKG  +A P+          SPRD  GH
Sbjct  171  NSSHCNNKLIGAQVFSKGAHSAMPNNITD------SPRDQDGH  207



>ref|XP_006425911.1| hypothetical protein CICLE_v10024929mg [Citrus clementina]
 gb|ESR39151.1| hypothetical protein CICLE_v10024929mg [Citrus clementina]
Length=786

 Score =   117 bits (292),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 58/102 (57%), Positives = 67/102 (66%), Gaps = 4/102 (4%)
 Frame = -1

Query  307  KFLGLSVTEGAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQGFN  128
            +FLGLS   GAW  S +G G IIGL+DTG+WPES SF D GM   P +WKG C  G  FN
Sbjct  146  QFLGLSSLSGAWPASNYGKGVIIGLVDTGIWPESQSFSDEGMAKVPPRWKGECMSGVQFN  205

Query  127  SSSCNRKLIGARFFSKGHVAASPDYSPHLVEEYISPRDSHGH  2
            SS CN+KLIGARFF+KG +A     +P L     SPRD  GH
Sbjct  206  SSLCNKKLIGARFFNKGLIAN----NPKLKVRMNSPRDGSGH  243



>ref|XP_004975630.1| PREDICTED: subtilisin-like protease-like [Setaria italica]
Length=773

 Score =   116 bits (291),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 58/103 (56%), Positives = 72/103 (70%), Gaps = 4/103 (4%)
 Frame = -1

Query  307  KFLGLSVTEGAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMP-PAPGKWKGVCQEGQGF  131
            +FLGLS   G W  S++G   IIG++DTGVWPES SF DAG+  P P +WKG C+ GQ F
Sbjct  120  EFLGLSAGAGLWPASKYGDDVIIGIVDTGVWPESESFSDAGIKKPVPARWKGACEAGQKF  179

Query  130  NSSSCNRKLIGARFFSKGHVAASPDYSPHLVEEYISPRDSHGH  2
            N+S+CNRKLIGAR FSKG   +    SP   ++Y SPRD +GH
Sbjct  180  NASACNRKLIGARSFSKGLKQSGLGISP---DDYDSPRDYYGH  219



>gb|KDO79191.1| hypothetical protein CISIN_1g004824mg [Citrus sinensis]
Length=728

 Score =   116 bits (291),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 58/102 (57%), Positives = 67/102 (66%), Gaps = 4/102 (4%)
 Frame = -1

Query  307  KFLGLSVTEGAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQGFN  128
            +FLGLS   GAW  S +G G IIGL+DTG+WPES SF D GM   P +WKG C  G  FN
Sbjct  88   EFLGLSSLSGAWPASNYGKGVIIGLVDTGIWPESQSFSDEGMAKVPPRWKGECMSGVQFN  147

Query  127  SSSCNRKLIGARFFSKGHVAASPDYSPHLVEEYISPRDSHGH  2
            SS CN+KLIGARFF+KG +A     +P L     SPRD  GH
Sbjct  148  SSLCNKKLIGARFFNKGLIAN----NPKLKVRMNSPRDGSGH  185



>ref|XP_010066012.1| PREDICTED: subtilisin-like protease [Eucalyptus grandis]
 gb|KCW63760.1| hypothetical protein EUGRSUZ_G01420 [Eucalyptus grandis]
Length=763

 Score =   116 bits (291),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 54/102 (53%), Positives = 70/102 (69%), Gaps = 2/102 (2%)
 Frame = -1

Query  307  KFLGLSVTEGAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQGFN  128
            KFLGL+   G W ++ FG G I+G++D+G+WPES SF D GM P P +W+G C+ G  FN
Sbjct  115  KFLGLNRQTGLWPRAEFGDGVIVGVVDSGIWPESESFKDKGMSPVPKRWRGTCESGVDFN  174

Query  127  SSSCNRKLIGARFFSKGHVAASPDYSPHLVEEYISPRDSHGH  2
            +S+CNRKLIGAR FSKG      + S    ++Y SPRDS GH
Sbjct  175  ASNCNRKLIGARSFSKGMKQQGLNIS--TTDDYDSPRDSDGH  214



>gb|KDP41709.1| hypothetical protein JCGZ_16116 [Jatropha curcas]
Length=764

 Score =   116 bits (291),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 58/102 (57%), Positives = 67/102 (66%), Gaps = 2/102 (2%)
 Frame = -1

Query  307  KFLGLSVTEGAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQGFN  128
            KFLGL    G W  + +G G IIG+LDTG+WPES SF+D GMPP P +WKG C+ G  F+
Sbjct  123  KFLGLKHKHGLWPAASYGEGVIIGILDTGIWPESESFNDKGMPPVPQRWKGQCENGTAFS  182

Query  127  SSSCNRKLIGARFFSKGHVAASPDYSPHLVEEYISPRDSHGH  2
             SSCNRKLIGAR FSKG  AA    S     +Y S RD  GH
Sbjct  183  PSSCNRKLIGARSFSKGLAAAGRKISTEF--DYDSARDFFGH  222



>ref|XP_010927458.1| PREDICTED: subtilisin-like protease [Elaeis guineensis]
Length=733

 Score =   116 bits (290),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 59/102 (58%), Positives = 68/102 (67%), Gaps = 2/102 (2%)
 Frame = -1

Query  307  KFLGLSVTEGAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQGFN  128
            KFLGL+   G W  S FG   IIG++DTG+WPES SFDD GMPP P +WKG C+ G  FN
Sbjct  82   KFLGLNRHLGLWPMSNFGDEMIIGIIDTGIWPESDSFDDKGMPPIPERWKGTCETGTKFN  141

Query  127  SSSCNRKLIGARFFSKGHVAASPDYSPHLVEEYISPRDSHGH  2
            SS CNRKLIGAR FSKG      + S     +Y SPRD+ GH
Sbjct  142  SSDCNRKLIGARSFSKGLKQRGLNVSK--TWDYDSPRDNFGH  181



>ref|XP_011069660.1| PREDICTED: subtilisin-like protease [Sesamum indicum]
Length=762

 Score =   116 bits (291),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 53/103 (51%), Positives = 73/103 (71%), Gaps = 4/103 (4%)
 Frame = -1

Query  310  YKFLGLSVTEGAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQGF  131
            YKFLGL+   G W  S++G   IIG++D+G+WPESPSF D GM   P +W+G C  GQ F
Sbjct  118  YKFLGLNTASGIWPASQYGKDVIIGVVDSGIWPESPSFRDEGMTEVPARWRGACVVGQDF  177

Query  130  NSSSCNRKLIGARFFSKGHVAASPDYSPHLVEEYISPRDSHGH  2
            NSS CN+K+IGAR+F++G +AA+PD +  +     S RD++GH
Sbjct  178  NSSLCNKKIIGARWFNQGVLAANPDGTISMN----STRDTYGH  216



>ref|XP_006466594.1| PREDICTED: subtilisin-like protease-like [Citrus sinensis]
Length=786

 Score =   116 bits (291),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 58/102 (57%), Positives = 67/102 (66%), Gaps = 4/102 (4%)
 Frame = -1

Query  307  KFLGLSVTEGAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQGFN  128
            +FLGLS   GAW  S +G G IIGL+DTG+WPES SF D GM   P +WKG C  G  FN
Sbjct  146  EFLGLSSLSGAWPASNYGKGVIIGLVDTGIWPESQSFSDEGMAKVPPRWKGECMSGVQFN  205

Query  127  SSSCNRKLIGARFFSKGHVAASPDYSPHLVEEYISPRDSHGH  2
            SS CN+KLIGARFF+KG +A     +P L     SPRD  GH
Sbjct  206  SSLCNKKLIGARFFNKGLIAN----NPKLKVRMNSPRDGSGH  243



>ref|XP_008657904.1| PREDICTED: subtilisin-like protease [Zea mays]
Length=825

 Score =   116 bits (291),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 53/102 (52%), Positives = 70/102 (69%), Gaps = 4/102 (4%)
 Frame = -1

Query  307  KFLGLSVTEGAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQGFN  128
            +FL L+   G W  S+FG G IIG++DTG+WPES SF+DAGMPP P +W+G C+ G  F 
Sbjct  151  EFLNLNSASGLWPASKFGEGVIIGMIDTGLWPESASFNDAGMPPVPSRWRGTCEPGVQFT  210

Query  127  SSSCNRKLIGARFFSKGHVAASPDYSPHLVEEYISPRDSHGH  2
             S CNRKL+GAR+F++G VAA+P     +     S RD+ GH
Sbjct  211  PSMCNRKLVGARYFNRGLVAANPGVKISMN----STRDTEGH  248



>ref|XP_010059919.1| PREDICTED: subtilisin-like protease [Eucalyptus grandis]
Length=766

 Score =   116 bits (291),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 56/102 (55%), Positives = 69/102 (68%), Gaps = 4/102 (4%)
 Frame = -1

Query  307  KFLGLSVTEGAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQGFN  128
            +FLGL+   GAW  S +G   IIGL+DTGVWPESPSF+D GM   P KWKG C+ G  FN
Sbjct  124  QFLGLNSNAGAWPTSDYGKDIIIGLVDTGVWPESPSFNDDGMTAIPSKWKGECEVGTQFN  183

Query  127  SSSCNRKLIGARFFSKGHVAASPDYSPHLVEEYISPRDSHGH  2
            +S CNRKLIGARFF+K  +A  P+ +  +     S RD+ GH
Sbjct  184  ASMCNRKLIGARFFNKALIAKYPNVTLSMN----STRDTEGH  221



>ref|XP_006434738.1| hypothetical protein CICLE_v10000411mg [Citrus clementina]
 gb|ESR47978.1| hypothetical protein CICLE_v10000411mg [Citrus clementina]
Length=729

 Score =   116 bits (290),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 55/102 (54%), Positives = 72/102 (71%), Gaps = 4/102 (4%)
 Frame = -1

Query  307  KFLGLSVTEGAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQGFN  128
            +FLGL+   GAW  S+FG   IIG++DTGVWPES S++D GM   P +WKG C+ G  FN
Sbjct  90   QFLGLNPKSGAWPVSKFGKDIIIGVVDTGVWPESESYNDGGMTEIPSRWKGECESGTQFN  149

Query  127  SSSCNRKLIGARFFSKGHVAASPDYSPHLVEEYISPRDSHGH  2
            SS CN+KLIGARFF+KG +A +P  +  +     SPRD++GH
Sbjct  150  SSLCNKKLIGARFFNKGLLAKNPTITIAMN----SPRDANGH  187



>ref|XP_004972264.1| PREDICTED: subtilisin-like protease-like [Setaria italica]
Length=760

 Score =   116 bits (290),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 55/102 (54%), Positives = 69/102 (68%), Gaps = 4/102 (4%)
 Frame = -1

Query  307  KFLGLSVTEGAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQGFN  128
            +FL LS   G W  + FG G IIG++DTGVWPES SFDDA MPP P +W+G C+ G  F 
Sbjct  127  EFLNLSSVGGLWPAANFGEGVIIGMIDTGVWPESASFDDADMPPVPSRWRGTCEPGVEFT  186

Query  127  SSSCNRKLIGARFFSKGHVAASPDYSPHLVEEYISPRDSHGH  2
             S CNRKLI AR+F+KG VAA+P+ +  +     S RD+ GH
Sbjct  187  PSMCNRKLISARYFNKGLVAANPNVNISMN----STRDTDGH  224



>gb|KCW44171.1| hypothetical protein EUGRSUZ_L024072, partial [Eucalyptus grandis]
Length=194

 Score =   110 bits (275),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 57/102 (56%), Positives = 67/102 (66%), Gaps = 2/102 (2%)
 Frame = -1

Query  307  KFLGLSVTEGAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQGFN  128
            KFLGL  + G W  S +G   IIG+LDTG+WPES SF D GMPP P +WKG C+ G  F+
Sbjct  83   KFLGLKHSSGLWPNSSYGEDVIIGILDTGIWPESASFCDKGMPPVPPRWKGECENGTAFS  142

Query  127  SSSCNRKLIGARFFSKGHVAASPDYSPHLVEEYISPRDSHGH  2
             S CNRKLIGAR FSKG  AA  + S   + +Y S RD  GH
Sbjct  143  PSHCNRKLIGARSFSKGLAAAGLNISQ--MYDYDSARDFAGH  182



>ref|XP_009611962.1| PREDICTED: subtilisin-like protease [Nicotiana tomentosiformis]
 ref|XP_009611971.1| PREDICTED: subtilisin-like protease [Nicotiana tomentosiformis]
Length=767

 Score =   116 bits (290),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 53/102 (52%), Positives = 69/102 (68%), Gaps = 2/102 (2%)
 Frame = -1

Query  307  KFLGLSVTEGAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQGFN  128
            +FLGL    G W  S      I+G++DTG+WPE  SF D+GMPP P +WKG C+ G  F+
Sbjct  122  QFLGLKSGSGLWSASNLTSDVIVGMIDTGIWPEHVSFRDSGMPPVPSRWKGKCEAGTRFS  181

Query  127  SSSCNRKLIGARFFSKGHVAASPDYSPHLVEEYISPRDSHGH  2
             S+CN+K+IGAR FSKG+ AA+   +    E+YISPRDS GH
Sbjct  182  PSNCNKKIIGARMFSKGYEAAAGKINE--TEDYISPRDSQGH  221



>gb|KDO84130.1| hypothetical protein CISIN_1g004809mg [Citrus sinensis]
Length=729

 Score =   116 bits (290),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 55/102 (54%), Positives = 72/102 (71%), Gaps = 4/102 (4%)
 Frame = -1

Query  307  KFLGLSVTEGAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQGFN  128
            +FLGL+   GAW  S+FG   IIG++DTGVWPES S++D GM   P +WKG C+ G  FN
Sbjct  90   QFLGLNPKSGAWPVSKFGKDIIIGVVDTGVWPESESYNDGGMTEIPSRWKGECESGTQFN  149

Query  127  SSSCNRKLIGARFFSKGHVAASPDYSPHLVEEYISPRDSHGH  2
            SS CN+KLIGARFF+KG +A +P  +  +     SPRD++GH
Sbjct  150  SSLCNKKLIGARFFNKGLLAKNPTITIAMN----SPRDANGH  187



>ref|XP_002282841.2| PREDICTED: uncharacterized protein LOC100259061 [Vitis vinifera]
Length=1529

 Score =   117 bits (293),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 56/102 (55%), Positives = 69/102 (68%), Gaps = 4/102 (4%)
 Frame = -1

Query  307  KFLGLSVTEGAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQGFN  128
            KFLGL+   GAW  S +G   IIGL+DTG+WPES SF+D GM   P +WKG C+ G  FN
Sbjct  889  KFLGLNSNSGAWPMSNYGKDVIIGLVDTGIWPESESFNDDGMTEIPSRWKGACESGTQFN  948

Query  127  SSSCNRKLIGARFFSKGHVAASPDYSPHLVEEYISPRDSHGH  2
            SS CN+KLIGARFF+KG +A  P+ S  +     S RD+ GH
Sbjct  949  SSMCNKKLIGARFFNKGLIAKHPNVSISMN----STRDTDGH  986


 Score =   115 bits (288),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 56/103 (54%), Positives = 70/103 (68%), Gaps = 4/103 (4%)
 Frame = -1

Query  310  YKFLGLSVTEGAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQGF  131
            ++FL L+   G W  S +G   I+G++D+GVWPESPSF D GM   P +WKG C+EG+ F
Sbjct  127  FEFLKLNPVTGLWPASDYGEDVIVGVIDSGVWPESPSFKDDGMTQIPARWKGTCEEGEDF  186

Query  130  NSSSCNRKLIGARFFSKGHVAASPDYSPHLVEEYISPRDSHGH  2
            NSS CNRKLIGAR F KG +AA+P    H+     SPRDS GH
Sbjct  187  NSSMCNRKLIGARSFIKGLIAANPGI--HVTMN--SPRDSFGH  225



>gb|KCW66398.1| hypothetical protein EUGRSUZ_F00212 [Eucalyptus grandis]
Length=728

 Score =   116 bits (290),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 56/102 (55%), Positives = 69/102 (68%), Gaps = 4/102 (4%)
 Frame = -1

Query  307  KFLGLSVTEGAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQGFN  128
            +FLGL+   GAW  S +G   IIGL+DTGVWPESPSF+D GM   P KWKG C+ G  FN
Sbjct  124  QFLGLNSNAGAWPTSDYGKDIIIGLVDTGVWPESPSFNDDGMTAIPSKWKGECEVGTQFN  183

Query  127  SSSCNRKLIGARFFSKGHVAASPDYSPHLVEEYISPRDSHGH  2
            +S CNRKLIGARFF+K  +A  P+ +  +     S RD+ GH
Sbjct  184  ASMCNRKLIGARFFNKALIAKYPNVTLSMN----STRDTEGH  221



>ref|XP_006495263.1| PREDICTED: subtilisin-like protease-like [Citrus sinensis]
Length=785

 Score =   116 bits (290),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 57/102 (56%), Positives = 66/102 (65%), Gaps = 2/102 (2%)
 Frame = -1

Query  307  KFLGLSVTEGAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQGFN  128
            KFLGL    G W  + FG   I+G++DTGVWPESPSF D GMPP P +W+G C+ G  FN
Sbjct  128  KFLGLKKQAGLWPAAGFGSHVIVGVIDTGVWPESPSFKDDGMPPVPERWRGACEVGVEFN  187

Query  127  SSSCNRKLIGARFFSKGHVAASPDYSPHLVEEYISPRDSHGH  2
            +S CNRKLIGAR FSKG      + S     EY SPRD  GH
Sbjct  188  ASHCNRKLIGARSFSKGLKHYGLNISTTF--EYDSPRDFLGH  227



>gb|KDP41712.1| hypothetical protein JCGZ_16119 [Jatropha curcas]
Length=732

 Score =   115 bits (289),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 55/103 (53%), Positives = 70/103 (68%), Gaps = 4/103 (4%)
 Frame = -1

Query  310  YKFLGLSVTEGAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQGF  131
            ++FL L+ T G W  S FG   IIG++DTGVWPES S+ D GM P P +WKG+C+EG+ F
Sbjct  90   FEFLSLNSTTGLWPASNFGEDVIIGVIDTGVWPESLSYKDDGMTPVPSRWKGICEEGEEF  149

Query  130  NSSSCNRKLIGARFFSKGHVAASPDYSPHLVEEYISPRDSHGH  2
             SS CN KLIGAR+F+KG  AA+P     +     SPRD+ GH
Sbjct  150  TSSMCNSKLIGARYFNKGVKAAAPGIKIIMN----SPRDTRGH  188



>gb|EYU25440.1| hypothetical protein MIMGU_mgv1a0017511mg, partial [Erythranthe 
guttata]
Length=650

 Score =   115 bits (288),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 56/103 (54%), Positives = 69/103 (67%), Gaps = 4/103 (4%)
 Frame = -1

Query  310  YKFLGLSVTEGAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQGF  131
            YKFLGL+   G W  S +G   IIG++DTGVWPES SF D GM   P +W+G+CQ G+ F
Sbjct  116  YKFLGLNTAAGIWPASEYGKDVIIGVVDTGVWPESRSFGDDGMTAVPARWRGICQAGEEF  175

Query  130  NSSSCNRKLIGARFFSKGHVAASPDYSPHLVEEYISPRDSHGH  2
            NSS CNRKLIGAR+F++G  AA+P     +V    S RD  GH
Sbjct  176  NSSLCNRKLIGARYFNEGVRAANPG----VVITLNSARDDSGH  214



>gb|EEE55729.1| hypothetical protein OsJ_04215 [Oryza sativa Japonica Group]
Length=715

 Score =   115 bits (289),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 56/102 (55%), Positives = 70/102 (69%), Gaps = 4/102 (4%)
 Frame = -1

Query  307  KFLGLSVTEGAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQGFN  128
            +FL LS   G W  +RFG G IIG++DTGVWPES SFDD GMPP P +W+G C+ GQ F 
Sbjct  82   EFLRLSPFGGLWPAARFGEGVIIGVIDTGVWPESASFDDGGMPPVPSRWRGECEAGQDFT  141

Query  127  SSSCNRKLIGARFFSKGHVAASPDYSPHLVEEYISPRDSHGH  2
               CNRKLIGAR+F++G VAA+P  +  +     S RD+ GH
Sbjct  142  LDMCNRKLIGARYFNRGLVAANPTVTVSMN----STRDTLGH  179



>ref|XP_002446493.1| hypothetical protein SORBIDRAFT_06g016860 [Sorghum bicolor]
 gb|EES10821.1| hypothetical protein SORBIDRAFT_06g016860 [Sorghum bicolor]
Length=771

 Score =   115 bits (289),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 57/103 (55%), Positives = 70/103 (68%), Gaps = 5/103 (5%)
 Frame = -1

Query  304  FLGLSVT--EGAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQGF  131
            FLGL++    G W  S++G G IIG++DTGVWPES SF DAGM P P +WKG C+ GQ F
Sbjct  118  FLGLTMNGGSGVWPASKYGDGVIIGIVDTGVWPESESFSDAGMGPVPARWKGACEVGQAF  177

Query  130  NSSSCNRKLIGARFFSKGHVAASPDYSPHLVEEYISPRDSHGH  2
             +S CNRKLIGAR FSKG        +P   ++Y SPRD +GH
Sbjct  178  KASMCNRKLIGARSFSKGLKQRGLTIAP---DDYDSPRDYYGH  217



>ref|XP_010025755.1| PREDICTED: subtilisin-like protease [Eucalyptus grandis]
Length=759

 Score =   115 bits (289),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 56/102 (55%), Positives = 70/102 (69%), Gaps = 4/102 (4%)
 Frame = -1

Query  307  KFLGLSVTEGAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQGFN  128
            +FLGL+   GAW  S +G   I+GL+DTGVWPESPSF+D GM   P KWKG C+ G  FN
Sbjct  116  QFLGLNSNSGAWPTSDYGKDVIVGLVDTGVWPESPSFNDDGMTTIPSKWKGECEVGIQFN  175

Query  127  SSSCNRKLIGARFFSKGHVAASPDYSPHLVEEYISPRDSHGH  2
            +S CN+KLIGARFF+K  VA +P+ +  L     S RD+ GH
Sbjct  176  ASMCNKKLIGARFFNKALVAKNPNITISLN----SSRDTEGH  213



>dbj|BAD82002.1| putative subtilase [Oryza sativa Japonica Group]
Length=757

 Score =   115 bits (289),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 56/102 (55%), Positives = 70/102 (69%), Gaps = 4/102 (4%)
 Frame = -1

Query  307  KFLGLSVTEGAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQGFN  128
            +FL LS   G W  +RFG G IIG++DTGVWPES SFDD GMPP P +W+G C+ GQ F 
Sbjct  124  EFLRLSPFGGLWPAARFGEGVIIGVIDTGVWPESASFDDGGMPPVPSRWRGECEAGQDFT  183

Query  127  SSSCNRKLIGARFFSKGHVAASPDYSPHLVEEYISPRDSHGH  2
               CNRKLIGAR+F++G VAA+P  +  +     S RD+ GH
Sbjct  184  LDMCNRKLIGARYFNRGLVAANPTVTVSMN----STRDTLGH  221



>ref|XP_006487124.1| PREDICTED: subtilisin-like protease-like [Citrus sinensis]
Length=793

 Score =   115 bits (289),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 57/102 (56%), Positives = 66/102 (65%), Gaps = 2/102 (2%)
 Frame = -1

Query  307  KFLGLSVTEGAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQGFN  128
            KFLGL    G W  + FG   I+G++DTGVWPESPSF D GMPP P +W+G C+ G  FN
Sbjct  128  KFLGLKKQAGLWPAAGFGSHVIVGVIDTGVWPESPSFKDDGMPPVPERWRGACEVGVEFN  187

Query  127  SSSCNRKLIGARFFSKGHVAASPDYSPHLVEEYISPRDSHGH  2
            +S CNRKLIGAR FSKG      + S     EY SPRD  GH
Sbjct  188  ASHCNRKLIGARSFSKGLKHYGLNISTTF--EYDSPRDFLGH  227



>gb|KCW62487.1| hypothetical protein EUGRSUZ_H05125 [Eucalyptus grandis]
Length=768

 Score =   115 bits (289),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 56/102 (55%), Positives = 70/102 (69%), Gaps = 4/102 (4%)
 Frame = -1

Query  307  KFLGLSVTEGAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQGFN  128
            +FLGL+   GAW  S +G   I+GL+DTGVWPESPSF+D GM   P KWKG C+ G  FN
Sbjct  125  QFLGLNSNSGAWPTSDYGKDVIVGLVDTGVWPESPSFNDDGMTTIPSKWKGECEVGIQFN  184

Query  127  SSSCNRKLIGARFFSKGHVAASPDYSPHLVEEYISPRDSHGH  2
            +S CN+KLIGARFF+K  VA +P+ +  L     S RD+ GH
Sbjct  185  ASMCNKKLIGARFFNKALVAKNPNITISLN----SSRDTEGH  222



>gb|EYU36342.1| hypothetical protein MIMGU_mgv1a001789mg [Erythranthe guttata]
Length=759

 Score =   115 bits (288),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 57/103 (55%), Positives = 69/103 (67%), Gaps = 5/103 (5%)
 Frame = -1

Query  310  YKFLGLSVTEGAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQGF  131
            YKFL L+   G W  S +G   IIG+LDTG+WPESPSF D GM   P KWKG CQ GQ F
Sbjct  112  YKFLSLNTASGLWPASNYGKDVIIGILDTGIWPESPSFRDEGMTAIPAKWKGSCQGGQDF  171

Query  130  NSSSCNRKLIGARFFSKGHVAASPDYSPHLVEEYISPRDSHGH  2
            NSS CN+KLIG R+F++G  AA PD   + V +  + RD+ GH
Sbjct  172  NSSLCNKKLIGVRYFNQGTRAAFPD---NPVPD--TARDNEGH  209



>ref|XP_010068463.1| PREDICTED: subtilisin-like protease [Eucalyptus grandis]
Length=746

 Score =   115 bits (288),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 54/102 (53%), Positives = 70/102 (69%), Gaps = 2/102 (2%)
 Frame = -1

Query  307  KFLGLSVTEGAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQGFN  128
            KFLGL+   G W ++ FG G I+G++D+G+WPES SF D GM P P +W+G C+ G  FN
Sbjct  115  KFLGLNRQTGLWPRAEFGDGMIVGVVDSGIWPESESFKDKGMSPVPKRWRGTCESGVDFN  174

Query  127  SSSCNRKLIGARFFSKGHVAASPDYSPHLVEEYISPRDSHGH  2
            +S+CNRKLIGAR FSKG      + S    ++Y SPRDS GH
Sbjct  175  ASNCNRKLIGARSFSKGMKQHGLNIS--TTDDYDSPRDSFGH  214



>ref|XP_011000657.1| PREDICTED: subtilisin-like protease [Populus euphratica]
Length=783

 Score =   115 bits (289),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 54/102 (53%), Positives = 69/102 (68%), Gaps = 2/102 (2%)
 Frame = -1

Query  307  KFLGLSVTEGAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQGFN  128
            KFLGL+   GAW   +FG   IIG+LDTG+WPES SF+D  MPP P +W+G+C+ G  FN
Sbjct  120  KFLGLNKRAGAWPAGKFGDDVIIGVLDTGIWPESESFNDKNMPPVPQRWRGICETGTEFN  179

Query  127  SSSCNRKLIGARFFSKGHVAASPDYSPHLVEEYISPRDSHGH  2
            +S CN+KLIGAR FS+G      + S    ++Y SPRD  GH
Sbjct  180  TSHCNKKLIGARKFSQGMKQVGLNISS--ADDYDSPRDYMGH  219



>gb|EYU25438.1| hypothetical protein MIMGU_mgv1a001996mg [Erythranthe guttata]
Length=729

 Score =   115 bits (288),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 54/103 (52%), Positives = 71/103 (69%), Gaps = 4/103 (4%)
 Frame = -1

Query  310  YKFLGLSVTEGAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQGF  131
            YKFL L+   G W  S++G   IIG++D+G+WPESPSF + GM   P KW+G C+ GQ F
Sbjct  83   YKFLSLNTASGIWPASQYGKDVIIGVVDSGIWPESPSFGEDGMTAIPAKWRGTCEVGQDF  142

Query  130  NSSSCNRKLIGARFFSKGHVAASPDYSPHLVEEYISPRDSHGH  2
            NSS CN+KLIGARFF++G +AASP  +  +     S RD+ GH
Sbjct  143  NSSMCNKKLIGARFFNQGVMAASPGTTISMN----STRDTFGH  181



>ref|XP_002313857.1| hypothetical protein POPTR_0009s10340g [Populus trichocarpa]
 gb|EEE87812.1| hypothetical protein POPTR_0009s10340g [Populus trichocarpa]
Length=758

 Score =   115 bits (288),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 54/102 (53%), Positives = 69/102 (68%), Gaps = 2/102 (2%)
 Frame = -1

Query  307  KFLGLSVTEGAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQGFN  128
            KFLGL+   GAW   +FG   IIG+LDTG+WPES SF+D  MPP P +W+G+C+ G  FN
Sbjct  116  KFLGLNKRAGAWPAGKFGDDVIIGVLDTGIWPESESFNDKNMPPVPQRWRGICETGTEFN  175

Query  127  SSSCNRKLIGARFFSKGHVAASPDYSPHLVEEYISPRDSHGH  2
            +S CN+KLIGAR FS+G      + S    ++Y SPRD  GH
Sbjct  176  TSHCNKKLIGARKFSQGMKQVGLNISS--TDDYDSPRDYMGH  215



>ref|XP_010687642.1| PREDICTED: subtilisin-like protease [Beta vulgaris subsp. vulgaris]
Length=782

 Score =   115 bits (288),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 53/101 (52%), Positives = 71/101 (70%), Gaps = 4/101 (4%)
 Frame = -1

Query  304  FLGLSVTEGAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQGFNS  125
            FL L+   G W  S +G   IIG++DTGVWPES SF+DAGM P P +WKG C+ GQ FN+
Sbjct  135  FLSLNPYTGLWPASNYGHDVIIGVIDTGVWPESRSFNDAGMTPVPSRWKGACEGGQNFNA  194

Query  124  SSCNRKLIGARFFSKGHVAASPDYSPHLVEEYISPRDSHGH  2
            S CN+KLIGA++F+KG +A++P+    L  +  S RD+ GH
Sbjct  195  SMCNKKLIGAKYFNKGVIASTPN----LQSKANSARDTDGH  231



>ref|XP_004291093.1| PREDICTED: subtilisin-like protease-like [Fragaria vesca subsp. 
vesca]
Length=767

 Score =   115 bits (288),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 56/102 (55%), Positives = 71/102 (70%), Gaps = 4/102 (4%)
 Frame = -1

Query  307  KFLGLSVTEGAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQGFN  128
            +FLGL+   GAW  S +G GTIIGL+DTGVWPE+ SF+D GM   P +WKG C+ G  F+
Sbjct  119  QFLGLNSKTGAWPVSNYGKGTIIGLVDTGVWPENESFNDGGMSEIPSRWKGECESGMQFS  178

Query  127  SSSCNRKLIGARFFSKGHVAASPDYSPHLVEEYISPRDSHGH  2
            SS CN+KLIGARFF+KG  AA P+ +  +     S RD+ GH
Sbjct  179  SSLCNKKLIGARFFNKGLAAADPNVTFAMN----STRDTDGH  216



>ref|XP_006847080.1| hypothetical protein AMTR_s00017p00213920 [Amborella trichopoda]
 gb|ERN08661.1| hypothetical protein AMTR_s00017p00213920 [Amborella trichopoda]
Length=239

 Score =   110 bits (276),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 53/101 (52%), Positives = 68/101 (67%), Gaps = 2/101 (2%)
 Frame = -1

Query  304  FLGLSVTEGAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQGFNS  125
            FLGL+   G W    FG GTIIG++D+G+WPES SFDD GMPP P +W+G C+ G+ F +
Sbjct  113  FLGLNKQIGLWPVGNFGNGTIIGIIDSGIWPESKSFDDKGMPPIPKRWRGACEIGEEFGT  172

Query  124  SSCNRKLIGARFFSKGHVAASPDYSPHLVEEYISPRDSHGH  2
             +CNR+LIGAR FSKG      + S   + +Y SPR SH H
Sbjct  173  LNCNRELIGARSFSKGLKERGKNISE--INDYDSPRGSHSH  211



>gb|KCW66392.1| hypothetical protein EUGRSUZ_F00206 [Eucalyptus grandis]
Length=756

 Score =   115 bits (288),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 56/102 (55%), Positives = 69/102 (68%), Gaps = 4/102 (4%)
 Frame = -1

Query  307  KFLGLSVTEGAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQGFN  128
            +FLGL+   GAW  S +G   I+GL+DTGVWPESPSF D GM   P KWKG C+ G  FN
Sbjct  125  QFLGLNSNSGAWPTSDYGKDVIVGLVDTGVWPESPSFSDGGMTTIPSKWKGECEVGTQFN  184

Query  127  SSSCNRKLIGARFFSKGHVAASPDYSPHLVEEYISPRDSHGH  2
            +S CN+KLIGARFF+K  VA +P+ +  L     S RD+ GH
Sbjct  185  ASMCNKKLIGARFFNKALVAKNPNITISLN----SSRDTAGH  222



>ref|XP_010059916.1| PREDICTED: subtilisin-like protease [Eucalyptus grandis]
Length=768

 Score =   115 bits (288),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 56/102 (55%), Positives = 69/102 (68%), Gaps = 4/102 (4%)
 Frame = -1

Query  307  KFLGLSVTEGAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQGFN  128
            +FLGL+   GAW  S +G   I+GL+DTGVWPESPSF D GM   P KWKG C+ G  FN
Sbjct  125  QFLGLNSNSGAWPTSDYGKDVIVGLVDTGVWPESPSFSDGGMTTIPSKWKGECEVGTQFN  184

Query  127  SSSCNRKLIGARFFSKGHVAASPDYSPHLVEEYISPRDSHGH  2
            +S CN+KLIGARFF+K  VA +P+ +  L     S RD+ GH
Sbjct  185  ASMCNKKLIGARFFNKALVAKNPNITISLN----SSRDTAGH  222



>ref|XP_010059917.1| PREDICTED: subtilisin-like protease [Eucalyptus grandis]
 gb|KCW66393.1| hypothetical protein EUGRSUZ_F00207 [Eucalyptus grandis]
Length=768

 Score =   115 bits (287),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 55/102 (54%), Positives = 69/102 (68%), Gaps = 4/102 (4%)
 Frame = -1

Query  307  KFLGLSVTEGAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQGFN  128
            +FLGL+   GAW  S +G   I+GL+DTGVWPESPSF+D GM   P KWKG C+ G  FN
Sbjct  125  QFLGLNSNSGAWPTSDYGKDVIVGLVDTGVWPESPSFNDDGMTTIPSKWKGECEVGTQFN  184

Query  127  SSSCNRKLIGARFFSKGHVAASPDYSPHLVEEYISPRDSHGH  2
            +S CN+KLIGARFF+K  V  +P+ +  L     S RD+ GH
Sbjct  185  ASMCNKKLIGARFFNKALVTKNPNVTISLN----STRDTDGH  222



>ref|XP_010068464.1| PREDICTED: subtilisin-like protease [Eucalyptus grandis]
Length=763

 Score =   115 bits (287),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 53/102 (52%), Positives = 71/102 (70%), Gaps = 2/102 (2%)
 Frame = -1

Query  307  KFLGLSVTEGAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQGFN  128
            K LGL+  +G W +++FG G I+G++D+G+WPES SF D GM P P +W+G C+ G  FN
Sbjct  115  KLLGLNRQKGLWPRAKFGDGVIVGVVDSGIWPESESFKDKGMSPVPKRWRGTCESGVDFN  174

Query  127  SSSCNRKLIGARFFSKGHVAASPDYSPHLVEEYISPRDSHGH  2
            +S+CNRKLIGAR FSKG      + S    ++Y SPRDS GH
Sbjct  175  ASNCNRKLIGARSFSKGMKQHGLNIS--TTDDYDSPRDSFGH  214



>gb|KDP41710.1| hypothetical protein JCGZ_16117 [Jatropha curcas]
Length=651

 Score =   114 bits (286),  Expect = 3e-27, Method: Composition-based stats.
 Identities = 55/103 (53%), Positives = 70/103 (68%), Gaps = 4/103 (4%)
 Frame = -1

Query  310  YKFLGLSVTEGAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQGF  131
            ++FL L+ T G W  S FG   IIG++DTGVWPES S+ D GM P P +WKG+C+EG+ F
Sbjct  10   FEFLSLNSTTGLWPASNFGEDVIIGVIDTGVWPESLSYKDDGMTPVPSRWKGICEEGEEF  69

Query  130  NSSSCNRKLIGARFFSKGHVAASPDYSPHLVEEYISPRDSHGH  2
             SS CN KLIGAR+F+KG  AA+P     +     SPRD+ GH
Sbjct  70   TSSMCNSKLIGARYFNKGVKAAAPGIKIIMN----SPRDTRGH  108



>gb|KCW63975.1| hypothetical protein EUGRSUZ_G01657, partial [Eucalyptus grandis]
Length=743

 Score =   115 bits (287),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 58/102 (57%), Positives = 69/102 (68%), Gaps = 2/102 (2%)
 Frame = -1

Query  307  KFLGLSVTEGAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQGFN  128
            KFLGL  + G W  S +G G IIG+LDTG+WPES SF D GMPP P +WKG C+ G  F+
Sbjct  120  KFLGLKHSSGLWPNSSYGEGVIIGILDTGIWPESASFCDKGMPPVPPRWKGECENGTAFS  179

Query  127  SSSCNRKLIGARFFSKGHVAASPDYSPHLVEEYISPRDSHGH  2
             S+CNRKLIGAR FSKG  AA  + S   + +Y S RD  GH
Sbjct  180  PSNCNRKLIGARSFSKGLAAAGLNISK--MYDYDSARDFAGH  219



>ref|XP_007042045.1| Subtilase family protein, putative isoform 4 [Theobroma cacao]
 gb|EOX97876.1| Subtilase family protein, putative isoform 4 [Theobroma cacao]
Length=535

 Score =   113 bits (283),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 51/96 (53%), Positives = 67/96 (70%), Gaps = 0/96 (0%)
 Frame = -1

Query  289  VTEGAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQGFNSSSCNR  110
            + +G   +S  G GTIIG++DTG+WPES SF D GM   P +WKG+CQEG+GFN S CNR
Sbjct  123  IVDGILSRSHSGVGTIIGVMDTGIWPESESFKDKGMGKVPSRWKGICQEGEGFNRSHCNR  182

Query  109  KLIGARFFSKGHVAASPDYSPHLVEEYISPRDSHGH  2
            K+IGAR++ KG+ A      P    E++SPRD+ GH
Sbjct  183  KIIGARWYVKGYEAEFGKLDPSDGVEFMSPRDASGH  218



>ref|XP_010068558.1| PREDICTED: subtilisin-like protease [Eucalyptus grandis]
Length=765

 Score =   115 bits (287),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 58/102 (57%), Positives = 69/102 (68%), Gaps = 2/102 (2%)
 Frame = -1

Query  307  KFLGLSVTEGAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQGFN  128
            KFLGL  + G W  S +G G IIG+LDTG+WPES SF D GMPP P +WKG C+ G  F+
Sbjct  125  KFLGLKHSSGLWPNSSYGEGVIIGILDTGIWPESASFCDKGMPPVPPRWKGECENGTAFS  184

Query  127  SSSCNRKLIGARFFSKGHVAASPDYSPHLVEEYISPRDSHGH  2
             S+CNRKLIGAR FSKG  AA  + S   + +Y S RD  GH
Sbjct  185  PSNCNRKLIGARSFSKGLAAAGLNISK--MYDYDSARDFAGH  224



>gb|EYU36340.1| hypothetical protein MIMGU_mgv1a001790mg [Erythranthe guttata]
Length=759

 Score =   114 bits (286),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 58/103 (56%), Positives = 70/103 (68%), Gaps = 5/103 (5%)
 Frame = -1

Query  310  YKFLGLSVTEGAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQGF  131
            YKFL L+   G W  S +G   IIG+LDTG+WPESPSF D GM   P KWKG CQ GQ F
Sbjct  112  YKFLSLNTATGLWPASNYGKDVIIGILDTGIWPESPSFRDEGMTAIPAKWKGSCQGGQDF  171

Query  130  NSSSCNRKLIGARFFSKGHVAASPDYSPHLVEEYISPRDSHGH  2
            NSS CN+KLIG R+F++G  AA P+ +P  V +  S RD+ GH
Sbjct  172  NSSLCNKKLIGVRYFNQGTRAAQPE-TP--VPD--SARDNDGH  209



>ref|XP_006422999.1| hypothetical protein CICLE_v10027863mg [Citrus clementina]
 gb|ESR36239.1| hypothetical protein CICLE_v10027863mg [Citrus clementina]
Length=778

 Score =   115 bits (287),  Expect = 4e-27, Method: Composition-based stats.
 Identities = 54/102 (53%), Positives = 68/102 (67%), Gaps = 2/102 (2%)
 Frame = -1

Query  307  KFLGLSVTEGAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQGFN  128
            +FLGL+   G W  + FG   I+G+LDTG+WPES S+DD GMPP P +W+G C+ G  FN
Sbjct  120  QFLGLNKHAGVWPAAGFGSDIIVGILDTGIWPESKSYDDRGMPPVPERWRGACEVGVQFN  179

Query  127  SSSCNRKLIGARFFSKGHVAASPDYSPHLVEEYISPRDSHGH  2
            +S CNRKLIGAR FSKG      + S    ++Y SPRD  GH
Sbjct  180  TSHCNRKLIGARSFSKGIRQNGLNISK--TDDYDSPRDFFGH  219



>ref|XP_006342631.1| PREDICTED: subtilisin-like protease-like [Solanum tuberosum]
Length=755

 Score =   114 bits (286),  Expect = 4e-27, Method: Composition-based stats.
 Identities = 54/102 (53%), Positives = 72/102 (71%), Gaps = 4/102 (4%)
 Frame = -1

Query  307  KFLGLSVTEGAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQGFN  128
            +FLGL+   GAW KS +G   IIGL+DTGVWPES S++D GM   P +WKG C+ G  FN
Sbjct  115  QFLGLNSNSGAWPKSDYGRDVIIGLVDTGVWPESKSYNDNGMIDVPSRWKGECESGTQFN  174

Query  127  SSSCNRKLIGARFFSKGHVAASPDYSPHLVEEYISPRDSHGH  2
            SS CN+KLIGAR+F+KG +A++P+ +  +     S RD+ GH
Sbjct  175  SSLCNKKLIGARYFNKGLIASNPNITIVMN----SARDTTGH  212



>ref|XP_010112177.1| Subtilisin-like protease [Morus notabilis]
 gb|EXC32843.1| Subtilisin-like protease [Morus notabilis]
Length=767

 Score =   114 bits (286),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 55/103 (53%), Positives = 70/103 (68%), Gaps = 4/103 (4%)
 Frame = -1

Query  310  YKFLGLSVTEGAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQGF  131
            +KFLGL+   GAW +S +G   IIGL+DTGVWPES SF+D GM   P +WKG C+ G  F
Sbjct  123  FKFLGLNSNSGAWRESNYGENVIIGLVDTGVWPESASFNDDGMSEIPSRWKGECETGTQF  182

Query  130  NSSSCNRKLIGARFFSKGHVAASPDYSPHLVEEYISPRDSHGH  2
            NSS CN+KLIGAR F+KG +A  P+ +  +     S RD+ GH
Sbjct  183  NSSLCNKKLIGARIFNKGLLAKYPNTTIAMN----STRDTSGH  221



>ref|XP_002284864.1| PREDICTED: subtilisin-like protease [Vitis vinifera]
Length=763

 Score =   114 bits (286),  Expect = 5e-27, Method: Composition-based stats.
 Identities = 55/102 (54%), Positives = 69/102 (68%), Gaps = 4/102 (4%)
 Frame = -1

Query  307  KFLGLSVTEGAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQGFN  128
            +FL L+   G W  S FG   I+G++DTGVWPES SF D GM   P +WKG C+EGQ FN
Sbjct  126  EFLKLNQISGLWPASDFGKDVIVGVIDTGVWPESASFKDDGMTQIPARWKGTCEEGQEFN  185

Query  127  SSSCNRKLIGARFFSKGHVAASPDYSPHLVEEYISPRDSHGH  2
            SS CNRKLIGAR+F+KG +AA+P  +  +     S RD+ GH
Sbjct  186  SSMCNRKLIGARYFNKGVIAANPGVNLTMN----SARDTQGH  223



>ref|XP_007041871.1| Subtilisin-like serine protease 2 [Theobroma cacao]
 gb|EOX97702.1| Subtilisin-like serine protease 2 [Theobroma cacao]
Length=774

 Score =   114 bits (286),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 55/106 (52%), Positives = 68/106 (64%), Gaps = 4/106 (4%)
 Frame = -1

Query  307  KFLGLSVTEGAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQGFN  128
            +FLGL    G W  S +G   IIG+ DTG+WPE  SF D  + P P +WKGVCQ G  F 
Sbjct  111  QFLGLRNQHGLWSDSDYGSDVIIGVFDTGIWPERRSFSDTNLGPIPARWKGVCQTGAKFV  170

Query  127  SSSCNRKLIGARFFSKGHVAAS----PDYSPHLVEEYISPRDSHGH  2
            + +CNRKLIGARFFSKGH AA+    P    +   E++SPRD+ GH
Sbjct  171  AKNCNRKLIGARFFSKGHEAAAGLGGPIAGINETIEFMSPRDADGH  216



>gb|EYU45084.1| hypothetical protein MIMGU_mgv1a001942mg [Erythranthe guttata]
Length=736

 Score =   114 bits (285),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 56/103 (54%), Positives = 68/103 (66%), Gaps = 4/103 (4%)
 Frame = -1

Query  310  YKFLGLSVTEGAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQGF  131
            YKFL L+   G W  S +G   I+G++D+GVWPESPSF D GMP  P +WKG CQEG  F
Sbjct  112  YKFLSLNHVTGLWPTSNYGEDIIVGVIDSGVWPESPSFKDHGMPEIPKRWKGTCQEGPNF  171

Query  130  NSSSCNRKLIGARFFSKGHVAASPDYSPHLVEEYISPRDSHGH  2
            NSS CNRKLIG ++F KG  AA+ D    L  +  S RD+ GH
Sbjct  172  NSSLCNRKLIGVQYFDKGAKAANLD----LNTDNNSGRDTKGH  210



>gb|ABR16566.1| unknown [Picea sitchensis]
Length=522

 Score =   112 bits (281),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 54/101 (53%), Positives = 68/101 (67%), Gaps = 2/101 (2%)
 Frame = -1

Query  304  FLGLSVTEGAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQGFNS  125
            FLGLS + G W  SR+G   I+G+LDTG+WPES SF+D G+ P P +WKG C+ G  FN+
Sbjct  122  FLGLSSSHGLWPLSRYGDDIIVGVLDTGIWPESKSFNDQGLTPVPARWKGECEVGTEFNA  181

Query  124  SSCNRKLIGARFFSKGHVAASPDYSPHLVEEYISPRDSHGH  2
            S CN KLIGAR+F KG+ A          E+Y SPRD+ GH
Sbjct  182  SHCNNKLIGARYFLKGYEAKFGRIDEK--EDYRSPRDADGH  220



>ref|XP_011029640.1| PREDICTED: subtilisin-like protease [Populus euphratica]
Length=779

 Score =   114 bits (286),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 57/102 (56%), Positives = 69/102 (68%), Gaps = 4/102 (4%)
 Frame = -1

Query  307  KFLGLSVTEGAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQGFN  128
            KFLGL+    AW  S  G G IIGL+D+GVWPES S++D GM   P +WKG CQ G  FN
Sbjct  129  KFLGLAPQSPAWKASNLGDGIIIGLVDSGVWPESESYNDHGMSEIPKRWKGGCQSGAQFN  188

Query  127  SSSCNRKLIGARFFSKGHVAASPDYSPHLVEEYISPRDSHGH  2
            SS CN+KLIGARFF+KG +A +PD +  L     S RD+ GH
Sbjct  189  SSMCNKKLIGARFFNKGLIANNPDITISLN----STRDTDGH  226



>ref|XP_010068466.1| PREDICTED: subtilisin-like protease [Eucalyptus grandis]
Length=763

 Score =   114 bits (285),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 54/102 (53%), Positives = 71/102 (70%), Gaps = 2/102 (2%)
 Frame = -1

Query  307  KFLGLSVTEGAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQGFN  128
            KFLGL+  +G W +++FG G I+G++D+G+WPES SF D GM P P +W+G C+ G  FN
Sbjct  115  KFLGLNRQKGLWPRAKFGDGVIVGVVDSGIWPESESFKDKGMSPVPERWRGSCESGVAFN  174

Query  127  SSSCNRKLIGARFFSKGHVAASPDYSPHLVEEYISPRDSHGH  2
            SS+CNRKLIGAR FSKG      + S    ++Y SPRD  GH
Sbjct  175  SSNCNRKLIGARSFSKGLKHRGLNIS--TTDDYDSPRDFFGH  214



>ref|XP_010266807.1| PREDICTED: subtilisin-like protease [Nelumbo nucifera]
Length=779

 Score =   114 bits (285),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 56/108 (52%), Positives = 70/108 (65%), Gaps = 6/108 (6%)
 Frame = -1

Query  307  KFLGLSVTEGAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQGFN  128
            +FLGL   +G W +S +G   IIG+LDTG+WPE  SF D  + P P +WKGVC+ G  F+
Sbjct  114  QFLGLRYQQGLWSESNYGSDVIIGILDTGIWPERRSFSDLNLGPVPARWKGVCETGVQFS  173

Query  127  SSSCNRKLIGARFFSKGHVAASPDYSP------HLVEEYISPRDSHGH  2
            S+ CNRKLIGARFFSKGH AA     P      +   E+ SPRD+ GH
Sbjct  174  SAHCNRKLIGARFFSKGHEAAGRFGGPGGIGGINETVEFRSPRDADGH  221



>ref|XP_011017184.1| PREDICTED: subtilisin-like protease [Populus euphratica]
Length=772

 Score =   114 bits (285),  Expect = 6e-27, Method: Composition-based stats.
 Identities = 57/102 (56%), Positives = 68/102 (67%), Gaps = 4/102 (4%)
 Frame = -1

Query  307  KFLGLSVTEGAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQGFN  128
            KFLGL+    AW  S +G G IIGL+DTGVWPES S+ D GM   P +WKG CQ G  FN
Sbjct  128  KFLGLTPQSLAWKVSNYGEGIIIGLVDTGVWPESQSYKDHGMSEIPKRWKGECQSGTQFN  187

Query  127  SSSCNRKLIGARFFSKGHVAASPDYSPHLVEEYISPRDSHGH  2
            SS CN+KLIGARFF+KG +A  P+ +  L     S RD+ GH
Sbjct  188  SSMCNKKLIGARFFNKGLIAKYPNINISLN----SARDTDGH  225



>ref|XP_008669405.1| PREDICTED: subtilisin-like protease [Zea mays]
 tpg|DAA37771.1| TPA: putative subtilase family protein [Zea mays]
Length=771

 Score =   114 bits (285),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 59/102 (58%), Positives = 69/102 (68%), Gaps = 4/102 (4%)
 Frame = -1

Query  304  FLGL-SVTEGAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQGFN  128
            FLGL S   G W  S++G G IIG++DTGVWPES SF DAGM P P  WKG C+ GQ F 
Sbjct  115  FLGLVSGGSGVWPASKYGDGVIIGIVDTGVWPESESFSDAGMGPVPAGWKGACEAGQAFR  174

Query  127  SSSCNRKLIGARFFSKGHVAASPDYSPHLVEEYISPRDSHGH  2
            +S+CNRKLIGAR FSKG        SP   ++Y SPRD +GH
Sbjct  175  ASACNRKLIGARSFSKGLKQRGITVSP---DDYDSPRDYYGH  213



>ref|XP_010092449.1| Subtilisin-like protease SDD1 [Morus notabilis]
 gb|EXB51215.1| Subtilisin-like protease SDD1 [Morus notabilis]
Length=403

 Score =   111 bits (278),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 49/90 (54%), Positives = 66/90 (73%), Gaps = 1/90 (1%)
 Frame = -1

Query  271  VKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQGFNSSSCNRKLIGAR  92
            + +  G GTIIG++D+GVWPES SF D GMPP P +WKG+CQ G+ FNS++CN+K+IGAR
Sbjct  141  LSNNLGQGTIIGVIDSGVWPESESFKDDGMPPIPKRWKGICQTGKEFNSTNCNKKIIGAR  200

Query  91   FFSKGHVAASPDYSPHLVEEYISPRDSHGH  2
            +F+KG +    D    L + + SPRD HGH
Sbjct  201  WFAKGLLEVK-DLGMELTQLHKSPRDIHGH  229



>ref|XP_006487123.1| PREDICTED: subtilisin-like protease-like [Citrus sinensis]
Length=778

 Score =   114 bits (285),  Expect = 7e-27, Method: Composition-based stats.
 Identities = 54/102 (53%), Positives = 67/102 (66%), Gaps = 2/102 (2%)
 Frame = -1

Query  307  KFLGLSVTEGAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQGFN  128
            +FLGL    G W  + FG   I+G+LDTG+WPES S+DD GMPP P +W+G C+ G  FN
Sbjct  120  QFLGLKKHAGVWPAAGFGSDIIVGILDTGIWPESKSYDDRGMPPVPERWRGACEVGVEFN  179

Query  127  SSSCNRKLIGARFFSKGHVAASPDYSPHLVEEYISPRDSHGH  2
            +S CNRKLIGAR FSKG      + S    ++Y SPRD  GH
Sbjct  180  TSHCNRKLIGARSFSKGIRQNGLNIST--TDDYDSPRDFFGH  219



>ref|XP_006857970.1| hypothetical protein AMTR_s00069p00178060 [Amborella trichopoda]
 gb|ERN19437.1| hypothetical protein AMTR_s00069p00178060 [Amborella trichopoda]
Length=756

 Score =   114 bits (285),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 57/103 (55%), Positives = 72/103 (70%), Gaps = 4/103 (4%)
 Frame = -1

Query  307  KFLGLSVTEGAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQE-GQGF  131
            +FLGLS  +G W ++ FG GTI+G+LDTG+WPE PS D AGMPP P KWKGVC + G+ F
Sbjct  110  QFLGLSPNQGVWPEAGFGNGTIVGVLDTGIWPEHPSLDPAGMPPPPAKWKGVCVDAGEEF  169

Query  130  NSSSCNRKLIGARFFSKGHVAASPDYSPHLVEEYISPRDSHGH  2
            NSS+CN KLIGA+FF+ G  A   +     +    SPRD+ GH
Sbjct  170  NSSNCNNKLIGAQFFNAGAKAMLGEAE---LPGLNSPRDTDGH  209



>ref|XP_006487074.1| PREDICTED: subtilisin-like protease-like [Citrus sinensis]
Length=588

 Score =   113 bits (282),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 57/102 (56%), Positives = 66/102 (65%), Gaps = 2/102 (2%)
 Frame = -1

Query  307  KFLGLSVTEGAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQGFN  128
            KFLGL    G W  + FG   I+G++DTGVWPESPSF D GMPP P +W+G C+ G  FN
Sbjct  128  KFLGLKKQAGLWPAAGFGSHVIVGVIDTGVWPESPSFKDDGMPPVPERWRGACEVGVEFN  187

Query  127  SSSCNRKLIGARFFSKGHVAASPDYSPHLVEEYISPRDSHGH  2
            +S CNRKLIGAR FSKG      + S     EY SPRD  GH
Sbjct  188  ASHCNRKLIGARSFSKGLKHYGLNISTTF--EYDSPRDFLGH  227



>gb|AFW84453.1| putative subtilase family protein [Zea mays]
Length=770

 Score =   114 bits (285),  Expect = 7e-27, Method: Composition-based stats.
 Identities = 53/102 (52%), Positives = 70/102 (69%), Gaps = 4/102 (4%)
 Frame = -1

Query  307  KFLGLSVTEGAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQGFN  128
            +FL L+   G W  S+FG G IIG++DTG+WPES SF+DAGMPP P +W+G C+ G  F 
Sbjct  127  EFLNLNSASGLWPASKFGEGVIIGMIDTGLWPESASFNDAGMPPVPSRWRGTCEPGVQFT  186

Query  127  SSSCNRKLIGARFFSKGHVAASPDYSPHLVEEYISPRDSHGH  2
             S CNRKL+GAR+F++G VAA+P     +     S RD+ GH
Sbjct  187  PSMCNRKLVGARYFNRGLVAANPGVKISMN----STRDTEGH  224



>ref|XP_006487073.1| PREDICTED: subtilisin-like protease-like [Citrus sinensis]
Length=691

 Score =   114 bits (284),  Expect = 7e-27, Method: Composition-based stats.
 Identities = 55/102 (54%), Positives = 65/102 (64%), Gaps = 2/102 (2%)
 Frame = -1

Query  307  KFLGLSVTEGAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQGFN  128
            KFLGL    G W  + FG   I+G++DTGVWPESPSF D GMPP P +W+G C+ G  FN
Sbjct  128  KFLGLKKQAGLWPAAGFGSHVIVGVIDTGVWPESPSFKDDGMPPVPERWRGACEVGVEFN  187

Query  127  SSSCNRKLIGARFFSKGHVAASPDYSPHLVEEYISPRDSHGH  2
            +S CNRKLIGAR F+KG        S     +Y SPRD  GH
Sbjct  188  ASHCNRKLIGARSFNKGLKQYGLKISTTF--DYDSPRDFFGH  227



>ref|XP_009790288.1| PREDICTED: subtilisin-like protease [Nicotiana sylvestris]
Length=764

 Score =   114 bits (284),  Expect = 8e-27, Method: Composition-based stats.
 Identities = 52/102 (51%), Positives = 71/102 (70%), Gaps = 4/102 (4%)
 Frame = -1

Query  307  KFLGLSVTEGAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQGFN  128
            +FLGL+   GAW KS +G   I+GL+DTG+WPES S++D GM   P +WKG C+ G  FN
Sbjct  124  QFLGLNSNSGAWPKSDYGKDVIVGLVDTGIWPESKSYNDNGMTEVPSRWKGECESGTQFN  183

Query  127  SSSCNRKLIGARFFSKGHVAASPDYSPHLVEEYISPRDSHGH  2
            SS CN+KLIGAR+F+KG +A +P+ +  +     S RD+ GH
Sbjct  184  SSLCNKKLIGARYFNKGLIANNPNITISMN----SARDTDGH  221



>ref|XP_009800439.1| PREDICTED: subtilisin-like protease [Nicotiana sylvestris]
Length=764

 Score =   114 bits (284),  Expect = 8e-27, Method: Composition-based stats.
 Identities = 52/102 (51%), Positives = 71/102 (70%), Gaps = 4/102 (4%)
 Frame = -1

Query  307  KFLGLSVTEGAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQGFN  128
            +FLGL+   GAW KS +G   I+GL+DTG+WPES S++D GM   P +WKG C+ G  FN
Sbjct  124  QFLGLNSNSGAWPKSDYGKDVIVGLVDTGIWPESKSYNDNGMTEVPSRWKGECESGTQFN  183

Query  127  SSSCNRKLIGARFFSKGHVAASPDYSPHLVEEYISPRDSHGH  2
            SS CN+KLIGAR+F+KG +A +P+ +  +     S RD+ GH
Sbjct  184  SSLCNKKLIGARYFNKGLIANNPNITISMN----SARDTDGH  221



>ref|XP_006422997.1| hypothetical protein CICLE_v10027850mg [Citrus clementina]
 gb|ESR36237.1| hypothetical protein CICLE_v10027850mg [Citrus clementina]
Length=793

 Score =   114 bits (284),  Expect = 8e-27, Method: Composition-based stats.
 Identities = 55/102 (54%), Positives = 66/102 (65%), Gaps = 2/102 (2%)
 Frame = -1

Query  307  KFLGLSVTEGAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQGFN  128
            KFLGL    G W  + FG   I+G++D+GVWPESPSF D GMPP P +W+G C+ G  FN
Sbjct  128  KFLGLKKQAGLWPAAGFGSDVIVGVIDSGVWPESPSFKDDGMPPVPERWRGACEVGVEFN  187

Query  127  SSSCNRKLIGARFFSKGHVAASPDYSPHLVEEYISPRDSHGH  2
            +S CNRKLIGAR FSKG      + S     +Y SPRD  GH
Sbjct  188  ASHCNRKLIGARSFSKGLKHYGLNISTTF--DYDSPRDFLGH  227



>gb|EYU36336.1| hypothetical protein MIMGU_mgv1a019012mg, partial [Erythranthe 
guttata]
Length=733

 Score =   114 bits (284),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 54/102 (53%), Positives = 69/102 (68%), Gaps = 4/102 (4%)
 Frame = -1

Query  307  KFLGLSVTEGAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQGFN  128
            KFL L+   G W  S +G   IIG++DTG+WPESPSF D GM   P +WKG+C+EG+ FN
Sbjct  88   KFLSLNSATGLWPASNYGKDVIIGVIDTGIWPESPSFRDDGMTEIPTRWKGICEEGEEFN  147

Query  127  SSSCNRKLIGARFFSKGHVAASPDYSPHLVEEYISPRDSHGH  2
            SSSCNRK+IGAR+F +G  AA+P  +  +     S RD  GH
Sbjct  148  SSSCNRKIIGARYFREGLRAANPGVAIPMY----SARDIDGH  185



>ref|XP_009799242.1| PREDICTED: subtilisin-like protease [Nicotiana sylvestris]
Length=757

 Score =   114 bits (284),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 55/101 (54%), Positives = 68/101 (67%), Gaps = 4/101 (4%)
 Frame = -1

Query  304  FLGLSVTEGAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQGFNS  125
            FLGL+   G+W KS +G   IIG++DTGVWPES SFDD GM   P +WKG+CQ G  FNS
Sbjct  121  FLGLNSMSGSWPKSNYGKYVIIGVVDTGVWPESRSFDDDGMTQVPSRWKGICQTGTQFNS  180

Query  124  SSCNRKLIGARFFSKGHVAASPDYSPHLVEEYISPRDSHGH  2
            S CN+KLIGAR+F+KG +A   +    L     S RD+ GH
Sbjct  181  SLCNKKLIGARYFNKGLLAKVKN----LTITRNSARDTEGH  217



>ref|XP_002282304.3| PREDICTED: subtilisin-like protease [Vitis vinifera]
Length=732

 Score =   114 bits (284),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 57/102 (56%), Positives = 68/102 (67%), Gaps = 2/102 (2%)
 Frame = -1

Query  307  KFLGLSVTEGAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQGFN  128
            KFLGL    G+W K +FG   IIG+LD+G+WPES SF D GM P P +W+G C+ G  FN
Sbjct  81   KFLGLEKKVGSWPKGKFGEDMIIGILDSGIWPESESFKDKGMAPVPDRWRGACESGVEFN  140

Query  127  SSSCNRKLIGARFFSKGHVAASPDYSPHLVEEYISPRDSHGH  2
            SS CNRKLIGAR FSKG      + S  L ++Y SPRD  GH
Sbjct  141  SSYCNRKLIGARSFSKGMKQRGLNIS--LPDDYDSPRDFLGH  180



>ref|XP_006487072.1| PREDICTED: subtilisin-like protease-like [Citrus sinensis]
Length=775

 Score =   114 bits (284),  Expect = 9e-27, Method: Composition-based stats.
 Identities = 55/102 (54%), Positives = 65/102 (64%), Gaps = 2/102 (2%)
 Frame = -1

Query  307  KFLGLSVTEGAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQGFN  128
            KFLGL    G W  + FG   I+G++DTGVWPESPSF D GMPP P +W+G C+ G  FN
Sbjct  118  KFLGLKKQAGLWPAAGFGSHVIVGVIDTGVWPESPSFKDDGMPPVPERWRGACEVGVEFN  177

Query  127  SSSCNRKLIGARFFSKGHVAASPDYSPHLVEEYISPRDSHGH  2
            +S CNRKLIGAR F+KG        S     +Y SPRD  GH
Sbjct  178  ASHCNRKLIGARSFNKGLKQYGLKISTTF--DYDSPRDFFGH  217



>ref|XP_010059918.1| PREDICTED: subtilisin-like protease [Eucalyptus grandis]
 gb|KCW66394.1| hypothetical protein EUGRSUZ_F00208 [Eucalyptus grandis]
Length=768

 Score =   113 bits (283),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 54/102 (53%), Positives = 69/102 (68%), Gaps = 4/102 (4%)
 Frame = -1

Query  307  KFLGLSVTEGAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQGFN  128
            +FLGL+   GAW  S +G   I+GL+DTGVWPESPSF+D GM   P KWKG C+ G  FN
Sbjct  125  QFLGLNSNSGAWPISDYGKDVIVGLVDTGVWPESPSFNDGGMTTIPSKWKGECEVGTQFN  184

Query  127  SSSCNRKLIGARFFSKGHVAASPDYSPHLVEEYISPRDSHGH  2
            SS CN+KLIGAR+F+K  +A +P+    +     S RD+ GH
Sbjct  185  SSMCNKKLIGARYFNKALMAKNPN----ITFSMNSTRDTDGH  222



>ref|XP_008785865.1| PREDICTED: subtilisin-like protease [Phoenix dactylifera]
Length=760

 Score =   113 bits (283),  Expect = 1e-26, Method: Composition-based stats.
 Identities = 54/102 (53%), Positives = 70/102 (69%), Gaps = 4/102 (4%)
 Frame = -1

Query  307  KFLGLSVTEGAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQGFN  128
            +FL LS   G W  S +G   IIG++D+G+WPES SF D GM   P +WKGVC++G  F+
Sbjct  117  EFLHLSSASGLWPASNYGEDVIIGVVDSGIWPESESFSDYGMTDVPARWKGVCEQGTTFS  176

Query  127  SSSCNRKLIGARFFSKGHVAASPDYSPHLVEEYISPRDSHGH  2
            SS+CNRKLIGAR F+KG +AA+P+    L     SPRD+ GH
Sbjct  177  SSACNRKLIGARSFNKGLLAANPN----LTIAVNSPRDTDGH  214



>emb|CAN64996.1| hypothetical protein VITISV_001780 [Vitis vinifera]
Length=769

 Score =   113 bits (283),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 59/108 (55%), Positives = 69/108 (64%), Gaps = 13/108 (12%)
 Frame = -1

Query  307  KFLGLSVTEGAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQGFN  128
            KFLGL    GAW + +FG   II +LDTGVWPES SF D GM P P +W+G C+ G  F 
Sbjct  115  KFLGLEKNSGAWPEGKFGEDMIIAILDTGVWPESESFRDKGMGPVPKRWRGACESGVEFK  174

Query  127  SSSCNRKLIGARFFSKG------HVAASPDYSPHLVEEYISPRDSHGH  2
            SS CNRKLIGAR FS+G      +V+A PD       +Y SPRD HGH
Sbjct  175  SSYCNRKLIGARSFSEGLKRRGLNVSAPPD-------DYDSPRDFHGH  215



>emb|CAN60787.1| hypothetical protein VITISV_034533 [Vitis vinifera]
Length=763

 Score =   113 bits (283),  Expect = 1e-26, Method: Composition-based stats.
 Identities = 54/102 (53%), Positives = 69/102 (68%), Gaps = 4/102 (4%)
 Frame = -1

Query  307  KFLGLSVTEGAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQGFN  128
            +FL L+   G W  S FG   I+G++DTGVWPES SF D GM   P +WKG C+EGQ FN
Sbjct  126  EFLKLNQISGLWPASDFGKDVIVGVIDTGVWPESASFKDDGMTQIPARWKGTCEEGQEFN  185

Query  127  SSSCNRKLIGARFFSKGHVAASPDYSPHLVEEYISPRDSHGH  2
            SS CNRK+IGAR+F+KG +AA+P  +  +     S RD+ GH
Sbjct  186  SSMCNRKMIGARYFNKGVIAANPGVNLTMN----SARDTQGH  223



>ref|XP_011069662.1| PREDICTED: subtilisin-like protease [Sesamum indicum]
Length=769

 Score =   113 bits (283),  Expect = 1e-26, Method: Composition-based stats.
 Identities = 54/103 (52%), Positives = 70/103 (68%), Gaps = 4/103 (4%)
 Frame = -1

Query  310  YKFLGLSVTEGAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQGF  131
            YKFL L+   G W  S++G   IIG++DTGVWPES SF D GM   P +W+G+CQEG+ F
Sbjct  123  YKFLSLNTAIGLWPASQYGKDVIIGVIDTGVWPESQSFKDDGMTEIPARWRGICQEGEEF  182

Query  130  NSSSCNRKLIGARFFSKGHVAASPDYSPHLVEEYISPRDSHGH  2
            NSS CN+KLIGAR+F++G  AA+P  +  +     S RD  GH
Sbjct  183  NSSLCNKKLIGARYFNEGVRAANPGVTITMN----SARDDDGH  221



>ref|XP_006848886.1| hypothetical protein AMTR_s00420p00013050 [Amborella trichopoda]
 gb|ERN10467.1| hypothetical protein AMTR_s00420p00013050 [Amborella trichopoda]
Length=215

 Score =   108 bits (269),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 57/103 (55%), Positives = 68/103 (66%), Gaps = 8/103 (8%)
 Frame = -1

Query  307  KFLGLSVTEGAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQE-GQGF  131
            +FLGLS   G W  +RFG GTIIG+LDTG+WPE PS +D GM   P KWKG C + G  F
Sbjct  78   RFLGLSPKHGIWPNTRFGKGTIIGVLDTGIWPEHPSLNDIGMSQPPKKWKGWCVDAGPDF  137

Query  130  NSSSCNRKLIGARFFSKGHVAASPDYSPHLVEEYISPRDSHGH  2
            NSS CN+KLIGA+ F+KG +AA  + S        SPRD  GH
Sbjct  138  NSSHCNKKLIGAQVFTKGALAAKANVSD-------SPRDDEGH  173



>ref|XP_002284869.3| PREDICTED: subtilisin-like protease [Vitis vinifera]
Length=778

 Score =   113 bits (283),  Expect = 1e-26, Method: Composition-based stats.
 Identities = 54/102 (53%), Positives = 69/102 (68%), Gaps = 4/102 (4%)
 Frame = -1

Query  307  KFLGLSVTEGAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQGFN  128
            +FL L+   G W  S FG   I+G++DTGVWPES SF D GM   P +WKG C+EGQ FN
Sbjct  141  EFLKLNQISGLWPASDFGKDVIVGVIDTGVWPESASFKDDGMTQIPARWKGTCEEGQEFN  200

Query  127  SSSCNRKLIGARFFSKGHVAASPDYSPHLVEEYISPRDSHGH  2
            SS CNRK+IGAR+F+KG +AA+P  +  +     S RD+ GH
Sbjct  201  SSMCNRKMIGARYFNKGVIAANPGVNLTMN----SARDTQGH  238



>ref|XP_007042042.1| Subtilase family protein, putative isoform 1 [Theobroma cacao]
 gb|EOX97873.1| Subtilase family protein, putative isoform 1 [Theobroma cacao]
Length=778

 Score =   113 bits (282),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 51/96 (53%), Positives = 67/96 (70%), Gaps = 0/96 (0%)
 Frame = -1

Query  289  VTEGAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQGFNSSSCNR  110
            + +G   +S  G GTIIG++DTG+WPES SF D GM   P +WKG+CQEG+GFN S CNR
Sbjct  123  IVDGILSRSHSGVGTIIGVMDTGIWPESESFKDKGMGKVPSRWKGICQEGEGFNRSHCNR  182

Query  109  KLIGARFFSKGHVAASPDYSPHLVEEYISPRDSHGH  2
            K+IGAR++ KG+ A      P    E++SPRD+ GH
Sbjct  183  KIIGARWYVKGYEAEFGKLDPSDGVEFMSPRDASGH  218



>ref|XP_002523606.1| Cucumisin precursor, putative [Ricinus communis]
 gb|EEF38801.1| Cucumisin precursor, putative [Ricinus communis]
Length=768

 Score =   113 bits (282),  Expect = 1e-26, Method: Composition-based stats.
 Identities = 54/102 (53%), Positives = 67/102 (66%), Gaps = 4/102 (4%)
 Frame = -1

Query  307  KFLGLSVTEGAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQGFN  128
            +FLGLS   GAW  + +G   IIGL+DTG+WPES SF D GM   P +W+G C  G  FN
Sbjct  128  QFLGLSSVSGAWPATSYGEDVIIGLVDTGIWPESQSFSDVGMSSIPSRWRGKCSSGTHFN  187

Query  127  SSSCNRKLIGARFFSKGHVAASPDYSPHLVEEYISPRDSHGH  2
            SS CN+KLIGA FF+KG +A     +P L     SPRD++GH
Sbjct  188  SSLCNKKLIGAHFFNKGLLAN----NPKLKISVNSPRDTNGH  225



>ref|XP_007042044.1| Subtilase family protein, putative isoform 3 [Theobroma cacao]
 gb|EOX97875.1| Subtilase family protein, putative isoform 3 [Theobroma cacao]
Length=801

 Score =   113 bits (283),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 51/96 (53%), Positives = 67/96 (70%), Gaps = 0/96 (0%)
 Frame = -1

Query  289  VTEGAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQGFNSSSCNR  110
            + +G   +S  G GTIIG++DTG+WPES SF D GM   P +WKG+CQEG+GFN S CNR
Sbjct  123  IVDGILSRSHSGVGTIIGVMDTGIWPESESFKDKGMGKVPSRWKGICQEGEGFNRSHCNR  182

Query  109  KLIGARFFSKGHVAASPDYSPHLVEEYISPRDSHGH  2
            K+IGAR++ KG+ A      P    E++SPRD+ GH
Sbjct  183  KIIGARWYVKGYEAEFGKLDPSDGVEFMSPRDASGH  218



>gb|EYU45081.1| hypothetical protein MIMGU_mgv1a002217mg [Erythranthe guttata]
Length=700

 Score =   113 bits (282),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 55/103 (53%), Positives = 67/103 (65%), Gaps = 6/103 (6%)
 Frame = -1

Query  310  YKFLGLSVTEGAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQGF  131
            Y+FLGL+   GAW  S +G   IIGL+DTG+WPES SF D G+   P +W+GVC+    F
Sbjct  115  YRFLGLNHDHGAWPASNYGDNVIIGLVDTGIWPESKSFKDDGIGEIPSRWRGVCESCSDF  174

Query  130  NSSSCNRKLIGARFFSKGHVAASPDYSPHLVEEYISPRDSHGH  2
            NSS CNRKLIGAR F KG +A  P+ S        SPRD+ GH
Sbjct  175  NSSLCNRKLIGARSFGKGMLAKKPEMSMS------SPRDTEGH  211



>ref|XP_008357385.1| PREDICTED: subtilisin-like protease [Malus domestica]
Length=772

 Score =   113 bits (282),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 55/102 (54%), Positives = 70/102 (69%), Gaps = 4/102 (4%)
 Frame = -1

Query  307  KFLGLSVTEGAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQGFN  128
            +FLGL+   GAW  S +G   IIGL+DTGVWPES SF++ GM   P +WKG C+ G  FN
Sbjct  127  QFLGLNSRSGAWPVSNYGKDVIIGLVDTGVWPESESFNEDGMSEIPPRWKGECEXGTQFN  186

Query  127  SSSCNRKLIGARFFSKGHVAASPDYSPHLVEEYISPRDSHGH  2
            SS CN+KLIGA+FF+KG +A +P+    L  E  S RD+ GH
Sbjct  187  SSLCNKKLIGAKFFNKGLIAQNPN----LTIEVNSTRDTEGH  224



>emb|CDP17956.1| unnamed protein product [Coffea canephora]
Length=725

 Score =   112 bits (281),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 56/102 (55%), Positives = 68/102 (67%), Gaps = 4/102 (4%)
 Frame = -1

Query  307  KFLGLSVTEGAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQGFN  128
            KFLGL+   GAW  S +G   IIGL+D+GVWPES S+ D GM   P +WKG C+ G  FN
Sbjct  83   KFLGLNSKYGAWPNSDYGKDVIIGLVDSGVWPESKSYSDDGMTEIPSRWKGQCESGTQFN  142

Query  127  SSSCNRKLIGARFFSKGHVAASPDYSPHLVEEYISPRDSHGH  2
            SSSCN+KLIGARFF+KG +A  P+    L     S RD+ GH
Sbjct  143  SSSCNKKLIGARFFNKGLLAKFPN----LTISMNSTRDTDGH  180



>gb|KDP41714.1| hypothetical protein JCGZ_16121 [Jatropha curcas]
Length=724

 Score =   112 bits (281),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 51/79 (65%), Positives = 60/79 (76%), Gaps = 0/79 (0%)
 Frame = -1

Query  304  FLGLSVTEGAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQGFNS  125
            FLGL+   GAW  S +G   IIG++DTGVWPES SF D GMP  P +WKG+C+ GQ FNS
Sbjct  80   FLGLTSNSGAWKVSNYGEDIIIGVVDTGVWPESESFGDKGMPKIPKRWKGICESGQQFNS  139

Query  124  SSCNRKLIGARFFSKGHVA  68
            SSCN KLIGARFF+KG +A
Sbjct  140  SSCNNKLIGARFFNKGLLA  158



>ref|XP_008785920.1| PREDICTED: LOW QUALITY PROTEIN: subtilisin-like protease [Phoenix 
dactylifera]
Length=764

 Score =   112 bits (281),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 55/102 (54%), Positives = 69/102 (68%), Gaps = 4/102 (4%)
 Frame = -1

Query  307  KFLGLSVTEGAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQGFN  128
            +FL LS   G W  S +G   IIG++DTG+WPES SF D GM   P +WKGVC++G  F+
Sbjct  118  EFLHLSSGSGLWPASNYGEDVIIGVVDTGIWPESKSFSDDGMTDVPARWKGVCEQGTAFS  177

Query  127  SSSCNRKLIGARFFSKGHVAASPDYSPHLVEEYISPRDSHGH  2
            SS+CNRKLIGAR F+KG +AA P+    L     SPRD+ GH
Sbjct  178  SSACNRKLIGARSFNKGLLAAHPN----LTIVVNSPRDTEGH  215



>ref|XP_010093626.1| Subtilisin-like protease [Morus notabilis]
 gb|EXB54387.1| Subtilisin-like protease [Morus notabilis]
Length=724

 Score =   112 bits (281),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 56/102 (55%), Positives = 66/102 (65%), Gaps = 4/102 (4%)
 Frame = -1

Query  307  KFLGLSVTEGAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQGFN  128
            KFLGLS   G W  S +G G IIG++DTGVWPES SF D GM   P +WKG C  G+ FN
Sbjct  83   KFLGLSQNSGVWPASSYGEGVIIGVVDTGVWPESESFSDKGMTKVPSRWKGKCVPGEKFN  142

Query  127  SSSCNRKLIGARFFSKGHVAASPDYSPHLVEEYISPRDSHGH  2
            SS CN+KLIGARF++KG  A  P +   +     SPRD  GH
Sbjct  143  SSLCNKKLIGARFYNKGLHANIPKFKISMN----SPRDDDGH  180



>ref|XP_001755716.1| predicted protein [Physcomitrella patens]
 gb|EDQ79389.1| predicted protein [Physcomitrella patens]
Length=720

 Score =   112 bits (281),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 55/102 (54%), Positives = 69/102 (68%), Gaps = 2/102 (2%)
 Frame = -1

Query  307  KFLGLSVTEGAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQGFN  128
            +FLGLS TEG W +S FG   I+G+LD+GVWPE  SF D G+ P P +WKG CQ G  FN
Sbjct  65   EFLGLSSTEGLWPESNFGDDVIVGVLDSGVWPEGESFSDKGLGPVPSRWKGSCQSGPDFN  124

Query  127  SSSCNRKLIGARFFSKGHVAASPDYSPHLVEEYISPRDSHGH  2
             S CN K+IGAR+FS G+ AA+   +  +  E  SPRD+ GH
Sbjct  125  VSLCNNKIIGARYFSAGYEAATGPMNDTI--ESRSPRDTEGH  164



>gb|EYU19442.1| hypothetical protein MIMGU_mgv1a001731mg [Erythranthe guttata]
Length=768

 Score =   112 bits (281),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 54/102 (53%), Positives = 68/102 (67%), Gaps = 4/102 (4%)
 Frame = -1

Query  307  KFLGLSVTEGAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQGFN  128
            +FL L+   G W  S +G   IIG++DTG+WPES SF D GM   P +WKG+CQ GQ FN
Sbjct  124  QFLSLNTAAGLWPASDYGKDVIIGVIDTGIWPESRSFSDTGMTEIPPRWKGICQTGQEFN  183

Query  127  SSSCNRKLIGARFFSKGHVAASPDYSPHLVEEYISPRDSHGH  2
            SSSCN+K+IGAR+F++G+ A SPD     V    S RD  GH
Sbjct  184  SSSCNKKIIGARYFNQGYRAESPDS----VITMNSARDVDGH  221



>ref|XP_010484555.1| PREDICTED: subtilisin-like protease [Camelina sativa]
Length=737

 Score =   112 bits (281),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 55/103 (53%), Positives = 71/103 (69%), Gaps = 5/103 (5%)
 Frame = -1

Query  307  KFLGLSVTEGAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQGFN  128
            +F+GL+ T G W  S +G GT+IG++DTG+WP+SPSF D G+   P KWKG CQ    FN
Sbjct  107  QFIGLNSTSGTWPVSNYGAGTVIGIIDTGIWPDSPSFHDDGLGSVPSKWKGECQ----FN  162

Query  127  SSS-CNRKLIGARFFSKGHVAASPDYSPHLVEEYISPRDSHGH  2
            SSS CN+KLIGAR F+KG  A +PD     + +Y SP D+ GH
Sbjct  163  SSSLCNKKLIGARLFNKGLFANNPDLRGTKIGQYSSPYDTIGH  205



>ref|XP_009762584.1| PREDICTED: subtilisin-like protease isoform X4 [Nicotiana sylvestris]
 ref|XP_009762585.1| PREDICTED: subtilisin-like protease isoform X4 [Nicotiana sylvestris]
Length=767

 Score =   112 bits (281),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 52/102 (51%), Positives = 68/102 (67%), Gaps = 2/102 (2%)
 Frame = -1

Query  307  KFLGLSVTEGAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQGFN  128
            +FLGL    G W  S      I+G++DTG+WPE  SF D+GMPP P +WKG C+ G  F+
Sbjct  122  QFLGLKSGSGLWSASNLTSDVIVGVIDTGIWPEHLSFRDSGMPPVPSRWKGKCEAGTRFS  181

Query  127  SSSCNRKLIGARFFSKGHVAASPDYSPHLVEEYISPRDSHGH  2
             S+CN+K+IGAR FSKG+ AA+   +    E+Y SPRDS GH
Sbjct  182  PSNCNKKIIGARIFSKGYEAAAGKINE--TEDYRSPRDSQGH  221



>ref|XP_009762581.1| PREDICTED: subtilisin-like protease isoform X1 [Nicotiana sylvestris]
 ref|XP_009762582.1| PREDICTED: subtilisin-like protease isoform X2 [Nicotiana sylvestris]
 ref|XP_009762583.1| PREDICTED: subtilisin-like protease isoform X3 [Nicotiana sylvestris]
Length=769

 Score =   112 bits (281),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 52/102 (51%), Positives = 68/102 (67%), Gaps = 2/102 (2%)
 Frame = -1

Query  307  KFLGLSVTEGAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQGFN  128
            +FLGL    G W  S      I+G++DTG+WPE  SF D+GMPP P +WKG C+ G  F+
Sbjct  124  QFLGLKSGSGLWSASNLTSDVIVGVIDTGIWPEHLSFRDSGMPPVPSRWKGKCEAGTRFS  183

Query  127  SSSCNRKLIGARFFSKGHVAASPDYSPHLVEEYISPRDSHGH  2
             S+CN+K+IGAR FSKG+ AA+   +    E+Y SPRDS GH
Sbjct  184  PSNCNKKIIGARIFSKGYEAAAGKINE--TEDYRSPRDSQGH  223



>ref|XP_006345404.1| PREDICTED: subtilisin-like protease-like [Solanum tuberosum]
Length=782

 Score =   112 bits (281),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 55/102 (54%), Positives = 67/102 (66%), Gaps = 4/102 (4%)
 Frame = -1

Query  307  KFLGLSVTEGAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQGFN  128
            +FL L+ + G W  S FG   IIGL+DTG+WPESPSF D GMP  P +WKG+C+EG  FN
Sbjct  119  EFLKLNPSSGLWPASNFGQDVIIGLVDTGIWPESPSFRDDGMPEIPKRWKGICREGTDFN  178

Query  127  SSSCNRKLIGARFFSKGHVAASPDYSPHLVEEYISPRDSHGH  2
            SS CNRK+IG  +F KG VA     + H+     S RDS GH
Sbjct  179  SSLCNRKIIGVNYFYKGAVAE----NTHVNLTTFSARDSWGH  216



>ref|XP_009359804.1| PREDICTED: subtilisin-like protease [Pyrus x bretschneideri]
Length=765

 Score =   112 bits (281),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 55/102 (54%), Positives = 70/102 (69%), Gaps = 4/102 (4%)
 Frame = -1

Query  307  KFLGLSVTEGAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQGFN  128
            +FLGL+   GAW  + +G   IIGL+DTGVWPES SF++ GM   P +WKG C+ G  FN
Sbjct  128  QFLGLNSKSGAWPVANYGKDVIIGLVDTGVWPESESFNEDGMSKIPPRWKGECESGTQFN  187

Query  127  SSSCNRKLIGARFFSKGHVAASPDYSPHLVEEYISPRDSHGH  2
            SS CN+KLIGA+FF+KG VA +P+    L  E  S RD+ GH
Sbjct  188  SSLCNKKLIGAKFFNKGLVAQNPN----LTIEVNSTRDTDGH  225



>ref|XP_002518750.1| Xylem serine proteinase 1 precursor, putative [Ricinus communis]
 gb|EEF43675.1| Xylem serine proteinase 1 precursor, putative [Ricinus communis]
Length=778

 Score =   112 bits (281),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 54/102 (53%), Positives = 68/102 (67%), Gaps = 2/102 (2%)
 Frame = -1

Query  307  KFLGLSVTEGAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQGFN  128
            KFLGL+   G W  S+FG   IIG+LDTG+WPES SF+D  MPP P +W G+C+ G  FN
Sbjct  116  KFLGLNRHTGLWPASKFGDDIIIGVLDTGIWPESESFNDKNMPPVPNRWLGICETGTEFN  175

Query  127  SSSCNRKLIGARFFSKGHVAASPDYSPHLVEEYISPRDSHGH  2
            +S CN+KLIGAR FS+G      + S    ++Y SPRD  GH
Sbjct  176  TSHCNKKLIGARKFSEGMKHYRLNISK--TDDYDSPRDFMGH  215



>gb|KDP41723.1| hypothetical protein JCGZ_26741 [Jatropha curcas]
Length=774

 Score =   112 bits (280),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 51/94 (54%), Positives = 66/94 (70%), Gaps = 0/94 (0%)
 Frame = -1

Query  283  EGAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQGFNSSSCNRKL  104
            +G   KS  G G+IIG++DTG+WPES SF D G+   P +WKG+CQEG+GFN S CNRK+
Sbjct  122  DGLLSKSHSGVGSIIGVMDTGIWPESKSFTDEGIGEVPSRWKGICQEGEGFNHSHCNRKI  181

Query  103  IGARFFSKGHVAASPDYSPHLVEEYISPRDSHGH  2
            IGAR++ KG+ A         V EY+SPRD+ GH
Sbjct  182  IGARWYIKGYEAEIGKLDTSDVLEYLSPRDARGH  215



>gb|KDO59722.1| hypothetical protein CISIN_1g037455mg [Citrus sinensis]
Length=755

 Score =   112 bits (280),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 54/102 (53%), Positives = 67/102 (66%), Gaps = 2/102 (2%)
 Frame = -1

Query  307  KFLGLSVTEGAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQGFN  128
            +FLGL    G W  + FG   I+G+LDTG+WPES S+DD GMPP P +W+G C+ G  FN
Sbjct  120  QFLGLKKHAGVWPAAGFGSDIIVGILDTGIWPESKSYDDRGMPPVPERWRGACEVGVEFN  179

Query  127  SSSCNRKLIGARFFSKGHVAASPDYSPHLVEEYISPRDSHGH  2
            +S CNRKLIGAR FSKG      + S    ++Y SPRD  GH
Sbjct  180  TSHCNRKLIGARSFSKGIRQNGLNIST--TDDYDSPRDFFGH  219



>ref|XP_008220243.1| PREDICTED: subtilisin-like protease [Prunus mume]
Length=767

 Score =   112 bits (280),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 55/103 (53%), Positives = 69/103 (67%), Gaps = 4/103 (4%)
 Frame = -1

Query  310  YKFLGLSVTEGAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQGF  131
            ++FLGLS   GAW  + +G   IIG++DTGVWPES SF D GM   P +WKG C+ G  F
Sbjct  122  FQFLGLSSKSGAWPVADYGKDVIIGVVDTGVWPESESFSDDGMSEIPPRWKGECESGTQF  181

Query  130  NSSSCNRKLIGARFFSKGHVAASPDYSPHLVEEYISPRDSHGH  2
            NSS CN+KLIGARFF+KG +A +P+    L     S RD+ GH
Sbjct  182  NSSLCNKKLIGARFFNKGLIAQNPN----LTISVNSTRDTDGH  220



>ref|XP_001774001.1| predicted protein [Physcomitrella patens]
 gb|EDQ61191.1| predicted protein [Physcomitrella patens]
Length=781

 Score =   112 bits (280),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 51/101 (50%), Positives = 68/101 (67%), Gaps = 1/101 (1%)
 Frame = -1

Query  304  FLGLSVTEGAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQGFNS  125
            F+GLS + G W +S +G  TI+G+LDTGVWPES SF+D G  P P +W+G CQ G+ F  
Sbjct  129  FIGLSTSSGLWPESNYGSDTIVGVLDTGVWPESESFNDVGFGPIPARWRGTCQTGKSFTR  188

Query  124  SSCNRKLIGARFFSKGHVAASPDYSPHLVEEYISPRDSHGH  2
              CN+KLIGAR+FS G+ A +   + +  E   SPRD+ GH
Sbjct  189  EVCNKKLIGARYFSAGYEAVAGPIADNSTEVR-SPRDTEGH  228



>gb|EYU25437.1| hypothetical protein MIMGU_mgv1a002005mg [Erythranthe guttata]
Length=728

 Score =   112 bits (280),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 55/103 (53%), Positives = 67/103 (65%), Gaps = 4/103 (4%)
 Frame = -1

Query  310  YKFLGLSVTEGAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQGF  131
            YKFLGL+   G W  S +G   IIGL+DTGVWPES SFDD GM   P +WKG C+ G  F
Sbjct  87   YKFLGLNPQNGLWPVSDYGNDVIIGLVDTGVWPESRSFDDGGMAVVPARWKGECERGTQF  146

Query  130  NSSSCNRKLIGARFFSKGHVAASPDYSPHLVEEYISPRDSHGH  2
            + S CN+KLIGAR+F+KG +A  P+    L     S RD+ GH
Sbjct  147  DPSMCNKKLIGARYFNKGLMAKYPN----LTITMNSARDTDGH  185



>emb|CAN60788.1| hypothetical protein VITISV_034534 [Vitis vinifera]
Length=766

 Score =   112 bits (280),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 54/102 (53%), Positives = 68/102 (67%), Gaps = 2/102 (2%)
 Frame = -1

Query  307  KFLGLSVTEGAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQGFN  128
            KFLGL    G W  + +G G IIG++DTG+WPES SF D GM P P +WKG C+ G  F+
Sbjct  125  KFLGLKPNSGIWPAASYGDGVIIGIIDTGIWPESRSFSDKGMSPVPERWKGQCEYGTAFS  184

Query  127  SSSCNRKLIGARFFSKGHVAASPDYSPHLVEEYISPRDSHGH  2
             S CNRKL+GAR FSKG +AA  + S  L  ++ S RD+ GH
Sbjct  185  QSCCNRKLVGARSFSKGLIAAGRNISTEL--DFDSARDNVGH  224



>ref|XP_002282856.2| PREDICTED: subtilisin-like protease [Vitis vinifera]
 emb|CBI19500.3| unnamed protein product [Vitis vinifera]
Length=766

 Score =   112 bits (280),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 54/102 (53%), Positives = 68/102 (67%), Gaps = 2/102 (2%)
 Frame = -1

Query  307  KFLGLSVTEGAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQGFN  128
            KFLGL    G W  + +G G IIG++DTG+WPES SF D GM P P +WKG C+ G  F+
Sbjct  125  KFLGLKPNSGIWPAASYGDGVIIGIIDTGIWPESRSFSDKGMSPVPERWKGQCEYGTAFS  184

Query  127  SSSCNRKLIGARFFSKGHVAASPDYSPHLVEEYISPRDSHGH  2
             S CNRKL+GAR FSKG +AA  + S  L  ++ S RD+ GH
Sbjct  185  QSCCNRKLVGARSFSKGLIAAGRNISTEL--DFDSARDNVGH  224



>ref|XP_007017191.1| Subtilisin-like serine protease 2, putative [Theobroma cacao]
 gb|EOY14416.1| Subtilisin-like serine protease 2, putative [Theobroma cacao]
Length=761

 Score =   112 bits (279),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 55/102 (54%), Positives = 67/102 (66%), Gaps = 2/102 (2%)
 Frame = -1

Query  307  KFLGLSVTEGAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQGFN  128
            +FLGL    G W  + +G G IIG+ DTG+WPES SF+D GMP  P  WKG C+ G  F+
Sbjct  123  EFLGLEHNSGLWPAASYGEGVIIGVFDTGIWPESESFNDKGMPQVPQNWKGKCENGTAFS  182

Query  127  SSSCNRKLIGARFFSKGHVAASPDYSPHLVEEYISPRDSHGH  2
             S+CN+KLIGAR FSKG  AA  + S  L  +Y SPRD  GH
Sbjct  183  PSACNKKLIGARSFSKGIQAAEGNISKEL--DYDSPRDFDGH  222



>ref|XP_011046353.1| PREDICTED: LOW QUALITY PROTEIN: subtilisin-like protease [Populus 
euphratica]
Length=777

 Score =   112 bits (279),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 53/106 (50%), Positives = 67/106 (63%), Gaps = 4/106 (4%)
 Frame = -1

Query  307  KFLGLSVTEGAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQGFN  128
            +FLGL    G W  S +G   IIG+LDTG+WPE  SF D  + P PG+WKGVC+ G+ F 
Sbjct  115  QFLGLRNQRGLWSDSNYGSDVIIGVLDTGIWPERRSFSDVNLGPVPGRWKGVCEVGERFT  174

Query  127  SSSCNRKLIGARFFSKGHVAASPDYSP----HLVEEYISPRDSHGH  2
            + +CN+KLIGARFF KGH A      P    +   E+ SPRD+ GH
Sbjct  175  ARNCNKKLIGARFFIKGHEAVGGAMGPISPINETLEFKSPRDADGH  220



>ref|XP_011069659.1| PREDICTED: subtilisin-like protease [Sesamum indicum]
Length=754

 Score =   112 bits (279),  Expect = 5e-26, Method: Composition-based stats.
 Identities = 52/103 (50%), Positives = 70/103 (68%), Gaps = 4/103 (4%)
 Frame = -1

Query  310  YKFLGLSVTEGAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQGF  131
            Y+FLGL+   GAW  S +G   I+G++DTGVWPES SF+D GM   P +W+G C+ G  F
Sbjct  116  YRFLGLNSDNGAWPASDYGKDVIVGVVDTGVWPESRSFNDDGMTEIPARWRGECESGTQF  175

Query  130  NSSSCNRKLIGARFFSKGHVAASPDYSPHLVEEYISPRDSHGH  2
            N+S CN+KLIGAR+F+KG +A +P+    L     S RD+ GH
Sbjct  176  NTSLCNKKLIGARYFNKGLLAKNPN----LTISMNSARDTDGH  214



>gb|KFK30136.1| hypothetical protein AALP_AA7G221600 [Arabis alpina]
Length=766

 Score =   111 bits (278),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 53/102 (52%), Positives = 67/102 (66%), Gaps = 1/102 (1%)
 Frame = -1

Query  307  KFLGLSVTEGAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQGFN  128
            +FLGL   +G W  S +G   IIG+LDTG+WPE  SF D  + P P +W+GVC+ G  F 
Sbjct  107  QFLGLQNQKGLWSNSNYGSDVIIGVLDTGIWPERRSFSDLNLTPIPKRWRGVCESGTRFR  166

Query  127  SSSCNRKLIGARFFSKGHVAASPDYSPHLVEEYISPRDSHGH  2
            SS+CNRKLIGARFF+KG  A         V E++SPRD+ GH
Sbjct  167  SSNCNRKLIGARFFAKGQQAGVLGGINKTV-EFLSPRDADGH  207



>ref|XP_002977794.1| hypothetical protein SELMODRAFT_107394, partial [Selaginella 
moellendorffii]
 gb|EFJ21132.1| hypothetical protein SELMODRAFT_107394, partial [Selaginella 
moellendorffii]
Length=727

 Score =   111 bits (278),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 54/97 (56%), Positives = 68/97 (70%), Gaps = 3/97 (3%)
 Frame = -1

Query  286  TEGAWV--KSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQGFNSSSCN  113
            TE +W+  KS+FG   IIG+LD+GVWPES SF D GM P P +WKG C+ G+ FN+S CN
Sbjct  89   TESSWLWKKSKFGKDVIIGVLDSGVWPESESFSDHGMGPTPERWKGTCETGEQFNASHCN  148

Query  112  RKLIGARFFSKGHVAASPDYSPHLVEEYISPRDSHGH  2
            +KLIGARFFS G +   P+      +E +SPRD HGH
Sbjct  149  KKLIGARFFSHG-LQDGPEAYAKAHQEVLSPRDVHGH  184



>ref|XP_007221958.1| hypothetical protein PRUPE_ppa001770mg [Prunus persica]
 gb|EMJ23157.1| hypothetical protein PRUPE_ppa001770mg [Prunus persica]
Length=767

 Score =   111 bits (278),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 56/102 (55%), Positives = 68/102 (67%), Gaps = 4/102 (4%)
 Frame = -1

Query  307  KFLGLSVTEGAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQGFN  128
            +FLGLS   GAW  + +G   IIGL+DTGVWPES SF D GM   P +WKG C+ G  FN
Sbjct  123  QFLGLSSKSGAWPVADYGKDVIIGLVDTGVWPESESFSDDGMSEIPPRWKGECESGTQFN  182

Query  127  SSSCNRKLIGARFFSKGHVAASPDYSPHLVEEYISPRDSHGH  2
            SS CN+KLIGARFF+KG +A +P+    L     S RD+ GH
Sbjct  183  SSLCNKKLIGARFFNKGLIAQNPN----LTFPVNSTRDTDGH  220



>gb|EYU36339.1| hypothetical protein MIMGU_mgv1a001782mg [Erythranthe guttata]
Length=760

 Score =   111 bits (278),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 57/103 (55%), Positives = 68/103 (66%), Gaps = 5/103 (5%)
 Frame = -1

Query  310  YKFLGLSVTEGAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQGF  131
            YKFL L+   G W  S +G   IIG+LD G+WPESPSF D GM   P KWKG CQ GQ F
Sbjct  113  YKFLSLNTASGLWPASNYGKDVIIGILDGGIWPESPSFSDEGMTAIPAKWKGTCQGGQDF  172

Query  130  NSSSCNRKLIGARFFSKGHVAASPDYSPHLVEEYISPRDSHGH  2
            NSS CN+KLIG R+F++G  AA P+ +P  V +  S RD  GH
Sbjct  173  NSSLCNKKLIGVRYFNQGTRAAFPE-TP--VPD--SARDDDGH  210



>ref|XP_002313716.1| hypothetical protein POPTR_0009s13590g [Populus trichocarpa]
 gb|EEE87671.1| hypothetical protein POPTR_0009s13590g [Populus trichocarpa]
Length=773

 Score =   111 bits (278),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 52/106 (49%), Positives = 67/106 (63%), Gaps = 4/106 (4%)
 Frame = -1

Query  307  KFLGLSVTEGAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQGFN  128
            +FLGL    G W  S +G   IIG+LDTG+WPE  SF D  + P PG+WKG+C+ G+ F 
Sbjct  111  QFLGLRNQRGLWSDSNYGSDVIIGVLDTGIWPERRSFSDVNLGPVPGRWKGICEAGERFT  170

Query  127  SSSCNRKLIGARFFSKGHVAASPDYSP----HLVEEYISPRDSHGH  2
            + +CN+KLIGARFF KGH A      P    +   E+ SPRD+ GH
Sbjct  171  ARNCNKKLIGARFFIKGHEAVGGAMGPISPINDTLEFKSPRDADGH  216



>ref|XP_009595649.1| PREDICTED: subtilisin-like protease [Nicotiana tomentosiformis]
Length=763

 Score =   111 bits (278),  Expect = 6e-26, Method: Composition-based stats.
 Identities = 51/102 (50%), Positives = 69/102 (68%), Gaps = 4/102 (4%)
 Frame = -1

Query  307  KFLGLSVTEGAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQGFN  128
            +FLGL+   G W KS +G   I+GL+DTG+WPES S+ D GM   P +WKG C+ G  FN
Sbjct  123  QFLGLNSNSGVWPKSDYGKDVIVGLVDTGIWPESKSYTDNGMTEVPSRWKGECESGTQFN  182

Query  127  SSSCNRKLIGARFFSKGHVAASPDYSPHLVEEYISPRDSHGH  2
            SS CN+KLIGAR+F+KG +A +P+ +  +     S RD+ GH
Sbjct  183  SSLCNKKLIGARYFNKGLIATNPNITILMN----SARDTDGH  220



>ref|XP_004492811.1| PREDICTED: subtilisin-like protease-like [Cicer arietinum]
Length=758

 Score =   111 bits (278),  Expect = 6e-26, Method: Composition-based stats.
 Identities = 54/104 (52%), Positives = 70/104 (67%), Gaps = 5/104 (5%)
 Frame = -1

Query  310  YKFLGLSVTEGAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPA-PGKWKGVCQEGQG  134
            ++FL L    G W  S FG   I+G++D+GVWPES SF D GM    P KWKG C+EGQ 
Sbjct  126  FQFLSLDSPNGLWHASNFGEDIIVGVIDSGVWPESESFKDHGMTKKIPSKWKGACEEGQD  185

Query  133  FNSSSCNRKLIGARFFSKGHVAASPDYSPHLVEEYISPRDSHGH  2
            FN+S CN KLIGAR+F+KG +AA+P+ +  +     SPRD+ GH
Sbjct  186  FNASMCNFKLIGARYFNKGMIAANPNATITMN----SPRDTIGH  225



>ref|XP_006374911.1| subtilase family protein [Populus trichocarpa]
 gb|ERP52708.1| subtilase family protein [Populus trichocarpa]
Length=778

 Score =   111 bits (278),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 55/102 (54%), Positives = 69/102 (68%), Gaps = 4/102 (4%)
 Frame = -1

Query  307  KFLGLSVTEGAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQGFN  128
            KFLGL+    AW  S  G G IIGL+D+GVWPES S++D GM   P +WKG CQ G  FN
Sbjct  129  KFLGLAPQSPAWKASNLGDGIIIGLVDSGVWPESESYNDHGMSEIPKRWKGGCQSGAQFN  188

Query  127  SSSCNRKLIGARFFSKGHVAASPDYSPHLVEEYISPRDSHGH  2
            SS CN+KLIGARFF+KG +A +P+ +  +     S RD+ GH
Sbjct  189  SSMCNKKLIGARFFNKGLIANNPNITISVN----STRDTDGH  226



>gb|ACT34764.1| subtilisin-like protease preproenzyme [Nicotiana tabacum]
Length=763

 Score =   111 bits (278),  Expect = 6e-26, Method: Composition-based stats.
 Identities = 51/102 (50%), Positives = 69/102 (68%), Gaps = 4/102 (4%)
 Frame = -1

Query  307  KFLGLSVTEGAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQGFN  128
            +FLGL+   G W KS +G   I+GL+DTG+WPES S+ D GM   P +WKG C+ G  FN
Sbjct  123  QFLGLNSNSGVWPKSDYGKDVIVGLVDTGIWPESKSYTDNGMTEVPSRWKGECESGTQFN  182

Query  127  SSSCNRKLIGARFFSKGHVAASPDYSPHLVEEYISPRDSHGH  2
            SS CN+KLIGAR+F+KG +A +P+ +  +     S RD+ GH
Sbjct  183  SSLCNKKLIGARYFNKGLIATNPNITILMN----SARDTDGH  220



>gb|ABK95622.1| unknown [Populus trichocarpa]
Length=778

 Score =   111 bits (278),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 55/102 (54%), Positives = 69/102 (68%), Gaps = 4/102 (4%)
 Frame = -1

Query  307  KFLGLSVTEGAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQGFN  128
            KFLGL+    AW  S  G G IIGL+D+GVWPES S++D GM   P +WKG CQ G  FN
Sbjct  129  KFLGLAPQSPAWKASNLGDGIIIGLVDSGVWPESESYNDHGMSEIPKRWKGGCQSGAQFN  188

Query  127  SSSCNRKLIGARFFSKGHVAASPDYSPHLVEEYISPRDSHGH  2
            SS CN+KLIGARFF+KG +A +P+ +  +     S RD+ GH
Sbjct  189  SSMCNKKLIGARFFNKGLIANNPNITISVN----STRDTDGH  226



>ref|NP_001051353.1| Os03g0761500 [Oryza sativa Japonica Group]
 gb|AAK63927.1|AC084282_8 putative serine protease [Oryza sativa Japonica Group]
 gb|ABF99010.1| cucumisin-like serine protease, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF13267.1| Os03g0761500 [Oryza sativa Japonica Group]
 gb|EAZ28668.1| hypothetical protein OsJ_12679 [Oryza sativa Japonica Group]
 dbj|BAG95169.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG95978.1| unnamed protein product [Oryza sativa Japonica Group]
Length=764

 Score =   111 bits (278),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 54/102 (53%), Positives = 69/102 (68%), Gaps = 2/102 (2%)
 Frame = -1

Query  307  KFLGLSVTEGAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQGFN  128
            +FLGL  T+  + +S  G   I+G+LDTGVWPE PS+DDAG+ P P  WKG C+EG  FN
Sbjct  117  EFLGLDRTDALFPQSNTGSDVIVGVLDTGVWPERPSYDDAGLGPVPAGWKGKCEEGNDFN  176

Query  127  SSSCNRKLIGARFFSKGHVAASPDYSPHLVEEYISPRDSHGH  2
            +S+CN+KLIGARFF  G+ AA         +E  SPRD+ GH
Sbjct  177  ASACNKKLIGARFFLTGYEAAKGPVDTS--KESRSPRDNDGH  216



>ref|XP_006407132.1| hypothetical protein EUTSA_v10022348mg, partial [Eutrema salsugineum]
 gb|ESQ48585.1| hypothetical protein EUTSA_v10022348mg, partial [Eutrema salsugineum]
Length=1359

 Score =   112 bits (280),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 52/101 (51%), Positives = 65/101 (64%), Gaps = 0/101 (0%)
 Frame = -1

Query  304  FLGLSVTEGAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQGFNS  125
            FLG S   G W  S +G   I+G+LDTG+WPE PSF D+G+ P P  WKG C+ G  F +
Sbjct  720  FLGFSDNSGLWSNSNYGEDVIVGVLDTGIWPEHPSFSDSGLDPVPSTWKGECETGPDFPA  779

Query  124  SSCNRKLIGARFFSKGHVAASPDYSPHLVEEYISPRDSHGH  2
            SSCNRKLIGAR F KG++      + H  +E  SPRD+ GH
Sbjct  780  SSCNRKLIGARAFYKGYLTHRNGSTTHTAKESRSPRDTEGH  820



>ref|XP_002986914.1| hypothetical protein SELMODRAFT_425830 [Selaginella moellendorffii]
 gb|EFJ11996.1| hypothetical protein SELMODRAFT_425830 [Selaginella moellendorffii]
Length=768

 Score =   111 bits (278),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 54/97 (56%), Positives = 68/97 (70%), Gaps = 3/97 (3%)
 Frame = -1

Query  286  TEGAWV--KSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQGFNSSSCN  113
            TE +W+  KS+FG   IIG+LD+GVWPES SF D GM P P +WKG C+ G+ FN+S CN
Sbjct  132  TESSWLWKKSKFGKDVIIGVLDSGVWPESESFSDHGMGPIPERWKGTCETGEQFNASHCN  191

Query  112  RKLIGARFFSKGHVAASPDYSPHLVEEYISPRDSHGH  2
            +KLIGARFFS G +   P+      +E +SPRD HGH
Sbjct  192  KKLIGARFFSHG-LQDGPEAYAKAHQEVLSPRDVHGH  227



>ref|XP_009351978.1| PREDICTED: subtilisin-like protease SBT5.3 [Pyrus x bretschneideri]
Length=781

 Score =   111 bits (278),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 55/92 (60%), Positives = 64/92 (70%), Gaps = 7/92 (8%)
 Frame = -1

Query  268  KSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQGFNSSSCNRKLIGARF  89
            K+RFG   I+GLLD+GVWPES SF D GM P P  WKG+CQ G GFNSS CNRKLIGAR+
Sbjct  137  KARFGKDIIVGLLDSGVWPESKSFRDEGMGPVPNSWKGICQSGPGFNSSHCNRKLIGARY  196

Query  88   FSKGHVAASPDYSPHLV---EEYISPRDSHGH  2
            + KG+      Y  H+V   E+Y SPRD  GH
Sbjct  197  YLKGY----EQYYGHVVNASEDYRSPRDMDGH  224



>ref|XP_008377749.1| PREDICTED: subtilisin-like protease [Malus domestica]
Length=785

 Score =   111 bits (277),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 55/106 (52%), Positives = 67/106 (63%), Gaps = 4/106 (4%)
 Frame = -1

Query  307  KFLGLSVTEGAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQGFN  128
            +FLGL    G W +S +G   I+G+ DTGVWPE  SF D  + P P +WKGVC+ G  F 
Sbjct  125  QFLGLRNQRGLWSESDYGSDVIVGVFDTGVWPEHRSFQDKNLGPIPRRWKGVCETGTKFA  184

Query  127  SSSCNRKLIGARFFSKGHVAAS----PDYSPHLVEEYISPRDSHGH  2
              SCNRKLIGARFF KGH AA+    P  + +   EY SPRD+ GH
Sbjct  185  KGSCNRKLIGARFFIKGHEAAANAGGPISAINDTVEYRSPRDADGH  230



>gb|EYU36338.1| hypothetical protein MIMGU_mgv1a002690mg [Erythranthe guttata]
Length=646

 Score =   110 bits (276),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 55/103 (53%), Positives = 68/103 (66%), Gaps = 5/103 (5%)
 Frame = -1

Query  310  YKFLGLSVTEGAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQGF  131
            YKFL L+   G W  S +G   IIG+LDTG+WPESPSF D GM   P +WKG CQ GQ F
Sbjct  80   YKFLSLNTATGLWPASNYGKDVIIGILDTGIWPESPSFRDEGMTEIPPRWKGSCQGGQDF  139

Query  130  NSSSCNRKLIGARFFSKGHVAASPDYSPHLVEEYISPRDSHGH  2
            NSS CN+KLIG R+F++G  AA P+   + V +  + RD  GH
Sbjct  140  NSSLCNKKLIGVRYFNQGTRAAFPE---NPVPD--TARDDQGH  177



>ref|XP_008220244.1| PREDICTED: subtilisin-like protease [Prunus mume]
Length=767

 Score =   111 bits (277),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 55/102 (54%), Positives = 68/102 (67%), Gaps = 4/102 (4%)
 Frame = -1

Query  307  KFLGLSVTEGAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQGFN  128
            +FLGLS   GAW  + +G   IIG++DTGVWPES SF D GM   P +WKG C+ G  FN
Sbjct  123  QFLGLSSKSGAWPVADYGKDVIIGVVDTGVWPESESFSDDGMSEIPPRWKGECESGTQFN  182

Query  127  SSSCNRKLIGARFFSKGHVAASPDYSPHLVEEYISPRDSHGH  2
            SS CN+KLIGARFF+KG +A +P+    L     S RD+ GH
Sbjct  183  SSLCNKKLIGARFFNKGLIAQNPN----LTISVNSTRDTDGH  220



>ref|XP_003523496.1| PREDICTED: subtilisin-like protease-like [Glycine max]
Length=777

 Score =   111 bits (277),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 51/102 (50%), Positives = 70/102 (69%), Gaps = 2/102 (2%)
 Frame = -1

Query  307  KFLGLSVTEGAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQGFN  128
            +F+GL    G W ++ +G   IIG+ DTG+WPE  SF D+ + P P +WKGVC+ G  F+
Sbjct  121  QFVGLRNQRGLWSETDYGSDVIIGVFDTGIWPERRSFSDSNLGPIPKRWKGVCESGVRFS  180

Query  127  SSSCNRKLIGARFFSKGHVAASPDYSPHLVEEYISPRDSHGH  2
             S+CNRKLIGARFFSKGH A+   ++  +  E+ SPRD+ GH
Sbjct  181  PSNCNRKLIGARFFSKGHEASGTSFNDTV--EFRSPRDADGH  220



>ref|XP_010246830.1| PREDICTED: subtilisin-like protease [Nelumbo nucifera]
Length=776

 Score =   111 bits (277),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 55/108 (51%), Positives = 69/108 (64%), Gaps = 6/108 (6%)
 Frame = -1

Query  307  KFLGLSVTEGAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQGFN  128
            +FLGL   +G W +S +G   IIG+LDTG+WPE  SF D  + P P +WKGVC+ G  F+
Sbjct  111  QFLGLRNQQGLWSESDYGSDVIIGVLDTGIWPERRSFSDLNLGPVPRRWKGVCEAGVQFS  170

Query  127  SSSCNRKLIGARFFSKGHVAA------SPDYSPHLVEEYISPRDSHGH  2
            S+ CNRKLIGARFFSKGH AA            +   E+ SPRD+ GH
Sbjct  171  SAHCNRKLIGARFFSKGHDAAGGLGGPGGVGGVNETIEFRSPRDADGH  218



>gb|EPS63009.1| subtilisin-like protease preproenzyme [Genlisea aurea]
Length=716

 Score =   110 bits (276),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 53/103 (51%), Positives = 69/103 (67%), Gaps = 4/103 (4%)
 Frame = -1

Query  310  YKFLGLSVTEGAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQGF  131
            Y+FLGL    GAW +S  G   I+G++DTGVWPES SF+D GM   P +W G+C+ G  F
Sbjct  86   YRFLGLDSDHGAWSESDSGSDVIVGVVDTGVWPESRSFNDDGMGEIPRRWNGICEVGVRF  145

Query  130  NSSSCNRKLIGARFFSKGHVAASPDYSPHLVEEYISPRDSHGH  2
            NSS+CNRKL+GAR+F+KG +A     +P L     S RD+ GH
Sbjct  146  NSSNCNRKLVGARYFNKGLLAG----NPKLKISMNSARDTDGH  184



>ref|XP_006359680.1| PREDICTED: subtilisin-like protease-like [Solanum tuberosum]
Length=772

 Score =   111 bits (277),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 53/106 (50%), Positives = 68/106 (64%), Gaps = 4/106 (4%)
 Frame = -1

Query  307  KFLGLSVTEGAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQGFN  128
            +FLGL   +G W +S +G   I+G+LDTG+WPE  SF D  + P P +WKGVC+ G  F 
Sbjct  110  QFLGLRNQKGLWSESDYGSDVIVGVLDTGIWPERRSFSDLNLGPVPTRWKGVCETGAKFT  169

Query  127  SSSCNRKLIGARFFSKGHVAA----SPDYSPHLVEEYISPRDSHGH  2
            S +CNRK+IGARFFSKGH AA          +   E+ SPRD+ GH
Sbjct  170  SRNCNRKIIGARFFSKGHEAAPGFGPIGGGINDTVEFRSPRDADGH  215



>ref|XP_008241490.1| PREDICTED: subtilisin-like protease [Prunus mume]
Length=745

 Score =   110 bits (276),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 55/103 (53%), Positives = 71/103 (69%), Gaps = 5/103 (5%)
 Frame = -1

Query  307  KFLGLSVTEGAWVKSRFGCGTIIGLLDTGVWPESPSFDD-AGMPPAPGKWKGVCQEGQGF  131
            +FLGL+ + GAW  S +G G IIG+LDTGVWPES SF +  G+   P +WKG C  G  F
Sbjct  125  QFLGLTSSSGAWPASNYGEGVIIGVLDTGVWPESESFKEYEGITDVPSRWKGKCVSGTQF  184

Query  130  NSSSCNRKLIGARFFSKGHVAASPDYSPHLVEEYISPRDSHGH  2
            NSS CN+KLIGA+FF+KG +A +PD    +     SPRD++GH
Sbjct  185  NSSLCNKKLIGAQFFNKGFIANNPDLKIGMN----SPRDTNGH  223



>ref|XP_009789823.1| PREDICTED: subtilisin-like protease [Nicotiana sylvestris]
Length=774

 Score =   111 bits (277),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 53/107 (50%), Positives = 68/107 (64%), Gaps = 5/107 (5%)
 Frame = -1

Query  307  KFLGLSVTEGAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQGFN  128
            +FLGL   +G W +S +G   I+G+LDTG+WPE  SF D  + P P +WKGVCQ G  F 
Sbjct  111  QFLGLRNQKGLWSESDYGSDVIVGVLDTGIWPERRSFSDLNLGPIPTRWKGVCQTGDKFT  170

Query  127  SSSCNRKLIGARFFSKGHVAA-----SPDYSPHLVEEYISPRDSHGH  2
            + +CNRK+IGARFFSKGH AA           +   E+ SPRD+ GH
Sbjct  171  AKNCNRKIIGARFFSKGHEAAPGFGGIGGGGINDTVEFKSPRDADGH  217



>emb|CDP01318.1| unnamed protein product [Coffea canephora]
Length=769

 Score =   110 bits (276),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 52/103 (50%), Positives = 69/103 (67%), Gaps = 3/103 (3%)
 Frame = -1

Query  310  YKFLGLSVTEGAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQGF  131
            YKFL L+  +G W  S FG   I+G++DTGVWPESPS+ D GMP  P +WKG C  G+GF
Sbjct  125  YKFLQLNHADGLWPASDFGNDVIVGVIDTGVWPESPSYRDGGMPKVPSRWKGRCAGGEGF  184

Query  130  NSSSCNRKLIGARFFSKGHVAASPDYSPHLVEEYISPRDSHGH  2
            NSS CN+KLIG R+F++G++AA+        +   + RD  GH
Sbjct  185  NSSLCNKKLIGVRYFNQGNLAANGGNGE---QNKFTARDGKGH  224



>ref|XP_002533857.1| Cucumisin precursor, putative [Ricinus communis]
 gb|EEF28521.1| Cucumisin precursor, putative [Ricinus communis]
Length=753

 Score =   110 bits (276),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 53/106 (50%), Positives = 67/106 (63%), Gaps = 4/106 (4%)
 Frame = -1

Query  307  KFLGLSVTEGAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQGFN  128
            +FLGL    G W +S +G   IIG+ DTGVWPE  SF D  + P P +WKGVC+ G  F 
Sbjct  90   QFLGLRNQRGLWSESDYGSDVIIGVFDTGVWPERRSFSDVNLGPVPTRWKGVCESGVKFT  149

Query  127  SSSCNRKLIGARFFSKGHVAASPDYSP----HLVEEYISPRDSHGH  2
            + +CN+KLIGARFF KGH AA+    P    +   E+ SPRD+ GH
Sbjct  150  AKNCNKKLIGARFFIKGHEAAARSAGPISGINETVEFKSPRDADGH  195



>ref|XP_009419397.1| PREDICTED: subtilisin-like protease [Musa acuminata subsp. malaccensis]
Length=761

 Score =   110 bits (276),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 52/101 (51%), Positives = 67/101 (66%), Gaps = 4/101 (4%)
 Frame = -1

Query  304  FLGLSVTEGAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQGFNS  125
            FL LS + G W  S +G   IIG+LDTG+WPES SF D G+   P +W+G C++G  F S
Sbjct  121  FLELSASAGLWPASNYGDDVIIGVLDTGIWPESASFRDDGLTAVPSRWRGACEQGTAFRS  180

Query  124  SSCNRKLIGARFFSKGHVAASPDYSPHLVEEYISPRDSHGH  2
            S+CNRKLIGAR F+KG +A+ P+    L     SPRD+ GH
Sbjct  181  SACNRKLIGARSFNKGLLASDPN----LTIAVNSPRDTDGH  217



>ref|XP_010464539.1| PREDICTED: subtilisin-like protease [Camelina sativa]
Length=738

 Score =   110 bits (276),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 55/103 (53%), Positives = 70/103 (68%), Gaps = 5/103 (5%)
 Frame = -1

Query  307  KFLGLSVTEGAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQGFN  128
            +F+GL+ T G W  S +G GT IG++DTG+WP+SPSF D G+   P KWKG CQ    FN
Sbjct  109  QFIGLNSTSGTWPVSNYGAGTFIGIIDTGIWPDSPSFHDDGIGSVPSKWKGECQ----FN  164

Query  127  SSS-CNRKLIGARFFSKGHVAASPDYSPHLVEEYISPRDSHGH  2
            SSS CN+KLIGAR F+KG  A +PD     + +Y SP D+ GH
Sbjct  165  SSSLCNKKLIGARVFNKGLFANNPDLRGSKIGQYSSPYDTIGH  207



>ref|XP_002267740.1| PREDICTED: subtilisin-like protease [Vitis vinifera]
Length=762

 Score =   110 bits (276),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 55/102 (54%), Positives = 67/102 (66%), Gaps = 4/102 (4%)
 Frame = -1

Query  307  KFLGLSVTEGAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQGFN  128
            +FLGLS   GAW  S +G G IIG++DTGVWPES S  D GM   P +WKG C+ G  FN
Sbjct  120  QFLGLSYDHGAWPASSYGDGVIIGVVDTGVWPESESLKDNGMSEVPARWKGECETGTQFN  179

Query  127  SSSCNRKLIGARFFSKGHVAASPDYSPHLVEEYISPRDSHGH  2
            SS CN+KLIGARFF+KG  A  P+ +  +     S RD+ GH
Sbjct  180  SSLCNKKLIGARFFNKGFTANKPNSNTVMS----SCRDTDGH  217



>ref|XP_011074591.1| PREDICTED: subtilisin-like protease [Sesamum indicum]
Length=758

 Score =   110 bits (276),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 53/103 (51%), Positives = 69/103 (67%), Gaps = 4/103 (4%)
 Frame = -1

Query  310  YKFLGLSVTEGAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQGF  131
            ++FL L+   G W  S +G G I+G++DTGVWPES SF+D GM   P  WKG C+ GQ F
Sbjct  121  FEFLSLNPVTGLWPASEYGKGVIVGVIDTGVWPESLSFNDDGMTEVPSWWKGTCEAGQEF  180

Query  130  NSSSCNRKLIGARFFSKGHVAASPDYSPHLVEEYISPRDSHGH  2
            NSS CNRKLIG R+F+KG  AA+P+ +  +     S RD+ GH
Sbjct  181  NSSLCNRKLIGVRYFNKGVKAANPNITLSMN----SGRDTQGH  219



>ref|XP_008393790.1| PREDICTED: subtilisin-like protease [Malus domestica]
Length=766

 Score =   110 bits (276),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 54/102 (53%), Positives = 69/102 (68%), Gaps = 4/102 (4%)
 Frame = -1

Query  307  KFLGLSVTEGAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQGFN  128
            +FLGL+   G W  + +G   IIGL+DTGVWPES SF++ GM   P +WKG C+ G  FN
Sbjct  128  QFLGLNSKSGVWPVANYGKDVIIGLVDTGVWPESESFNEDGMSEIPPRWKGECESGTQFN  187

Query  127  SSSCNRKLIGARFFSKGHVAASPDYSPHLVEEYISPRDSHGH  2
            SS CN+KLIGA+FF+KG VA +P+    L  E  S RD+ GH
Sbjct  188  SSLCNKKLIGAKFFNKGLVAQNPN----LTIEVNSTRDTDGH  225



>ref|XP_008351993.1| PREDICTED: LOW QUALITY PROTEIN: subtilisin-like protease [Malus 
domestica]
Length=764

 Score =   110 bits (276),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 55/102 (54%), Positives = 69/102 (68%), Gaps = 4/102 (4%)
 Frame = -1

Query  307  KFLGLSVTEGAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQGFN  128
            +FLGL+   GAW  + +G   IIGL+DTGVWPES SF++ GM   P +WKG C+ G  FN
Sbjct  127  QFLGLNSKSGAWPVANYGKDVIIGLVDTGVWPESGSFNEDGMSEIPPRWKGECESGTQFN  186

Query  127  SSSCNRKLIGARFFSKGHVAASPDYSPHLVEEYISPRDSHGH  2
            SS CN+KLIGA+FF+KG VA  P+    L  E  S RD+ GH
Sbjct  187  SSLCNKKLIGAKFFNKGLVAQIPN----LTIEVNSTRDTEGH  224



>ref|XP_006374912.1| hypothetical protein POPTR_0014s02640g [Populus trichocarpa]
 gb|ERP52709.1| hypothetical protein POPTR_0014s02640g [Populus trichocarpa]
Length=760

 Score =   110 bits (276),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 55/102 (54%), Positives = 65/102 (64%), Gaps = 2/102 (2%)
 Frame = -1

Query  307  KFLGLSVTEGAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQGFN  128
            KFLGL    G    +  G G IIG++DTG+WPES SF D GMPP P +WKG C+ G  F+
Sbjct  119  KFLGLRQNSGILPTASRGEGVIIGIIDTGIWPESESFHDKGMPPVPQRWKGKCENGTAFS  178

Query  127  SSSCNRKLIGARFFSKGHVAASPDYSPHLVEEYISPRDSHGH  2
             S+CNRKLIGAR FSKG +AA    S     +Y S RD  GH
Sbjct  179  PSACNRKLIGARSFSKGLIAAGRKISTEY--DYDSARDFFGH  218



>ref|XP_010320531.1| PREDICTED: subtilisin-like protease [Solanum lycopersicum]
Length=750

 Score =   110 bits (276),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 51/103 (50%), Positives = 70/103 (68%), Gaps = 4/103 (4%)
 Frame = -1

Query  310  YKFLGLSVTEGAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQGF  131
            ++FLGL+   G W  S +G   I+G++DTGVWPES S+ D GM   P +WKG+C+ GQ F
Sbjct  111  FEFLGLNPESGLWPASHYGEDVIVGVIDTGVWPESRSYKDDGMTEIPSRWKGICEPGQDF  170

Query  130  NSSSCNRKLIGARFFSKGHVAASPDYSPHLVEEYISPRDSHGH  2
            N+S CN KLIG R+F+KG  AA+P+ +  +     S RD+HGH
Sbjct  171  NASMCNNKLIGVRYFNKGVKAANPNITISM----DSGRDTHGH  209



>ref|XP_004231026.1| PREDICTED: subtilisin-like protease [Solanum lycopersicum]
Length=772

 Score =   110 bits (276),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 53/106 (50%), Positives = 68/106 (64%), Gaps = 4/106 (4%)
 Frame = -1

Query  307  KFLGLSVTEGAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQGFN  128
            +FLGL   +G W +S +G   I+G+LDTG+WPE  SF D  + P P +WKGVC+ G  F 
Sbjct  110  QFLGLRNQKGLWSESDYGSDVIVGVLDTGIWPERRSFSDLNLGPVPTRWKGVCETGPQFT  169

Query  127  SSSCNRKLIGARFFSKGHVAA----SPDYSPHLVEEYISPRDSHGH  2
            S +CNRK+IGARFFSKGH AA          +   E+ SPRD+ GH
Sbjct  170  SRNCNRKIIGARFFSKGHEAAPGFGPIGGGINDTVEFRSPRDADGH  215



>ref|XP_010646965.1| PREDICTED: subtilisin-like protease [Vitis vinifera]
Length=774

 Score =   110 bits (276),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 52/107 (49%), Positives = 68/107 (64%), Gaps = 5/107 (5%)
 Frame = -1

Query  307  KFLGLSVTEGAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQGFN  128
            +FLGL    G W +S +G   I+G+ DTGVWPE  SF D  + P P KWKG+C+ G  F 
Sbjct  110  QFLGLRNQRGLWSESDYGSDVIVGVFDTGVWPERRSFSDLNLGPVPAKWKGICETGVRFA  169

Query  127  SSSCNRKLIGARFFSKGHVAASPDYSP-----HLVEEYISPRDSHGH  2
             ++CNRKL+GARFF+KGH AA+    P     +   E+ SPRD+ GH
Sbjct  170  RTNCNRKLVGARFFAKGHEAAAKGAGPGFGGINETVEFRSPRDADGH  216



>ref|XP_002865029.1| subtilase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH41288.1| subtilase family protein [Arabidopsis lyrata subsp. lyrata]
Length=736

 Score =   110 bits (275),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 54/103 (52%), Positives = 71/103 (69%), Gaps = 5/103 (5%)
 Frame = -1

Query  307  KFLGLSVTEGAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQGFN  128
            +F+GL+ T G W  S +G GT+IG++DTG+WP+SPSF D G+   P KWKG C+    FN
Sbjct  107  QFIGLNSTSGTWPVSNYGDGTVIGIIDTGIWPDSPSFHDDGVGSVPSKWKGACE----FN  162

Query  127  SSS-CNRKLIGARFFSKGHVAASPDYSPHLVEEYISPRDSHGH  2
            SSS CN+KLIGAR F+KG  A +PD     + +Y SP D+ GH
Sbjct  163  SSSLCNKKLIGARVFNKGLFANNPDLRETKIGQYSSPYDTIGH  205



>ref|NP_001046517.1| Os02g0269600 [Oryza sativa Japonica Group]
 dbj|BAD28637.1| putative subtilisin-like serine proteinase [Oryza sativa Japonica 
Group]
 dbj|BAF08431.1| Os02g0269600 [Oryza sativa Japonica Group]
 gb|EAY85318.1| hypothetical protein OsI_06696 [Oryza sativa Indica Group]
 gb|EAZ22529.1| hypothetical protein OsJ_06196 [Oryza sativa Japonica Group]
Length=735

 Score =   110 bits (275),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 55/105 (52%), Positives = 72/105 (69%), Gaps = 8/105 (8%)
 Frame = -1

Query  310  YKFLGLSVTE--GAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQ  137
            + FLGL+  E  G    + +G   IIG++DTG+WPESPSF+D G  P P +WKGVCQ G 
Sbjct  114  WDFLGLNYYEKSGVLKDAMYGEDVIIGVVDTGIWPESPSFNDDGYGPVPARWKGVCQTGD  173

Query  136  GFNSSSCNRKLIGARFFSKGHVAASPDYSPHLVEEYISPRDSHGH  2
             FN+++CNRK+IGAR++S G   A+ D    L  EY+SPRD HGH
Sbjct  174  AFNTTNCNRKIIGARWYSAG---ATDDM---LKGEYMSPRDFHGH  212



>ref|XP_006374913.1| subtilase family protein [Populus trichocarpa]
 gb|ERP52710.1| subtilase family protein [Populus trichocarpa]
Length=775

 Score =   110 bits (275),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 53/102 (52%), Positives = 67/102 (66%), Gaps = 4/102 (4%)
 Frame = -1

Query  307  KFLGLSVTEGAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQGFN  128
            K+LGL+    AW  S +G G IIGL+DTG WPES S++D GMP  P  WKG C+ G  FN
Sbjct  128  KYLGLTPQSPAWKASNYGDGIIIGLVDTGAWPESESYNDHGMPEIPKTWKGECESGTQFN  187

Query  127  SSSCNRKLIGARFFSKGHVAASPDYSPHLVEEYISPRDSHGH  2
            S  CN+KLIGARFF+KG +A  P+ +  +     S RD+ GH
Sbjct  188  SLMCNKKLIGARFFNKGLIAKYPNITISMN----STRDTEGH  225



>ref|XP_004229661.1| PREDICTED: subtilisin-like protease [Solanum lycopersicum]
Length=769

 Score =   110 bits (275),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 52/102 (51%), Positives = 71/102 (70%), Gaps = 4/102 (4%)
 Frame = -1

Query  307  KFLGLSVTEGAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQGFN  128
            +FL L+ + G W  S FG   +IG+LD+GVWPES SF D GMP  P KWKG+C+ G  FN
Sbjct  123  EFLKLNPSSGLWPASGFGQDVVIGVLDSGVWPESASFRDEGMPEIPKKWKGICRPGMEFN  182

Query  127  SSSCNRKLIGARFFSKGHVAASPDYSPHLVEEYISPRDSHGH  2
            +S CN+KLIGA +F+KG +A++PD +  +     S RD++GH
Sbjct  183  TSLCNKKLIGANYFNKGLLASNPDVNISMN----SARDTYGH  220



>ref|XP_007017194.1| Subtilisin-like serine endopeptidase family protein [Theobroma 
cacao]
 gb|EOY14419.1| Subtilisin-like serine endopeptidase family protein [Theobroma 
cacao]
Length=793

 Score =   110 bits (275),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 52/102 (51%), Positives = 69/102 (68%), Gaps = 4/102 (4%)
 Frame = -1

Query  307  KFLGLSVTEGAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQGFN  128
            +FL L+   G W  S +G   IIG++D+GVWPES S+ D GM P P +W G+C+EGQ FN
Sbjct  126  EFLSLNPYSGLWPASNYGEDIIIGVIDSGVWPESDSYKDDGMTPVPARWNGICEEGQEFN  185

Query  127  SSSCNRKLIGARFFSKGHVAASPDYSPHLVEEYISPRDSHGH  2
            SS CN KLIGAR+F+KG +AA+P  +  +     S RD+ GH
Sbjct  186  SSMCNSKLIGARYFNKGVIAANPGVNISMN----SARDTIGH  223



>ref|XP_011029618.1| PREDICTED: subtilisin-like protease [Populus euphratica]
Length=775

 Score =   110 bits (275),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 53/102 (52%), Positives = 67/102 (66%), Gaps = 4/102 (4%)
 Frame = -1

Query  307  KFLGLSVTEGAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQGFN  128
            K+LGL+    AW  S +G G IIGL+DTG WPES S++D GMP  P  WKG C+ G  FN
Sbjct  128  KYLGLTPQSPAWKASNYGDGIIIGLVDTGAWPESESYNDHGMPEIPKTWKGECESGTQFN  187

Query  127  SSSCNRKLIGARFFSKGHVAASPDYSPHLVEEYISPRDSHGH  2
            S  CN+KLIGARFF+KG +A  P+ +  +     S RD+ GH
Sbjct  188  SLMCNKKLIGARFFNKGLIAKYPNITISMN----STRDTEGH  225



>ref|XP_010540359.1| PREDICTED: subtilisin-like protease [Tarenaya hassleriana]
Length=768

 Score =   110 bits (275),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 55/103 (53%), Positives = 70/103 (68%), Gaps = 4/103 (4%)
 Frame = -1

Query  310  YKFLGLSVTEGAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQGF  131
            ++FLGLS   GAW  + FG G IIG++D+G+WPES SF + GM   P KWKG C+EG  F
Sbjct  111  FEFLGLSPGSGAWAITDFGKGVIIGVVDSGLWPESKSFAEDGMGTIPSKWKGECEEGTQF  170

Query  130  NSSSCNRKLIGARFFSKGHVAASPDYSPHLVEEYISPRDSHGH  2
            NSS CN+KLIGAR FS+G VA    + P++     S RD+ GH
Sbjct  171  NSSLCNKKLIGARSFSRGLVA----HVPNVTISMNSTRDTEGH  209



>ref|XP_011029629.1| PREDICTED: subtilisin-like protease [Populus euphratica]
Length=764

 Score =   110 bits (275),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 55/102 (54%), Positives = 65/102 (64%), Gaps = 2/102 (2%)
 Frame = -1

Query  307  KFLGLSVTEGAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQGFN  128
            KFLGL    G    +  G G IIG++DTG+WPES SF D GMPP P +WKG C+ G  F+
Sbjct  123  KFLGLRQNSGILPTASRGEGVIIGIIDTGIWPESESFHDKGMPPVPQRWKGKCENGTAFS  182

Query  127  SSSCNRKLIGARFFSKGHVAASPDYSPHLVEEYISPRDSHGH  2
             S+CNRKLIGAR FSKG +AA    S     +Y S RD  GH
Sbjct  183  PSACNRKLIGARSFSKGLIAAGRKISTEY--DYDSARDFAGH  222



>ref|XP_010090327.1| Subtilisin-like protease [Morus notabilis]
 gb|EXB39297.1| Subtilisin-like protease [Morus notabilis]
Length=778

 Score =   110 bits (275),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 54/106 (51%), Positives = 67/106 (63%), Gaps = 4/106 (4%)
 Frame = -1

Query  307  KFLGLSVTEGAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQGFN  128
            +FLGL    G W +S +G   IIG+ DTG+WPE  SF D  + P P +WKGVC+ G  F+
Sbjct  116  QFLGLRNQRGLWSESDYGSDVIIGVFDTGIWPERRSFSDLNLGPIPSRWKGVCESGAKFS  175

Query  127  SSSCNRKLIGARFFSKGHVAA----SPDYSPHLVEEYISPRDSHGH  2
              +CNRKLIGARFFSKGH AA     P    +   E+ SPRD+ GH
Sbjct  176  VRNCNRKLIGARFFSKGHEAAGSIGGPISGVNDTLEFRSPRDADGH  221



>ref|XP_003558354.1| PREDICTED: subtilisin-like protease [Brachypodium distachyon]
Length=792

 Score =   110 bits (275),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 51/105 (49%), Positives = 66/105 (63%), Gaps = 3/105 (3%)
 Frame = -1

Query  307  KFLGLSVTEGAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQGFN  128
            +F+GL    G W  + +G   I+G+LDTGVWPE  S  D  +PP P +W+G C  G  F 
Sbjct  126  QFMGLRARLGLWSLADYGSDVIVGVLDTGVWPERRSLSDRNLPPVPARWRGGCDAGAAFP  185

Query  127  SSSCNRKLIGARFFSKGHVAASPDYSPHLVE---EYISPRDSHGH  2
            +SSCNRKL+GARFFS+GH A   D +        EY+SPRD+ GH
Sbjct  186  ASSCNRKLVGARFFSQGHAAHYGDTAAVASNGSVEYMSPRDADGH  230



>ref|XP_008342302.1| PREDICTED: subtilisin-like protease [Malus domestica]
Length=772

 Score =   110 bits (275),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 51/96 (53%), Positives = 69/96 (72%), Gaps = 0/96 (0%)
 Frame = -1

Query  289  VTEGAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQGFNSSSCNR  110
            +  G   KS+ G G+IIG++DTG+WPES SF D GM  AP +++G+CQEG+ FN S CNR
Sbjct  124  IRNGILSKSQSGIGSIIGIMDTGIWPESESFRDEGMGDAPSRFRGICQEGEKFNRSHCNR  183

Query  109  KLIGARFFSKGHVAASPDYSPHLVEEYISPRDSHGH  2
            K+IGAR++SKG+ A   + S     EY+SPRD+ GH
Sbjct  184  KIIGARWYSKGYEAEFGNLSTSDEFEYLSPRDAAGH  219



>emb|CDO96926.1| unnamed protein product [Coffea canephora]
Length=775

 Score =   110 bits (275),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 54/107 (50%), Positives = 69/107 (64%), Gaps = 6/107 (6%)
 Frame = -1

Query  307  KFLGLSVTEGAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQGFN  128
            +FLGLS   G W +S +G   IIG+ DTG+WPE  SF D  + P P +WKGVCQ G  F 
Sbjct  113  QFLGLSNQRGLWSESDYGSDVIIGVFDTGIWPERRSFSDLNLGPVPARWKGVCQAGVRFT  172

Query  127  SSSCNRKLIGARFFSKGHVAASPDYSP-----HLVEEYISPRDSHGH  2
            + +CNRK++GARFFSKGH  ASP +       +   E+ SPRD+ GH
Sbjct  173  TKNCNRKIVGARFFSKGH-EASPGFGGFGGGINETIEFKSPRDADGH  218



>ref|XP_002886065.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH62324.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=765

 Score =   110 bits (274),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 51/102 (50%), Positives = 68/102 (67%), Gaps = 1/102 (1%)
 Frame = -1

Query  307  KFLGLSVTEGAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQGFN  128
            +FLGL   +G W  S +G   IIG+LDTG+WPE  SF D  + P P +W+GVCQ G  F+
Sbjct  107  QFLGLRNQKGLWSNSDYGSDVIIGVLDTGIWPERRSFSDLNLGPVPKRWRGVCQTGVRFD  166

Query  127  SSSCNRKLIGARFFSKGHVAASPDYSPHLVEEYISPRDSHGH  2
            + +CNRK++GARFF+KG  AA        V E++SPRD+ GH
Sbjct  167  ARNCNRKIVGARFFAKGQQAAMFSGINKTV-EFLSPRDADGH  207



>ref|XP_009593174.1| PREDICTED: subtilisin-like protease [Nicotiana tomentosiformis]
Length=774

 Score =   110 bits (274),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 53/107 (50%), Positives = 67/107 (63%), Gaps = 5/107 (5%)
 Frame = -1

Query  307  KFLGLSVTEGAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQGFN  128
            +FLGL   +G W +S +G   I+G+LDTG+WPE  SF D  + P P  WKGVCQ G  F 
Sbjct  111  QFLGLRNQKGLWSESDYGSDVIVGVLDTGIWPERRSFSDLNLGPVPTHWKGVCQTGDKFT  170

Query  127  SSSCNRKLIGARFFSKGHVAA-----SPDYSPHLVEEYISPRDSHGH  2
            + +CNRK+IGARFFSKGH AA           +   E+ SPRD+ GH
Sbjct  171  AKNCNRKIIGARFFSKGHEAAPGFGGIGGGGINDTVEFKSPRDADGH  217



>ref|NP_566473.2| Subtilase family protein [Arabidopsis thaliana]
 dbj|BAB02339.1| cucumisin-like serine protease; subtilisin-like protease [Arabidopsis 
thaliana]
 gb|AAS49055.1| At3g14067 [Arabidopsis thaliana]
 gb|AAS76762.1| At3g14067 [Arabidopsis thaliana]
 dbj|BAF00939.1| putative subtilisin-like serine proteinase [Arabidopsis thaliana]
 gb|AEE75461.1| Subtilase family protein [Arabidopsis thaliana]
Length=777

 Score =   110 bits (274),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 51/101 (50%), Positives = 64/101 (63%), Gaps = 0/101 (0%)
 Frame = -1

Query  304  FLGLSVTEGAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQGFNS  125
            FLG S   G W  S +G   I+G+LDTG+WPE PSF D+G+ P P  WKG C+ G  F +
Sbjct  117  FLGFSQNSGLWSNSNYGEDVIVGVLDTGIWPEHPSFSDSGLGPIPSTWKGECEIGPDFPA  176

Query  124  SSCNRKLIGARFFSKGHVAASPDYSPHLVEEYISPRDSHGH  2
            SSCNRKLIGAR F +G++        H  +E  SPRD+ GH
Sbjct  177  SSCNRKLIGARAFYRGYLTQRNGTKKHAAKESRSPRDTEGH  217



>ref|XP_007047286.1| Subtilisin-like serine endopeptidase family protein [Theobroma 
cacao]
 gb|EOX91443.1| Subtilisin-like serine endopeptidase family protein [Theobroma 
cacao]
Length=767

 Score =   110 bits (274),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 54/102 (53%), Positives = 66/102 (65%), Gaps = 4/102 (4%)
 Frame = -1

Query  307  KFLGLSVTEGAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQGFN  128
            +FLGLS   GAW     G   IIG++DTG+WPES SF D GM   P +WKG C+ G  FN
Sbjct  126  QFLGLSSVSGAWTAPNNGEDVIIGIVDTGIWPESESFSDEGMNKVPPRWKGKCESGTEFN  185

Query  127  SSSCNRKLIGARFFSKGHVAASPDYSPHLVEEYISPRDSHGH  2
            SS CN+KLIGARF++KG +A     +P L     SPRD +GH
Sbjct  186  SSFCNKKLIGARFYNKGLLAN----NPKLTIPMNSPRDINGH  223



>ref|XP_011001974.1| PREDICTED: subtilisin-like protease [Populus euphratica]
Length=773

 Score =   110 bits (274),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 52/106 (49%), Positives = 69/106 (65%), Gaps = 4/106 (4%)
 Frame = -1

Query  307  KFLGLSVTEGAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQGFN  128
            +FLGL    G W +S +G   IIG+LDTG+WPE  SF D  +   P +WKG+C+ G+ F+
Sbjct  111  QFLGLRNQRGLWSESDYGSDVIIGVLDTGIWPERRSFSDVNLGAIPARWKGICEVGERFS  170

Query  127  SSSCNRKLIGARFFSKGHVAASPDYSP----HLVEEYISPRDSHGH  2
            + +CN+KLIGARFF KGH AAS    P    +   E+ SPRD+ GH
Sbjct  171  ARNCNKKLIGARFFIKGHEAASGSTGPITPINETVEFKSPRDADGH  216



>ref|XP_002310134.2| subtilase family protein [Populus trichocarpa]
 gb|EEE90584.2| subtilase family protein [Populus trichocarpa]
Length=757

 Score =   110 bits (274),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 52/102 (51%), Positives = 67/102 (66%), Gaps = 4/102 (4%)
 Frame = -1

Query  307  KFLGLSVTEGAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQGFN  128
            +FLGLS + GAW  + +G   IIGL+DTG+WPES SF D GM   P +WKG C+ G  FN
Sbjct  117  EFLGLSSSSGAWPTANYGEDMIIGLVDTGIWPESESFSDEGMTEVPSRWKGKCEPGTQFN  176

Query  127  SSSCNRKLIGARFFSKGHVAASPDYSPHLVEEYISPRDSHGH  2
            SS CN+KLIGAR+++KG +A  P     +     S RD+ GH
Sbjct  177  SSMCNKKLIGARYYNKGLLANDPKIKISMN----STRDTDGH  214



>gb|KDP25228.1| hypothetical protein JCGZ_20384 [Jatropha curcas]
Length=335

 Score =   107 bits (266),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 53/107 (50%), Positives = 75/107 (70%), Gaps = 5/107 (5%)
 Frame = -1

Query  310  YKFLGLS--VTEGAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQ  137
            ++F+GL+   +     +S  G GTIIG++D+G+WPES SF+D GM P P  WKG+CQ G+
Sbjct  79   WEFIGLNHHSSRNLLTQSNMGEGTIIGVIDSGIWPESKSFNDQGMRPVPSHWKGICQGGE  138

Query  136  GFNSSSCNRKLIGARFFSKG--HVAASPDYSPHLVEEYISPRDSHGH  2
             FNSS+CN+KLIGAR+F KG   V + P  + + + E++SPRD  GH
Sbjct  139  HFNSSNCNKKLIGARWFIKGFKDVISKPVNTTNSM-EFLSPRDGSGH  184



>ref|XP_011001975.1| PREDICTED: subtilisin-like protease [Populus euphratica]
Length=773

 Score =   109 bits (273),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 52/106 (49%), Positives = 69/106 (65%), Gaps = 4/106 (4%)
 Frame = -1

Query  307  KFLGLSVTEGAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQGFN  128
            +FLGL    G W +S +G   IIG+LDTG+WPE  SF D  +   P +WKG+C+ G+ F+
Sbjct  111  QFLGLRNQRGLWSESDYGSDVIIGVLDTGIWPERRSFSDVNLGAIPARWKGICEVGERFS  170

Query  127  SSSCNRKLIGARFFSKGHVAASPDYSP----HLVEEYISPRDSHGH  2
            + +CN+KLIGARFF KGH AAS    P    +   E+ SPRD+ GH
Sbjct  171  ARNCNKKLIGARFFIKGHEAASGSTGPITPINETVEFKSPRDADGH  216



>ref|XP_007051967.1| Subtilase family protein [Theobroma cacao]
 gb|EOX96124.1| Subtilase family protein [Theobroma cacao]
Length=771

 Score =   109 bits (273),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 50/102 (49%), Positives = 65/102 (64%), Gaps = 2/102 (2%)
 Frame = -1

Query  307  KFLGLSVTEGAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQGFN  128
            +FLGL   +G W  S      IIGL+D+G+WPE  SF D  MPP P +WKG C+EG  F 
Sbjct  122  QFLGLEYGKGLWNASNLNSDVIIGLVDSGIWPEHVSFQDENMPPVPSRWKGACEEGTNFT  181

Query  127  SSSCNRKLIGARFFSKGHVAASPDYSPHLVEEYISPRDSHGH  2
             S+CN+K+IGAR+F KG+ A    +S   + +Y S RDS GH
Sbjct  182  KSNCNKKIIGARYFFKGYEATIGKFSK--ITDYKSARDSVGH  221



>ref|XP_010320328.1| PREDICTED: subtilisin-like protease [Solanum lycopersicum]
Length=751

 Score =   109 bits (273),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 51/102 (50%), Positives = 68/102 (67%), Gaps = 4/102 (4%)
 Frame = -1

Query  307  KFLGLSVTEGAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQGFN  128
            +FLGL+   G W KS +G   I+GL+DTG+WPES S+ D GM   P +WKG C+ G  FN
Sbjct  108  QFLGLNSESGVWPKSDYGKDVIVGLVDTGIWPESRSYSDDGMNEVPSRWKGECESGTQFN  167

Query  127  SSSCNRKLIGARFFSKGHVAASPDYSPHLVEEYISPRDSHGH  2
            +S CN+KLIGAR+F+KG +A +P+    L     S RD+ GH
Sbjct  168  TSLCNKKLIGARYFNKGLLANNPN----LTISMDSARDTDGH  205



>ref|XP_008221259.1| PREDICTED: subtilisin-like protease [Prunus mume]
Length=767

 Score =   109 bits (273),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 54/102 (53%), Positives = 68/102 (67%), Gaps = 4/102 (4%)
 Frame = -1

Query  307  KFLGLSVTEGAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQGFN  128
            +FLGLS   GAW  + +G   IIG++D+GVWPES SF D GM   P +WKG C+ G  FN
Sbjct  123  QFLGLSSKSGAWPVADYGKDVIIGVVDSGVWPESESFSDDGMSEIPPRWKGECESGTQFN  182

Query  127  SSSCNRKLIGARFFSKGHVAASPDYSPHLVEEYISPRDSHGH  2
            SS CN+KLIGARFF+KG +A +P+    L     S RD+ GH
Sbjct  183  SSLCNKKLIGARFFNKGLIAQNPN----LTISVNSTRDTDGH  220



>ref|NP_001052820.1| Os04g0430700 [Oryza sativa Japonica Group]
 dbj|BAF14734.1| Os04g0430700 [Oryza sativa Japonica Group]
Length=777

 Score =   109 bits (273),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 54/102 (53%), Positives = 67/102 (66%), Gaps = 4/102 (4%)
 Frame = -1

Query  304  FLGLSVTEGAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGM-PPAPGKWKGVCQEGQGFN  128
            FLGLS   GAW  SR+G   ++G++DTGVWPES SF DAG+  P P +WKG C+ G  F 
Sbjct  118  FLGLSAGAGAWPASRYGADVVVGIVDTGVWPESASFSDAGVAAPVPARWKGACEAGASFR  177

Query  127  SSSCNRKLIGARFFSKGHVAASPDYSPHLVEEYISPRDSHGH  2
             S CNRKL+GAR FSKG      + S    ++Y SPRD +GH
Sbjct  178  PSMCNRKLVGARSFSKGLRQRGLNISD---DDYDSPRDYYGH  216



>ref|XP_007199629.1| hypothetical protein PRUPE_ppa001754mg [Prunus persica]
 gb|EMJ00828.1| hypothetical protein PRUPE_ppa001754mg [Prunus persica]
Length=770

 Score =   109 bits (273),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 54/106 (51%), Positives = 68/106 (64%), Gaps = 4/106 (4%)
 Frame = -1

Query  307  KFLGLSVTEGAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQGFN  128
            +FLGL    G W +S +G   I+G+ DTGVWPE  SF D  + P P +W+GVC+ G  F 
Sbjct  110  QFLGLRNQRGLWSESDYGSDVIVGVFDTGVWPERRSFSDKHLGPIPRRWRGVCETGVKFA  169

Query  127  SSSCNRKLIGARFFSKGHVAAS----PDYSPHLVEEYISPRDSHGH  2
             S+CNRKLIGARFF KGH AA+    P  + +   EY SPRD+ GH
Sbjct  170  RSNCNRKLIGARFFIKGHEAAANAGGPISAINDTVEYRSPRDADGH  215



>ref|NP_569044.1| Subtilisin-like serine endopeptidase family protein [Arabidopsis 
thaliana]
 dbj|BAB10943.1| subtilisin-type protease-like [Arabidopsis thaliana]
 gb|AAS99721.1| At5g67090 [Arabidopsis thaliana]
 dbj|BAD94613.1| subtilisin-type protease-like [Arabidopsis thaliana]
 gb|AED98299.1| Subtilisin-like serine endopeptidase family protein [Arabidopsis 
thaliana]
Length=736

 Score =   109 bits (273),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 53/103 (51%), Positives = 70/103 (68%), Gaps = 5/103 (5%)
 Frame = -1

Query  307  KFLGLSVTEGAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGMPPAPGKWKGVCQEGQGFN  128
            KF+GL+ T G W  S +G G +IG++DTG+WP+SPSF D G+   P KWKG C+    FN
Sbjct  107  KFIGLNSTSGTWPVSNYGAGIVIGIIDTGIWPDSPSFHDDGVGSVPSKWKGACE----FN  162

Query  127  SSS-CNRKLIGARFFSKGHVAASPDYSPHLVEEYISPRDSHGH  2
            SSS CN+KLIGA+ F+KG  A +PD     + +Y SP D+ GH
Sbjct  163  SSSLCNKKLIGAKVFNKGLFANNPDLRETKIGQYSSPYDTIGH  205



>emb|CAH67004.1| OSIGBa0160I14.2 [Oryza sativa Indica Group]
Length=776

 Score =   109 bits (273),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 54/102 (53%), Positives = 67/102 (66%), Gaps = 4/102 (4%)
 Frame = -1

Query  304  FLGLSVTEGAWVKSRFGCGTIIGLLDTGVWPESPSFDDAGM-PPAPGKWKGVCQEGQGFN  128
            FLGLS   GAW  SR+G   ++G++DTGVWPES SF DAG+  P P +WKG C+ G  F 
Sbjct  117  FLGLSAGAGAWPASRYGADVVVGIVDTGVWPESASFSDAGVAAPVPARWKGACEAGASFR  176

Query  127  SSSCNRKLIGARFFSKGHVAASPDYSPHLVEEYISPRDSHGH  2
             S CNRKL+GAR FSKG      + S    ++Y SPRD +GH
Sbjct  177  PSMCNRKLVGARSFSKGLRQRGLNISD---DDYDSPRDYYGH  215



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 513816688404