BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c98338_g1_i1 len=351 path=[329:0-350]

Length=351
                                                                      Score     E

ref|XP_010323418.1|  PREDICTED: putative E3 ubiquitin-protein lig...    185   9e-52   
ref|XP_010323417.1|  PREDICTED: putative E3 ubiquitin-protein lig...    185   1e-51   
ref|XP_010323416.1|  PREDICTED: putative E3 ubiquitin-protein lig...    185   1e-51   
ref|XP_006341274.1|  PREDICTED: putative E3 ubiquitin-protein lig...    184   7e-51   
emb|CDP03302.1|  unnamed protein product                                183   1e-50   
ref|XP_009606221.1|  PREDICTED: putative E3 ubiquitin-protein lig...    181   9e-50   
ref|XP_009788941.1|  PREDICTED: putative E3 ubiquitin-protein lig...    180   1e-49   
ref|XP_009788939.1|  PREDICTED: putative E3 ubiquitin-protein lig...    180   1e-49   
gb|KDP33701.1|  hypothetical protein JCGZ_07272                         169   1e-48   
ref|XP_008352326.1|  PREDICTED: putative E3 ubiquitin-protein lig...    176   5e-48   
ref|XP_009352688.1|  PREDICTED: putative E3 ubiquitin-protein lig...    175   1e-47   
ref|XP_011078302.1|  PREDICTED: LOW QUALITY PROTEIN: putative E3 ...    174   3e-47   
emb|CAN83797.1|  hypothetical protein VITISV_002973                     174   3e-47   Vitis vinifera
ref|XP_010656298.1|  PREDICTED: putative E3 ubiquitin-protein lig...    172   5e-47   
emb|CBI28040.3|  unnamed protein product                                172   5e-47   
ref|XP_010656297.1|  PREDICTED: putative E3 ubiquitin-protein lig...    173   5e-47   
ref|XP_007204677.1|  hypothetical protein PRUPE_ppa000309mg             172   1e-46   
ref|XP_010100641.1|  Putative E3 ubiquitin-protein ligase LIN-1         171   2e-46   
ref|XP_010249650.1|  PREDICTED: putative E3 ubiquitin-protein lig...    171   2e-46   
ref|XP_007013113.1|  Transducin/WD40 repeat-like superfamily protein    169   8e-46   
ref|XP_011048372.1|  PREDICTED: putative E3 ubiquitin-protein lig...    168   2e-45   
ref|XP_004299991.1|  PREDICTED: LOW QUALITY PROTEIN: putative E3 ...    168   3e-45   
ref|XP_002514271.1|  F-box and wd40 domain protein, putative            167   3e-45   Ricinus communis
ref|XP_008242573.1|  PREDICTED: putative E3 ubiquitin-protein lig...    164   4e-44   
ref|XP_008387007.1|  PREDICTED: LOW QUALITY PROTEIN: putative E3 ...    162   1e-43   
gb|KDO66445.1|  hypothetical protein CISIN_1g001349mg                   162   2e-43   
gb|KDO66444.1|  hypothetical protein CISIN_1g001349mg                   162   2e-43   
ref|XP_006451205.1|  hypothetical protein CICLE_v10007255mg             162   3e-43   
gb|EYU32945.1|  hypothetical protein MIMGU_mgv1a000874mg                160   7e-43   
ref|XP_006833370.1|  hypothetical protein AMTR_s00109p00103350          158   1e-41   
ref|XP_008462773.1|  PREDICTED: putative E3 ubiquitin-protein lig...    155   6e-41   
gb|KCW79939.1|  hypothetical protein EUGRSUZ_C01271                     154   9e-41   
gb|KCW79938.1|  hypothetical protein EUGRSUZ_C01271                     154   1e-40   
ref|XP_010050571.1|  PREDICTED: putative E3 ubiquitin-protein lig...    154   2e-40   
ref|XP_004155724.1|  PREDICTED: LOW QUALITY PROTEIN: putative E3 ...    153   4e-40   
ref|XP_004142566.1|  PREDICTED: putative E3 ubiquitin-protein lig...    153   6e-40   
gb|KGN66817.1|  hypothetical protein Csa_1G696500                       152   6e-40   
ref|XP_009606222.1|  PREDICTED: putative E3 ubiquitin-protein lig...    152   7e-40   
ref|XP_009788942.1|  PREDICTED: putative E3 ubiquitin-protein lig...    152   7e-40   
ref|XP_010915863.1|  PREDICTED: putative E3 ubiquitin-protein lig...    152   1e-39   
ref|XP_006580471.1|  PREDICTED: putative E3 ubiquitin-protein lig...    151   2e-39   
ref|XP_002325006.2|  hypothetical protein POPTR_0018s09040g             150   2e-39   Populus trichocarpa [western balsam poplar]
ref|XP_006584821.1|  PREDICTED: putative E3 ubiquitin-protein lig...    148   2e-38   
ref|XP_007160321.1|  hypothetical protein PHAVU_002G311800g             148   3e-38   
ref|XP_003630767.1|  U-box domain-containing protein                    146   6e-38   
gb|KEH21350.1|  E3 ubiquitin-protein ligase LIN-like protein, put...    147   8e-38   
ref|XP_008783309.1|  PREDICTED: putative E3 ubiquitin-protein lig...    141   6e-36   
ref|XP_009380565.1|  PREDICTED: putative E3 ubiquitin-protein lig...    138   1e-34   
ref|XP_004971473.1|  PREDICTED: putative E3 ubiquitin-protein lig...    137   1e-34   
ref|XP_002454892.1|  hypothetical protein SORBIDRAFT_03g000870          133   4e-33   Sorghum bicolor [broomcorn]
ref|XP_002307730.2|  hypothetical protein POPTR_0005s26160g             132   9e-33   Populus trichocarpa [western balsam poplar]
dbj|BAJ95654.1|  predicted protein                                      131   2e-32   
ref|XP_010230655.1|  PREDICTED: putative E3 ubiquitin-protein lig...    131   2e-32   
ref|XP_007225466.1|  hypothetical protein PRUPE_ppa000216mg             131   3e-32   
ref|XP_002300701.2|  hypothetical protein POPTR_0002s02320g             130   4e-32   Populus trichocarpa [western balsam poplar]
ref|XP_009334977.1|  PREDICTED: putative E3 ubiquitin-protein lig...    130   5e-32   
ref|XP_008221252.1|  PREDICTED: putative E3 ubiquitin-protein lig...    130   7e-32   
ref|XP_008221253.1|  PREDICTED: putative E3 ubiquitin-protein lig...    130   7e-32   
ref|XP_011045075.1|  PREDICTED: putative E3 ubiquitin-protein lig...    129   8e-32   
ref|XP_011045077.1|  PREDICTED: putative E3 ubiquitin-protein lig...    129   8e-32   
ref|XP_011045078.1|  PREDICTED: putative E3 ubiquitin-protein lig...    129   1e-31   
ref|XP_011029082.1|  PREDICTED: putative E3 ubiquitin-protein lig...    127   5e-31   
ref|XP_004292946.1|  PREDICTED: putative E3 ubiquitin-protein lig...    127   7e-31   
ref|XP_008366744.1|  PREDICTED: putative E3 ubiquitin-protein lig...    126   1e-30   
gb|KDP36916.1|  hypothetical protein JCGZ_08207                         122   1e-30   
ref|XP_008466477.1|  PREDICTED: LOW QUALITY PROTEIN: putative E3 ...    125   2e-30   
gb|EMT16354.1|  U-box domain-containing protein 13                      125   3e-30   
ref|XP_008675635.1|  PREDICTED: putative E3 ubiquitin-protein lig...    125   3e-30   
tpg|DAA52769.1|  TPA: hypothetical protein ZEAMMB73_576745              125   3e-30   
ref|XP_006492801.1|  PREDICTED: putative E3 ubiquitin-protein lig...    125   3e-30   
gb|KDO41596.1|  hypothetical protein CISIN_1g0007442mg                  124   5e-30   
emb|CAN74785.1|  hypothetical protein VITISV_011516                     124   5e-30   Vitis vinifera
ref|XP_009588633.1|  PREDICTED: putative E3 ubiquitin-protein lig...    124   5e-30   
ref|XP_009588632.1|  PREDICTED: putative E3 ubiquitin-protein lig...    124   5e-30   
ref|XP_009588635.1|  PREDICTED: putative E3 ubiquitin-protein lig...    124   5e-30   
ref|XP_009588634.1|  PREDICTED: putative E3 ubiquitin-protein lig...    124   6e-30   
ref|XP_006851971.1|  hypothetical protein AMTR_s00041p00198080          121   9e-30   
tpg|DAA52770.1|  TPA: hypothetical protein ZEAMMB73_576745              123   1e-29   
ref|XP_009773051.1|  PREDICTED: putative E3 ubiquitin-protein lig...    123   1e-29   
ref|XP_009773032.1|  PREDICTED: putative E3 ubiquitin-protein lig...    123   1e-29   
ref|XP_009773059.1|  PREDICTED: putative E3 ubiquitin-protein lig...    123   1e-29   
ref|XP_009773037.1|  PREDICTED: putative E3 ubiquitin-protein lig...    123   1e-29   
ref|XP_009773043.1|  PREDICTED: putative E3 ubiquitin-protein lig...    123   2e-29   
ref|XP_010062045.1|  PREDICTED: LOW QUALITY PROTEIN: putative E3 ...    122   2e-29   
ref|XP_004162568.1|  PREDICTED: putative E3 ubiquitin-protein lig...    122   2e-29   
gb|KCW69116.1|  hypothetical protein EUGRSUZ_F02660                     122   2e-29   
ref|XP_004136490.1|  PREDICTED: putative E3 ubiquitin-protein lig...    122   2e-29   
gb|KGN60041.1|  hypothetical protein Csa_3G872720                       122   2e-29   
sp|C6L7U1.2|LIN1_LOTJA  RecName: Full=Putative E3 ubiquitin-prote...    122   3e-29   Lotus japonicus
dbj|BAH86605.1|  U-box protein with unknown function                    122   3e-29   Lotus japonicus
ref|XP_003536276.1|  PREDICTED: putative E3 ubiquitin-protein lig...    122   3e-29   
ref|XP_011083563.1|  PREDICTED: putative E3 ubiquitin-protein lig...    122   4e-29   
ref|XP_006357361.1|  PREDICTED: putative E3 ubiquitin-protein lig...    122   4e-29   
ref|XP_007027082.1|  Transducin/WD40 repeat-like superfamily protein    122   5e-29   
ref|XP_002279863.2|  PREDICTED: putative E3 ubiquitin-protein lig...    121   5e-29   Vitis vinifera
ref|XP_010664820.1|  PREDICTED: putative E3 ubiquitin-protein lig...    121   5e-29   
emb|CBI19874.3|  unnamed protein product                                121   5e-29   
ref|XP_004496090.1|  PREDICTED: putative E3 ubiquitin-protein lig...    121   8e-29   
ref|XP_007144197.1|  hypothetical protein PHAVU_007G136300g             120   1e-28   
ref|XP_003591660.1|  U-box domain-containing protein                    119   3e-28   
sp|D1FP53.1|LIN_MEDTR  RecName: Full=Putative E3 ubiquitin-protei...    119   3e-28   Medicago truncatula
ref|XP_010319719.1|  PREDICTED: putative E3 ubiquitin-protein lig...    119   5e-28   
ref|XP_010319718.1|  PREDICTED: putative E3 ubiquitin-protein lig...    119   5e-28   
ref|XP_010319715.1|  PREDICTED: putative E3 ubiquitin-protein lig...    119   5e-28   
gb|EYU38802.1|  hypothetical protein MIMGU_mgv1a023448mg                119   5e-28   
emb|CDP07391.1|  unnamed protein product                                118   7e-28   
ref|XP_010920190.1|  PREDICTED: putative E3 ubiquitin-protein lig...    117   2e-27   
ref|XP_008788369.1|  PREDICTED: putative E3 ubiquitin-protein lig...    116   3e-27   
ref|XP_008788367.1|  PREDICTED: putative E3 ubiquitin-protein lig...    116   3e-27   
ref|XP_006645675.1|  PREDICTED: LOW QUALITY PROTEIN: putative E3 ...    116   3e-27   
gb|KHN37909.1|  Putative E3 ubiquitin-protein ligase LIN-1              114   2e-26   
gb|KCW67972.1|  hypothetical protein EUGRSUZ_F016653                    108   2e-26   
ref|NP_001042489.1|  Os01g0229700                                       112   6e-26   Oryza sativa Japonica Group [Japonica rice]
gb|EEE54168.1|  hypothetical protein OsJ_00982                          112   7e-26   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010064564.1|  PREDICTED: LOW QUALITY PROTEIN: putative E3 ...    112   1e-25   
gb|EEC70236.1|  hypothetical protein OsI_01010                          111   2e-25   Oryza sativa Indica Group [Indian rice]
ref|XP_002510542.1|  hypothetical protein RCOM_1598060                  110   3e-25   Ricinus communis
sp|D1FP57.1|LIN2_LOTJA  RecName: Full=Putative E3 ubiquitin-prote...    107   6e-24   Lotus japonicus
gb|ACL14424.1|  putative E3 ubiquitin ligase                            105   3e-23   Lotus japonicus
ref|XP_002988129.1|  hypothetical protein SELMODRAFT_426843             101   7e-22   
ref|XP_010104461.1|  Putative E3 ubiquitin-protein ligase LIN-1       98.6    6e-21   
ref|XP_002972675.1|  hypothetical protein SELMODRAFT_413195           96.3    4e-20   
gb|KDO66446.1|  hypothetical protein CISIN_1g001349mg                 88.2    2e-17   
ref|XP_010259556.1|  PREDICTED: putative E3 ubiquitin-protein lig...  80.5    9e-15   
ref|XP_002269707.2|  PREDICTED: putative E3 ubiquitin-protein lig...  79.3    2e-14   Vitis vinifera
emb|CAN65866.1|  hypothetical protein VITISV_010257                   79.3    2e-14   Vitis vinifera
ref|XP_010649586.1|  PREDICTED: putative E3 ubiquitin-protein lig...  79.3    2e-14   
emb|CBI23000.3|  unnamed protein product                              79.3    2e-14   
ref|XP_002984593.1|  hypothetical protein SELMODRAFT_423775           77.4    1e-13   
ref|XP_002978658.1|  hypothetical protein SELMODRAFT_418457           76.6    2e-13   
ref|XP_004296849.1|  PREDICTED: putative E3 ubiquitin-protein lig...  76.3    2e-13   
ref|XP_006840583.1|  hypothetical protein AMTR_s00045p00231470        75.5    5e-13   
ref|XP_006442167.1|  hypothetical protein CICLE_v10024300mg           75.1    7e-13   
ref|XP_009411673.1|  PREDICTED: putative E3 ubiquitin-protein lig...  74.7    9e-13   
ref|XP_007225317.1|  hypothetical protein PRUPE_ppa001127mg           73.6    2e-12   
gb|KEH37240.1|  E3 ubiquitin-protein ligase LIN-like protein, put...  73.6    2e-12   
ref|XP_002516937.1|  nucleotide binding protein, putative             73.6    3e-12   Ricinus communis
ref|XP_010921672.1|  PREDICTED: LOW QUALITY PROTEIN: putative E3 ...  73.2    3e-12   
ref|XP_008223230.1|  PREDICTED: putative E3 ubiquitin-protein lig...  72.8    3e-12   
ref|XP_006342809.1|  PREDICTED: putative E3 ubiquitin-protein lig...  72.4    5e-12   
ref|XP_009352279.1|  PREDICTED: putative E3 ubiquitin-protein lig...  72.4    5e-12   
ref|XP_009352280.1|  PREDICTED: putative E3 ubiquitin-protein lig...  72.4    5e-12   
ref|XP_009352281.1|  PREDICTED: putative E3 ubiquitin-protein lig...  72.4    5e-12   
ref|XP_006342808.1|  PREDICTED: putative E3 ubiquitin-protein lig...  72.4    5e-12   
ref|XP_010938388.1|  PREDICTED: putative E3 ubiquitin-protein lig...  72.4    6e-12   
ref|XP_008390650.1|  PREDICTED: putative E3 ubiquitin-protein lig...  72.0    7e-12   
ref|XP_008390649.1|  PREDICTED: putative E3 ubiquitin-protein lig...  72.0    8e-12   
ref|XP_010039822.1|  PREDICTED: putative E3 ubiquitin-protein lig...  71.6    1e-11   
ref|XP_010039827.1|  PREDICTED: putative E3 ubiquitin-protein lig...  71.6    1e-11   
ref|XP_004134218.1|  PREDICTED: putative E3 ubiquitin-protein lig...  70.9    2e-11   
ref|XP_004164710.1|  PREDICTED: putative E3 ubiquitin-protein lig...  70.9    2e-11   
ref|XP_009787386.1|  PREDICTED: putative E3 ubiquitin-protein lig...  70.9    2e-11   
ref|XP_009787385.1|  PREDICTED: putative E3 ubiquitin-protein lig...  70.9    2e-11   
ref|XP_002440973.1|  hypothetical protein SORBIDRAFT_09g018080        70.5    2e-11   Sorghum bicolor [broomcorn]
ref|XP_004229247.1|  PREDICTED: putative E3 ubiquitin-protein lig...  70.5    2e-11   
ref|XP_009593979.1|  PREDICTED: putative E3 ubiquitin-protein lig...  70.5    3e-11   
ref|XP_009593981.1|  PREDICTED: putative E3 ubiquitin-protein lig...  70.5    3e-11   
ref|XP_008784743.1|  PREDICTED: putative E3 ubiquitin-protein lig...  70.1    3e-11   
ref|XP_004487840.1|  PREDICTED: putative E3 ubiquitin-protein lig...  69.7    5e-11   
ref|XP_008438896.1|  PREDICTED: putative E3 ubiquitin-protein lig...  69.3    5e-11   
ref|XP_006597729.1|  PREDICTED: putative E3 ubiquitin-protein lig...  69.3    6e-11   
ref|XP_006597730.1|  PREDICTED: putative E3 ubiquitin-protein lig...  69.3    6e-11   
ref|XP_006597728.1|  PREDICTED: putative E3 ubiquitin-protein lig...  69.3    6e-11   
gb|KHN14614.1|  Putative E3 ubiquitin-protein ligase LIN-1            69.3    6e-11   
ref|XP_006380148.1|  transducin family protein                        69.3    7e-11   
ref|XP_011014347.1|  PREDICTED: putative E3 ubiquitin-protein lig...  68.6    1e-10   
ref|XP_011014349.1|  PREDICTED: putative E3 ubiquitin-protein lig...  68.6    1e-10   
ref|XP_011014348.1|  PREDICTED: putative E3 ubiquitin-protein lig...  68.6    1e-10   
ref|XP_004963834.1|  PREDICTED: putative E3 ubiquitin-protein lig...  68.6    1e-10   
ref|XP_010486217.1|  PREDICTED: putative E3 ubiquitin-protein lig...  68.6    1e-10   
gb|KDP27810.1|  hypothetical protein JCGZ_18890                       68.2    1e-10   
ref|XP_008789861.1|  PREDICTED: putative E3 ubiquitin-protein lig...  68.2    2e-10   
ref|XP_011090986.1|  PREDICTED: putative E3 ubiquitin-protein lig...  67.8    2e-10   
ref|XP_011090985.1|  PREDICTED: putative E3 ubiquitin-protein lig...  67.8    2e-10   
gb|KHN26549.1|  Putative E3 ubiquitin-protein ligase LIN-1            67.8    2e-10   
ref|XP_006586921.1|  PREDICTED: putative E3 ubiquitin-protein lig...  67.4    2e-10   
ref|XP_006586920.1|  PREDICTED: putative E3 ubiquitin-protein lig...  67.4    2e-10   
ref|XP_006586918.1|  PREDICTED: putative E3 ubiquitin-protein lig...  67.4    3e-10   
ref|XP_006586919.1|  PREDICTED: putative E3 ubiquitin-protein lig...  67.4    3e-10   
gb|AAV31407.1|  unknown protein                                       66.6    3e-10   Oryza sativa Japonica Group [Japonica rice]
gb|AAU10838.1|  unknown protein                                       66.6    3e-10   Oryza sativa Japonica Group [Japonica rice]
gb|AFW77650.1|  hypothetical protein ZEAMMB73_448999                  67.0    3e-10   
gb|EMS51188.1|  Mitochondrial division protein 1                      67.0    4e-10   
gb|EMT33236.1|  hypothetical protein F775_04441                       67.0    4e-10   
gb|AFW77651.1|  hypothetical protein ZEAMMB73_448999                  66.6    4e-10   
ref|XP_008649518.1|  PREDICTED: putative E3 ubiquitin-protein lig...  66.6    4e-10   
ref|XP_008649517.1|  PREDICTED: putative E3 ubiquitin-protein lig...  66.6    4e-10   
ref|XP_007035615.1|  Nucleotide binding protein, putative isoform 2   66.2    6e-10   
emb|CDO98856.1|  unnamed protein product                              66.2    6e-10   
ref|XP_007035614.1|  Nucleotide binding protein, putative isoform 1   66.2    6e-10   
ref|XP_007138921.1|  hypothetical protein PHAVU_009G249000g           65.9    9e-10   
gb|EEE63434.1|  hypothetical protein OsJ_18247                        65.9    1e-09   Oryza sativa Japonica Group [Japonica rice]
gb|EEC79071.1|  hypothetical protein OsI_19654                        65.9    1e-09   Oryza sativa Indica Group [Indian rice]
ref|XP_006296842.1|  hypothetical protein CARUB_v10012828mg           65.1    1e-09   
ref|XP_006296841.1|  hypothetical protein CARUB_v10012828mg           65.1    2e-09   
ref|XP_006655235.1|  PREDICTED: putative E3 ubiquitin-protein lig...  64.7    2e-09   
ref|XP_010445722.1|  PREDICTED: putative E3 ubiquitin-protein lig...  63.5    6e-09   
gb|KFK38152.1|  hypothetical protein AALP_AA3G075800                  63.5    6e-09   
ref|XP_010445833.1|  PREDICTED: putative E3 ubiquitin-protein lig...  63.5    6e-09   
gb|KFK38151.1|  hypothetical protein AALP_AA3G075800                  63.5    6e-09   
gb|EYU43963.1|  hypothetical protein MIMGU_mgv1a0007471mg             61.6    6e-09   
ref|XP_010547022.1|  PREDICTED: putative E3 ubiquitin-protein lig...  63.2    7e-09   
ref|XP_010547024.1|  PREDICTED: putative E3 ubiquitin-protein lig...  63.2    7e-09   
ref|XP_010464281.1|  PREDICTED: putative E3 ubiquitin-protein lig...  62.8    8e-09   
ref|XP_010464279.1|  PREDICTED: putative E3 ubiquitin-protein lig...  62.8    8e-09   
ref|XP_002884613.1|  transducin family protein                        62.8    8e-09   
gb|AAF26992.1|AC016827_3  hypothetical protein                        62.0    2e-08   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006407893.1|  hypothetical protein EUTSA_v10019914mg           61.6    2e-08   
ref|XP_010233259.1|  PREDICTED: putative E3 ubiquitin-protein lig...  60.8    4e-08   
ref|XP_010547025.1|  PREDICTED: putative E3 ubiquitin-protein lig...  60.8    4e-08   
gb|KHG22392.1|  Putative E3 ubiquitin-protein ligase LIN-1            60.5    6e-08   
ref|NP_001189833.1|  transducin/WD-40 repeat-containing protein       59.7    1e-07   
ref|NP_187344.5|  transducin/WD-40 repeat-containing protein          59.7    1e-07   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006419552.1|  hypothetical protein CICLE_v10004156mg           58.9    2e-07   
ref|XP_006419551.1|  hypothetical protein CICLE_v10004156mg           58.5    2e-07   
gb|KDO71701.1|  hypothetical protein CISIN_1g000694mg                 58.5    2e-07   
gb|KDO71699.1|  hypothetical protein CISIN_1g000694mg                 58.2    3e-07   
gb|KDO71698.1|  hypothetical protein CISIN_1g000694mg                 58.2    3e-07   
ref|XP_006489060.1|  PREDICTED: putative E3 ubiquitin-protein lig...  55.5    2e-06   
ref|XP_006489061.1|  PREDICTED: putative E3 ubiquitin-protein lig...  55.5    2e-06   
ref|XP_006489062.1|  PREDICTED: putative E3 ubiquitin-protein lig...  55.5    3e-06   
gb|ETO22081.1|  NB-ARC domain-containing protein                      55.5    3e-06   
ref|XP_009134936.1|  PREDICTED: putative E3 ubiquitin-protein lig...  54.7    5e-06   
ref|XP_009134935.1|  PREDICTED: putative E3 ubiquitin-protein lig...  54.7    5e-06   
emb|CDX74073.1|  BnaA03g29740D                                        53.9    7e-06   
emb|CDY08026.1|  BnaC03g34970D                                        53.5    1e-05   
ref|WP_011305578.1|  WD-40 repeat-containing protein                  52.8    1e-05   
ref|WP_017746049.1|  hypothetical protein                             52.8    2e-05   
ref|WP_015144880.1|  WD40 repeat-containing protein                   52.0    3e-05   
gb|EUC67532.1|  vegetative incompatibility protein HET-E-1            52.0    3e-05   
ref|XP_010056242.1|  PREDICTED: zinc finger CCCH domain-containin...  48.5    3e-05   
ref|WP_015148272.1|  WD40 repeat-containing protein                   51.6    4e-05   
ref|XP_008595056.1|  F-box protein                                    50.8    4e-05   
emb|CCX32796.1|  Similar to Ribosome biogenesis protein YTM1; acc...  51.2    5e-05   
ref|XP_007337066.1|  WD40 repeat-like protein                         51.6    5e-05   
ref|WP_035799680.1|  hypothetical protein                             49.7    5e-05   
gb|ETO16966.1|  NB-ARC domain-containing protein                      51.6    5e-05   
ref|WP_038075931.1|  hypothetical protein                             51.2    5e-05   
emb|CCL98577.1|  predicted protein                                    51.2    6e-05   
ref|WP_015138834.1|  WD40 repeat-containing protein                   51.2    6e-05   
ref|WP_034957264.1|  hypothetical protein                             50.8    6e-05   
ref|WP_015114595.1|  serine/threonine protein kinase with WD40 re...  50.8    7e-05   
ref|WP_007357883.1|  MULTISPECIES: hypothetical protein               50.8    7e-05   
ref|WP_017653704.1|  hypothetical protein                             50.8    7e-05   
ref|XP_759931.1|  hypothetical protein UM03784.1                      50.8    8e-05   Ustilago maydis 521
gb|EAZ90378.1|  Serine/Threonine protein kinase with WD40 repeats     49.7    9e-05   Cyanothece sp. CCY0110
gb|ETO12363.1|  G-protein beta WD-40 repeats containing protein       50.4    9e-05   
gb|KFH70070.1|  hypothetical protein MVEG_04873                       50.4    9e-05   
ref|WP_039717436.1|  hypothetical protein                             49.7    1e-04   
emb|CCF50547.1|  related to STRIATIN                                  50.4    1e-04   
gb|EMT33425.1|  hypothetical protein F775_17090                       50.1    1e-04   
ref|WP_017306791.1|  hypothetical protein                             50.4    1e-04   
gb|ETO09924.1|  NB-ARC domain-containing protein                      50.4    1e-04   
ref|XP_002956559.1|  hypothetical protein VOLCADRAFT_67131            50.1    1e-04   
gb|EEC70085.1|  hypothetical protein OsI_00706                        50.1    1e-04   Oryza sativa Indica Group [Indian rice]
ref|XP_002511781.1|  F-box and wd40 domain protein, putative          50.1    1e-04   Ricinus communis
gb|EEE54020.1|  hypothetical protein OsJ_00683                        50.4    1e-04   Oryza sativa Japonica Group [Japonica rice]
ref|XP_001448700.1|  hypothetical protein                             50.1    1e-04   Paramecium tetraurelia strain d4-2
ref|WP_027269037.1|  hypothetical protein                             50.1    1e-04   
gb|KEP52548.1|  putative vegetative incompatibility protein HET-E-1   50.1    1e-04   
gb|EUC55584.1|  vegetative incompatibility protein HET-E-1, putative  50.1    1e-04   
gb|EJY70949.1|  WD repeat domain 16                                   49.7    1e-04   
ref|WP_015189013.1|  WD40 repeat-containing protein                   49.3    1e-04   
gb|EUC57206.1|  vegetative incompatibility protein HET-E-1            50.1    2e-04   
gb|EMD30352.1|  hypothetical protein CERSUDRAFT_61248                 47.8    2e-04   
ref|XP_010034837.1|  PREDICTED: F-box/WD repeat-containing protei...  49.3    2e-04   
ref|WP_035150906.1|  WD40 repeat-containing protein                   49.7    2e-04   
gb|EJY66457.1|  WD40 repeat-containing protein                        49.7    2e-04   
ref|XP_003289678.1|  myosin heavy chain kinase B                      49.7    2e-04   
gb|KEP48259.1|  vegetative incompatibility protein HET-E-1            49.7    2e-04   
dbj|GAK57023.1|  serine/threonine protein kinase with WD40 repeats    49.7    2e-04   
ref|XP_005100523.1|  PREDICTED: striatin-3-like isoform X4            49.7    2e-04   
ref|WP_013192512.1|  WD40 domain-containing protein                   49.7    2e-04   
ref|XP_005100521.1|  PREDICTED: striatin-3-like isoform X2            49.7    2e-04   
ref|WP_035151589.1|  serine/threonine protein kinase                  49.7    2e-04   
gb|AHI00259.1|  hypothetical protein KALB_6900                        49.7    2e-04   
gb|EHK48473.1|  transcriptional repressor rco-1-like protein          48.9    2e-04   
ref|WP_008186446.1|  protein kinase                                   49.7    2e-04   
ref|XP_002511756.1|  F-box and wd40 domain protein, putative          49.3    2e-04   Ricinus communis
ref|WP_023066432.1|  WD domain, G-beta repeat family protein          49.7    2e-04   
ref|XP_001435826.1|  hypothetical protein                             49.3    2e-04   
ref|XP_005100520.1|  PREDICTED: striatin-3-like isoform X1            49.3    2e-04   
ref|WP_008181439.1|  WD-40 repeat-containing protein                  49.7    2e-04   
ref|XP_005100522.1|  PREDICTED: striatin-3-like isoform X3            49.3    2e-04   
ref|WP_012160733.1|  hypothetical protein                             49.3    2e-04   
ref|WP_015159425.1|  WD40 repeat-containing protein                   49.3    2e-04   
ref|WP_006973899.1|  WD-40 repeat                                     49.3    3e-04   
ref|WP_027845222.1|  serine/threonine protein kinase                  48.9    3e-04   
ref|XP_004476350.1|  PREDICTED: LOW QUALITY PROTEIN: WD repeat-co...  48.5    3e-04   
gb|EMD36771.1|  hypothetical protein CERSUDRAFT_123824                49.3    3e-04   
ref|XP_009353578.1|  PREDICTED: F-box/WD repeat-containing protei...  48.5    3e-04   
ref|XP_007387094.1|  WD40 repeat-like protein                         48.9    3e-04   
ref|WP_006194418.1|  hypothetical protein                             48.1    3e-04   
ref|WP_009786074.1|  serine/threonine kinase with WD-40 repeat        48.9    3e-04   
ref|WP_038308209.1|  hypothetical protein                             48.9    3e-04   
ref|WP_029636563.1|  hypothetical protein [                           48.5    3e-04   
gb|AHJ26389.1|  WD-40 repeat protein                                  48.1    3e-04   
ref|XP_001699653.1|  centriole proteome protein                       48.1    3e-04   
ref|XP_001430277.1|  hypothetical protein                             48.9    3e-04   
ref|WP_015146731.1|  WD40 repeat-containing protein                   48.9    4e-04   
gb|EUC56527.1|  vegetative incompatibility protein HET-E-1, putative  48.9    4e-04   
ref|XP_005551266.1|  PREDICTED: WD repeat-containing protein 86 i...  48.1    4e-04   
ref|XP_011010524.1|  PREDICTED: F-box/WD repeat-containing protei...  48.5    4e-04   
ref|XP_011010523.1|  PREDICTED: F-box/WD repeat-containing protei...  48.5    4e-04   
ref|WP_015203003.1|  WD-40 repeat-containing protein                  48.1    4e-04   
ref|WP_030453363.1|  hypothetical protein                             48.5    4e-04   
gb|EHH52646.1|  hypothetical protein EGM_13116                        47.8    4e-04   
ref|WP_017315111.1|  hypothetical protein                             48.5    4e-04   
gb|KDQ54129.1|  hypothetical protein JAAARDRAFT_108357                48.5    4e-04   
gb|KEP52018.1|  putative vegetative incompatibility protein HET-E-1   48.5    4e-04   
ref|XP_005039610.1|  PREDICTED: apoptotic protease-activating fac...  48.5    4e-04   
gb|ETO02034.1|  hypothetical protein RFI_35402                        47.0    4e-04   
ref|WP_035997724.1|  hypothetical protein                             48.5    4e-04   
ref|XP_004766037.1|  PREDICTED: WD repeat-containing protein 86 i...  47.8    4e-04   
dbj|BAG99321.1|  unnamed protein product                              47.8    4e-04   
ref|XP_007311522.1|  WD40 repeat-like protein                         48.5    4e-04   
gb|KDN40945.1|  hypothetical protein RSAG8_07813                      48.5    4e-04   
ref|XP_008380904.1|  PREDICTED: dynein assembly factor with WDR r...  48.1    4e-04   
ref|XP_005551267.1|  PREDICTED: WD repeat-containing protein 86 i...  48.1    4e-04   
ref|WP_015203852.1|  WD40 repeat-containing protein                   48.5    4e-04   
gb|ERZ94683.1|  hypothetical protein GLOINDRAFT_341644                48.5    4e-04   
ref|XP_001432218.1|  hypothetical protein                             48.1    4e-04   
ref|XP_001513198.2|  PREDICTED: WD repeat-containing protein 86       47.8    5e-04   
ref|WP_007356978.1|  MULTISPECIES: hypothetical protein               48.5    5e-04   
gb|EXX56670.1|  Met30p                                                48.1    5e-04   
ref|WP_034956517.1|  hypothetical protein                             48.1    5e-04   
gb|EST08016.1|  hypothetical protein PSEUBRA_SCAF19g03225             48.1    5e-04   
gb|KEP46633.1|  vegetative incompatibility protein HET-E-1            48.1    5e-04   
emb|CCO34305.1|  Vegetative incompatibility protein HET-E-1           48.1    5e-04   
gb|EUC56593.1|  vegetative incompatibility protein HET-E-1            48.1    5e-04   
gb|KFH64943.1|  hypothetical protein MVEG_09671                       47.8    5e-04   
gb|EPS59971.1|  hypothetical protein M569_14833                       48.1    6e-04   
emb|CDI54510.1|  related to STRIATIN                                  48.1    6e-04   
ref|WP_016878778.1|  serine/threonine protein kinase                  48.1    6e-04   
ref|WP_035967173.1|  hypothetical protein                             47.8    6e-04   
ref|WP_033335524.1|  WD40 repeat-containing protein                   47.4    6e-04   
gb|EUC57582.1|  vegetative incompatibility protein HET-E-1, putative  48.1    6e-04   
ref|XP_001455153.1|  hypothetical protein                             47.8    6e-04   
gb|AIV63444.1|  WD domain, G-beta repeat family protein               48.1    6e-04   
gb|ETO05180.1|  WD repeat-containing protein                          47.8    6e-04   
ref|XP_004998772.1|  hypothetical protein PTSG_00223                  47.8    6e-04   
emb|CCD77252.1|  putative f-box and wd40 domain protein               47.8    6e-04   
ref|WP_036046695.1|  hypothetical protein                             48.1    6e-04   
ref|WP_023074569.1|  wd40 repeat-containing protein                   48.1    6e-04   
ref|XP_006421456.1|  hypothetical protein CICLE_v10005464mg           47.4    7e-04   
gb|ETO13217.1|  G-protein beta WD-40 repeats containing protein       48.1    7e-04   
emb|CCM01095.1|  predicted protein                                    48.1    7e-04   
ref|WP_036487476.1|  hypothetical protein                             48.1    7e-04   
ref|XP_006493896.1|  PREDICTED: protein LST8 homolog isoform X1       47.4    7e-04   
emb|CBQ68398.1|  related to STRIATIN                                  47.8    7e-04   
ref|WP_039726101.1|  hypothetical protein                             47.8    7e-04   
ref|WP_006508829.1|  WD40 repeat-containing protein                   47.8    7e-04   
ref|WP_026098065.1|  hypothetical protein                             47.8    7e-04   
ref|WP_017739711.1|  hypothetical protein                             46.2    7e-04   
ref|WP_015152772.1|  WD40 repeat, subgroup                            47.8    7e-04   
emb|CBY12219.1|  unnamed protein product                              47.8    8e-04   
ref|WP_013324221.1|  hypothetical protein                             47.8    8e-04   
emb|CBY32112.1|  unnamed protein product                              47.8    8e-04   
ref|XP_006421455.1|  hypothetical protein CICLE_v10005464mg           47.0    8e-04   
gb|KCW50992.1|  hypothetical protein EUGRSUZ_J00620                   47.4    8e-04   
ref|WP_006507276.1|  WD40 repeat-containing protein                   45.4    8e-04   
ref|WP_017312877.1|  hypothetical protein                             47.8    8e-04   
gb|KDO27095.1|  hypothetical protein SPRG_07806                       47.4    8e-04   
ref|WP_016950914.1|  hypothetical protein                             47.4    8e-04   
ref|WP_036266889.1|  hypothetical protein                             44.7    8e-04   
ref|XP_006645585.1|  PREDICTED: zinc finger CCCH domain-containin...  46.6    8e-04   
gb|EDN72660.1|  WD-40 repeat protein                                  45.8    8e-04   
ref|XP_007037806.1|  Transducin/WD40 repeat-like superfamily protein  47.0    9e-04   
dbj|GAC92489.1|  hypothetical protein PHSY_000042                     47.4    9e-04   
ref|WP_008051109.1|  putative Peptidase C14, caspase catalytic su...  47.8    9e-04   
ref|XP_006873766.1|  PREDICTED: WD repeat-containing protein 86       47.0    9e-04   
ref|WP_007354545.1|  serine/threonine protein kinase [                47.4    0.001   
ref|XP_007300753.1|  WD40 repeat-like protein                         47.4    0.001   
ref|XP_001419932.1|  predicted protein                                47.4    0.001   
ref|WP_009786756.1|  Serine/Threonine protein kinase with WD40 re...  47.4    0.001   
ref|WP_008055231.1|  hypothetical protein                             47.0    0.001   
ref|WP_015144330.1|  WD40 repeat-containing protein                   47.4    0.001   
ref|WP_006624825.1|  MULTISPECIES: hypothetical protein               47.0    0.001   
gb|KDN33909.1|  hypothetical protein RSAG8_13001                      47.4    0.001   
ref|WP_029632543.1|  serine/threonine protein kinase [                47.4    0.001   
ref|WP_026103790.1|  serine/threonine protein kinase                  47.4    0.001   
gb|KEP51009.1|  putative vegetative incompatibility protein HET-E-1   47.4    0.001   
ref|XP_010031629.1|  PREDICTED: F-box/WD-40 repeat-containing pro...  47.0    0.001   



>ref|XP_010323418.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN-1 isoform 
X3 [Solanum lycopersicum]
Length=940

 Score =   185 bits (470),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 83/116 (72%), Positives = 99/116 (85%), Gaps = 0/116 (0%)
 Frame = -2

Query  350  KVLSGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAI  171
            KV S H+DGTIK W++K   LHL+QE R+H+KAVTSL +LQS EK YSGSLDRT+RVW+I
Sbjct  671  KVFSSHTDGTIKVWTVKAKSLHLIQEIRDHLKAVTSLVVLQSGEKLYSGSLDRTVRVWSI  730

Query  170  SNEGIRCEQVHEIKDHVNNLVVSESLSCFIPQGAGIKVHSWCGEFKLVNQAKHARC  3
             +EGI CE+VHE+KDHVNNL+VS SLSCFIPQGAGIKVHSW G  KL+NQ K+A+C
Sbjct  731  QDEGIECEEVHEMKDHVNNLLVSNSLSCFIPQGAGIKVHSWNGATKLLNQQKYAKC  786



>ref|XP_010323417.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN-1 isoform 
X2 [Solanum lycopersicum]
Length=1038

 Score =   185 bits (470),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 83/116 (72%), Positives = 99/116 (85%), Gaps = 0/116 (0%)
 Frame = -2

Query  350  KVLSGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAI  171
            KV S H+DGTIK W++K   LHL+QE R+H+KAVTSL +LQS EK YSGSLDRT+RVW+I
Sbjct  769  KVFSSHTDGTIKVWTVKAKSLHLIQEIRDHLKAVTSLVVLQSGEKLYSGSLDRTVRVWSI  828

Query  170  SNEGIRCEQVHEIKDHVNNLVVSESLSCFIPQGAGIKVHSWCGEFKLVNQAKHARC  3
             +EGI CE+VHE+KDHVNNL+VS SLSCFIPQGAGIKVHSW G  KL+NQ K+A+C
Sbjct  829  QDEGIECEEVHEMKDHVNNLLVSNSLSCFIPQGAGIKVHSWNGATKLLNQQKYAKC  884



>ref|XP_010323416.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN-1 isoform 
X1 [Solanum lycopersicum]
Length=1039

 Score =   185 bits (470),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 83/116 (72%), Positives = 99/116 (85%), Gaps = 0/116 (0%)
 Frame = -2

Query  350  KVLSGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAI  171
            KV S H+DGTIK W++K   LHL+QE R+H+KAVTSL +LQS EK YSGSLDRT+RVW+I
Sbjct  770  KVFSSHTDGTIKVWTVKAKSLHLIQEIRDHLKAVTSLVVLQSGEKLYSGSLDRTVRVWSI  829

Query  170  SNEGIRCEQVHEIKDHVNNLVVSESLSCFIPQGAGIKVHSWCGEFKLVNQAKHARC  3
             +EGI CE+VHE+KDHVNNL+VS SLSCFIPQGAGIKVHSW G  KL+NQ K+A+C
Sbjct  830  QDEGIECEEVHEMKDHVNNLLVSNSLSCFIPQGAGIKVHSWNGATKLLNQQKYAKC  885



>ref|XP_006341274.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN-like [Solanum 
tuberosum]
Length=1284

 Score =   184 bits (466),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 81/116 (70%), Positives = 98/116 (84%), Gaps = 0/116 (0%)
 Frame = -2

Query  350   KVLSGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAI  171
             KV S H+DGTIK W++K   LHL+QE R+H+KA TSL +LQS EK YSGSLDRT+RVW+I
Sbjct  1015  KVFSSHTDGTIKVWTVKAKSLHLIQEIRDHLKAATSLVVLQSGEKLYSGSLDRTVRVWSI  1074

Query  170   SNEGIRCEQVHEIKDHVNNLVVSESLSCFIPQGAGIKVHSWCGEFKLVNQAKHARC  3
              +EGI CE++HE+KDHVNNL+VS SLSCFIPQGAGIKVHSW G  KL+NQ K+A+C
Sbjct  1075  QDEGIECEEIHEMKDHVNNLMVSNSLSCFIPQGAGIKVHSWNGATKLLNQQKYAKC  1130



>emb|CDP03302.1| unnamed protein product [Coffea canephora]
Length=1369

 Score =   183 bits (465),  Expect = 1e-50, Method: Composition-based stats.
 Identities = 82/116 (71%), Positives = 98/116 (84%), Gaps = 0/116 (0%)
 Frame = -2

Query  350   KVLSGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAI  171
             K+ SGHSDGTIK W++K G +HLVQE++EH KAVTSLAILQS E+ YSGSLDRT+RVWAI
Sbjct  1100  KIFSGHSDGTIKVWAMKSGNMHLVQESQEHTKAVTSLAILQSVERLYSGSLDRTVRVWAI  1159

Query  170   SNEGIRCEQVHEIKDHVNNLVVSESLSCFIPQGAGIKVHSWCGEFKLVNQAKHARC  3
               + + CEQVHE+KDHVNNL+VS S+SCFIPQGAGIKVHSW G  K +N  K+A+C
Sbjct  1160  GGKVMHCEQVHEMKDHVNNLLVSNSISCFIPQGAGIKVHSWSGASKSLNPQKYAKC  1215



>ref|XP_009606221.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN isoform X1 
[Nicotiana tomentosiformis]
Length=1310

 Score =   181 bits (458),  Expect = 9e-50, Method: Composition-based stats.
 Identities = 79/115 (69%), Positives = 96/115 (83%), Gaps = 0/115 (0%)
 Frame = -2

Query  347   VLSGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAIS  168
             V S H+DG+IK W +K   LHL+QE REH+KAVTSL ++ SAEK YSGSLDRT+RVW I 
Sbjct  1042  VFSSHTDGSIKVWKVKAKSLHLIQEIREHLKAVTSLVVVHSAEKLYSGSLDRTVRVWLIQ  1101

Query  167   NEGIRCEQVHEIKDHVNNLVVSESLSCFIPQGAGIKVHSWCGEFKLVNQAKHARC  3
             +EGI CE+VHE+KDHVNNL+V+ SLSCF+PQG+GIKVHSW G  KLVNQ K+A+C
Sbjct  1102  DEGIECEEVHEMKDHVNNLLVANSLSCFLPQGSGIKVHSWNGATKLVNQQKYAKC  1156



>ref|XP_009788941.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN isoform X2 
[Nicotiana sylvestris]
Length=1310

 Score =   180 bits (457),  Expect = 1e-49, Method: Composition-based stats.
 Identities = 79/116 (68%), Positives = 97/116 (84%), Gaps = 0/116 (0%)
 Frame = -2

Query  350   KVLSGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAI  171
             KV S H+DG+IK W +K   LHL+Q+ REH+KAVTSL ++ SAEK YSGSLDRT+RVW I
Sbjct  1041  KVFSSHTDGSIKVWKVKAKSLHLIQDIREHLKAVTSLVVVHSAEKLYSGSLDRTVRVWLI  1100

Query  170   SNEGIRCEQVHEIKDHVNNLVVSESLSCFIPQGAGIKVHSWCGEFKLVNQAKHARC  3
              +EGI CE+VHE+KDHVNNL+V+ SLSCF+PQG+GIKVHSW G  KLVNQ K+A+C
Sbjct  1101  QDEGIECEEVHEMKDHVNNLLVANSLSCFLPQGSGIKVHSWNGATKLVNQQKYAKC  1156



>ref|XP_009788939.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN isoform X1 
[Nicotiana sylvestris]
Length=1311

 Score =   180 bits (457),  Expect = 1e-49, Method: Composition-based stats.
 Identities = 79/116 (68%), Positives = 97/116 (84%), Gaps = 0/116 (0%)
 Frame = -2

Query  350   KVLSGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAI  171
             KV S H+DG+IK W +K   LHL+Q+ REH+KAVTSL ++ SAEK YSGSLDRT+RVW I
Sbjct  1042  KVFSSHTDGSIKVWKVKAKSLHLIQDIREHLKAVTSLVVVHSAEKLYSGSLDRTVRVWLI  1101

Query  170   SNEGIRCEQVHEIKDHVNNLVVSESLSCFIPQGAGIKVHSWCGEFKLVNQAKHARC  3
              +EGI CE+VHE+KDHVNNL+V+ SLSCF+PQG+GIKVHSW G  KLVNQ K+A+C
Sbjct  1102  QDEGIECEEVHEMKDHVNNLLVANSLSCFLPQGSGIKVHSWNGATKLVNQQKYAKC  1157



>gb|KDP33701.1| hypothetical protein JCGZ_07272 [Jatropha curcas]
Length=330

 Score =   169 bits (428),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 75/116 (65%), Positives = 94/116 (81%), Gaps = 0/116 (0%)
 Frame = -2

Query  350  KVLSGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAI  171
            K+ SGHSDGTIK W+ +G +LHL+QE REH KAVTSL +LQS E+ YSGSLDRT R+W+I
Sbjct  61   KIFSGHSDGTIKVWTGRGSILHLIQELREHTKAVTSLVVLQSGERLYSGSLDRTARIWSI  120

Query  170  SNEGIRCEQVHEIKDHVNNLVVSESLSCFIPQGAGIKVHSWCGEFKLVNQAKHARC  3
             NE + C QVH++KD V+NLVV+ S+SCFIPQGAG+KVHSW G  KL+N  K+ +C
Sbjct  121  GNEALHCVQVHDMKDQVHNLVVANSISCFIPQGAGVKVHSWNGGSKLLNANKYVKC  176



>ref|XP_008352326.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN-1 [Malus 
domestica]
Length=1386

 Score =   176 bits (445),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 81/116 (70%), Positives = 94/116 (81%), Gaps = 0/116 (0%)
 Frame = -2

Query  350   KVLSGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAI  171
             K+ SGHSDGTIK W+ KG VLHL+QETREH KAVTSLAILQS E  YSGSLDRT RVW+I
Sbjct  1098  KIFSGHSDGTIKVWTGKGSVLHLIQETREHTKAVTSLAILQSGEVLYSGSLDRTTRVWSI  1157

Query  170   SNEGIRCEQVHEIKDHVNNLVVSESLSCFIPQGAGIKVHSWCGEFKLVNQAKHARC  3
             SNE + C QVH++KD V++L V+ SL+CFIPQ  GIKVHSW G  KL+N +KH RC
Sbjct  1158  SNEAMYCVQVHDMKDQVHSLAVTNSLACFIPQSTGIKVHSWNGGTKLLNSSKHVRC  1213



>ref|XP_009352688.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN-1 [Pyrus 
x bretschneideri]
Length=1367

 Score =   175 bits (443),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 79/116 (68%), Positives = 94/116 (81%), Gaps = 0/116 (0%)
 Frame = -2

Query  350   KVLSGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAI  171
             K+ SGHSDGTIK W+ KG VLHL+QETREH KAVTSLAILQS E  YSGSLDRT RVW+I
Sbjct  1098  KIFSGHSDGTIKVWTGKGSVLHLIQETREHTKAVTSLAILQSGEVLYSGSLDRTTRVWSI  1157

Query  170   SNEGIRCEQVHEIKDHVNNLVVSESLSCFIPQGAGIKVHSWCGEFKLVNQAKHARC  3
             SNE + C QVH++KD +++L V+ SL+CFIPQ  G+KVHSW G  KL+N +KH RC
Sbjct  1158  SNEAMYCVQVHDMKDQIHSLAVTNSLACFIPQSTGVKVHSWNGGTKLLNSSKHVRC  1213



>ref|XP_011078302.1| PREDICTED: LOW QUALITY PROTEIN: putative E3 ubiquitin-protein 
ligase LIN [Sesamum indicum]
Length=1325

 Score =   174 bits (440),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 77/116 (66%), Positives = 97/116 (84%), Gaps = 0/116 (0%)
 Frame = -2

Query  350   KVLSGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAI  171
             K+ SGHSDGTIK WS +G  LHL+QE  EH KAVTSLA+L S++K YSGSLDRT+RVW +
Sbjct  1056  KIFSGHSDGTIKVWSSEGSELHLIQEICEHTKAVTSLAVLHSSDKLYSGSLDRTVRVWVV  1115

Query  170   SNEGIRCEQVHEIKDHVNNLVVSESLSCFIPQGAGIKVHSWCGEFKLVNQAKHARC  3
             S EGI CEQV E+KDH+NNLVV+ +++C+IPQGAG+KV+SW G  KL+NQ K+A+C
Sbjct  1116  SVEGIYCEQVQEMKDHINNLVVANNIACYIPQGAGVKVYSWNGSSKLLNQQKYAKC  1171



>emb|CAN83797.1| hypothetical protein VITISV_002973 [Vitis vinifera]
Length=1618

 Score =   174 bits (440),  Expect = 3e-47, Method: Composition-based stats.
 Identities = 75/116 (65%), Positives = 94/116 (81%), Gaps = 0/116 (0%)
 Frame = -2

Query  350   KVLSGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAI  171
             K+ SGHSDGTIK W+ +G +LHL+ ETREH KAVTSLAIL+S E+ YSGSLDRT R+W+I
Sbjct  1349  KIFSGHSDGTIKVWTGRGSILHLIHETREHTKAVTSLAILESGERLYSGSLDRTARIWSI  1408

Query  170   SNEGIRCEQVHEIKDHVNNLVVSESLSCFIPQGAGIKVHSWCGEFKLVNQAKHARC  3
              +E I C Q H++KD VNNLVV+ S++CFIPQGAG+KVHSW G  KL+N  K+ +C
Sbjct  1409  GSEAIYCVQXHDMKDQVNNLVVANSIACFIPQGAGVKVHSWNGRSKLLNPNKNVKC  1464



>ref|XP_010656298.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN-1 isoform 
X2 [Vitis vinifera]
Length=1074

 Score =   172 bits (437),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 75/116 (65%), Positives = 96/116 (83%), Gaps = 0/116 (0%)
 Frame = -2

Query  350  KVLSGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAI  171
            K+ SGHSDGTIK W+ +G +LHL+ ETREH KAVTSLAIL+S E+ YSGSLDRT R+W+I
Sbjct  805  KIFSGHSDGTIKVWTGRGSILHLIHETREHTKAVTSLAILESGERLYSGSLDRTARIWSI  864

Query  170  SNEGIRCEQVHEIKDHVNNLVVSESLSCFIPQGAGIKVHSWCGEFKLVNQAKHARC  3
             +E I C Q+H++KD VNNLVV+ S++CFIPQGAG+KVHSW G+ KL+N  K+ +C
Sbjct  865  GSEAIYCVQIHDMKDQVNNLVVANSIACFIPQGAGVKVHSWNGKSKLLNPNKNVKC  920



>emb|CBI28040.3| unnamed protein product [Vitis vinifera]
Length=1154

 Score =   172 bits (437),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 75/116 (65%), Positives = 96/116 (83%), Gaps = 0/116 (0%)
 Frame = -2

Query  350  KVLSGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAI  171
            K+ SGHSDGTIK W+ +G +LHL+ ETREH KAVTSLAIL+S E+ YSGSLDRT R+W+I
Sbjct  885  KIFSGHSDGTIKVWTGRGSILHLIHETREHTKAVTSLAILESGERLYSGSLDRTARIWSI  944

Query  170  SNEGIRCEQVHEIKDHVNNLVVSESLSCFIPQGAGIKVHSWCGEFKLVNQAKHARC  3
             +E I C Q+H++KD VNNLVV+ S++CFIPQGAG+KVHSW G+ KL+N  K+ +C
Sbjct  945  GSEAIYCVQIHDMKDQVNNLVVANSIACFIPQGAGVKVHSWNGKSKLLNPNKNVKC  1000



>ref|XP_010656297.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN-1 isoform 
X1 [Vitis vinifera]
Length=1339

 Score =   173 bits (438),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 75/116 (65%), Positives = 96/116 (83%), Gaps = 0/116 (0%)
 Frame = -2

Query  350   KVLSGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAI  171
             K+ SGHSDGTIK W+ +G +LHL+ ETREH KAVTSLAIL+S E+ YSGSLDRT R+W+I
Sbjct  1070  KIFSGHSDGTIKVWTGRGSILHLIHETREHTKAVTSLAILESGERLYSGSLDRTARIWSI  1129

Query  170   SNEGIRCEQVHEIKDHVNNLVVSESLSCFIPQGAGIKVHSWCGEFKLVNQAKHARC  3
              +E I C Q+H++KD VNNLVV+ S++CFIPQGAG+KVHSW G+ KL+N  K+ +C
Sbjct  1130  GSEAIYCVQIHDMKDQVNNLVVANSIACFIPQGAGVKVHSWNGKSKLLNPNKNVKC  1185



>ref|XP_007204677.1| hypothetical protein PRUPE_ppa000309mg [Prunus persica]
 gb|EMJ05876.1| hypothetical protein PRUPE_ppa000309mg [Prunus persica]
Length=1300

 Score =   172 bits (435),  Expect = 1e-46, Method: Composition-based stats.
 Identities = 77/116 (66%), Positives = 92/116 (79%), Gaps = 0/116 (0%)
 Frame = -2

Query  350   KVLSGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAI  171
             K+ SGHSDGTIK W+ KG VLHL+QE REH KAVTSLAILQS E  YSGSLDRT RVW+I
Sbjct  1071  KIFSGHSDGTIKVWTGKGSVLHLIQEIREHTKAVTSLAILQSGETLYSGSLDRTTRVWSI  1130

Query  170   SNEGIRCEQVHEIKDHVNNLVVSESLSCFIPQGAGIKVHSWCGEFKLVNQAKHARC  3
             SNE I C  VH++KD V+++ V+ +L+CFIPQ  GIKVHSW G  KL+N +KH +C
Sbjct  1131  SNEAIYCVHVHDMKDQVHSIAVTNTLACFIPQSNGIKVHSWNGGSKLLNSSKHVKC  1186



>ref|XP_010100641.1| Putative E3 ubiquitin-protein ligase LIN-1 [Morus notabilis]
 gb|EXB83506.1| Putative E3 ubiquitin-protein ligase LIN-1 [Morus notabilis]
Length=1365

 Score =   171 bits (433),  Expect = 2e-46, Method: Composition-based stats.
 Identities = 74/116 (64%), Positives = 94/116 (81%), Gaps = 0/116 (0%)
 Frame = -2

Query  350   KVLSGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAI  171
             K+ SGH+DGTIK W+ KG +LHL+QE REH KAVTSLA+L + E+ YSGSLDR+ R+W+I
Sbjct  1096  KLFSGHADGTIKVWTGKGSILHLIQEIREHTKAVTSLAVLAAGERLYSGSLDRSARIWSI  1155

Query  170   SNEGIRCEQVHEIKDHVNNLVVSESLSCFIPQGAGIKVHSWCGEFKLVNQAKHARC  3
             S++ I C QVH++KD V NLVVS ++SCFIP GAG+KVHSW G FKL+N  KH +C
Sbjct  1156  SDDTIDCIQVHDMKDQVQNLVVSNNISCFIPHGAGLKVHSWNGVFKLLNPGKHVKC  1211



>ref|XP_010249650.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN [Nelumbo 
nucifera]
Length=1331

 Score =   171 bits (433),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 76/116 (66%), Positives = 95/116 (82%), Gaps = 0/116 (0%)
 Frame = -2

Query  350   KVLSGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAI  171
             K+ SGHSDGTIK WS +G +LHL+QETREH KAVTSL +LQSA++ YSGSLD+T RVWAI
Sbjct  1063  KIFSGHSDGTIKVWSGRGSLLHLIQETREHTKAVTSLTVLQSADRLYSGSLDKTARVWAI  1122

Query  170   SNEGIRCEQVHEIKDHVNNLVVSESLSCFIPQGAGIKVHSWCGEFKLVNQAKHARC  3
              +E I C QV+++KD V NL+V+ ++SCFIPQGAGIKVHSW G  KL+N  K+ +C
Sbjct  1123  EDEAIHCTQVYDMKDQVYNLIVANTVSCFIPQGAGIKVHSWNGGSKLLNPNKYVKC  1178



>ref|XP_007013113.1| Transducin/WD40 repeat-like superfamily protein [Theobroma cacao]
 gb|EOY30732.1| Transducin/WD40 repeat-like superfamily protein [Theobroma cacao]
Length=1332

 Score =   169 bits (429),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 76/116 (66%), Positives = 95/116 (82%), Gaps = 0/116 (0%)
 Frame = -2

Query  350   KVLSGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAI  171
             K+ SGHSDGTIK W+ +G +LHLVQE REH K VTSL ILQS E+ YSGSLD+T RVW+I
Sbjct  1063  KIFSGHSDGTIKVWTGRGSILHLVQEIREHSKPVTSLYILQSGERLYSGSLDKTARVWSI  1122

Query  170   SNEGIRCEQVHEIKDHVNNLVVSESLSCFIPQGAGIKVHSWCGEFKLVNQAKHARC  3
              +E I C QVH++KD V+NLVV+ S+SCFIPQGAG+KVH+W G+ KL+NQ K+ +C
Sbjct  1123  GDELIHCVQVHDMKDQVHNLVVANSISCFIPQGAGVKVHAWNGQSKLLNQNKYIKC  1178



>ref|XP_011048372.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN-1 [Populus 
euphratica]
Length=1334

 Score =   168 bits (426),  Expect = 2e-45, Method: Composition-based stats.
 Identities = 75/115 (65%), Positives = 90/115 (78%), Gaps = 0/115 (0%)
 Frame = -2

Query  347   VLSGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAIS  168
             + SGHSDGTIK W+ KG +LHL+QE REH KAVTSLA LQ  EK YSGSLDRT RVW+I 
Sbjct  1065  IFSGHSDGTIKVWTGKGSILHLIQEIREHTKAVTSLAFLQPGEKLYSGSLDRTARVWSIG  1124

Query  167   NEGIRCEQVHEIKDHVNNLVVSESLSCFIPQGAGIKVHSWCGEFKLVNQAKHARC  3
             NE + C QVH++KD V+NLVV+  + CFIPQGAG+KVHSW G  KL+N  K+ +C
Sbjct  1125  NESLTCVQVHDMKDQVHNLVVANGICCFIPQGAGVKVHSWNGGSKLLNPHKYVKC  1179



>ref|XP_004299991.1| PREDICTED: LOW QUALITY PROTEIN: putative E3 ubiquitin-protein 
ligase LIN-like [Fragaria vesca subsp. vesca]
Length=1266

 Score =   168 bits (425),  Expect = 3e-45, Method: Composition-based stats.
 Identities = 74/116 (64%), Positives = 91/116 (78%), Gaps = 0/116 (0%)
 Frame = -2

Query  350   KVLSGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAI  171
             K+ SGHSDGTIK W+ KG +LHL+QET+EH KAV+SLAILQS E  YSGSLD+T R W+I
Sbjct  996   KIFSGHSDGTIKVWTGKGSILHLIQETQEHTKAVSSLAILQSKEILYSGSLDKTTRAWSI  1055

Query  170   SNEGIRCEQVHEIKDHVNNLVVSESLSCFIPQGAGIKVHSWCGEFKLVNQAKHARC  3
             SNEGI+C +VH++KD V+NL V+ S SCFIPQ  GIK HSW G  K++N  K  +C
Sbjct  1056  SNEGIQCVEVHDMKDQVHNLAVTNSFSCFIPQSNGIKAHSWNGGSKMLNSGKSVKC  1111



>ref|XP_002514271.1| F-box and wd40 domain protein, putative [Ricinus communis]
 gb|EEF48225.1| F-box and wd40 domain protein, putative [Ricinus communis]
Length=1268

 Score =   167 bits (424),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 74/116 (64%), Positives = 93/116 (80%), Gaps = 0/116 (0%)
 Frame = -2

Query  350   KVLSGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAI  171
             K+ SGHSDGTIK W+ +G VLHL+QE +EH KAVTSL +LQS E+ YSGSLDRT RVW+I
Sbjct  987   KIFSGHSDGTIKIWTGRGSVLHLIQEIKEHTKAVTSLVVLQSGERLYSGSLDRTARVWSI  1046

Query  170   SNEGIRCEQVHEIKDHVNNLVVSESLSCFIPQGAGIKVHSWCGEFKLVNQAKHARC  3
              NE + C Q+H++KD V +LVV+ S+SCFIPQGAG+KVHSW G  KL+N  K+ +C
Sbjct  1047  GNEELHCVQIHDMKDQVQSLVVANSISCFIPQGAGVKVHSWNGGSKLLNSNKYVKC  1102



>ref|XP_008242573.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN [Prunus mume]
Length=1340

 Score =   164 bits (416),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 75/116 (65%), Positives = 92/116 (79%), Gaps = 0/116 (0%)
 Frame = -2

Query  350   KVLSGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAI  171
             K+ SGHSDGTIK W+ KG VLHL+QE +EH KAVTSLAILQS E  YSGSLDRT RVW+I
Sbjct  1071  KIFSGHSDGTIKVWTGKGSVLHLIQEIQEHTKAVTSLAILQSGETLYSGSLDRTTRVWSI  1130

Query  170   SNEGIRCEQVHEIKDHVNNLVVSESLSCFIPQGAGIKVHSWCGEFKLVNQAKHARC  3
             SNE I C  VH++KD V+++ V+ +L+CFIPQ  GIKVHSW G  KL+N +K+ +C
Sbjct  1131  SNEAIYCVHVHDMKDQVHSIAVTNTLACFIPQSNGIKVHSWNGGSKLLNSSKYVKC  1186



>ref|XP_008387007.1| PREDICTED: LOW QUALITY PROTEIN: putative E3 ubiquitin-protein 
ligase LIN-1 [Malus domestica]
Length=962

 Score =   162 bits (411),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 74/116 (64%), Positives = 91/116 (78%), Gaps = 0/116 (0%)
 Frame = -2

Query  350  KVLSGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAI  171
            K+ SGHSDGTIK W+ KG VLHL+QE REH+KAVTSLA+LQS E  YSGSLDRT RVW+I
Sbjct  693  KIFSGHSDGTIKVWTGKGSVLHLIQEIREHMKAVTSLAVLQSGEVLYSGSLDRTTRVWSI  752

Query  170  SNEGIRCEQVHEIKDHVNNLVVSESLSCFIPQGAGIKVHSWCGEFKLVNQAKHARC  3
            SNE + C +VH++KD V++L V+ S + FIPQ  GIKVHSW G  KL+N + H +C
Sbjct  753  SNEAMHCVKVHDMKDQVHSLAVTNSFAYFIPQSTGIKVHSWNGRTKLLNSSNHVKC  808



>gb|KDO66445.1| hypothetical protein CISIN_1g001349mg [Citrus sinensis]
Length=949

 Score =   162 bits (409),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 74/116 (64%), Positives = 90/116 (78%), Gaps = 0/116 (0%)
 Frame = -2

Query  350  KVLSGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAI  171
            K+ SGHSDGTIK W+ +G +LHL+Q+ REH KAVT LAILQS E  YSGSLD+T RVW+I
Sbjct  680  KIFSGHSDGTIKVWTGRGSILHLIQQIREHTKAVTGLAILQSGEMLYSGSLDKTARVWSI  739

Query  170  SNEGIRCEQVHEIKDHVNNLVVSESLSCFIPQGAGIKVHSWCGEFKLVNQAKHARC  3
             NE I C QVH+IKD + NL VS S+ CFIPQGAGIKVH   G+ KL+N +K+ +C
Sbjct  740  GNEEIHCVQVHDIKDQIQNLAVSNSILCFIPQGAGIKVHLRNGKTKLLNSSKYPKC  795



>gb|KDO66444.1| hypothetical protein CISIN_1g001349mg [Citrus sinensis]
Length=1094

 Score =   162 bits (410),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 74/116 (64%), Positives = 90/116 (78%), Gaps = 0/116 (0%)
 Frame = -2

Query  350  KVLSGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAI  171
            K+ SGHSDGTIK W+ +G +LHL+Q+ REH KAVT LAILQS E  YSGSLD+T RVW+I
Sbjct  825  KIFSGHSDGTIKVWTGRGSILHLIQQIREHTKAVTGLAILQSGEMLYSGSLDKTARVWSI  884

Query  170  SNEGIRCEQVHEIKDHVNNLVVSESLSCFIPQGAGIKVHSWCGEFKLVNQAKHARC  3
             NE I C QVH+IKD + NL VS S+ CFIPQGAGIKVH   G+ KL+N +K+ +C
Sbjct  885  GNEEIHCVQVHDIKDQIQNLAVSNSILCFIPQGAGIKVHLRNGKTKLLNSSKYPKC  940



>ref|XP_006451205.1| hypothetical protein CICLE_v10007255mg [Citrus clementina]
 gb|ESR64445.1| hypothetical protein CICLE_v10007255mg [Citrus clementina]
Length=1380

 Score =   162 bits (410),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 74/116 (64%), Positives = 90/116 (78%), Gaps = 0/116 (0%)
 Frame = -2

Query  350   KVLSGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAI  171
             K+ SGHSDGTIK W+ +G +LHL+Q+ REH KAVT LAILQS E  YSGSLD+T RVW+I
Sbjct  1111  KIFSGHSDGTIKVWTGRGSILHLIQQIREHTKAVTGLAILQSGEMLYSGSLDKTARVWSI  1170

Query  170   SNEGIRCEQVHEIKDHVNNLVVSESLSCFIPQGAGIKVHSWCGEFKLVNQAKHARC  3
              NE I C QVH+IKD + NL VS S+ CFIPQGAGIKVH   G+ KL+N +K+ +C
Sbjct  1171  GNEEIHCVQVHDIKDQIQNLAVSNSILCFIPQGAGIKVHLRNGKTKLLNSSKYPKC  1226



>gb|EYU32945.1| hypothetical protein MIMGU_mgv1a000874mg [Erythranthe guttata]
Length=953

 Score =   160 bits (405),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 72/116 (62%), Positives = 92/116 (79%), Gaps = 0/116 (0%)
 Frame = -2

Query  350  KVLSGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAI  171
            K+ SGHSDGTIK W  +   L+L+QE  EH K VTSLA++ S+EK YSGSLD+T+RVWAI
Sbjct  684  KIFSGHSDGTIKVWKSENSELNLIQEIHEHTKHVTSLAVVHSSEKLYSGSLDKTVRVWAI  743

Query  170  SNEGIRCEQVHEIKDHVNNLVVSESLSCFIPQGAGIKVHSWCGEFKLVNQAKHARC  3
            + EGI CEQV E KD +N LVV+ S++C+IPQGAG+KVHSW G  K++NQ K+A+C
Sbjct  744  TEEGIYCEQVQETKDQINTLVVANSIACYIPQGAGVKVHSWNGSSKVLNQHKYAKC  799



>ref|XP_006833370.1| hypothetical protein AMTR_s00109p00103350 [Amborella trichopoda]
 gb|ERM98648.1| hypothetical protein AMTR_s00109p00103350 [Amborella trichopoda]
Length=1452

 Score =   158 bits (399),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 65/116 (56%), Positives = 91/116 (78%), Gaps = 0/116 (0%)
 Frame = -2

Query  350   KVLSGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAI  171
             ++ +GHSDGT+K WS +G +LHL+QE REH KA+TSLAIL +++  YSGSLD++++VWAI
Sbjct  1187  RIFTGHSDGTLKVWSGRGKLLHLIQELREHSKAITSLAILHASDNMYSGSLDKSVKVWAI  1246

Query  170   SNEGIRCEQVHEIKDHVNNLVVSESLSCFIPQGAGIKVHSWCGEFKLVNQAKHARC  3
               + I C QVH++KD + NL V+ +++CF+PQGAG+KVHSW G  KL+N  K  RC
Sbjct  1247  GTQDIHCIQVHDMKDQIYNLTVANTIACFVPQGAGVKVHSWSGTSKLINSTKQVRC  1302



>ref|XP_008462773.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN-1 [Cucumis 
melo]
Length=1413

 Score =   155 bits (393),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 66/116 (57%), Positives = 96/116 (83%), Gaps = 0/116 (0%)
 Frame = -2

Query  350   KVLSGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAI  171
             K++SGHSDG IK WS++G  LHL+ E +EH K VTSLA+L+  EK YSGSLD+T++VW++
Sbjct  1145  KIISGHSDGRIKVWSVRGTNLHLIHEVQEHSKGVTSLAVLEFEEKLYSGSLDKTIKVWSL  1204

Query  170   SNEGIRCEQVHEIKDHVNNLVVSESLSCFIPQGAGIKVHSWCGEFKLVNQAKHARC  3
              ++ I+C Q+H++KD ++NLVVS++++CFIP GAGI+V+SW GE KL+N +KH +C
Sbjct  1205  GSDTIQCIQLHDVKDQIHNLVVSKTVACFIPHGAGIRVYSWGGESKLLNSSKHVKC  1260



>gb|KCW79939.1| hypothetical protein EUGRSUZ_C01271 [Eucalyptus grandis]
Length=1043

 Score =   154 bits (390),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 67/115 (58%), Positives = 91/115 (79%), Gaps = 0/115 (0%)
 Frame = -2

Query  347   VLSGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAIS  168
             + SGHSDGTIK W+ +G +LH +QE REH KAVTSLAI QS E+ YSGSLD+T +VW+I 
Sbjct  904   IFSGHSDGTIKVWTGRGSILHQIQEVREHTKAVTSLAISQSGERLYSGSLDKTAKVWSIG  963

Query  167   NEGIRCEQVHEIKDHVNNLVVSESLSCFIPQGAGIKVHSWCGEFKLVNQAKHARC  3
             +  + C +VH+++D V+NLVV+ S++ FIPQGAG+KVHSW G  +L+NQ K+ +C
Sbjct  964   DNALHCTEVHDMRDQVHNLVVANSVAYFIPQGAGVKVHSWNGGSRLLNQNKYVKC  1018



>gb|KCW79938.1| hypothetical protein EUGRSUZ_C01271 [Eucalyptus grandis]
Length=1172

 Score =   154 bits (390),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 67/115 (58%), Positives = 91/115 (79%), Gaps = 0/115 (0%)
 Frame = -2

Query  347   VLSGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAIS  168
             + SGHSDGTIK W+ +G +LH +QE REH KAVTSLAI QS E+ YSGSLD+T +VW+I 
Sbjct  904   IFSGHSDGTIKVWTGRGSILHQIQEVREHTKAVTSLAISQSGERLYSGSLDKTAKVWSIG  963

Query  167   NEGIRCEQVHEIKDHVNNLVVSESLSCFIPQGAGIKVHSWCGEFKLVNQAKHARC  3
             +  + C +VH+++D V+NLVV+ S++ FIPQGAG+KVHSW G  +L+NQ K+ +C
Sbjct  964   DNALHCTEVHDMRDQVHNLVVANSVAYFIPQGAGVKVHSWNGGSRLLNQNKYVKC  1018



>ref|XP_010050571.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN-1 [Eucalyptus 
grandis]
Length=1321

 Score =   154 bits (390),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 67/115 (58%), Positives = 91/115 (79%), Gaps = 0/115 (0%)
 Frame = -2

Query  347   VLSGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAIS  168
             + SGHSDGTIK W+ +G +LH +QE REH KAVTSLAI QS E+ YSGSLD+T +VW+I 
Sbjct  1053  IFSGHSDGTIKVWTGRGSILHQIQEVREHTKAVTSLAISQSGERLYSGSLDKTAKVWSIG  1112

Query  167   NEGIRCEQVHEIKDHVNNLVVSESLSCFIPQGAGIKVHSWCGEFKLVNQAKHARC  3
             +  + C +VH+++D V+NLVV+ S++ FIPQGAG+KVHSW G  +L+NQ K+ +C
Sbjct  1113  DNALHCTEVHDMRDQVHNLVVANSVAYFIPQGAGVKVHSWNGGSRLLNQNKYVKC  1167



>ref|XP_004155724.1| PREDICTED: LOW QUALITY PROTEIN: putative E3 ubiquitin-protein 
ligase LIN-2-like [Cucumis sativus]
Length=1230

 Score =   153 bits (386),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 64/116 (55%), Positives = 95/116 (82%), Gaps = 0/116 (0%)
 Frame = -2

Query  350   KVLSGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAI  171
             K++SGHSDG IK W+++G  LHL+ E +EH K VTSL +L+  EK YSGSLD+T++VW++
Sbjct  962   KIISGHSDGRIKVWAVRGTNLHLIHEVQEHSKGVTSLVVLEFEEKLYSGSLDKTIKVWSL  1021

Query  170   SNEGIRCEQVHEIKDHVNNLVVSESLSCFIPQGAGIKVHSWCGEFKLVNQAKHARC  3
              ++ I+C Q+H++KD ++NLVVS++++CFIP GAGI+V+SW GE KL+N +KH +C
Sbjct  1022  GSDTIQCIQLHDVKDQIHNLVVSKTVACFIPHGAGIRVYSWGGESKLLNSSKHVKC  1077



>ref|XP_004142566.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN-like [Cucumis 
sativus]
Length=1336

 Score =   153 bits (386),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 64/116 (55%), Positives = 95/116 (82%), Gaps = 0/116 (0%)
 Frame = -2

Query  350   KVLSGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAI  171
             K++SGHSDG IK W+++G  LHL+ E +EH K VTSL +L+  EK YSGSLD+T++VW++
Sbjct  1068  KIISGHSDGRIKVWAVRGTNLHLIHEVQEHSKGVTSLVVLEFEEKLYSGSLDKTIKVWSL  1127

Query  170   SNEGIRCEQVHEIKDHVNNLVVSESLSCFIPQGAGIKVHSWCGEFKLVNQAKHARC  3
              ++ I+C Q+H++KD ++NLVVS++++CFIP GAGI+V+SW GE KL+N +KH +C
Sbjct  1128  GSDTIQCIQLHDVKDQIHNLVVSKTVACFIPHGAGIRVYSWGGESKLLNSSKHVKC  1183



>gb|KGN66817.1| hypothetical protein Csa_1G696500 [Cucumis sativus]
Length=1329

 Score =   152 bits (385),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 64/116 (55%), Positives = 95/116 (82%), Gaps = 0/116 (0%)
 Frame = -2

Query  350   KVLSGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAI  171
             K++SGHSDG IK W+++G  LHL+ E +EH K VTSL +L+  EK YSGSLD+T++VW++
Sbjct  1061  KIISGHSDGRIKVWAVRGTNLHLIHEVQEHSKGVTSLVVLEFEEKLYSGSLDKTIKVWSL  1120

Query  170   SNEGIRCEQVHEIKDHVNNLVVSESLSCFIPQGAGIKVHSWCGEFKLVNQAKHARC  3
              ++ I+C Q+H++KD ++NLVVS++++CFIP GAGI+V+SW GE KL+N +KH +C
Sbjct  1121  GSDTIQCIQLHDVKDQIHNLVVSKTVACFIPHGAGIRVYSWGGESKLLNSSKHVKC  1176



>ref|XP_009606222.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN isoform X2 
[Nicotiana tomentosiformis]
Length=1273

 Score =   152 bits (385),  Expect = 7e-40, Method: Composition-based stats.
 Identities = 66/96 (69%), Positives = 81/96 (84%), Gaps = 0/96 (0%)
 Frame = -2

Query  347   VLSGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAIS  168
             V S H+DG+IK W +K   LHL+QE REH+KAVTSL ++ SAEK YSGSLDRT+RVW I 
Sbjct  1042  VFSSHTDGSIKVWKVKAKSLHLIQEIREHLKAVTSLVVVHSAEKLYSGSLDRTVRVWLIQ  1101

Query  167   NEGIRCEQVHEIKDHVNNLVVSESLSCFIPQGAGIK  60
             +EGI CE+VHE+KDHVNNL+V+ SLSCF+PQG+GIK
Sbjct  1102  DEGIECEEVHEMKDHVNNLLVANSLSCFLPQGSGIK  1137



>ref|XP_009788942.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN isoform X3 
[Nicotiana sylvestris]
Length=1274

 Score =   152 bits (385),  Expect = 7e-40, Method: Composition-based stats.
 Identities = 66/97 (68%), Positives = 82/97 (85%), Gaps = 0/97 (0%)
 Frame = -2

Query  350   KVLSGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAI  171
             KV S H+DG+IK W +K   LHL+Q+ REH+KAVTSL ++ SAEK YSGSLDRT+RVW I
Sbjct  1042  KVFSSHTDGSIKVWKVKAKSLHLIQDIREHLKAVTSLVVVHSAEKLYSGSLDRTVRVWLI  1101

Query  170   SNEGIRCEQVHEIKDHVNNLVVSESLSCFIPQGAGIK  60
              +EGI CE+VHE+KDHVNNL+V+ SLSCF+PQG+GIK
Sbjct  1102  QDEGIECEEVHEMKDHVNNLLVANSLSCFLPQGSGIK  1138



>ref|XP_010915863.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN-1 [Elaeis 
guineensis]
 ref|XP_010915864.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN-1 [Elaeis 
guineensis]
Length=1340

 Score =   152 bits (383),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 67/116 (58%), Positives = 88/116 (76%), Gaps = 0/116 (0%)
 Frame = -2

Query  350   KVLSGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAI  171
             K+ SGHSDGTIK W     +LH V ETREH KAVTSLA+  S EK YSGSLD+T+RVW++
Sbjct  1071  KIFSGHSDGTIKVWEGNENLLHPVHETREHSKAVTSLAVSNSGEKLYSGSLDKTVRVWSV  1130

Query  170   SNEGIRCEQVHEIKDHVNNLVVSESLSCFIPQGAGIKVHSWCGEFKLVNQAKHARC  3
              +  I C ++H++KD V+NL V+ +++CFIP GAG+KV SW G +KL+N +KH RC
Sbjct  1131  QDRQIHCVEIHDMKDPVHNLTVANTIACFIPHGAGVKVLSWNGGYKLLNPSKHVRC  1186



>ref|XP_006580471.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN-1-like [Glycine 
max]
Length=1384

 Score =   151 bits (382),  Expect = 2e-39, Method: Composition-based stats.
 Identities = 66/116 (57%), Positives = 89/116 (77%), Gaps = 0/116 (0%)
 Frame = -2

Query  350   KVLSGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAI  171
             K  SGH+DGTIK W+LK  + +L+QE +EH KAVT+L IL+S ++ YSGSLDRT +VW+I
Sbjct  1115  KFFSGHTDGTIKVWTLKDNLFYLLQEIQEHTKAVTNLVILESDDRLYSGSLDRTAKVWSI  1174

Query  170   SNEGIRCEQVHEIKDHVNNLVVSESLSCFIPQGAGIKVHSWCGEFKLVNQAKHARC  3
                 I C QVH++KD ++NLVV+ SL+CFIPQG G+KV S  GE KL+N +K+ +C
Sbjct  1175  GKAAIHCVQVHDMKDQIHNLVVTNSLACFIPQGTGVKVQSLNGESKLLNSSKYVKC  1230



>ref|XP_002325006.2| hypothetical protein POPTR_0018s09040g [Populus trichocarpa]
 gb|EEF03571.2| hypothetical protein POPTR_0018s09040g [Populus trichocarpa]
Length=991

 Score =   150 bits (380),  Expect = 2e-39, Method: Composition-based stats.
 Identities = 66/98 (67%), Positives = 80/98 (82%), Gaps = 0/98 (0%)
 Frame = -2

Query  350  KVLSGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAI  171
            K+ SGHSDGTIK W+ KG +LHL+QE REH KAVTSLA+LQ  EK YSGSLDRT RVW+I
Sbjct  807  KIFSGHSDGTIKVWTGKGSILHLIQEIREHTKAVTSLAVLQPGEKLYSGSLDRTARVWSI  866

Query  170  SNEGIRCEQVHEIKDHVNNLVVSESLSCFIPQGAGIKV  57
             NE + C QVH++KD V+NLVV+  + CFIPQGAG+K+
Sbjct  867  GNESLTCVQVHDMKDQVHNLVVANGICCFIPQGAGVKI  904



>ref|XP_006584821.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN-like [Glycine 
max]
Length=1333

 Score =   148 bits (374),  Expect = 2e-38, Method: Composition-based stats.
 Identities = 66/116 (57%), Positives = 87/116 (75%), Gaps = 0/116 (0%)
 Frame = -2

Query  350   KVLSGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAI  171
             K  SGH+DGT+K W+LK  +  L+QE +EH KAVT+L I +S ++ YSGSLDRT RVW+I
Sbjct  1064  KFFSGHTDGTMKVWTLKDNLFCLMQEIQEHTKAVTNLVISESDDRLYSGSLDRTARVWSI  1123

Query  170   SNEGIRCEQVHEIKDHVNNLVVSESLSCFIPQGAGIKVHSWCGEFKLVNQAKHARC  3
                 I C QVH++KD ++NLVV+ SLSCFIPQG G+KV S  GE KL+N +K+ +C
Sbjct  1124  GKAAIHCVQVHDMKDQIHNLVVTNSLSCFIPQGTGVKVQSLNGESKLLNSSKYVKC  1179



>ref|XP_007160321.1| hypothetical protein PHAVU_002G311800g [Phaseolus vulgaris]
 gb|ESW32315.1| hypothetical protein PHAVU_002G311800g [Phaseolus vulgaris]
Length=1334

 Score =   148 bits (373),  Expect = 3e-38, Method: Composition-based stats.
 Identities = 64/116 (55%), Positives = 89/116 (77%), Gaps = 0/116 (0%)
 Frame = -2

Query  350   KVLSGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAI  171
             K +SGH+DGTIK W+LK  + HL+QE +EH KAVT+L I +S ++ YSGSLDRT +VW+I
Sbjct  1065  KKISGHTDGTIKVWTLKNNLFHLLQEIQEHTKAVTNLVISESGDRLYSGSLDRTSKVWSI  1124

Query  170   SNEGIRCEQVHEIKDHVNNLVVSESLSCFIPQGAGIKVHSWCGEFKLVNQAKHARC  3
                 I C QV+++KD ++NLVV++SLSCF+ QG G+KV S  GE KL+N +K+ +C
Sbjct  1125  GKAAIHCVQVYDMKDQIHNLVVTDSLSCFVSQGTGVKVQSLNGESKLLNSSKYVKC  1180



>ref|XP_003630767.1| U-box domain-containing protein [Medicago truncatula]
Length=1068

 Score =   146 bits (369),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 64/116 (55%), Positives = 88/116 (76%), Gaps = 0/116 (0%)
 Frame = -2

Query  350  KVLSGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAI  171
            K++SGH+DG+IK W+LK   L L+QE +EH KAVT+L I +  ++ YSGSLDRT ++W+I
Sbjct  829  KIISGHTDGSIKVWTLKDNELLLLQEIQEHTKAVTNLTISEPGDRLYSGSLDRTAKIWSI  888

Query  170  SNEGIRCEQVHEIKDHVNNLVVSESLSCFIPQGAGIKVHSWCGEFKLVNQAKHARC  3
                I CEQVH++KD ++NLVV+ S +CFIPQGAG+KV S  GE KL+N  K+ +C
Sbjct  889  GKAAIHCEQVHDMKDQIHNLVVTNSTTCFIPQGAGVKVQSMNGESKLLNSNKYVKC  944



>gb|KEH21350.1| E3 ubiquitin-protein ligase LIN-like protein, putative [Medicago 
truncatula]
Length=1335

 Score =   147 bits (370),  Expect = 8e-38, Method: Composition-based stats.
 Identities = 64/116 (55%), Positives = 88/116 (76%), Gaps = 0/116 (0%)
 Frame = -2

Query  350   KVLSGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAI  171
             K++SGH+DG+IK W+LK   L L+QE +EH KAVT+L I +  ++ YSGSLDRT ++W+I
Sbjct  1067  KIISGHTDGSIKVWTLKDNELLLLQEIQEHTKAVTNLTISEPGDRLYSGSLDRTAKIWSI  1126

Query  170   SNEGIRCEQVHEIKDHVNNLVVSESLSCFIPQGAGIKVHSWCGEFKLVNQAKHARC  3
                 I CEQVH++KD ++NLVV+ S +CFIPQGAG+KV S  GE KL+N  K+ +C
Sbjct  1127  GKAAIHCEQVHDMKDQIHNLVVTNSTTCFIPQGAGVKVQSMNGESKLLNSNKYVKC  1182



>ref|XP_008783309.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN [Phoenix 
dactylifera]
Length=1341

 Score =   141 bits (356),  Expect = 6e-36, Method: Composition-based stats.
 Identities = 63/116 (54%), Positives = 84/116 (72%), Gaps = 0/116 (0%)
 Frame = -2

Query  350   KVLSGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAI  171
             ++ SGHSDG IK W     +LH V  TREH KAVTSLA+  S EK YSGSLD+T+RVW +
Sbjct  1072  RIFSGHSDGMIKVWEGNENLLHPVHATREHSKAVTSLALSNSGEKLYSGSLDKTVRVWYV  1131

Query  170   SNEGIRCEQVHEIKDHVNNLVVSESLSCFIPQGAGIKVHSWCGEFKLVNQAKHARC  3
              +  I C ++H++KD V+NL V+ +++CFIP GAG+KV SW G  KL+N +K+ RC
Sbjct  1132  RDRQIHCVEIHDMKDPVHNLTVANTIACFIPHGAGVKVLSWNGGCKLLNPSKYVRC  1187



>ref|XP_009380565.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN [Musa acuminata 
subsp. malaccensis]
Length=1335

 Score =   138 bits (347),  Expect = 1e-34, Method: Composition-based stats.
 Identities = 63/115 (55%), Positives = 84/115 (73%), Gaps = 0/115 (0%)
 Frame = -2

Query  350   KVLSGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAI  171
             +++SGH DGTIK W     +LHLV ET EH+KAVTSLAI QS EK YSGSLD+T+RVWA+
Sbjct  1066  RIISGHLDGTIKVWKGDESILHLVHETNEHLKAVTSLAISQSGEKLYSGSLDKTVRVWAV  1125

Query  170   SNEGIRCEQVHEIKDHVNNLVVSESLSCFIPQGAGIKVHSWCGEFKLVNQAKHAR  6
              +  I C +  ++KD V NL V++++ CF PQGAG+KV SW G  K+++  K+ R
Sbjct  1126  HDGWIHCTETFDVKDPVRNLSVADTIVCFTPQGAGVKVLSWKGASKILSPNKNVR  1180



>ref|XP_004971473.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN-like [Setaria 
italica]
Length=1374

 Score =   137 bits (346),  Expect = 1e-34, Method: Composition-based stats.
 Identities = 58/114 (51%), Positives = 82/114 (72%), Gaps = 0/114 (0%)
 Frame = -2

Query  347   VLSGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAIS  168
             + SGHSDGT+K W     +L LV E +EH KA+TSL++L S EK YSGSLDRT+RVW + 
Sbjct  1104  IFSGHSDGTLKVWEGSENILRLVHEAQEHTKAITSLSVLHSEEKLYSGSLDRTIRVWQLR  1163

Query  167   NEGIRCEQVHEIKDHVNNLVVSESLSCFIPQGAGIKVHSWCGEFKLVNQAKHAR  6
             +  ++C + H+ KD V NL V+ +++CF+PQGAG+K+ +W G  KL+N  K+ R
Sbjct  1164  DGVLQCVETHDTKDPVQNLAVASAMACFVPQGAGVKLLNWNGNSKLLNANKYVR  1217



>ref|XP_002454892.1| hypothetical protein SORBIDRAFT_03g000870 [Sorghum bicolor]
 gb|EES00012.1| hypothetical protein SORBIDRAFT_03g000870 [Sorghum bicolor]
Length=1404

 Score =   133 bits (335),  Expect = 4e-33, Method: Composition-based stats.
 Identities = 59/115 (51%), Positives = 83/115 (72%), Gaps = 1/115 (1%)
 Frame = -2

Query  347   VLSGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAIS  168
             + SGHSDGT+K W     +L LV E +EH KA+TSL++LQS EK +SGSLDR++RVW   
Sbjct  1130  IFSGHSDGTLKVWEGSENILRLVHEAQEHTKAITSLSVLQSEEKLFSGSLDRSIRVWQFR  1189

Query  167   NEGIRCEQVHEIKDHVNNLVVSESLSCFIPQGAGIKVHSW-CGEFKLVNQAKHAR  6
             +  +RC +VH+ +D V +L V+ +++CF+PQGAG+KV SW  G  KL+N  K+ R
Sbjct  1190  DGVLRCVEVHDTRDPVQSLAVASAVACFVPQGAGVKVLSWNSGNSKLLNPNKYVR  1244



>ref|XP_002307730.2| hypothetical protein POPTR_0005s26160g [Populus trichocarpa]
 gb|EEE94726.2| hypothetical protein POPTR_0005s26160g [Populus trichocarpa]
Length=1368

 Score =   132 bits (332),  Expect = 9e-33, Method: Composition-based stats.
 Identities = 62/116 (53%), Positives = 79/116 (68%), Gaps = 0/116 (0%)
 Frame = -2

Query  350   KVLSGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAI  171
             +V+S HSDGTIK W     VL L+QE REH KAVT L I  S +K YSGSLD+T+RVWAI
Sbjct  1098  RVISSHSDGTIKVWDAGKSVLRLIQEVREHTKAVTCLYISSSGDKLYSGSLDKTVRVWAI  1157

Query  170   SNEGIRCEQVHEIKDHVNNLVVSESLSCFIPQGAGIKVHSWCGEFKLVNQAKHARC  3
               E I C QVH++K+ V  L  +  ++CF+ QGAG+KV+SW G  K +N  K  +C
Sbjct  1158  KPEEIHCIQVHDVKEAVYELTANGKVACFVSQGAGVKVYSWSGVPKHINFNKTVKC  1213



>dbj|BAJ95654.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=1375

 Score =   131 bits (329),  Expect = 2e-32, Method: Composition-based stats.
 Identities = 60/115 (52%), Positives = 84/115 (73%), Gaps = 2/115 (2%)
 Frame = -2

Query  347   VLSGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAIS  168
             + SGHSDGT+K W     +L LVQE++EH KA+TSL+IL S EK YSGS+DRT+RVW   
Sbjct  1106  IFSGHSDGTLKVWEGSENILRLVQESQEHTKAITSLSILPSEEKLYSGSMDRTIRVWQF-  1164

Query  167   NEGIRCEQVHEIKDHVNNLVVSESLSCFIPQGAGIKVHSWCGEF-KLVNQAKHAR  6
              +G+RC +V++ +D V NL V+ +++CF+PQGAG+K  SW G   K++N +K  R
Sbjct  1165  RDGLRCAEVYDTRDPVQNLAVASAMACFVPQGAGVKTLSWNGGTPKVLNPSKSVR  1219



>ref|XP_010230655.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN [Brachypodium 
distachyon]
Length=1419

 Score =   131 bits (330),  Expect = 2e-32, Method: Composition-based stats.
 Identities = 57/114 (50%), Positives = 81/114 (71%), Gaps = 1/114 (1%)
 Frame = -2

Query  347   VLSGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAIS  168
             + SGHSDGT+K W     +L LV E++EH KA++SL++L S EK YSGSLDRT+RVW   
Sbjct  1151  IFSGHSDGTLKVWEGSENILRLVHESQEHTKAISSLSLLHSEEKLYSGSLDRTIRVWQF-  1209

Query  167   NEGIRCEQVHEIKDHVNNLVVSESLSCFIPQGAGIKVHSWCGEFKLVNQAKHAR  6
              +G+RC +VH+ +D V  L V+ +++CF+PQG G+K  SW G  K++N +K  R
Sbjct  1210  RDGLRCVEVHDTRDPVQGLAVAGAMACFVPQGGGVKALSWSGGSKVLNPSKSVR  1263



>ref|XP_007225466.1| hypothetical protein PRUPE_ppa000216mg [Prunus persica]
 gb|EMJ26665.1| hypothetical protein PRUPE_ppa000216mg [Prunus persica]
Length=1450

 Score =   131 bits (329),  Expect = 3e-32, Method: Composition-based stats.
 Identities = 62/115 (54%), Positives = 78/115 (68%), Gaps = 0/115 (0%)
 Frame = -2

Query  350   KVLSGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAI  171
             +VLS HSDGTIK W     VL L+QE REH KAVT L I  S +K YSGSLD+T+RVWAI
Sbjct  1180  RVLSSHSDGTIKVWDAGKKVLRLIQEVREHTKAVTCLYISSSGDKLYSGSLDKTIRVWAI  1239

Query  170   SNEGIRCEQVHEIKDHVNNLVVSESLSCFIPQGAGIKVHSWCGEFKLVNQAKHAR  6
               E I C QVH++K+ V  LV +  ++CFI QG G+KV+ W G  K +N  K+ +
Sbjct  1240  KAEEIHCLQVHDVKEAVYELVANAKVACFISQGTGVKVYEWSGVQKHINFNKYVK  1294



>ref|XP_002300701.2| hypothetical protein POPTR_0002s02320g [Populus trichocarpa]
 gb|EEE79974.2| hypothetical protein POPTR_0002s02320g [Populus trichocarpa]
Length=1438

 Score =   130 bits (328),  Expect = 4e-32, Method: Composition-based stats.
 Identities = 60/116 (52%), Positives = 79/116 (68%), Gaps = 0/116 (0%)
 Frame = -2

Query  350   KVLSGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAI  171
             +V+S HSDGTIK W     VL L+QE REH KAVT L I  S +K YSGSLD+T+RVWAI
Sbjct  1168  RVISSHSDGTIKVWDAGKRVLRLIQEVREHTKAVTCLYIPSSGDKLYSGSLDKTIRVWAI  1227

Query  170   SNEGIRCEQVHEIKDHVNNLVVSESLSCFIPQGAGIKVHSWCGEFKLVNQAKHARC  3
               E IRC QVH++K+ V  L  ++ ++CF+ QG G+KV+SW    K +N  +  +C
Sbjct  1228  KPEEIRCIQVHDVKEAVYELAANDKVACFVSQGPGVKVYSWSDVPKHINFNRTVKC  1283



>ref|XP_009334977.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN-1 [Pyrus 
x bretschneideri]
Length=1484

 Score =   130 bits (327),  Expect = 5e-32, Method: Composition-based stats.
 Identities = 60/115 (52%), Positives = 78/115 (68%), Gaps = 0/115 (0%)
 Frame = -2

Query  350   KVLSGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAI  171
             ++LS HSDGTIK W     V  L+QE REH KAVT L IL + +K YSGSLD+T+R+WAI
Sbjct  1214  RILSSHSDGTIKVWDAGKKVPRLIQEVREHAKAVTCLYILPTGDKLYSGSLDKTIRIWAI  1273

Query  170   SNEGIRCEQVHEIKDHVNNLVVSESLSCFIPQGAGIKVHSWCGEFKLVNQAKHAR  6
               E I C QVH++KD V  LV +  ++CF+ QG G+KV+ W G  K +N  K+ R
Sbjct  1274  KAEEIHCLQVHDVKDAVYELVANGKMACFVSQGTGVKVYEWSGVQKHINFNKYVR  1328



>ref|XP_008221252.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN-1 isoform 
X1 [Prunus mume]
Length=1482

 Score =   130 bits (326),  Expect = 7e-32, Method: Composition-based stats.
 Identities = 62/115 (54%), Positives = 78/115 (68%), Gaps = 0/115 (0%)
 Frame = -2

Query  350   KVLSGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAI  171
             +VLS HSDGTIK W     VL L+QE REH KAVT L I  S +K YSGSLD+T+RVWAI
Sbjct  1212  RVLSSHSDGTIKIWDAGKKVLRLIQEVREHTKAVTCLYISSSGDKLYSGSLDKTIRVWAI  1271

Query  170   SNEGIRCEQVHEIKDHVNNLVVSESLSCFIPQGAGIKVHSWCGEFKLVNQAKHAR  6
               E I C QVH++K+ V  LV +  ++CFI QG G+KV+ W G  K +N  K+ +
Sbjct  1272  KAEEIHCLQVHDVKEAVYELVANAKVACFISQGTGVKVYEWSGVQKHINFNKYVK  1326



>ref|XP_008221253.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN-1 isoform 
X2 [Prunus mume]
Length=1457

 Score =   130 bits (326),  Expect = 7e-32, Method: Composition-based stats.
 Identities = 62/115 (54%), Positives = 78/115 (68%), Gaps = 0/115 (0%)
 Frame = -2

Query  350   KVLSGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAI  171
             +VLS HSDGTIK W     VL L+QE REH KAVT L I  S +K YSGSLD+T+RVWAI
Sbjct  1187  RVLSSHSDGTIKIWDAGKKVLRLIQEVREHTKAVTCLYISSSGDKLYSGSLDKTIRVWAI  1246

Query  170   SNEGIRCEQVHEIKDHVNNLVVSESLSCFIPQGAGIKVHSWCGEFKLVNQAKHAR  6
               E I C QVH++K+ V  LV +  ++CFI QG G+KV+ W G  K +N  K+ +
Sbjct  1247  KAEEIHCLQVHDVKEAVYELVANAKVACFISQGTGVKVYEWSGVQKHINFNKYVK  1301



>ref|XP_011045075.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN-1 isoform 
X1 [Populus euphratica]
 ref|XP_011045076.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN-1 isoform 
X1 [Populus euphratica]
Length=1508

 Score =   129 bits (325),  Expect = 8e-32, Method: Composition-based stats.
 Identities = 60/116 (52%), Positives = 78/116 (67%), Gaps = 0/116 (0%)
 Frame = -2

Query  350   KVLSGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAI  171
             +V+S HSDGTIK W     V+ L+ E REH KAVT L I  S +K YSGSLD+T+RVWAI
Sbjct  1235  RVISSHSDGTIKVWDAGNSVVRLIHEVREHAKAVTCLYISSSGDKLYSGSLDKTIRVWAI  1294

Query  170   SNEGIRCEQVHEIKDHVNNLVVSESLSCFIPQGAGIKVHSWCGEFKLVNQAKHARC  3
               E I C QVH++K+ V  L  +  ++CF+ QGAG+KV+SW G  K +N  K  +C
Sbjct  1295  KPEEIHCIQVHDVKEAVYELTANGKVACFVSQGAGVKVYSWSGVPKHINFNKTVKC  1350



>ref|XP_011045077.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN-1 isoform 
X2 [Populus euphratica]
Length=1505

 Score =   129 bits (325),  Expect = 8e-32, Method: Composition-based stats.
 Identities = 60/116 (52%), Positives = 78/116 (67%), Gaps = 0/116 (0%)
 Frame = -2

Query  350   KVLSGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAI  171
             +V+S HSDGTIK W     V+ L+ E REH KAVT L I  S +K YSGSLD+T+RVWAI
Sbjct  1235  RVISSHSDGTIKVWDAGNSVVRLIHEVREHAKAVTCLYISSSGDKLYSGSLDKTIRVWAI  1294

Query  170   SNEGIRCEQVHEIKDHVNNLVVSESLSCFIPQGAGIKVHSWCGEFKLVNQAKHARC  3
               E I C QVH++K+ V  L  +  ++CF+ QGAG+KV+SW G  K +N  K  +C
Sbjct  1295  KPEEIHCIQVHDVKEAVYELTANGKVACFVSQGAGVKVYSWSGVPKHINFNKTVKC  1350



>ref|XP_011045078.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN-1 isoform 
X3 [Populus euphratica]
Length=1258

 Score =   129 bits (324),  Expect = 1e-31, Method: Composition-based stats.
 Identities = 60/116 (52%), Positives = 78/116 (67%), Gaps = 0/116 (0%)
 Frame = -2

Query  350   KVLSGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAI  171
             +V+S HSDGTIK W     V+ L+ E REH KAVT L I  S +K YSGSLD+T+RVWAI
Sbjct  985   RVISSHSDGTIKVWDAGNSVVRLIHEVREHAKAVTCLYISSSGDKLYSGSLDKTIRVWAI  1044

Query  170   SNEGIRCEQVHEIKDHVNNLVVSESLSCFIPQGAGIKVHSWCGEFKLVNQAKHARC  3
               E I C QVH++K+ V  L  +  ++CF+ QGAG+KV+SW G  K +N  K  +C
Sbjct  1045  KPEEIHCIQVHDVKEAVYELTANGKVACFVSQGAGVKVYSWSGVPKHINFNKTVKC  1100



>ref|XP_011029082.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN-1 [Populus 
euphratica]
Length=1342

 Score =   127 bits (319),  Expect = 5e-31, Method: Composition-based stats.
 Identities = 60/109 (55%), Positives = 76/109 (70%), Gaps = 0/109 (0%)
 Frame = -2

Query  350   KVLSGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAI  171
             +V+S HSDGTIK W     VL LVQE REH KAVT L I  S +K YSGSLD+T+RVWAI
Sbjct  1229  RVISSHSDGTIKVWDAGKRVLRLVQEVREHTKAVTCLYIPSSRDKLYSGSLDKTIRVWAI  1288

Query  170   SNEGIRCEQVHEIKDHVNNLVVSESLSCFIPQGAGIKVHSWCGEFKLVN  24
               E IRC QVH++K+ V  L  ++ ++CF+ QG G+KV+SW    K +N
Sbjct  1289  KPEEIRCIQVHDVKEAVFELAANDKVACFVSQGPGVKVYSWSDVPKHIN  1337



>ref|XP_004292946.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN-1-like [Fragaria 
vesca subsp. vesca]
Length=1476

 Score =   127 bits (318),  Expect = 7e-31, Method: Composition-based stats.
 Identities = 61/115 (53%), Positives = 77/115 (67%), Gaps = 0/115 (0%)
 Frame = -2

Query  350   KVLSGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAI  171
             +VLS HSDGTIK W      L L+QE REH KAVT L I  S +K YSGSLD+T+RVWAI
Sbjct  1206  RVLSSHSDGTIKVWDAGKKALRLIQEVREHTKAVTCLYISPSGDKLYSGSLDKTIRVWAI  1265

Query  170   SNEGIRCEQVHEIKDHVNNLVVSESLSCFIPQGAGIKVHSWCGEFKLVNQAKHAR  6
               E I C QVH++K+ V  LV +  ++CFI QG G++V+ W G  K VN  K+ +
Sbjct  1266  KAEEIHCLQVHDVKEVVYKLVANAKVACFISQGTGVRVYEWSGVQKHVNFNKNVK  1320



>ref|XP_008366744.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN-1 [Malus 
domestica]
 ref|XP_008366745.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN-1 [Malus 
domestica]
 ref|XP_008366746.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN-1 [Malus 
domestica]
Length=1484

 Score =   126 bits (316),  Expect = 1e-30, Method: Composition-based stats.
 Identities = 58/115 (50%), Positives = 77/115 (67%), Gaps = 0/115 (0%)
 Frame = -2

Query  350   KVLSGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAI  171
             ++LS HSDGTIK W     V  L+QE REH KAVT L I  + +K YSGSLD+T+R+WAI
Sbjct  1214  RILSSHSDGTIKVWEAGKKVPRLIQEVREHAKAVTCLYISPTGDKLYSGSLDKTIRIWAI  1273

Query  170   SNEGIRCEQVHEIKDHVNNLVVSESLSCFIPQGAGIKVHSWCGEFKLVNQAKHAR  6
               E I C QVH++KD V  LV +  ++CF+ QG G+KV+ W G  K +N  K+ +
Sbjct  1274  KAEEIHCLQVHDVKDAVYELVANGKMACFVSQGTGVKVYEWSGVQKHINFNKYVK  1328



>gb|KDP36916.1| hypothetical protein JCGZ_08207 [Jatropha curcas]
Length=390

 Score =   122 bits (306),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 60/116 (52%), Positives = 76/116 (66%), Gaps = 0/116 (0%)
 Frame = -2

Query  350  KVLSGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAI  171
            +VLSGHSDGTIK W      L L+ E REH KAVT L +  S +K YSGSLD+T+RVWAI
Sbjct  120  RVLSGHSDGTIKVWDAGKRGLRLIHEVREHTKAVTCLYVPSSGDKLYSGSLDKTVRVWAI  179

Query  170  SNEGIRCEQVHEIKDHVNNLVVSESLSCFIPQGAGIKVHSWCGEFKLVNQAKHARC  3
              E I C QVH++K+ V  L  +  ++CFI QG G+KV++W G  K V   K  +C
Sbjct  180  KPEEIHCVQVHDVKEVVYELTANAKVACFISQGTGVKVYNWSGVPKHVTFNKTVKC  235



>ref|XP_008466477.1| PREDICTED: LOW QUALITY PROTEIN: putative E3 ubiquitin-protein 
ligase LIN-1 [Cucumis melo]
Length=1488

 Score =   125 bits (314),  Expect = 2e-30, Method: Composition-based stats.
 Identities = 60/116 (52%), Positives = 81/116 (70%), Gaps = 0/116 (0%)
 Frame = -2

Query  350   KVLSGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAI  171
             +VLSGHSDGTIK W     VL L+QE R+H KAVT L +  S +  YSGSLD+T+RVW+I
Sbjct  1215  RVLSGHSDGTIKVWCAGNKVLRLIQEARKHSKAVTCLCVSSSYDTVYSGSLDKTIRVWSI  1274

Query  170   SNEGIRCEQVHEIKDHVNNLVVSESLSCFIPQGAGIKVHSWCGEFKLVNQAKHARC  3
              +E I+C QVH++K+ V +L V+   +CFI QG G+KV ++ G  K VN  K+ +C
Sbjct  1275  KSEEIQCVQVHDVKEPVYDLKVNGKFACFISQGTGVKVFNFSGVPKHVNFNKYVKC  1330



>gb|EMT16354.1| U-box domain-containing protein 13 [Aegilops tauschii]
Length=1035

 Score =   125 bits (313),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 60/127 (47%), Positives = 84/127 (66%), Gaps = 14/127 (11%)
 Frame = -2

Query  347  VLSGHSDGTIKA------------WSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSG  204
            + SGHSDGT+K             W     +L LVQE++EH KA+TSL+IL S EK YSG
Sbjct  726  IFSGHSDGTLKVALPKCSCLQLQVWEGSENILRLVQESQEHTKAITSLSILPSEEKLYSG  785

Query  203  SLDRTLRVWAISNEGIRCEQVHEIKDHVNNLVVSESLSCFIPQGAGIKVHSW-CGEFKLV  27
            S+DRT+RVW    +G+RC +V++ +D V NL V+ +++CF+PQGAG+K  SW  G  K++
Sbjct  786  SMDRTIRVWQF-RDGLRCAEVYDTRDPVQNLAVASAMACFVPQGAGVKTLSWNGGTPKVL  844

Query  26   NQAKHAR  6
            N +K  R
Sbjct  845  NPSKSVR  851



>ref|XP_008675635.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN [Zea mays]
Length=1403

 Score =   125 bits (313),  Expect = 3e-30, Method: Composition-based stats.
 Identities = 57/117 (49%), Positives = 83/117 (71%), Gaps = 3/117 (3%)
 Frame = -2

Query  347   VLSGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAIL--QSAEKFYSGSLDRTLRVWA  174
             + SGHSDGT+K W     +L LV E +EH KA+TSL++L  +S EK YSGSLDR++R W 
Sbjct  1124  IFSGHSDGTLKVWQGSENILALVHEAQEHSKAITSLSVLHSESEEKLYSGSLDRSIRAWQ  1183

Query  173   ISNEGIRCEQVHEIKDHVNNLVVSESLSCFIPQGAGIKVHSW-CGEFKLVNQAKHAR  6
             + +  +RC +VH+ +D V +L V+ +++CF+PQGAG+KV SW  G  ++VN  K+ R
Sbjct  1184  LRDGVLRCVEVHDTRDPVQSLAVASAVACFVPQGAGVKVLSWGSGSSRVVNANKYVR  1240



>tpg|DAA52769.1| TPA: hypothetical protein ZEAMMB73_576745 [Zea mays]
Length=1398

 Score =   125 bits (313),  Expect = 3e-30, Method: Composition-based stats.
 Identities = 57/117 (49%), Positives = 83/117 (71%), Gaps = 3/117 (3%)
 Frame = -2

Query  347   VLSGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAIL--QSAEKFYSGSLDRTLRVWA  174
             + SGHSDGT+K W     +L LV E +EH KA+TSL++L  +S EK YSGSLDR++R W 
Sbjct  1119  IFSGHSDGTLKVWQGSENILALVHEAQEHSKAITSLSVLHSESEEKLYSGSLDRSIRAWQ  1178

Query  173   ISNEGIRCEQVHEIKDHVNNLVVSESLSCFIPQGAGIKVHSW-CGEFKLVNQAKHAR  6
             + +  +RC +VH+ +D V +L V+ +++CF+PQGAG+KV SW  G  ++VN  K+ R
Sbjct  1179  LRDGVLRCVEVHDTRDPVQSLAVASAVACFVPQGAGVKVLSWGSGSSRVVNANKYVR  1235



>ref|XP_006492801.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN-1-like [Citrus 
sinensis]
Length=1496

 Score =   125 bits (313),  Expect = 3e-30, Method: Composition-based stats.
 Identities = 56/115 (49%), Positives = 76/115 (66%), Gaps = 0/115 (0%)
 Frame = -2

Query  350   KVLSGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAI  171
             +VLS HSDGTIK W     VL L+QE REH +AVT L +  S +K YSGSLD+T+RVW+I
Sbjct  1224  RVLSSHSDGTIKMWDSGKRVLRLIQEVREHTRAVTCLYVPSSGDKLYSGSLDKTIRVWSI  1283

Query  170   SNEGIRCEQVHEIKDHVNNLVVSESLSCFIPQGAGIKVHSWCGEFKLVNQAKHAR  6
               E I C QVH +K+ V+ L  +  ++CF+    G+KV++W G  K +N  KH +
Sbjct  1284  KPEEIHCLQVHNVKEAVHELTANAEIACFVSPATGVKVYNWSGAIKHINFNKHVK  1338



>gb|KDO41596.1| hypothetical protein CISIN_1g0007442mg, partial [Citrus sinensis]
Length=1294

 Score =   124 bits (312),  Expect = 5e-30, Method: Composition-based stats.
 Identities = 56/115 (49%), Positives = 76/115 (66%), Gaps = 0/115 (0%)
 Frame = -2

Query  350   KVLSGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAI  171
             +VLS HSDGTIK W     VL L+QE REH +AVT L +  S +K YSGSLD+T+RVW+I
Sbjct  1048  RVLSSHSDGTIKMWDSGKRVLRLIQEVREHTRAVTCLYVPSSGDKLYSGSLDKTIRVWSI  1107

Query  170   SNEGIRCEQVHEIKDHVNNLVVSESLSCFIPQGAGIKVHSWCGEFKLVNQAKHAR  6
               E I C QVH +K+ V+ L  +  ++CF+    G+KV++W G  K +N  KH +
Sbjct  1108  KPEEIHCLQVHNVKEAVHELTANAEIACFVSPATGVKVYNWSGAIKHINFNKHVK  1162



>emb|CAN74785.1| hypothetical protein VITISV_011516 [Vitis vinifera]
Length=1494

 Score =   124 bits (312),  Expect = 5e-30, Method: Composition-based stats.
 Identities = 58/115 (50%), Positives = 75/115 (65%), Gaps = 0/115 (0%)
 Frame = -2

Query  347   VLSGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAIS  168
             VLSGHSDGTIK W      L L+QE REH KAVT L    S++K YSGSLD+T+RVW + 
Sbjct  1225  VLSGHSDGTIKVWDAGKRDLRLIQEVREHTKAVTCLYASSSSDKLYSGSLDKTIRVWTVK  1284

Query  167   NEGIRCEQVHEIKDHVNNLVVSESLSCFIPQGAGIKVHSWCGEFKLVNQAKHARC  3
              E I C QVH++K+ V  L  + + +CF  QG G+ V+SW G  K +N  K+ +C
Sbjct  1285  PEEIHCVQVHDVKEAVYQLTANANFACFSSQGTGVNVYSWSGVPKHINFNKYVKC  1339



>ref|XP_009588633.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN-1 {ECO:0000250|UniProtKB:D1FP53} 
isoform X2 [Nicotiana tomentosiformis]
Length=1481

 Score =   124 bits (312),  Expect = 5e-30, Method: Composition-based stats.
 Identities = 58/116 (50%), Positives = 76/116 (66%), Gaps = 0/116 (0%)
 Frame = -2

Query  350   KVLSGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAI  171
             +++S HSDGTIK W        L+ ETREH KAVT L +  S EK YSGSLDRT+RVWAI
Sbjct  1211  RLISSHSDGTIKVWETGKRAPRLIHETREHTKAVTCLYVSSSYEKLYSGSLDRTIRVWAI  1270

Query  170   SNEGIRCEQVHEIKDHVNNLVVSESLSCFIPQGAGIKVHSWCGEFKLVNQAKHARC  3
             + E I C QVH++K+ V  L+ +   +CF  Q  G+KV++W G  K VN  K+ +C
Sbjct  1271  NQEEIHCLQVHDVKEPVLELIANTHFACFASQATGVKVYTWSGVPKHVNFQKYVKC  1326



>ref|XP_009588632.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN-1 {ECO:0000250|UniProtKB:D1FP53} 
isoform X1 [Nicotiana tomentosiformis]
Length=1486

 Score =   124 bits (312),  Expect = 5e-30, Method: Composition-based stats.
 Identities = 58/116 (50%), Positives = 76/116 (66%), Gaps = 0/116 (0%)
 Frame = -2

Query  350   KVLSGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAI  171
             +++S HSDGTIK W        L+ ETREH KAVT L +  S EK YSGSLDRT+RVWAI
Sbjct  1216  RLISSHSDGTIKVWETGKRAPRLIHETREHTKAVTCLYVSSSYEKLYSGSLDRTIRVWAI  1275

Query  170   SNEGIRCEQVHEIKDHVNNLVVSESLSCFIPQGAGIKVHSWCGEFKLVNQAKHARC  3
             + E I C QVH++K+ V  L+ +   +CF  Q  G+KV++W G  K VN  K+ +C
Sbjct  1276  NQEEIHCLQVHDVKEPVLELIANTHFACFASQATGVKVYTWSGVPKHVNFQKYVKC  1331



>ref|XP_009588635.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN-1 {ECO:0000250|UniProtKB:D1FP53} 
isoform X4 [Nicotiana tomentosiformis]
Length=1266

 Score =   124 bits (311),  Expect = 5e-30, Method: Composition-based stats.
 Identities = 58/116 (50%), Positives = 76/116 (66%), Gaps = 0/116 (0%)
 Frame = -2

Query  350   KVLSGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAI  171
             +++S HSDGTIK W        L+ ETREH KAVT L +  S EK YSGSLDRT+RVWAI
Sbjct  996   RLISSHSDGTIKVWETGKRAPRLIHETREHTKAVTCLYVSSSYEKLYSGSLDRTIRVWAI  1055

Query  170   SNEGIRCEQVHEIKDHVNNLVVSESLSCFIPQGAGIKVHSWCGEFKLVNQAKHARC  3
             + E I C QVH++K+ V  L+ +   +CF  Q  G+KV++W G  K VN  K+ +C
Sbjct  1056  NQEEIHCLQVHDVKEPVLELIANTHFACFASQATGVKVYTWSGVPKHVNFQKYVKC  1111



>ref|XP_009588634.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN-1 {ECO:0000250|UniProtKB:D1FP53} 
isoform X3 [Nicotiana tomentosiformis]
Length=1375

 Score =   124 bits (311),  Expect = 6e-30, Method: Composition-based stats.
 Identities = 58/116 (50%), Positives = 76/116 (66%), Gaps = 0/116 (0%)
 Frame = -2

Query  350   KVLSGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAI  171
             +++S HSDGTIK W        L+ ETREH KAVT L +  S EK YSGSLDRT+RVWAI
Sbjct  1105  RLISSHSDGTIKVWETGKRAPRLIHETREHTKAVTCLYVSSSYEKLYSGSLDRTIRVWAI  1164

Query  170   SNEGIRCEQVHEIKDHVNNLVVSESLSCFIPQGAGIKVHSWCGEFKLVNQAKHARC  3
             + E I C QVH++K+ V  L+ +   +CF  Q  G+KV++W G  K VN  K+ +C
Sbjct  1165  NQEEIHCLQVHDVKEPVLELIANTHFACFASQATGVKVYTWSGVPKHVNFQKYVKC  1220



>ref|XP_006851971.1| hypothetical protein AMTR_s00041p00198080 [Amborella trichopoda]
 gb|ERN13438.1| hypothetical protein AMTR_s00041p00198080 [Amborella trichopoda]
Length=569

 Score =   121 bits (304),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 58/115 (50%), Positives = 76/115 (66%), Gaps = 0/115 (0%)
 Frame = -2

Query  350  KVLSGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAI  171
            ++ S HSDG IK W      L L+QE REH K VTSL++  S EK YSGSLD+T+RVW I
Sbjct  280  RLFSSHSDGHIKVWDTGRRTLRLIQEAREHTKPVTSLSLALSGEKLYSGSLDKTIRVWGI  339

Query  170  SNEGIRCEQVHEIKDHVNNLVVSESLSCFIPQGAGIKVHSWCGEFKLVNQAKHAR  6
              E I C QV+E+K+ V +L V+  ++CFI QG G KV++W G  K +N  KH +
Sbjct  340  GPEEIHCIQVYEVKEAVCSLTVNGEMACFISQGTGTKVYNWSGFPKNINSNKHVK  394



>tpg|DAA52770.1| TPA: hypothetical protein ZEAMMB73_576745 [Zea mays]
Length=899

 Score =   123 bits (308),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 57/117 (49%), Positives = 83/117 (71%), Gaps = 3/117 (3%)
 Frame = -2

Query  347  VLSGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAIL--QSAEKFYSGSLDRTLRVWA  174
            + SGHSDGT+K W     +L LV E +EH KA+TSL++L  +S EK YSGSLDR++R W 
Sbjct  620  IFSGHSDGTLKVWQGSENILALVHEAQEHSKAITSLSVLHSESEEKLYSGSLDRSIRAWQ  679

Query  173  ISNEGIRCEQVHEIKDHVNNLVVSESLSCFIPQGAGIKVHSW-CGEFKLVNQAKHAR  6
            + +  +RC +VH+ +D V +L V+ +++CF+PQGAG+KV SW  G  ++VN  K+ R
Sbjct  680  LRDGVLRCVEVHDTRDPVQSLAVASAVACFVPQGAGVKVLSWGSGSSRVVNANKYVR  736



>ref|XP_009773051.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN-1 isoform 
X4 [Nicotiana sylvestris]
Length=1338

 Score =   123 bits (309),  Expect = 1e-29, Method: Composition-based stats.
 Identities = 57/116 (49%), Positives = 76/116 (66%), Gaps = 0/116 (0%)
 Frame = -2

Query  350   KVLSGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAI  171
             +++S HSDGTIK W        L+ ETREH KAVT L +  S +K YSGSLDRT+RVWAI
Sbjct  1068  RLISSHSDGTIKVWETGKRAPRLIHETREHAKAVTCLYVSSSCDKLYSGSLDRTIRVWAI  1127

Query  170   SNEGIRCEQVHEIKDHVNNLVVSESLSCFIPQGAGIKVHSWCGEFKLVNQAKHARC  3
             + E I C QVH++K+ V  L+ +   +CF  Q  G+KV++W G  K VN  K+ +C
Sbjct  1128  NQEEIHCLQVHDVKEPVLELIANTQFACFASQATGVKVYNWSGVPKHVNFQKNVKC  1183



>ref|XP_009773032.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN-1 isoform 
X1 [Nicotiana sylvestris]
Length=1486

 Score =   123 bits (309),  Expect = 1e-29, Method: Composition-based stats.
 Identities = 57/116 (49%), Positives = 76/116 (66%), Gaps = 0/116 (0%)
 Frame = -2

Query  350   KVLSGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAI  171
             +++S HSDGTIK W        L+ ETREH KAVT L +  S +K YSGSLDRT+RVWAI
Sbjct  1216  RLISSHSDGTIKVWETGKRAPRLIHETREHAKAVTCLYVSSSCDKLYSGSLDRTIRVWAI  1275

Query  170   SNEGIRCEQVHEIKDHVNNLVVSESLSCFIPQGAGIKVHSWCGEFKLVNQAKHARC  3
             + E I C QVH++K+ V  L+ +   +CF  Q  G+KV++W G  K VN  K+ +C
Sbjct  1276  NQEEIHCLQVHDVKEPVLELIANTQFACFASQATGVKVYNWSGVPKHVNFQKNVKC  1331



>ref|XP_009773059.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN-1 isoform 
X5 [Nicotiana sylvestris]
Length=1266

 Score =   123 bits (308),  Expect = 1e-29, Method: Composition-based stats.
 Identities = 57/116 (49%), Positives = 76/116 (66%), Gaps = 0/116 (0%)
 Frame = -2

Query  350   KVLSGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAI  171
             +++S HSDGTIK W        L+ ETREH KAVT L +  S +K YSGSLDRT+RVWAI
Sbjct  996   RLISSHSDGTIKVWETGKRAPRLIHETREHAKAVTCLYVSSSCDKLYSGSLDRTIRVWAI  1055

Query  170   SNEGIRCEQVHEIKDHVNNLVVSESLSCFIPQGAGIKVHSWCGEFKLVNQAKHARC  3
             + E I C QVH++K+ V  L+ +   +CF  Q  G+KV++W G  K VN  K+ +C
Sbjct  1056  NQEEIHCLQVHDVKEPVLELIANTQFACFASQATGVKVYNWSGVPKHVNFQKNVKC  1111



>ref|XP_009773037.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN-1 isoform 
X2 [Nicotiana sylvestris]
Length=1478

 Score =   123 bits (308),  Expect = 1e-29, Method: Composition-based stats.
 Identities = 57/116 (49%), Positives = 76/116 (66%), Gaps = 0/116 (0%)
 Frame = -2

Query  350   KVLSGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAI  171
             +++S HSDGTIK W        L+ ETREH KAVT L +  S +K YSGSLDRT+RVWAI
Sbjct  1208  RLISSHSDGTIKVWETGKRAPRLIHETREHAKAVTCLYVSSSCDKLYSGSLDRTIRVWAI  1267

Query  170   SNEGIRCEQVHEIKDHVNNLVVSESLSCFIPQGAGIKVHSWCGEFKLVNQAKHARC  3
             + E I C QVH++K+ V  L+ +   +CF  Q  G+KV++W G  K VN  K+ +C
Sbjct  1268  NQEEIHCLQVHDVKEPVLELIANTQFACFASQATGVKVYNWSGVPKHVNFQKNVKC  1323



>ref|XP_009773043.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN-1 isoform 
X3 [Nicotiana sylvestris]
Length=1375

 Score =   123 bits (308),  Expect = 2e-29, Method: Composition-based stats.
 Identities = 57/116 (49%), Positives = 76/116 (66%), Gaps = 0/116 (0%)
 Frame = -2

Query  350   KVLSGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAI  171
             +++S HSDGTIK W        L+ ETREH KAVT L +  S +K YSGSLDRT+RVWAI
Sbjct  1105  RLISSHSDGTIKVWETGKRAPRLIHETREHAKAVTCLYVSSSCDKLYSGSLDRTIRVWAI  1164

Query  170   SNEGIRCEQVHEIKDHVNNLVVSESLSCFIPQGAGIKVHSWCGEFKLVNQAKHARC  3
             + E I C QVH++K+ V  L+ +   +CF  Q  G+KV++W G  K VN  K+ +C
Sbjct  1165  NQEEIHCLQVHDVKEPVLELIANTQFACFASQATGVKVYNWSGVPKHVNFQKNVKC  1220



>ref|XP_010062045.1| PREDICTED: LOW QUALITY PROTEIN: putative E3 ubiquitin-protein 
ligase LIN-1 [Eucalyptus grandis]
Length=1495

 Score =   122 bits (307),  Expect = 2e-29, Method: Composition-based stats.
 Identities = 59/115 (51%), Positives = 74/115 (64%), Gaps = 2/115 (2%)
 Frame = -2

Query  341   SGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAISNE  162
             S HSDGTIK W     VL L+QE REH KAVT L +  S ++ YSGSLD+T+RVW I  E
Sbjct  1229  SSHSDGTIKVWDAGKRVLRLIQEVREHTKAVTCLYVPPSGDRLYSGSLDKTIRVWVIKPE  1288

Query  161   GIRCEQVHEIKDHVNNLVVSESLSCFIPQGAGIKVHSWCGEFKLVN--QAKHARC  3
              I C QVH++K+ V  L  +   +CFI QG G+KV++W G  K +N    K ARC
Sbjct  1289  EIHCLQVHDVKEPVYELTANAHAACFISQGTGVKVYNWSGTPKHINFSNNKMARC  1343



>ref|XP_004162568.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN-1-like, partial 
[Cucumis sativus]
Length=1407

 Score =   122 bits (307),  Expect = 2e-29, Method: Composition-based stats.
 Identities = 58/116 (50%), Positives = 81/116 (70%), Gaps = 0/116 (0%)
 Frame = -2

Query  350   KVLSGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAI  171
             +VLS HSDGTIK W  +  VL L+QE R+H KAVT L +  S +  YSGSLD+T+RVW+I
Sbjct  1134  RVLSSHSDGTIKVWDARNKVLRLIQEARKHSKAVTCLCVSSSYDTVYSGSLDKTIRVWSI  1193

Query  170   SNEGIRCEQVHEIKDHVNNLVVSESLSCFIPQGAGIKVHSWCGEFKLVNQAKHARC  3
              +E I+C QVHE+K+ V +L V+  L+CF+  G G+KV ++ G  K +N  K+ +C
Sbjct  1194  KSEEIQCVQVHEVKEPVYDLKVNGKLACFVSPGNGVKVFNFFGVPKHINFNKYVKC  1249



>gb|KCW69116.1| hypothetical protein EUGRSUZ_F02660, partial [Eucalyptus grandis]
Length=1479

 Score =   122 bits (307),  Expect = 2e-29, Method: Composition-based stats.
 Identities = 59/115 (51%), Positives = 74/115 (64%), Gaps = 2/115 (2%)
 Frame = -2

Query  341   SGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAISNE  162
             S HSDGTIK W     VL L+QE REH KAVT L +  S ++ YSGSLD+T+RVW I  E
Sbjct  1214  SSHSDGTIKVWDAGKRVLRLIQEVREHTKAVTCLYVPPSGDRLYSGSLDKTIRVWVIKPE  1273

Query  161   GIRCEQVHEIKDHVNNLVVSESLSCFIPQGAGIKVHSWCGEFKLVN--QAKHARC  3
              I C QVH++K+ V  L  +   +CFI QG G+KV++W G  K +N    K ARC
Sbjct  1274  EIHCLQVHDVKEPVYELTANAHAACFISQGTGVKVYNWSGTPKHINFSNNKMARC  1328



>ref|XP_004136490.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN-1-like [Cucumis 
sativus]
Length=1489

 Score =   122 bits (307),  Expect = 2e-29, Method: Composition-based stats.
 Identities = 58/116 (50%), Positives = 81/116 (70%), Gaps = 0/116 (0%)
 Frame = -2

Query  350   KVLSGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAI  171
             +VLS HSDGTIK W  +  VL L+QE R+H KAVT L +  S +  YSGSLD+T+RVW+I
Sbjct  1216  RVLSSHSDGTIKVWDARNKVLRLIQEARKHSKAVTCLCVSSSYDTVYSGSLDKTIRVWSI  1275

Query  170   SNEGIRCEQVHEIKDHVNNLVVSESLSCFIPQGAGIKVHSWCGEFKLVNQAKHARC  3
              +E I+C QVHE+K+ V +L V+  L+CF+  G G+KV ++ G  K +N  K+ +C
Sbjct  1276  KSEEIQCVQVHEVKEPVYDLKVNGKLACFVSPGNGVKVFNFFGVPKHINFNKYVKC  1331



>gb|KGN60041.1| hypothetical protein Csa_3G872720 [Cucumis sativus]
Length=1516

 Score =   122 bits (307),  Expect = 2e-29, Method: Composition-based stats.
 Identities = 58/116 (50%), Positives = 81/116 (70%), Gaps = 0/116 (0%)
 Frame = -2

Query  350   KVLSGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAI  171
             +VLS HSDGTIK W  +  VL L+QE R+H KAVT L +  S +  YSGSLD+T+RVW+I
Sbjct  1243  RVLSSHSDGTIKVWDARNKVLRLIQEARKHSKAVTCLCVSSSYDTVYSGSLDKTIRVWSI  1302

Query  170   SNEGIRCEQVHEIKDHVNNLVVSESLSCFIPQGAGIKVHSWCGEFKLVNQAKHARC  3
              +E I+C QVHE+K+ V +L V+  L+CF+  G G+KV ++ G  K +N  K+ +C
Sbjct  1303  KSEEIQCVQVHEVKEPVYDLKVNGKLACFVSPGNGVKVFNFFGVPKHINFNKYVKC  1358



>sp|C6L7U1.2|LIN1_LOTJA RecName: Full=Putative E3 ubiquitin-protein ligase LIN-1; AltName: 
Full=Protein cerberus [Lotus japonicus]
Length=1485

 Score =   122 bits (306),  Expect = 3e-29, Method: Composition-based stats.
 Identities = 54/115 (47%), Positives = 82/115 (71%), Gaps = 2/115 (2%)
 Frame = -2

Query  350   KVLSGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAI  171
             +VLSGH+DGTIK W  +  +  ++QET EH KAVTSL    S ++ YSGSLD+T+RVW I
Sbjct  1218  QVLSGHTDGTIKVWDARKRIPRVIQETHEHTKAVTSLC--SSGDRLYSGSLDKTIRVWTI  1275

Query  170   SNEGIRCEQVHEIKDHVNNLVVSESLSCFIPQGAGIKVHSWCGEFKLVNQAKHAR  6
              ++GI+C  V++IK+ V+ L  ++ L+C++ QG G+KV +W    KL+N +K+ +
Sbjct  1276  KSDGIKCIDVYDIKEAVHELAANDKLACYVSQGTGVKVFNWSEAPKLINFSKYVK  1330



>dbj|BAH86605.1| U-box protein with unknown function [Lotus japonicus]
 dbj|BAH86606.1| U-box protein with unknown function [Lotus japonicus]
Length=1477

 Score =   122 bits (306),  Expect = 3e-29, Method: Composition-based stats.
 Identities = 54/115 (47%), Positives = 82/115 (71%), Gaps = 2/115 (2%)
 Frame = -2

Query  350   KVLSGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAI  171
             +VLSGH+DGTIK W  +  +  ++QET EH KAVTSL    S ++ YSGSLD+T+RVW I
Sbjct  1210  QVLSGHTDGTIKVWDARKRIPRVIQETHEHTKAVTSLC--SSGDRLYSGSLDKTIRVWTI  1267

Query  170   SNEGIRCEQVHEIKDHVNNLVVSESLSCFIPQGAGIKVHSWCGEFKLVNQAKHAR  6
              ++GI+C  V++IK+ V+ L  ++ L+C++ QG G+KV +W    KL+N +K+ +
Sbjct  1268  KSDGIKCIDVYDIKEAVHELAANDKLACYVSQGTGVKVFNWSEAPKLINFSKYVK  1322



>ref|XP_003536276.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN-1-like [Glycine 
max]
Length=1481

 Score =   122 bits (306),  Expect = 3e-29, Method: Composition-based stats.
 Identities = 55/116 (47%), Positives = 80/116 (69%), Gaps = 2/116 (2%)
 Frame = -2

Query  350   KVLSGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAI  171
             +VLSGHSDGTIK W  +  +  ++QET EH KAVTSL    S ++ YSGSLD+T+RVW +
Sbjct  1214  QVLSGHSDGTIKVWDARKRIPRVIQETHEHTKAVTSLC--SSDDRLYSGSLDKTIRVWTV  1271

Query  170   SNEGIRCEQVHEIKDHVNNLVVSESLSCFIPQGAGIKVHSWCGEFKLVNQAKHARC  3
               + I+C  VH++K+ V  L V+  L+C++ QG+G+KV +W    KL+N  K+ +C
Sbjct  1272  KPDEIKCIDVHDVKEPVYELTVNAKLACYVSQGSGVKVFNWSEAPKLINFNKYVKC  1327



>ref|XP_011083563.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN [Sesamum 
indicum]
Length=1499

 Score =   122 bits (305),  Expect = 4e-29, Method: Composition-based stats.
 Identities = 57/116 (49%), Positives = 75/116 (65%), Gaps = 0/116 (0%)
 Frame = -2

Query  350   KVLSGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAI  171
             +++S HSDGTIK W        L+QE REH KAVT L +  S +K YSGSLD+T+RVW+I
Sbjct  1215  RLISSHSDGTIKVWDTGKSTPRLIQEAREHSKAVTCLYVPPSCDKLYSGSLDKTIRVWSI  1274

Query  170   SNEGIRCEQVHEIKDHVNNLVVSESLSCFIPQGAGIKVHSWCGEFKLVNQAKHARC  3
               E I C QVH++K+ V  LV + S +CF  QG G+KV +W G  K +N  K  +C
Sbjct  1275  KQEEIHCIQVHDVKEAVLALVANASFACFSSQGNGVKVFNWSGVPKSINFNKQVKC  1330



>ref|XP_006357361.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN-1-like [Solanum 
tuberosum]
Length=1490

 Score =   122 bits (305),  Expect = 4e-29, Method: Composition-based stats.
 Identities = 57/116 (49%), Positives = 76/116 (66%), Gaps = 0/116 (0%)
 Frame = -2

Query  350   KVLSGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAI  171
             +++S HSDGTIK W        L+ ETREH KAVT L +  S +K YSGSLDRT+RVWAI
Sbjct  1220  RLISSHSDGTIKVWETGKRNPRLIHETREHSKAVTCLYVSSSGDKLYSGSLDRTIRVWAI  1279

Query  170   SNEGIRCEQVHEIKDHVNNLVVSESLSCFIPQGAGIKVHSWCGEFKLVNQAKHARC  3
             + E I C QVH++K+ V  L+ +   +CF  Q  G+KV++W G  K VN  K+ +C
Sbjct  1280  NQEEIHCLQVHDVKEPVLELIANTHFACFASQATGVKVYNWSGVPKHVNFQKYVKC  1335



>ref|XP_007027082.1| Transducin/WD40 repeat-like superfamily protein [Theobroma cacao]
 gb|EOY07584.1| Transducin/WD40 repeat-like superfamily protein [Theobroma cacao]
Length=1500

 Score =   122 bits (305),  Expect = 5e-29, Method: Composition-based stats.
 Identities = 54/115 (47%), Positives = 78/115 (68%), Gaps = 0/115 (0%)
 Frame = -2

Query  347   VLSGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAIS  168
             +++ HSDG+IK W      L LVQE REH+KAVT L +  S ++ YSGSLD+T+R+WA+ 
Sbjct  1231  LITSHSDGSIKVWDSGKRGLRLVQEAREHMKAVTCLYVPSSGDRLYSGSLDKTIRIWALK  1290

Query  167   NEGIRCEQVHEIKDHVNNLVVSESLSCFIPQGAGIKVHSWCGEFKLVNQAKHARC  3
              E I C QVH++K+ V++L  +   +CFI QG G+KV++W G  K +   KH +C
Sbjct  1291  PEEIHCIQVHDVKEAVHDLSANSKFACFISQGNGVKVYNWTGTPKHITFNKHVKC  1345



>ref|XP_002279863.2| PREDICTED: putative E3 ubiquitin-protein ligase LIN-1 isoform 
X2 [Vitis vinifera]
Length=1494

 Score =   121 bits (304),  Expect = 5e-29, Method: Composition-based stats.
 Identities = 58/114 (51%), Positives = 74/114 (65%), Gaps = 0/114 (0%)
 Frame = -2

Query  347   VLSGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAIS  168
             VLSGHSDGTIK W      L L+QE REH KAVT L    S++K YSGSLD+T+RVW + 
Sbjct  1225  VLSGHSDGTIKVWDAGKRDLRLIQEVREHTKAVTCLYASSSSDKLYSGSLDKTIRVWTVK  1284

Query  167   NEGIRCEQVHEIKDHVNNLVVSESLSCFIPQGAGIKVHSWCGEFKLVNQAKHAR  6
              E I C QVH++K+ V  L  + S +CF  QG G+ V+SW G  K +N  K+ +
Sbjct  1285  PEEIHCVQVHDVKEAVYQLTANASFACFSSQGTGVNVYSWSGVPKHINFNKNVK  1338



>ref|XP_010664820.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN-1 isoform 
X1 [Vitis vinifera]
Length=1496

 Score =   121 bits (304),  Expect = 5e-29, Method: Composition-based stats.
 Identities = 58/114 (51%), Positives = 74/114 (65%), Gaps = 0/114 (0%)
 Frame = -2

Query  347   VLSGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAIS  168
             VLSGHSDGTIK W      L L+QE REH KAVT L    S++K YSGSLD+T+RVW + 
Sbjct  1225  VLSGHSDGTIKVWDAGKRDLRLIQEVREHTKAVTCLYASSSSDKLYSGSLDKTIRVWTVK  1284

Query  167   NEGIRCEQVHEIKDHVNNLVVSESLSCFIPQGAGIKVHSWCGEFKLVNQAKHAR  6
              E I C QVH++K+ V  L  + S +CF  QG G+ V+SW G  K +N  K+ +
Sbjct  1285  PEEIHCVQVHDVKEAVYQLTANASFACFSSQGTGVNVYSWSGVPKHINFNKNVK  1338



>emb|CBI19874.3| unnamed protein product [Vitis vinifera]
Length=1510

 Score =   121 bits (304),  Expect = 5e-29, Method: Composition-based stats.
 Identities = 58/114 (51%), Positives = 74/114 (65%), Gaps = 0/114 (0%)
 Frame = -2

Query  347   VLSGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAIS  168
             VLSGHSDGTIK W      L L+QE REH KAVT L    S++K YSGSLD+T+RVW + 
Sbjct  1241  VLSGHSDGTIKVWDAGKRDLRLIQEVREHTKAVTCLYASSSSDKLYSGSLDKTIRVWTVK  1300

Query  167   NEGIRCEQVHEIKDHVNNLVVSESLSCFIPQGAGIKVHSWCGEFKLVNQAKHAR  6
              E I C QVH++K+ V  L  + S +CF  QG G+ V+SW G  K +N  K+ +
Sbjct  1301  PEEIHCVQVHDVKEAVYQLTANASFACFSSQGTGVNVYSWSGVPKHINFNKNVK  1354



>ref|XP_004496090.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN-like isoform 
X1 [Cicer arietinum]
 ref|XP_004496091.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN-like isoform 
X2 [Cicer arietinum]
Length=1486

 Score =   121 bits (303),  Expect = 8e-29, Method: Composition-based stats.
 Identities = 53/116 (46%), Positives = 81/116 (70%), Gaps = 2/116 (2%)
 Frame = -2

Query  350   KVLSGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAI  171
             +V SGHSDGTIK W  +  +  ++QETREH KA+TSL    S ++ YS S+D+T+RVW+I
Sbjct  1219  QVFSGHSDGTIKVWDARKRIPRVIQETREHKKAITSLC--SSVDRLYSSSMDKTIRVWSI  1276

Query  170   SNEGIRCEQVHEIKDHVNNLVVSESLSCFIPQGAGIKVHSWCGEFKLVNQAKHARC  3
               +GI+C  V+++K+ V  LV +  L+C++ QG G+KV +W G  K +N +K+ +C
Sbjct  1277  KPDGIKCTDVYDVKEVVFELVANAELACYVTQGTGVKVFNWSGAPKHINFSKYVKC  1332



>ref|XP_007144197.1| hypothetical protein PHAVU_007G136300g [Phaseolus vulgaris]
 gb|ESW16191.1| hypothetical protein PHAVU_007G136300g [Phaseolus vulgaris]
Length=1491

 Score =   120 bits (302),  Expect = 1e-28, Method: Composition-based stats.
 Identities = 55/116 (47%), Positives = 79/116 (68%), Gaps = 2/116 (2%)
 Frame = -2

Query  350   KVLSGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAI  171
             +VLSGHSDGTIK W  +  +  ++QET EH KAVTSL    S ++ YSGSLD+T+RVW I
Sbjct  1224  QVLSGHSDGTIKVWDARKRIPRVIQETHEHTKAVTSLC--SSDDRLYSGSLDKTIRVWTI  1281

Query  170   SNEGIRCEQVHEIKDHVNNLVVSESLSCFIPQGAGIKVHSWCGEFKLVNQAKHARC  3
               + I+C  VH++K+ V  L  +  L+C++ QG+G+KV +W    KL+N  K+ +C
Sbjct  1282  KPDEIKCIDVHDVKEPVYELTANAKLACYVSQGSGVKVFNWSEAPKLINFNKYVKC  1337



>ref|XP_003591660.1| U-box domain-containing protein [Medicago truncatula]
 ref|XP_003637097.1| U-box domain-containing protein [Medicago truncatula]
 gb|AES61911.1| E3 ubiquitin-protein ligase LIN-like protein, putative [Medicago 
truncatula]
Length=1490

 Score =   119 bits (299),  Expect = 3e-28, Method: Composition-based stats.
 Identities = 54/116 (47%), Positives = 78/116 (67%), Gaps = 2/116 (2%)
 Frame = -2

Query  350   KVLSGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAI  171
             +VLSGH+DGTIK W  +  +  ++QETREH KAVTSL    S +K YS SLD+T+RVW I
Sbjct  1223  QVLSGHADGTIKVWDARKRIPRVIQETREHKKAVTSLC--SSVDKLYSSSLDKTIRVWTI  1280

Query  170   SNEGIRCEQVHEIKDHVNNLVVSESLSCFIPQGAGIKVHSWCGEFKLVNQAKHARC  3
               +GI+C  V+++K+ V  L  +  L+C++ QG G+KV +W    K +N  K+ +C
Sbjct  1281  KPDGIKCIDVYDVKEAVYELAANAKLACYVTQGTGVKVFNWLDAPKFINFNKYVKC  1336



>sp|D1FP53.1|LIN_MEDTR RecName: Full=Putative E3 ubiquitin-protein ligase LIN; Short=MtLIN 
[Medicago truncatula]
 gb|ACL14419.1| putative E3 ubiquitin ligase [Medicago truncatula]
 gb|ACL14420.1| putative E3 ubiquitin ligase [Medicago truncatula]
 gb|KEH43296.1| E3 ubiquitin-protein ligase LIN-like protein, putative [Medicago 
truncatula]
Length=1488

 Score =   119 bits (298),  Expect = 3e-28, Method: Composition-based stats.
 Identities = 54/116 (47%), Positives = 78/116 (67%), Gaps = 2/116 (2%)
 Frame = -2

Query  350   KVLSGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAI  171
             +VLSGH+DGTIK W  +  +  ++QETREH KAVTSL    S +K YS SLD+T+RVW I
Sbjct  1221  QVLSGHADGTIKVWDARKRIPRVIQETREHKKAVTSLC--SSVDKLYSSSLDKTIRVWTI  1278

Query  170   SNEGIRCEQVHEIKDHVNNLVVSESLSCFIPQGAGIKVHSWCGEFKLVNQAKHARC  3
               +GI+C  V+++K+ V  L  +  L+C++ QG G+KV +W    K +N  K+ +C
Sbjct  1279  KPDGIKCIDVYDVKEAVYELAANAKLACYVTQGTGVKVFNWLDAPKFINFNKYVKC  1334



>ref|XP_010319719.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN-1 isoform 
X3 [Solanum lycopersicum]
Length=1481

 Score =   119 bits (297),  Expect = 5e-28, Method: Composition-based stats.
 Identities = 56/116 (48%), Positives = 75/116 (65%), Gaps = 0/116 (0%)
 Frame = -2

Query  350   KVLSGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAI  171
             +++S HSDGTIK W        L  ETREH KAVT L +  S +K YSGSLDRT+RVWAI
Sbjct  1211  RLISSHSDGTIKVWETGKRNPRLNHETREHSKAVTCLYVSSSCDKLYSGSLDRTIRVWAI  1270

Query  170   SNEGIRCEQVHEIKDHVNNLVVSESLSCFIPQGAGIKVHSWCGEFKLVNQAKHARC  3
             + E I C QVH++K+ V  L+ +   +CF  Q  G+KV++W G  K +N  K+ +C
Sbjct  1271  NQEEIHCLQVHDVKEPVLELIANTHFACFTSQSTGVKVYNWSGVPKHINFQKYVKC  1326



>ref|XP_010319718.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN-1 isoform 
X2 [Solanum lycopersicum]
Length=1482

 Score =   119 bits (297),  Expect = 5e-28, Method: Composition-based stats.
 Identities = 56/116 (48%), Positives = 75/116 (65%), Gaps = 0/116 (0%)
 Frame = -2

Query  350   KVLSGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAI  171
             +++S HSDGTIK W        L  ETREH KAVT L +  S +K YSGSLDRT+RVWAI
Sbjct  1212  RLISSHSDGTIKVWETGKRNPRLNHETREHSKAVTCLYVSSSCDKLYSGSLDRTIRVWAI  1271

Query  170   SNEGIRCEQVHEIKDHVNNLVVSESLSCFIPQGAGIKVHSWCGEFKLVNQAKHARC  3
             + E I C QVH++K+ V  L+ +   +CF  Q  G+KV++W G  K +N  K+ +C
Sbjct  1272  NQEEIHCLQVHDVKEPVLELIANTHFACFTSQSTGVKVYNWSGVPKHINFQKYVKC  1327



>ref|XP_010319715.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN-1 isoform 
X1 [Solanum lycopersicum]
 ref|XP_010319716.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN-1 isoform 
X1 [Solanum lycopersicum]
 ref|XP_010319717.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN-1 isoform 
X1 [Solanum lycopersicum]
Length=1483

 Score =   119 bits (297),  Expect = 5e-28, Method: Composition-based stats.
 Identities = 56/116 (48%), Positives = 75/116 (65%), Gaps = 0/116 (0%)
 Frame = -2

Query  350   KVLSGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAI  171
             +++S HSDGTIK W        L  ETREH KAVT L +  S +K YSGSLDRT+RVWAI
Sbjct  1213  RLISSHSDGTIKVWETGKRNPRLNHETREHSKAVTCLYVSSSCDKLYSGSLDRTIRVWAI  1272

Query  170   SNEGIRCEQVHEIKDHVNNLVVSESLSCFIPQGAGIKVHSWCGEFKLVNQAKHARC  3
             + E I C QVH++K+ V  L+ +   +CF  Q  G+KV++W G  K +N  K+ +C
Sbjct  1273  NQEEIHCLQVHDVKEPVLELIANTHFACFTSQSTGVKVYNWSGVPKHINFQKYVKC  1328



>gb|EYU38802.1| hypothetical protein MIMGU_mgv1a023448mg [Erythranthe guttata]
Length=1225

 Score =   119 bits (297),  Expect = 5e-28, Method: Composition-based stats.
 Identities = 55/116 (47%), Positives = 76/116 (66%), Gaps = 0/116 (0%)
 Frame = -2

Query  350   KVLSGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAI  171
             +++S HSDGTIK W        L+QE REH KAVT L +  S +K YSGSLD+T+RVW+I
Sbjct  954   RLISSHSDGTIKVWDTAKRAPRLIQEAREHSKAVTCLYVTPSCDKLYSGSLDKTIRVWSI  1013

Query  170   SNEGIRCEQVHEIKDHVNNLVVSESLSCFIPQGAGIKVHSWCGEFKLVNQAKHARC  3
               E I C QVH++++ V  L  + S++CF  QG G+KV++W G  K +   K A+C
Sbjct  1014  KQEEIYCIQVHDVREAVLALAANASVACFSSQGNGVKVYNWSGIVKNIGFNKQAKC  1069



>emb|CDP07391.1| unnamed protein product [Coffea canephora]
Length=1488

 Score =   118 bits (296),  Expect = 7e-28, Method: Composition-based stats.
 Identities = 52/116 (45%), Positives = 78/116 (67%), Gaps = 0/116 (0%)
 Frame = -2

Query  350   KVLSGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAI  171
             +++S HSDGT+K W +   +  L+QE REH KAV+ L +  S  K +SGSLD+T+RVWAI
Sbjct  1218  RLISSHSDGTMKVWDIGKKIPRLIQEVREHSKAVSCLCLSSSGTKVFSGSLDKTIRVWAI  1277

Query  170   SNEGIRCEQVHEIKDHVNNLVVSESLSCFIPQGAGIKVHSWCGEFKLVNQAKHARC  3
                 I+C QVH++K+ V  L  + + +CF  QG G+KV++W G  + VN +K+ +C
Sbjct  1278  KQAEIQCVQVHDVKEAVLELYANSNFACFSSQGTGLKVYNWSGIPRHVNFSKNVKC  1333



>ref|XP_010920190.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN-1 [Elaeis 
guineensis]
Length=1550

 Score =   117 bits (292),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 58/116 (50%), Positives = 72/116 (62%), Gaps = 0/116 (0%)
 Frame = -2

Query  350   KVLSGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAI  171
             ++ S HSDGTIK W     VL L+QE R H KAVT L I  S +K YSGS D+T+RVWAI
Sbjct  1280  RLFSSHSDGTIKVWETGRRVLKLIQEVRAHSKAVTCLYIPSSGDKLYSGSHDKTIRVWAI  1339

Query  170   SNEGIRCEQVHEIKDHVNNLVVSESLSCFIPQGAGIKVHSWCGEFKLVNQAKHARC  3
               + I   Q+H+ KD VN L  + +L CF  QG G KV+ W G  K VN  K+ +C
Sbjct  1340  RPDEIHPVQIHDTKDTVNCLAANANLLCFTSQGTGAKVYDWNGSPKHVNFNKNVKC  1395



>ref|XP_008788369.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN isoform X2 
[Phoenix dactylifera]
Length=1520

 Score =   116 bits (291),  Expect = 3e-27, Method: Composition-based stats.
 Identities = 59/115 (51%), Positives = 71/115 (62%), Gaps = 0/115 (0%)
 Frame = -2

Query  347   VLSGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAIS  168
             + S HSDGTIK W     VL L+QE   H KAVT L I  S +K YSGS D+T+RVWAI 
Sbjct  1251  LFSSHSDGTIKVWETGRRVLKLIQEVHAHSKAVTCLYIPPSGDKLYSGSHDKTIRVWAIG  1310

Query  167   NEGIRCEQVHEIKDHVNNLVVSESLSCFIPQGAGIKVHSWCGEFKLVNQAKHARC  3
              + IR  QVH+ KD VN L  + +L CF  QG G KV+ W G  K VN  K+ +C
Sbjct  1311  PDKIRPVQVHDTKDTVNCLAANANLLCFTSQGTGAKVYDWNGSPKHVNFNKNVKC  1365



>ref|XP_008788367.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN isoform X1 
[Phoenix dactylifera]
 ref|XP_008788368.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN isoform X1 
[Phoenix dactylifera]
Length=1552

 Score =   116 bits (291),  Expect = 3e-27, Method: Composition-based stats.
 Identities = 59/115 (51%), Positives = 71/115 (62%), Gaps = 0/115 (0%)
 Frame = -2

Query  347   VLSGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAIS  168
             + S HSDGTIK W     VL L+QE   H KAVT L I  S +K YSGS D+T+RVWAI 
Sbjct  1283  LFSSHSDGTIKVWETGRRVLKLIQEVHAHSKAVTCLYIPPSGDKLYSGSHDKTIRVWAIG  1342

Query  167   NEGIRCEQVHEIKDHVNNLVVSESLSCFIPQGAGIKVHSWCGEFKLVNQAKHARC  3
              + IR  QVH+ KD VN L  + +L CF  QG G KV+ W G  K VN  K+ +C
Sbjct  1343  PDKIRPVQVHDTKDTVNCLAANANLLCFTSQGTGAKVYDWNGSPKHVNFNKNVKC  1397



>ref|XP_006645675.1| PREDICTED: LOW QUALITY PROTEIN: putative E3 ubiquitin-protein 
ligase LIN-like [Oryza brachyantha]
Length=1245

 Score =   116 bits (290),  Expect = 3e-27, Method: Composition-based stats.
 Identities = 61/115 (53%), Positives = 83/115 (72%), Gaps = 2/115 (2%)
 Frame = -2

Query  347   VLSGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAIS  168
             + SGHSDGT+K W     +L LV E++EH KA+TSLA+L S EK +SGSLDRT+RVW + 
Sbjct  976   IFSGHSDGTLKVWGGSESILRLVSESQEHTKAITSLAVLPSEEKLFSGSLDRTIRVWQLR  1035

Query  167   NEGIRCEQVHEIKDHVNNLVVSESLSCFIPQGAGIKVHSW-CGEFKLVNQAKHAR  6
             +  +RC +VH+ KD V NL V+ +++CF PQGAG+KV SW  G  K++N +K  R
Sbjct  1036  DT-LRCVEVHDTKDAVQNLAVAAAMACFAPQGAGVKVLSWNGGNSKVLNTSKVVR  1089



>gb|KHN37909.1| Putative E3 ubiquitin-protein ligase LIN-1 [Glycine soja]
Length=1479

 Score =   114 bits (285),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 54/116 (47%), Positives = 78/116 (67%), Gaps = 4/116 (3%)
 Frame = -2

Query  350   KVLSGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAI  171
             +VLSGHSDGTIK W  +  +  ++QET EH KAVTSL    S ++ YSGSLD+T+RVW +
Sbjct  1214  QVLSGHSDGTIKVWDARKRIPRVIQETHEHTKAVTSLC--SSDDRLYSGSLDKTIRVWTV  1271

Query  170   SNEGIRCEQVHEIKDHVNNLVVSESLSCFIPQGAGIKVHSWCGEFKLVNQAKHARC  3
               + I+C  VH++K+ V  L V+  L+C++ QG+G  V +W    KL+N  K+ +C
Sbjct  1272  KPDEIKCIDVHDVKEPVYELTVNAKLACYVSQGSG--VFNWSEAPKLINFNKYVKC  1325



>gb|KCW67972.1| hypothetical protein EUGRSUZ_F016653, partial [Eucalyptus grandis]
Length=259

 Score =   108 bits (271),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 51/97 (53%), Positives = 65/97 (67%), Gaps = 0/97 (0%)
 Frame = -2

Query  350  KVLSGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAI  171
            ++LS HSDGTIK W     VL L+QE REH KAVT L +  S ++ YSGSLD+T+RVW I
Sbjct  163  QLLSSHSDGTIKVWDAGKRVLRLIQEVREHTKAVTCLYVPPSGDRLYSGSLDKTIRVWVI  222

Query  170  SNEGIRCEQVHEIKDHVNNLVVSESLSCFIPQGAGIK  60
              E I C QVH++K+ V  L  +   +CFI QG G+K
Sbjct  223  KPEEIHCLQVHDVKEPVYELTTNAHAACFISQGTGVK  259



>ref|NP_001042489.1| Os01g0229700 [Oryza sativa Japonica Group]
 dbj|BAD81324.1| hypothetical protein [Oryza sativa Japonica Group]
 dbj|BAF04403.1| Os01g0229700 [Oryza sativa Japonica Group]
Length=1392

 Score =   112 bits (281),  Expect = 6e-26, Method: Composition-based stats.
 Identities = 59/116 (51%), Positives = 83/116 (72%), Gaps = 3/116 (3%)
 Frame = -2

Query  347   VLSGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAIS  168
             + SGHSDGT+K W     +L LV E++EH KA+TSLA+L S EK +SGSLDRT+RVW + 
Sbjct  1120  IFSGHSDGTLKVWEGSENILRLVHESQEHTKAITSLAVLHSEEKLFSGSLDRTIRVWQL-  1178

Query  167   NEGIRCEQVHEIKDHVNNLVVSESLSCFIPQGAGIKVHSW--CGEFKLVNQAKHAR  6
              + +RC +VH+ KD V +L V+ +++CF PQG+G+KV SW   G  K++N +K  R
Sbjct  1179  RDALRCVEVHDAKDPVQSLAVAAAMACFAPQGSGVKVLSWNNGGGAKVLNASKVVR  1234



>gb|EEE54168.1| hypothetical protein OsJ_00982 [Oryza sativa Japonica Group]
Length=1152

 Score =   112 bits (280),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 59/116 (51%), Positives = 83/116 (72%), Gaps = 3/116 (3%)
 Frame = -2

Query  347  VLSGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAIS  168
            + SGHSDGT+K W     +L LV E++EH KA+TSLA+L S EK +SGSLDRT+RVW + 
Sbjct  880  IFSGHSDGTLKVWEGSENILRLVHESQEHTKAITSLAVLHSEEKLFSGSLDRTIRVWQL-  938

Query  167  NEGIRCEQVHEIKDHVNNLVVSESLSCFIPQGAGIKVHSW--CGEFKLVNQAKHAR  6
             + +RC +VH+ KD V +L V+ +++CF PQG+G+KV SW   G  K++N +K  R
Sbjct  939  RDALRCVEVHDAKDPVQSLAVAAAMACFAPQGSGVKVLSWNNGGGAKVLNASKVVR  994



>ref|XP_010064564.1| PREDICTED: LOW QUALITY PROTEIN: putative E3 ubiquitin-protein 
ligase LIN-1 [Eucalyptus grandis]
Length=1429

 Score =   112 bits (279),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 53/102 (52%), Positives = 68/102 (67%), Gaps = 2/102 (2%)
 Frame = -2

Query  350   KVLSGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAI  171
             ++LS HSDGTIK W     VL L+QE REH KAVT L +  S ++ YSGSLD+T+RVW I
Sbjct  1221  QLLSSHSDGTIKVWDAGKRVLRLIQEVREHTKAVTCLYVPPSGDRLYSGSLDKTIRVWVI  1280

Query  170   SNEGIRCEQVHEIKDHVNNLVVSESLSCFIPQGAGIK--VHS  51
               E I C QVH++K+ V  L  +   +CFI QG G+K  +HS
Sbjct  1281  KPEEIHCLQVHDVKEPVYELTTNAHAACFISQGTGVKKTIHS  1322



>gb|EEC70236.1| hypothetical protein OsI_01010 [Oryza sativa Indica Group]
Length=927

 Score =   111 bits (277),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 59/116 (51%), Positives = 83/116 (72%), Gaps = 3/116 (3%)
 Frame = -2

Query  347  VLSGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAIS  168
            + SGHSDGT+K W     +L LV E++EH KA+TSLA+L S EK +SGSLDRT+RVW + 
Sbjct  656  IFSGHSDGTLKVWEGSENILRLVHESQEHTKAITSLAVLHSEEKLFSGSLDRTIRVWQL-  714

Query  167  NEGIRCEQVHEIKDHVNNLVVSESLSCFIPQGAGIKVHSWC--GEFKLVNQAKHAR  6
             + +RC +VH+ KD V +L V+ +++CF PQG+G+KV SW   G  K++N +K  R
Sbjct  715  RDALRCVEVHDAKDPVQSLAVAAAMACFAPQGSGVKVLSWNNGGGAKVLNASKVVR  770



>ref|XP_002510542.1| hypothetical protein RCOM_1598060 [Ricinus communis]
 gb|EEF52729.1| hypothetical protein RCOM_1598060 [Ricinus communis]
Length=1427

 Score =   110 bits (276),  Expect = 3e-25, Method: Composition-based stats.
 Identities = 54/119 (45%), Positives = 74/119 (62%), Gaps = 4/119 (3%)
 Frame = -2

Query  350   KVLSGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAI  171
             +V+S HSDGTIK W     VL L+QE REH KAVT + +    +K YSGSLD+T+RVW I
Sbjct  1153  RVISSHSDGTIKVWDAGKRVLRLIQEVREHTKAVTCICVPSFGDKLYSGSLDKTIRVWVI  1212

Query  170   SNEGIRCEQVHEIKDHVNNLVVSESLSCFIPQGAGIK----VHSWCGEFKLVNQAKHAR  6
               E I C QVH++K+ V  L  +  ++CF  QG G+K    +++W G  K V   K+ +
Sbjct  1213  KPEEIHCVQVHDVKEAVFGLTANAKVACFTSQGTGVKASAPIYNWSGIPKHVTFNKNVK  1271



>sp|D1FP57.1|LIN2_LOTJA RecName: Full=Putative E3 ubiquitin-protein ligase LIN-2; Short=LjLIN 
[Lotus japonicus]
 gb|ACL14423.1| putative E3 ubiquitin ligase [Lotus japonicus]
Length=1485

 Score =   107 bits (266),  Expect = 6e-24, Method: Composition-based stats.
 Identities = 50/115 (43%), Positives = 77/115 (67%), Gaps = 2/115 (2%)
 Frame = -2

Query  350   KVLSGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAI  171
             +VLSG  DGT K    +  +  ++QET EH KAVTSL    S ++ YS SLD+T+RVW I
Sbjct  1218  QVLSGLMDGTSKVCDARKRIPRVIQETHEHTKAVTSLC--SSGDRLYSASLDKTIRVWTI  1275

Query  170   SNEGIRCEQVHEIKDHVNNLVVSESLSCFIPQGAGIKVHSWCGEFKLVNQAKHAR  6
              ++GI+C  V++IK+ V+ L  ++ L+C++ QG G+KV +W    KL+N +K+ +
Sbjct  1276  KSDGIKCIDVYDIKEAVHELAANDKLACYVSQGTGVKVFNWSEAPKLINFSKYVK  1330



>gb|ACL14424.1| putative E3 ubiquitin ligase [Lotus japonicus]
Length=1485

 Score =   105 bits (261),  Expect = 3e-23, Method: Composition-based stats.
 Identities = 49/115 (43%), Positives = 77/115 (67%), Gaps = 2/115 (2%)
 Frame = -2

Query  350   KVLSGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAI  171
             +VLSG  DGT K    +  +  ++QET EH KAVTSL    S ++ YS SL++T+RVW I
Sbjct  1218  QVLSGLMDGTSKVCDARKRIPRVIQETHEHTKAVTSLC--SSGDRLYSASLNKTIRVWTI  1275

Query  170   SNEGIRCEQVHEIKDHVNNLVVSESLSCFIPQGAGIKVHSWCGEFKLVNQAKHAR  6
              ++GI+C  V++IK+ V+ L  ++ L+C++ QG G+KV +W    KL+N +K+ +
Sbjct  1276  KSDGIKCIDVYDIKEAVHELAANDKLACYVSQGTGVKVFNWSEAPKLINFSKYVK  1330



>ref|XP_002988129.1| hypothetical protein SELMODRAFT_426843 [Selaginella moellendorffii]
 gb|EFJ10921.1| hypothetical protein SELMODRAFT_426843 [Selaginella moellendorffii]
Length=1405

 Score =   101 bits (251),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 52/117 (44%), Positives = 72/117 (62%), Gaps = 1/117 (1%)
 Frame = -2

Query  350   KVLSGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAI  171
             ++ SGHSDG+I+ W  K  V  L+    +H KAVTSLA+  S+ + YS SLDRT+RVWAI
Sbjct  1141  RLFSGHSDGSIQVWETKKKVPTLLLVLTDHSKAVTSLALSSSSNRLYSASLDRTVRVWAI  1200

Query  170   SNEGIRCEQVHEIKDHVNNLVVS-ESLSCFIPQGAGIKVHSWCGEFKLVNQAKHARC  3
             S E + C  V + K+ V  L +S  +++   PQG GIKV +     K +N  KH +C
Sbjct  1201  SPESVLCMNVLDFKEAVGALAISGSTIATATPQGNGIKVQAESNSSKQLNSGKHVQC  1257



>ref|XP_010104461.1| Putative E3 ubiquitin-protein ligase LIN-1 [Morus notabilis]
 gb|EXC00994.1| Putative E3 ubiquitin-protein ligase LIN-1 [Morus notabilis]
Length=1555

 Score = 98.6 bits (244),  Expect = 6e-21, Method: Composition-based stats.
 Identities = 51/116 (44%), Positives = 67/116 (58%), Gaps = 12/116 (10%)
 Frame = -2

Query  350   KVLSGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAI  171
             ++LS HSDGTIK W     V  L+QE REH KAVT L    S +K YSGS D+T+RVWA+
Sbjct  1296  RILSSHSDGTIKVWDSGKRVPRLIQEVREHSKAVTCLYASSSGDKLYSGSSDKTIRVWAV  1355

Query  170   SNEGIRCEQVHEIKDHVNNLVVSESLSCFIPQGAGIKVHSWCGEFKLVNQAKHARC  3
               + I C QVH++K+ V +L             A  KV+ W G  K +N  K+ +C
Sbjct  1356  KADEIHCVQVHDVKEAVFDL------------AANTKVYYWSGSPKHINFNKYVKC  1399



>ref|XP_002972675.1| hypothetical protein SELMODRAFT_413195 [Selaginella moellendorffii]
 gb|EFJ25896.1| hypothetical protein SELMODRAFT_413195 [Selaginella moellendorffii]
Length=1405

 Score = 96.3 bits (238),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 52/117 (44%), Positives = 70/117 (60%), Gaps = 1/117 (1%)
 Frame = -2

Query  350   KVLSGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAI  171
             ++ SGHSDG+I+ W  K  V  L+    +H KAVTSLA+  S+ + YS SLDRT+RVWAI
Sbjct  1141  RLFSGHSDGSIQVWETKKKVPTLLLVLTDHSKAVTSLALSSSSNRLYSASLDRTVRVWAI  1200

Query  170   SNEGIRCEQVHEIKDHVNNLVVSES-LSCFIPQGAGIKVHSWCGEFKLVNQAKHARC  3
             S E + C  V + K+ V  L +S S +     QG GIKV +     K +N  KH +C
Sbjct  1201  SPESVLCMNVLDFKEAVGALAISGSTIVTATAQGNGIKVQAETNSSKQLNSGKHVQC  1257



>gb|KDO66446.1| hypothetical protein CISIN_1g001349mg [Citrus sinensis]
Length=897

 Score = 88.2 bits (217),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 39/57 (68%), Positives = 46/57 (81%), Gaps = 0/57 (0%)
 Frame = -2

Query  350  KVLSGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRV  180
            K+ SGHSDGTIK W+ +G +LHL+Q+ REH KAVT LAILQS E  YSGSLD+T RV
Sbjct  825  KIFSGHSDGTIKVWTGRGSILHLIQQIREHTKAVTGLAILQSGEMLYSGSLDKTARV  881



>ref|XP_010259556.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN-1 [Nelumbo 
nucifera]
Length=1406

 Score = 80.5 bits (197),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 42/116 (36%), Positives = 64/116 (55%), Gaps = 0/116 (0%)
 Frame = -2

Query  350   KVLSGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAI  171
             ++ SG+SDG+IK W +KG    LV + ++H KAVT  A+ +      SGS D+T+RVW I
Sbjct  1138  QLFSGYSDGSIKVWHIKGQRATLVWDIKKHKKAVTCFALFEPGNSLLSGSSDKTIRVWQI  1197

Query  170   SNEGIRCEQVHEIKDHVNNLVVSESLSCFIPQGAGIKVHSWCGEFKLVNQAKHARC  3
                 + C +V E K+ V  +  S  L   + Q  GIKV     + K++   +H +C
Sbjct  1198  IQRKLECVEVIETKEPVCKIDTSGQLIFVLAQSRGIKVFDESRKMKVICNNRHVKC  1253



>ref|XP_002269707.2| PREDICTED: putative E3 ubiquitin-protein ligase LIN-1 isoform 
X2 [Vitis vinifera]
Length=1339

 Score = 79.3 bits (194),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 41/116 (35%), Positives = 64/116 (55%), Gaps = 0/116 (0%)
 Frame = -2

Query  350   KVLSGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAI  171
             ++ SG+SDG+IK W +KG    LV + +EH KAVT  +  +  +   SGS D+T+RVW +
Sbjct  1071  QLCSGYSDGSIKVWDIKGQSATLVLDIKEHRKAVTCFSHFEPGDSLLSGSADKTIRVWQM  1130

Query  170   SNEGIRCEQVHEIKDHVNNLVVSESLSCFIPQGAGIKVHSWCGEFKLVNQAKHARC  3
                 + C +V   K+ V NL     L   +  G G+KV     + K + ++KH +C
Sbjct  1131  VKRKMECTEVISTKEPVQNLDTHGQLIFTVTHGHGVKVFDASRKVKDICKSKHVKC  1186



>emb|CAN65866.1| hypothetical protein VITISV_010257 [Vitis vinifera]
Length=1378

 Score = 79.3 bits (194),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 41/116 (35%), Positives = 64/116 (55%), Gaps = 0/116 (0%)
 Frame = -2

Query  350   KVLSGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAI  171
             ++ SG+SDG+IK W +KG    LV + +EH KAVT  +  +  +   SGS D+T+RVW +
Sbjct  1071  QLCSGYSDGSIKVWDIKGQSATLVLDIKEHRKAVTCFSHFEPGDSLLSGSADKTIRVWQM  1130

Query  170   SNEGIRCEQVHEIKDHVNNLVVSESLSCFIPQGAGIKVHSWCGEFKLVNQAKHARC  3
                 + C +V   K+ V NL     L   +  G G+KV     + K + ++KH +C
Sbjct  1131  VKRKMECTEVISTKEPVQNLDTHGQLIFTVTHGHGVKVFDASRKVKDICKSKHVKC  1186



>ref|XP_010649586.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN-2 isoform 
X1 [Vitis vinifera]
Length=1356

 Score = 79.3 bits (194),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 41/116 (35%), Positives = 64/116 (55%), Gaps = 0/116 (0%)
 Frame = -2

Query  350   KVLSGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAI  171
             ++ SG+SDG+IK W +KG    LV + +EH KAVT  +  +  +   SGS D+T+RVW +
Sbjct  1088  QLCSGYSDGSIKVWDIKGQSATLVLDIKEHRKAVTCFSHFEPGDSLLSGSADKTIRVWQM  1147

Query  170   SNEGIRCEQVHEIKDHVNNLVVSESLSCFIPQGAGIKVHSWCGEFKLVNQAKHARC  3
                 + C +V   K+ V NL     L   +  G G+KV     + K + ++KH +C
Sbjct  1148  VKRKMECTEVISTKEPVQNLDTHGQLIFTVTHGHGVKVFDASRKVKDICKSKHVKC  1203



>emb|CBI23000.3| unnamed protein product [Vitis vinifera]
Length=1274

 Score = 79.3 bits (194),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 41/116 (35%), Positives = 64/116 (55%), Gaps = 0/116 (0%)
 Frame = -2

Query  350   KVLSGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAI  171
             ++ SG+SDG+IK W +KG    LV + +EH KAVT  +  +  +   SGS D+T+RVW +
Sbjct  1006  QLCSGYSDGSIKVWDIKGQSATLVLDIKEHRKAVTCFSHFEPGDSLLSGSADKTIRVWQM  1065

Query  170   SNEGIRCEQVHEIKDHVNNLVVSESLSCFIPQGAGIKVHSWCGEFKLVNQAKHARC  3
                 + C +V   K+ V NL     L   +  G G+KV     + K + ++KH +C
Sbjct  1066  VKRKMECTEVISTKEPVQNLDTHGQLIFTVTHGHGVKVFDASRKVKDICKSKHVKC  1121



>ref|XP_002984593.1| hypothetical protein SELMODRAFT_423775 [Selaginella moellendorffii]
 gb|EFJ14238.1| hypothetical protein SELMODRAFT_423775 [Selaginella moellendorffii]
Length=1211

 Score = 77.4 bits (189),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 44/104 (42%), Positives = 64/104 (62%), Gaps = 5/104 (5%)
 Frame = -2

Query  350   KVLSGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLR----  183
             +V+   + G  ++W +    L L++E  EH K VTSLAIL S  + YSGSLD+T+R    
Sbjct  963   EVMQADTSGNGESWKVAEENLLLLREATEHTKCVTSLAILPSKHRLYSGSLDKTIRVCKT  1022

Query  182   VWAISNEGIRCEQVHEIKDHVNNLVVSESLSCFIPQG-AGIKVH  54
             VW+I ++ + C  V E+   V +LVV+ SL+C I QG  GI+V 
Sbjct  1023  VWSIEDDALHCLHVFELNGGVLSLVVTGSLACIILQGIPGIQVQ  1066



>ref|XP_002978658.1| hypothetical protein SELMODRAFT_418457 [Selaginella moellendorffii]
 gb|EFJ20105.1| hypothetical protein SELMODRAFT_418457 [Selaginella moellendorffii]
Length=1211

 Score = 76.6 bits (187),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 44/104 (42%), Positives = 64/104 (62%), Gaps = 5/104 (5%)
 Frame = -2

Query  350   KVLSGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLR----  183
             +V+   + G  ++W +    L L++E  EH K VTSLAIL S  + YSGSLD+T+R    
Sbjct  963   EVMQADTSGNGESWKVAEENLLLLREATEHTKCVTSLAILPSKHRLYSGSLDKTIRVCKT  1022

Query  182   VWAISNEGIRCEQVHEIKDHVNNLVVSESLSCFIPQG-AGIKVH  54
             VW+I ++ + C  V E+   V +LVV+ SL+C I QG  GI+V 
Sbjct  1023  VWSIEDDTLHCLHVFELNGGVLSLVVTGSLACIILQGIPGIQVQ  1066



>ref|XP_004296849.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN-1-like [Fragaria 
vesca subsp. vesca]
Length=1331

 Score = 76.3 bits (186),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 40/112 (36%), Positives = 65/112 (58%), Gaps = 0/112 (0%)
 Frame = -2

Query  338   GHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAISNEG  159
             G+SDG++K W++KG    LV + +EH KA+T  ++L+S +   SGSLD+T+RVW + ++ 
Sbjct  1067  GYSDGSLKVWNIKGQSATLVWDMKEHKKALTCFSLLESRDSLISGSLDKTIRVWQVVHKK  1126

Query  158   IRCEQVHEIKDHVNNLVVSESLSCFIPQGAGIKVHSWCGEFKLVNQAKHARC  3
             + C +V E K  + +L     +   I +G GIKV     + K     K  +C
Sbjct  1127  MECIEVIETKQPIRHLNTCGDMIFAITRGQGIKVFDASRKVKENCMNKRVKC  1178



>ref|XP_006840583.1| hypothetical protein AMTR_s00045p00231470 [Amborella trichopoda]
 gb|ERN02258.1| hypothetical protein AMTR_s00045p00231470 [Amborella trichopoda]
Length=1290

 Score = 75.5 bits (184),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 41/115 (36%), Positives = 63/115 (55%), Gaps = 0/115 (0%)
 Frame = -2

Query  350   KVLSGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAI  171
             ++ SGHSDG+IK W +K     LVQ  REH KAVT  A+ +  +   SGS D+T+R+W +
Sbjct  1014  QLCSGHSDGSIKVWEIKQKKSKLVQVIREHKKAVTCFALYKPGDSLLSGSTDKTVRIWQM  1073

Query  170   SNEGIRCEQVHEIKDHVNNLVVSESLSCFIPQGAGIKVHSWCGEFKLVNQAKHAR  6
              +  + C  V E+K+ V  +         I   +GIKV    G  K++N+ +  +
Sbjct  1074  VHRNLECIAVVELKESVRKVDAFGKEIFVITHASGIKVCDASGVIKVLNKKRRVQ  1128



>ref|XP_006442167.1| hypothetical protein CICLE_v10024300mg [Citrus clementina]
 gb|ESR55407.1| hypothetical protein CICLE_v10024300mg [Citrus clementina]
Length=1441

 Score = 75.1 bits (183),  Expect = 7e-13, Method: Composition-based stats.
 Identities = 35/58 (60%), Positives = 42/58 (72%), Gaps = 0/58 (0%)
 Frame = -2

Query  350   KVLSGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVW  177
             +VLS HSDGTIK W     VL L+QE REH KAVT L +  S +K YSGSLD+T+RV+
Sbjct  1211  RVLSSHSDGTIKMWDSGKRVLRLIQEVREHTKAVTCLYVPSSGDKLYSGSLDKTIRVY  1268



>ref|XP_009411673.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN-1 {ECO:0000250|UniProtKB:D1FP53} 
[Musa acuminata subsp. malaccensis]
Length=1329

 Score = 74.7 bits (182),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 37/112 (33%), Positives = 63/112 (56%), Gaps = 0/112 (0%)
 Frame = -2

Query  338   GHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAISNEG  159
             GHSDG+IK W +KG    L+ E +EH +A+T  A+ +S +   SGS D+T+R+W ++ + 
Sbjct  1065  GHSDGSIKVWDIKGQKSMLLLEAKEHKRAITCFALSESGDSILSGSSDKTVRIWKMAQKK  1124

Query  158   IRCEQVHEIKDHVNNLVVSESLSCFIPQGAGIKVHSWCGEFKLVNQAKHARC  3
             + C +V E+K+ +  L         I +  G+KV       + + + KH +C
Sbjct  1125  LECVEVIELKEPIQKLETYGGKILVITRSRGLKVCQASRSIQTLCKNKHIKC  1176



>ref|XP_007225317.1| hypothetical protein PRUPE_ppa001127mg [Prunus persica]
 gb|EMJ26516.1| hypothetical protein PRUPE_ppa001127mg [Prunus persica]
Length=902

 Score = 73.6 bits (179),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 40/115 (35%), Positives = 62/115 (54%), Gaps = 0/115 (0%)
 Frame = -2

Query  347  VLSGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAIS  168
            + SGHSDG+IK W++KG    LV + +EH KAVT  ++ +  +   SGSLD+T+RVW + 
Sbjct  635  LYSGHSDGSIKVWNIKGQSATLVWDMKEHKKAVTCFSLFEPGDSLISGSLDKTIRVWQVV  694

Query  167  NEGIRCEQVHEIKDHVNNLVVSESLSCFIPQGAGIKVHSWCGEFKLVNQAKHARC  3
            +  + C +V   K+ + +L            G GIKV     + K   + K  +C
Sbjct  695  HRKLECIEVIATKEPIQHLNTYGQTIFATTNGHGIKVFDASRKVKDNCKNKKVKC  749



>gb|KEH37240.1| E3 ubiquitin-protein ligase LIN-like protein, putative [Medicago 
truncatula]
Length=1149

 Score = 73.6 bits (179),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 37/115 (32%), Positives = 66/115 (57%), Gaps = 0/115 (0%)
 Frame = -2

Query  347  VLSGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAIS  168
            + SG+SDG+IK W ++G    L+ + +EH K+VT  +I +  +   SGS D+T+RVW ++
Sbjct  882  LFSGYSDGSIKVWDIRGHSASLLWDIKEHKKSVTCFSIYEPLDSLLSGSTDKTIRVWKMN  941

Query  167  NEGIRCEQVHEIKDHVNNLVVSESLSCFIPQGAGIKVHSWCGEFKLVNQAKHARC  3
               + C +V  +K+ V++L         I +  GIK+ +   E + + + KH +C
Sbjct  942  QRNLECLEVIVMKEPVHHLRAHGETIFAISEKQGIKLVNKSREIRDIFKGKHGKC  996



>ref|XP_002516937.1| nucleotide binding protein, putative [Ricinus communis]
 gb|EEF45551.1| nucleotide binding protein, putative [Ricinus communis]
Length=1357

 Score = 73.6 bits (179),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 39/116 (34%), Positives = 63/116 (54%), Gaps = 0/116 (0%)
 Frame = -2

Query  350   KVLSGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAI  171
             ++ SG+SDG+IK W +K     LV + +EH KAVT  ++ +  E+  SGS D+T+RVW +
Sbjct  1089  QLYSGYSDGSIKVWDIKHQSATLVWDLKEHKKAVTCFSLFELGERLLSGSADKTIRVWQM  1148

Query  170   SNEGIRCEQVHEIKDHVNNLVVSESLSCFIPQGAGIKVHSWCGEFKLVNQAKHARC  3
              N  + C +V  +K+ +  +         I QG G+KV       K + + K  +C
Sbjct  1149  VNRKLECVEVIAMKEPIQKIETYGQTMFIITQGHGMKVLDSSRTVKDLCKNKKFKC  1204



>ref|XP_010921672.1| PREDICTED: LOW QUALITY PROTEIN: putative E3 ubiquitin-protein 
ligase LIN-1 [Elaeis guineensis]
Length=1327

 Score = 73.2 bits (178),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 37/116 (32%), Positives = 61/116 (53%), Gaps = 0/116 (0%)
 Frame = -2

Query  350   KVLSGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAI  171
             ++ +G+SDG+IK W +KG    LV E ++H + VTS  + +  +   SGS D+T+RVW +
Sbjct  1059  QLCAGYSDGSIKVWDIKGQRTTLVWEVKDHKRPVTSFTLFEPGDSLLSGSSDKTIRVWKM  1118

Query  170   SNEGIRCEQVHEIKDHVNNLVVSESLSCFIPQGAGIKVHSWCGEFKLVNQAKHARC  3
                 + C +V E+KD +  +         I Q  G+KV       +   + KH +C
Sbjct  1119  QQRKLECVEVIEMKDPIQKVESCGDKILAITQSHGLKVCHESRSIQTTCKXKHYKC  1174



>ref|XP_008223230.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN-1 [Prunus 
mume]
Length=1304

 Score = 72.8 bits (177),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 38/97 (39%), Positives = 55/97 (57%), Gaps = 0/97 (0%)
 Frame = -2

Query  347   VLSGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAIS  168
             + SGHSDG+IK WS+KG    LV + +EH KAVT  ++ +  +   SGSLD+T+RVW + 
Sbjct  1047  LYSGHSDGSIKVWSIKGQSATLVWDMKEHKKAVTCFSLFEPGDNLISGSLDKTIRVWQVV  1106

Query  167   NEGIRCEQVHEIKDHVNNLVVSESLSCFIPQGAGIKV  57
             +  + C +V   K  + +L            G GIKV
Sbjct  1107  HRKLECIEVIATKGPIQHLNTYGQTIFATTNGHGIKV  1143



>ref|XP_006342809.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN-like isoform 
X2 [Solanum tuberosum]
Length=1061

 Score = 72.4 bits (176),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 39/116 (34%), Positives = 61/116 (53%), Gaps = 0/116 (0%)
 Frame = -2

Query  350  KVLSGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAI  171
            ++ SGH+DG+IKAW +KG    LV++ REH KAVT  +I +S     SGS D+T+++W +
Sbjct  793  ELYSGHTDGSIKAWDIKGQEATLVRDVREHKKAVTCFSISESGNCLLSGSADKTIKIWQM  852

Query  170  SNEGIRCEQVHEIKDHVNNLVVSESLSCFIPQGAGIKVHSWCGEFKLVNQAKHARC  3
                + C +    KD + N+     L   + Q   +KV     +     + K  RC
Sbjct  853  FERKLECTETILTKDPIQNINTHGELIFAVTQSHKMKVFDGSRKASKYFKNKSIRC  908



>ref|XP_009352279.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN-1 isoform 
X1 [Pyrus x bretschneideri]
Length=1287

 Score = 72.4 bits (176),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 40/113 (35%), Positives = 63/113 (56%), Gaps = 0/113 (0%)
 Frame = -2

Query  341   SGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAISNE  162
             SG+SDG+IK W++KG    LV + +EH KAVT  ++++  +   SGSLD+T+RVW + + 
Sbjct  1022  SGYSDGSIKVWNIKGQSATLVWDVKEHKKAVTCFSLVEPGDSLISGSLDKTIRVWQVVHR  1081

Query  161   GIRCEQVHEIKDHVNNLVVSESLSCFIPQGAGIKVHSWCGEFKLVNQAKHARC  3
              + C +V   K  V +L     +      G GIKV     + K   ++K  +C
Sbjct  1082  KLECIEVIAAKKPVQHLNTHGQMIFATTNGHGIKVFDASRKAKNNCKSKRVKC  1134



>ref|XP_009352280.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN-1 isoform 
X2 [Pyrus x bretschneideri]
Length=1286

 Score = 72.4 bits (176),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 40/113 (35%), Positives = 63/113 (56%), Gaps = 0/113 (0%)
 Frame = -2

Query  341   SGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAISNE  162
             SG+SDG+IK W++KG    LV + +EH KAVT  ++++  +   SGSLD+T+RVW + + 
Sbjct  1021  SGYSDGSIKVWNIKGQSATLVWDVKEHKKAVTCFSLVEPGDSLISGSLDKTIRVWQVVHR  1080

Query  161   GIRCEQVHEIKDHVNNLVVSESLSCFIPQGAGIKVHSWCGEFKLVNQAKHARC  3
              + C +V   K  V +L     +      G GIKV     + K   ++K  +C
Sbjct  1081  KLECIEVIAAKKPVQHLNTHGQMIFATTNGHGIKVFDASRKAKNNCKSKRVKC  1133



>ref|XP_009352281.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN-1 isoform 
X3 [Pyrus x bretschneideri]
Length=1281

 Score = 72.4 bits (176),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 40/113 (35%), Positives = 63/113 (56%), Gaps = 0/113 (0%)
 Frame = -2

Query  341   SGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAISNE  162
             SG+SDG+IK W++KG    LV + +EH KAVT  ++++  +   SGSLD+T+RVW + + 
Sbjct  1016  SGYSDGSIKVWNIKGQSATLVWDVKEHKKAVTCFSLVEPGDSLISGSLDKTIRVWQVVHR  1075

Query  161   GIRCEQVHEIKDHVNNLVVSESLSCFIPQGAGIKVHSWCGEFKLVNQAKHARC  3
              + C +V   K  V +L     +      G GIKV     + K   ++K  +C
Sbjct  1076  KLECIEVIAAKKPVQHLNTHGQMIFATTNGHGIKVFDASRKAKNNCKSKRVKC  1128



>ref|XP_006342808.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN-like isoform 
X1 [Solanum tuberosum]
Length=1318

 Score = 72.4 bits (176),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 39/116 (34%), Positives = 61/116 (53%), Gaps = 0/116 (0%)
 Frame = -2

Query  350   KVLSGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAI  171
             ++ SGH+DG+IKAW +KG    LV++ REH KAVT  +I +S     SGS D+T+++W +
Sbjct  1050  ELYSGHTDGSIKAWDIKGQEATLVRDVREHKKAVTCFSISESGNCLLSGSADKTIKIWQM  1109

Query  170   SNEGIRCEQVHEIKDHVNNLVVSESLSCFIPQGAGIKVHSWCGEFKLVNQAKHARC  3
                 + C +    KD + N+     L   + Q   +KV     +     + K  RC
Sbjct  1110  FERKLECTETILTKDPIQNINTHGELIFAVTQSHKMKVFDGSRKASKYFKNKSIRC  1165



>ref|XP_010938388.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN-1 [Elaeis 
guineensis]
Length=1382

 Score = 72.4 bits (176),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 35/116 (30%), Positives = 59/116 (51%), Gaps = 0/116 (0%)
 Frame = -2

Query  350   KVLSGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAI  171
             ++ +G+SDG+IK W +KG     V E +EH + VT   + +  +   SGS D+T+RVW +
Sbjct  1114  QLCAGYSDGSIKVWDIKGQRAMFVLEVKEHKRPVTCFTLFEPGDSLLSGSFDKTVRVWKM  1173

Query  170   SNEGIRCEQVHEIKDHVNNLVVSESLSCFIPQGAGIKVHSWCGEFKLVNQAKHARC  3
                 + C +V E+KD +  +         + Q  G+KV       +   + KH +C
Sbjct  1174  IQRKLECVEVIEMKDPIQKVDSCGDKILIVTQSNGLKVCHASRSIQTTCKNKHVKC  1229



>ref|XP_008390650.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN-1 isoform 
X2 [Malus domestica]
Length=1281

 Score = 72.0 bits (175),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 40/113 (35%), Positives = 62/113 (55%), Gaps = 0/113 (0%)
 Frame = -2

Query  341   SGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAISNE  162
             SG+SDG+IK W++KG    LV + +EH KAVT  ++++  +   SGSLD+T+RVW + + 
Sbjct  1016  SGYSDGSIKVWNIKGQSATLVWDVKEHKKAVTCFSLVEPGDSLISGSLDKTIRVWQVVHR  1075

Query  161   GIRCEQVHEIKDHVNNLVVSESLSCFIPQGAGIKVHSWCGEFKLVNQAKHARC  3
              + C +V   K  V +L            G GIKV     + K   ++K  +C
Sbjct  1076  KLECIEVISAKKPVQHLNTHGRTIFATTNGHGIKVFDASRKAKYNCKSKKVKC  1128



>ref|XP_008390649.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN-1 isoform 
X1 [Malus domestica]
Length=1287

 Score = 72.0 bits (175),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 40/113 (35%), Positives = 62/113 (55%), Gaps = 0/113 (0%)
 Frame = -2

Query  341   SGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAISNE  162
             SG+SDG+IK W++KG    LV + +EH KAVT  ++++  +   SGSLD+T+RVW + + 
Sbjct  1022  SGYSDGSIKVWNIKGQSATLVWDVKEHKKAVTCFSLVEPGDSLISGSLDKTIRVWQVVHR  1081

Query  161   GIRCEQVHEIKDHVNNLVVSESLSCFIPQGAGIKVHSWCGEFKLVNQAKHARC  3
              + C +V   K  V +L            G GIKV     + K   ++K  +C
Sbjct  1082  KLECIEVISAKKPVQHLNTHGRTIFATTNGHGIKVFDASRKAKYNCKSKKVKC  1134



>ref|XP_010039822.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN-1 isoform 
X1 [Eucalyptus grandis]
Length=1406

 Score = 71.6 bits (174),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 37/95 (39%), Positives = 52/95 (55%), Gaps = 0/95 (0%)
 Frame = -2

Query  341   SGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAISNE  162
             SGHSDG+IK W +KG    L  + +EH K VT  ++L+  E   SGS D+T+RVW +   
Sbjct  1082  SGHSDGSIKMWDVKGQFATLAWDKKEHKKEVTCFSLLEQGESLLSGSADKTIRVWKMVQR  1141

Query  161   GIRCEQVHEIKDHVNNLVVSESLSCFIPQGAGIKV  57
              + C +V  +KD +  +         I  G GIKV
Sbjct  1142  KLECLEVISLKDRIRKIDTLGDAIVAIILGHGIKV  1176



>ref|XP_010039827.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN-1 isoform 
X2 [Eucalyptus grandis]
 gb|KCW84796.1| hypothetical protein EUGRSUZ_B01598 [Eucalyptus grandis]
Length=1347

 Score = 71.6 bits (174),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 37/95 (39%), Positives = 52/95 (55%), Gaps = 0/95 (0%)
 Frame = -2

Query  341   SGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAISNE  162
             SGHSDG+IK W +KG    L  + +EH K VT  ++L+  E   SGS D+T+RVW +   
Sbjct  1082  SGHSDGSIKMWDVKGQFATLAWDKKEHKKEVTCFSLLEQGESLLSGSADKTIRVWKMVQR  1141

Query  161   GIRCEQVHEIKDHVNNLVVSESLSCFIPQGAGIKV  57
              + C +V  +KD +  +         I  G GIKV
Sbjct  1142  KLECLEVISLKDRIRKIDTLGDAIVAIILGHGIKV  1176



>ref|XP_004134218.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN-1-like [Cucumis 
sativus]
 gb|KGN57123.1| hypothetical protein Csa_3G159430 [Cucumis sativus]
Length=1339

 Score = 70.9 bits (172),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 38/115 (33%), Positives = 66/115 (57%), Gaps = 0/115 (0%)
 Frame = -2

Query  347   VLSGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAIS  168
             +  G+SDG+IK W++KG    L+ + ++H KAVT  A  +S E   SGS D+T+RVW + 
Sbjct  1071  LFGGYSDGSIKVWNIKGQSASLLWDIKKHRKAVTCFAHFESGESLLSGSADKTIRVWKMI  1130

Query  167   NEGIRCEQVHEIKDHVNNLVVSESLSCFIPQGAGIKVHSWCGEFKLVNQAKHARC  3
             +  + C +V E K+ + +L     +   +  G G+KV       K++ ++K+ +C
Sbjct  1131  HGRLECIEVIESKEQIQHLGAYGQIIFAVTHGYGLKVIDASRTTKVLFKSKNLKC  1185



>ref|XP_004164710.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN-1-like, partial 
[Cucumis sativus]
Length=1313

 Score = 70.9 bits (172),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 38/115 (33%), Positives = 66/115 (57%), Gaps = 0/115 (0%)
 Frame = -2

Query  347   VLSGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAIS  168
             +  G+SDG+IK W++KG    L+ + ++H KAVT  A  +S E   SGS D+T+RVW + 
Sbjct  1050  LFGGYSDGSIKVWNIKGQSASLLWDIKKHRKAVTCFAHFESGESLLSGSADKTIRVWKMI  1109

Query  167   NEGIRCEQVHEIKDHVNNLVVSESLSCFIPQGAGIKVHSWCGEFKLVNQAKHARC  3
             +  + C +V E K+ + +L     +   +  G G+KV       K++ ++K+ +C
Sbjct  1110  HGRLECIEVIESKEQIQHLGAYGQIIFAVTHGYGLKVIDASRTTKVLFKSKNLKC  1164



>ref|XP_009787386.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN isoform X2 
[Nicotiana sylvestris]
Length=1336

 Score = 70.9 bits (172),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 39/116 (34%), Positives = 59/116 (51%), Gaps = 0/116 (0%)
 Frame = -2

Query  350   KVLSGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAI  171
             ++ SGH+DG+IKAW +KG    LV++ +EH KAVT   I +S     SGS D+T+++W +
Sbjct  1068  QLYSGHADGSIKAWDIKGQAATLVRDVKEHKKAVTCFTISESGNCLLSGSADKTVKIWQM  1127

Query  170   SNEGIRCEQVHEIKDHVNNLVVSESLSCFIPQGAGIKVHSWCGEFKLVNQAKHARC  3
                 + C +    KD + N+     L   I Q   +KV     +       K  RC
Sbjct  1128  LERNLECVETILAKDPIQNINTHGELIFAITQSHKMKVFDRSRKASKYFTNKSVRC  1183



>ref|XP_009787385.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN isoform X1 
[Nicotiana sylvestris]
Length=1337

 Score = 70.9 bits (172),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 39/116 (34%), Positives = 59/116 (51%), Gaps = 0/116 (0%)
 Frame = -2

Query  350   KVLSGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAI  171
             ++ SGH+DG+IKAW +KG    LV++ +EH KAVT   I +S     SGS D+T+++W +
Sbjct  1069  QLYSGHADGSIKAWDIKGQAATLVRDVKEHKKAVTCFTISESGNCLLSGSADKTVKIWQM  1128

Query  170   SNEGIRCEQVHEIKDHVNNLVVSESLSCFIPQGAGIKVHSWCGEFKLVNQAKHARC  3
                 + C +    KD + N+     L   I Q   +KV     +       K  RC
Sbjct  1129  LERNLECVETILAKDPIQNINTHGELIFAITQSHKMKVFDRSRKASKYFTNKSVRC  1184



>ref|XP_002440973.1| hypothetical protein SORBIDRAFT_09g018080 [Sorghum bicolor]
 gb|EES19403.1| hypothetical protein SORBIDRAFT_09g018080 [Sorghum bicolor]
Length=989

 Score = 70.5 bits (171),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 34/115 (30%), Positives = 65/115 (57%), Gaps = 0/115 (0%)
 Frame = -2

Query  350  KVLSGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAI  171
            ++ +G+S+GTI+AW +KG    +++E +EH KAVT  A+ ++ E   SGS D+++RVW +
Sbjct  721  QLFAGYSNGTIRAWDIKGQRAVIIREVKEHKKAVTCFALSETGENLLSGSADKSIRVWEM  780

Query  170  SNEGIRCEQVHEIKDHVNNLVVSESLSCFIPQGAGIKVHSWCGEFKLVNQAKHAR  6
            +   + C ++ +I++ V  L +       + Q    K  S     +   ++KH +
Sbjct  781  AQRKLECVEMIQIREAVQKLDICGDKVLVLAQNNVFKFSSASRSSQTFYRSKHVK  835



>ref|XP_004229247.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN [Solanum 
lycopersicum]
Length=1326

 Score = 70.5 bits (171),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 38/116 (33%), Positives = 60/116 (52%), Gaps = 0/116 (0%)
 Frame = -2

Query  350   KVLSGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAI  171
             ++ SGH+DG+IKAW +KG    LV++ REH KAVT   I +S     SGS D+++++W +
Sbjct  1058  ELYSGHADGSIKAWDIKGQEATLVRDVREHKKAVTCFTISESGNCLLSGSADKSIKIWQM  1117

Query  170   SNEGIRCEQVHEIKDHVNNLVVSESLSCFIPQGAGIKVHSWCGEFKLVNQAKHARC  3
                 + C +    KD + N+     L   + Q   +KV     +     + K  RC
Sbjct  1118  FERKLECTETILTKDPIQNINTHGELIFAVTQSHKMKVFDGSRKASKYFKNKSIRC  1173



>ref|XP_009593979.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN isoform X1 
[Nicotiana tomentosiformis]
Length=1324

 Score = 70.5 bits (171),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 49/80 (61%), Gaps = 0/80 (0%)
 Frame = -2

Query  350   KVLSGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAI  171
             ++ SGH+DG+IKAW +KG    LV++ +EH KAVT  AI +S     SGS D+T ++W +
Sbjct  1056  QLYSGHADGSIKAWDIKGQAATLVRDVKEHKKAVTCFAISESGNCLLSGSADKTAKIWQM  1115

Query  170   SNEGIRCEQVHEIKDHVNNL  111
                 + C +    KD + N+
Sbjct  1116  LERNLECVETILTKDPIQNI  1135



>ref|XP_009593981.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN isoform X2 
[Nicotiana tomentosiformis]
Length=1323

 Score = 70.5 bits (171),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 49/80 (61%), Gaps = 0/80 (0%)
 Frame = -2

Query  350   KVLSGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAI  171
             ++ SGH+DG+IKAW +KG    LV++ +EH KAVT  AI +S     SGS D+T ++W +
Sbjct  1055  QLYSGHADGSIKAWDIKGQAATLVRDVKEHKKAVTCFAISESGNCLLSGSADKTAKIWQM  1114

Query  170   SNEGIRCEQVHEIKDHVNNL  111
                 + C +    KD + N+
Sbjct  1115  LERNLECVETILTKDPIQNI  1134



>ref|XP_008784743.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN-1 [Phoenix 
dactylifera]
Length=1328

 Score = 70.1 bits (170),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 36/116 (31%), Positives = 61/116 (53%), Gaps = 0/116 (0%)
 Frame = -2

Query  350   KVLSGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAI  171
             ++ +G+SDG+IK W +KG    LV E ++H + VT L + +  +   SGS D+T++VW +
Sbjct  1060  QLCAGYSDGSIKVWDIKGQRTMLVWEAKDHKRPVTCLTLFEPGDSLLSGSSDKTVKVWKM  1119

Query  170   SNEGIRCEQVHEIKDHVNNLVVSESLSCFIPQGAGIKVHSWCGEFKLVNQAKHARC  3
                 + C +V E+KD +  +         I Q  G+KV       +   + KH +C
Sbjct  1120  LQRKLECVEVIEMKDPIQKVESCGDKILVITQSHGLKVCHESRSIETTCKKKHVKC  1175



>ref|XP_004487840.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN-1-like [Cicer 
arietinum]
Length=1276

 Score = 69.7 bits (169),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 37/115 (32%), Positives = 63/115 (55%), Gaps = 0/115 (0%)
 Frame = -2

Query  347   VLSGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAIS  168
             + SG+SDG+IK W ++G    LV + +EH K+VT  +I    +   SGS D+T+RVW + 
Sbjct  1008  LFSGYSDGSIKVWDIRGHSASLVWDIKEHKKSVTCFSIYGPLDSLLSGSTDKTIRVWKMI  1067

Query  167   NEGIRCEQVHEIKDHVNNLVVSESLSCFIPQGAGIKVHSWCGEFKLVNQAKHARC  3
                + C +V  +K+ +++L         I +  GIK+ +   E   + + KH +C
Sbjct  1068  QRKLECLEVIVMKEPIHHLRAHGETIFAITEKQGIKLVNNSREISDIFKGKHGKC  1122



>ref|XP_008438896.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN-1 [Cucumis 
melo]
Length=1335

 Score = 69.3 bits (168),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 37/115 (32%), Positives = 65/115 (57%), Gaps = 0/115 (0%)
 Frame = -2

Query  347   VLSGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAIS  168
             +  G+SDG+IK W++KG    L+ + ++H KAVT  +  +S E   SGS D+T+RVW + 
Sbjct  1067  LFGGYSDGSIKVWNIKGQSASLLWDIKKHRKAVTCFSHFESGESLLSGSADKTIRVWKMI  1126

Query  167   NEGIRCEQVHEIKDHVNNLVVSESLSCFIPQGAGIKVHSWCGEFKLVNQAKHARC  3
                + C +V E K+ + +L     +   +  G G+KV       K++ ++K+ +C
Sbjct  1127  QGRLECIEVIESKEQIQHLGAYGQIIFAVTNGHGLKVIDASRTTKVLFKSKNLKC  1181



>ref|XP_006597729.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN-1-like isoform 
X2 [Glycine max]
Length=1302

 Score = 69.3 bits (168),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 35/115 (30%), Positives = 65/115 (57%), Gaps = 0/115 (0%)
 Frame = -2

Query  347   VLSGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAIS  168
             + SG+SDG+IK W ++G    LV + +EH K+VT  ++ + ++   SGS D+T+RVW + 
Sbjct  1035  LFSGYSDGSIKVWDIRGHSASLVWDIKEHKKSVTCFSLYEPSDSLLSGSTDKTIRVWKMI  1094

Query  167   NEGIRCEQVHEIKDHVNNLVVSESLSCFIPQGAGIKVHSWCGEFKLVNQAKHARC  3
                + C +V  +K+ +++L         I +  G+K+ +     K + + KH +C
Sbjct  1095  QRKLECVEVIALKEPIHHLRAHGETIFSISESLGLKLVNESRVTKDILKGKHVKC  1149



>ref|XP_006597730.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN-1-like isoform 
X3 [Glycine max]
Length=1218

 Score = 69.3 bits (168),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 35/115 (30%), Positives = 65/115 (57%), Gaps = 0/115 (0%)
 Frame = -2

Query  347   VLSGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAIS  168
             + SG+SDG+IK W ++G    LV + +EH K+VT  ++ + ++   SGS D+T+RVW + 
Sbjct  951   LFSGYSDGSIKVWDIRGHSASLVWDIKEHKKSVTCFSLYEPSDSLLSGSTDKTIRVWKMI  1010

Query  167   NEGIRCEQVHEIKDHVNNLVVSESLSCFIPQGAGIKVHSWCGEFKLVNQAKHARC  3
                + C +V  +K+ +++L         I +  G+K+ +     K + + KH +C
Sbjct  1011  QRKLECVEVIALKEPIHHLRAHGETIFSISESLGLKLVNESRVTKDILKGKHVKC  1065



>ref|XP_006597728.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN-1-like isoform 
X1 [Glycine max]
Length=1304

 Score = 69.3 bits (168),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 35/115 (30%), Positives = 65/115 (57%), Gaps = 0/115 (0%)
 Frame = -2

Query  347   VLSGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAIS  168
             + SG+SDG+IK W ++G    LV + +EH K+VT  ++ + ++   SGS D+T+RVW + 
Sbjct  1037  LFSGYSDGSIKVWDIRGHSASLVWDIKEHKKSVTCFSLYEPSDSLLSGSTDKTIRVWKMI  1096

Query  167   NEGIRCEQVHEIKDHVNNLVVSESLSCFIPQGAGIKVHSWCGEFKLVNQAKHARC  3
                + C +V  +K+ +++L         I +  G+K+ +     K + + KH +C
Sbjct  1097  QRKLECVEVIALKEPIHHLRAHGETIFSISESLGLKLVNESRVTKDILKGKHVKC  1151



>gb|KHN14614.1| Putative E3 ubiquitin-protein ligase LIN-1 [Glycine soja]
Length=1330

 Score = 69.3 bits (168),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 35/115 (30%), Positives = 65/115 (57%), Gaps = 0/115 (0%)
 Frame = -2

Query  347   VLSGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAIS  168
             + SG+SDG+IK W ++G    LV + +EH K+VT  ++ + ++   SGS D+T+RVW + 
Sbjct  1035  LFSGYSDGSIKVWDIRGHSASLVWDIKEHKKSVTCFSLYEPSDSLLSGSTDKTIRVWKMI  1094

Query  167   NEGIRCEQVHEIKDHVNNLVVSESLSCFIPQGAGIKVHSWCGEFKLVNQAKHARC  3
                + C +V  +K+ +++L         I +  G+K+ +     K + + KH +C
Sbjct  1095  QRKLECVEVIALKEPIHHLRAHGETIFSISESLGLKLVNESRVTKDILKGKHVKC  1149



>ref|XP_006380148.1| transducin family protein [Populus trichocarpa]
 gb|ERP57945.1| transducin family protein [Populus trichocarpa]
Length=1305

 Score = 69.3 bits (168),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 33/98 (34%), Positives = 56/98 (57%), Gaps = 0/98 (0%)
 Frame = -2

Query  347   VLSGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAIS  168
             + SGHSDG+IK W +K     ++ + +EH KAVT  ++ ++ E   SGS D+T+RVW + 
Sbjct  1038  LYSGHSDGSIKVWDIKQQSATIIWDLKEHKKAVTCFSLFEAGESLLSGSSDKTIRVWKMV  1097

Query  167   NEGIRCEQVHEIKDHVNNLVVSESLSCFIPQGAGIKVH  54
                  C +V  +++ +  L   + +   I QG  +KV+
Sbjct  1098  QRKPECTEVIAMEEPIRQLEKYDQMIFVITQGHRMKVY  1135



>ref|XP_011014347.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN-1 isoform 
X1 [Populus euphratica]
Length=1337

 Score = 68.6 bits (166),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 33/98 (34%), Positives = 56/98 (57%), Gaps = 0/98 (0%)
 Frame = -2

Query  347   VLSGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAIS  168
             + SGHSDG+IK W +K     ++ + +EH KAVT  ++ ++ E   SGS D+T+RVW + 
Sbjct  1052  LYSGHSDGSIKVWDIKQQSATVIWDLKEHKKAVTCFSLFEAGESLLSGSSDKTIRVWKMV  1111

Query  167   NEGIRCEQVHEIKDHVNNLVVSESLSCFIPQGAGIKVH  54
                  C +V  +++ +  L   + +   I QG  +KV+
Sbjct  1112  QRKPECTEVIAMEEPIRQLEKYDQMIFVITQGHRMKVY  1149



>ref|XP_011014349.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN-1 isoform 
X3 [Populus euphratica]
Length=1318

 Score = 68.6 bits (166),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 33/98 (34%), Positives = 56/98 (57%), Gaps = 0/98 (0%)
 Frame = -2

Query  347   VLSGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAIS  168
             + SGHSDG+IK W +K     ++ + +EH KAVT  ++ ++ E   SGS D+T+RVW + 
Sbjct  1052  LYSGHSDGSIKVWDIKQQSATVIWDLKEHKKAVTCFSLFEAGESLLSGSSDKTIRVWKMV  1111

Query  167   NEGIRCEQVHEIKDHVNNLVVSESLSCFIPQGAGIKVH  54
                  C +V  +++ +  L   + +   I QG  +KV+
Sbjct  1112  QRKPECTEVIAMEEPIRQLEKYDQMIFVITQGHRMKVY  1149



>ref|XP_011014348.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN-1 isoform 
X2 [Populus euphratica]
Length=1333

 Score = 68.6 bits (166),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 33/98 (34%), Positives = 56/98 (57%), Gaps = 0/98 (0%)
 Frame = -2

Query  347   VLSGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAIS  168
             + SGHSDG+IK W +K     ++ + +EH KAVT  ++ ++ E   SGS D+T+RVW + 
Sbjct  1048  LYSGHSDGSIKVWDIKQQSATVIWDLKEHKKAVTCFSLFEAGESLLSGSSDKTIRVWKMV  1107

Query  167   NEGIRCEQVHEIKDHVNNLVVSESLSCFIPQGAGIKVH  54
                  C +V  +++ +  L   + +   I QG  +KV+
Sbjct  1108  QRKPECTEVIAMEEPIRQLEKYDQMIFVITQGHRMKVY  1145



>ref|XP_004963834.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN-1-like [Setaria 
italica]
Length=1305

 Score = 68.6 bits (166),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 28/80 (35%), Positives = 52/80 (65%), Gaps = 0/80 (0%)
 Frame = -2

Query  350   KVLSGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAI  171
             ++ +G+S+GTI+AW +KG    +++E +EH KAVT   + ++ E   SGS D+++RVW +
Sbjct  1037  QLFAGYSNGTIRAWDIKGQRAVIIREVKEHKKAVTCFTLSETGENLLSGSADKSIRVWEM  1096

Query  170   SNEGIRCEQVHEIKDHVNNL  111
             +   + C +V + ++ V  L
Sbjct  1097  AQRKLECVEVIQTREAVQKL  1116



>ref|XP_010486217.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN-1 [Camelina 
sativa]
Length=1270

 Score = 68.6 bits (166),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 33/97 (34%), Positives = 56/97 (58%), Gaps = 0/97 (0%)
 Frame = -2

Query  347   VLSGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAIS  168
             + SG+SDG+I+ W++   V  L+ + +EH   VT  ++ +S E   SGS D+T+RVW I+
Sbjct  1003  LFSGYSDGSIRVWNVNKKVATLLWDIKEHKSTVTCFSLSESGESVLSGSADKTIRVWQIA  1062

Query  167   NEGIRCEQVHEIKDHVNNLVVSESLSCFIPQGAGIKV  57
                + C +V + KD +  L    ++   I +G  IK+
Sbjct  1063  KGKLECAEVIKTKDSIRRLEAYGNMIIVITKGHKIKL  1099



>gb|KDP27810.1| hypothetical protein JCGZ_18890 [Jatropha curcas]
Length=1317

 Score = 68.2 bits (165),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 34/97 (35%), Positives = 55/97 (57%), Gaps = 0/97 (0%)
 Frame = -2

Query  347   VLSGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAIS  168
             + SG+SDG+IK W  K     L+ + +EH K VT  ++ +  E   SGS D+T+RVW + 
Sbjct  1050  LYSGYSDGSIKVWDFKQQSAALLWDLKEHKKTVTCFSLYEPGESLLSGSADKTIRVWQMV  1109

Query  167   NEGIRCEQVHEIKDHVNNLVVSESLSCFIPQGAGIKV  57
             +  + C +V  +K+ V+ +     +   + QG GIKV
Sbjct  1110  HRKLECIEVISLKEPVHKIETYGQMIFVVAQGHGIKV  1146



>ref|XP_008789861.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN-1 [Phoenix 
dactylifera]
Length=1368

 Score = 68.2 bits (165),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 36/116 (31%), Positives = 59/116 (51%), Gaps = 0/116 (0%)
 Frame = -2

Query  350   KVLSGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAI  171
             ++ +G+SDG+IK W +K     LV E +EH + VT   + +  +   SGS D+T+RVW +
Sbjct  1100  QLCAGYSDGSIKVWGIKRQRAMLVLEVKEHKRPVTCFTLFEPGDSLLSGSSDKTVRVWKM  1159

Query  170   SNEGIRCEQVHEIKDHVNNLVVSESLSCFIPQGAGIKVHSWCGEFKLVNQAKHARC  3
                 + C +V E+KD V  +         + Q  G+KV       +   + KH +C
Sbjct  1160  VQRKLECVEVIEMKDPVQKVDSYGDKILIVTQSCGLKVCHASRCIQTTCKNKHVKC  1215



>ref|XP_011090986.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN-1 isoform 
X2 [Sesamum indicum]
Length=1330

 Score = 67.8 bits (164),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 37/113 (33%), Positives = 60/113 (53%), Gaps = 0/113 (0%)
 Frame = -2

Query  341   SGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAISNE  162
             SG++DG+IK W +KG    LVQE +EH KAVT  A+ +      SGS D+T+++W +   
Sbjct  1066  SGYADGSIKVWDIKGQKAILVQEMKEHKKAVTCFALYEPGNCLLSGSADKTIKMWQMLQR  1125

Query  161   GIRCEQVHEIKDHVNNLVVSESLSCFIPQGAGIKVHSWCGEFKLVNQAKHARC  3
              + C +V   K+ + ++     L     Q   +KV    G+ K + + K  +C
Sbjct  1126  NLECIEVIPTKESIRSIDSWGELIFATTQNHKLKVIDASGKAKDIFKNKRVKC  1178



>ref|XP_011090985.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN-1 isoform 
X1 [Sesamum indicum]
Length=1332

 Score = 67.8 bits (164),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 37/113 (33%), Positives = 60/113 (53%), Gaps = 0/113 (0%)
 Frame = -2

Query  341   SGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAISNE  162
             SG++DG+IK W +KG    LVQE +EH KAVT  A+ +      SGS D+T+++W +   
Sbjct  1068  SGYADGSIKVWDIKGQKAILVQEMKEHKKAVTCFALYEPGNCLLSGSADKTIKMWQMLQR  1127

Query  161   GIRCEQVHEIKDHVNNLVVSESLSCFIPQGAGIKVHSWCGEFKLVNQAKHARC  3
              + C +V   K+ + ++     L     Q   +KV    G+ K + + K  +C
Sbjct  1128  NLECIEVIPTKESIRSIDSWGELIFATTQNHKLKVIDASGKAKDIFKNKRVKC  1180



>gb|KHN26549.1| Putative E3 ubiquitin-protein ligase LIN-1 [Glycine soja]
Length=1301

 Score = 67.8 bits (164),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 35/115 (30%), Positives = 65/115 (57%), Gaps = 0/115 (0%)
 Frame = -2

Query  347   VLSGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAIS  168
             + SG+SDG+IK W ++G    LV + +EH K+VT  ++ + ++   SGS D+T+RVW + 
Sbjct  1034  LFSGYSDGSIKVWDIRGHSASLVWDIKEHKKSVTCFSLHEPSDSLLSGSTDKTIRVWKMI  1093

Query  167   NEGIRCEQVHEIKDHVNNLVVSESLSCFIPQGAGIKVHSWCGEFKLVNQAKHARC  3
                + C +V  +K+ +++L         I +  G+K+ +     K + + KH +C
Sbjct  1094  QRKLECVEVIALKEPIHHLRAHGETIFAISESHGLKLVNESRVTKDILKGKHVKC  1148



>ref|XP_006586921.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN-1-like isoform 
X4 [Glycine max]
Length=1217

 Score = 67.4 bits (163),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 35/115 (30%), Positives = 65/115 (57%), Gaps = 0/115 (0%)
 Frame = -2

Query  347   VLSGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAIS  168
             + SG+SDG+IK W ++G    LV + +EH K+VT  ++ + ++   SGS D+T+RVW + 
Sbjct  950   LFSGYSDGSIKVWDIRGHSASLVWDIKEHKKSVTCFSLHEPSDSLLSGSTDKTIRVWKMI  1009

Query  167   NEGIRCEQVHEIKDHVNNLVVSESLSCFIPQGAGIKVHSWCGEFKLVNQAKHARC  3
                + C +V  +K+ +++L         I +  G+K+ +     K + + KH +C
Sbjct  1010  QRKLECVEVIALKEPIHHLRAHGETIFAISESHGLKLVNESRVTKDILKGKHVKC  1064



>ref|XP_006586920.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN-1-like isoform 
X3 [Glycine max]
Length=1219

 Score = 67.4 bits (163),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 35/115 (30%), Positives = 65/115 (57%), Gaps = 0/115 (0%)
 Frame = -2

Query  347   VLSGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAIS  168
             + SG+SDG+IK W ++G    LV + +EH K+VT  ++ + ++   SGS D+T+RVW + 
Sbjct  952   LFSGYSDGSIKVWDIRGHSASLVWDIKEHKKSVTCFSLHEPSDSLLSGSTDKTIRVWKMI  1011

Query  167   NEGIRCEQVHEIKDHVNNLVVSESLSCFIPQGAGIKVHSWCGEFKLVNQAKHARC  3
                + C +V  +K+ +++L         I +  G+K+ +     K + + KH +C
Sbjct  1012  QRKLECVEVIALKEPIHHLRAHGETIFAISESHGLKLVNESRVTKDILKGKHVKC  1066



>ref|XP_006586918.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN-1-like isoform 
X1 [Glycine max]
Length=1262

 Score = 67.4 bits (163),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 35/115 (30%), Positives = 65/115 (57%), Gaps = 0/115 (0%)
 Frame = -2

Query  347   VLSGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAIS  168
             + SG+SDG+IK W ++G    LV + +EH K+VT  ++ + ++   SGS D+T+RVW + 
Sbjct  995   LFSGYSDGSIKVWDIRGHSASLVWDIKEHKKSVTCFSLHEPSDSLLSGSTDKTIRVWKMI  1054

Query  167   NEGIRCEQVHEIKDHVNNLVVSESLSCFIPQGAGIKVHSWCGEFKLVNQAKHARC  3
                + C +V  +K+ +++L         I +  G+K+ +     K + + KH +C
Sbjct  1055  QRKLECVEVIALKEPIHHLRAHGETIFAISESHGLKLVNESRVTKDILKGKHVKC  1109



>ref|XP_006586919.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN-1-like isoform 
X2 [Glycine max]
Length=1260

 Score = 67.4 bits (163),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 35/115 (30%), Positives = 65/115 (57%), Gaps = 0/115 (0%)
 Frame = -2

Query  347   VLSGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAIS  168
             + SG+SDG+IK W ++G    LV + +EH K+VT  ++ + ++   SGS D+T+RVW + 
Sbjct  993   LFSGYSDGSIKVWDIRGHSASLVWDIKEHKKSVTCFSLHEPSDSLLSGSTDKTIRVWKMI  1052

Query  167   NEGIRCEQVHEIKDHVNNLVVSESLSCFIPQGAGIKVHSWCGEFKLVNQAKHARC  3
                + C +V  +K+ +++L         I +  G+K+ +     K + + KH +C
Sbjct  1053  QRKLECVEVIALKEPIHHLRAHGETIFAISESHGLKLVNESRVTKDILKGKHVKC  1107



>gb|AAV31407.1| unknown protein [Oryza sativa Japonica Group]
Length=550

 Score = 66.6 bits (161),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 28/82 (34%), Positives = 51/82 (62%), Gaps = 0/82 (0%)
 Frame = -2

Query  350  KVLSGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAI  171
            ++  G+S GTI+AW +KG    +++E +EH +AVT  A+  + E   SGS D+++RVW +
Sbjct  72   QLFVGYSSGTIRAWDIKGQRAVVIREVKEHKRAVTCFALSDTGENLLSGSADKSIRVWKM  131

Query  170  SNEGIRCEQVHEIKDHVNNLVV  105
            +   + C +V +I++ V    +
Sbjct  132  AQRKLECVEVIQIREAVEQFEI  153



>gb|AAU10838.1| unknown protein [Oryza sativa Japonica Group]
Length=580

 Score = 66.6 bits (161),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 28/82 (34%), Positives = 51/82 (62%), Gaps = 0/82 (0%)
 Frame = -2

Query  350  KVLSGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAI  171
            ++  G+S GTI+AW +KG    +++E +EH +AVT  A+  + E   SGS D+++RVW +
Sbjct  102  QLFVGYSSGTIRAWDIKGQRAVVIREVKEHKRAVTCFALSDTGENLLSGSADKSIRVWKM  161

Query  170  SNEGIRCEQVHEIKDHVNNLVV  105
            +   + C +V +I++ V    +
Sbjct  162  AQRKLECVEVIQIREAVEQFEI  183



>gb|AFW77650.1| hypothetical protein ZEAMMB73_448999 [Zea mays]
Length=990

 Score = 67.0 bits (162),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 27/82 (33%), Positives = 54/82 (66%), Gaps = 0/82 (0%)
 Frame = -2

Query  350  KVLSGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAI  171
            ++ +G+S+GTI+AW +KG    +++E +EH KAVT  ++ ++ E   SGS D+++RVW +
Sbjct  721  QLFAGYSNGTIRAWDIKGQRAVIIREVKEHKKAVTCFSLSETGENLLSGSADKSIRVWEM  780

Query  170  SNEGIRCEQVHEIKDHVNNLVV  105
            +   + C ++ + ++ V  L +
Sbjct  781  AQRKLECVEMIQTREAVQKLDI  802



>gb|EMS51188.1| Mitochondrial division protein 1 [Triticum urartu]
Length=1122

 Score = 67.0 bits (162),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 52/82 (63%), Gaps = 0/82 (0%)
 Frame = -2

Query  350  KVLSGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAI  171
            ++  G+ +GTI+AW +KG    +++E +EH KAVT  A+ ++ +   SGS D+++RVW +
Sbjct  854  QLFVGYLNGTIRAWDIKGQRAVIIREVKEHKKAVTCFALSETGQNLLSGSADKSIRVWKM  913

Query  170  SNEGIRCEQVHEIKDHVNNLVV  105
            +   + C +V +IK+ V    +
Sbjct  914  AQRKLECVEVFQIKEAVQKFDI  935



>gb|EMT33236.1| hypothetical protein F775_04441 [Aegilops tauschii]
Length=1102

 Score = 67.0 bits (162),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 52/82 (63%), Gaps = 0/82 (0%)
 Frame = -2

Query  350  KVLSGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAI  171
            ++  G+ +GTI+AW +KG    +++E +EH KAVT  A+ ++ +   SGS D+++RVW +
Sbjct  834  QLFVGYFNGTIRAWDIKGQRAVIIREVKEHKKAVTCFALSETGQNLLSGSADKSIRVWKM  893

Query  170  SNEGIRCEQVHEIKDHVNNLVV  105
            +   + C +V +IK+ V    +
Sbjct  894  AQRKLECVEVFQIKEAVQKFDI  915



>gb|AFW77651.1| hypothetical protein ZEAMMB73_448999 [Zea mays]
Length=1014

 Score = 66.6 bits (161),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 27/82 (33%), Positives = 54/82 (66%), Gaps = 0/82 (0%)
 Frame = -2

Query  350  KVLSGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAI  171
            ++ +G+S+GTI+AW +KG    +++E +EH KAVT  ++ ++ E   SGS D+++RVW +
Sbjct  745  QLFAGYSNGTIRAWDIKGQRAVIIREVKEHKKAVTCFSLSETGENLLSGSADKSIRVWEM  804

Query  170  SNEGIRCEQVHEIKDHVNNLVV  105
            +   + C ++ + ++ V  L +
Sbjct  805  AQRKLECVEMIQTREAVQKLDI  826



>ref|XP_008649518.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN-1 isoform 
X2 [Zea mays]
Length=1314

 Score = 66.6 bits (161),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 27/82 (33%), Positives = 54/82 (66%), Gaps = 0/82 (0%)
 Frame = -2

Query  350   KVLSGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAI  171
             ++ +G+S+GTI+AW +KG    +++E +EH KAVT  ++ ++ E   SGS D+++RVW +
Sbjct  1045  QLFAGYSNGTIRAWDIKGQRAVIIREVKEHKKAVTCFSLSETGENLLSGSADKSIRVWEM  1104

Query  170   SNEGIRCEQVHEIKDHVNNLVV  105
             +   + C ++ + ++ V  L +
Sbjct  1105  AQRKLECVEMIQTREAVQKLDI  1126



>ref|XP_008649517.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN-1 isoform 
X1 [Zea mays]
Length=1315

 Score = 66.6 bits (161),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 27/82 (33%), Positives = 54/82 (66%), Gaps = 0/82 (0%)
 Frame = -2

Query  350   KVLSGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAI  171
             ++ +G+S+GTI+AW +KG    +++E +EH KAVT  ++ ++ E   SGS D+++RVW +
Sbjct  1046  QLFAGYSNGTIRAWDIKGQRAVIIREVKEHKKAVTCFSLSETGENLLSGSADKSIRVWEM  1105

Query  170   SNEGIRCEQVHEIKDHVNNLVV  105
             +   + C ++ + ++ V  L +
Sbjct  1106  AQRKLECVEMIQTREAVQKLDI  1127



>ref|XP_007035615.1| Nucleotide binding protein, putative isoform 2 [Theobroma cacao]
 ref|XP_007035616.1| Nucleotide binding protein, putative isoform 2 [Theobroma cacao]
 gb|EOY06541.1| Nucleotide binding protein, putative isoform 2 [Theobroma cacao]
 gb|EOY06542.1| Nucleotide binding protein, putative isoform 2 [Theobroma cacao]
Length=940

 Score = 66.2 bits (160),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 36/115 (31%), Positives = 58/115 (50%), Gaps = 0/115 (0%)
 Frame = -2

Query  347  VLSGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAIS  168
            + SG+SDG+IK W ++     LV +T+EH KAVT  ++ +  E   SGS D+T+ VW + 
Sbjct  673  LYSGYSDGSIKVWDVRKQSATLVWDTKEHKKAVTCFSLFEPGESLLSGSADKTIGVWQMV  732

Query  167  NEGIRCEQVHEIKDHVNNLVVSESLSCFIPQGAGIKVHSWCGEFKLVNQAKHARC  3
               + C +V   K+ V  L     +   I QG   KV         + +++  +C
Sbjct  733  QNKLECIEVIATKEPVQKLETYGQMIFVITQGHRFKVFDSSRTVNSICKSRSVKC  787



>emb|CDO98856.1| unnamed protein product [Coffea canephora]
Length=1327

 Score = 66.2 bits (160),  Expect = 6e-10, Method: Composition-based stats.
 Identities = 31/98 (32%), Positives = 56/98 (57%), Gaps = 0/98 (0%)
 Frame = -2

Query  350   KVLSGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAI  171
             ++ SG++DG+IK W +KG    LVQ+ + H KAVT  A+L+      SGS D+++++W +
Sbjct  1059  QLCSGYADGSIKVWDIKGQTATLVQDMKNHNKAVTCFALLEQGNCLLSGSADKSIKIWQM  1118

Query  170   SNEGIRCEQVHEIKDHVNNLVVSESLSCFIPQGAGIKV  57
                 + C ++   K+ + ++     L   I +G  +KV
Sbjct  1119  VQRNLECIEIIATKESIQSIDTFGQLIFTISRGHKMKV  1156



>ref|XP_007035614.1| Nucleotide binding protein, putative isoform 1 [Theobroma cacao]
 gb|EOY06540.1| Nucleotide binding protein, putative isoform 1 [Theobroma cacao]
Length=1082

 Score = 66.2 bits (160),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 36/115 (31%), Positives = 58/115 (50%), Gaps = 0/115 (0%)
 Frame = -2

Query  347  VLSGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAIS  168
            + SG+SDG+IK W ++     LV +T+EH KAVT  ++ +  E   SGS D+T+ VW + 
Sbjct  815  LYSGYSDGSIKVWDVRKQSATLVWDTKEHKKAVTCFSLFEPGESLLSGSADKTIGVWQMV  874

Query  167  NEGIRCEQVHEIKDHVNNLVVSESLSCFIPQGAGIKVHSWCGEFKLVNQAKHARC  3
               + C +V   K+ V  L     +   I QG   KV         + +++  +C
Sbjct  875  QNKLECIEVIATKEPVQKLETYGQMIFVITQGHRFKVFDSSRTVNSICKSRSVKC  929



>ref|XP_007138921.1| hypothetical protein PHAVU_009G249000g [Phaseolus vulgaris]
 gb|ESW10915.1| hypothetical protein PHAVU_009G249000g [Phaseolus vulgaris]
Length=1303

 Score = 65.9 bits (159),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 34/115 (30%), Positives = 65/115 (57%), Gaps = 0/115 (0%)
 Frame = -2

Query  347   VLSGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAIS  168
             + SG+SDGTIK W ++G    LV + +EH K+VT  ++ + ++   SGS D+T+RVW + 
Sbjct  1036  LFSGYSDGTIKVWDIRGHSASLVWDIKEHKKSVTCFSLYEPSDCLISGSTDKTIRVWKMI  1095

Query  167   NEGIRCEQVHEIKDHVNNLVVSESLSCFIPQGAGIKVHSWCGEFKLVNQAKHARC  3
                + C +V  +K+ +++L         I +  G+K+ +     + + + K+ +C
Sbjct  1096  QRKLECVEVIVLKEPIHHLRAHGETVFAITESQGLKLVNESRVTRDILKGKNVKC  1150



>gb|EEE63434.1| hypothetical protein OsJ_18247 [Oryza sativa Japonica Group]
Length=1153

 Score = 65.9 bits (159),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 51/82 (62%), Gaps = 0/82 (0%)
 Frame = -2

Query  350  KVLSGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAI  171
            ++  G+S GTI+AW +KG    +++E +EH +AVT  A+  + E   SGS D+++RVW +
Sbjct  775  QLFVGYSSGTIRAWDIKGQRAVVIREVKEHKRAVTCFALSDTGENLLSGSADKSIRVWKM  834

Query  170  SNEGIRCEQVHEIKDHVNNLVV  105
            +   + C +V +I++ V    +
Sbjct  835  AQRKLECVEVIQIREAVEQFEI  856



>gb|EEC79071.1| hypothetical protein OsI_19654 [Oryza sativa Indica Group]
Length=1269

 Score = 65.9 bits (159),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 51/82 (62%), Gaps = 0/82 (0%)
 Frame = -2

Query  350   KVLSGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAI  171
             ++  G+S GTI+AW +KG    +++E +EH +AVT  A+  + E   SGS D+++RVW +
Sbjct  1001  QLFVGYSSGTIRAWDIKGQRAVVIREVKEHKRAVTCFALSDTGENLLSGSADKSIRVWKM  1060

Query  170   SNEGIRCEQVHEIKDHVNNLVV  105
             +   + C +V +I++ V    +
Sbjct  1061  AQRKLECVEVIQIREAVEQFEI  1082



>ref|XP_006296842.1| hypothetical protein CARUB_v10012828mg [Capsella rubella]
 gb|EOA29740.1| hypothetical protein CARUB_v10012828mg [Capsella rubella]
Length=1270

 Score = 65.1 bits (157),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 31/97 (32%), Positives = 57/97 (59%), Gaps = 0/97 (0%)
 Frame = -2

Query  347   VLSGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAIS  168
             + SG+SDG+++ W++   V  L+ + +EH  AVT  ++ +S E+  SGS D+T+R+W I 
Sbjct  1003  LFSGYSDGSVRVWNVNKKVATLLWDIKEHKSAVTCFSLSESGERVLSGSADKTIRIWQIV  1062

Query  167   NEGIRCEQVHEIKDHVNNLVVSESLSCFIPQGAGIKV  57
                + C +V + KD +  L    ++   I +G  +K+
Sbjct  1063  KGKLECAEVIKTKDSIRKLEACGNMIFVITKGHKMKL  1099



>ref|XP_006296841.1| hypothetical protein CARUB_v10012828mg [Capsella rubella]
 gb|EOA29739.1| hypothetical protein CARUB_v10012828mg [Capsella rubella]
Length=1266

 Score = 65.1 bits (157),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 31/97 (32%), Positives = 57/97 (59%), Gaps = 0/97 (0%)
 Frame = -2

Query  347   VLSGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAIS  168
             + SG+SDG+++ W++   V  L+ + +EH  AVT  ++ +S E+  SGS D+T+R+W I 
Sbjct  999   LFSGYSDGSVRVWNVNKKVATLLWDIKEHKSAVTCFSLSESGERVLSGSADKTIRIWQIV  1058

Query  167   NEGIRCEQVHEIKDHVNNLVVSESLSCFIPQGAGIKV  57
                + C +V + KD +  L    ++   I +G  +K+
Sbjct  1059  KGKLECAEVIKTKDSIRKLEACGNMIFVITKGHKMKL  1095



>ref|XP_006655235.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN-1-like [Oryza 
brachyantha]
Length=1134

 Score = 64.7 bits (156),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 28/80 (35%), Positives = 50/80 (63%), Gaps = 0/80 (0%)
 Frame = -2

Query  350  KVLSGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAI  171
            ++  G+S GTI+AW +KG    +++E  EH KAVT  A+ ++ +   SGS D+++RVW +
Sbjct  866  QLFVGYSSGTIRAWDIKGQRAVVIREVTEHKKAVTCFALSETGDNLLSGSADKSIRVWKM  925

Query  170  SNEGIRCEQVHEIKDHVNNL  111
            +   + C +V +I++ V   
Sbjct  926  AQRKLECVEVIQIREAVQKF  945



>ref|XP_010445722.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN-1 isoform 
X1 [Camelina sativa]
 ref|XP_010445794.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN-1 isoform 
X1 [Camelina sativa]
Length=1271

 Score = 63.5 bits (153),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 32/97 (33%), Positives = 55/97 (57%), Gaps = 0/97 (0%)
 Frame = -2

Query  347   VLSGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAIS  168
             + SG+SDG+I+ W++   V  ++ + +EH   VT  ++ +S E   SGS D+T+RVW I 
Sbjct  1004  LFSGYSDGSIRVWNVNKKVATVLWDIKEHKSTVTCFSLSESGESILSGSADKTIRVWQIV  1063

Query  167   NEGIRCEQVHEIKDHVNNLVVSESLSCFIPQGAGIKV  57
                + C +V + KD +  L    ++   I +G  IK+
Sbjct  1064  KGKLDCAEVIKTKDSIRRLEAYGNMIFVITKGHKIKL  1100



>gb|KFK38152.1| hypothetical protein AALP_AA3G075800 [Arabis alpina]
Length=1229

 Score = 63.5 bits (153),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 30/97 (31%), Positives = 56/97 (58%), Gaps = 0/97 (0%)
 Frame = -2

Query  347   VLSGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAIS  168
             + SG+SDG++K W++   +  L+   +EH  AVT  ++ ++ E   SGS D+T+R+W I 
Sbjct  962   LFSGYSDGSVKVWNVNEKLSTLLWSIKEHKSAVTCFSLSETGESVLSGSADKTIRIWQIV  1021

Query  167   NEGIRCEQVHEIKDHVNNLVVSESLSCFIPQGAGIKV  57
                + C +V + K+ +  L V  ++   I +G  +K+
Sbjct  1022  KGKLECTEVIKTKESIRKLEVFGNMIFVITKGHKMKL  1058



>ref|XP_010445833.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN-1 isoform 
X2 [Camelina sativa]
Length=1270

 Score = 63.5 bits (153),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 32/97 (33%), Positives = 55/97 (57%), Gaps = 0/97 (0%)
 Frame = -2

Query  347   VLSGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAIS  168
             + SG+SDG+I+ W++   V  ++ + +EH   VT  ++ +S E   SGS D+T+RVW I 
Sbjct  1003  LFSGYSDGSIRVWNVNKKVATVLWDIKEHKSTVTCFSLSESGESILSGSADKTIRVWQIV  1062

Query  167   NEGIRCEQVHEIKDHVNNLVVSESLSCFIPQGAGIKV  57
                + C +V + KD +  L    ++   I +G  IK+
Sbjct  1063  KGKLDCAEVIKTKDSIRRLEAYGNMIFVITKGHKIKL  1099



>gb|KFK38151.1| hypothetical protein AALP_AA3G075800 [Arabis alpina]
Length=1228

 Score = 63.5 bits (153),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 30/97 (31%), Positives = 56/97 (58%), Gaps = 0/97 (0%)
 Frame = -2

Query  347   VLSGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAIS  168
             + SG+SDG++K W++   +  L+   +EH  AVT  ++ ++ E   SGS D+T+R+W I 
Sbjct  961   LFSGYSDGSVKVWNVNEKLSTLLWSIKEHKSAVTCFSLSETGESVLSGSADKTIRIWQIV  1020

Query  167   NEGIRCEQVHEIKDHVNNLVVSESLSCFIPQGAGIKV  57
                + C +V + K+ +  L V  ++   I +G  +K+
Sbjct  1021  KGKLECTEVIKTKESIRKLEVFGNMIFVITKGHKMKL  1057



>gb|EYU43963.1| hypothetical protein MIMGU_mgv1a0007471mg, partial [Erythranthe 
guttata]
Length=300

 Score = 61.6 bits (148),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 27/77 (35%), Positives = 46/77 (60%), Gaps = 0/77 (0%)
 Frame = -2

Query  341  SGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAISNE  162
            SG++DG+IK W +KG    L+QE +EH K VT  A+ +      SGS D+T+++W +  +
Sbjct  40   SGYTDGSIKVWDIKGQRATLIQEIKEHKKTVTCFALYEHGNCLLSGSSDKTIKMWQMIQK  99

Query  161  GIRCEQVHEIKDHVNNL  111
               C +V   K+ + ++
Sbjct  100  NFECIEVITTKESIRSI  116



>ref|XP_010547022.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN-1 isoform 
X1 [Tarenaya hassleriana]
 ref|XP_010547023.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN-1 isoform 
X2 [Tarenaya hassleriana]
Length=1320

 Score = 63.2 bits (152),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 35/115 (30%), Positives = 59/115 (51%), Gaps = 0/115 (0%)
 Frame = -2

Query  347   VLSGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAIS  168
             + SG+SDG+IK W + G +  L+ + +EH   VT  ++ +  E   SGS D+T+R+W I 
Sbjct  1053  LYSGYSDGSIKVWDVNGKLATLLWDIKEHKSTVTCFSLFEPRESVLSGSADKTIRMWQIV  1112

Query  167   NEGIRCEQVHEIKDHVNNLVVSESLSCFIPQGAGIKVHSWCGEFKLVNQAKHARC  3
                + C +V   K+ V  L    +    I +G  +K+      F  + + K A+C
Sbjct  1113  KGKLECVEVITAKESVRKLEAFGNAIYLITKGHKMKLLDSSRIFHSICKGKSAKC  1167



>ref|XP_010547024.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN-1 isoform 
X3 [Tarenaya hassleriana]
Length=1311

 Score = 63.2 bits (152),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 35/115 (30%), Positives = 59/115 (51%), Gaps = 0/115 (0%)
 Frame = -2

Query  347   VLSGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAIS  168
             + SG+SDG+IK W + G +  L+ + +EH   VT  ++ +  E   SGS D+T+R+W I 
Sbjct  1044  LYSGYSDGSIKVWDVNGKLATLLWDIKEHKSTVTCFSLFEPRESVLSGSADKTIRMWQIV  1103

Query  167   NEGIRCEQVHEIKDHVNNLVVSESLSCFIPQGAGIKVHSWCGEFKLVNQAKHARC  3
                + C +V   K+ V  L    +    I +G  +K+      F  + + K A+C
Sbjct  1104  KGKLECVEVITAKESVRKLEAFGNAIYLITKGHKMKLLDSSRIFHSICKGKSAKC  1158



>ref|XP_010464281.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN-1 isoform 
X2 [Camelina sativa]
Length=1265

 Score = 62.8 bits (151),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 32/97 (33%), Positives = 54/97 (56%), Gaps = 0/97 (0%)
 Frame = -2

Query  347   VLSGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAIS  168
             + SG+SDG+I+ W++   V  L+ + +EH   VT  ++ +S E   SGS D+ +RVW I 
Sbjct  998   LFSGYSDGSIRVWNVNKKVATLLWDIKEHKSTVTCFSLSESGESILSGSADKIIRVWQIV  1057

Query  167   NEGIRCEQVHEIKDHVNNLVVSESLSCFIPQGAGIKV  57
                + C +V + KD +  L    ++   I +G  IK+
Sbjct  1058  KGKLECAEVIKTKDSIRRLEAYGNMIFVITKGHKIKL  1094



>ref|XP_010464279.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN-1 isoform 
X1 [Camelina sativa]
 ref|XP_010464280.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN-1 isoform 
X1 [Camelina sativa]
Length=1266

 Score = 62.8 bits (151),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 32/97 (33%), Positives = 54/97 (56%), Gaps = 0/97 (0%)
 Frame = -2

Query  347   VLSGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAIS  168
             + SG+SDG+I+ W++   V  L+ + +EH   VT  ++ +S E   SGS D+ +RVW I 
Sbjct  999   LFSGYSDGSIRVWNVNKKVATLLWDIKEHKSTVTCFSLSESGESILSGSADKIIRVWQIV  1058

Query  167   NEGIRCEQVHEIKDHVNNLVVSESLSCFIPQGAGIKV  57
                + C +V + KD +  L    ++   I +G  IK+
Sbjct  1059  KGKLECAEVIKTKDSIRRLEAYGNMIFVITKGHKIKL  1095



>ref|XP_002884613.1| transducin family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH60872.1| transducin family protein [Arabidopsis lyrata subsp. lyrata]
Length=1111

 Score = 62.8 bits (151),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 30/97 (31%), Positives = 55/97 (57%), Gaps = 0/97 (0%)
 Frame = -2

Query  347  VLSGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAIS  168
            + SG+SDG+I+ W++   +  ++ + +EH   VT  ++ ++ E   SGS D+T+RVW I 
Sbjct  864  LFSGYSDGSIRVWNVNKKLATILWDIKEHKSTVTCFSLSEAGESVLSGSADKTIRVWQIV  923

Query  167  NEGIRCEQVHEIKDHVNNLVVSESLSCFIPQGAGIKV  57
               + C +V + KD +  L    S+   I +G  +K+
Sbjct  924  KGKLECAEVIKKKDSIRKLEAFGSMIFVITKGHKMKL  960



>gb|AAF26992.1|AC016827_3 hypothetical protein [Arabidopsis thaliana]
Length=1115

 Score = 62.0 bits (149),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 30/97 (31%), Positives = 54/97 (56%), Gaps = 0/97 (0%)
 Frame = -2

Query  347  VLSGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAIS  168
            + SG SDG+I+ W++   +  L+ + +EH   VT  ++ ++ E   SGS D+T+RVW I 
Sbjct  866  LFSGFSDGSIRVWNVNKKIATLLWDIKEHKSTVTCFSLSETGECVLSGSADKTIRVWQIV  925

Query  167  NEGIRCEQVHEIKDHVNNLVVSESLSCFIPQGAGIKV  57
               + C +V + KD +  L    ++   I +G  +K+
Sbjct  926  KGKLECAEVIKTKDSIRKLEAFGNMIFVITKGHKMKL  962



>ref|XP_006407893.1| hypothetical protein EUTSA_v10019914mg [Eutrema salsugineum]
 gb|ESQ49346.1| hypothetical protein EUTSA_v10019914mg [Eutrema salsugineum]
Length=1272

 Score = 61.6 bits (148),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/97 (31%), Positives = 55/97 (57%), Gaps = 0/97 (0%)
 Frame = -2

Query  347   VLSGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAIS  168
             + SG+SDG+IK W++   +  ++   +EH   VT  +I ++ E  +SGS D+T+R+W I 
Sbjct  1005  LFSGYSDGSIKVWNVNEKLATIIWNIKEHKSTVTCFSISETGESVFSGSADKTIRMWQIV  1064

Query  167   NEGIRCEQVHEIKDHVNNLVVSESLSCFIPQGAGIKV  57
                + C +V + K+ +  L    ++   I +G  +KV
Sbjct  1065  KGKLECTEVIKTKESIRKLEAIGNMIFVITKGHKMKV  1101



>ref|XP_010233259.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN-1 [Brachypodium 
distachyon]
Length=1267

 Score = 60.8 bits (146),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 29/82 (35%), Positives = 49/82 (60%), Gaps = 0/82 (0%)
 Frame = -2

Query  350   KVLSGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAI  171
             ++  G+ +GTI+AW +K      ++E  EH KAVT  A+ ++ E   SGS D+++RVW +
Sbjct  999   QLFVGYFNGTIRAWDIKDQRAVNIREITEHKKAVTCFALSETGENLLSGSADKSIRVWKM  1058

Query  170   SNEGIRCEQVHEIKDHVNNLVV  105
             +   + C  V +IK+ V+   V
Sbjct  1059  AQRKLECVDVIQIKEAVHKFDV  1080



>ref|XP_010547025.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN-1 isoform 
X4 [Tarenaya hassleriana]
Length=1151

 Score = 60.8 bits (146),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 28/77 (36%), Positives = 44/77 (57%), Gaps = 0/77 (0%)
 Frame = -2

Query  341   SGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAISNE  162
             SG+SDG+IK W + G +  L+ + +EH   VT  ++ +  E   SGS D+T+R+W I   
Sbjct  1055  SGYSDGSIKVWDVNGKLATLLWDIKEHKSTVTCFSLFEPRESVLSGSADKTIRMWQIVKG  1114

Query  161   GIRCEQVHEIKDHVNNL  111
              + C +V   K+ V  L
Sbjct  1115  KLECVEVITAKESVRKL  1131



>gb|KHG22392.1| Putative E3 ubiquitin-protein ligase LIN-1 [Gossypium arboreum]
Length=1290

 Score = 60.5 bits (145),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 28/79 (35%), Positives = 46/79 (58%), Gaps = 0/79 (0%)
 Frame = -2

Query  347   VLSGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAIS  168
             + SG+SDG+IK W +K     L+ + +EH  +VT  ++ +  E   SGS D+T+RVW + 
Sbjct  1023  LYSGYSDGSIKVWDIKRQSTTLLWDIKEHKDSVTCFSLFEPGETLLSGSTDKTIRVWQMV  1082

Query  167   NEGIRCEQVHEIKDHVNNL  111
             +  + C +V   K+ V  L
Sbjct  1083  HNKLECIEVIATKEPVQKL  1101



>ref|NP_001189833.1| transducin/WD-40 repeat-containing protein [Arabidopsis thaliana]
 gb|AEE74472.1| transducin/WD-40 repeat-containing protein [Arabidopsis thaliana]
Length=1264

 Score = 59.7 bits (143),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 30/97 (31%), Positives = 54/97 (56%), Gaps = 0/97 (0%)
 Frame = -2

Query  347   VLSGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAIS  168
             + SG SDG+I+ W++   +  L+ + +EH   VT  ++ ++ E   SGS D+T+RVW I 
Sbjct  997   LFSGFSDGSIRVWNVNKKIATLLWDIKEHKSTVTCFSLSETGECVLSGSADKTIRVWQIV  1056

Query  167   NEGIRCEQVHEIKDHVNNLVVSESLSCFIPQGAGIKV  57
                + C +V + KD +  L    ++   I +G  +K+
Sbjct  1057  KGKLECAEVIKTKDSIRKLEAFGNMIFVITKGHKMKL  1093



>ref|NP_187344.5| transducin/WD-40 repeat-containing protein [Arabidopsis thaliana]
 gb|AEE74471.1| transducin/WD-40 repeat-containing protein [Arabidopsis thaliana]
Length=1261

 Score = 59.7 bits (143),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 30/97 (31%), Positives = 54/97 (56%), Gaps = 0/97 (0%)
 Frame = -2

Query  347   VLSGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAIS  168
             + SG SDG+I+ W++   +  L+ + +EH   VT  ++ ++ E   SGS D+T+RVW I 
Sbjct  997   LFSGFSDGSIRVWNVNKKIATLLWDIKEHKSTVTCFSLSETGECVLSGSADKTIRVWQIV  1056

Query  167   NEGIRCEQVHEIKDHVNNLVVSESLSCFIPQGAGIKV  57
                + C +V + KD +  L    ++   I +G  +K+
Sbjct  1057  KGKLECAEVIKTKDSIRKLEAFGNMIFVITKGHKMKL  1093



>ref|XP_006419552.1| hypothetical protein CICLE_v10004156mg [Citrus clementina]
 gb|ESR32792.1| hypothetical protein CICLE_v10004156mg [Citrus clementina]
Length=1349

 Score = 58.9 bits (141),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 34/95 (36%), Positives = 49/95 (52%), Gaps = 0/95 (0%)
 Frame = -2

Query  341   SGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAISNE  162
             SG SDG+IK W +K     LV + +EH KAVTS ++ +  E   SGS D+T+ VW +   
Sbjct  1084  SGFSDGSIKMWDIKKQSAVLVWDVKEHRKAVTSFSLFEPGESLLSGSADKTIGVWQMVQR  1143

Query  161   GIRCEQVHEIKDHVNNLVVSESLSCFIPQGAGIKV  57
              +   +V   K+ +  L         I QG  +KV
Sbjct  1144  KLELIEVIATKEPIRKLDTYGKTIFAITQGHRMKV  1178



>ref|XP_006419551.1| hypothetical protein CICLE_v10004156mg [Citrus clementina]
 gb|ESR32791.1| hypothetical protein CICLE_v10004156mg [Citrus clementina]
Length=1074

 Score = 58.5 bits (140),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 34/95 (36%), Positives = 49/95 (52%), Gaps = 0/95 (0%)
 Frame = -2

Query  341  SGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAISNE  162
            SG SDG+IK W +K     LV + +EH KAVTS ++ +  E   SGS D+T+ VW +   
Sbjct  809  SGFSDGSIKMWDIKKQSAVLVWDVKEHRKAVTSFSLFEPGESLLSGSADKTIGVWQMVQR  868

Query  161  GIRCEQVHEIKDHVNNLVVSESLSCFIPQGAGIKV  57
             +   +V   K+ +  L         I QG  +KV
Sbjct  869  KLELIEVIATKEPIRKLDTYGKTIFAITQGHRMKV  903



>gb|KDO71701.1| hypothetical protein CISIN_1g000694mg [Citrus sinensis]
Length=929

 Score = 58.5 bits (140),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/77 (38%), Positives = 43/77 (56%), Gaps = 0/77 (0%)
 Frame = -2

Query  341  SGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAISNE  162
            SG SDG+IK W +K     LV + +EH KAVTS ++ +  E   SGS D+T+ VW +   
Sbjct  664  SGFSDGSIKMWDIKKQSAMLVWDVKEHRKAVTSFSLFEPGESLLSGSADKTIGVWQMVQR  723

Query  161  GIRCEQVHEIKDHVNNL  111
             +   +V   K+ +  L
Sbjct  724  KLELIEVIATKEPIRKL  740



>gb|KDO71699.1| hypothetical protein CISIN_1g000694mg [Citrus sinensis]
 gb|KDO71700.1| hypothetical protein CISIN_1g000694mg [Citrus sinensis]
Length=1074

 Score = 58.2 bits (139),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 29/77 (38%), Positives = 43/77 (56%), Gaps = 0/77 (0%)
 Frame = -2

Query  341  SGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAISNE  162
            SG SDG+IK W +K     LV + +EH KAVTS ++ +  E   SGS D+T+ VW +   
Sbjct  809  SGFSDGSIKMWDIKKQSAMLVWDVKEHRKAVTSFSLFEPGESLLSGSADKTIGVWQMVQR  868

Query  161  GIRCEQVHEIKDHVNNL  111
             +   +V   K+ +  L
Sbjct  869  KLELIEVIATKEPIRKL  885



>gb|KDO71698.1| hypothetical protein CISIN_1g000694mg [Citrus sinensis]
Length=1349

 Score = 58.2 bits (139),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 29/77 (38%), Positives = 43/77 (56%), Gaps = 0/77 (0%)
 Frame = -2

Query  341   SGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAISNE  162
             SG SDG+IK W +K     LV + +EH KAVTS ++ +  E   SGS D+T+ VW +   
Sbjct  1084  SGFSDGSIKMWDIKKQSAMLVWDVKEHRKAVTSFSLFEPGESLLSGSADKTIGVWQMVQR  1143

Query  161   GIRCEQVHEIKDHVNNL  111
              +   +V   K+ +  L
Sbjct  1144  KLELIEVIATKEPIRKL  1160



>ref|XP_006489060.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN-1-like isoform 
X1 [Citrus sinensis]
Length=1351

 Score = 55.5 bits (132),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/77 (38%), Positives = 42/77 (55%), Gaps = 0/77 (0%)
 Frame = -2

Query  341   SGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAISNE  162
             SG SDG+IK W +K     LV   +EH KAVTS ++ +  E   SGS D+T+ VW +   
Sbjct  1086  SGFSDGSIKMWDIKKQSAVLVWGVKEHRKAVTSFSLFEPGESLLSGSADKTIGVWQMVQR  1145

Query  161   GIRCEQVHEIKDHVNNL  111
              +   +V   K+ +  L
Sbjct  1146  KLELIEVIATKEPIRKL  1162



>ref|XP_006489061.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN-1-like isoform 
X2 [Citrus sinensis]
Length=1351

 Score = 55.5 bits (132),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/77 (38%), Positives = 42/77 (55%), Gaps = 0/77 (0%)
 Frame = -2

Query  341   SGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAISNE  162
             SG SDG+IK W +K     LV   +EH KAVTS ++ +  E   SGS D+T+ VW +   
Sbjct  1086  SGFSDGSIKMWDIKKQSAVLVWGVKEHRKAVTSFSLFEPGESLLSGSADKTIGVWQMVQR  1145

Query  161   GIRCEQVHEIKDHVNNL  111
              +   +V   K+ +  L
Sbjct  1146  KLELIEVIATKEPIRKL  1162



>ref|XP_006489062.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN-1-like isoform 
X3 [Citrus sinensis]
Length=1349

 Score = 55.5 bits (132),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 29/77 (38%), Positives = 42/77 (55%), Gaps = 0/77 (0%)
 Frame = -2

Query  341   SGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAISNE  162
             SG SDG+IK W +K     LV   +EH KAVTS ++ +  E   SGS D+T+ VW +   
Sbjct  1084  SGFSDGSIKMWDIKKQSAVLVWGVKEHRKAVTSFSLFEPGESLLSGSADKTIGVWQMVQR  1143

Query  161   GIRCEQVHEIKDHVNNL  111
              +   +V   K+ +  L
Sbjct  1144  KLELIEVIATKEPIRKL  1160



>gb|ETO22081.1| NB-ARC domain-containing protein [Reticulomyxa filosa]
Length=1777

 Score = 55.5 bits (132),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 30/96 (31%), Positives = 53/96 (55%), Gaps = 10/96 (10%)
 Frame = -2

Query  350   KVLSGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAI  171
             +++SG  D TI+ W +  G   L+Q    H+ AV+S+      ++  SGSLD+T+R+W  
Sbjct  1493  RIVSGSRDKTIRLWDVSSG--ELIQSLEGHLYAVSSIDFAPDGKRIVSGSLDKTVRLW--  1548

Query  170   SNEGIRCEQVHEIKDHVNNLVVSESLSCFIPQGAGI  63
               + +  EQ+  ++ HVN++   +    F P G+ I
Sbjct  1549  --DALSGEQIQSLQGHVNDVNSVQ----FSPDGSRI  1578



>ref|XP_009134936.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN-1 isoform 
X2 [Brassica rapa]
Length=1219

 Score = 54.7 bits (130),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 29/98 (30%), Positives = 55/98 (56%), Gaps = 1/98 (1%)
 Frame = -2

Query  347   VLSGHSDGTIKAWSLKGGV-LHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAI  171
             + SG+SDG++K W++   +   L+   +EH  AVT  ++ ++ E   SGS D+T+R+W I
Sbjct  951   LFSGYSDGSVKVWNVDEKLSTTLLWNIKEHKSAVTCFSVSETGESVLSGSADKTIRIWQI  1010

Query  170   SNEGIRCEQVHEIKDHVNNLVVSESLSCFIPQGAGIKV  57
                 + C +V + K+ +  L    ++   I +G  +K+
Sbjct  1011  VKGKLECVEVIKTKESIRKLEALGNMIFVITKGHKMKM  1048



>ref|XP_009134935.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN-1 isoform 
X1 [Brassica rapa]
Length=1222

 Score = 54.7 bits (130),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 29/98 (30%), Positives = 55/98 (56%), Gaps = 1/98 (1%)
 Frame = -2

Query  347   VLSGHSDGTIKAWSLKGGV-LHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAI  171
             + SG+SDG++K W++   +   L+   +EH  AVT  ++ ++ E   SGS D+T+R+W I
Sbjct  954   LFSGYSDGSVKVWNVDEKLSTTLLWNIKEHKSAVTCFSVSETGESVLSGSADKTIRIWQI  1013

Query  170   SNEGIRCEQVHEIKDHVNNLVVSESLSCFIPQGAGIKV  57
                 + C +V + K+ +  L    ++   I +G  +K+
Sbjct  1014  VKGKLECVEVIKTKESIRKLEALGNMIFVITKGHKMKM  1051



>emb|CDX74073.1| BnaA03g29740D [Brassica napus]
Length=1219

 Score = 53.9 bits (128),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 29/98 (30%), Positives = 55/98 (56%), Gaps = 1/98 (1%)
 Frame = -2

Query  347   VLSGHSDGTIKAWSLKGGVLH-LVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAI  171
             + SG+SDG++K W++   +   L+   +EH  AVT  ++ ++ E   SGS D+T+R+W I
Sbjct  951   LFSGYSDGSVKVWNVDEKLSSTLLWNIKEHKSAVTCFSVSETGESVLSGSADKTIRIWQI  1010

Query  170   SNEGIRCEQVHEIKDHVNNLVVSESLSCFIPQGAGIKV  57
                 + C +V + K+ +  L    ++   I +G  +K+
Sbjct  1011  VKGKLECVEVIKTKESIRKLEALGNMIFVITKGHKMKM  1048



>emb|CDY08026.1| BnaC03g34970D [Brassica napus]
Length=1222

 Score = 53.5 bits (127),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 28/98 (29%), Positives = 55/98 (56%), Gaps = 1/98 (1%)
 Frame = -2

Query  347   VLSGHSDGTIKAWSLKGGVLH-LVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAI  171
             + SG+SDG++K W++   +   L+   ++H  AVT  ++ ++ E   SGS D+T+R+W I
Sbjct  954   LFSGYSDGSVKVWNVDEKLSSTLLWNIKDHKSAVTCFSVCETGESVLSGSADKTIRIWQI  1013

Query  170   SNEGIRCEQVHEIKDHVNNLVVSESLSCFIPQGAGIKV  57
                 + C +V + K+ +  L    ++   I +G  +K+
Sbjct  1014  VKGKLECVEVIKTKESIRKLEAFGNMIFVITKGHKMKM  1051



>ref|WP_011305578.1| WD-40 repeat-containing protein [Methanosarcina barkeri]
 ref|YP_304107.1| WD-40 repeat-containing protein [Methanosarcina barkeri str. 
Fusaro]
 gb|AAZ69527.1| WD-40 repeat-containing protein [Methanosarcina barkeri str. 
Fusaro]
Length=505

 Score = 52.8 bits (125),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 28/90 (31%), Positives = 52/90 (58%), Gaps = 5/90 (6%)
 Frame = -2

Query  350  KVLSGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAI  171
            +++SG SD T++ W LK G + L    + H + VTS+AI    +   SGS DRT++VW +
Sbjct  231  RIISGSSDKTLRVWDLKKGNMTL----KGHKREVTSVAITSDGKYAISGSFDRTIKVWDL  286

Query  170  SNEGIRCEQVHEIKDHVNNLVVSESLSCFI  81
             N  I+   +   K++++ + +  + +C +
Sbjct  287  ENGKIKV-TLEGHKNYISTISIIPNKNCIV  315



>ref|WP_017746049.1| hypothetical protein [Scytonema hofmanni]
Length=654

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 26/60 (43%), Positives = 38/60 (63%), Gaps = 2/60 (3%)
 Frame = -2

Query  347  VLSGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAIS  168
            V+SG  D TIK W+L+ G   L++   +H  AV S+AI    +KF SGS D T+++W I+
Sbjct  515  VVSGSQDKTIKIWNLQTG--KLIRTLEDHTDAVRSVAISPDGQKFASGSWDNTVKIWDIT  572



>ref|WP_015144880.1| WD40 repeat-containing protein [Pleurocapsa minor]
 ref|YP_007082138.1| WD40 repeat-containing protein [Pleurocapsa sp. PCC 7327]
 gb|AFY78581.1| WD40 repeat-containing protein [Pleurocapsa sp. PCC 7327]
Length=1331

 Score = 52.0 bits (123),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 38/105 (36%), Positives = 48/105 (46%), Gaps = 12/105 (11%)
 Frame = -2

Query  341  SGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAI-SN  165
            +G  DGT++ W L G  +   Q  R H   VTS+A     +   SGS DRT+R+W + SN
Sbjct  898  TGGGDGTVRLWDLSGNPIG--QPLRGHAGDVTSVAFSPDGQTIASGSWDRTIRLWNLASN  955

Query  164  EGIRCEQVHEIKDHVNNLVVSESLSCFIPQGAGIKVHSWCGEFKL  30
               R  Q HE      N V S     F P G  I   SW    +L
Sbjct  956  PIARPFQGHE------NDVTS---VAFSPDGEKIASGSWDKTIRL  991


 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 33/102 (32%), Positives = 49/102 (48%), Gaps = 5/102 (5%)
 Frame = -2

Query  350   KVLSGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAI  171
             K+ SG  D TI+ W LKG ++   +  R H   VTS+      EK  SGS D+T+R+W +
Sbjct  979   KIASGSWDKTIRLWDLKGNLI--ARPFRGHEGDVTSVVFSPDGEKIASGSWDKTIRLWDL  1036

Query  170   SNEGI-RCEQVHEIKDHVNNLVVSESLSCFIPQGAGIKVHSW  48
                 I R  Q H  ++ VN++  S      +  G    +  W
Sbjct  1037  KGNLIARPFQGH--RERVNSVAFSPDGQVIVSGGGDGTIRLW  1076



>gb|EUC67532.1| vegetative incompatibility protein HET-E-1, partial [Rhizoctonia 
solani AG-3 Rhs1AP]
Length=636

 Score = 52.0 bits (123),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 23/65 (35%), Positives = 41/65 (63%), Gaps = 0/65 (0%)
 Frame = -2

Query  350  KVLSGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAI  171
            +V+SG SDGTI+ W+++GG+L        HV ++ S+ + ++  +  SGS D ++  W I
Sbjct  354  RVISGSSDGTIRVWNVRGGLLPPPTPFEAHVSSLRSVLLAENGTRILSGSEDSSIWAWDI  413

Query  170  SNEGI  156
            ++ GI
Sbjct  414  THGGI  418



>ref|XP_010056242.1| PREDICTED: zinc finger CCCH domain-containing protein 48-like 
[Eucalyptus grandis]
Length=97

 Score = 48.5 bits (114),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 33/92 (36%), Positives = 46/92 (50%), Gaps = 15/92 (16%)
 Frame = -2

Query  347  VLSGHSDGTIKAWSLKGG----VLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRV  180
            +  G  DGTI  W  KGG       +    R H + + SL +    ++FYSGS+DRT+RV
Sbjct  2    LFGGAQDGTILVW--KGGSEADPFQMAAPLRSHTQGMVSLTV--GPDRFYSGSIDRTIRV  57

Query  179  WAISNEGIRCEQVHEIKDHVNNLVVSESLSCF  84
            W +       E V EI  H +   V+ SL C+
Sbjct  58   WDLHT----LECVLEIVGHTD---VAMSLICW  82



>ref|WP_015148272.1| WD40 repeat-containing protein [Oscillatoria acuminata]
 ref|YP_007085548.1| WD40 repeat-containing protein [Oscillatoria acuminata PCC 6304]
 gb|AFY81628.1| WD40 repeat-containing protein [Oscillatoria acuminata PCC 6304]
Length=636

 Score = 51.6 bits (122),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 25/60 (42%), Positives = 36/60 (60%), Gaps = 2/60 (3%)
 Frame = -2

Query  347  VLSGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAIS  168
            + SG SD TIK WSLK G   L+   + H  AVT +A     +   SGS D+TL++W+++
Sbjct  443  IASGSSDKTIKVWSLKNG--ELIHTLKGHSYAVTCIAFTPDGKTLVSGSGDKTLKIWSLT  500



>ref|XP_008595056.1| F-box protein [Beauveria bassiana ARSEF 2860]
 gb|EJP69772.1| F-box protein [Beauveria bassiana ARSEF 2860]
Length=325

 Score = 50.8 bits (120),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 32/79 (41%), Positives = 43/79 (54%), Gaps = 5/79 (6%)
 Frame = -2

Query  347  VLSGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAIS  168
            ++S   DG IK WSL+      +QE   H  AV  L + QS     SGS DRT+RVW + 
Sbjct  109  LVSASKDGIIKVWSLEKS--ECIQELSAHEGAVRCLGVDQSRHLLVSGSSDRTVRVWDLK  166

Query  167  NEGIRCEQVHEIKDHVNNL  111
            N G  CE+V  ++ HV  +
Sbjct  167  N-GFNCERV--LRGHVGTI  182



>emb|CCX32796.1| Similar to Ribosome biogenesis protein YTM1; acc. no. A6R3K5 
[Pyronema omphalodes CBS 100304]
Length=445

 Score = 51.2 bits (121),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 30/86 (35%), Positives = 44/86 (51%), Gaps = 4/86 (5%)
 Frame = -2

Query  347  VLSGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAIS  168
            VLSG  DG  + W+L G VL    E   H   + S+  L  AE F + SLDRTLR+W  +
Sbjct  128  VLSGSYDGIARVWNLSGQVL---SEGAGHTAGIKSVKWL-DAESFVTSSLDRTLRIWRYT  183

Query  167  NEGIRCEQVHEIKDHVNNLVVSESLS  90
             +G     +    +++ +    ESL+
Sbjct  184  ADGTVAASIKPAAEYIGHKSTVESLA  209



>ref|XP_007337066.1| WD40 repeat-like protein [Auricularia delicata TFB-10046 SS5]
 gb|EJD54177.1| WD40 repeat-like protein [Auricularia delicata TFB-10046 SS5]
Length=963

 Score = 51.6 bits (122),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 35/111 (32%), Positives = 55/111 (50%), Gaps = 11/111 (10%)
 Frame = -2

Query  347  VLSGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAIS  168
            V+SG  DGT++  S++ G   + +   EH + +  +A+ Q      SGSLDRT+R W +S
Sbjct  681  VVSGSEDGTLRLGSIRTG-QPIGEAVSEHTEGIRCVAVSQDGSLIASGSLDRTIRTWKVS  739

Query  167  NEG---IRCEQVHEIKDHVNNLVVSESLSCFIPQGAGIKVHSWCGEFKLVN  24
             +G   IR  +  +  D V +L        F P G+ I   S+ G   + N
Sbjct  740  ADGITRIRLIEQADCGDRVFSLA-------FSPDGSRIVSGSFNGHLTMWN  783



>ref|WP_035799680.1| hypothetical protein [Cyanothece sp. CCY0110]
Length=207

 Score = 49.7 bits (117),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 26/76 (34%), Positives = 43/76 (57%), Gaps = 6/76 (8%)
 Frame = -2

Query  350  KVLSGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAI  171
            K++SG  DGTIK W L  G  +L    + H  ++  LA+   ++K  SGS D+TL++W +
Sbjct  22   KLISGSCDGTIKVWDLATG--NLENTLKNHSYSINILAVTTDSKKVISGSRDQTLKIWDL  79

Query  170  SNEGIRCEQVHEIKDH  123
              E +     + +K+H
Sbjct  80   DTENLE----NTLKNH  91



>gb|ETO16966.1| NB-ARC domain-containing protein [Reticulomyxa filosa]
Length=1128

 Score = 51.6 bits (122),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 34/101 (34%), Positives = 54/101 (53%), Gaps = 10/101 (10%)
 Frame = -2

Query  350  KVLSGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAI  171
            K+LS   D TI+ W +   +   +Q T E++  VT++A      K  SGSLD+T+R+W +
Sbjct  725  KILSCSDDYTIRIWDIS--LERKIQATEEYLDIVTTVAFSPDGSKIVSGSLDKTVRLWDV  782

Query  170  SNEGIRCEQVHEIKDHVNNLVVSESLSCFIPQGAGIKVHSW  48
             +      Q++  + H +   VSE L  F P G+ I  +SW
Sbjct  783  QSG----RQIYVFEGHSDR--VSEVL--FSPDGSKIVSYSW  815



>ref|WP_038075931.1| hypothetical protein [Tolypothrix bouteillei]
 gb|KIE07496.1| hypothetical protein DA73_0241165 [Tolypothrix bouteillei VB521301]
Length=653

 Score = 51.2 bits (121),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 25/60 (42%), Positives = 38/60 (63%), Gaps = 2/60 (3%)
 Frame = -2

Query  347  VLSGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAIS  168
            ++S   D TIK W+L+ G   L++   +H  AV S+AI    +KF SGS D+T++VW I+
Sbjct  514  LISSSQDKTIKIWNLQTG--KLIRTLEDHTDAVRSVAISPDGQKFASGSWDKTIKVWDIA  571



>emb|CCL98577.1| predicted protein [Fibroporia radiculosa]
Length=1624

 Score = 51.2 bits (121),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 28/84 (33%), Positives = 43/84 (51%), Gaps = 1/84 (1%)
 Frame = -2

Query  350   KVLSGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAI  171
             K++SG SDGT++ W    G L +    R+   ++TS+ I Q   +  SGS D T+RVW  
Sbjct  937   KIVSGSSDGTVRVWDADTG-LQVGSTLRDCTGSITSVTISQDGRRIVSGSWDGTVRVWDA  995

Query  170   SNEGIRCEQVHEIKDHVNNLVVSE  99
                   C       D V ++V+S+
Sbjct  996   DTGRQICSTFQGHGDEVTSVVISQ  1019


 Score = 49.3 bits (116),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 23/58 (40%), Positives = 35/58 (60%), Gaps = 1/58 (2%)
 Frame = -2

Query  350   KVLSGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVW  177
             ++  G  DGT++ W    G L +    + H+ AVTS+AI +  ++  SGS DRT+RVW
Sbjct  1409  RIACGSWDGTVRVWDADTG-LQICSTLQGHIDAVTSVAISKDMQRIVSGSRDRTVRVW  1465



>ref|WP_015138834.1| WD40 repeat-containing protein [Nostoc sp. PCC 7524]
 ref|YP_007075993.1| WD40 repeat-containing protein [Nostoc sp. PCC 7524]
 gb|AFY48396.1| WD40 repeat-containing protein [Nostoc sp. PCC 7524]
Length=779

 Score = 51.2 bits (121),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 30/85 (35%), Positives = 44/85 (52%), Gaps = 9/85 (11%)
 Frame = -2

Query  347  VLSGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAIS  168
            + SG +D TIK W L  G   L+    EH   +TSLA+    +  +S S D T+++W IS
Sbjct  677  LFSGSADTTIKIWHLITG--KLLYSLTEHTDEITSLAVSPDGQTLFSSSADTTIKIWRIS  734

Query  167  NEGIRCEQVHEIKDH---VNNLVVS  102
            N    CE V  +  H   +N + +S
Sbjct  735  N----CEAVQTLTGHSEKINTIALS  755



>ref|WP_034957264.1| hypothetical protein, partial [Glomeribacter sp. 1016415]
Length=572

 Score = 50.8 bits (120),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 32/99 (32%), Positives = 47/99 (47%), Gaps = 1/99 (1%)
 Frame = -2

Query  341  SGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAISNE  162
            SG  D T+K W L+   + L Q    H   +TS++     +   SGSLD+TL+ WA+ NE
Sbjct  240  SGGGDSTVKLWELRNSKVMLCQTFEGHRGLITSVSFSPDGKWLASGSLDKTLKFWALRNE  299

Query  161  GIRCEQVHE-IKDHVNNLVVSESLSCFIPQGAGIKVHSW  48
             +   Q  E  +D V ++ +S          A  KV  W
Sbjct  300  EVLSRQTFEGQRDKVCSVSISPDGKWLASGSADEKVKLW  338



>ref|WP_015114595.1| serine/threonine protein kinase with WD40 repeats [Nostoc sp. 
PCC 7107]
 ref|YP_007051543.1| serine/threonine protein kinase with WD40 repeats [Nostoc sp. 
PCC 7107]
 gb|AFY44393.1| serine/threonine protein kinase with WD40 repeats [Nostoc sp. 
PCC 7107]
Length=643

 Score = 50.8 bits (120),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 28/70 (40%), Positives = 42/70 (60%), Gaps = 3/70 (4%)
 Frame = -2

Query  341  SGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAISN-  165
            SG  D TIK W+LK G   LV+    H+ +V SLAI   ++   SGS D+T+++W ++  
Sbjct  461  SGSGDKTIKIWNLKTG--QLVKTLTSHLSSVMSLAISPDSQTLVSGSNDKTIKIWNLATG  518

Query  164  EGIRCEQVHE  135
            E IR  + H+
Sbjct  519  ELIRTIKAHD  528



>ref|WP_007357883.1| MULTISPECIES: hypothetical protein [Kamptonema]
 emb|CBN58706.1| WD-repeat protein [ [[Oscillatoria] sp. PCC 6506]
Length=552

 Score = 50.8 bits (120),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 36/108 (33%), Positives = 57/108 (53%), Gaps = 12/108 (11%)
 Frame = -2

Query  344  LSGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAI-S  168
            +SG++DG+I  W+L  G   L    R H  AV ++AI    + F SGS D+T+++W + +
Sbjct  285  VSGNTDGSISVWNLPSG--ELKSTLRGHGDAVNAVAIASDGKIFASGSDDKTIKIWNLET  342

Query  167  NEGIRCEQVHEIKDHVNNLVVSESLSCFIPQGAGIKVHSWCGEFKLVN  24
             E IR    H      +++VV+ +LS   P G  +   SW    K+ N
Sbjct  343  GENIRTLTGH------SDVVVAIALS---PDGQFLASGSWDKTVKIWN  381



>ref|WP_017653704.1| hypothetical protein [Microchaete sp. PCC 7126]
Length=605

 Score = 50.8 bits (120),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 27/60 (45%), Positives = 34/60 (57%), Gaps = 2/60 (3%)
 Frame = -2

Query  347  VLSGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAIS  168
            + SG +D TIK W LK G   L+     H   VTSLA   S E   SGSLD+T+++W  S
Sbjct  548  IASGSADKTIKLWHLKTG--ELLATFTGHTNTVTSLAFTASGEMLVSGSLDKTIKIWQRS  605



>ref|XP_759931.1| hypothetical protein UM03784.1 [Ustilago maydis 521]
 gb|EAK84819.1| hypothetical protein UM03784.1 [Ustilago maydis 521]
Length=907

 Score = 50.8 bits (120),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 27/75 (36%), Positives = 39/75 (52%), Gaps = 11/75 (15%)
 Frame = -2

Query  347  VLSGHSDGTIKAWSLKGGVLHL-----------VQETREHVKAVTSLAILQSAEKFYSGS  201
            +LS   D TIK W+L  G L+            +   R H   VT LA+  +  +FYSGS
Sbjct  544  LLSASDDNTIKFWNLDAGTLNQPAAKSGTDSQPIVTFRGHSAGVTCLAVSPNKRRFYSGS  603

Query  200  LDRTLRVWAISNEGI  156
            LD ++RVW + + G+
Sbjct  604  LDSSVRVWQLPDSGL  618



>gb|EAZ90378.1| Serine/Threonine protein kinase with WD40 repeats [Cyanothece 
sp. CCY0110]
Length=275

 Score = 49.7 bits (117),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 29/86 (34%), Positives = 48/86 (56%), Gaps = 9/86 (10%)
 Frame = -2

Query  350  KVLSGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAI  171
            K++SG  DGTIK W L  G  +L    + H  ++  LA+   ++K  SGS D+TL++W +
Sbjct  90   KLISGSCDGTIKVWDLATG--NLENTLKNHSYSINILAVTTDSKKVISGSRDQTLKIWDL  147

Query  170  SNEGIRCEQVHEIKDH---VNNLVVS  102
              E +     + +K+H   +N L V+
Sbjct  148  DTENLE----NTLKNHSYSINILAVT  169



>gb|ETO12363.1| G-protein beta WD-40 repeats containing protein [Reticulomyxa 
filosa]
Length=842

 Score = 50.4 bits (119),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 32/101 (32%), Positives = 49/101 (49%), Gaps = 10/101 (10%)
 Frame = -2

Query  350  KVLSGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAI  171
            K++SG  D TI+ W +  G    +Q +  H  AV S+ I     K  SGS DRT+R+W +
Sbjct  580  KIVSGSYDATIRIWDVSSG--EQLQSSETHSGAVYSIGISLDGSKIVSGSFDRTVRIWDV  637

Query  170  SNEGIRCEQVHEIKDHVNNLVVSESLSCFIPQGAGIKVHSW  48
            S+ G + + +    D V ++        F P G+ I    W
Sbjct  638  SS-GKQLQLLQGHSDRVRSV-------AFSPDGSTIVSGGW  670



>gb|KFH70070.1| hypothetical protein MVEG_04873 [Mortierella verticillata NRRL 
6337]
Length=826

 Score = 50.4 bits (119),  Expect = 9e-05, Method: Composition-based stats.
 Identities = 26/69 (38%), Positives = 38/69 (55%), Gaps = 10/69 (14%)
 Frame = -2

Query  347  VLSGHSDGTIKAWSLKGGV----------LHLVQETREHVKAVTSLAILQSAEKFYSGSL  198
            +LSG  DGT+K W+L+  +          +  V   R H KA+TS+AI     K +SGS+
Sbjct  495  ILSGSEDGTMKYWNLESPLRESKRTLTAEIEPVHTYRGHTKAITSVAISADHNKCFSGSM  554

Query  197  DRTLRVWAI  171
            D T+R W +
Sbjct  555  DSTIRAWKM  563



>ref|WP_039717436.1| hypothetical protein, partial [Scytonema millei]
Length=276

 Score = 49.7 bits (117),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 32/101 (32%), Positives = 51/101 (50%), Gaps = 3/101 (3%)
 Frame = -2

Query  350  KVLSGHSDGTIKAWSLKGGVLHLVQETREHVKAVTSLAILQSAEKFYSGSLDRTLRVWAI  171
            K++SG SD TIK W+L+ G    ++  R H  AV ++A+    +   SGS DRT++VW +
Sbjct  63   KLISGSSDRTIKVWNLQTG--EPIRTLRGHTDAVRAVAVSPDDKHIVSGSSDRTIKVWDL  120

Query  170  SNEGIRCEQVHEIKDHVNNLVVSESLSCFIPQGAGIKVHSW  48
            S  G+    +      V  + +S +    +  GA   V  W
Sbjct  121  ST-GVLLRTLSRHTSAVRAVAISPNGYTIVSGGADNLVRVW  160



>emb|CCF50547.1| related to STRIATIN [Ustilago hordei]
Length=923

 Score = 50.4 bits (119),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 28/75 (37%), Positives = 39/75 (52%), Gaps = 11/75 (15%)
 Frame = -2

Query  347  VLSGHSDGTIKAWSLKGGVLHLVQET-----------REHVKAVTSLAILQSAEKFYSGS  201
            +LS   D TIK W+L  G L+                R H  AVTSLA+  +  +FYSGS
Sbjct  558  LLSASDDNTIKFWNLDVGTLNQPASKTGTDSQPLVTFRGHSAAVTSLAVSPNKRRFYSGS  617

Query  200  LDRTLRVWAISNEGI  156
            LD ++RVW + +  +
Sbjct  618  LDSSIRVWQLPDRNV  632



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 506325383488