BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c9821_g1_i1 len=943 path=[1:0-740 742:741-875 877:876-942]

Length=943
                                                                      Score     E

gb|ABE11612.1|  SWIb domain-containing protein                          170   5e-49   Solanum chacoense
ref|XP_009598334.1|  PREDICTED: upstream activation factor subuni...    170   5e-49   
ref|XP_004244091.1|  PREDICTED: upstream activation factor subuni...    169   9e-49   
ref|XP_010060279.1|  PREDICTED: upstream activation factor subuni...    168   2e-48   
ref|XP_006346190.1|  PREDICTED: upstream activation factor subuni...    168   4e-48   
ref|XP_010060280.1|  PREDICTED: upstream activation factor subuni...    167   8e-48   
gb|AFK40800.1|  unknown                                                 167   9e-48   
ref|XP_004500110.1|  PREDICTED: upstream activation factor subuni...    165   5e-47   
gb|KDP39192.1|  hypothetical protein JCGZ_00949                         163   2e-46   
ref|XP_002322444.1|  SWIB complex BAF60b domain-containing family...    163   3e-46   Populus trichocarpa [western balsam poplar]
ref|XP_004295850.1|  PREDICTED: upstream activation factor subuni...    163   3e-46   
ref|XP_009334158.1|  PREDICTED: upstream activation factor subuni...    162   5e-46   
emb|CDP13786.1|  unnamed protein product                                162   6e-46   
ref|XP_011041625.1|  PREDICTED: upstream activation factor subuni...    161   1e-45   
ref|XP_010675787.1|  PREDICTED: upstream activation factor subuni...    161   1e-45   
ref|XP_007020708.1|  SWIB/MDM2 domain superfamily protein               160   2e-45   
ref|XP_011041619.1|  PREDICTED: upstream activation factor subuni...    160   2e-45   
ref|XP_010248405.1|  PREDICTED: upstream activation factor subuni...    160   3e-45   
ref|XP_009348302.1|  PREDICTED: upstream activation factor subuni...    160   4e-45   
ref|XP_010438693.1|  PREDICTED: upstream activation factor subuni...    160   4e-45   
ref|NP_001236050.1|  uncharacterized protein LOC100527179               160   5e-45   
ref|XP_010433434.1|  PREDICTED: upstream activation factor subuni...    159   9e-45   
ref|XP_009361046.1|  PREDICTED: upstream activation factor subuni...    159   1e-44   
ref|XP_008355320.1|  PREDICTED: upstream activation factor subuni...    159   1e-44   
ref|XP_010545234.1|  PREDICTED: upstream activation factor subuni...    159   1e-44   
ref|XP_011095453.1|  PREDICTED: upstream activation factor subuni...    158   2e-44   
ref|XP_006413137.1|  hypothetical protein EUTSA_v10026656mg             157   3e-44   
ref|XP_006282479.1|  hypothetical protein CARUB_v10006096mg             157   4e-44   
ref|XP_006452454.1|  hypothetical protein CICLE_v10010012mg             157   4e-44   
ref|XP_010090482.1|  Upstream activation factor subunit spp27           157   5e-44   
ref|XP_003551777.1|  PREDICTED: upstream activation factor subuni...    156   1e-43   
ref|XP_002277738.1|  PREDICTED: upstream activation factor subuni...    156   1e-43   Vitis vinifera
ref|XP_006474999.1|  PREDICTED: upstream activation factor subuni...    155   4e-43   
ref|NP_194411.1|  SWIB/MDM2 domain-containing protein                   155   5e-43   Arabidopsis thaliana [mouse-ear cress]
gb|EYU27377.1|  hypothetical protein MIMGU_mgv1a016940mg                154   8e-43   
ref|XP_007212283.1|  hypothetical protein PRUPE_ppa013835mg             154   8e-43   
ref|XP_009142850.1|  PREDICTED: upstream activation factor subuni...    154   1e-42   
emb|CDY29252.1|  BnaC01g19040D                                          153   2e-42   
ref|XP_009109167.1|  PREDICTED: upstream activation factor subuni...    154   2e-42   
emb|CDX97367.1|  BnaC08g12320D                                          153   3e-42   
ref|XP_007146524.1|  hypothetical protein PHAVU_006G048200g             152   4e-42   
ref|XP_008449303.1|  PREDICTED: upstream activation factor subuni...    150   3e-41   
ref|XP_004172787.1|  PREDICTED: upstream activation factor subuni...    149   4e-41   
gb|KGN54777.1|  hypothetical protein Csa_4G493210                       151   1e-40   
ref|XP_002867540.1|  hypothetical protein ARALYDRAFT_354113             150   6e-39   
ref|XP_009770633.1|  PREDICTED: upstream activation factor subuni...    139   4e-37   
ref|XP_010943230.1|  PREDICTED: upstream activation factor subuni...    135   2e-35   
ref|XP_008806080.1|  PREDICTED: upstream activation factor subuni...    133   7e-35   
ref|XP_004146416.1|  PREDICTED: protein TRI1-like                       134   1e-34   
ref|XP_009390982.1|  PREDICTED: upstream activation factor subuni...    127   2e-32   
ref|XP_004962128.1|  PREDICTED: upstream activation factor subuni...    126   3e-32   
ref|NP_001062629.1|  Os09g0133000                                       125   1e-31   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006660431.1|  PREDICTED: uncharacterized protein LOC102702963    124   3e-31   
gb|EMT28759.1|  hypothetical protein F775_31075                         122   1e-30   
gb|EMS65517.1|  hypothetical protein TRIUR3_13584                       121   2e-30   
ref|XP_003578023.1|  PREDICTED: uncharacterized protein LOC100833627    120   3e-30   
ref|XP_002446461.1|  hypothetical protein SORBIDRAFT_06g016360          120   7e-30   Sorghum bicolor [broomcorn]
dbj|BAJ88504.1|  predicted protein                                      119   1e-29   
ref|NP_001148297.1|  SWIb domain-containing protein                     119   2e-29   Zea mays [maize]
ref|XP_004956342.1|  PREDICTED: upstream activation factor subuni...    118   2e-29   
ref|XP_003567001.1|  PREDICTED: uncharacterized protein LOC100834706    117   5e-29   
ref|XP_010239346.1|  PREDICTED: LOW QUALITY PROTEIN: aminopeptida...    123   1e-28   
ref|NP_001146978.1|  SWIb domain-containing protein                     113   2e-27   Zea mays [maize]
ref|XP_010064311.1|  PREDICTED: uncharacterized protein LOC104451313    106   4e-25   
gb|KEH33922.1|  SWIB/MDM2 domain protein                              99.4    1e-21   
gb|KHN30875.1|  hypothetical protein glysoja_045269                   94.0    2e-20   
gb|KHG15894.1|  Protein TRI1                                          92.4    5e-20   
ref|XP_009789183.1|  PREDICTED: upstream activation factor subuni...  81.3    2e-15   
gb|EPS64694.1|  hypothetical protein M569_10089                       79.0    2e-15   
ref|XP_010275139.1|  PREDICTED: upstream activation factor subuni...  80.5    3e-15   
ref|NP_001235054.1|  uncharacterized protein LOC100499975             80.9    3e-15   
ref|NP_001235290.1|  uncharacterized protein LOC100306198             80.9    3e-15   
gb|AFW58245.1|  hypothetical protein ZEAMMB73_992750                  79.7    4e-15   
gb|ACU23004.1|  unknown                                               78.6    4e-15   Glycine max [soybeans]
ref|XP_006878621.1|  hypothetical protein AMTR_s00011p00260300        79.7    5e-15   
gb|EMS58405.1|  Protein TRI1                                          78.6    5e-15   
dbj|BAK03084.1|  predicted protein                                    79.3    1e-14   
ref|XP_006361226.1|  PREDICTED: upstream activation factor subuni...  78.6    1e-14   
gb|KDP39609.1|  hypothetical protein JCGZ_02629                       79.0    1e-14   
dbj|BAJ87657.1|  predicted protein                                    78.6    3e-14   
ref|XP_002270166.1|  PREDICTED: upstream activation factor subuni...  77.8    3e-14   Vitis vinifera
gb|KEH33923.1|  SWIB/MDM2 domain protein                              76.3    4e-14   
ref|XP_009631043.1|  PREDICTED: uncharacterized protein LOC104120876  78.2    5e-14   
emb|CDP07200.1|  unnamed protein product                              77.0    5e-14   
ref|XP_001766284.1|  predicted protein                                76.6    5e-14   
ref|XP_009782755.1|  PREDICTED: upstream activation factor subuni...  77.0    6e-14   
ref|XP_003612482.1|  Upstream activation factor subunit UAF30         77.0    7e-14   
ref|XP_010540712.1|  PREDICTED: upstream activation factor subuni...  76.3    8e-14   
ref|XP_004168991.1|  PREDICTED: upstream activation factor subuni...  77.0    8e-14   
gb|AFK49439.1|  unknown                                               76.6    9e-14   
ref|NP_565810.1|  SWIB/MDM2 domain-containing protein                 75.9    9e-14   Arabidopsis thaliana [mouse-ear cress]
gb|AAQ24534.1|  SWIb domain-containing protein                        77.0    9e-14   Solanum chacoense
emb|CBI22492.3|  unnamed protein product                              74.7    1e-13   
ref|XP_002879559.1|  SWIB complex BAF60b domain-containing protein    75.9    1e-13   
ref|XP_003537709.1|  PREDICTED: upstream activation factor subuni...  76.3    1e-13   
ref|XP_006847805.1|  hypothetical protein AMTR_s00029p00035130        76.3    1e-13   
ref|XP_009395451.1|  PREDICTED: upstream activation factor subuni...  75.5    2e-13   
ref|XP_003610630.1|  Upstream activation factor subunit UAF30         76.3    2e-13   
ref|XP_002272147.1|  PREDICTED: upstream activation factor subuni...  76.3    2e-13   Vitis vinifera
emb|CAN78429.1|  hypothetical protein VITISV_011142                   76.3    2e-13   Vitis vinifera
gb|EYU29119.1|  hypothetical protein MIMGU_mgv1a016400mg              75.5    2e-13   
ref|XP_006648278.1|  PREDICTED: protein TRI1-like                     75.5    2e-13   
ref|XP_004511300.1|  PREDICTED: upstream activation factor subuni...  75.9    2e-13   
gb|KHG13769.1|  Protein TRI1                                          75.9    2e-13   
ref|XP_004244435.1|  PREDICTED: upstream activation factor subuni...  75.5    2e-13   
ref|XP_010509591.1|  PREDICTED: upstream activation factor subuni...  75.1    2e-13   
ref|XP_004145013.1|  PREDICTED: upstream activation factor subuni...  75.9    2e-13   
ref|XP_009394338.1|  PREDICTED: uncharacterized protein LOC103979848  75.5    2e-13   
ref|XP_003574019.1|  PREDICTED: protein TRI1-like                     75.1    3e-13   
ref|XP_009114968.1|  PREDICTED: upstream activation factor subuni...  74.7    3e-13   
ref|XP_003517103.1|  PREDICTED: protein TRI1-like                     74.7    4e-13   
ref|XP_007158069.1|  hypothetical protein PHAVU_002G121400g           74.7    5e-13   
ref|XP_010505072.1|  PREDICTED: upstream activation factor subuni...  73.9    5e-13   
gb|KFK44945.1|  hypothetical protein AALP_AA1G323100                  73.9    7e-13   
ref|XP_006295268.1|  hypothetical protein CARUB_v10024355mg           73.6    8e-13   
ref|XP_009385884.1|  PREDICTED: upstream activation factor subuni...  73.6    8e-13   
ref|XP_009411071.1|  PREDICTED: uncharacterized protein LOC103992897  73.9    8e-13   
ref|XP_006412243.1|  hypothetical protein EUTSA_v10026522mg           73.9    1e-12   
ref|XP_002313162.1|  SWIB complex BAF60b domain-containing family...  73.6    1e-12   Populus trichocarpa [western balsam poplar]
ref|XP_010097671.1|  Upstream activation factor subunit spp27         73.2    1e-12   
emb|CDY45303.1|  BnaA03g52760D                                        73.6    1e-12   
ref|XP_011001566.1|  PREDICTED: uncharacterized protein LOC105108804  73.6    2e-12   
ref|XP_010099071.1|  Upstream activation factor subunit spp27         73.2    2e-12   
ref|XP_008366495.1|  PREDICTED: uncharacterized protein LOC103430142  73.2    2e-12   
ref|XP_004512323.1|  PREDICTED: upstream activation factor subuni...  73.2    2e-12   
ref|XP_007200577.1|  hypothetical protein PRUPE_ppa013038mg           73.2    2e-12   
ref|XP_010499717.1|  PREDICTED: upstream activation factor subuni...  72.4    2e-12   
emb|CDX72477.1|  BnaC07g44990D                                        73.2    2e-12   
ref|XP_002893684.1|  SWIB complex BAF60b domain-containing protein    72.4    2e-12   
ref|XP_010939955.1|  PREDICTED: uncharacterized protein LOC105058655  72.8    2e-12   
ref|XP_008460088.1|  PREDICTED: protein TRI1-like                     72.8    3e-12   
ref|XP_009619389.1|  PREDICTED: protein TRI1                          72.8    3e-12   
ref|XP_010460996.1|  PREDICTED: upstream activation factor subuni...  72.0    3e-12   
ref|XP_006409620.1|  hypothetical protein EUTSA_v10022904mg           72.4    4e-12   
ref|XP_002518650.1|  brg-1 associated factor, putative                72.4    4e-12   Ricinus communis
ref|NP_001045781.1|  Os02g0130000                                     72.0    4e-12   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004246013.1|  PREDICTED: upstream activation factor subuni...  72.0    4e-12   
ref|XP_009625777.1|  PREDICTED: protein TRI1-like                     71.6    5e-12   
ref|XP_009378891.1|  PREDICTED: uncharacterized protein LOC103967364  72.0    5e-12   
ref|XP_008364448.1|  PREDICTED: uncharacterized protein LOC103428126  72.0    5e-12   
ref|XP_003559112.1|  PREDICTED: upstream activation factor subuni...  72.0    5e-12   
ref|XP_007042581.1|  SWIB/MDM2 domain superfamily protein             71.6    5e-12   
ref|XP_006829241.1|  hypothetical protein AMTR_s00001p00272500        71.6    5e-12   
gb|ABK23195.1|  unknown                                               71.6    5e-12   Picea sitchensis
ref|XP_009801356.1|  PREDICTED: protein TRI1-like                     71.2    6e-12   
emb|CDY50651.1|  BnaC05g48150D                                        72.0    6e-12   
ref|XP_002298761.1|  SWIB complex BAF60b domain-containing family...  71.6    6e-12   Populus trichocarpa [western balsam poplar]
emb|CDY47689.1|  BnaCnng15310D                                        71.2    6e-12   
ref|XP_011030373.1|  PREDICTED: protein TRI1-like                     71.6    7e-12   
emb|CDY69869.1|  BnaCnng65730D                                        71.6    7e-12   
ref|XP_011071994.1|  PREDICTED: upstream activation factor subuni...  70.9    8e-12   
ref|XP_009145233.1|  PREDICTED: upstream activation factor subuni...  70.9    8e-12   
ref|XP_004136946.1|  PREDICTED: upstream activation factor subuni...  71.6    8e-12   
ref|XP_009113880.1|  PREDICTED: protein TRI1                          71.2    8e-12   
ref|XP_010277138.1|  PREDICTED: uncharacterized protein LOC104611668  71.6    8e-12   
gb|AID60143.1|  SWIB/MDM2 domain superfamily protein                  71.2    8e-12   
ref|XP_009138278.1|  PREDICTED: upstream activation factor subuni...  71.2    1e-11   
ref|XP_008438197.1|  PREDICTED: upstream activation factor subuni...  71.6    1e-11   
gb|KDP44460.1|  hypothetical protein JCGZ_16293                       70.9    1e-11   
gb|KHG22078.1|  Upstream activation factor subunit UAF30              71.2    1e-11   
ref|XP_002463848.1|  hypothetical protein SORBIDRAFT_01g007350        70.9    1e-11   Sorghum bicolor [broomcorn]
ref|XP_008354803.1|  PREDICTED: protein TRI1-like                     70.9    1e-11   
ref|NP_564382.1|  SWIB/MDM2 domain-containing protein                 70.1    1e-11   Arabidopsis thaliana [mouse-ear cress]
gb|AAK62445.1|AF387000_1  putative protein                            70.9    1e-11   Arabidopsis thaliana [mouse-ear cress]
ref|NP_195155.1|  SWIB/MDM2 domain-containing protein                 70.9    1e-11   Arabidopsis thaliana [mouse-ear cress]
gb|EEC69349.1|  hypothetical protein OsI_38464                        69.3    1e-11   Oryza sativa Indica Group [Indian rice]
ref|XP_007040857.1|  SWIB/MDM2 domain superfamily protein             70.1    1e-11   
gb|AAM62986.1|  unknown                                               70.9    1e-11   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009130373.1|  PREDICTED: protein TRI1                          70.9    2e-11   
gb|KHG30093.1|  Upstream activation factor subunit UAF30              70.1    2e-11   
ref|XP_008232208.1|  PREDICTED: upstream activation factor subuni...  70.9    2e-11   
ref|XP_008805671.1|  PREDICTED: upstream activation factor subuni...  70.1    2e-11   
ref|XP_010918651.1|  PREDICTED: protein TRI1-like                     70.1    2e-11   
ref|XP_007218559.1|  hypothetical protein PRUPE_ppa012921mg           70.9    2e-11   
emb|CDY51761.1|  BnaA05g32850D                                        70.5    2e-11   
ref|XP_010675600.1|  PREDICTED: upstream activation factor subuni...  70.1    2e-11   
dbj|BAJ94258.1|  predicted protein                                    70.5    2e-11   
gb|EAY84337.1|  hypothetical protein OsI_05714                        70.1    2e-11   Oryza sativa Indica Group [Indian rice]
ref|XP_009380089.1|  PREDICTED: protein TRI1-like                     70.5    2e-11   
ref|XP_006415306.1|  hypothetical protein EUTSA_v10008891mg           70.9    2e-11   
ref|XP_010271723.1|  PREDICTED: uncharacterized protein LOC104607719  70.1    2e-11   
ref|XP_004962921.1|  PREDICTED: upstream activation factor subuni...  70.5    2e-11   
ref|XP_006408288.1|  hypothetical protein EUTSA_v10021710mg           70.1    2e-11   
ref|XP_010530721.1|  PREDICTED: upstream activation factor subuni...  70.1    3e-11   
ref|XP_010943392.1|  PREDICTED: upstream activation factor subuni...  69.3    3e-11   
ref|XP_010065391.1|  PREDICTED: zinc finger CCCH domain-containin...  69.7    3e-11   
ref|XP_002869158.1|  hypothetical protein ARALYDRAFT_491238           70.1    3e-11   
ref|XP_006410720.1|  hypothetical protein EUTSA_v10017454mg           69.3    3e-11   
ref|NP_001143368.1|  uncharacterized protein LOC100275998             69.7    3e-11   Zea mays [maize]
ref|XP_010517878.1|  PREDICTED: upstream activation factor subuni...  69.7    3e-11   
emb|CDX76269.1|  BnaA08g11310D                                        68.6    3e-11   
ref|XP_006298767.1|  hypothetical protein CARUB_v10014869mg           69.7    3e-11   
emb|CDP07628.1|  unnamed protein product                              70.1    3e-11   
ref|XP_006303413.1|  hypothetical protein CARUB_v10010619mg           69.3    4e-11   
ref|XP_010488931.1|  PREDICTED: upstream activation factor subuni...  69.7    4e-11   
ref|XP_010447106.1|  PREDICTED: upstream activation factor subuni...  69.7    4e-11   
ref|XP_010432435.1|  PREDICTED: upstream activation factor subuni...  69.7    4e-11   
ref|XP_004133931.1|  PREDICTED: uncharacterized protein LOC101218027  70.1    4e-11   
gb|AFW67548.1|  SWIb domain-containing protein                        69.7    4e-11   
ref|XP_002979782.1|  hypothetical protein SELMODRAFT_59520            68.2    4e-11   
ref|XP_010065937.1|  PREDICTED: zinc finger CCCH domain-containin...  69.7    4e-11   
ref|XP_010496487.1|  PREDICTED: upstream activation factor subuni...  69.3    4e-11   
ref|XP_010437637.1|  PREDICTED: upstream activation factor subuni...  69.3    4e-11   
ref|XP_011086668.1|  PREDICTED: upstream activation factor subuni...  69.3    4e-11   
gb|EMS58614.1|  Protein TRI1                                          68.2    4e-11   
ref|XP_008780890.1|  PREDICTED: uncharacterized protein LOC103700804  69.3    5e-11   
ref|XP_009376300.1|  PREDICTED: upstream activation factor subuni...  69.3    5e-11   
ref|XP_010547959.1|  PREDICTED: protein TRI1-like                     69.3    5e-11   
ref|XP_010939095.1|  PREDICTED: uncharacterized protein LOC105058027  69.3    5e-11   
gb|ADE77352.1|  unknown                                               68.9    6e-11   
ref|XP_008455019.1|  PREDICTED: uncharacterized protein LOC103495293  69.3    6e-11   
gb|KFK39989.1|  hypothetical protein AALP_AA3G315600                  68.2    6e-11   
gb|KFK30067.1|  hypothetical protein AALP_AA7G212300                  68.9    7e-11   
gb|KDO72266.1|  hypothetical protein CISIN_1g048564mg                 68.2    7e-11   
ref|XP_009396701.1|  PREDICTED: protein TRI1-like                     68.6    7e-11   
gb|KFK37792.1|  hypothetical protein AALP_AA3G029600                  68.6    8e-11   
ref|XP_009804463.1|  PREDICTED: protein TRI1-like                     68.9    8e-11   
gb|EYU37600.1|  hypothetical protein MIMGU_mgv1a015703mg              68.6    9e-11   
ref|XP_008790633.1|  PREDICTED: uncharacterized protein LOC103707776  68.6    9e-11   
ref|XP_010437638.1|  PREDICTED: protein TRI1-like                     67.4    9e-11   
ref|XP_009594988.1|  PREDICTED: uncharacterized protein LOC104091364  68.6    1e-10   
gb|AAK63939.1|AC084282_20  hypothetical protein                       68.6    1e-10   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006430903.1|  hypothetical protein CICLE_v10013159mg           67.8    1e-10   
ref|XP_004289737.1|  PREDICTED: uncharacterized protein LOC101294411  68.6    1e-10   
ref|XP_008792695.1|  PREDICTED: upstream activation factor subuni...  71.2    1e-10   
ref|XP_008792693.1|  PREDICTED: upstream activation factor subuni...  71.2    1e-10   
ref|XP_007157220.1|  hypothetical protein PHAVU_002G052700g           68.2    1e-10   
ref|XP_006664582.1|  PREDICTED: upstream activation factor subuni...  68.6    1e-10   
gb|EMT15267.1|  hypothetical protein F775_31925                       66.6    1e-10   
emb|CDY12300.1|  BnaA09g25000D                                        67.0    2e-10   
ref|XP_006482358.1|  PREDICTED: protein TRI1-like                     66.6    2e-10   
emb|CDY49157.1|  BnaA09g25180D                                        66.2    3e-10   
ref|XP_006422864.1|  hypothetical protein CICLE_v10029545mg           67.0    3e-10   
ref|XP_006346331.1|  PREDICTED: protein TRI1-like                     67.0    3e-10   
ref|XP_010512159.1|  PREDICTED: protein TRI1-like                     67.0    3e-10   
emb|CDO97251.1|  unnamed protein product                              65.5    4e-10   
ref|XP_009361364.1|  PREDICTED: upstream activation factor subuni...  67.0    4e-10   
ref|XP_008790042.1|  PREDICTED: protein TRI1-like                     67.0    4e-10   
ref|XP_004230716.1|  PREDICTED: protein TRI1                          67.0    4e-10   
ref|XP_006298716.1|  hypothetical protein CARUB_v10014811mg           67.0    4e-10   
gb|AAL91165.1|  unknown protein                                       66.6    4e-10   Arabidopsis thaliana [mouse-ear cress]
ref|NP_565366.1|  SWIB/MDM2 domain-containing protein                 66.6    4e-10   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006298715.1|  hypothetical protein CARUB_v10014811mg           67.0    5e-10   
ref|XP_006437339.1|  hypothetical protein CICLE_v10033040mg           66.6    5e-10   
ref|XP_002885945.1|  SWIB complex BAF60b domain-containing protein    66.6    5e-10   
ref|XP_010549735.1|  PREDICTED: protein TRI1                          66.6    5e-10   
ref|XP_004981679.1|  PREDICTED: upstream activation factor subuni...  66.6    5e-10   
gb|AAM65680.1|  unknown                                               66.6    5e-10   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010463811.1|  PREDICTED: protein TRI1-like                     66.6    5e-10   
ref|NP_566210.1|  SWIB/MDM2 domain-containing protein                 66.2    6e-10   Arabidopsis thaliana [mouse-ear cress]
gb|AAM65610.1|  unknown                                               66.2    6e-10   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010052662.1|  PREDICTED: upstream activation factor subuni...  66.2    6e-10   
gb|EYU40109.1|  hypothetical protein MIMGU_mgv1a015844mg              66.2    7e-10   
ref|XP_002884397.1|  hypothetical protein ARALYDRAFT_477604           66.2    7e-10   
ref|XP_009409923.1|  PREDICTED: protein TRI1-like                     65.9    7e-10   
ref|WP_038322481.1|  hypothetical protein                             64.7    8e-10   
ref|XP_010679574.1|  PREDICTED: upstream activation factor subuni...  65.9    9e-10   
ref|XP_002523973.1|  brg-1 associated factor, putative                65.9    9e-10   Ricinus communis
ref|XP_008776796.1|  PREDICTED: protein TRI1-like                     65.5    1e-09   
ref|XP_011092525.1|  PREDICTED: upstream activation factor subuni...  65.5    1e-09   
ref|XP_003576058.1|  PREDICTED: zinc finger CCCH domain-containin...  65.9    1e-09   
ref|XP_010485702.1|  PREDICTED: protein TRI1-like                     65.5    1e-09   
ref|NP_001150804.1|  LOC100284437                                     65.1    2e-09   Zea mays [maize]
ref|XP_002443244.1|  hypothetical protein SORBIDRAFT_08g016260        64.7    2e-09   Sorghum bicolor [broomcorn]
ref|XP_002319215.1|  SWIB complex BAF60b domain-containing family...  64.3    2e-09   Populus trichocarpa [western balsam poplar]
ref|WP_002629076.1|  DNA topoisomerase III                            63.9    2e-09   
ref|XP_006375957.1|  hypothetical protein POPTR_0013s06780g           64.3    3e-09   
gb|EPS69753.1|  hypothetical protein M569_05012                       64.3    3e-09   
gb|EPS70894.1|  hypothetical protein M569_03867                       62.4    6e-09   
ref|WP_012792346.1|  hypothetical protein                             62.8    6e-09   
ref|WP_025918383.1|  hypothetical protein                             62.8    6e-09   
ref|XP_004307291.1|  PREDICTED: upstream activation factor subuni...  63.5    6e-09   
gb|EMS67367.1|  Upstream activation factor subunit spp27              66.6    6e-09   
gb|EMT28995.1|  hypothetical protein F775_31871                       65.1    8e-09   
ref|XP_006286261.1|  hypothetical protein CARUB_v10007836mg           63.2    9e-09   
ref|XP_007720699.1|  hypothetical protein A1O1_01596                  65.1    1e-08   
gb|EYU27179.1|  hypothetical protein MIMGU_mgv1a016089mg              62.8    1e-08   
ref|XP_006650641.1|  PREDICTED: upstream activation factor subuni...  65.5    1e-08   
gb|EGA73010.1|  Uaf30p                                                63.9    1e-08   
gb|EGA84739.1|  Uaf30p                                                63.9    1e-08   
ref|XP_001613775.1|  hypothetical protein                             62.8    1e-08   
ref|NP_001147217.1|  SWIb domain-containing protein                   61.2    1e-08   
gb|EGA56803.1|  Uaf30p                                                63.5    2e-08   
ref|NP_014938.3|  Uaf30p                                              63.5    2e-08   
ref|XP_008792593.1|  PREDICTED: upstream activation factor subuni...  64.3    2e-08   
gb|EWG83364.1|  Uaf30p                                                63.5    2e-08   
gb|EDN63620.1|  upstream activation factor subunit                    63.5    2e-08   
ref|XP_008792594.1|  PREDICTED: upstream activation factor subuni...  64.3    2e-08   
ref|XP_009397729.1|  PREDICTED: upstream activation factor subuni...  65.1    2e-08   
ref|XP_008867795.1|  hypothetical protein H310_04980                  64.7    2e-08   
ref|WP_005877961.1|  hypothetical protein                             61.6    2e-08   
ref|XP_002270707.1|  PREDICTED: upstream activation factor subuni...  61.6    2e-08   
gb|ACN58982.1|  SWIB complex BAF60b                                   62.0    2e-08   
ref|XP_011004935.1|  PREDICTED: upstream activation factor subuni...  61.6    2e-08   
ref|XP_009838176.1|  hypothetical protein H257_12602                  64.7    2e-08   
ref|WP_025539118.1|  hypothetical protein                             61.6    2e-08   
ref|WP_036170146.1|  hypothetical protein                             60.5    2e-08   
ref|XP_010905630.1|  PREDICTED: upstream activation factor subuni...  64.3    2e-08   
ref|XP_010905631.1|  PREDICTED: upstream activation factor subuni...  64.3    2e-08   
ref|WP_019923150.1|  hypothetical protein                             62.0    2e-08   
gb|ABF99032.1|  SWIB complex BAF60b domain-containing protein, pu...  64.3    3e-08   
gb|EDZ69123.1|  YOR295Wp-like protein                                 63.2    3e-08   
ref|XP_008792591.1|  PREDICTED: upstream activation factor subuni...  64.3    3e-08   
ref|XP_008792590.1|  PREDICTED: upstream activation factor subuni...  64.3    3e-08   
ref|XP_011088175.1|  PREDICTED: upstream activation factor subuni...  61.6    3e-08   
ref|XP_008815152.1|  hypothetical protein C922_01324                  61.6    3e-08   
ref|WP_008452147.1|  SWIB/MDM2 domain containing protein              61.2    3e-08   
ref|WP_014394388.1|  hypothetical protein                             60.8    3e-08   
gb|EGA60609.1|  Uaf30p                                                63.5    3e-08   
ref|WP_015090474.1|  hypothetical protein                             61.2    4e-08   
ref|WP_026354157.1|  hypothetical protein                             60.8    4e-08   
ref|WP_027996918.1|  hypothetical protein                             60.5    4e-08   
ref|XP_002259633.1|  hypothetical protein, conserved in Plasmodiu...  60.8    4e-08   
ref|XP_009771309.1|  PREDICTED: upstream activation factor subuni...  60.8    4e-08   
ref|XP_010941848.1|  PREDICTED: upstream activation factor subuni...  63.5    5e-08   
ref|WP_011163832.1|  hypothetical protein                             60.8    5e-08   
ref|WP_010401369.1|  hypothetical protein                             60.8    5e-08   
ref|XP_010941846.1|  PREDICTED: upstream activation factor subuni...  63.5    5e-08   
ref|XP_010941845.1|  PREDICTED: upstream activation factor subuni...  63.5    5e-08   
emb|CDG81377.1|  SWIB/MDM2 domain protein                             60.5    5e-08   
ref|WP_007187393.1|  hypothetical protein                             60.1    5e-08   
ref|WP_039140588.1|  hypothetical protein                             60.8    5e-08   
ref|XP_009803136.1|  PREDICTED: upstream activation factor subuni...  63.5    5e-08   
ref|XP_009626587.1|  PREDICTED: upstream activation factor subuni...  60.8    6e-08   
emb|CCX32309.1|  Similar to Upstream activation factor subunit sp...  63.5    6e-08   
ref|XP_010229398.1|  PREDICTED: upstream activation factor subuni...  63.2    6e-08   
ref|XP_003558997.1|  PREDICTED: upstream activation factor subuni...  63.2    6e-08   
ref|XP_009587440.1|  PREDICTED: upstream activation factor subuni...  63.2    6e-08   
ref|WP_008116321.1|  hypothetical protein                             60.8    6e-08   
ref|XP_009803137.1|  PREDICTED: protein TRI1-like isoform X2          63.2    6e-08   
ref|WP_015347253.1|  DNA topoisomerase domain-containing protein      60.1    6e-08   
ref|XP_011001190.1|  PREDICTED: upstream activation factor subuni...  63.5    7e-08   
ref|XP_011001193.1|  PREDICTED: upstream activation factor subuni...  63.2    7e-08   
ref|XP_011001192.1|  PREDICTED: protein TRI1-like isoform X2          63.2    8e-08   
ref|XP_004222832.1|  hypothetical protein PCYB_102350                 60.5    8e-08   
ref|XP_010255131.1|  PREDICTED: upstream activation factor subuni...  62.8    8e-08   
gb|ACN26234.1|  unknown                                               58.9    9e-08   
ref|XP_004290311.1|  PREDICTED: upstream activation factor subuni...  63.2    9e-08   
gb|KFA92644.1|  hypothetical protein Q664_13625                       59.7    9e-08   
gb|ETB62389.1|  hypothetical protein YYC_00971                        60.1    9e-08   
ref|WP_020701133.1|  hypothetical protein                             58.9    9e-08   
ref|WP_035375261.1|  hypothetical protein                             58.9    9e-08   
ref|XP_002986194.1|  hypothetical protein SELMODRAFT_123621           59.3    9e-08   
ref|WP_025498515.1|  hypothetical protein                             59.7    9e-08   
ref|WP_028253485.1|  hypothetical protein                             60.1    1e-07   
ref|WP_012414917.1|  hypothetical protein                             58.9    1e-07   
ref|XP_009626588.1|  PREDICTED: upstream activation factor subuni...  60.1    1e-07   
ref|WP_028079575.1|  hypothetical protein                             59.7    1e-07   
emb|CDU19526.1|  SWIB/MDM2 domain-containing protein, putative        59.7    1e-07   
gb|ACG24534.1|  SWIb domain-containing protein                        59.7    1e-07   
ref|WP_013542341.1|  hypothetical protein                             60.1    1e-07   
ref|XP_007681798.1|  hypothetical protein BAUCODRAFT_127412           62.0    1e-07   
gb|EGA76635.1|  Uaf30p                                                61.2    1e-07   
ref|XP_002521839.1|  brg-1 associated factor, putative                63.2    1e-07   
gb|ACG36570.1|  SWIb domain-containing protein                        59.7    1e-07   
ref|NP_001150291.1|  LOC100283921 precursor                           59.7    1e-07   
ref|WP_027100687.1|  hypothetical protein                             58.9    1e-07   
ref|XP_010263743.1|  PREDICTED: upstream activation factor subuni...  62.4    1e-07   
ref|WP_026172117.1|  hypothetical protein                             59.7    1e-07   
gb|KGF79406.1|  hypothetical protein IA69_24280                       59.7    1e-07   
ref|XP_006406538.1|  hypothetical protein EUTSA_v10020944mg           62.4    1e-07   
ref|XP_010263742.1|  PREDICTED: upstream activation factor subuni...  62.4    1e-07   
ref|WP_034300844.1|  hypothetical protein                             58.5    1e-07   
ref|XP_010263744.1|  PREDICTED: upstream activation factor subuni...  62.0    1e-07   
gb|KDP31884.1|  hypothetical protein JCGZ_12345                       62.4    1e-07   
ref|XP_010263746.1|  PREDICTED: upstream activation factor subuni...  62.0    1e-07   
gb|KEH27539.1|  upstream activation factor subunit UAF30, putative    61.6    1e-07   
ref|WP_036251082.1|  hypothetical protein                             58.2    1e-07   
ref|XP_010999862.1|  PREDICTED: upstream activation factor subuni...  62.4    2e-07   
ref|XP_010999870.1|  PREDICTED: upstream activation factor subuni...  62.4    2e-07   
ref|XP_001904978.1|  hypothetical protein                             61.2    2e-07   
gb|KIF81894.1|  hypothetical protein TSA66_15570                      59.7    2e-07   
gb|AHG89601.1|  SWIB/MDM2 domain-containing protein                   59.7    2e-07   
ref|XP_006366602.1|  PREDICTED: uncharacterized protein LOC102593466  59.3    2e-07   
ref|XP_010999856.1|  PREDICTED: uncharacterized protein PFB0145c-...  62.4    2e-07   
ref|XP_010999846.1|  PREDICTED: uncharacterized protein PFB0145c-...  62.4    2e-07   
ref|NP_001132227.1|  uncharacterized protein LOC100193662             59.3    2e-07   
ref|XP_010999877.1|  PREDICTED: upstream activation factor subuni...  62.0    2e-07   
ref|XP_006361626.1|  PREDICTED: uncharacterized protein LOC102582026  59.3    2e-07   
ref|WP_028357728.1|  hypothetical protein                             58.2    2e-07   
gb|ACF80995.1|  unknown                                               58.9    2e-07   
ref|XP_010999905.1|  PREDICTED: upstream activation factor subuni...  62.0    2e-07   
gb|KFI05884.1|  hypothetical protein JN27_17275                       58.9    2e-07   
ref|WP_038498581.1|  hypothetical protein                             57.8    2e-07   
gb|EWM22046.1|  swib complex baf60b domain-containing protein         59.3    2e-07   
ref|XP_008236631.1|  PREDICTED: upstream activation factor subuni...  61.6    2e-07   
ref|XP_003611801.1|  Upstream activation factor subunit spp27         61.6    2e-07   
ref|XP_008236632.1|  PREDICTED: upstream activation factor subuni...  61.6    2e-07   
ref|WP_029363443.1|  hypothetical protein                             58.9    2e-07   
emb|CDI74881.1|  SWIB/MDM2 domain-containing protein, putative        60.8    2e-07   
ref|XP_004178696.1|  hypothetical protein TBLA_0B03360                60.5    2e-07   
gb|AES94759.2|  upstream activation factor subunit UAF30, putative    61.2    3e-07   
gb|KFC71144.1|  hypothetical protein FG94_02389                       58.5    3e-07   
gb|ETW31931.1|  hypothetical protein PFFCH_00715                      58.9    3e-07   
ref|XP_003537360.1|  PREDICTED: upstream activation factor subuni...  61.2    3e-07   
ref|XP_007199917.1|  hypothetical protein PRUPE_ppa007326mg           61.6    3e-07   
gb|KDP38240.1|  hypothetical protein JCGZ_04883                       60.1    3e-07   
emb|CDO63060.1|  SWIB/MDM2 domain-containing protein, putative        58.5    3e-07   
tpg|DAA51565.1|  TPA: hypothetical protein ZEAMMB73_913346            60.5    3e-07   
ref|XP_006393249.1|  hypothetical protein EUTSA_v10011568mg           61.6    3e-07   
ref|WP_019574588.1|  MULTISPECIES: hypothetical protein               58.9    3e-07   
ref|XP_002808698.1|  conserved Plasmodium protein, unknown function   58.5    3e-07   
ref|WP_005665240.1|  hypothetical protein                             58.5    3e-07   
ref|XP_007928856.1|  hypothetical protein MYCFIDRAFT_56639            60.5    3e-07   
ref|WP_020648826.1|  hypothetical protein                             58.2    4e-07   
ref|WP_028006640.1|  hypothetical protein                             58.2    4e-07   
ref|WP_036238191.1|  hypothetical protein                             57.0    4e-07   
ref|WP_035787740.1|  hypothetical protein                             57.0    4e-07   
ref|WP_018715118.1|  hypothetical protein                             57.4    4e-07   
gb|KDO79318.1|  hypothetical protein CISIN_1g0196442mg                58.9    4e-07   
gb|KDO79319.1|  hypothetical protein CISIN_1g0196442mg                58.9    4e-07   
ref|XP_003665329.1|  hypothetical protein MYCTH_2308924               60.1    4e-07   
ref|WP_019141960.1|  hypothetical protein                             58.5    5e-07   
ref|WP_019653319.1|  hypothetical protein                             58.2    5e-07   
gb|ACJ85465.1|  unknown                                               60.5    5e-07   
ref|WP_012747003.1|  MULTISPECIES: hypothetical protein               58.2    5e-07   
ref|WP_007832487.1|  hypothetical protein                             58.2    5e-07   
ref|NP_001148210.1|  SWIB/MDM2 domain containing protein              60.5    5e-07   
ref|XP_002883161.1|  SWIB complex BAF60b domain-containing protein    60.8    5e-07   
gb|KDB17672.1|  SWIB/MDM2 domain protein                              60.1    5e-07   
ref|WP_035406695.1|  hypothetical protein                             57.0    5e-07   
ref|WP_006713223.1|  hypothetical protein                             57.0    5e-07   
ref|XP_010500494.1|  PREDICTED: upstream activation factor subuni...  60.8    5e-07   
ref|XP_002313088.2|  hypothetical protein POPTR_0009s10990g           59.7    5e-07   
ref|WP_038201150.1|  hypothetical protein                             57.8    5e-07   
gb|KDO79317.1|  hypothetical protein CISIN_1g0196442mg                58.9    6e-07   
ref|XP_010461790.1|  PREDICTED: upstream activation factor subuni...  60.5    6e-07   
ref|WP_034746563.1|  hypothetical protein                             56.6    6e-07   
gb|EKG14615.1|  hypothetical protein MPH_08195                        61.2    6e-07   
ref|WP_034780270.1|  MULTISPECIES: hypothetical protein               56.6    6e-07   
ref|WP_028789168.1|  hypothetical protein                             57.8    6e-07   
ref|WP_007417264.1|  SWIB/MDM2 domain protein                         57.0    6e-07   
ref|XP_010461791.1|  PREDICTED: upstream activation factor subuni...  60.5    6e-07   
ref|WP_011872152.1|  hypothetical protein                             57.8    6e-07   
gb|ESA19797.1|  hypothetical protein GLOINDRAFT_133123                60.5    6e-07   
gb|AFW67527.1|  hypothetical protein ZEAMMB73_352797                  60.1    7e-07   
emb|CCF34198.1|  DEK C terminal domain-containing protein             59.7    7e-07   
ref|WP_038101062.1|  hypothetical protein                             57.4    7e-07   
ref|WP_034379509.1|  hypothetical protein                             56.6    7e-07   
emb|CDS49551.1|  SWIB/MDM2 domain-containing protein, putative        57.4    7e-07   
gb|EZP41701.1|  SWIB/MDM2 domain containing protein                   56.2    7e-07   
gb|KDD74104.1|  hypothetical protein H632_c1567p0                     58.2    7e-07   
ref|WP_026779659.1|  hypothetical protein                             56.6    8e-07   
ref|NP_001147426.1|  LOC100281035                                     60.1    8e-07   
emb|CDJ59482.1|  SWIB/MDM2 domain-containing protein, putative        58.5    8e-07   
gb|KFH17132.1|  DNA topoisomerase domain-containing protein           59.3    8e-07   
gb|KFH11532.1|  DNA topoisomerase domain-containing protein           59.3    8e-07   
ref|XP_008882692.1|  DNA topoisomerase domain-containing protein      59.3    8e-07   
gb|KFG51544.1|  DNA topoisomerase domain-containing protein           58.9    9e-07   
gb|ELT93618.1|  hypothetical protein CAPTEDRAFT_227075                58.2    9e-07   
ref|XP_006303686.1|  hypothetical protein CARUB_v10011771mg           60.1    9e-07   
gb|EPR64572.1|  DNA topoisomerase domain-containing protein           58.9    9e-07   
ref|XP_002365994.1|  SWIB/MDM2 domain-containing protein              58.9    9e-07   
gb|EKC98869.1|  hypothetical protein A1Q2_06840                       58.5    9e-07   
ref|XP_009774095.1|  PREDICTED: upstream activation factor subuni...  59.7    1e-06   
gb|ABK24867.1|  unknown                                               59.3    1e-06   
ref|XP_002453249.1|  hypothetical protein SORBIDRAFT_04g002500        57.0    1e-06   
ref|XP_004170902.1|  PREDICTED: uncharacterized protein LOC101226406  58.5    1e-06   
ref|XP_009774096.1|  PREDICTED: upstream activation factor subuni...  59.7    1e-06   
emb|CDX99270.1|  BnaC05g33850D                                        59.7    1e-06   
ref|XP_003883626.1|  hypothetical protein NCLIV_033810                58.5    1e-06   
ref|WP_012080835.1|  hypothetical protein                             57.0    1e-06   
emb|CDJ37337.1|  SWIB/MDM2 domain-containing protein, putative        59.3    1e-06   
gb|EJT49862.1|  hypothetical protein A1Q1_01014                       58.5    1e-06   
gb|AGT16365.1|  SWIB/MDM2 domain containing protein                   59.3    1e-06   
ref|XP_002466401.1|  hypothetical protein SORBIDRAFT_01g007140        59.3    1e-06   
ref|WP_036211656.1|  MULTISPECIES: hypothetical protein               55.8    1e-06   
ref|WP_037483647.1|  hypothetical protein                             56.6    1e-06   
gb|ACO10826.1|  Upstream activation factor subunit UAF30              58.2    1e-06   
ref|WP_019936850.1|  SWIB (YM74) complex protein                      55.8    1e-06   
gb|KDO35066.1|  hypothetical protein SPRG_01130                       59.3    1e-06   
ref|XP_005716867.1|  unnamed protein product                          58.9    1e-06   
ref|XP_009629952.1|  PREDICTED: upstream activation factor subuni...  59.3    1e-06   
ref|XP_006384456.1|  SWIB complex BAF60b domain-containing family...  59.3    1e-06   
gb|KCB21047.1|  SWIB/MDM2 domain protein                              56.2    1e-06   
gb|KHD87652.1|  hypothetical protein OM95_13235                       56.6    1e-06   
ref|XP_009145829.1|  PREDICTED: uncharacterized protein LOC103869495  59.3    1e-06   
ref|XP_009629951.1|  PREDICTED: upstream activation factor subuni...  58.9    2e-06   
gb|EUD72345.1|  hypothetical protein YYG_02246                        56.6    2e-06   
ref|XP_004952016.1|  PREDICTED: upstream activation factor subuni...  56.6    2e-06   
emb|CDJ69026.1|  SWIB/MDM2 domain-containing protein, putative        58.9    2e-06   
ref|XP_004230795.1|  PREDICTED: upstream activation factor subuni...  58.9    2e-06   
emb|CDX92300.1|  BnaA05g21070D                                        59.3    2e-06   
ref|WP_011551643.1|  MULTISPECIES: hypothetical protein               55.8    2e-06   
gb|ACO10693.1|  Upstream activation factor subunit UAF30              58.2    2e-06   
ref|WP_013232417.1|  hypothetical protein                             57.0    2e-06   
gb|EJL91745.1|  SWIB domain-containing protein possibly involved ...  56.6    2e-06   
emb|CDR14881.1|  SWIB/MDM2 domain-containing protein, putative        56.2    2e-06   
ref|XP_008623571.1|  hypothetical protein YYE_01671                   56.2    2e-06   
gb|AGT16808.1|  SWIB/MDM2 domain containing protein                   58.9    2e-06   
ref|XP_002985006.1|  hypothetical protein SELMODRAFT_121478           58.5    2e-06   
ref|XP_006425831.1|  hypothetical protein CICLE_v10026010mg           58.9    2e-06   
ref|WP_038493199.1|  hypothetical protein                             56.2    2e-06   
ref|WP_012522617.1|  SWIB-domain-containing protein implicated in...  55.5    2e-06   
gb|EWG44839.1|  hypothetical protein FVEG_05817                       58.2    2e-06   
ref|XP_008457882.1|  PREDICTED: upstream activation factor subuni...  58.5    2e-06   
gb|EPS57960.1|  hypothetical protein M569_16857                       57.0    2e-06   
ref|XP_011099216.1|  PREDICTED: upstream activation factor subuni...  58.5    2e-06   
ref|WP_005881720.1|  hypothetical protein                             55.8    2e-06   
ref|XP_010536330.1|  PREDICTED: synaptonemal complex protein 1 is...  59.3    2e-06   



>gb|ABE11612.1| SWIb domain-containing protein [Solanum chacoense]
Length=100

 Score =   170 bits (431),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 79/97 (81%), Positives = 88/97 (91%), Gaps = 0/97 (0%)
 Frame = -1

Query  706  MLPHKMKSFVAENPKKLGNLINLVNLPSALRDFMGQSQTSRLGCFKRIWSYIKENNLQDP  527
            MLP +MK  + +NPKKL NLI+LVNLPS LR+FMGQSQTSRLGCFKR+WSYIKENNLQDP
Sbjct  1    MLPQRMKKVMTDNPKKLANLIDLVNLPSTLREFMGQSQTSRLGCFKRVWSYIKENNLQDP  60

Query  526  NNKNLVNCDEKLKSILLGKSQVDLAELPALLKLHFPK  416
            NNKNLVNCDEKLKS+LLGK QV+L ELP L+KLHFPK
Sbjct  61   NNKNLVNCDEKLKSVLLGKPQVELTELPTLIKLHFPK  97



>ref|XP_009598334.1| PREDICTED: upstream activation factor subunit spp27 [Nicotiana 
tomentosiformis]
 ref|XP_009598335.1| PREDICTED: upstream activation factor subunit spp27 [Nicotiana 
tomentosiformis]
 ref|XP_009598336.1| PREDICTED: upstream activation factor subunit spp27 [Nicotiana 
tomentosiformis]
 ref|XP_009770630.1| PREDICTED: upstream activation factor subunit spp27 isoform X1 
[Nicotiana sylvestris]
 ref|XP_009770631.1| PREDICTED: upstream activation factor subunit spp27 isoform X1 
[Nicotiana sylvestris]
 ref|XP_009770632.1| PREDICTED: upstream activation factor subunit spp27 isoform X1 
[Nicotiana sylvestris]
Length=100

 Score =   170 bits (430),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 80/97 (82%), Positives = 88/97 (91%), Gaps = 0/97 (0%)
 Frame = -1

Query  706  MLPHKMKSFVAENPKKLGNLINLVNLPSALRDFMGQSQTSRLGCFKRIWSYIKENNLQDP  527
            MLP +MK  + +NPKKL NLI+LVNLPS LR+FMGQSQTSRLGCFKR+WSYIKENNLQDP
Sbjct  1    MLPQRMKKAMTDNPKKLANLIDLVNLPSTLREFMGQSQTSRLGCFKRVWSYIKENNLQDP  60

Query  526  NNKNLVNCDEKLKSILLGKSQVDLAELPALLKLHFPK  416
            NNKNLVNCDEKLKSILLGK QV+L ELP L+KLHFPK
Sbjct  61   NNKNLVNCDEKLKSILLGKPQVELTELPTLIKLHFPK  97



>ref|XP_004244091.1| PREDICTED: upstream activation factor subunit spp27 [Solanum 
lycopersicum]
Length=100

 Score =   169 bits (429),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 78/97 (80%), Positives = 88/97 (91%), Gaps = 0/97 (0%)
 Frame = -1

Query  706  MLPHKMKSFVAENPKKLGNLINLVNLPSALRDFMGQSQTSRLGCFKRIWSYIKENNLQDP  527
            MLP +MK  + +NPKKL NLI+LVNLPS LR+FMGQSQTSRLGCFKR+WSYIKENNLQDP
Sbjct  1    MLPQRMKKVMTDNPKKLANLIDLVNLPSTLREFMGQSQTSRLGCFKRVWSYIKENNLQDP  60

Query  526  NNKNLVNCDEKLKSILLGKSQVDLAELPALLKLHFPK  416
            NNKNLVNCDEKLK++LLGK QV+L ELP L+KLHFPK
Sbjct  61   NNKNLVNCDEKLKTVLLGKPQVELTELPTLIKLHFPK  97



>ref|XP_010060279.1| PREDICTED: upstream activation factor subunit UAF30-like [Eucalyptus 
grandis]
 gb|KCW66906.1| hypothetical protein EUGRSUZ_F00653 [Eucalyptus grandis]
 gb|KCW66907.1| hypothetical protein EUGRSUZ_F00653 [Eucalyptus grandis]
 gb|KCW66908.1| hypothetical protein EUGRSUZ_F00653 [Eucalyptus grandis]
Length=100

 Score =   168 bits (426),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 79/97 (81%), Positives = 89/97 (92%), Gaps = 0/97 (0%)
 Frame = -1

Query  706  MLPHKMKSFVAENPKKLGNLINLVNLPSALRDFMGQSQTSRLGCFKRIWSYIKENNLQDP  527
            MLP +MK  VA+NPKKL NLI+LVNLPS +RDF+GQSQTSRLGCF R+WSYIK NNLQDP
Sbjct  1    MLPQRMKRAVADNPKKLANLIDLVNLPSTVRDFVGQSQTSRLGCFMRVWSYIKSNNLQDP  60

Query  526  NNKNLVNCDEKLKSILLGKSQVDLAELPALLKLHFPK  416
            +NKNLVNCDEKLKSILLGK QV+LAELPAL++LHFPK
Sbjct  61   SNKNLVNCDEKLKSILLGKPQVELAELPALIRLHFPK  97



>ref|XP_006346190.1| PREDICTED: upstream activation factor subunit spp27-like isoform 
X1 [Solanum tuberosum]
 ref|XP_006346191.1| PREDICTED: upstream activation factor subunit spp27-like isoform 
X2 [Solanum tuberosum]
 ref|XP_006346192.1| PREDICTED: upstream activation factor subunit spp27-like isoform 
X3 [Solanum tuberosum]
Length=100

 Score =   168 bits (425),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 78/97 (80%), Positives = 87/97 (90%), Gaps = 0/97 (0%)
 Frame = -1

Query  706  MLPHKMKSFVAENPKKLGNLINLVNLPSALRDFMGQSQTSRLGCFKRIWSYIKENNLQDP  527
            MLP +MK  + +NPKKL NLI+LVNLPS LR+FMGQSQTSRLGCFKR+W YIKENNLQDP
Sbjct  1    MLPQRMKKVMTDNPKKLANLIDLVNLPSTLREFMGQSQTSRLGCFKRVWCYIKENNLQDP  60

Query  526  NNKNLVNCDEKLKSILLGKSQVDLAELPALLKLHFPK  416
            NNKNLVNCDEKLKS+LLGK QV+L ELP L+KLHFPK
Sbjct  61   NNKNLVNCDEKLKSVLLGKPQVELTELPTLIKLHFPK  97



>ref|XP_010060280.1| PREDICTED: upstream activation factor subunit UAF30-like [Eucalyptus 
grandis]
 gb|KCW66910.1| hypothetical protein EUGRSUZ_F00655 [Eucalyptus grandis]
Length=100

 Score =   167 bits (423),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 79/97 (81%), Positives = 88/97 (91%), Gaps = 0/97 (0%)
 Frame = -1

Query  706  MLPHKMKSFVAENPKKLGNLINLVNLPSALRDFMGQSQTSRLGCFKRIWSYIKENNLQDP  527
            MLP +MK  VA+NPKKL NLI+LVNLPS +RDF+GQSQTSRLGCF  +WSYIK NNLQDP
Sbjct  1    MLPQRMKKAVADNPKKLANLIDLVNLPSTVRDFVGQSQTSRLGCFMSVWSYIKSNNLQDP  60

Query  526  NNKNLVNCDEKLKSILLGKSQVDLAELPALLKLHFPK  416
            +NKNLVNCDEKLKSILLGK QV+LAELPAL+KLHFPK
Sbjct  61   SNKNLVNCDEKLKSILLGKPQVELAELPALIKLHFPK  97



>gb|AFK40800.1| unknown [Medicago truncatula]
Length=100

 Score =   167 bits (422),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 79/97 (81%), Positives = 86/97 (89%), Gaps = 0/97 (0%)
 Frame = -1

Query  706  MLPHKMKSFVAENPKKLGNLINLVNLPSALRDFMGQSQTSRLGCFKRIWSYIKENNLQDP  527
            MLP +MK  V +NPKKL NLI+LVNLPS LRDF+GQSQTSRL CF R+WSYIK NNLQDP
Sbjct  1    MLPQRMKKAVTDNPKKLANLIDLVNLPSTLRDFVGQSQTSRLSCFMRVWSYIKTNNLQDP  60

Query  526  NNKNLVNCDEKLKSILLGKSQVDLAELPALLKLHFPK  416
            NNKN+VNCDEKLK ILLGK QVDLAELPAL+KLHFPK
Sbjct  61   NNKNVVNCDEKLKGILLGKPQVDLAELPALIKLHFPK  97



>ref|XP_004500110.1| PREDICTED: upstream activation factor subunit UAF30-like [Cicer 
arietinum]
Length=100

 Score =   165 bits (417),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 78/97 (80%), Positives = 85/97 (88%), Gaps = 0/97 (0%)
 Frame = -1

Query  706  MLPHKMKSFVAENPKKLGNLINLVNLPSALRDFMGQSQTSRLGCFKRIWSYIKENNLQDP  527
            MLP +MK  V +NPKKL NLI+LVNLPS LRDF+GQSQTSRL CF R+WSYIK NNLQDP
Sbjct  1    MLPQRMKKAVTDNPKKLANLIDLVNLPSTLRDFIGQSQTSRLSCFMRVWSYIKTNNLQDP  60

Query  526  NNKNLVNCDEKLKSILLGKSQVDLAELPALLKLHFPK  416
            NNKN+VNCDEKLK ILLGK QVDLAELP L+KLHFPK
Sbjct  61   NNKNVVNCDEKLKGILLGKPQVDLAELPELIKLHFPK  97



>gb|KDP39192.1| hypothetical protein JCGZ_00949 [Jatropha curcas]
Length=100

 Score =   163 bits (413),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 77/97 (79%), Positives = 85/97 (88%), Gaps = 0/97 (0%)
 Frame = -1

Query  706  MLPHKMKSFVAENPKKLGNLINLVNLPSALRDFMGQSQTSRLGCFKRIWSYIKENNLQDP  527
            MLP +MK  + ENPKKL NLI+LVNLPS LR+F+GQSQ SRLGCF R+WSYIK NNLQDP
Sbjct  1    MLPQQMKKAITENPKKLANLIDLVNLPSTLREFVGQSQISRLGCFMRVWSYIKTNNLQDP  60

Query  526  NNKNLVNCDEKLKSILLGKSQVDLAELPALLKLHFPK  416
             NKN+VNCDEKLK ILLGK QVDLAELPAL+KLHFPK
Sbjct  61   KNKNIVNCDEKLKGILLGKPQVDLAELPALIKLHFPK  97



>ref|XP_002322444.1| SWIB complex BAF60b domain-containing family protein [Populus 
trichocarpa]
 gb|EEF06571.1| SWIB complex BAF60b domain-containing family protein [Populus 
trichocarpa]
Length=100

 Score =   163 bits (412),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 76/97 (78%), Positives = 85/97 (88%), Gaps = 0/97 (0%)
 Frame = -1

Query  706  MLPHKMKSFVAENPKKLGNLINLVNLPSALRDFMGQSQTSRLGCFKRIWSYIKENNLQDP  527
            MLP KMK  + +NPK+L NLI+LVNLPS LRDF+GQSQ S LGCF R+WSYIK NNLQDP
Sbjct  1    MLPQKMKKAITDNPKQLANLIDLVNLPSTLRDFVGQSQISHLGCFMRVWSYIKTNNLQDP  60

Query  526  NNKNLVNCDEKLKSILLGKSQVDLAELPALLKLHFPK  416
            NNKN+VNCDEKLKSILLGK QV+L ELPAL+KLHFPK
Sbjct  61   NNKNVVNCDEKLKSILLGKQQVELVELPALIKLHFPK  97



>ref|XP_004295850.1| PREDICTED: upstream activation factor subunit UAF30-like [Fragaria 
vesca subsp. vesca]
Length=100

 Score =   163 bits (412),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 77/97 (79%), Positives = 87/97 (90%), Gaps = 0/97 (0%)
 Frame = -1

Query  706  MLPHKMKSFVAENPKKLGNLINLVNLPSALRDFMGQSQTSRLGCFKRIWSYIKENNLQDP  527
            MLP  +K  V +NPKKL NLI+LVNLPS LR+F+GQSQ SRLGCF R+WSYIK+NNLQDP
Sbjct  1    MLPQGIKKAVTDNPKKLANLIDLVNLPSTLREFVGQSQISRLGCFVRVWSYIKDNNLQDP  60

Query  526  NNKNLVNCDEKLKSILLGKSQVDLAELPALLKLHFPK  416
            NNKN+VNCDEKLKSILLGK QV+LAELPAL+KLHFPK
Sbjct  61   NNKNVVNCDEKLKSILLGKPQVELAELPALIKLHFPK  97



>ref|XP_009334158.1| PREDICTED: upstream activation factor subunit UAF30-like [Pyrus 
x bretschneideri]
 ref|XP_009334161.1| PREDICTED: upstream activation factor subunit UAF30-like [Pyrus 
x bretschneideri]
Length=100

 Score =   162 bits (410),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 74/97 (76%), Positives = 88/97 (91%), Gaps = 0/97 (0%)
 Frame = -1

Query  706  MLPHKMKSFVAENPKKLGNLINLVNLPSALRDFMGQSQTSRLGCFKRIWSYIKENNLQDP  527
            MLP +MK  + +NPKKL NLI+LVNLPS LR+F+GQSQ SRLGCF R+WSYIK+NNLQDP
Sbjct  1    MLPPRMKKAITDNPKKLANLIDLVNLPSTLREFVGQSQISRLGCFMRVWSYIKDNNLQDP  60

Query  526  NNKNLVNCDEKLKSILLGKSQVDLAELPALLKLHFPK  416
            NNKN+VNCDEKLKS+LLGK+QV+L+ELP L+KLHFPK
Sbjct  61   NNKNVVNCDEKLKSVLLGKTQVELSELPTLIKLHFPK  97



>emb|CDP13786.1| unnamed protein product [Coffea canephora]
Length=100

 Score =   162 bits (410),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 75/97 (77%), Positives = 84/97 (87%), Gaps = 0/97 (0%)
 Frame = -1

Query  706  MLPHKMKSFVAENPKKLGNLINLVNLPSALRDFMGQSQTSRLGCFKRIWSYIKENNLQDP  527
            MLP +MK  + +NPK+L +LI+LVNLPS LR+F GQSQTSRLGCF R+WSYIKEN LQDP
Sbjct  1    MLPQRMKKVITDNPKQLADLIDLVNLPSTLREFTGQSQTSRLGCFTRVWSYIKENKLQDP  60

Query  526  NNKNLVNCDEKLKSILLGKSQVDLAELPALLKLHFPK  416
            NNKNLVNCD KLK ILLGK QVDLAELP L+KLHFPK
Sbjct  61   NNKNLVNCDAKLKQILLGKGQVDLAELPMLIKLHFPK  97



>ref|XP_011041625.1| PREDICTED: upstream activation factor subunit UAF30 isoform X2 
[Populus euphratica]
Length=101

 Score =   161 bits (408),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 75/97 (77%), Positives = 85/97 (88%), Gaps = 0/97 (0%)
 Frame = -1

Query  706  MLPHKMKSFVAENPKKLGNLINLVNLPSALRDFMGQSQTSRLGCFKRIWSYIKENNLQDP  527
            MLP KMK  + +NPK+L NLI+LVNLPS LRDF+GQSQ S LGCF R+WSYIK NNL+DP
Sbjct  1    MLPQKMKKAITDNPKQLANLIDLVNLPSTLRDFVGQSQISHLGCFMRVWSYIKTNNLKDP  60

Query  526  NNKNLVNCDEKLKSILLGKSQVDLAELPALLKLHFPK  416
            NNKN+VNCDEKLKSILLGK QV+L ELPAL+KLHFPK
Sbjct  61   NNKNVVNCDEKLKSILLGKQQVELVELPALIKLHFPK  97



>ref|XP_010675787.1| PREDICTED: upstream activation factor subunit UAF30 [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010675788.1| PREDICTED: upstream activation factor subunit UAF30 [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010675789.1| PREDICTED: upstream activation factor subunit UAF30 [Beta vulgaris 
subsp. vulgaris]
Length=100

 Score =   161 bits (407),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 77/97 (79%), Positives = 86/97 (89%), Gaps = 0/97 (0%)
 Frame = -1

Query  706  MLPHKMKSFVAENPKKLGNLINLVNLPSALRDFMGQSQTSRLGCFKRIWSYIKENNLQDP  527
            MLP ++K    ENPKKL NLI+LVNLPS LRDF+GQSQ SRLGCF R+WSYIK NNLQDP
Sbjct  1    MLPPRIKKSFIENPKKLANLIDLVNLPSTLRDFVGQSQISRLGCFMRVWSYIKTNNLQDP  60

Query  526  NNKNLVNCDEKLKSILLGKSQVDLAELPALLKLHFPK  416
             NKN+VNCD+KLKSILLGKS+VDLAELPAL+KLHFPK
Sbjct  61   QNKNIVNCDDKLKSILLGKSKVDLAELPALIKLHFPK  97



>ref|XP_007020708.1| SWIB/MDM2 domain superfamily protein [Theobroma cacao]
 gb|EOY12233.1| SWIB/MDM2 domain superfamily protein [Theobroma cacao]
Length=100

 Score =   160 bits (406),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 73/97 (75%), Positives = 88/97 (91%), Gaps = 0/97 (0%)
 Frame = -1

Query  706  MLPHKMKSFVAENPKKLGNLINLVNLPSALRDFMGQSQTSRLGCFKRIWSYIKENNLQDP  527
            MLP ++K  + +NPKKL NLI+LVNLPS +R+F+GQSQ SRLGCF R+WSYIK+NNLQDP
Sbjct  1    MLPQRLKKAITDNPKKLANLIDLVNLPSTVREFVGQSQISRLGCFMRVWSYIKQNNLQDP  60

Query  526  NNKNLVNCDEKLKSILLGKSQVDLAELPALLKLHFPK  416
            NNKN+VNCDEKL+SILLGK +V+LAELPAL+KLHFPK
Sbjct  61   NNKNIVNCDEKLRSILLGKPRVELAELPALIKLHFPK  97



>ref|XP_011041619.1| PREDICTED: upstream activation factor subunit UAF30 isoform X1 
[Populus euphratica]
 ref|XP_011041620.1| PREDICTED: upstream activation factor subunit UAF30 isoform X1 
[Populus euphratica]
 ref|XP_011041622.1| PREDICTED: upstream activation factor subunit UAF30 isoform X1 
[Populus euphratica]
 ref|XP_011041623.1| PREDICTED: upstream activation factor subunit UAF30 isoform X1 
[Populus euphratica]
 ref|XP_011041624.1| PREDICTED: upstream activation factor subunit UAF30 isoform X1 
[Populus euphratica]
Length=102

 Score =   160 bits (406),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 75/97 (77%), Positives = 85/97 (88%), Gaps = 0/97 (0%)
 Frame = -1

Query  706  MLPHKMKSFVAENPKKLGNLINLVNLPSALRDFMGQSQTSRLGCFKRIWSYIKENNLQDP  527
            MLP KMK  + +NPK+L NLI+LVNLPS LRDF+GQSQ S LGCF R+WSYIK NNL+DP
Sbjct  1    MLPQKMKKAITDNPKQLANLIDLVNLPSTLRDFVGQSQISHLGCFMRVWSYIKTNNLKDP  60

Query  526  NNKNLVNCDEKLKSILLGKSQVDLAELPALLKLHFPK  416
            NNKN+VNCDEKLKSILLGK QV+L ELPAL+KLHFPK
Sbjct  61   NNKNVVNCDEKLKSILLGKQQVELVELPALIKLHFPK  97



>ref|XP_010248405.1| PREDICTED: upstream activation factor subunit UAF30 [Nelumbo 
nucifera]
Length=100

 Score =   160 bits (405),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 75/97 (77%), Positives = 87/97 (90%), Gaps = 0/97 (0%)
 Frame = -1

Query  706  MLPHKMKSFVAENPKKLGNLINLVNLPSALRDFMGQSQTSRLGCFKRIWSYIKENNLQDP  527
            MLP K+K  + ENP+KL NLI+LVNLPS LR+F+G+SQ SRLGCF  +WSYIK+NNLQDP
Sbjct  1    MLPQKVKKAITENPRKLANLIDLVNLPSTLREFVGRSQISRLGCFIHVWSYIKKNNLQDP  60

Query  526  NNKNLVNCDEKLKSILLGKSQVDLAELPALLKLHFPK  416
            NNKNLVNCDEKL+SILLGKSQV+LAELP L+KLHFPK
Sbjct  61   NNKNLVNCDEKLRSILLGKSQVELAELPMLIKLHFPK  97



>ref|XP_009348302.1| PREDICTED: upstream activation factor subunit spp27-like [Pyrus 
x bretschneideri]
Length=100

 Score =   160 bits (405),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 74/97 (76%), Positives = 87/97 (90%), Gaps = 0/97 (0%)
 Frame = -1

Query  706  MLPHKMKSFVAENPKKLGNLINLVNLPSALRDFMGQSQTSRLGCFKRIWSYIKENNLQDP  527
            MLP +MK  + +NPKKL NLI+LVNLPS LR+F+GQSQ SRLGCF R+WSYIK+NNLQDP
Sbjct  1    MLPPRMKKAITDNPKKLANLIDLVNLPSRLREFVGQSQISRLGCFMRVWSYIKDNNLQDP  60

Query  526  NNKNLVNCDEKLKSILLGKSQVDLAELPALLKLHFPK  416
            NNKN+VNCDEKLKS+LLGK QV+L+ELP L+KLHFPK
Sbjct  61   NNKNVVNCDEKLKSVLLGKPQVELSELPTLIKLHFPK  97



>ref|XP_010438693.1| PREDICTED: upstream activation factor subunit UAF30-like [Camelina 
sativa]
 ref|XP_010448207.1| PREDICTED: upstream activation factor subunit UAF30-like [Camelina 
sativa]
Length=100

 Score =   160 bits (404),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 74/97 (76%), Positives = 86/97 (89%), Gaps = 0/97 (0%)
 Frame = -1

Query  706  MLPHKMKSFVAENPKKLGNLINLVNLPSALRDFMGQSQTSRLGCFKRIWSYIKENNLQDP  527
            MLP ++K  + +NPKKLGNLI+LVNLPS LR+F+GQSQ SRLGCF R+WSYIK NNLQDP
Sbjct  1    MLPQRLKKAITDNPKKLGNLIDLVNLPSTLREFVGQSQISRLGCFMRVWSYIKTNNLQDP  60

Query  526  NNKNLVNCDEKLKSILLGKSQVDLAELPALLKLHFPK  416
             NKN+VNCDEKLKSILLGK QV+L ELP+L+KLHFPK
Sbjct  61   KNKNVVNCDEKLKSILLGKKQVELVELPSLIKLHFPK  97



>ref|NP_001236050.1| uncharacterized protein LOC100527179 [Glycine max]
 ref|XP_006584528.1| PREDICTED: uncharacterized protein LOC100527179 isoform X1 [Glycine 
max]
 ref|XP_006584529.1| PREDICTED: uncharacterized protein LOC100527179 isoform X2 [Glycine 
max]
 gb|ACU16230.1| unknown [Glycine max]
 gb|KHM99521.1| Upstream activation factor subunit spp27 [Glycine soja]
Length=100

 Score =   160 bits (404),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 76/97 (78%), Positives = 86/97 (89%), Gaps = 0/97 (0%)
 Frame = -1

Query  706  MLPHKMKSFVAENPKKLGNLINLVNLPSALRDFMGQSQTSRLGCFKRIWSYIKENNLQDP  527
            MLP +MK  + +NPKKL NLI+LVNLPS LR+F+GQSQ SRLGCFK IWSYIK NNLQD 
Sbjct  1    MLPQRMKKAITDNPKKLANLIDLVNLPSTLREFVGQSQISRLGCFKCIWSYIKTNNLQDQ  60

Query  526  NNKNLVNCDEKLKSILLGKSQVDLAELPALLKLHFPK  416
            NNKN+VNCDEKLKSILLGK QV+LAELPAL+K+HFPK
Sbjct  61   NNKNVVNCDEKLKSILLGKPQVELAELPALIKMHFPK  97



>ref|XP_010433434.1| PREDICTED: upstream activation factor subunit UAF30-like [Camelina 
sativa]
 ref|XP_010433435.1| PREDICTED: upstream activation factor subunit UAF30-like [Camelina 
sativa]
Length=100

 Score =   159 bits (402),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 73/97 (75%), Positives = 86/97 (89%), Gaps = 0/97 (0%)
 Frame = -1

Query  706  MLPHKMKSFVAENPKKLGNLINLVNLPSALRDFMGQSQTSRLGCFKRIWSYIKENNLQDP  527
            MLP ++K  + +NPKKLGNLI+LVNLPS LR+F+GQSQ SRLGCF R+WSYIK NNLQDP
Sbjct  1    MLPQRLKKAITDNPKKLGNLIDLVNLPSTLREFVGQSQISRLGCFMRVWSYIKTNNLQDP  60

Query  526  NNKNLVNCDEKLKSILLGKSQVDLAELPALLKLHFPK  416
             NKN+VNCDEKLKSILLGK +V+L ELP+L+KLHFPK
Sbjct  61   TNKNVVNCDEKLKSILLGKQRVELVELPSLIKLHFPK  97



>ref|XP_009361046.1| PREDICTED: upstream activation factor subunit UAF30-like [Pyrus 
x bretschneideri]
Length=100

 Score =   159 bits (402),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 74/97 (76%), Positives = 85/97 (88%), Gaps = 0/97 (0%)
 Frame = -1

Query  706  MLPHKMKSFVAENPKKLGNLINLVNLPSALRDFMGQSQTSRLGCFKRIWSYIKENNLQDP  527
            MLP  MK  + +NPKKL NLI+LVNLPS LR+F GQSQ SRLGCF R+WSYIK+NNLQDP
Sbjct  1    MLPPMMKKAITDNPKKLANLIDLVNLPSTLREFTGQSQISRLGCFMRVWSYIKDNNLQDP  60

Query  526  NNKNLVNCDEKLKSILLGKSQVDLAELPALLKLHFPK  416
            NNKN+VNCDEKLKS+LLGK QV+L+ELP L+KLHFPK
Sbjct  61   NNKNVVNCDEKLKSVLLGKPQVELSELPTLIKLHFPK  97



>ref|XP_008355320.1| PREDICTED: upstream activation factor subunit UAF30-like [Malus 
domestica]
Length=100

 Score =   159 bits (401),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 73/97 (75%), Positives = 85/97 (88%), Gaps = 0/97 (0%)
 Frame = -1

Query  706  MLPHKMKSFVAENPKKLGNLINLVNLPSALRDFMGQSQTSRLGCFKRIWSYIKENNLQDP  527
            MLP  MK  + +NPKKL NLI+LVNLPS LR+F GQSQ SRLGCF R+WSYIK+NNLQDP
Sbjct  1    MLPPXMKKTITDNPKKLANLIDLVNLPSTLREFTGQSQISRLGCFMRVWSYIKDNNLQDP  60

Query  526  NNKNLVNCDEKLKSILLGKSQVDLAELPALLKLHFPK  416
            NNKN+VNCDEKL+S+LLGK QV+L+ELP L+KLHFPK
Sbjct  61   NNKNVVNCDEKLRSVLLGKPQVELSELPTLIKLHFPK  97



>ref|XP_010545234.1| PREDICTED: upstream activation factor subunit UAF30 [Tarenaya 
hassleriana]
Length=100

 Score =   159 bits (401),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 73/97 (75%), Positives = 88/97 (91%), Gaps = 0/97 (0%)
 Frame = -1

Query  706  MLPHKMKSFVAENPKKLGNLINLVNLPSALRDFMGQSQTSRLGCFKRIWSYIKENNLQDP  527
            MLP +++  + ++PKKL NLI+LVN+PSALR+F+GQSQ SRLGCF R+WSYIK NNLQDP
Sbjct  1    MLPQQLRKPIGDSPKKLANLIDLVNIPSALREFVGQSQISRLGCFMRVWSYIKANNLQDP  60

Query  526  NNKNLVNCDEKLKSILLGKSQVDLAELPALLKLHFPK  416
            NNKN+VNCDEKLKSILLGK +V+LAELPAL+KLHFPK
Sbjct  61   NNKNVVNCDEKLKSILLGKQRVELAELPALIKLHFPK  97



>ref|XP_011095453.1| PREDICTED: upstream activation factor subunit UAF30 [Sesamum 
indicum]
Length=100

 Score =   158 bits (400),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 73/97 (75%), Positives = 87/97 (90%), Gaps = 0/97 (0%)
 Frame = -1

Query  706  MLPHKMKSFVAENPKKLGNLINLVNLPSALRDFMGQSQTSRLGCFKRIWSYIKENNLQDP  527
            ML  ++K  V +NPKK+ +LI+LVNLP+ LRDFMGQSQ+SRL CF+R+WSYIKENNLQDP
Sbjct  1    MLQQRLKKAVTDNPKKVADLIDLVNLPTVLRDFMGQSQSSRLNCFRRVWSYIKENNLQDP  60

Query  526  NNKNLVNCDEKLKSILLGKSQVDLAELPALLKLHFPK  416
             NKN+VNCD+KLKSILLGKS+VDLAELP L+KLHFPK
Sbjct  61   VNKNVVNCDQKLKSILLGKSKVDLAELPMLVKLHFPK  97



>ref|XP_006413137.1| hypothetical protein EUTSA_v10026656mg [Eutrema salsugineum]
 gb|ESQ54590.1| hypothetical protein EUTSA_v10026656mg [Eutrema salsugineum]
Length=100

 Score =   157 bits (398),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 73/97 (75%), Positives = 86/97 (89%), Gaps = 0/97 (0%)
 Frame = -1

Query  706  MLPHKMKSFVAENPKKLGNLINLVNLPSALRDFMGQSQTSRLGCFKRIWSYIKENNLQDP  527
            MLP ++K  V +NPKKLGNLI+LVNLPS LR+F+GQSQ SRLGCF R+WSYIK NNLQDP
Sbjct  1    MLPQRLKKAVTDNPKKLGNLIDLVNLPSTLREFVGQSQISRLGCFMRVWSYIKTNNLQDP  60

Query  526  NNKNLVNCDEKLKSILLGKSQVDLAELPALLKLHFPK  416
             NKN+VNCD+KLKSILLGK +V+L ELP+L+KLHFPK
Sbjct  61   KNKNVVNCDDKLKSILLGKQRVELVELPSLIKLHFPK  97



>ref|XP_006282479.1| hypothetical protein CARUB_v10006096mg, partial [Capsella rubella]
 gb|EOA15377.1| hypothetical protein CARUB_v10006096mg, partial [Capsella rubella]
Length=103

 Score =   157 bits (398),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 72/98 (73%), Positives = 87/98 (89%), Gaps = 0/98 (0%)
 Frame = -1

Query  709  KMLPHKMKSFVAENPKKLGNLINLVNLPSALRDFMGQSQTSRLGCFKRIWSYIKENNLQD  530
            KMLP ++K  + +NPKKLGNLI+LVNLPS LR+F+GQSQ SRLGCF R+WSYIK NNLQD
Sbjct  3    KMLPQRLKKAITDNPKKLGNLIDLVNLPSTLREFLGQSQISRLGCFMRVWSYIKTNNLQD  62

Query  529  PNNKNLVNCDEKLKSILLGKSQVDLAELPALLKLHFPK  416
            P NKN+VNCD+KLKSILLGK +V+L +LP+L+KLHFPK
Sbjct  63   PKNKNVVNCDDKLKSILLGKQRVELVDLPSLIKLHFPK  100



>ref|XP_006452454.1| hypothetical protein CICLE_v10010012mg [Citrus clementina]
 gb|ESR65694.1| hypothetical protein CICLE_v10010012mg [Citrus clementina]
 gb|KDO62122.1| hypothetical protein CISIN_1g034230mg [Citrus sinensis]
Length=100

 Score =   157 bits (397),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 73/97 (75%), Positives = 87/97 (90%), Gaps = 0/97 (0%)
 Frame = -1

Query  706  MLPHKMKSFVAENPKKLGNLINLVNLPSALRDFMGQSQTSRLGCFKRIWSYIKENNLQDP  527
            MLP  +K  V +NPKKL NLI+LVNLPS LR+F+GQS+ SRLGCF R+WSYIK NNLQDP
Sbjct  1    MLPQGVKKTVIDNPKKLANLIDLVNLPSTLREFVGQSRISRLGCFMRVWSYIKTNNLQDP  60

Query  526  NNKNLVNCDEKLKSILLGKSQVDLAELPALLKLHFPK  416
            NNKN+VNCD+KL+SIL+GKS+V+LAELPAL+KLHFPK
Sbjct  61   NNKNVVNCDQKLRSILMGKSRVELAELPALIKLHFPK  97



>ref|XP_010090482.1| Upstream activation factor subunit spp27 [Morus notabilis]
 gb|EXB39581.1| Upstream activation factor subunit spp27 [Morus notabilis]
Length=100

 Score =   157 bits (397),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 74/97 (76%), Positives = 85/97 (88%), Gaps = 0/97 (0%)
 Frame = -1

Query  706  MLPHKMKSFVAENPKKLGNLINLVNLPSALRDFMGQSQTSRLGCFKRIWSYIKENNLQDP  527
            MLP +MK  V +NPKKL NLI+LVNLP+ LR+FMGQSQTSRLGCF  +WSYIKEN LQDP
Sbjct  1    MLPPRMKQAVMDNPKKLANLIDLVNLPTPLREFMGQSQTSRLGCFMHVWSYIKENKLQDP  60

Query  526  NNKNLVNCDEKLKSILLGKSQVDLAELPALLKLHFPK  416
            NN N++NCD KL+SILLGK QV+LAELPAL+KLHFPK
Sbjct  61   NNNNVINCDGKLRSILLGKPQVELAELPALVKLHFPK  97



>ref|XP_003551777.1| PREDICTED: upstream activation factor subunit UAF30-like [Glycine 
max]
Length=100

 Score =   156 bits (394),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 74/97 (76%), Positives = 85/97 (88%), Gaps = 0/97 (0%)
 Frame = -1

Query  706  MLPHKMKSFVAENPKKLGNLINLVNLPSALRDFMGQSQTSRLGCFKRIWSYIKENNLQDP  527
            MLP +MK  + +NPKKL NLI+LVNLPS LR+F+GQSQ SRLGCFK +W YIK NNLQD 
Sbjct  1    MLPQRMKKAITDNPKKLANLIDLVNLPSTLREFVGQSQISRLGCFKCVWFYIKTNNLQDQ  60

Query  526  NNKNLVNCDEKLKSILLGKSQVDLAELPALLKLHFPK  416
            NNKN+VNCDEKLKSILLGK QV+LAELPAL+K+HFPK
Sbjct  61   NNKNVVNCDEKLKSILLGKPQVELAELPALIKMHFPK  97



>ref|XP_002277738.1| PREDICTED: upstream activation factor subunit spp27 [Vitis vinifera]
 emb|CBI26691.3| unnamed protein product [Vitis vinifera]
Length=100

 Score =   156 bits (394),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 72/97 (74%), Positives = 85/97 (88%), Gaps = 0/97 (0%)
 Frame = -1

Query  706  MLPHKMKSFVAENPKKLGNLINLVNLPSALRDFMGQSQTSRLGCFKRIWSYIKENNLQDP  527
            MLP ++K  + ENPKKL NLI+L NLPS LR+F+GQSQ SRLGCF R+WSYIK NNLQDP
Sbjct  1    MLPQRVKRAITENPKKLANLIDLANLPSTLREFVGQSQISRLGCFMRVWSYIKANNLQDP  60

Query  526  NNKNLVNCDEKLKSILLGKSQVDLAELPALLKLHFPK  416
            NNKN+V CD+KL+SILLGK +V+LAELPAL+KLHFPK
Sbjct  61   NNKNVVICDDKLRSILLGKPRVELAELPALIKLHFPK  97



>ref|XP_006474999.1| PREDICTED: upstream activation factor subunit UAF30-like isoform 
X1 [Citrus sinensis]
 ref|XP_006475000.1| PREDICTED: upstream activation factor subunit UAF30-like isoform 
X2 [Citrus sinensis]
 ref|XP_006475001.1| PREDICTED: upstream activation factor subunit UAF30-like isoform 
X3 [Citrus sinensis]
 ref|XP_006475002.1| PREDICTED: upstream activation factor subunit UAF30-like isoform 
X4 [Citrus sinensis]
 ref|XP_006475003.1| PREDICTED: upstream activation factor subunit UAF30-like isoform 
X5 [Citrus sinensis]
 ref|XP_006475004.1| PREDICTED: upstream activation factor subunit UAF30-like isoform 
X6 [Citrus sinensis]
Length=100

 Score =   155 bits (391),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 72/97 (74%), Positives = 86/97 (89%), Gaps = 0/97 (0%)
 Frame = -1

Query  706  MLPHKMKSFVAENPKKLGNLINLVNLPSALRDFMGQSQTSRLGCFKRIWSYIKENNLQDP  527
            MLP  +K    +NPKKL NLI+LVNLPS LR+F+GQS+ SRLGCF R+WSYIK NNLQDP
Sbjct  1    MLPQGVKKTFIDNPKKLANLIDLVNLPSTLREFVGQSRISRLGCFMRVWSYIKTNNLQDP  60

Query  526  NNKNLVNCDEKLKSILLGKSQVDLAELPALLKLHFPK  416
            NNKN+VNCD+KL+SIL+GKS+V+LAELPAL+KLHFPK
Sbjct  61   NNKNVVNCDQKLRSILMGKSRVELAELPALIKLHFPK  97



>ref|NP_194411.1| SWIB/MDM2 domain-containing protein [Arabidopsis thaliana]
 ref|NP_001119064.1| SWIB/MDM2 domain-containing protein [Arabidopsis thaliana]
 emb|CAB36527.1| putative protein [Arabidopsis thaliana]
 emb|CAB79536.1| putative protein [Arabidopsis thaliana]
 gb|AAR24162.1| At4g26810 [Arabidopsis thaliana]
 gb|AAR92306.1| At4g26810 [Arabidopsis thaliana]
 gb|AEE85255.1| SWIB/MDM2 domain-containing protein [Arabidopsis thaliana]
 gb|AEE85256.1| SWIB/MDM2 domain-containing protein [Arabidopsis thaliana]
Length=106

 Score =   155 bits (391),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 72/101 (71%), Positives = 86/101 (85%), Gaps = 0/101 (0%)
 Frame = -1

Query  706  MLPHKMKSFVAENPKKLGNLINLVNLPSALRDFMGQSQTSRLGCFKRIWSYIKENNLQDP  527
            MLP ++K  + +NPKKLGNLI+LVNLPS LR+F+GQSQ SRLGCF R+WSYIK NNLQDP
Sbjct  1    MLPQRLKKAITDNPKKLGNLIDLVNLPSTLRNFVGQSQISRLGCFMRVWSYIKTNNLQDP  60

Query  526  NNKNLVNCDEKLKSILLGKSQVDLAELPALLKLHFPKPNSK  404
             NKN+V CDEKLKSILLGK +V+L +LP+L+KLHFPK   K
Sbjct  61   KNKNVVICDEKLKSILLGKQRVELVDLPSLIKLHFPKEQKK  101



>gb|EYU27377.1| hypothetical protein MIMGU_mgv1a016940mg [Erythranthe guttata]
 gb|EYU27378.1| hypothetical protein MIMGU_mgv1a016940mg [Erythranthe guttata]
 gb|EYU27379.1| hypothetical protein MIMGU_mgv1a016940mg [Erythranthe guttata]
Length=100

 Score =   154 bits (389),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 70/97 (72%), Positives = 84/97 (87%), Gaps = 0/97 (0%)
 Frame = -1

Query  706  MLPHKMKSFVAENPKKLGNLINLVNLPSALRDFMGQSQTSRLGCFKRIWSYIKENNLQDP  527
            MLP  +K  V +NPKK+  LI+LVNLP+ LRDFMGQSQ+S+L CF+R+WSY+KENNLQDP
Sbjct  1    MLPQGLKKAVTDNPKKVAELIDLVNLPTVLRDFMGQSQSSQLNCFRRVWSYVKENNLQDP  60

Query  526  NNKNLVNCDEKLKSILLGKSQVDLAELPALLKLHFPK  416
             NKN+VNCD+KL SILLGKS+VDL ELP L+KLHFPK
Sbjct  61   VNKNVVNCDQKLMSILLGKSRVDLTELPTLVKLHFPK  97



>ref|XP_007212283.1| hypothetical protein PRUPE_ppa013835mg [Prunus persica]
 ref|XP_008226999.1| PREDICTED: upstream activation factor subunit UAF30 [Prunus mume]
 ref|XP_008227000.1| PREDICTED: upstream activation factor subunit UAF30 [Prunus mume]
 gb|EMJ13482.1| hypothetical protein PRUPE_ppa013835mg [Prunus persica]
Length=100

 Score =   154 bits (389),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 72/97 (74%), Positives = 84/97 (87%), Gaps = 0/97 (0%)
 Frame = -1

Query  706  MLPHKMKSFVAENPKKLGNLINLVNLPSALRDFMGQSQTSRLGCFKRIWSYIKENNLQDP  527
            MLP ++K  + +NPKKL NLI+LVNLPS LR+F+GQSQ S LGCF R+WSYIK+NNLQDP
Sbjct  1    MLPPRLKKAITDNPKKLANLIDLVNLPSTLREFVGQSQISHLGCFMRVWSYIKDNNLQDP  60

Query  526  NNKNLVNCDEKLKSILLGKSQVDLAELPALLKLHFPK  416
            NNKN+V CDEKLK ILLGK QV+L ELPAL+KLHFPK
Sbjct  61   NNKNVVKCDEKLKGILLGKPQVELCELPALIKLHFPK  97



>ref|XP_009142850.1| PREDICTED: upstream activation factor subunit UAF30 [Brassica 
rapa]
 ref|XP_009142856.1| PREDICTED: upstream activation factor subunit UAF30 [Brassica 
rapa]
 emb|CDX89300.1| BnaA01g15930D [Brassica napus]
Length=102

 Score =   154 bits (388),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 71/97 (73%), Positives = 84/97 (87%), Gaps = 0/97 (0%)
 Frame = -1

Query  706  MLPHKMKSFVAENPKKLGNLINLVNLPSALRDFMGQSQTSRLGCFKRIWSYIKENNLQDP  527
            M P ++K  + +NPKKLGNLI+LVNLPS LRDF+GQSQ SRLGCF R+WSYIK NNLQDP
Sbjct  1    MQPQRLKKAITDNPKKLGNLIDLVNLPSTLRDFLGQSQISRLGCFMRVWSYIKTNNLQDP  60

Query  526  NNKNLVNCDEKLKSILLGKSQVDLAELPALLKLHFPK  416
             NKN+VNCDEKLKSILLGK +V+L +LP+L+KLHF K
Sbjct  61   KNKNVVNCDEKLKSILLGKQRVELVDLPSLIKLHFTK  97



>emb|CDY29252.1| BnaC01g19040D [Brassica napus]
Length=102

 Score =   153 bits (387),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 70/97 (72%), Positives = 84/97 (87%), Gaps = 0/97 (0%)
 Frame = -1

Query  706  MLPHKMKSFVAENPKKLGNLINLVNLPSALRDFMGQSQTSRLGCFKRIWSYIKENNLQDP  527
            M P ++K  + +NPKKLGNLI+LVNLPS LRDF+GQSQ SRLGCF R+WSYIK NNLQDP
Sbjct  1    MQPQRLKKAITDNPKKLGNLIDLVNLPSTLRDFLGQSQISRLGCFMRVWSYIKTNNLQDP  60

Query  526  NNKNLVNCDEKLKSILLGKSQVDLAELPALLKLHFPK  416
             NKN+VNCDEKLKSILLG+ +V+L +LP+L+KLHF K
Sbjct  61   KNKNVVNCDEKLKSILLGRQRVELVDLPSLIKLHFTK  97



>ref|XP_009109167.1| PREDICTED: upstream activation factor subunit UAF30-like [Brassica 
rapa]
 ref|XP_009109168.1| PREDICTED: upstream activation factor subunit UAF30-like [Brassica 
rapa]
 emb|CDY14298.1| BnaA08g14290D [Brassica napus]
Length=115

 Score =   154 bits (388),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 73/102 (72%), Positives = 87/102 (85%), Gaps = 2/102 (2%)
 Frame = -1

Query  706  MLPHKMKSFVAENPKKLGNLINLVNLPSALRDFMGQSQTSRLGCFKRIWSYIKENNLQDP  527
            M P ++K  + +NPKKLGNLI+LVNLPS LRDF+GQSQ+SRLGCF R+WSYIK NNLQDP
Sbjct  1    MQPQRLKKAIVDNPKKLGNLIDLVNLPSTLRDFLGQSQSSRLGCFMRVWSYIKTNNLQDP  60

Query  526  NNKNLVNCDEKLKSILLGKSQVDLAELPALLKLHFPK--PNS  407
             NKN+VNCDEKLKSILLGK +V+L +LP+L+KLHF    PNS
Sbjct  61   KNKNVVNCDEKLKSILLGKPRVELVDLPSLIKLHFTTKAPNS  102



>emb|CDX97367.1| BnaC08g12320D [Brassica napus]
Length=115

 Score =   153 bits (386),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 73/102 (72%), Positives = 87/102 (85%), Gaps = 2/102 (2%)
 Frame = -1

Query  706  MLPHKMKSFVAENPKKLGNLINLVNLPSALRDFMGQSQTSRLGCFKRIWSYIKENNLQDP  527
            M P ++K  + +NPKKLGNLI+LVNLPS LRDF+GQSQ+SRLGCF R+WSYIK NNLQDP
Sbjct  1    MQPQRLKKAIIDNPKKLGNLIDLVNLPSTLRDFLGQSQSSRLGCFMRVWSYIKTNNLQDP  60

Query  526  NNKNLVNCDEKLKSILLGKSQVDLAELPALLKLHFPK--PNS  407
             NKN+VNCDEKLKSILLGK +V+L +LP+L+KLHF    PNS
Sbjct  61   KNKNVVNCDEKLKSILLGKPRVELVDLPSLIKLHFTTKAPNS  102



>ref|XP_007146524.1| hypothetical protein PHAVU_006G048200g [Phaseolus vulgaris]
 gb|ESW18518.1| hypothetical protein PHAVU_006G048200g [Phaseolus vulgaris]
Length=100

 Score =   152 bits (384),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 72/97 (74%), Positives = 83/97 (86%), Gaps = 0/97 (0%)
 Frame = -1

Query  706  MLPHKMKSFVAENPKKLGNLINLVNLPSALRDFMGQSQTSRLGCFKRIWSYIKENNLQDP  527
            MLP  +K  + +NPKKL NLI+LVNLPS LR+F+GQSQ SRLGCF  +WSYIK  NLQDP
Sbjct  1    MLPQGIKKAITDNPKKLANLIDLVNLPSTLREFVGQSQISRLGCFMCVWSYIKTKNLQDP  60

Query  526  NNKNLVNCDEKLKSILLGKSQVDLAELPALLKLHFPK  416
             NKN+VNCD+KLKSILLGK QVDLAELPAL+K+HFPK
Sbjct  61   YNKNVVNCDDKLKSILLGKPQVDLAELPALIKMHFPK  97



>ref|XP_008449303.1| PREDICTED: upstream activation factor subunit spp27 [Cucumis 
melo]
 ref|XP_008449304.1| PREDICTED: upstream activation factor subunit spp27 [Cucumis 
melo]
 ref|XP_008449305.1| PREDICTED: upstream activation factor subunit spp27 [Cucumis 
melo]
 ref|XP_008449307.1| PREDICTED: upstream activation factor subunit spp27 [Cucumis 
melo]
Length=100

 Score =   150 bits (378),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 72/97 (74%), Positives = 83/97 (86%), Gaps = 0/97 (0%)
 Frame = -1

Query  706  MLPHKMKSFVAENPKKLGNLINLVNLPSALRDFMGQSQTSRLGCFKRIWSYIKENNLQDP  527
            M   +MK  + +NPKKL NLI+LVNLPS LR+F+GQSQ SRLGCFK +WSYIK NNLQDP
Sbjct  1    MTIRRMKMAMTDNPKKLANLIDLVNLPSTLREFVGQSQISRLGCFKCVWSYIKTNNLQDP  60

Query  526  NNKNLVNCDEKLKSILLGKSQVDLAELPALLKLHFPK  416
             NKN+V CDEKLKSILLGK +V+LAELPAL+KLHFPK
Sbjct  61   TNKNVVVCDEKLKSILLGKPKVELAELPALIKLHFPK  97



>ref|XP_004172787.1| PREDICTED: upstream activation factor subunit spp27-like [Cucumis 
sativus]
Length=100

 Score =   149 bits (377),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 74/101 (73%), Positives = 85/101 (84%), Gaps = 1/101 (1%)
 Frame = -1

Query  706  MLPHKMKSFVAENPKKLGNLINLVNLPSALRDFMGQSQTSRLGCFKRIWSYIKENNLQDP  527
            M   +MK  + +NPKKL NLI+LVNLPS LR+F+G SQ SRLGCFK +WSYIK NNLQDP
Sbjct  1    MATKRMKMAITDNPKKLANLIDLVNLPSTLREFVGHSQISRLGCFKCVWSYIKTNNLQDP  60

Query  526  NNKNLVNCDEKLKSILLGKSQVDLAELPALLKLHFPKPNSK  404
             NKN+V CDEKLKSILLGK +V+LAELPAL+KLHFPK NSK
Sbjct  61   TNKNVVICDEKLKSILLGKPKVELAELPALIKLHFPK-NSK  100



>gb|KGN54777.1| hypothetical protein Csa_4G493210 [Cucumis sativus]
Length=192

 Score =   151 bits (382),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 75/102 (74%), Positives = 86/102 (84%), Gaps = 1/102 (1%)
 Frame = -1

Query  709  KMLPHKMKSFVAENPKKLGNLINLVNLPSALRDFMGQSQTSRLGCFKRIWSYIKENNLQD  530
            KM   +MK  + +NPKKL NLI+LVNLPS LR+F+G SQ SRLGCFK +WSYIK NNLQD
Sbjct  92   KMATKRMKMAITDNPKKLANLIDLVNLPSTLREFVGHSQISRLGCFKCVWSYIKTNNLQD  151

Query  529  PNNKNLVNCDEKLKSILLGKSQVDLAELPALLKLHFPKPNSK  404
            P NKN+V CDEKLKSILLGK +V+LAELPAL+KLHFPK NSK
Sbjct  152  PTNKNVVICDEKLKSILLGKPKVELAELPALIKLHFPK-NSK  192



>ref|XP_002867540.1| hypothetical protein ARALYDRAFT_354113 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43799.1| hypothetical protein ARALYDRAFT_354113 [Arabidopsis lyrata subsp. 
lyrata]
Length=320

 Score =   150 bits (380),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 69/93 (74%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = -1

Query  694  KMKSFVAENPKKLGNLINLVNLPSALRDFMGQSQTSRLGCFKRIWSYIKENNLQDPNNKN  515
            ++K  + +NPKKLGNLI+LVNLPS LR+F+GQSQ SRLGCF R+WSYIK NNLQDP NKN
Sbjct  225  RLKKAITDNPKKLGNLIDLVNLPSTLREFVGQSQISRLGCFMRVWSYIKTNNLQDPKNKN  284

Query  514  LVNCDEKLKSILLGKSQVDLAELPALLKLHFPK  416
            +V CDEKLKSILLGK +V+L ELP+L+KLHFPK
Sbjct  285  VVICDEKLKSILLGKQRVELVELPSLIKLHFPK  317



>ref|XP_009770633.1| PREDICTED: upstream activation factor subunit spp27 isoform X2 
[Nicotiana sylvestris]
Length=91

 Score =   139 bits (349),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 65/78 (83%), Positives = 71/78 (91%), Gaps = 0/78 (0%)
 Frame = -1

Query  706  MLPHKMKSFVAENPKKLGNLINLVNLPSALRDFMGQSQTSRLGCFKRIWSYIKENNLQDP  527
            MLP +MK  + +NPKKL NLI+LVNLPS LR+FMGQSQTSRLGCFKR+WSYIKENNLQDP
Sbjct  1    MLPQRMKKAMTDNPKKLANLIDLVNLPSTLREFMGQSQTSRLGCFKRVWSYIKENNLQDP  60

Query  526  NNKNLVNCDEKLKSILLG  473
            NNKNLVNCDEKLKSILL 
Sbjct  61   NNKNLVNCDEKLKSILLD  78



>ref|XP_010943230.1| PREDICTED: upstream activation factor subunit spp27 [Elaeis guineensis]
 ref|XP_010943232.1| PREDICTED: upstream activation factor subunit spp27 [Elaeis guineensis]
 ref|XP_010943233.1| PREDICTED: upstream activation factor subunit spp27 [Elaeis guineensis]
Length=98

 Score =   135 bits (339),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 64/88 (73%), Positives = 75/88 (85%), Gaps = 0/88 (0%)
 Frame = -1

Query  679  VAENPKKLGNLINLVNLPSALRDFMGQSQTSRLGCFKRIWSYIKENNLQDPNNKNLVNCD  500
            V E PKK+ +LI+L NLPS LR+F G+SQ S L  F R+WS+IK NNLQDPNNKN+VNCD
Sbjct  8    VGECPKKVASLIDLANLPSTLREFAGRSQMSHLSFFIRVWSHIKSNNLQDPNNKNMVNCD  67

Query  499  EKLKSILLGKSQVDLAELPALLKLHFPK  416
            +KLKSILLGKSQV+LAELP L+KLHFPK
Sbjct  68   DKLKSILLGKSQVELAELPMLIKLHFPK  95



>ref|XP_008806080.1| PREDICTED: upstream activation factor subunit UAF30 [Phoenix 
dactylifera]
 ref|XP_008806081.1| PREDICTED: upstream activation factor subunit UAF30 [Phoenix 
dactylifera]
Length=98

 Score =   133 bits (335),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 63/86 (73%), Positives = 74/86 (86%), Gaps = 0/86 (0%)
 Frame = -1

Query  673  ENPKKLGNLINLVNLPSALRDFMGQSQTSRLGCFKRIWSYIKENNLQDPNNKNLVNCDEK  494
            E PKK+ +LI+L NLPS LR+F GQSQ S L  F R+WS+IK NNLQDPNNKN+VNCD+K
Sbjct  10   ECPKKVASLIDLANLPSTLREFAGQSQMSHLSFFIRVWSHIKSNNLQDPNNKNIVNCDDK  69

Query  493  LKSILLGKSQVDLAELPALLKLHFPK  416
            LK+ILLGKSQV+LAELP L+KLHFPK
Sbjct  70   LKNILLGKSQVELAELPMLIKLHFPK  95



>ref|XP_004146416.1| PREDICTED: protein TRI1-like [Cucumis sativus]
Length=127

 Score =   134 bits (336),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 63/89 (71%), Positives = 73/89 (82%), Gaps = 0/89 (0%)
 Frame = -1

Query  706  MLPHKMKSFVAENPKKLGNLINLVNLPSALRDFMGQSQTSRLGCFKRIWSYIKENNLQDP  527
            M   +MK  + +NPKKL NLI+LVNLPS LR+F+G SQ SRLGCFK +WSYIK NNLQDP
Sbjct  1    MATKRMKMAITDNPKKLANLIDLVNLPSTLREFVGHSQISRLGCFKCVWSYIKTNNLQDP  60

Query  526  NNKNLVNCDEKLKSILLGKSQVDLAELPA  440
             NKN+V CDEKLKSILLGK +V+LAELP 
Sbjct  61   TNKNVVICDEKLKSILLGKPKVELAELPT  89



>ref|XP_009390982.1| PREDICTED: upstream activation factor subunit UAF30 [Musa acuminata 
subsp. malaccensis]
Length=103

 Score =   127 bits (319),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 62/94 (66%), Positives = 78/94 (83%), Gaps = 1/94 (1%)
 Frame = -1

Query  688  KSFVAENPKKLGNLINLVNLPSALRDFMG-QSQTSRLGCFKRIWSYIKENNLQDPNNKNL  512
            K+ + E PKK+  LI+LVNLPS LR+F G QSQ + L  F R+WS+IK +NLQDPNNKNL
Sbjct  9    KAMLGECPKKVARLIDLVNLPSNLREFAGGQSQMAHLSFFIRVWSHIKTHNLQDPNNKNL  68

Query  511  VNCDEKLKSILLGKSQVDLAELPALLKLHFPKPN  410
            VNCD+KLKSILLGK+QV+L++LP L+ LHFPKP+
Sbjct  69   VNCDDKLKSILLGKTQVELSKLPMLINLHFPKPS  102



>ref|XP_004962128.1| PREDICTED: upstream activation factor subunit UAF30-like [Setaria 
italica]
Length=99

 Score =   126 bits (316),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 59/93 (63%), Positives = 78/93 (84%), Gaps = 1/93 (1%)
 Frame = -1

Query  691  MKSFVAENPKKLGNLINLVNLPSALRDFMG-QSQTSRLGCFKRIWSYIKENNLQDPNNKN  515
            ++  VAE PKK+  L++LVNLP+ALR+F G +SQ S+L  F R+WS+IKE+NLQDP NKN
Sbjct  3    LQRAVAECPKKVARLVDLVNLPTALREFAGGRSQMSQLSFFLRVWSHIKEHNLQDPTNKN  62

Query  514  LVNCDEKLKSILLGKSQVDLAELPALLKLHFPK  416
            +VNCDEKLK++LLG+S+V L ELP ++KLHFPK
Sbjct  63   IVNCDEKLKTVLLGRSKVQLLELPMIVKLHFPK  95



>ref|NP_001062629.1| Os09g0133000 [Oryza sativa Japonica Group]
 dbj|BAD22301.1| SWIB complex BAF60b domain-containing protein-like [Oryza sativa 
Japonica Group]
 dbj|BAD34141.1| SWIB complex BAF60b domain-containing protein-like [Oryza sativa 
Japonica Group]
 dbj|BAF24543.1| Os09g0133000 [Oryza sativa Japonica Group]
 gb|EAZ08206.1| hypothetical protein OsI_30466 [Oryza sativa Indica Group]
 gb|EAZ43836.1| hypothetical protein OsJ_28454 [Oryza sativa Japonica Group]
Length=102

 Score =   125 bits (313),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 58/98 (59%), Positives = 80/98 (82%), Gaps = 1/98 (1%)
 Frame = -1

Query  706  MLPHKMKSFVAENPKKLGNLINLVNLPSALRDFMG-QSQTSRLGCFKRIWSYIKENNLQD  530
            M+  +  + V + PKK+  L++LVNLP+ALR+F G QSQ S L  F R+WS+IK NNLQD
Sbjct  1    MVLRRATAAVGDCPKKVAKLVDLVNLPTALREFAGGQSQMSHLSFFLRVWSHIKSNNLQD  60

Query  529  PNNKNLVNCDEKLKSILLGKSQVDLAELPALLKLHFPK  416
            P+N+N+VNCD+KLK++LLG+S+V+L+ELP L+KLHFPK
Sbjct  61   PSNRNIVNCDDKLKTVLLGRSKVELSELPMLVKLHFPK  98



>ref|XP_006660431.1| PREDICTED: uncharacterized protein LOC102702963 [Oryza brachyantha]
Length=103

 Score =   124 bits (310),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 58/89 (65%), Positives = 75/89 (84%), Gaps = 1/89 (1%)
 Frame = -1

Query  679  VAENPKKLGNLINLVNLPSALRDFMG-QSQTSRLGCFKRIWSYIKENNLQDPNNKNLVNC  503
            VA+ PKK+  L++LVNLP+ALR F G QSQ S L  F R+WS+IK NNLQDP N+N+VNC
Sbjct  11   VADCPKKVARLVDLVNLPTALRGFAGGQSQMSHLSFFLRVWSHIKNNNLQDPTNRNIVNC  70

Query  502  DEKLKSILLGKSQVDLAELPALLKLHFPK  416
            D+KLK++LLG+S+V+L+ELP L+KLHFPK
Sbjct  71   DDKLKTVLLGRSKVELSELPMLVKLHFPK  99



>gb|EMT28759.1| hypothetical protein F775_31075 [Aegilops tauschii]
Length=99

 Score =   122 bits (305),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 56/93 (60%), Positives = 76/93 (82%), Gaps = 1/93 (1%)
 Frame = -1

Query  691  MKSFVAENPKKLGNLINLVNLPSALRDFMG-QSQTSRLGCFKRIWSYIKENNLQDPNNKN  515
            ++    E+PKK+  L++LVNLP+ALR+F G +SQ S L  F  +WS+IK NNLQDP N+N
Sbjct  3    LRRAAVESPKKVAALVDLVNLPTALREFAGGRSQMSHLSFFLGVWSHIKNNNLQDPTNRN  62

Query  514  LVNCDEKLKSILLGKSQVDLAELPALLKLHFPK  416
            +VNCDEKLK++LLG+S+V+L+ELP L+KLHFPK
Sbjct  63   IVNCDEKLKTVLLGRSKVELSELPMLVKLHFPK  95



>gb|EMS65517.1| hypothetical protein TRIUR3_13584 [Triticum urartu]
Length=99

 Score =   121 bits (304),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 56/93 (60%), Positives = 76/93 (82%), Gaps = 1/93 (1%)
 Frame = -1

Query  691  MKSFVAENPKKLGNLINLVNLPSALRDFMG-QSQTSRLGCFKRIWSYIKENNLQDPNNKN  515
            ++    E+PKK+  L++LVNLP+ALR+F G +SQ S L  F  +WS+IK NNLQDP N+N
Sbjct  3    LRRAAVESPKKVAALVDLVNLPTALREFAGGRSQMSHLSFFLGVWSHIKNNNLQDPTNRN  62

Query  514  LVNCDEKLKSILLGKSQVDLAELPALLKLHFPK  416
            +VNCDEKLK++LLG+S+V+L+ELP L+KLHFPK
Sbjct  63   IVNCDEKLKTVLLGRSKVELSELPMLVKLHFPK  95



>ref|XP_003578023.1| PREDICTED: uncharacterized protein LOC100833627 [Brachypodium 
distachyon]
Length=98

 Score =   120 bits (302),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 55/93 (59%), Positives = 76/93 (82%), Gaps = 1/93 (1%)
 Frame = -1

Query  691  MKSFVAENPKKLGNLINLVNLPSALRDFMG-QSQTSRLGCFKRIWSYIKENNLQDPNNKN  515
            ++    E+PKK+  L++LVNLP+ALR+F G +SQ S L  F  +WS+IK NNLQDP N+N
Sbjct  3    LRRAAVESPKKVAALVDLVNLPTALREFAGGRSQMSHLSFFLGVWSHIKNNNLQDPTNRN  62

Query  514  LVNCDEKLKSILLGKSQVDLAELPALLKLHFPK  416
            +VNCDEKLK++L+G+S+V+L+ELP L+KLHFPK
Sbjct  63   IVNCDEKLKTVLVGRSKVELSELPMLVKLHFPK  95



>ref|XP_002446461.1| hypothetical protein SORBIDRAFT_06g016360 [Sorghum bicolor]
 gb|EES10789.1| hypothetical protein SORBIDRAFT_06g016360 [Sorghum bicolor]
Length=98

 Score =   120 bits (300),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 55/93 (59%), Positives = 75/93 (81%), Gaps = 1/93 (1%)
 Frame = -1

Query  691  MKSFVAENPKKLGNLINLVNLPSALRDFMG-QSQTSRLGCFKRIWSYIKENNLQDPNNKN  515
            +K   AE PKK+  L++LVNLP+ LR+F G +SQ S +  F R+WSYIK+N LQDP N+N
Sbjct  3    LKRAAAECPKKVAGLMDLVNLPTQLREFAGGRSQMSHISFFLRVWSYIKDNKLQDPTNRN  62

Query  514  LVNCDEKLKSILLGKSQVDLAELPALLKLHFPK  416
            +V CDEKLK++LLGKS+V+L+ELP ++KLHFP+
Sbjct  63   IVKCDEKLKTVLLGKSKVELSELPMIVKLHFPR  95



>dbj|BAJ88504.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK00728.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=99

 Score =   119 bits (298),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 55/93 (59%), Positives = 75/93 (81%), Gaps = 1/93 (1%)
 Frame = -1

Query  691  MKSFVAENPKKLGNLINLVNLPSALRDFMG-QSQTSRLGCFKRIWSYIKENNLQDPNNKN  515
            ++    E+PKK+  L++LVNLP+ALR+F G +SQ S L  F  +WS+IK NNLQDP N+N
Sbjct  3    LRRAAVESPKKVAALVDLVNLPTALREFAGGRSQMSHLSFFLGVWSHIKNNNLQDPTNRN  62

Query  514  LVNCDEKLKSILLGKSQVDLAELPALLKLHFPK  416
            +VNCD KLK++LLG+S+V+L+ELP L+KLHFPK
Sbjct  63   IVNCDNKLKTVLLGRSKVELSELPMLVKLHFPK  95



>ref|NP_001148297.1| SWIb domain-containing protein [Zea mays]
 gb|ACG30445.1| SWIb domain-containing protein [Zea mays]
Length=98

 Score =   119 bits (297),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 55/93 (59%), Positives = 73/93 (78%), Gaps = 1/93 (1%)
 Frame = -1

Query  691  MKSFVAENPKKLGNLINLVNLPSALRDFMG-QSQTSRLGCFKRIWSYIKENNLQDPNNKN  515
            ++  + E+PKK+  L +LVNLP  LR+F G QSQ S +  F R+WSYIK+N LQDP NKN
Sbjct  3    LRRAITESPKKVAGLKDLVNLPIQLREFAGGQSQMSHISFFLRVWSYIKDNKLQDPTNKN  62

Query  514  LVNCDEKLKSILLGKSQVDLAELPALLKLHFPK  416
            +V CDEKLK++LLG+S+V L+ELP ++KLHFPK
Sbjct  63   IVKCDEKLKTVLLGRSKVQLSELPMIVKLHFPK  95



>ref|XP_004956342.1| PREDICTED: upstream activation factor subunit UAF30-like [Setaria 
italica]
Length=99

 Score =   118 bits (296),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 56/93 (60%), Positives = 74/93 (80%), Gaps = 1/93 (1%)
 Frame = -1

Query  691  MKSFVAENPKKLGNLINLVNLPSALRDFMG-QSQTSRLGCFKRIWSYIKENNLQDPNNKN  515
            ++  V E PKK+  L++LVNLP+ LR+F G +SQ S +  F R WS+IKE+NLQDP NKN
Sbjct  3    LQRAVTECPKKVAGLVDLVNLPTVLREFAGGRSQMSHISFFLRKWSHIKEHNLQDPTNKN  62

Query  514  LVNCDEKLKSILLGKSQVDLAELPALLKLHFPK  416
            +VNCDEKLK++LLG+S+V L ELP ++KLHFPK
Sbjct  63   IVNCDEKLKTVLLGRSKVQLFELPMIVKLHFPK  95



>ref|XP_003567001.1| PREDICTED: uncharacterized protein LOC100834706 [Brachypodium 
distachyon]
Length=98

 Score =   117 bits (294),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 54/93 (58%), Positives = 75/93 (81%), Gaps = 1/93 (1%)
 Frame = -1

Query  691  MKSFVAENPKKLGNLINLVNLPSALRDFMG-QSQTSRLGCFKRIWSYIKENNLQDPNNKN  515
            ++    E+PKK+  L++LVNLP+ALR+F G +SQ S L  F  +WS+IK NNLQDP N++
Sbjct  3    LRRAAVESPKKVAALVDLVNLPTALREFAGGRSQMSHLSFFLGVWSHIKNNNLQDPTNRS  62

Query  514  LVNCDEKLKSILLGKSQVDLAELPALLKLHFPK  416
            +VNCDEKLK++L G+S+V+L+ELP L+KLHFPK
Sbjct  63   IVNCDEKLKTVLSGRSKVELSELPMLVKLHFPK  95



>ref|XP_010239346.1| PREDICTED: LOW QUALITY PROTEIN: aminopeptidase 2, mitochondrial-like 
[Brachypodium distachyon]
Length=358

 Score =   123 bits (308),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 57/93 (61%), Positives = 76/93 (82%), Gaps = 1/93 (1%)
 Frame = -1

Query  691  MKSFVAENPKKLGNLINLVNLPSALRDFMG-QSQTSRLGCFKRIWSYIKENNLQDPNNKN  515
            ++    E+PKK+  L++LVNLP+ALR+F G +SQ S L  F  +WS+IK NNLQDP N+N
Sbjct  263  LRRAAVESPKKVAALVDLVNLPTALREFAGGRSQMSHLSFFLGVWSHIKNNNLQDPTNRN  322

Query  514  LVNCDEKLKSILLGKSQVDLAELPALLKLHFPK  416
            +VNCDEKLK+ILLG+S+V+L+ELP L+KLHFPK
Sbjct  323  IVNCDEKLKTILLGRSKVELSELPMLVKLHFPK  355



>ref|NP_001146978.1| SWIb domain-containing protein [Zea mays]
 ref|XP_008667888.1| PREDICTED: SWIb domain-containing protein isoform X1 [Zea mays]
 ref|XP_008667889.1| PREDICTED: SWIb domain-containing protein isoform X1 [Zea mays]
 gb|ACG24859.1| SWIb domain-containing protein [Zea mays]
 gb|ACG27282.1| SWIb domain-containing protein [Zea mays]
 tpg|DAA37862.1| TPA: hypothetical protein ZEAMMB73_400027 [Zea mays]
 gb|AIB05927.1| SWI-SNF-BAF60 transcription factor, partial [Zea mays]
Length=98

 Score =   113 bits (282),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 53/93 (57%), Positives = 71/93 (76%), Gaps = 1/93 (1%)
 Frame = -1

Query  691  MKSFVAENPKKLGNLINLVNLPSALRDFMG-QSQTSRLGCFKRIWSYIKENNLQDPNNKN  515
            ++    E PKK+  L +LVNLP+ LR+F G +SQ S +  F  +WSYIK+N LQDP NKN
Sbjct  3    LRRAATECPKKVAGLKDLVNLPTQLREFAGGRSQMSHISFFLSVWSYIKDNKLQDPTNKN  62

Query  514  LVNCDEKLKSILLGKSQVDLAELPALLKLHFPK  416
            +V CDEKLK++LLG+S+V L+ELP ++KLHFPK
Sbjct  63   IVKCDEKLKTVLLGRSKVQLSELPMIVKLHFPK  95



>ref|XP_010064311.1| PREDICTED: uncharacterized protein LOC104451313 [Eucalyptus grandis]
Length=63

 Score =   106 bits (264),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 49/63 (78%), Positives = 55/63 (87%), Gaps = 0/63 (0%)
 Frame = -1

Query  691  MKSFVAENPKKLGNLINLVNLPSALRDFMGQSQTSRLGCFKRIWSYIKENNLQDPNNKNL  512
            MK  VA+NPKKL NLI+LVNLPS +RDF+GQSQTSRLGCF R+WSYIK N LQDP NKN+
Sbjct  1    MKMAVADNPKKLTNLIDLVNLPSTVRDFVGQSQTSRLGCFMRVWSYIKSNKLQDPINKNV  60

Query  511  VNC  503
            VNC
Sbjct  61   VNC  63



>gb|KEH33922.1| SWIB/MDM2 domain protein [Medicago truncatula]
Length=161

 Score = 99.4 bits (246),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 46/83 (55%), Positives = 59/83 (71%), Gaps = 0/83 (0%)
 Frame = -1

Query  706  MLPHKMKSFVAENPKKLGNLINLVNLPSALRDFMGQSQTSRLGCFKRIWSYIKENNLQDP  527
            MLP +MK  V +NPKKL NLI+LVNLPS LRDF+GQSQTSRL CF R+WSYIK NNLQ  
Sbjct  1    MLPQRMKKAVTDNPKKLANLIDLVNLPSTLRDFVGQSQTSRLSCFMRVWSYIKTNNLQHK  60

Query  526  NNKNLVNCDEKLKSILLGKSQVD  458
              + L+   +    I++ +  ++
Sbjct  61   QTQTLMTDMDMSTPIIISQDDIN  83



>gb|KHN30875.1| hypothetical protein glysoja_045269 [Glycine soja]
Length=83

 Score = 94.0 bits (232),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 43/63 (68%), Positives = 50/63 (79%), Gaps = 0/63 (0%)
 Frame = -1

Query  706  MLPHKMKSFVAENPKKLGNLINLVNLPSALRDFMGQSQTSRLGCFKRIWSYIKENNLQDP  527
            MLP +MK  + +NPKKL NLI+LVNLPS LR+F+GQSQ SRLGCFK +W YIK NNLQ P
Sbjct  1    MLPQRMKKAITDNPKKLANLIDLVNLPSTLREFVGQSQISRLGCFKCVWFYIKTNNLQFP  60

Query  526  NNK  518
              K
Sbjct  61   TCK  63



>gb|KHG15894.1| Protein TRI1 [Gossypium arboreum]
Length=74

 Score = 92.4 bits (228),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 40/58 (69%), Positives = 49/58 (84%), Gaps = 0/58 (0%)
 Frame = -1

Query  706  MLPHKMKSFVAENPKKLGNLINLVNLPSALRDFMGQSQTSRLGCFKRIWSYIKENNLQ  533
            MLP ++K  + +NPKKL NLI+L NLPS +R+F+GQSQ SRLGCF R+WSYIKENNLQ
Sbjct  1    MLPQRLKKTITDNPKKLANLIDLANLPSPVREFVGQSQISRLGCFFRVWSYIKENNLQ  58



>ref|XP_009789183.1| PREDICTED: upstream activation factor subunit spp27-like [Nicotiana 
sylvestris]
Length=142

 Score = 81.3 bits (199),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 39/80 (49%), Positives = 50/80 (63%), Gaps = 0/80 (0%)
 Frame = -1

Query  649  LINLVNLPSALRDFMGQSQTSRLGCFKRIWSYIKENNLQDPNNKNLVNCDEKLKSILLGK  470
            L+ +  +   L  F+G S+TSR    K+IW YIK +NLQDP NK  +NCD KLK+I  GK
Sbjct  63   LLKVTPVSPTLHSFLGVSETSRGDAVKKIWDYIKLHNLQDPMNKREINCDHKLKTIFGGK  122

Query  469  SQVDLAELPALLKLHFPKPN  410
             +V   E+  LL  HF KPN
Sbjct  123  DKVGFLEISKLLSAHFVKPN  142



>gb|EPS64694.1| hypothetical protein M569_10089, partial [Genlisea aurea]
Length=55

 Score = 79.0 bits (193),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 36/58 (62%), Positives = 46/58 (79%), Gaps = 3/58 (5%)
 Frame = -1

Query  706  MLPHKMKSFVAENPKKLGNLINLVNLPSALRDFMGQSQTSRLGCFKRIWSYIKENNLQ  533
            MLP ++K   A  PKK+  LI++VNLP  LR+FMGQSQ+S+L CF+R+W YIKENNLQ
Sbjct  1    MLPQRLK---AVGPKKVAGLIDIVNLPQVLRNFMGQSQSSQLNCFRRVWCYIKENNLQ  55



>ref|XP_010275139.1| PREDICTED: upstream activation factor subunit spp27 [Nelumbo 
nucifera]
Length=124

 Score = 80.5 bits (197),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 38/80 (48%), Positives = 49/80 (61%), Gaps = 0/80 (0%)
 Frame = -1

Query  649  LINLVNLPSALRDFMGQSQTSRLGCFKRIWSYIKENNLQDPNNKNLVNCDEKLKSILLGK  470
            +  +V +  ALR F+G  + SR    K++W YIKENNLQ+P NK  + CD+KLKSI  GK
Sbjct  45   IFKVVPVSPALRKFIGAPEVSRGDAVKKVWEYIKENNLQNPANKKEIRCDDKLKSIFEGK  104

Query  469  SQVDLAELPALLKLHFPKPN  410
              V   E+  LL  HF K N
Sbjct  105  DTVGFLEIATLLSRHFVKTN  124



>ref|NP_001235054.1| uncharacterized protein LOC100499975 [Glycine max]
 gb|ACU14450.1| unknown [Glycine max]
 gb|KHN30428.1| Upstream activation factor subunit spp27 [Glycine soja]
Length=139

 Score = 80.9 bits (198),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 35/87 (40%), Positives = 54/87 (62%), Gaps = 0/87 (0%)
 Frame = -1

Query  664  KKLGNLINLVNLPSALRDFMGQSQTSRLGCFKRIWSYIKENNLQDPNNKNLVNCDEKLKS  485
            +K+  ++    +   + D +G  + +R    KRIW+YIK+NNLQDP +K  +NCDEKLK 
Sbjct  52   RKIRGIMKPRKVSPEMEDLVGAPEMARTQVLKRIWAYIKDNNLQDPTDKRTINCDEKLKK  111

Query  484  ILLGKSQVDLAELPALLKLHFPKPNSK  404
            +  GK QV++ E+  L+  HF K  S+
Sbjct  112  VFAGKDQVEMLEIARLISPHFLKSESE  138



>ref|NP_001235290.1| uncharacterized protein LOC100306198 [Glycine max]
 gb|ACU14265.1| unknown [Glycine max]
 gb|KHN05608.1| Upstream activation factor subunit spp27 [Glycine soja]
Length=148

 Score = 80.9 bits (198),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 35/87 (40%), Positives = 54/87 (62%), Gaps = 0/87 (0%)
 Frame = -1

Query  664  KKLGNLINLVNLPSALRDFMGQSQTSRLGCFKRIWSYIKENNLQDPNNKNLVNCDEKLKS  485
            +K+  ++    +   + D +G  + +R    KRIW+YIK+NNLQDP +K  +NCDEKLK 
Sbjct  61   RKIRGIMKPRKVSPEMEDLVGAPEMARTQVLKRIWAYIKDNNLQDPTDKRTINCDEKLKK  120

Query  484  ILLGKSQVDLAELPALLKLHFPKPNSK  404
            +  GK QV++ E+  L+  HF K  S+
Sbjct  121  VFAGKDQVEMLEIARLISPHFLKSESE  147



>gb|AFW58245.1| hypothetical protein ZEAMMB73_992750 [Zea mays]
Length=100

 Score = 79.7 bits (195),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 46/95 (48%), Positives = 62/95 (65%), Gaps = 3/95 (3%)
 Frame = -1

Query  691  MKSFVAENPKKLGNLINLVNLPSALRDFMGQSQTSRLGC-FKRIWSYI--KENNLQDPNN  521
            ++    E PKK+  L +LVNL + LR+F G        C F  I+S    K  +LQDP N
Sbjct  3    LRRATTECPKKVAGLKDLVNLLTQLREFAGGRLNKNALCGFIIIFSRYGNKYPDLQDPTN  62

Query  520  KNLVNCDEKLKSILLGKSQVDLAELPALLKLHFPK  416
            KN+V CDEKLK +LLG+S+V L+ELP ++KL+FPK
Sbjct  63   KNIVKCDEKLKIVLLGRSKVQLSELPMIVKLNFPK  97



>gb|ACU23004.1| unknown [Glycine max]
Length=71

 Score = 78.6 bits (192),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 34/49 (69%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = -1

Query  706  MLPHKMKSFVAENPKKLGNLINLVNLPSALRDFMGQSQTSRLGCFKRIW  560
            MLP +MK  + +NPKKL NLI+LVNLPS LR+F+GQSQ SRLGCFK +W
Sbjct  1    MLPQRMKKAITDNPKKLANLIDLVNLPSTLREFVGQSQISRLGCFKCVW  49



>ref|XP_006878621.1| hypothetical protein AMTR_s00011p00260300 [Amborella trichopoda]
 gb|ERM94766.1| hypothetical protein AMTR_s00011p00260300 [Amborella trichopoda]
Length=125

 Score = 79.7 bits (195),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 34/71 (48%), Positives = 48/71 (68%), Gaps = 0/71 (0%)
 Frame = -1

Query  622  ALRDFMGQSQTSRLGCFKRIWSYIKENNLQDPNNKNLVNCDEKLKSILLGKSQVDLAELP  443
            A+R F+G    SR    K++W YIK NNLQ+P ++ +V CDEKLK+I  GK +V + E+ 
Sbjct  55   AMRKFLGVPDISRTDAMKKVWEYIKANNLQNPADRKVVMCDEKLKTIFEGKDKVGILEIA  114

Query  442  ALLKLHFPKPN  410
             L+ +HF KPN
Sbjct  115  KLMSVHFVKPN  125



>gb|EMS58405.1| Protein TRI1 [Triticum urartu]
Length=78

 Score = 78.6 bits (192),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 35/69 (51%), Positives = 48/69 (70%), Gaps = 0/69 (0%)
 Frame = -1

Query  622  ALRDFMGQSQTSRLGCFKRIWSYIKENNLQDPNNKNLVNCDEKLKSILLGKSQVDLAELP  443
            AL+ FMG ++  R    KRIW+YIK+NNLQDP +K ++ CDEKLK++  G+ +V   E+ 
Sbjct  8    ALQAFMGAAEVPRTEAMKRIWAYIKQNNLQDPADKKVIVCDEKLKALFAGRERVGFLEIA  67

Query  442  ALLKLHFPK  416
             LL LHF K
Sbjct  68   KLLSLHFVK  76



>dbj|BAK03084.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK07017.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=138

 Score = 79.3 bits (194),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 34/69 (49%), Positives = 47/69 (68%), Gaps = 0/69 (0%)
 Frame = -1

Query  622  ALRDFMGQSQTSRLGCFKRIWSYIKENNLQDPNNKNLVNCDEKLKSILLGKSQVDLAELP  443
            AL+ FMG ++  R    KRIW+YIK+NNLQDP +K ++ CDEKLK++  G+ +V   E+ 
Sbjct  68   ALQAFMGAAEVPRTEAMKRIWAYIKQNNLQDPEDKKIIVCDEKLKALFAGRERVGFLEVA  127

Query  442  ALLKLHFPK  416
             LL  HF K
Sbjct  128  KLLSPHFVK  136



>ref|XP_006361226.1| PREDICTED: upstream activation factor subunit UAF30-like [Solanum 
tuberosum]
Length=122

 Score = 78.6 bits (192),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 35/71 (49%), Positives = 47/71 (66%), Gaps = 0/71 (0%)
 Frame = -1

Query  622  ALRDFMGQSQTSRLGCFKRIWSYIKENNLQDPNNKNLVNCDEKLKSILLGKSQVDLAELP  443
            AL+ F+G S+ +R    K+IW YIK NNLQ+P NK  +NCD+KLK+I  GK +V   E+ 
Sbjct  52   ALQKFVGTSEIARTDAVKKIWDYIKTNNLQNPANKKEINCDDKLKTIFAGKDKVGFLEIA  111

Query  442  ALLKLHFPKPN  410
             LL  HF K +
Sbjct  112  KLLSFHFQKAS  122



>gb|KDP39609.1| hypothetical protein JCGZ_02629 [Jatropha curcas]
Length=134

 Score = 79.0 bits (193),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 38/86 (44%), Positives = 54/86 (63%), Gaps = 0/86 (0%)
 Frame = -1

Query  673  ENPKKLGNLINLVNLPSALRDFMGQSQTSRLGCFKRIWSYIKENNLQDPNNKNLVNCDEK  494
            E P +   ++ +  +  ALRDF+G  ++SR    K+IW +IK+NNLQ+P NK  + CDEK
Sbjct  47   EKPLQPAGILKVTPVSPALRDFLGVPESSRTDAVKKIWIHIKQNNLQNPTNKKEIFCDEK  106

Query  493  LKSILLGKSQVDLAELPALLKLHFPK  416
            LK+I  GK +V   E+  LL  HF K
Sbjct  107  LKAIFDGKEKVGFLEIGKLLTRHFVK  132



>dbj|BAJ87657.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=157

 Score = 78.6 bits (192),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 33/67 (49%), Positives = 46/67 (69%), Gaps = 0/67 (0%)
 Frame = -1

Query  622  ALRDFMGQSQTSRLGCFKRIWSYIKENNLQDPNNKNLVNCDEKLKSILLGKSQVDLAELP  443
            AL+ FMG ++  R    KRIW+YIK+NNLQDP +K ++ CDEKLK++  G+ +V   E+ 
Sbjct  87   ALQAFMGAAEVPRTEAMKRIWAYIKQNNLQDPEDKKIIVCDEKLKALFAGRERVGFLEVA  146

Query  442  ALLKLHF  422
             LL  HF
Sbjct  147  KLLSPHF  153



>ref|XP_002270166.1| PREDICTED: upstream activation factor subunit spp27 [Vitis vinifera]
 emb|CAN68050.1| hypothetical protein VITISV_015104 [Vitis vinifera]
 emb|CBI40013.3| unnamed protein product [Vitis vinifera]
Length=128

 Score = 77.8 bits (190),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 38/86 (44%), Positives = 51/86 (59%), Gaps = 0/86 (0%)
 Frame = -1

Query  679  VAENPKKLGNLINLVNLPSALRDFMGQSQTSRLGCFKRIWSYIKENNLQDPNNKNLVNCD  500
             A+ P + G +   V +  ALR F+G  + SR    K+IW +IK NNLQ+P NK  + CD
Sbjct  39   AAKGPPRSGGITKPVPVSPALRKFLGVPEASRAEAVKKIWEHIKLNNLQNPTNKREILCD  98

Query  499  EKLKSILLGKSQVDLAELPALLKLHF  422
            EKLKS+  GK +V   E+  LL  HF
Sbjct  99   EKLKSVFEGKDKVGFLEIGKLLSHHF  124



>gb|KEH33923.1| SWIB/MDM2 domain protein [Medicago truncatula]
Length=76

 Score = 76.3 bits (186),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 36/40 (90%), Positives = 38/40 (95%), Gaps = 0/40 (0%)
 Frame = -1

Query  535  QDPNNKNLVNCDEKLKSILLGKSQVDLAELPALLKLHFPK  416
            QDPNNKN+VNCDEKLK ILLGK QVDLAELPAL+KLHFPK
Sbjct  34   QDPNNKNVVNCDEKLKGILLGKPQVDLAELPALIKLHFPK  73



>ref|XP_009631043.1| PREDICTED: uncharacterized protein LOC104120876, partial [Nicotiana 
tomentosiformis]
Length=174

 Score = 78.2 bits (191),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 36/69 (52%), Positives = 46/69 (67%), Gaps = 0/69 (0%)
 Frame = -1

Query  622  ALRDFMGQSQTSRLGCFKRIWSYIKENNLQDPNNKNLVNCDEKLKSILLGKSQVDLAELP  443
            ALR F+G S+ SR    K++W YIK NNLQ+P NK  +NCD+KLK+I  GK +V   E+ 
Sbjct  104  ALRKFVGSSEISRTDAVKKVWDYIKTNNLQNPANKKEINCDDKLKTIFAGKDKVGFLEIA  163

Query  442  ALLKLHFPK  416
             LL  HF K
Sbjct  164  KLLSSHFQK  172



>emb|CDP07200.1| unnamed protein product [Coffea canephora]
Length=121

 Score = 77.0 bits (188),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 34/84 (40%), Positives = 50/84 (60%), Gaps = 0/84 (0%)
 Frame = -1

Query  667  PKKLGNLINLVNLPSALRDFMGQSQTSRLGCFKRIWSYIKENNLQDPNNKNLVNCDEKLK  488
            P +   ++    +  ALR F+G  +TSR    +++W Y+K  NLQ+PNNK  + CD+KLK
Sbjct  36   PGRRNGILKTQPVSPALRQFVGAPETSRTDAVRKVWDYVKSKNLQNPNNKKEIYCDQKLK  95

Query  487  SILLGKSQVDLAELPALLKLHFPK  416
            +I  GK +V   E+  LL  HF K
Sbjct  96   TIFEGKEKVGFTEIAKLLSKHFQK  119



>ref|XP_001766284.1| predicted protein [Physcomitrella patens]
 gb|EDQ68916.1| predicted protein [Physcomitrella patens]
Length=107

 Score = 76.6 bits (187),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 36/80 (45%), Positives = 47/80 (59%), Gaps = 0/80 (0%)
 Frame = -1

Query  655  GNLINLVNLPSALRDFMGQSQTSRLGCFKRIWSYIKENNLQDPNNKNLVNCDEKLKSILL  476
            G L   + +   L+ F+G  + SR    KRIW YIK+  LQ+P NK  + CDEKLK +L 
Sbjct  15   GALTRAIQVSPTLKKFLGVGECSRPESMKRIWDYIKDQKLQNPQNKREILCDEKLKPVLG  74

Query  475  GKSQVDLAELPALLKLHFPK  416
            GK +V   E+  LL  HFPK
Sbjct  75   GKDKVGFTEIAKLLSEHFPK  94



>ref|XP_009782755.1| PREDICTED: upstream activation factor subunit UAF30-like [Nicotiana 
sylvestris]
Length=125

 Score = 77.0 bits (188),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 35/71 (49%), Positives = 46/71 (65%), Gaps = 0/71 (0%)
 Frame = -1

Query  622  ALRDFMGQSQTSRLGCFKRIWSYIKENNLQDPNNKNLVNCDEKLKSILLGKSQVDLAELP  443
            AL  F+G S+ SR    K++W YIK NNLQ+P NK  +NCD+KLK+I  GK +V   E+ 
Sbjct  55   ALGKFVGSSEISRTDAVKKVWDYIKTNNLQNPANKKEINCDDKLKTIFAGKDKVGFLEIA  114

Query  442  ALLKLHFPKPN  410
             LL  HF K +
Sbjct  115  KLLSSHFQKAS  125



>ref|XP_003612482.1| Upstream activation factor subunit UAF30 [Medicago truncatula]
 gb|AES95440.1| SWIB/MDM2 domain protein [Medicago truncatula]
 gb|AFK37033.1| unknown [Medicago truncatula]
Length=134

 Score = 77.0 bits (188),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 36/87 (41%), Positives = 50/87 (57%), Gaps = 0/87 (0%)
 Frame = -1

Query  670  NPKKLGNLINLVNLPSALRDFMGQSQTSRLGCFKRIWSYIKENNLQDPNNKNLVNCDEKL  491
              K  G +  +V + S L +F+G  + SR    K++W YIK  NLQ+PNNK  + CD+KL
Sbjct  48   TSKSTGGIQKVVQVTSELGNFIGAPEVSRTEAVKKVWEYIKLQNLQNPNNKKEIFCDDKL  107

Query  490  KSILLGKSQVDLAELPALLKLHFPKPN  410
            K+I  GK +V   E+  LL  HF K  
Sbjct  108  KTIFDGKDKVVFTEIAKLLATHFVKST  134



>ref|XP_010540712.1| PREDICTED: upstream activation factor subunit UAF30 [Tarenaya 
hassleriana]
Length=116

 Score = 76.3 bits (186),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 35/78 (45%), Positives = 49/78 (63%), Gaps = 0/78 (0%)
 Frame = -1

Query  649  LINLVNLPSALRDFMGQSQTSRLGCFKRIWSYIKENNLQDPNNKNLVNCDEKLKSILLGK  470
            ++  V +   L  F+G ++ SR    K+IW +IK +NLQ+P NK  +NCDEKLK+I  GK
Sbjct  37   ILKAVPVSQQLASFLGTNEASRTTAVKKIWEHIKLHNLQNPANKREINCDEKLKTIFEGK  96

Query  469  SQVDLAELPALLKLHFPK  416
             +V   E+  LL  HFPK
Sbjct  97   DKVGFLEIAKLLSRHFPK  114



>ref|XP_004168991.1| PREDICTED: upstream activation factor subunit UAF30-like [Cucumis 
sativus]
Length=146

 Score = 77.0 bits (188),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 37/88 (42%), Positives = 54/88 (61%), Gaps = 4/88 (5%)
 Frame = -1

Query  667  PKKLGN----LINLVNLPSALRDFMGQSQTSRLGCFKRIWSYIKENNLQDPNNKNLVNCD  500
            PKK+ N    L+    +   L  F+GQS+ +R    K+IW+YIK NNLQ+P +K  + CD
Sbjct  57   PKKVANPSGGLLKTQKVSPTLAGFLGQSEIARTEAVKQIWAYIKLNNLQNPTDKRQIICD  116

Query  499  EKLKSILLGKSQVDLAELPALLKLHFPK  416
             KLK+I  G+ +V + E+P  L +HF K
Sbjct  117  AKLKAIFGGREKVGMLEIPKFLSIHFVK  144



>gb|AFK49439.1| unknown [Lotus japonicus]
Length=132

 Score = 76.6 bits (187),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 39/100 (39%), Positives = 53/100 (53%), Gaps = 4/100 (4%)
 Frame = -1

Query  709  KMLPHKMKSFVAENPKKLGNLINLVNLPSALRDFM----GQSQTSRLGCFKRIWSYIKEN  542
            +M+   + S     P   GN I  +  P  +   M    G  + SR    K IW+YIKEN
Sbjct  31   RMVRPVVTSATVSQPSAAGNKIRGIMKPRKISPEMQSICGVPEISRTQALKHIWAYIKEN  90

Query  541  NLQDPNNKNLVNCDEKLKSILLGKSQVDLAELPALLKLHF  422
            NLQDP NK L+ CDEKLK +  GK +V + ++  L+  HF
Sbjct  91   NLQDPENKKLIRCDEKLKKVFAGKDEVGMLQIAGLISPHF  130



>ref|NP_565810.1| SWIB/MDM2 domain-containing protein [Arabidopsis thaliana]
 gb|AAK44049.1|AF370234_1 unknown protein [Arabidopsis thaliana]
 gb|AAL15230.1| unknown protein [Arabidopsis thaliana]
 gb|AAM15040.1| Expressed protein [Arabidopsis thaliana]
 gb|AAM15113.1| Expressed protein [Arabidopsis thaliana]
 gb|AAM67140.1| unknown [Arabidopsis thaliana]
 dbj|BAC43012.1| unknown protein [Arabidopsis thaliana]
 gb|AEC09127.1| SWIB/MDM2 domain-containing protein [Arabidopsis thaliana]
Length=109

 Score = 75.9 bits (185),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 37/97 (38%), Positives = 57/97 (59%), Gaps = 0/97 (0%)
 Frame = -1

Query  706  MLPHKMKSFVAENPKKLGNLINLVNLPSALRDFMGQSQTSRLGCFKRIWSYIKENNLQDP  527
            ++     S  A+  ++   ++ +V +   L +F+G+++ SR    K+IW YIK NNLQ+P
Sbjct  11   LMAKAASSTGAKTGRQGTGILKVVPVSKPLANFIGENEVSRTTAVKKIWEYIKLNNLQNP  70

Query  526  NNKNLVNCDEKLKSILLGKSQVDLAELPALLKLHFPK  416
             NK  + CDE+LK+I  GK  V   E+  LL  HFPK
Sbjct  71   VNKREILCDEQLKTIFSGKDTVGFLEISKLLSQHFPK  107



>gb|AAQ24534.1| SWIb domain-containing protein [Solanum chacoense]
Length=148

 Score = 77.0 bits (188),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 35/71 (49%), Positives = 46/71 (65%), Gaps = 0/71 (0%)
 Frame = -1

Query  622  ALRDFMGQSQTSRLGCFKRIWSYIKENNLQDPNNKNLVNCDEKLKSILLGKSQVDLAELP  443
            AL+ F+G S+ SR    K+IW YIK NNLQ+P NK  +NCD+ LK+I  GK +V   E+ 
Sbjct  78   ALQKFVGTSEISRTDAVKKIWDYIKTNNLQNPANKKEINCDDMLKTIFAGKDKVGFLEIA  137

Query  442  ALLKLHFPKPN  410
             LL  HF K +
Sbjct  138  KLLSFHFQKAS  148



>emb|CBI22492.3| unnamed protein product [Vitis vinifera]
Length=68

 Score = 74.7 bits (182),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 33/68 (49%), Positives = 46/68 (68%), Gaps = 0/68 (0%)
 Frame = -1

Query  619  LRDFMGQSQTSRLGCFKRIWSYIKENNLQDPNNKNLVNCDEKLKSILLGKSQVDLAELPA  440
            ++DF+G  +  R    K+IW+YIK++NLQDP NK ++ CDEKLKSI  GK +V   E+  
Sbjct  1    MQDFLGVPEIPRTQALKQIWAYIKQHNLQDPENKKIIVCDEKLKSIFAGKDRVGFLEIAG  60

Query  439  LLKLHFPK  416
            L+  HF K
Sbjct  61   LINPHFLK  68



>ref|XP_002879559.1| SWIB complex BAF60b domain-containing protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH55818.1| SWIB complex BAF60b domain-containing protein [Arabidopsis lyrata 
subsp. lyrata]
Length=112

 Score = 75.9 bits (185),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 36/85 (42%), Positives = 52/85 (61%), Gaps = 0/85 (0%)
 Frame = -1

Query  670  NPKKLGNLINLVNLPSALRDFMGQSQTSRLGCFKRIWSYIKENNLQDPNNKNLVNCDEKL  491
            N ++   ++ +V +   L  F+G+++ SR    K+IW YIK NNLQ+P NK  + CDE+L
Sbjct  26   NGRQGTGILKVVPVSKPLATFIGENEVSRTTAVKKIWEYIKLNNLQNPENKREILCDEQL  85

Query  490  KSILLGKSQVDLAELPALLKLHFPK  416
            K+I  GK  V   E+  LL  HFPK
Sbjct  86   KTIFSGKDTVGFLEISKLLSQHFPK  110



>ref|XP_003537709.1| PREDICTED: upstream activation factor subunit UAF30-like [Glycine 
max]
Length=132

 Score = 76.3 bits (186),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 36/75 (48%), Positives = 47/75 (63%), Gaps = 0/75 (0%)
 Frame = -1

Query  640  LVNLPSALRDFMGQSQTSRLGCFKRIWSYIKENNLQDPNNKNLVNCDEKLKSILLGKSQV  461
            +V + S L DF+G  Q SR    K++W+YIK  NLQ+P NK  + CDEKLK+I  GK +V
Sbjct  56   VVPVSSELGDFLGAPQVSRTDAVKKVWAYIKLQNLQNPANKKEIFCDEKLKTIFEGKDKV  115

Query  460  DLAELPALLKLHFPK  416
               E+  LL  HF K
Sbjct  116  GFTEIAKLLSSHFVK  130



>ref|XP_006847805.1| hypothetical protein AMTR_s00029p00035130 [Amborella trichopoda]
 gb|ERN09386.1| hypothetical protein AMTR_s00029p00035130 [Amborella trichopoda]
Length=130

 Score = 76.3 bits (186),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 33/67 (49%), Positives = 45/67 (67%), Gaps = 0/67 (0%)
 Frame = -1

Query  622  ALRDFMGQSQTSRLGCFKRIWSYIKENNLQDPNNKNLVNCDEKLKSILLGKSQVDLAELP  443
            A+RD +G S+  R    K IW+YIKE+NLQDP NK ++ CDEKLK+I  G+ +V   E+ 
Sbjct  59   AMRDLLGVSEIPRTQALKLIWAYIKEHNLQDPENKKIIVCDEKLKTIFGGRDRVGFLEIS  118

Query  442  ALLKLHF  422
             L+  HF
Sbjct  119  GLINPHF  125



>ref|XP_009395451.1| PREDICTED: upstream activation factor subunit spp27-like [Musa 
acuminata subsp. malaccensis]
Length=115

 Score = 75.5 bits (184),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 36/85 (42%), Positives = 53/85 (62%), Gaps = 0/85 (0%)
 Frame = -1

Query  664  KKLGNLINLVNLPSALRDFMGQSQTSRLGCFKRIWSYIKENNLQDPNNKNLVNCDEKLKS  485
            K+   L+  + +  A+  F+G S+ SR G  K+IW +IK N LQ+P+NK  + CD KLKS
Sbjct  31   KRTAGLLKPLRVSRAMEKFVGASEISRPGAIKKIWDHIKLNQLQNPSNKREIQCDFKLKS  90

Query  484  ILLGKSQVDLAELPALLKLHFPKPN  410
            I  G+ +V + E+  L+  HF KPN
Sbjct  91   IFDGRDKVGMLEIAKLIAPHFLKPN  115



>ref|XP_003610630.1| Upstream activation factor subunit UAF30 [Medicago truncatula]
 gb|AES93588.1| SWIB/MDM2 domain protein [Medicago truncatula]
 gb|AFK49175.1| unknown [Medicago truncatula]
Length=143

 Score = 76.3 bits (186),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 45/66 (68%), Gaps = 0/66 (0%)
 Frame = -1

Query  619  LRDFMGQSQTSRLGCFKRIWSYIKENNLQDPNNKNLVNCDEKLKSILLGKSQVDLAELPA  440
            ++D +GQ + SR    K IW++IKE+NLQ+P  K L+ CDEKLK +  G+ +VD+ E+  
Sbjct  76   MQDLVGQPEISRTQALKSIWAHIKEHNLQNPEKKRLIRCDEKLKKVFAGRDEVDMLEIAG  135

Query  439  LLKLHF  422
            L+  HF
Sbjct  136  LISPHF  141



>ref|XP_002272147.1| PREDICTED: upstream activation factor subunit spp27 [Vitis vinifera]
Length=145

 Score = 76.3 bits (186),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 45/66 (68%), Gaps = 0/66 (0%)
 Frame = -1

Query  619  LRDFMGQSQTSRLGCFKRIWSYIKENNLQDPNNKNLVNCDEKLKSILLGKSQVDLAELPA  440
            ++DF+G  +  R    K+IW+YIK++NLQDP NK ++ CDEKLKSI  GK +V   E+  
Sbjct  78   MQDFLGVPEIPRTQALKQIWAYIKQHNLQDPENKKIIVCDEKLKSIFAGKDRVGFLEIAG  137

Query  439  LLKLHF  422
            L+  HF
Sbjct  138  LINPHF  143



>emb|CAN78429.1| hypothetical protein VITISV_011142 [Vitis vinifera]
Length=145

 Score = 76.3 bits (186),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 45/66 (68%), Gaps = 0/66 (0%)
 Frame = -1

Query  619  LRDFMGQSQTSRLGCFKRIWSYIKENNLQDPNNKNLVNCDEKLKSILLGKSQVDLAELPA  440
            ++DF+G  +  R    K+IW+YIK++NLQDP NK ++ CDEKLKSI  GK +V   E+  
Sbjct  78   MQDFLGVPEIPRTQALKQIWAYIKQHNLQDPENKKIIVCDEKLKSIFAGKDRVGFLEIAG  137

Query  439  LLKLHF  422
            L+  HF
Sbjct  138  LINPHF  143



>gb|EYU29119.1| hypothetical protein MIMGU_mgv1a016400mg [Erythranthe guttata]
Length=123

 Score = 75.5 bits (184),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 35/84 (42%), Positives = 51/84 (61%), Gaps = 0/84 (0%)
 Frame = -1

Query  667  PKKLGNLINLVNLPSALRDFMGQSQTSRLGCFKRIWSYIKENNLQDPNNKNLVNCDEKLK  488
            P +   ++ + ++  AL  F+G  + SR G  K+IW Y+K NNLQ+P+NK  + CDE LK
Sbjct  38   PPRATGILKVQSVSPALAKFLGSPEASRSGAIKQIWDYVKSNNLQNPSNKREIFCDETLK  97

Query  487  SILLGKSQVDLAELPALLKLHFPK  416
            SI  G  +V+   +  LL  HFPK
Sbjct  98   SIFDGNDKVNFQGVAKLLSNHFPK  121



>ref|XP_006648278.1| PREDICTED: protein TRI1-like [Oryza brachyantha]
Length=125

 Score = 75.5 bits (184),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 43/104 (41%), Positives = 59/104 (57%), Gaps = 2/104 (2%)
 Frame = -1

Query  718  GKKKMLPHKMKSFVAENPKKLGNLINLVNLPSALRDFMGQS-QTSRLGCFKRIWSYIKEN  542
            G K+    K+    A  PKK G ++  + +  ALR F G + + SR G  K IW YIK N
Sbjct  23   GGKRPASAKVAMTEAAEPKKSG-ILKPLPVSDALRRFAGGTPEVSRAGATKLIWDYIKAN  81

Query  541  NLQDPNNKNLVNCDEKLKSILLGKSQVDLAELPALLKLHFPKPN  410
             LQ+P NK  + CDEKLKS+  G+ ++ + E+  LL  HF K N
Sbjct  82   GLQNPANKKEIYCDEKLKSLFAGRDKIGMLEIAKLLSPHFIKAN  125



>ref|XP_004511300.1| PREDICTED: upstream activation factor subunit UAF30-like [Cicer 
arietinum]
Length=137

 Score = 75.9 bits (185),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 33/66 (50%), Positives = 42/66 (64%), Gaps = 0/66 (0%)
 Frame = -1

Query  619  LRDFMGQSQTSRLGCFKRIWSYIKENNLQDPNNKNLVNCDEKLKSILLGKSQVDLAELPA  440
            +   +G  + SR    K IW+YIKENNLQDP NK L+ CDEKLK I  GK +V + E+  
Sbjct  70   MAAIVGVPEISRTQALKYIWAYIKENNLQDPENKKLIRCDEKLKKIFAGKDEVGMLEIAG  129

Query  439  LLKLHF  422
            L+  HF
Sbjct  130  LISPHF  135



>gb|KHG13769.1| Protein TRI1 [Gossypium arboreum]
Length=135

 Score = 75.9 bits (185),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 33/85 (39%), Positives = 50/85 (59%), Gaps = 0/85 (0%)
 Frame = -1

Query  676  AENPKKLGNLINLVNLPSALRDFMGQSQTSRLGCFKRIWSYIKENNLQDPNNKNLVNCDE  497
            A  P+    ++    +   ++D +G  +  R    K+IW+YIKE+NLQDP NK ++NCDE
Sbjct  50   ATGPRTPRGIMKPRRVTPEMQDVVGVPEIPRTQALKQIWAYIKEHNLQDPENKKIINCDE  109

Query  496  KLKSILLGKSQVDLAELPALLKLHF  422
            KLK I  GK ++   E+  L+  HF
Sbjct  110  KLKKIFGGKDRIGFLEIAGLISPHF  134



>ref|XP_004244435.1| PREDICTED: upstream activation factor subunit UAF30-like [Solanum 
lycopersicum]
Length=122

 Score = 75.5 bits (184),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 35/71 (49%), Positives = 46/71 (65%), Gaps = 0/71 (0%)
 Frame = -1

Query  622  ALRDFMGQSQTSRLGCFKRIWSYIKENNLQDPNNKNLVNCDEKLKSILLGKSQVDLAELP  443
            AL+ F+G S+ SR    K+IW YIK NNLQ+P NK  +NCD+ LK+I  GK +V   E+ 
Sbjct  52   ALQKFVGTSEISRTDAVKKIWDYIKTNNLQNPANKKEINCDDMLKTIFAGKDKVGFLEIA  111

Query  442  ALLKLHFPKPN  410
             LL  HF K +
Sbjct  112  KLLSNHFQKAS  122



>ref|XP_010509591.1| PREDICTED: upstream activation factor subunit UAF30-like [Camelina 
sativa]
Length=102

 Score = 75.1 bits (183),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 36/83 (43%), Positives = 49/83 (59%), Gaps = 0/83 (0%)
 Frame = -1

Query  664  KKLGNLINLVNLPSALRDFMGQSQTSRLGCFKRIWSYIKENNLQDPNNKNLVNCDEKLKS  485
            K++  +   V +   L  F+G+++ SR    K+IW YIK NNLQ+P NK  + CDEKLK+
Sbjct  18   KQINGIQKAVPISQPLAQFIGENEVSRTTAVKKIWEYIKLNNLQNPENKREILCDEKLKT  77

Query  484  ILLGKSQVDLAELPALLKLHFPK  416
            I  GK  V   E+   L  HFPK
Sbjct  78   IFSGKDTVGFLEIAKQLSQHFPK  100



>ref|XP_004145013.1| PREDICTED: upstream activation factor subunit UAF30-like [Cucumis 
sativus]
 ref|XP_004154030.1| PREDICTED: upstream activation factor subunit UAF30-like [Cucumis 
sativus]
 gb|KGN46262.1| hypothetical protein Csa_6G078570 [Cucumis sativus]
Length=146

 Score = 75.9 bits (185),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 37/88 (42%), Positives = 53/88 (60%), Gaps = 4/88 (5%)
 Frame = -1

Query  667  PKKLGN----LINLVNLPSALRDFMGQSQTSRLGCFKRIWSYIKENNLQDPNNKNLVNCD  500
            PKK+ N    L+    +   L  F+GQS+ +R    K+IW YIK NNLQ+P +K  + CD
Sbjct  57   PKKVANPSGGLLKTQKVSPTLAGFLGQSEIARTEAVKQIWVYIKLNNLQNPTDKRQIICD  116

Query  499  EKLKSILLGKSQVDLAELPALLKLHFPK  416
             KLK+I  G+ +V + E+P  L +HF K
Sbjct  117  AKLKAIFGGREKVGMLEIPKFLSIHFVK  144



>ref|XP_009394338.1| PREDICTED: uncharacterized protein LOC103979848 [Musa acuminata 
subsp. malaccensis]
Length=140

 Score = 75.5 bits (184),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 33/68 (49%), Positives = 45/68 (66%), Gaps = 0/68 (0%)
 Frame = -1

Query  619  LRDFMGQSQTSRLGCFKRIWSYIKENNLQDPNNKNLVNCDEKLKSILLGKSQVDLAELPA  440
            L+  +G+++  R    K+IW+YIKENNLQDP NK +V CDEKLK +  G+ +V   E+  
Sbjct  73   LQAVVGEAEIPRTQALKKIWAYIKENNLQDPENKRIVVCDEKLKKVFGGRDRVGFLEISG  132

Query  439  LLKLHFPK  416
            LL  HF K
Sbjct  133  LLNPHFAK  140



>ref|XP_003574019.1| PREDICTED: protein TRI1-like [Brachypodium distachyon]
Length=135

 Score = 75.1 bits (183),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 39/90 (43%), Positives = 55/90 (61%), Gaps = 1/90 (1%)
 Frame = -1

Query  676  AENPKKLGNLINLVNLPSALRDFMGQS-QTSRLGCFKRIWSYIKENNLQDPNNKNLVNCD  500
            A   K+L  ++  V +  ALR F G + + SR    K +W++IK NNLQ+P N+  +NCD
Sbjct  46   AAEAKELRGIMRPVPVSDALRRFPGGAPEISRANAIKIVWAHIKANNLQNPANRKEINCD  105

Query  499  EKLKSILLGKSQVDLAELPALLKLHFPKPN  410
            EKLKSI  G+ +V + E+  LL  HF K N
Sbjct  106  EKLKSIFSGRDKVGMMEISRLLSPHFMKTN  135



>ref|XP_009114968.1| PREDICTED: upstream activation factor subunit UAF30-like [Brassica 
rapa]
Length=115

 Score = 74.7 bits (182),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 33/79 (42%), Positives = 48/79 (61%), Gaps = 0/79 (0%)
 Frame = -1

Query  652  NLINLVNLPSALRDFMGQSQTSRLGCFKRIWSYIKENNLQDPNNKNLVNCDEKLKSILLG  473
             ++  V +   L  F G+S+ SR    K++W +IK NNLQ+P N+  + CD+KLK+I  G
Sbjct  35   GILKTVPVSKTLASFAGESELSRATAVKKVWEHIKGNNLQNPENRKEIICDDKLKTIFEG  94

Query  472  KSQVDLAELPALLKLHFPK  416
            K +V   E+  LL  HFPK
Sbjct  95   KDKVGFTEIAKLLSPHFPK  113



>ref|XP_003517103.1| PREDICTED: protein TRI1-like [Glycine max]
 gb|KHN28319.1| Upstream activation factor subunit UAF30 [Glycine soja]
Length=132

 Score = 74.7 bits (182),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 36/75 (48%), Positives = 47/75 (63%), Gaps = 0/75 (0%)
 Frame = -1

Query  640  LVNLPSALRDFMGQSQTSRLGCFKRIWSYIKENNLQDPNNKNLVNCDEKLKSILLGKSQV  461
            +V + S L DF+G  Q SR    K++W+YIK  NLQ+P NK  + CDEKLK+I  GK +V
Sbjct  56   VVPVSSELGDFLGAPQVSRTEAVKKVWAYIKLQNLQNPANKKEIFCDEKLKTIFEGKDKV  115

Query  460  DLAELPALLKLHFPK  416
               E+  LL  HF K
Sbjct  116  GFTEIAKLLSNHFVK  130



>ref|XP_007158069.1| hypothetical protein PHAVU_002G121400g [Phaseolus vulgaris]
 gb|ESW30063.1| hypothetical protein PHAVU_002G121400g [Phaseolus vulgaris]
Length=131

 Score = 74.7 bits (182),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 35/74 (47%), Positives = 48/74 (65%), Gaps = 0/74 (0%)
 Frame = -1

Query  637  VNLPSALRDFMGQSQTSRLGCFKRIWSYIKENNLQDPNNKNLVNCDEKLKSILLGKSQVD  458
            V + S L +F+G S+ SR    K++W YIK+ NLQ+P+NK  V CD KLK+I  GK +V 
Sbjct  56   VPVSSELGNFVGASEVSRTVAVKKVWEYIKQQNLQNPSNKKEVFCDAKLKTIFGGKDKVG  115

Query  457  LAELPALLKLHFPK  416
              E+ +LL  HF K
Sbjct  116  FTEIASLLSNHFVK  129



>ref|XP_010505072.1| PREDICTED: upstream activation factor subunit UAF30-like [Camelina 
sativa]
 ref|XP_010516740.1| PREDICTED: upstream activation factor subunit UAF30-like [Camelina 
sativa]
Length=114

 Score = 73.9 bits (180),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 37/89 (42%), Positives = 51/89 (57%), Gaps = 0/89 (0%)
 Frame = -1

Query  682  FVAENPKKLGNLINLVNLPSALRDFMGQSQTSRLGCFKRIWSYIKENNLQDPNNKNLVNC  503
             V  + K++  +   V +   L  F+G+++ SR    K+IW YIK NNLQ+P NK  + C
Sbjct  24   VVESSRKQITGIQKAVPISQPLALFIGENEVSRTTAVKKIWEYIKLNNLQNPENKREILC  83

Query  502  DEKLKSILLGKSQVDLAELPALLKLHFPK  416
            DEKLK+I  GK  V   E+   L  HFPK
Sbjct  84   DEKLKTIFSGKDTVGFLEIAKQLSQHFPK  112



>gb|KFK44945.1| hypothetical protein AALP_AA1G323100 [Arabis alpina]
Length=113

 Score = 73.9 bits (180),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 33/79 (42%), Positives = 49/79 (62%), Gaps = 0/79 (0%)
 Frame = -1

Query  652  NLINLVNLPSALRDFMGQSQTSRLGCFKRIWSYIKENNLQDPNNKNLVNCDEKLKSILLG  473
             ++ LV +   L  F G+++ SR    K++W Y+K +NLQ+P NK  + CD+KLK+I  G
Sbjct  33   GILKLVRVSPPLASFSGETELSRATAVKKVWEYVKLHNLQNPLNKREIQCDDKLKAIFAG  92

Query  472  KSQVDLAELPALLKLHFPK  416
            K  V + E+  LL  HFPK
Sbjct  93   KDTVGITEVMKLLSPHFPK  111



>ref|XP_006295268.1| hypothetical protein CARUB_v10024355mg [Capsella rubella]
 gb|EOA28166.1| hypothetical protein CARUB_v10024355mg [Capsella rubella]
Length=113

 Score = 73.6 bits (179),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 35/78 (45%), Positives = 48/78 (62%), Gaps = 0/78 (0%)
 Frame = -1

Query  649  LINLVNLPSALRDFMGQSQTSRLGCFKRIWSYIKENNLQDPNNKNLVNCDEKLKSILLGK  470
            ++ +V +   L  F+G+++ SR    K+IW YIK NNLQ+P NK  + CDEKLK+I  GK
Sbjct  34   ILKVVPVSQPLAQFIGENEVSRTTAVKKIWEYIKLNNLQNPANKREILCDEKLKTIFSGK  93

Query  469  SQVDLAELPALLKLHFPK  416
              V   E+   L  HFPK
Sbjct  94   DSVMFLEISKHLSQHFPK  111



>ref|XP_009385884.1| PREDICTED: upstream activation factor subunit spp27-like [Musa 
acuminata subsp. malaccensis]
Length=116

 Score = 73.6 bits (179),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 46/71 (65%), Gaps = 0/71 (0%)
 Frame = -1

Query  622  ALRDFMGQSQTSRLGCFKRIWSYIKENNLQDPNNKNLVNCDEKLKSILLGKSQVDLAELP  443
            A++ F+G  + SR+   K+IW +IK N LQ+P NK  + CDEKLK I  G+ +V + E+ 
Sbjct  46   AMKKFLGVPEISRVEAVKKIWEHIKANQLQNPTNKREICCDEKLKGIFDGRDKVGMMEIA  105

Query  442  ALLKLHFPKPN  410
             LL  HFPK N
Sbjct  106  KLLTPHFPKSN  116



>ref|XP_009411071.1| PREDICTED: uncharacterized protein LOC103992897 [Musa acuminata 
subsp. malaccensis]
Length=140

 Score = 73.9 bits (180),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 33/68 (49%), Positives = 46/68 (68%), Gaps = 0/68 (0%)
 Frame = -1

Query  619  LRDFMGQSQTSRLGCFKRIWSYIKENNLQDPNNKNLVNCDEKLKSILLGKSQVDLAELPA  440
            L+  +G+++  R    K+IW+YIKENNLQDP+NK ++ CDEKLK I  G+ +V   E+  
Sbjct  73   LQAVVGEAEIPRTQALKKIWAYIKENNLQDPDNKRIIVCDEKLKKIFGGRDRVGFLEITG  132

Query  439  LLKLHFPK  416
            LL  HF K
Sbjct  133  LLNPHFGK  140



>ref|XP_006412243.1| hypothetical protein EUTSA_v10026522mg [Eutrema salsugineum]
 gb|ESQ53696.1| hypothetical protein EUTSA_v10026522mg [Eutrema salsugineum]
Length=139

 Score = 73.9 bits (180),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 44/66 (67%), Gaps = 0/66 (0%)
 Frame = -1

Query  619  LRDFMGQSQTSRLGCFKRIWSYIKENNLQDPNNKNLVNCDEKLKSILLGKSQVDLAELPA  440
            ++D +G+S   R    KRIW+YIKE++LQDP NK ++ CDEKLK I  GK +V   E+  
Sbjct  73   MQDVVGESVIPRTQALKRIWAYIKEHDLQDPQNKKVIICDEKLKKIFEGKDRVGFLEIAK  132

Query  439  LLKLHF  422
            L+  HF
Sbjct  133  LIGPHF  138



>ref|XP_002313162.1| SWIB complex BAF60b domain-containing family protein [Populus 
trichocarpa]
 gb|EEE87117.1| SWIB complex BAF60b domain-containing family protein [Populus 
trichocarpa]
Length=141

 Score = 73.6 bits (179),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 43/66 (65%), Gaps = 0/66 (0%)
 Frame = -1

Query  619  LRDFMGQSQTSRLGCFKRIWSYIKENNLQDPNNKNLVNCDEKLKSILLGKSQVDLAELPA  440
            + DF+G  + SR    K IW++IKE+NLQDP+NK  + CDEKLK I  G+ QV   E+  
Sbjct  74   MADFIGAPEVSRTQALKLIWAHIKEHNLQDPSNKKNIICDEKLKKIFAGRDQVGFLEIAG  133

Query  439  LLKLHF  422
            L+  HF
Sbjct  134  LISPHF  139



>ref|XP_010097671.1| Upstream activation factor subunit spp27 [Morus notabilis]
 gb|EXB70626.1| Upstream activation factor subunit spp27 [Morus notabilis]
Length=126

 Score = 73.2 bits (178),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 35/89 (39%), Positives = 55/89 (62%), Gaps = 0/89 (0%)
 Frame = -1

Query  676  AENPKKLGNLINLVNLPSALRDFMGQSQTSRLGCFKRIWSYIKENNLQDPNNKNLVNCDE  497
            A+  ++ G L   V +   L  F+G SQ+SR    K+IW++IK ++LQ+P NK  ++CD 
Sbjct  38   AQTDRRPGGLQKPVQVSPTLASFLGASQSSRANAVKQIWAHIKLHSLQNPANKREIHCDG  97

Query  496  KLKSILLGKSQVDLAELPALLKLHFPKPN  410
            KLKS+  G+ +++  E+  LL  HF K N
Sbjct  98   KLKSLFDGRDKINFLEVSKLLNAHFVKTN  126



>emb|CDY45303.1| BnaA03g52760D [Brassica napus]
Length=141

 Score = 73.6 bits (179),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 44/66 (67%), Gaps = 0/66 (0%)
 Frame = -1

Query  619  LRDFMGQSQTSRLGCFKRIWSYIKENNLQDPNNKNLVNCDEKLKSILLGKSQVDLAELPA  440
            ++D +G+S   R    KRIW+YIKE++LQDP NK ++ CDEKLK I  GK +V   E+  
Sbjct  75   MQDVVGESVIPRTQALKRIWAYIKEHDLQDPQNKKVIICDEKLKKIFDGKDRVGFLEIAK  134

Query  439  LLKLHF  422
            L+  HF
Sbjct  135  LIGPHF  140



>ref|XP_011001566.1| PREDICTED: uncharacterized protein LOC105108804 [Populus euphratica]
Length=141

 Score = 73.6 bits (179),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 43/66 (65%), Gaps = 0/66 (0%)
 Frame = -1

Query  619  LRDFMGQSQTSRLGCFKRIWSYIKENNLQDPNNKNLVNCDEKLKSILLGKSQVDLAELPA  440
            + DF+G  + SR    K IW++IKE+NLQDP+NK  + CDEKLK I  G+ QV   E+  
Sbjct  74   MADFVGAPEVSRTQVLKIIWAHIKEHNLQDPSNKKNIICDEKLKKIFAGRDQVGFLEIAG  133

Query  439  LLKLHF  422
            L+  HF
Sbjct  134  LISPHF  139



>ref|XP_010099071.1| Upstream activation factor subunit spp27 [Morus notabilis]
 gb|EXB76660.1| Upstream activation factor subunit spp27 [Morus notabilis]
Length=137

 Score = 73.2 bits (178),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 37/110 (34%), Positives = 57/110 (52%), Gaps = 0/110 (0%)
 Frame = -1

Query  751  FTTVKGKYLRRGKKKMLPHKMKSFVAENPKKLGNLINLVNLPSALRDFMGQSQTSRLGCF  572
            F   +  YLR  +   L    K   + +  +L  ++    +   ++  +G  + SR    
Sbjct  27   FPAARPFYLRVSRTPTLATASKQASSTSKGELRGIMKPRRVSPEMQALVGAPEISRTQAL  86

Query  571  KRIWSYIKENNLQDPNNKNLVNCDEKLKSILLGKSQVDLAELPALLKLHF  422
            K IW++IKENNLQDP NK ++ CDEKLK I  G+ +V   E+  L+  HF
Sbjct  87   KLIWAHIKENNLQDPENKRIIICDEKLKKIFKGRDRVGFLEVAGLITPHF  136



>ref|XP_008366495.1| PREDICTED: uncharacterized protein LOC103430142 [Malus domestica]
Length=139

 Score = 73.2 bits (178),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 32/85 (38%), Positives = 50/85 (59%), Gaps = 0/85 (0%)
 Frame = -1

Query  676  AENPKKLGNLINLVNLPSALRDFMGQSQTSRLGCFKRIWSYIKENNLQDPNNKNLVNCDE  497
            A  P++   ++    +   ++  +G  + SR    K+IW++IK+NNLQDP NK ++ CDE
Sbjct  54   ATTPREPRGIMKPRKVSPEMQALVGAPEISRTQALKQIWAHIKQNNLQDPQNKRIIVCDE  113

Query  496  KLKSILLGKSQVDLAELPALLKLHF  422
            KLK I  GK +V   E+  L+  HF
Sbjct  114  KLKQIFAGKDRVGFLEVAGLITPHF  138



>ref|XP_004512323.1| PREDICTED: upstream activation factor subunit UAF30-like [Cicer 
arietinum]
Length=130

 Score = 73.2 bits (178),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 48/77 (62%), Gaps = 0/77 (0%)
 Frame = -1

Query  640  LVNLPSALRDFMGQSQTSRLGCFKRIWSYIKENNLQDPNNKNLVNCDEKLKSILLGKSQV  461
            +V + S L +F+G  + SR    KR+W YIK  NLQ+P+NK  + CDEKLK+I  GK +V
Sbjct  54   VVPVSSELGNFLGSPEVSRTDAVKRVWEYIKLQNLQNPSNKKEIFCDEKLKTIFDGKDKV  113

Query  460  DLAELPALLKLHFPKPN  410
               E+  LL  HF K +
Sbjct  114  VFTEIARLLANHFVKSS  130



>ref|XP_007200577.1| hypothetical protein PRUPE_ppa013038mg [Prunus persica]
 ref|XP_008236414.1| PREDICTED: uncharacterized protein LOC103335183 [Prunus mume]
 gb|EMJ01776.1| hypothetical protein PRUPE_ppa013038mg [Prunus persica]
Length=143

 Score = 73.2 bits (178),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 33/85 (39%), Positives = 49/85 (58%), Gaps = 0/85 (0%)
 Frame = -1

Query  676  AENPKKLGNLINLVNLPSALRDFMGQSQTSRLGCFKRIWSYIKENNLQDPNNKNLVNCDE  497
            A  P++   ++    +   ++  +G  + SR    K IW++IK+NNLQDP NK ++ CDE
Sbjct  58   ATTPRQPRGIMKPRKVSPEMQALVGTPEISRTQALKLIWAHIKQNNLQDPQNKRIIVCDE  117

Query  496  KLKSILLGKSQVDLAELPALLKLHF  422
            KLK I  GK QV   E+  L+  HF
Sbjct  118  KLKKIFAGKDQVGFLEVAGLITPHF  142



>ref|XP_010499717.1| PREDICTED: upstream activation factor subunit UAF30-like [Camelina 
sativa]
Length=116

 Score = 72.4 bits (176),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 32/79 (41%), Positives = 48/79 (61%), Gaps = 0/79 (0%)
 Frame = -1

Query  652  NLINLVNLPSALRDFMGQSQTSRLGCFKRIWSYIKENNLQDPNNKNLVNCDEKLKSILLG  473
             +  +  +   L  F G+SQ +R    K++W Y+K +NLQ+P NK  ++CD KLK+I  G
Sbjct  36   GVFKVFTVSQPLASFAGESQLTRGTAVKKVWEYVKLHNLQNPANKREIHCDAKLKTIFDG  95

Query  472  KSQVDLAELPALLKLHFPK  416
            K +V + E+  LL  HFPK
Sbjct  96   KDKVGITEVMKLLSPHFPK  114



>emb|CDX72477.1| BnaC07g44990D [Brassica napus]
Length=139

 Score = 73.2 bits (178),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 44/66 (67%), Gaps = 0/66 (0%)
 Frame = -1

Query  619  LRDFMGQSQTSRLGCFKRIWSYIKENNLQDPNNKNLVNCDEKLKSILLGKSQVDLAELPA  440
            ++D +G+S   R    KRIW+YIKE++LQDP NK ++ CDEKLK I  GK +V   E+  
Sbjct  73   MQDVVGESVIPRTQALKRIWAYIKEHDLQDPQNKKVIICDEKLKKIFDGKDRVGFLEIAK  132

Query  439  LLKLHF  422
            L+  HF
Sbjct  133  LIGPHF  138



>ref|XP_002893684.1| SWIB complex BAF60b domain-containing protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH69943.1| SWIB complex BAF60b domain-containing protein [Arabidopsis lyrata 
subsp. lyrata]
Length=112

 Score = 72.4 bits (176),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 31/68 (46%), Positives = 46/68 (68%), Gaps = 0/68 (0%)
 Frame = -1

Query  619  LRDFMGQSQTSRLGCFKRIWSYIKENNLQDPNNKNLVNCDEKLKSILLGKSQVDLAELPA  440
            L  F G+S+ +R    K++W Y+K +NLQ+P NK  ++CD+KLK+I  GK +V + E+  
Sbjct  43   LASFAGESELTRGSALKKVWEYVKLHNLQNPANKKEIHCDDKLKTIFDGKDKVGITEIMK  102

Query  439  LLKLHFPK  416
            LL  HFPK
Sbjct  103  LLSPHFPK  110



>ref|XP_010939955.1| PREDICTED: uncharacterized protein LOC105058655 [Elaeis guineensis]
Length=142

 Score = 72.8 bits (177),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 31/67 (46%), Positives = 44/67 (66%), Gaps = 0/67 (0%)
 Frame = -1

Query  622  ALRDFMGQSQTSRLGCFKRIWSYIKENNLQDPNNKNLVNCDEKLKSILLGKSQVDLAELP  443
            A++  +G  +  R    KRIW+YIKE+NLQDP NK ++ CDEKL+++  GK +V   E+ 
Sbjct  74   AMQAIVGVPEIPRTQALKRIWAYIKEHNLQDPENKRIIVCDEKLRNLFGGKERVGFLEIS  133

Query  442  ALLKLHF  422
             LL  HF
Sbjct  134  GLLNPHF  140



>ref|XP_008460088.1| PREDICTED: protein TRI1-like [Cucumis melo]
Length=146

 Score = 72.8 bits (177),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 34/80 (43%), Positives = 49/80 (61%), Gaps = 0/80 (0%)
 Frame = -1

Query  655  GNLINLVNLPSALRDFMGQSQTSRLGCFKRIWSYIKENNLQDPNNKNLVNCDEKLKSILL  476
            G ++  + +   L  F+GQS+ SR    K+IWSYIK NNLQ+  +K  +NCD KLK+I  
Sbjct  65   GGIMKSLKVSPTLAGFLGQSEISRADAIKQIWSYIKLNNLQNQTDKRQINCDAKLKAIFG  124

Query  475  GKSQVDLAELPALLKLHFPK  416
            G+ +V + E+   L  HF K
Sbjct  125  GREKVGMLEISKFLSPHFVK  144



>ref|XP_009619389.1| PREDICTED: protein TRI1 [Nicotiana tomentosiformis]
Length=142

 Score = 72.8 bits (177),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 35/81 (43%), Positives = 48/81 (59%), Gaps = 0/81 (0%)
 Frame = -1

Query  652  NLINLVNLPSALRDFMGQSQTSRLGCFKRIWSYIKENNLQDPNNKNLVNCDEKLKSILLG  473
             ++ +  +   L  F+G  +TSR    K+IW YIK +NLQDP NK  + CD KLK +  G
Sbjct  62   GILKVTPVSPTLHSFLGVPKTSRGDAVKKIWDYIKLHNLQDPMNKREIICDHKLKILFGG  121

Query  472  KSQVDLAELPALLKLHFPKPN  410
            K +V   E+  LL +HF KPN
Sbjct  122  KDKVGFLEISKLLSVHFVKPN  142



>ref|XP_010460996.1| PREDICTED: upstream activation factor subunit UAF30-like isoform 
X1 [Camelina sativa]
 ref|XP_010460997.1| PREDICTED: upstream activation factor subunit UAF30-like isoform 
X2 [Camelina sativa]
 ref|XP_010478590.1| PREDICTED: upstream activation factor subunit UAF30 [Camelina 
sativa]
Length=116

 Score = 72.0 bits (175),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 31/79 (39%), Positives = 48/79 (61%), Gaps = 0/79 (0%)
 Frame = -1

Query  652  NLINLVNLPSALRDFMGQSQTSRLGCFKRIWSYIKENNLQDPNNKNLVNCDEKLKSILLG  473
             +  +  +   L  F G++Q +R    K++W Y+K +NLQ+P NK  ++CD KLK+I  G
Sbjct  36   GVFKVFTVSQPLASFAGETQLTRGTAVKKVWEYVKLHNLQNPANKREIHCDAKLKTIFDG  95

Query  472  KSQVDLAELPALLKLHFPK  416
            K +V + E+  LL  HFPK
Sbjct  96   KDKVGITEIMKLLSPHFPK  114



>ref|XP_006409620.1| hypothetical protein EUTSA_v10022904mg [Eutrema salsugineum]
 gb|ESQ51073.1| hypothetical protein EUTSA_v10022904mg [Eutrema salsugineum]
Length=136

 Score = 72.4 bits (176),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 43/66 (65%), Gaps = 0/66 (0%)
 Frame = -1

Query  619  LRDFMGQSQTSRLGCFKRIWSYIKENNLQDPNNKNLVNCDEKLKSILLGKSQVDLAELPA  440
            ++D +G S+  R    KRIW+YIKEN+LQDP NK  + CDEKLK I  G+ +V   E+  
Sbjct  70   MQDVVGLSEIPRTQVLKRIWAYIKENDLQDPQNKREILCDEKLKKIFEGRERVGFLEIAK  129

Query  439  LLKLHF  422
            L+  HF
Sbjct  130  LIGPHF  135



>ref|XP_002518650.1| brg-1 associated factor, putative [Ricinus communis]
 gb|EEF43575.1| brg-1 associated factor, putative [Ricinus communis]
Length=141

 Score = 72.4 bits (176),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 31/66 (47%), Positives = 43/66 (65%), Gaps = 0/66 (0%)
 Frame = -1

Query  619  LRDFMGQSQTSRLGCFKRIWSYIKENNLQDPNNKNLVNCDEKLKSILLGKSQVDLAELPA  440
            + + +G S+  R    KRIW++IKENNLQDP NK ++ CDEKLK I  G+ +V   E+  
Sbjct  74   MAELVGASEIPRTQALKRIWAHIKENNLQDPENKKIIICDEKLKKIFGGRDRVGFLEVAG  133

Query  439  LLKLHF  422
            L+  HF
Sbjct  134  LISPHF  139



>ref|NP_001045781.1| Os02g0130000 [Oryza sativa Japonica Group]
 dbj|BAD07734.1| putative SWIb domain-containing protein [Oryza sativa Japonica 
Group]
 dbj|BAD07989.1| putative SWIb domain-containing protein [Oryza sativa Japonica 
Group]
 dbj|BAF07695.1| Os02g0130000 [Oryza sativa Japonica Group]
 gb|EAZ21611.1| hypothetical protein OsJ_05241 [Oryza sativa Japonica Group]
 dbj|BAG97727.1| unnamed protein product [Oryza sativa Japonica Group]
Length=131

 Score = 72.0 bits (175),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 40/94 (43%), Positives = 57/94 (61%), Gaps = 2/94 (2%)
 Frame = -1

Query  688  KSFVAENPKKLGNLINLVNLPSALRDFMGQS-QTSRLGCFKRIWSYIKENNLQDPNNKNL  512
            K+  A+  +K G ++  V +  AL  F G + + SR G  K IW++IK N LQ+P NK  
Sbjct  39   KTEAAQAKEKRG-IMQPVPVSDALSRFAGGAPEMSRAGAVKLIWNHIKANGLQNPANKRE  97

Query  511  VNCDEKLKSILLGKSQVDLAELPALLKLHFPKPN  410
            +NCD+KLKS+  GK +V + E+  LL  HF K N
Sbjct  98   INCDDKLKSLFAGKDKVGMMEIAKLLSPHFIKAN  131



>ref|XP_004246013.1| PREDICTED: upstream activation factor subunit UAF30 [Solanum 
lycopersicum]
Length=124

 Score = 72.0 bits (175),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 32/72 (44%), Positives = 46/72 (64%), Gaps = 0/72 (0%)
 Frame = -1

Query  631  LPSALRDFMGQSQTSRLGCFKRIWSYIKENNLQDPNNKNLVNCDEKLKSILLGKSQVDLA  452
            + +AL  F+G  ++SR    K++W YIK  NLQ+P NK  ++CD+KLK+I  GK +V   
Sbjct  51   VSTALGSFLGTKESSRADAVKKVWEYIKTQNLQNPTNKREIHCDDKLKTIFDGKDKVGFL  110

Query  451  ELPALLKLHFPK  416
            E+  LL  HF K
Sbjct  111  EIARLLSQHFRK  122



>ref|XP_009625777.1| PREDICTED: protein TRI1-like [Nicotiana tomentosiformis]
Length=115

 Score = 71.6 bits (174),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 32/71 (45%), Positives = 45/71 (63%), Gaps = 0/71 (0%)
 Frame = -1

Query  622  ALRDFMGQSQTSRLGCFKRIWSYIKENNLQDPNNKNLVNCDEKLKSILLGKSQVDLAELP  443
            AL  F+G ++ SR    K++W YIK +NLQ+P NK  ++CD+KLK+I  GK +V   E+ 
Sbjct  45   ALGKFLGTAEASRTDAVKKVWEYIKTHNLQNPANKREIHCDDKLKTIFDGKDKVGFLEIA  104

Query  442  ALLKLHFPKPN  410
             LL  HF K  
Sbjct  105  RLLTQHFQKAT  115



>ref|XP_009378891.1| PREDICTED: uncharacterized protein LOC103967364 [Pyrus x bretschneideri]
 ref|XP_009345726.1| PREDICTED: uncharacterized protein LOC103937504 [Pyrus x bretschneideri]
 ref|XP_009345727.1| PREDICTED: uncharacterized protein LOC103937505 [Pyrus x bretschneideri]
Length=140

 Score = 72.0 bits (175),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 43/66 (65%), Gaps = 0/66 (0%)
 Frame = -1

Query  619  LRDFMGQSQTSRLGCFKRIWSYIKENNLQDPNNKNLVNCDEKLKSILLGKSQVDLAELPA  440
            ++  +G  + SR    K+IW++IK+NNLQDP NK ++ CDEKLK I  GK +V   E+  
Sbjct  74   MQALVGAPEISRTQALKQIWAHIKQNNLQDPQNKRIIVCDEKLKQIFAGKDRVGFLEVAG  133

Query  439  LLKLHF  422
            L+  HF
Sbjct  134  LITPHF  139



>ref|XP_008364448.1| PREDICTED: uncharacterized protein LOC103428126 [Malus domestica]
Length=143

 Score = 72.0 bits (175),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 43/66 (65%), Gaps = 0/66 (0%)
 Frame = -1

Query  619  LRDFMGQSQTSRLGCFKRIWSYIKENNLQDPNNKNLVNCDEKLKSILLGKSQVDLAELPA  440
            ++  +G  + SR    K+IW++IK+NNLQDP NK ++ CDEKLK I  GK +V   E+  
Sbjct  77   MQALVGAPEISRTQALKQIWAHIKQNNLQDPQNKRIIVCDEKLKKIFAGKDRVGFLEVAG  136

Query  439  LLKLHF  422
            L+  HF
Sbjct  137  LITPHF  142



>ref|XP_003559112.1| PREDICTED: upstream activation factor subunit UAF30 [Brachypodium 
distachyon]
Length=138

 Score = 72.0 bits (175),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 30/67 (45%), Positives = 45/67 (67%), Gaps = 0/67 (0%)
 Frame = -1

Query  622  ALRDFMGQSQTSRLGCFKRIWSYIKENNLQDPNNKNLVNCDEKLKSILLGKSQVDLAELP  443
            AL+  +G S+  R    KR+W+YIK+NNLQDP +K ++ CD+KLK++  G+ +V   E+ 
Sbjct  68   ALQAVVGASEVPRTEAIKRLWAYIKQNNLQDPMDKKVIVCDQKLKALFAGRERVGFLEIA  127

Query  442  ALLKLHF  422
             LL  HF
Sbjct  128  KLLNPHF  134



>ref|XP_007042581.1| SWIB/MDM2 domain superfamily protein [Theobroma cacao]
 gb|EOX98412.1| SWIB/MDM2 domain superfamily protein [Theobroma cacao]
Length=136

 Score = 71.6 bits (174),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 31/68 (46%), Positives = 43/68 (63%), Gaps = 0/68 (0%)
 Frame = -1

Query  625  SALRDFMGQSQTSRLGCFKRIWSYIKENNLQDPNNKNLVNCDEKLKSILLGKSQVDLAEL  446
            + ++  +G  +  R    KRIW+YIKE+NLQDP NK ++ CDEKLK I  GK +V   E+
Sbjct  68   AEMQAVVGDPEIPRTQALKRIWAYIKEHNLQDPENKRVIICDEKLKKIFGGKDRVGFLEV  127

Query  445  PALLKLHF  422
              L+  HF
Sbjct  128  AGLISPHF  135



>ref|XP_006829241.1| hypothetical protein AMTR_s00001p00272500 [Amborella trichopoda]
 gb|ERM96657.1| hypothetical protein AMTR_s00001p00272500 [Amborella trichopoda]
Length=129

 Score = 71.6 bits (174),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 32/69 (46%), Positives = 46/69 (67%), Gaps = 0/69 (0%)
 Frame = -1

Query  622  ALRDFMGQSQTSRLGCFKRIWSYIKENNLQDPNNKNLVNCDEKLKSILLGKSQVDLAELP  443
            A+++ +G S+  R    K IW+YIK++NLQDP NK ++ CDEKLKSI  G+ +V   E+ 
Sbjct  61   AMQELLGVSEIPRTQALKLIWAYIKQHNLQDPENKKIIVCDEKLKSIFGGRDRVGFLEVT  120

Query  442  ALLKLHFPK  416
             L+  HF K
Sbjct  121  KLINPHFAK  129



>gb|ABK23195.1| unknown [Picea sitchensis]
 gb|ABR16808.1| unknown [Picea sitchensis]
Length=129

 Score = 71.6 bits (174),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 33/83 (40%), Positives = 49/83 (59%), Gaps = 0/83 (0%)
 Frame = -1

Query  664  KKLGNLINLVNLPSALRDFMGQSQTSRLGCFKRIWSYIKENNLQDPNNKNLVNCDEKLKS  485
            ++ G +     +  A++ F+G S+  R    K+IW YIKE +LQDP N+  + CDE LKS
Sbjct  46   RRGGGITQPRPISPAMQKFLGVSEIPRTKAIKKIWEYIKEKDLQDPANRREIVCDENLKS  105

Query  484  ILLGKSQVDLAELPALLKLHFPK  416
            I  G+ +V   E+  L+K HF K
Sbjct  106  IFGGRERVGFLEISGLMKPHFIK  128



>ref|XP_009801356.1| PREDICTED: protein TRI1-like [Nicotiana sylvestris]
Length=123

 Score = 71.2 bits (173),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 34/69 (49%), Positives = 44/69 (64%), Gaps = 0/69 (0%)
 Frame = -1

Query  622  ALRDFMGQSQTSRLGCFKRIWSYIKENNLQDPNNKNLVNCDEKLKSILLGKSQVDLAELP  443
            AL  F+G S+ SR    K++W YIK +NLQ+P NK  ++CDEKLK I  GK +V   E+ 
Sbjct  53   ALGKFLGNSEASRTDAVKKVWEYIKTHNLQNPANKREIHCDEKLKMIFDGKDKVGFLEIA  112

Query  442  ALLKLHFPK  416
             LL  HF K
Sbjct  113  RLLTQHFQK  121



>emb|CDY50651.1| BnaC05g48150D [Brassica napus]
Length=146

 Score = 72.0 bits (175),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 32/89 (36%), Positives = 50/89 (56%), Gaps = 1/89 (1%)
 Frame = -1

Query  673  ENPKKLGNLINLVNLPSALRDFMGQSQTSRLGCFKRIWSYIKENNLQDPNNKNLVNCDEK  494
            + P+  G +     +  AL  F+G  +T+R    K +W+Y+K ++LQ+P +K  + CDEK
Sbjct  59   KTPRTTG-IFKATTVSPALAQFLGTGETTRTDAVKEVWTYVKSHDLQNPADKREIFCDEK  117

Query  493  LKSILLGKSQVDLAELPALLKLHFPKPNS  407
            LK I  GK +V   E+  LL  HF K  +
Sbjct  118  LKQIFEGKDKVGFLEVTKLLSTHFVKTTA  146



>ref|XP_002298761.1| SWIB complex BAF60b domain-containing family protein [Populus 
trichocarpa]
 gb|ABK94753.1| unknown [Populus trichocarpa]
 gb|EEE83566.1| SWIB complex BAF60b domain-containing family protein [Populus 
trichocarpa]
Length=140

 Score = 71.6 bits (174),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 42/66 (64%), Gaps = 0/66 (0%)
 Frame = -1

Query  619  LRDFMGQSQTSRLGCFKRIWSYIKENNLQDPNNKNLVNCDEKLKSILLGKSQVDLAELPA  440
            + DF+G  + SR    K IW++IKE NLQDP+NK  + CDEKLK I  G+ QV   E+  
Sbjct  73   MADFVGAPEVSRTQVLKLIWAHIKERNLQDPSNKKNIICDEKLKKIFPGRDQVGFLEIAG  132

Query  439  LLKLHF  422
            L+  HF
Sbjct  133  LISPHF  138



>emb|CDY47689.1| BnaCnng15310D [Brassica napus]
Length=117

 Score = 71.2 bits (173),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 32/78 (41%), Positives = 47/78 (60%), Gaps = 0/78 (0%)
 Frame = -1

Query  649  LINLVNLPSALRDFMGQSQTSRLGCFKRIWSYIKENNLQDPNNKNLVNCDEKLKSILLGK  470
            ++  V +   L +F G+S+ SR    K++W +IK NNLQ+P N+  + CD+KLK+I   K
Sbjct  38   ILKTVPVSQTLANFAGESELSRATAVKKVWEHIKGNNLQNPENRKQIICDDKLKTIFGDK  97

Query  469  SQVDLAELPALLKLHFPK  416
              V   E+  LL  HFPK
Sbjct  98   DTVGFTEIAKLLSPHFPK  115



>ref|XP_011030373.1| PREDICTED: protein TRI1-like [Populus euphratica]
Length=140

 Score = 71.6 bits (174),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 42/66 (64%), Gaps = 0/66 (0%)
 Frame = -1

Query  619  LRDFMGQSQTSRLGCFKRIWSYIKENNLQDPNNKNLVNCDEKLKSILLGKSQVDLAELPA  440
            + DF+G  + SR    K IW++IKE NLQDP+NK  + CDEKLK I  G+ QV   E+  
Sbjct  73   MADFVGAPEVSRTQVLKLIWAHIKERNLQDPSNKKNIICDEKLKKIFPGRDQVGFLEIAG  132

Query  439  LLKLHF  422
            L+  HF
Sbjct  133  LISPHF  138



>emb|CDY69869.1| BnaCnng65730D [Brassica napus]
Length=137

 Score = 71.6 bits (174),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 43/66 (65%), Gaps = 0/66 (0%)
 Frame = -1

Query  619  LRDFMGQSQTSRLGCFKRIWSYIKENNLQDPNNKNLVNCDEKLKSILLGKSQVDLAELPA  440
            ++D +G+    R    KRIW+YIKE++LQDP +K ++ CDEKLK I  GK +V   E+  
Sbjct  71   MQDVVGEPVIPRTQALKRIWAYIKEHDLQDPQDKKVIVCDEKLKKIFAGKDRVGFLEIAK  130

Query  439  LLKLHF  422
            L+  HF
Sbjct  131  LIGPHF  136



>ref|XP_011071994.1| PREDICTED: upstream activation factor subunit spp27-like [Sesamum 
indicum]
Length=120

 Score = 70.9 bits (172),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 51/82 (62%), Gaps = 0/82 (0%)
 Frame = -1

Query  661  KLGNLINLVNLPSALRDFMGQSQTSRLGCFKRIWSYIKENNLQDPNNKNLVNCDEKLKSI  482
            ++  ++ +  +  AL  F+G  + SR G  K+IW Y+K +NLQ+P+NK  + CD+KLK+I
Sbjct  37   RVTGILKVQPVSPALAKFLGSPEASRSGAVKKIWEYVKSHNLQNPSNKKEIFCDDKLKAI  96

Query  481  LLGKSQVDLAELPALLKLHFPK  416
              G  +V+   +  LL  HFPK
Sbjct  97   FDGNDKVNFQGVAKLLSNHFPK  118



>ref|XP_009145233.1| PREDICTED: upstream activation factor subunit UAF30-like [Brassica 
rapa]
 emb|CDY50950.1| BnaA05g36010D [Brassica napus]
Length=116

 Score = 70.9 bits (172),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 32/78 (41%), Positives = 47/78 (60%), Gaps = 0/78 (0%)
 Frame = -1

Query  649  LINLVNLPSALRDFMGQSQTSRLGCFKRIWSYIKENNLQDPNNKNLVNCDEKLKSILLGK  470
            ++  V +   L +F G+S+ SR    K++W +IK NNLQ+P N+  + CD+KLK+I   K
Sbjct  37   ILKTVPVSQTLANFAGESELSRATAVKKVWEHIKGNNLQNPENRKQIICDDKLKTIFGDK  96

Query  469  SQVDLAELPALLKLHFPK  416
              V   E+  LL  HFPK
Sbjct  97   DTVGFTEIAKLLSPHFPK  114



>ref|XP_004136946.1| PREDICTED: upstream activation factor subunit UAF30-like [Cucumis 
sativus]
 gb|KGN43865.1| Brg-1 associated factor [Cucumis sativus]
Length=140

 Score = 71.6 bits (174),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 42/66 (64%), Gaps = 0/66 (0%)
 Frame = -1

Query  619  LRDFMGQSQTSRLGCFKRIWSYIKENNLQDPNNKNLVNCDEKLKSILLGKSQVDLAELPA  440
            L+  +G  + SR    K IW+YIKENNLQ P+NK ++ CDEKLK I  GK +V   E+  
Sbjct  74   LQALVGAPEISRTQALKVIWAYIKENNLQKPSNKKVIACDEKLKKIFGGKDEVGFLEIAG  133

Query  439  LLKLHF  422
            L+  HF
Sbjct  134  LISPHF  139



>ref|XP_009113880.1| PREDICTED: protein TRI1 [Brassica rapa]
 ref|XP_009113948.1| PREDICTED: protein TRI1 [Brassica rapa]
Length=138

 Score = 71.2 bits (173),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 43/66 (65%), Gaps = 0/66 (0%)
 Frame = -1

Query  619  LRDFMGQSQTSRLGCFKRIWSYIKENNLQDPNNKNLVNCDEKLKSILLGKSQVDLAELPA  440
            ++D +G+    R    KRIW+YIKE++LQDP +K ++ CDEKLK I  GK +V   E+  
Sbjct  72   MQDVVGEPVIPRTQALKRIWAYIKEHDLQDPQDKKVIICDEKLKKIFAGKDRVGFLEIAK  131

Query  439  LLKLHF  422
            L+  HF
Sbjct  132  LIGPHF  137



>ref|XP_010277138.1| PREDICTED: uncharacterized protein LOC104611668 [Nelumbo nucifera]
Length=141

 Score = 71.6 bits (174),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 31/67 (46%), Positives = 44/67 (66%), Gaps = 0/67 (0%)
 Frame = -1

Query  622  ALRDFMGQSQTSRLGCFKRIWSYIKENNLQDPNNKNLVNCDEKLKSILLGKSQVDLAELP  443
            A++  +G  +  R    K+IW+YIKE+NLQDP NK +V CDEKLK+I  G+ +V   E+ 
Sbjct  73   AMQALLGVPEIPRTQALKQIWAYIKEHNLQDPENKKIVVCDEKLKTIFGGRERVGFLEIS  132

Query  442  ALLKLHF  422
             L+  HF
Sbjct  133  GLINPHF  139



>gb|AID60143.1| SWIB/MDM2 domain superfamily protein [Brassica napus]
 emb|CDX75421.1| BnaA01g02810D [Brassica napus]
Length=138

 Score = 71.2 bits (173),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 43/66 (65%), Gaps = 0/66 (0%)
 Frame = -1

Query  619  LRDFMGQSQTSRLGCFKRIWSYIKENNLQDPNNKNLVNCDEKLKSILLGKSQVDLAELPA  440
            ++D +G+    R    KRIW+YIKE++LQDP +K ++ CDEKLK I  GK +V   E+  
Sbjct  72   MQDVVGEPVIPRTQALKRIWAYIKEHDLQDPQDKKVIICDEKLKKIFAGKDRVGFLEIAK  131

Query  439  LLKLHF  422
            L+  HF
Sbjct  132  LIGPHF  137



>ref|XP_009138278.1| PREDICTED: upstream activation factor subunit spp27-like [Brassica 
rapa]
Length=141

 Score = 71.2 bits (173),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/66 (47%), Positives = 44/66 (67%), Gaps = 0/66 (0%)
 Frame = -1

Query  619  LRDFMGQSQTSRLGCFKRIWSYIKENNLQDPNNKNLVNCDEKLKSILLGKSQVDLAELPA  440
            ++D +G+S   R    KRIW+YIKE++LQDP NK ++ C+EKLK I  GK +V   E+  
Sbjct  75   MQDVVGESVIPRTQALKRIWAYIKEHDLQDPQNKKVIICNEKLKKIFDGKDRVGFLEIAK  134

Query  439  LLKLHF  422
            L+  HF
Sbjct  135  LIGPHF  140



>ref|XP_008438197.1| PREDICTED: upstream activation factor subunit UAF30-like [Cucumis 
melo]
 ref|XP_008438198.1| PREDICTED: upstream activation factor subunit UAF30-like [Cucumis 
melo]
Length=156

 Score = 71.6 bits (174),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/78 (41%), Positives = 50/78 (64%), Gaps = 0/78 (0%)
 Frame = -1

Query  649  LINLVNLPSALRDFMGQSQTSRLGCFKRIWSYIKENNLQDPNNKNLVNCDEKLKSILLGK  470
            ++ +  +  AL +F+G S+ SR     +IWSYIK +NLQ+P+NK  + CD+KLK+I  G+
Sbjct  78   ILKVTQVSPALSNFLGVSEASRTDAVTQIWSYIKLHNLQNPDNKREIYCDDKLKAIFEGR  137

Query  469  SQVDLAELPALLKLHFPK  416
             +V   E+  +L  HF K
Sbjct  138  EKVSFLEIGKMLARHFVK  155



>gb|KDP44460.1| hypothetical protein JCGZ_16293 [Jatropha curcas]
Length=139

 Score = 70.9 bits (172),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/66 (47%), Positives = 41/66 (62%), Gaps = 0/66 (0%)
 Frame = -1

Query  619  LRDFMGQSQTSRLGCFKRIWSYIKENNLQDPNNKNLVNCDEKLKSILLGKSQVDLAELPA  440
            + D +G  +  R    K IW+YIKE+NLQDPNNK ++ CDEKLK I  G+  V   E+  
Sbjct  72   MADLVGAPEIPRTQALKLIWAYIKEHNLQDPNNKKIIICDEKLKKIFGGRDSVGFLEVAG  131

Query  439  LLKLHF  422
            L+  HF
Sbjct  132  LISPHF  137



>gb|KHG22078.1| Upstream activation factor subunit UAF30 [Gossypium arboreum]
Length=150

 Score = 71.2 bits (173),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 34/69 (49%), Positives = 43/69 (62%), Gaps = 0/69 (0%)
 Frame = -1

Query  622  ALRDFMGQSQTSRLGCFKRIWSYIKENNLQDPNNKNLVNCDEKLKSILLGKSQVDLAELP  443
            AL  F+G  Q SR    K+IW YIK  NLQ+PNN+  + CDEKLK+I  GK +V   E+ 
Sbjct  80   ALGQFLGAQQASRTEAVKQIWFYIKSQNLQNPNNRKEIFCDEKLKTIFNGKEKVGFLEIG  139

Query  442  ALLKLHFPK  416
             +L  HF K
Sbjct  140  KMLTPHFVK  148



>ref|XP_002463848.1| hypothetical protein SORBIDRAFT_01g007350 [Sorghum bicolor]
 gb|EER90846.1| hypothetical protein SORBIDRAFT_01g007350 [Sorghum bicolor]
Length=143

 Score = 70.9 bits (172),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/67 (46%), Positives = 44/67 (66%), Gaps = 0/67 (0%)
 Frame = -1

Query  622  ALRDFMGQSQTSRLGCFKRIWSYIKENNLQDPNNKNLVNCDEKLKSILLGKSQVDLAELP  443
            AL+  +G+    R    KR+W+YIKE+NLQDP++K +V CDEKLK +  G+ +V   E+ 
Sbjct  75   ALQAIVGEPVIPRTEALKRLWAYIKEHNLQDPSDKKVVICDEKLKVLFAGRERVGFLEIA  134

Query  442  ALLKLHF  422
             LL  HF
Sbjct  135  KLLNPHF  141



>ref|XP_008354803.1| PREDICTED: protein TRI1-like [Malus domestica]
Length=145

 Score = 70.9 bits (172),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 35/88 (40%), Positives = 53/88 (60%), Gaps = 0/88 (0%)
 Frame = -1

Query  679  VAENPKKLGNLINLVNLPSALRDFMGQSQTSRLGCFKRIWSYIKENNLQDPNNKNLVNCD  500
            V+  PK    ++  + + +AL  F+G  ++SR    K+IW++IK +NLQ+P NK  + CD
Sbjct  56   VSTKPKPTLGIMKPIPISAALGSFLGVKESSRAEAVKQIWAHIKLHNLQNPANKREIYCD  115

Query  499  EKLKSILLGKSQVDLAELPALLKLHFPK  416
            +KLK I  GK +V   E+  LL  HF K
Sbjct  116  DKLKEIFEGKEKVGFLEIGKLLSRHFVK  143



>ref|NP_564382.1| SWIB/MDM2 domain-containing protein [Arabidopsis thaliana]
 gb|AAG50727.1|AC079041_20 hypothetical protein [Arabidopsis thaliana]
 gb|AAG60155.1|AC074360_20 hypothetical protein [Arabidopsis thaliana]
 gb|AAM61643.1| unknown [Arabidopsis thaliana]
 gb|ABD59092.1| At1g31760 [Arabidopsis thaliana]
 gb|AEE31389.1| SWIB/MDM2 domain-containing protein [Arabidopsis thaliana]
Length=112

 Score = 70.1 bits (170),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 30/68 (44%), Positives = 45/68 (66%), Gaps = 0/68 (0%)
 Frame = -1

Query  619  LRDFMGQSQTSRLGCFKRIWSYIKENNLQDPNNKNLVNCDEKLKSILLGKSQVDLAELPA  440
            L  F G+ + +R    K++W Y+K +NLQ+P NK  ++CD+KLK+I  GK +V + E+  
Sbjct  43   LASFAGERELTRGSALKKVWEYVKLHNLQNPANKKEIHCDDKLKTIFDGKDKVGITEIMK  102

Query  439  LLKLHFPK  416
            LL  HFPK
Sbjct  103  LLSPHFPK  110



>gb|AAK62445.1|AF387000_1 putative protein [Arabidopsis thaliana]
Length=144

 Score = 70.9 bits (172),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/67 (48%), Positives = 43/67 (64%), Gaps = 0/67 (0%)
 Frame = -1

Query  622  ALRDFMGQSQTSRLGCFKRIWSYIKENNLQDPNNKNLVNCDEKLKSILLGKSQVDLAELP  443
            A++D +G  +  R    KRIW+YIKE++LQDP NK  + CDEKLK I  GK +V   E+ 
Sbjct  77   AMQDVVGVPEIPRTQALKRIWAYIKEHDLQDPQNKRDILCDEKLKKIFEGKERVGFLEIA  136

Query  442  ALLKLHF  422
             L+  HF
Sbjct  137  KLIGPHF  143



>ref|NP_195155.1| SWIB/MDM2 domain-containing protein [Arabidopsis thaliana]
 emb|CAB36706.1| putative protein [Arabidopsis thaliana]
 emb|CAB80146.1| putative protein [Arabidopsis thaliana]
 gb|AAN65085.1| putative protein [Arabidopsis thaliana]
 gb|AEE86355.1| SWIB/MDM2 domain-containing protein [Arabidopsis thaliana]
Length=144

 Score = 70.9 bits (172),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/67 (48%), Positives = 43/67 (64%), Gaps = 0/67 (0%)
 Frame = -1

Query  622  ALRDFMGQSQTSRLGCFKRIWSYIKENNLQDPNNKNLVNCDEKLKSILLGKSQVDLAELP  443
            A++D +G  +  R    KRIW+YIKE++LQDP NK  + CDEKLK I  GK +V   E+ 
Sbjct  77   AMQDVVGVPEIPRTQALKRIWAYIKEHDLQDPQNKRDILCDEKLKKIFEGKERVGFLEIA  136

Query  442  ALLKLHF  422
             L+  HF
Sbjct  137  KLIGPHF  143



>gb|EEC69349.1| hypothetical protein OsI_38464 [Oryza sativa Indica Group]
 gb|EEE53280.1| hypothetical protein OsJ_36231 [Oryza sativa Japonica Group]
Length=78

 Score = 69.3 bits (168),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 34/73 (47%), Positives = 47/73 (64%), Gaps = 1/73 (1%)
 Frame = -1

Query  631  LPSALRDFMGQSQT-SRLGCFKRIWSYIKENNLQDPNNKNLVNCDEKLKSILLGKSQVDL  455
            + + LR+F+G ++   R    K IW++IK NNLQDPNNK ++ CDEKLK I  G+ +V  
Sbjct  6    ISAELREFVGGAEELPRTEALKIIWAHIKGNNLQDPNNKKIIVCDEKLKKIFGGRDRVGF  65

Query  454  AELPALLKLHFPK  416
             E+  LL  HF K
Sbjct  66   LEISGLLNPHFQK  78



>ref|XP_007040857.1| SWIB/MDM2 domain superfamily protein [Theobroma cacao]
 gb|EOY25358.1| SWIB/MDM2 domain superfamily protein [Theobroma cacao]
Length=117

 Score = 70.1 bits (170),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 34/81 (42%), Positives = 49/81 (60%), Gaps = 0/81 (0%)
 Frame = -1

Query  652  NLINLVNLPSALRDFMGQSQTSRLGCFKRIWSYIKENNLQDPNNKNLVNCDEKLKSILLG  473
             L+ ++ +   L +F+G S++SR    K+IW YIK + LQ+P NK  + CDEKLK I  G
Sbjct  37   GLMRMMPVSPQLGEFLGASESSRTEAVKKIWGYIKLHKLQNPANKREILCDEKLKRIFAG  96

Query  472  KSQVDLAELPALLKLHFPKPN  410
            K  V + E+  LL  HF K +
Sbjct  97   KDSVGMFEITKLLSPHFVKSH  117



>gb|AAM62986.1| unknown [Arabidopsis thaliana]
Length=144

 Score = 70.9 bits (172),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/67 (48%), Positives = 43/67 (64%), Gaps = 0/67 (0%)
 Frame = -1

Query  622  ALRDFMGQSQTSRLGCFKRIWSYIKENNLQDPNNKNLVNCDEKLKSILLGKSQVDLAELP  443
            A++D +G  +  R    KRIW+YIKE++LQDP NK  + CDEKLK I  GK +V   E+ 
Sbjct  77   AMQDVVGVPEIPRTQALKRIWAYIKEHDLQDPQNKRDILCDEKLKKIFEGKERVGFLEIA  136

Query  442  ALLKLHF  422
             L+  HF
Sbjct  137  KLIGPHF  143



>ref|XP_009130373.1| PREDICTED: protein TRI1 [Brassica rapa]
Length=153

 Score = 70.9 bits (172),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 33/90 (37%), Positives = 50/90 (56%), Gaps = 1/90 (1%)
 Frame = -1

Query  685  SFVAENPKKLGNLINLVNLPSALRDFMGQSQTSRLGCFKRIWSYIKENNLQDPNNKNLVN  506
            S   + P+  G +     +  AL  F+G  +T+R    K +W+Y+K ++LQ+P +K  + 
Sbjct  63   SLTKKTPRTTG-IFKATPVSPALAHFLGTGETTRTDAVKEVWTYVKSHDLQNPADKREIF  121

Query  505  CDEKLKSILLGKSQVDLAELPALLKLHFPK  416
            CDEKLK I  GK +V   E+  LL  HF K
Sbjct  122  CDEKLKQIFEGKDKVGFLEVTKLLSTHFVK  151



>gb|KHG30093.1| Upstream activation factor subunit UAF30 [Gossypium arboreum]
Length=119

 Score = 70.1 bits (170),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 34/79 (43%), Positives = 47/79 (59%), Gaps = 0/79 (0%)
 Frame = -1

Query  652  NLINLVNLPSALRDFMGQSQTSRLGCFKRIWSYIKENNLQDPNNKNLVNCDEKLKSILLG  473
             L+ ++ +   L  F+G S+ SR    K+IW YIK +NLQ+P NK  + CDEKLK+I  G
Sbjct  39   GLMRVIPVSPQLGKFLGASEASRTDAIKKIWDYIKLHNLQNPANKKEIICDEKLKTIFAG  98

Query  472  KSQVDLAELPALLKLHFPK  416
            K  V + E+   L  HF K
Sbjct  99   KESVGMLEISKYLSPHFLK  117



>ref|XP_008232208.1| PREDICTED: upstream activation factor subunit spp27-like [Prunus 
mume]
Length=149

 Score = 70.9 bits (172),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 33/69 (48%), Positives = 47/69 (68%), Gaps = 0/69 (0%)
 Frame = -1

Query  622  ALRDFMGQSQTSRLGCFKRIWSYIKENNLQDPNNKNLVNCDEKLKSILLGKSQVDLAELP  443
            AL  F+G S++SR    K+IW++IK +NLQ+P NK  ++CD+KLK+I  GK +V   E+ 
Sbjct  79   ALGSFLGASESSRAEAVKQIWAHIKLHNLQNPANKKEIHCDDKLKAIFEGKEKVGFLEIG  138

Query  442  ALLKLHFPK  416
             LL  HF K
Sbjct  139  KLLSRHFVK  147



>ref|XP_008805671.1| PREDICTED: upstream activation factor subunit UAF30-like isoform 
X2 [Phoenix dactylifera]
Length=119

 Score = 70.1 bits (170),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 32/85 (38%), Positives = 50/85 (59%), Gaps = 0/85 (0%)
 Frame = -1

Query  676  AENPKKLGNLINLVNLPSALRDFMGQSQTSRLGCFKRIWSYIKENNLQDPNNKNLVNCDE  497
            A  P+    ++  + +  A+R F+G  + SR    K+IW +IK N LQ+P NK  ++CDE
Sbjct  31   AAKPRNTTGILKPLPVSPAMRKFVGAPEISRAEAVKKIWDHIKLNQLQNPTNKREIHCDE  90

Query  496  KLKSILLGKSQVDLAELPALLKLHF  422
            KLK I  G+ +V + E+  L+  HF
Sbjct  91   KLKIIFDGRDKVGMLEIAKLIAPHF  115



>ref|XP_010918651.1| PREDICTED: protein TRI1-like [Elaeis guineensis]
Length=118

 Score = 70.1 bits (170),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 50/82 (61%), Gaps = 0/82 (0%)
 Frame = -1

Query  667  PKKLGNLINLVNLPSALRDFMGQSQTSRLGCFKRIWSYIKENNLQDPNNKNLVNCDEKLK  488
            PK    ++  + +  A+R F+G  + SR    K+IW +IK N LQ+P NK  ++CDEKLK
Sbjct  33   PKNTVGILKPLPVSPAMRKFVGSPEISRAEVVKKIWEHIKLNQLQNPTNKREIHCDEKLK  92

Query  487  SILLGKSQVDLAELPALLKLHF  422
            +I  G+ +V + E+  L+  HF
Sbjct  93   TIFDGRDKVGMLEIARLIAPHF  114



>ref|XP_007218559.1| hypothetical protein PRUPE_ppa012921mg [Prunus persica]
 gb|EMJ19758.1| hypothetical protein PRUPE_ppa012921mg [Prunus persica]
Length=149

 Score = 70.9 bits (172),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 33/69 (48%), Positives = 47/69 (68%), Gaps = 0/69 (0%)
 Frame = -1

Query  622  ALRDFMGQSQTSRLGCFKRIWSYIKENNLQDPNNKNLVNCDEKLKSILLGKSQVDLAELP  443
            AL  F+G S++SR    K+IW++IK +NLQ+P NK  ++CD+KLK+I  GK +V   E+ 
Sbjct  79   ALGSFLGASESSRAEAVKQIWAHIKLHNLQNPANKREIHCDDKLKAIFEGKEKVGFLEIG  138

Query  442  ALLKLHFPK  416
             LL  HF K
Sbjct  139  KLLSRHFVK  147



>emb|CDY51761.1| BnaA05g32850D [Brassica napus]
Length=134

 Score = 70.5 bits (171),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 34/96 (35%), Positives = 52/96 (54%), Gaps = 1/96 (1%)
 Frame = -1

Query  694  KMKSFVAENPKKLGNLINLVNLPSALRDFMGQSQTSRLGCFKRIWSYIKENNLQDPNNKN  515
            K  S   + P+  G +     +  AL  F+G  +T+R    K +W+Y+K ++LQ+P +K 
Sbjct  40   KPDSLAKKTPRTTG-IFKATPVSPALAHFLGTGETTRTDAVKEVWTYVKSHDLQNPADKR  98

Query  514  LVNCDEKLKSILLGKSQVDLAELPALLKLHFPKPNS  407
             + CDEKLK I  GK +V   E+  LL  HF K  +
Sbjct  99   EIFCDEKLKQIFEGKDKVGFLEVTNLLSTHFVKTTA  134



>ref|XP_010675600.1| PREDICTED: upstream activation factor subunit spp27 [Beta vulgaris 
subsp. vulgaris]
Length=130

 Score = 70.1 bits (170),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 32/68 (47%), Positives = 43/68 (63%), Gaps = 0/68 (0%)
 Frame = -1

Query  619  LRDFMGQSQTSRLGCFKRIWSYIKENNLQDPNNKNLVNCDEKLKSILLGKSQVDLAELPA  440
            L DF+G  + SR    K++W +IK NNLQ+P NK  + CDEKLK++  GK +V   E+  
Sbjct  61   LSDFIGSPEASRTAAVKKVWEHIKLNNLQNPANKREIICDEKLKALFSGKDRVGFLEIAK  120

Query  439  LLKLHFPK  416
            LL  HF K
Sbjct  121  LLSQHFVK  128



>dbj|BAJ94258.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=146

 Score = 70.5 bits (171),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 35/85 (41%), Positives = 49/85 (58%), Gaps = 0/85 (0%)
 Frame = -1

Query  670  NPKKLGNLINLVNLPSALRDFMGQSQTSRLGCFKRIWSYIKENNLQDPNNKNLVNCDEKL  491
            +P  L  ++  V +  AL  F G    SR G  K +W Y+K N+LQ+P NK  + CDEKL
Sbjct  60   DPNNLRGIMRPVPVSDALSKFGGAPNISRSGVLKIVWDYVKANSLQNPANKKEIICDEKL  119

Query  490  KSILLGKSQVDLAELPALLKLHFPK  416
            K+I  G++ V + E+  LL  HF K
Sbjct  120  KTIFDGRNTVHMTEVTKLLSPHFVK  144



>gb|EAY84337.1| hypothetical protein OsI_05714 [Oryza sativa Indica Group]
Length=131

 Score = 70.1 bits (170),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 36/81 (44%), Positives = 49/81 (60%), Gaps = 1/81 (1%)
 Frame = -1

Query  649  LINLVNLPSALRDFM-GQSQTSRLGCFKRIWSYIKENNLQDPNNKNLVNCDEKLKSILLG  473
            ++  V +  AL  F  G  + SR G  K IW++IK N LQ+P NK  +NCD+KLKS+  G
Sbjct  51   IMQPVPVSDALSRFADGAPEMSRAGAVKLIWNHIKANGLQNPANKREINCDDKLKSLFAG  110

Query  472  KSQVDLAELPALLKLHFPKPN  410
            K +V + E+  LL  HF K N
Sbjct  111  KDKVGMMEIAKLLSPHFIKAN  131



>ref|XP_009380089.1| PREDICTED: protein TRI1-like [Musa acuminata subsp. malaccensis]
Length=141

 Score = 70.5 bits (171),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 31/69 (45%), Positives = 44/69 (64%), Gaps = 0/69 (0%)
 Frame = -1

Query  622  ALRDFMGQSQTSRLGCFKRIWSYIKENNLQDPNNKNLVNCDEKLKSILLGKSQVDLAELP  443
            A++  +G  +  R    K IW+YIKE+NLQDP NK ++ CDEKLK+I  G+ +V   E+ 
Sbjct  73   AMQALVGVPEIPRTQALKLIWAYIKEHNLQDPENKKIIVCDEKLKAIFGGRDRVGFLEIS  132

Query  442  ALLKLHFPK  416
             L+  HF K
Sbjct  133  GLINPHFSK  141



>ref|XP_006415306.1| hypothetical protein EUTSA_v10008891mg [Eutrema salsugineum]
 gb|ESQ33659.1| hypothetical protein EUTSA_v10008891mg [Eutrema salsugineum]
Length=180

 Score = 70.9 bits (172),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 32/78 (41%), Positives = 46/78 (59%), Gaps = 0/78 (0%)
 Frame = -1

Query  649  LINLVNLPSALRDFMGQSQTSRLGCFKRIWSYIKENNLQDPNNKNLVNCDEKLKSILLGK  470
            ++  V +   L  F G+++ SR    K++W YIK  NLQ+P N+  + CD+KLK+I  GK
Sbjct  101  ILKTVPVSPTLASFAGENELSRATAVKKVWEYIKGQNLQNPTNRREILCDDKLKTIFDGK  160

Query  469  SQVDLAELPALLKLHFPK  416
              V   E+  LL  HFPK
Sbjct  161  DTVGFTEIAKLLSPHFPK  178



>ref|XP_010271723.1| PREDICTED: uncharacterized protein LOC104607719 [Nelumbo nucifera]
Length=137

 Score = 70.1 bits (170),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 29/67 (43%), Positives = 44/67 (66%), Gaps = 0/67 (0%)
 Frame = -1

Query  622  ALRDFMGQSQTSRLGCFKRIWSYIKENNLQDPNNKNLVNCDEKLKSILLGKSQVDLAELP  443
            A++  +G  +  R    K+IW+YIK++NLQDP NK ++ CDEKLK+I  G+ +V   E+ 
Sbjct  69   AMQALLGVQEIPRTQALKQIWAYIKQHNLQDPENKKIIMCDEKLKTIFGGRERVGFLEIA  128

Query  442  ALLKLHF  422
             L+  HF
Sbjct  129  GLINPHF  135



>ref|XP_004962921.1| PREDICTED: upstream activation factor subunit spp27-like [Setaria 
italica]
Length=149

 Score = 70.5 bits (171),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 32/69 (46%), Positives = 46/69 (67%), Gaps = 1/69 (1%)
 Frame = -1

Query  619  LRDFMG-QSQTSRLGCFKRIWSYIKENNLQDPNNKNLVNCDEKLKSILLGKSQVDLAELP  443
            LR+F+G  ++  R    K +W++IK NNLQDP+NK ++ CD+KLK I  G+ +V   E+ 
Sbjct  81   LREFVGGAAELPRTEAIKLVWAHIKGNNLQDPDNKKIIVCDDKLKKIFGGRDRVGFLEIS  140

Query  442  ALLKLHFPK  416
             LL  HFPK
Sbjct  141  GLLNPHFPK  149



>ref|XP_006408288.1| hypothetical protein EUTSA_v10021710mg [Eutrema salsugineum]
 gb|ESQ49741.1| hypothetical protein EUTSA_v10021710mg [Eutrema salsugineum]
Length=146

 Score = 70.1 bits (170),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 33/86 (38%), Positives = 49/86 (57%), Gaps = 1/86 (1%)
 Frame = -1

Query  673  ENPKKLGNLINLVNLPSALRDFMGQSQTSRLGCFKRIWSYIKENNLQDPNNKNLVNCDEK  494
            + P+  G +     +  AL  F+G  +T+R    K IW+Y+K ++LQ+P +K  + CDEK
Sbjct  60   KTPRSTG-IFKATPVSPALAQFLGTGETTRTDAIKEIWTYVKSHDLQNPADKREIFCDEK  118

Query  493  LKSILLGKSQVDLAELPALLKLHFPK  416
            LK I  GK +V   E+  LL  HF K
Sbjct  119  LKQIFQGKDKVGFLEITKLLSPHFVK  144



>ref|XP_010530721.1| PREDICTED: upstream activation factor subunit UAF30-like [Tarenaya 
hassleriana]
Length=139

 Score = 70.1 bits (170),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 42/66 (64%), Gaps = 0/66 (0%)
 Frame = -1

Query  619  LRDFMGQSQTSRLGCFKRIWSYIKENNLQDPNNKNLVNCDEKLKSILLGKSQVDLAELPA  440
            +++ +G S+  R    KRIW+YIKENNLQDP N   + CDEKLK I  GK +V   E+  
Sbjct  73   MQEVVGVSEIPRTQALKRIWAYIKENNLQDPANMRDIICDEKLKKIFGGKDRVGFLEVAK  132

Query  439  LLKLHF  422
            L+  HF
Sbjct  133  LIGPHF  138



>ref|XP_010943392.1| PREDICTED: upstream activation factor subunit spp27-like [Elaeis 
guineensis]
Length=120

 Score = 69.3 bits (168),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 31/69 (45%), Positives = 45/69 (65%), Gaps = 0/69 (0%)
 Frame = -1

Query  622  ALRDFMGQSQTSRLGCFKRIWSYIKENNLQDPNNKNLVNCDEKLKSILLGKSQVDLAELP  443
            A+R F+G  + SR    K+IW +IK N LQ+P NK  ++CDEKLK+I  G+ +V + E+ 
Sbjct  50   AMRKFVGAPEISRAEVVKKIWEHIKLNQLQNPTNKREIHCDEKLKTIFNGRDKVGMLEIA  109

Query  442  ALLKLHFPK  416
             L+  HF K
Sbjct  110  RLITPHFQK  118



>ref|XP_010065391.1| PREDICTED: zinc finger CCCH domain-containing protein 44-like 
[Eucalyptus grandis]
Length=139

 Score = 69.7 bits (169),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 41/66 (62%), Gaps = 0/66 (0%)
 Frame = -1

Query  619  LRDFMGQSQTSRLGCFKRIWSYIKENNLQDPNNKNLVNCDEKLKSILLGKSQVDLAELPA  440
            ++  +G  +  R    K IW+YIKE+NLQDP NK ++ CDEKLK I  GK +V   E+  
Sbjct  73   MQALVGVPEIPRTQALKLIWAYIKEHNLQDPENKKVIMCDEKLKKIFAGKDRVGFLEIAG  132

Query  439  LLKLHF  422
            L+  HF
Sbjct  133  LISPHF  138



>ref|XP_002869158.1| hypothetical protein ARALYDRAFT_491238 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45417.1| hypothetical protein ARALYDRAFT_491238 [Arabidopsis lyrata subsp. 
lyrata]
Length=144

 Score = 70.1 bits (170),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 31/66 (47%), Positives = 42/66 (64%), Gaps = 0/66 (0%)
 Frame = -1

Query  619  LRDFMGQSQTSRLGCFKRIWSYIKENNLQDPNNKNLVNCDEKLKSILLGKSQVDLAELPA  440
            ++D +G  +  R    KRIW+YIKE++LQDP NK  + CDEKLK I  GK +V   E+  
Sbjct  78   MQDVVGVPEIPRTQALKRIWAYIKEHDLQDPQNKRDIICDEKLKKIFEGKERVGFLEIAK  137

Query  439  LLKLHF  422
            L+  HF
Sbjct  138  LIGPHF  143



>ref|XP_006410720.1| hypothetical protein EUTSA_v10017454mg [Eutrema salsugineum]
 gb|ESQ52173.1| hypothetical protein EUTSA_v10017454mg [Eutrema salsugineum]
Length=112

 Score = 69.3 bits (168),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 32/78 (41%), Positives = 48/78 (62%), Gaps = 0/78 (0%)
 Frame = -1

Query  649  LINLVNLPSALRDFMGQSQTSRLGCFKRIWSYIKENNLQDPNNKNLVNCDEKLKSILLGK  470
            ++ ++ +   L +F+G ++ +R    K+IW YIK +NLQ+P NK  + CD KLK+I  GK
Sbjct  33   ILKVMPVSQPLANFIGANEVARTTAVKKIWEYIKLHNLQNPENKKEILCDGKLKTIFNGK  92

Query  469  SQVDLAELPALLKLHFPK  416
              V   E+  LL  HFPK
Sbjct  93   DTVGFLEIAKLLSQHFPK  110



>ref|NP_001143368.1| uncharacterized protein LOC100275998 [Zea mays]
 gb|ACG31364.1| hypothetical protein [Zea mays]
 gb|ACN31729.1| unknown [Zea mays]
 gb|AFW74684.1| hypothetical protein ZEAMMB73_000211 [Zea mays]
 gb|AIB05615.1| SWI-SNF-BAF60 transcription factor, partial [Zea mays]
Length=143

 Score = 69.7 bits (169),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 47/73 (64%), Gaps = 1/73 (1%)
 Frame = -1

Query  631  LPSALRDFMG-QSQTSRLGCFKRIWSYIKENNLQDPNNKNLVNCDEKLKSILLGKSQVDL  455
            + + LR+F+G  ++  R    K +W++IK NNLQDPNNK ++ CDEKLK I  G+ +V  
Sbjct  71   ISTELREFVGGAAELPRTEAIKLVWAHIKGNNLQDPNNKKIIICDEKLKKIFGGRDRVGF  130

Query  454  AELPALLKLHFPK  416
             E+  LL  HF K
Sbjct  131  LEISGLLNPHFQK  143



>ref|XP_010517878.1| PREDICTED: upstream activation factor subunit spp27-like [Camelina 
sativa]
Length=141

 Score = 69.7 bits (169),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 31/66 (47%), Positives = 42/66 (64%), Gaps = 0/66 (0%)
 Frame = -1

Query  619  LRDFMGQSQTSRLGCFKRIWSYIKENNLQDPNNKNLVNCDEKLKSILLGKSQVDLAELPA  440
            ++D +G  +  R    KRIW+YIKE++LQDP NK  + CDEKLK I  GK +V   E+  
Sbjct  75   MQDIVGLPEIPRTQALKRIWAYIKEHDLQDPQNKREILCDEKLKKIFEGKDRVGFLEIAK  134

Query  439  LLKLHF  422
            L+  HF
Sbjct  135  LIGPHF  140



>emb|CDX76269.1| BnaA08g11310D [Brassica napus]
Length=88

 Score = 68.6 bits (166),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 30/66 (45%), Positives = 43/66 (65%), Gaps = 0/66 (0%)
 Frame = -1

Query  619  LRDFMGQSQTSRLGCFKRIWSYIKENNLQDPNNKNLVNCDEKLKSILLGKSQVDLAELPA  440
            ++D +G+S   R    KRIW+YIKE++LQDP +K ++ CDEKLK I  GK +    E+  
Sbjct  22   MKDVVGESVIPRTQALKRIWAYIKEHDLQDPQDKKVIICDEKLKKIFEGKDRDGFLEIAK  81

Query  439  LLKLHF  422
            L+  HF
Sbjct  82   LIGPHF  87



>ref|XP_006298767.1| hypothetical protein CARUB_v10014869mg [Capsella rubella]
 gb|EOA31665.1| hypothetical protein CARUB_v10014869mg [Capsella rubella]
Length=142

 Score = 69.7 bits (169),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 31/66 (47%), Positives = 42/66 (64%), Gaps = 0/66 (0%)
 Frame = -1

Query  619  LRDFMGQSQTSRLGCFKRIWSYIKENNLQDPNNKNLVNCDEKLKSILLGKSQVDLAELPA  440
            ++D +G  +  R    KRIW+YIKE++LQDP NK  + CDEKLK I  GK +V   E+  
Sbjct  76   MQDIVGLPEIPRTQALKRIWAYIKEHDLQDPQNKREILCDEKLKKIFEGKDRVGFLEIAK  135

Query  439  LLKLHF  422
            L+  HF
Sbjct  136  LIGPHF  141



>emb|CDP07628.1| unnamed protein product [Coffea canephora]
Length=168

 Score = 70.1 bits (170),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 30/67 (45%), Positives = 46/67 (69%), Gaps = 0/67 (0%)
 Frame = -1

Query  622  ALRDFMGQSQTSRLGCFKRIWSYIKENNLQDPNNKNLVNCDEKLKSILLGKSQVDLAELP  443
            AL DF+G S++SR    K++W +IK NNLQ+P NK  + CD+KLK++  G+ +V + E+ 
Sbjct  98   ALNDFLGVSESSRSDAVKKVWEHIKLNNLQNPANKREIYCDDKLKTLFEGRGKVGMLEIA  157

Query  442  ALLKLHF  422
             +L  HF
Sbjct  158  RILSGHF  164



>ref|XP_006303413.1| hypothetical protein CARUB_v10010619mg, partial [Capsella rubella]
 gb|EOA36311.1| hypothetical protein CARUB_v10010619mg, partial [Capsella rubella]
Length=132

 Score = 69.3 bits (168),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 31/68 (46%), Positives = 45/68 (66%), Gaps = 0/68 (0%)
 Frame = -1

Query  619  LRDFMGQSQTSRLGCFKRIWSYIKENNLQDPNNKNLVNCDEKLKSILLGKSQVDLAELPA  440
            L  F G+S+ +R    K++W YIK +NLQ+P NK  ++CD+KLK+I  GK +V + E+  
Sbjct  63   LASFAGESELTRGSAVKKVWEYIKLHNLQNPANKREIHCDDKLKTIFGGKDKVGMTEIMK  122

Query  439  LLKLHFPK  416
            LL  HF K
Sbjct  123  LLSPHFTK  130



>ref|XP_010488931.1| PREDICTED: upstream activation factor subunit spp27-like [Camelina 
sativa]
Length=141

 Score = 69.7 bits (169),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 31/66 (47%), Positives = 42/66 (64%), Gaps = 0/66 (0%)
 Frame = -1

Query  619  LRDFMGQSQTSRLGCFKRIWSYIKENNLQDPNNKNLVNCDEKLKSILLGKSQVDLAELPA  440
            ++D +G  +  R    KRIW+YIKE++LQDP NK  + CDEKLK I  GK +V   E+  
Sbjct  75   MQDIVGLPEIPRTQALKRIWAYIKEHDLQDPQNKREILCDEKLKKIFEGKDRVGFLEIAK  134

Query  439  LLKLHF  422
            L+  HF
Sbjct  135  LIGPHF  140



>ref|XP_010447106.1| PREDICTED: upstream activation factor subunit UAF30-like [Camelina 
sativa]
Length=141

 Score = 69.7 bits (169),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 31/66 (47%), Positives = 42/66 (64%), Gaps = 0/66 (0%)
 Frame = -1

Query  619  LRDFMGQSQTSRLGCFKRIWSYIKENNLQDPNNKNLVNCDEKLKSILLGKSQVDLAELPA  440
            ++D +G  +  R    KRIW+YIKE++LQDP NK  + CDEKLK I  GK +V   E+  
Sbjct  75   MQDIVGVPEIPRTQALKRIWAYIKEHDLQDPQNKRDILCDEKLKKIFEGKERVGFLEIAK  134

Query  439  LLKLHF  422
            L+  HF
Sbjct  135  LIGPHF  140



>ref|XP_010432435.1| PREDICTED: upstream activation factor subunit UAF30-like [Camelina 
sativa]
Length=140

 Score = 69.7 bits (169),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 31/66 (47%), Positives = 42/66 (64%), Gaps = 0/66 (0%)
 Frame = -1

Query  619  LRDFMGQSQTSRLGCFKRIWSYIKENNLQDPNNKNLVNCDEKLKSILLGKSQVDLAELPA  440
            ++D +G  +  R    KRIW+YIKE++LQDP NK  + CDEKLK I  GK +V   E+  
Sbjct  74   MQDIVGVPEIPRTQALKRIWAYIKEHDLQDPQNKRDILCDEKLKKIFEGKERVGFLEIAK  133

Query  439  LLKLHF  422
            L+  HF
Sbjct  134  LIGPHF  139



>ref|XP_004133931.1| PREDICTED: uncharacterized protein LOC101218027 [Cucumis sativus]
 gb|KGN56620.1| hypothetical protein Csa_3G126840 [Cucumis sativus]
Length=157

 Score = 70.1 bits (170),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 38/108 (35%), Positives = 59/108 (55%), Gaps = 8/108 (7%)
 Frame = -1

Query  715  KKKMLPHKMKSFVAENPK--------KLGNLINLVNLPSALRDFMGQSQTSRLGCFKRIW  560
            K K  P  + + VA  P+        +   ++ +  +  AL +F+G S+ SR     +IW
Sbjct  49   KVKTPPSSVAAGVAATPEPKIKKEMSRPSGILKVTQVSPALSNFLGVSEASRSDAVTQIW  108

Query  559  SYIKENNLQDPNNKNLVNCDEKLKSILLGKSQVDLAELPALLKLHFPK  416
            SYIK +NLQ+P+NK  + CD+KLK+I  G+ +V   E+   L  HF K
Sbjct  109  SYIKLHNLQNPDNKREIYCDDKLKAIFEGREKVGFLEIGKSLARHFVK  156



>gb|AFW67548.1| SWIb domain-containing protein [Zea mays]
Length=145

 Score = 69.7 bits (169),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 32/69 (46%), Positives = 44/69 (64%), Gaps = 0/69 (0%)
 Frame = -1

Query  622  ALRDFMGQSQTSRLGCFKRIWSYIKENNLQDPNNKNLVNCDEKLKSILLGKSQVDLAELP  443
            AL+  +G     R    KR+W+YIKE+NLQDP++K +V CDEKLK +  G+ +V   E+ 
Sbjct  77   ALQAIVGDPVIPRTEVLKRLWAYIKEHNLQDPSDKKVVVCDEKLKVLFAGRERVGFLEIA  136

Query  442  ALLKLHFPK  416
             LL  HF K
Sbjct  137  KLLNPHFVK  145



>ref|XP_002979782.1| hypothetical protein SELMODRAFT_59520, partial [Selaginella moellendorffii]
 ref|XP_002985445.1| hypothetical protein SELMODRAFT_49456, partial [Selaginella moellendorffii]
 gb|EFJ13575.1| hypothetical protein SELMODRAFT_49456, partial [Selaginella moellendorffii]
 gb|EFJ19184.1| hypothetical protein SELMODRAFT_59520, partial [Selaginella moellendorffii]
Length=79

 Score = 68.2 bits (165),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 33/75 (44%), Positives = 46/75 (61%), Gaps = 0/75 (0%)
 Frame = -1

Query  640  LVNLPSALRDFMGQSQTSRLGCFKRIWSYIKENNLQDPNNKNLVNCDEKLKSILLGKSQV  461
            +V + +A R F G  + SR+   K++W YIK +NLQDP  K  +  DEKLK  L  K ++
Sbjct  5    VVPISAAGRKFFGLQEMSRIDAMKQMWVYIKSHNLQDPEKKRNILPDEKLKQFLSCKDRI  64

Query  460  DLAELPALLKLHFPK  416
            D+ E+P LL  HF K
Sbjct  65   DMTEIPGLLSPHFAK  79



>ref|XP_010065937.1| PREDICTED: zinc finger CCCH domain-containing protein 44-like 
[Eucalyptus grandis]
 gb|KCW63650.1| hypothetical protein EUGRSUZ_G01289 [Eucalyptus grandis]
Length=141

 Score = 69.7 bits (169),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 41/66 (62%), Gaps = 0/66 (0%)
 Frame = -1

Query  619  LRDFMGQSQTSRLGCFKRIWSYIKENNLQDPNNKNLVNCDEKLKSILLGKSQVDLAELPA  440
            ++  +G  +  R    K IW+YIKE+NLQDP NK ++ CDEKLK I  GK +V   E+  
Sbjct  75   MQALVGVPEIPRTQALKLIWAYIKEHNLQDPENKKVIMCDEKLKKIFAGKDRVGFLEIAG  134

Query  439  LLKLHF  422
            L+  HF
Sbjct  135  LISPHF  140



>ref|XP_010496487.1| PREDICTED: upstream activation factor subunit spp27-like [Camelina 
sativa]
Length=141

 Score = 69.3 bits (168),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 31/66 (47%), Positives = 42/66 (64%), Gaps = 0/66 (0%)
 Frame = -1

Query  619  LRDFMGQSQTSRLGCFKRIWSYIKENNLQDPNNKNLVNCDEKLKSILLGKSQVDLAELPA  440
            ++D +G  +  R    KRIW+YIKE++LQDP NK  + CDEKLK I  GK +V   E+  
Sbjct  75   MQDIVGLPEIPRTQALKRIWAYIKEHDLQDPQNKREILCDEKLKKIFEGKDRVGFLEIAK  134

Query  439  LLKLHF  422
            L+  HF
Sbjct  135  LIGPHF  140



>ref|XP_010437637.1| PREDICTED: upstream activation factor subunit UAF30-like [Camelina 
sativa]
Length=140

 Score = 69.3 bits (168),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 31/66 (47%), Positives = 42/66 (64%), Gaps = 0/66 (0%)
 Frame = -1

Query  619  LRDFMGQSQTSRLGCFKRIWSYIKENNLQDPNNKNLVNCDEKLKSILLGKSQVDLAELPA  440
            ++D +G  +  R    KRIW+YIKE++LQDP NK  + CDEKLK I  GK +V   E+  
Sbjct  74   MQDIVGVPEIPRTQALKRIWAYIKEHDLQDPQNKRDILCDEKLKKIFEGKERVGFLEIAK  133

Query  439  LLKLHF  422
            L+  HF
Sbjct  134  LIGPHF  139



>ref|XP_011086668.1| PREDICTED: upstream activation factor subunit UAF30 [Sesamum 
indicum]
Length=142

 Score = 69.3 bits (168),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 46/71 (65%), Gaps = 0/71 (0%)
 Frame = -1

Query  622  ALRDFMGQSQTSRLGCFKRIWSYIKENNLQDPNNKNLVNCDEKLKSILLGKSQVDLAELP  443
            AL+  +G S+ SR+   K+IW+YIK +NLQ+P+NK  + CD KLK +  GK +V   E+ 
Sbjct  72   ALQSVVGASEVSRVEAVKKIWAYIKLHNLQNPSNKKEIICDAKLKKLFNGKDKVGFLEIA  131

Query  442  ALLKLHFPKPN  410
             LL  HF K N
Sbjct  132  KLLSPHFVKAN  142



>gb|EMS58614.1| Protein TRI1 [Triticum urartu]
Length=79

 Score = 68.2 bits (165),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 34/74 (46%), Positives = 44/74 (59%), Gaps = 0/74 (0%)
 Frame = -1

Query  637  VNLPSALRDFMGQSQTSRLGCFKRIWSYIKENNLQDPNNKNLVNCDEKLKSILLGKSQVD  458
            V +  ALR F G +  SR G  K +W YIK  +LQ+P NK  + CDEKLK+I  G+  V 
Sbjct  4    VPVSDALRKFGGAAHISRSGVLKIVWDYIKAKDLQNPLNKREIICDEKLKTIFPGRDTVH  63

Query  457  LAELPALLKLHFPK  416
            + E+  LL  HF K
Sbjct  64   MMEVTKLLSPHFVK  77



>ref|XP_008780890.1| PREDICTED: uncharacterized protein LOC103700804 [Phoenix dactylifera]
Length=142

 Score = 69.3 bits (168),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 31/67 (46%), Positives = 43/67 (64%), Gaps = 0/67 (0%)
 Frame = -1

Query  622  ALRDFMGQSQTSRLGCFKRIWSYIKENNLQDPNNKNLVNCDEKLKSILLGKSQVDLAELP  443
            A++  +G  +  R    K +W+YIKE+NLQDP NK +V CDEKLK++  GK +V   E+ 
Sbjct  74   AMQAIVGVPEIPRTQALKLLWAYIKEHNLQDPENKRIVVCDEKLKNLFGGKERVGFLEIS  133

Query  442  ALLKLHF  422
             LL  HF
Sbjct  134  GLLNPHF  140



>ref|XP_009376300.1| PREDICTED: upstream activation factor subunit spp27-like [Pyrus 
x bretschneideri]
Length=145

 Score = 69.3 bits (168),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 35/88 (40%), Positives = 52/88 (59%), Gaps = 0/88 (0%)
 Frame = -1

Query  679  VAENPKKLGNLINLVNLPSALRDFMGQSQTSRLGCFKRIWSYIKENNLQDPNNKNLVNCD  500
            V+  PK    ++  + +  AL  F+G  ++SR    K+IW++IK +NLQ+P NK  + CD
Sbjct  56   VSTKPKPTLGIMKPIPISPALGSFLGVKESSRAEAVKQIWAHIKLHNLQNPANKREIYCD  115

Query  499  EKLKSILLGKSQVDLAELPALLKLHFPK  416
            +KLK I  GK +V   E+  LL  HF K
Sbjct  116  DKLKEIFEGKEKVGFLEIGKLLSRHFVK  143



>ref|XP_010547959.1| PREDICTED: protein TRI1-like [Tarenaya hassleriana]
Length=140

 Score = 69.3 bits (168),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 31/66 (47%), Positives = 42/66 (64%), Gaps = 0/66 (0%)
 Frame = -1

Query  619  LRDFMGQSQTSRLGCFKRIWSYIKENNLQDPNNKNLVNCDEKLKSILLGKSQVDLAELPA  440
            +++ +G S+  R    KRIW+YIKENNLQDP N   + CDEKLK I  G+ +V   E+  
Sbjct  74   MQEVVGVSEIPRTQALKRIWAYIKENNLQDPANMRDIICDEKLKKIFDGRDRVGFLEVAK  133

Query  439  LLKLHF  422
            L+  HF
Sbjct  134  LIGPHF  139



>ref|XP_010939095.1| PREDICTED: uncharacterized protein LOC105058027 [Elaeis guineensis]
Length=145

 Score = 69.3 bits (168),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 31/66 (47%), Positives = 41/66 (62%), Gaps = 0/66 (0%)
 Frame = -1

Query  619  LRDFMGQSQTSRLGCFKRIWSYIKENNLQDPNNKNLVNCDEKLKSILLGKSQVDLAELPA  440
            L+  +G  +  R    K+IW+YIKEN LQDP NK ++ CDEKLK I  G+ +V   E+  
Sbjct  78   LQALLGVKEIPRTQALKQIWAYIKENGLQDPENKKVIVCDEKLKKIFGGRDRVGFLEISG  137

Query  439  LLKLHF  422
            LL  HF
Sbjct  138  LLNPHF  143



>gb|ADE77352.1| unknown [Picea sitchensis]
Length=129

 Score = 68.9 bits (167),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 31/68 (46%), Positives = 45/68 (66%), Gaps = 0/68 (0%)
 Frame = -1

Query  619  LRDFMGQSQTSRLGCFKRIWSYIKENNLQDPNNKNLVNCDEKLKSILLGKSQVDLAELPA  440
            ++ F+G S+ +R    K+IW +IK NNLQ+P NK  + CDEKLK+IL  K  V++ E+  
Sbjct  60   MKKFLGVSEVARSEAIKKIWEHIKANNLQNPANKTEILCDEKLKAILGQKENVNMFEIAK  119

Query  439  LLKLHFPK  416
            L+  HF K
Sbjct  120  LISPHFIK  127



>ref|XP_008455019.1| PREDICTED: uncharacterized protein LOC103495293 [Cucumis melo]
Length=143

 Score = 69.3 bits (168),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 31/66 (47%), Positives = 43/66 (65%), Gaps = 0/66 (0%)
 Frame = -1

Query  619  LRDFMGQSQTSRLGCFKRIWSYIKENNLQDPNNKNLVNCDEKLKSILLGKSQVDLAELPA  440
            L+  +G  + SR    K IW+YIKENNLQ P++K ++ CDEKLK+I  GK +V   E+  
Sbjct  77   LQALVGAPEISRTQALKVIWAYIKENNLQKPSDKKVIVCDEKLKNIFGGKDEVGFLEIAG  136

Query  439  LLKLHF  422
            L+  HF
Sbjct  137  LISPHF  142



>gb|KFK39989.1| hypothetical protein AALP_AA3G315600 [Arabis alpina]
Length=98

 Score = 68.2 bits (165),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 31/66 (47%), Positives = 42/66 (64%), Gaps = 0/66 (0%)
 Frame = -1

Query  619  LRDFMGQSQTSRLGCFKRIWSYIKENNLQDPNNKNLVNCDEKLKSILLGKSQVDLAELPA  440
            ++D +G S+  R    KR W+YIKEN+LQDP NK  + CDEKLK I  G+ +V   E+  
Sbjct  32   MQDVVGLSEIPRTQALKRTWAYIKENDLQDPQNKRDILCDEKLKKIFEGRERVGFLEIAK  91

Query  439  LLKLHF  422
            L+  HF
Sbjct  92   LIGPHF  97



>gb|KFK30067.1| hypothetical protein AALP_AA7G212300 [Arabis alpina]
Length=137

 Score = 68.9 bits (167),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 43/66 (65%), Gaps = 0/66 (0%)
 Frame = -1

Query  619  LRDFMGQSQTSRLGCFKRIWSYIKENNLQDPNNKNLVNCDEKLKSILLGKSQVDLAELPA  440
            ++D +G+S   R    KRIW+YIKE++LQDP +K ++ CDEKLK I   K +V   E+  
Sbjct  71   MQDVVGESVIPRTQALKRIWAYIKEHDLQDPQDKKVIICDEKLKKIFDNKDRVGFLEIAK  130

Query  439  LLKLHF  422
            L+  HF
Sbjct  131  LIGPHF  136



>gb|KDO72266.1| hypothetical protein CISIN_1g048564mg [Citrus sinensis]
Length=114

 Score = 68.2 bits (165),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 31/74 (42%), Positives = 46/74 (62%), Gaps = 0/74 (0%)
 Frame = -1

Query  637  VNLPSALRDFMGQSQTSRLGCFKRIWSYIKENNLQDPNNKNLVNCDEKLKSILLGKSQVD  458
            V + + L  F+G ++ SR    K+IW YI++++LQ+P NK  + CD+KLK+I  GK  V 
Sbjct  39   VPVSAQLSKFLGANEASRSDAVKKIWQYIRQHDLQNPANKREIRCDDKLKTIFNGKDSVG  98

Query  457  LAELPALLKLHFPK  416
              E+  LL  HF K
Sbjct  99   FLEIAKLLSQHFVK  112



>ref|XP_009396701.1| PREDICTED: protein TRI1-like [Musa acuminata subsp. malaccensis]
Length=134

 Score = 68.6 bits (166),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 31/69 (45%), Positives = 46/69 (67%), Gaps = 0/69 (0%)
 Frame = -1

Query  622  ALRDFMGQSQTSRLGCFKRIWSYIKENNLQDPNNKNLVNCDEKLKSILLGKSQVDLAELP  443
            A++ F+G S+ SR    K+IW +IK N LQD   K+ ++CD+KLKSI  G+ +V + E+ 
Sbjct  64   AMQKFVGASEISRNVAIKKIWEHIKLNQLQDTATKSEIHCDDKLKSIFDGRDKVRMLEIS  123

Query  442  ALLKLHFPK  416
             L+  HFPK
Sbjct  124  GLIASHFPK  132



>gb|KFK37792.1| hypothetical protein AALP_AA3G029600 [Arabis alpina]
Length=142

 Score = 68.6 bits (166),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 33/87 (38%), Positives = 49/87 (56%), Gaps = 0/87 (0%)
 Frame = -1

Query  676  AENPKKLGNLINLVNLPSALRDFMGQSQTSRLGCFKRIWSYIKENNLQDPNNKNLVNCDE  497
            A+   +   +  +  +   L  F+G  +T+R    K IW+Y+K ++LQ+P NK  + CDE
Sbjct  54   AKRTSRSAGIFKMTPVSPVLAQFLGTGETNRTDAVKEIWTYVKSHDLQNPANKREIFCDE  113

Query  496  KLKSILLGKSQVDLAELPALLKLHFPK  416
            KLK I  GK +V L E+  LL  HF K
Sbjct  114  KLKLIFDGKDKVGLLEITKLLAPHFVK  140



>ref|XP_009804463.1| PREDICTED: protein TRI1-like [Nicotiana sylvestris]
Length=147

 Score = 68.9 bits (167),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 41/63 (65%), Gaps = 0/63 (0%)
 Frame = -1

Query  604  GQSQTSRLGCFKRIWSYIKENNLQDPNNKNLVNCDEKLKSILLGKSQVDLAELPALLKLH  425
            G ++  R    K IW++IKENNLQDP NK ++ CDEKLK+I  GK +V   E+  L+  H
Sbjct  85   GIAEIPRTQALKLIWAHIKENNLQDPQNKKVIICDEKLKNIFAGKDRVGFLEIAGLISPH  144

Query  424  FPK  416
            F K
Sbjct  145  FLK  147



>gb|EYU37600.1| hypothetical protein MIMGU_mgv1a015703mg [Erythranthe guttata]
Length=141

 Score = 68.6 bits (166),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 34/104 (33%), Positives = 56/104 (54%), Gaps = 2/104 (2%)
 Frame = -1

Query  727  LRRGKKKMLPHKMKSFVAENPKKLGNLINLVNLPSALRDFMG--QSQTSRLGCFKRIWSY  554
            LR  +   +    K      P++   ++    +   ++DF+G   ++  R    K IW+Y
Sbjct  36   LRVPRPATISAVAKPATETKPREPRGIMKPRRVSPEMQDFIGGGVTEIPRTQALKEIWAY  95

Query  553  IKENNLQDPNNKNLVNCDEKLKSILLGKSQVDLAELPALLKLHF  422
            IK++NLQDP +K ++ CDEKLK+I  G+ +V   E+  LL  HF
Sbjct  96   IKQHNLQDPKDKKVIICDEKLKTIFGGRDRVGFLEIAGLLNPHF  139



>ref|XP_008790633.1| PREDICTED: uncharacterized protein LOC103707776 [Phoenix dactylifera]
Length=145

 Score = 68.6 bits (166),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 31/66 (47%), Positives = 41/66 (62%), Gaps = 0/66 (0%)
 Frame = -1

Query  619  LRDFMGQSQTSRLGCFKRIWSYIKENNLQDPNNKNLVNCDEKLKSILLGKSQVDLAELPA  440
            L+  +G  +  R    K+IW+YIKEN LQDP NK ++ CDEKLK I  G+ +V   E+  
Sbjct  78   LQALLGVKEIPRTQALKQIWAYIKENELQDPENKKVIVCDEKLKKIFGGRDRVGFLEISG  137

Query  439  LLKLHF  422
            LL  HF
Sbjct  138  LLNPHF  143



>ref|XP_010437638.1| PREDICTED: protein TRI1-like [Camelina sativa]
Length=82

 Score = 67.4 bits (163),  Expect = 9e-11, Method: Composition-based stats.
 Identities = 31/66 (47%), Positives = 42/66 (64%), Gaps = 0/66 (0%)
 Frame = -1

Query  619  LRDFMGQSQTSRLGCFKRIWSYIKENNLQDPNNKNLVNCDEKLKSILLGKSQVDLAELPA  440
            ++D +G  +  R    KRIW+YIKE++LQDP NK  + CDEKLK I  GK +V   E+  
Sbjct  16   MQDIVGVPEIPRTQALKRIWAYIKEHDLQDPQNKRDILCDEKLKKIFEGKERVGFLEIAK  75

Query  439  LLKLHF  422
            L+  HF
Sbjct  76   LIGPHF  81



>ref|XP_009594988.1| PREDICTED: uncharacterized protein LOC104091364 [Nicotiana tomentosiformis]
Length=147

 Score = 68.6 bits (166),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 41/63 (65%), Gaps = 0/63 (0%)
 Frame = -1

Query  604  GQSQTSRLGCFKRIWSYIKENNLQDPNNKNLVNCDEKLKSILLGKSQVDLAELPALLKLH  425
            G ++  R    K IW++IKENNLQDP NK ++ CDEKLK+I  GK +V   E+  L+  H
Sbjct  85   GIAEIPRTQALKLIWAHIKENNLQDPQNKKVIICDEKLKNIFAGKDRVGFLEIAGLISPH  144

Query  424  FPK  416
            F K
Sbjct  145  FLK  147



>gb|AAK63939.1|AC084282_20 hypothetical protein [Oryza sativa Japonica Group]
 gb|ABF99004.1| SWIB complex BAF60b domain-containing protein, putative, expressed 
[Oryza sativa Japonica Group]
 gb|EAY91940.1| hypothetical protein OsI_13627 [Oryza sativa Indica Group]
 dbj|BAH01476.1| unnamed protein product [Oryza sativa Japonica Group]
Length=144

 Score = 68.6 bits (166),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/69 (43%), Positives = 45/69 (65%), Gaps = 0/69 (0%)
 Frame = -1

Query  622  ALRDFMGQSQTSRLGCFKRIWSYIKENNLQDPNNKNLVNCDEKLKSILLGKSQVDLAELP  443
            AL+  +G ++  R    KR+W+YIK++NLQDP +K ++ CDEKLK +  G+ +V   E+ 
Sbjct  76   ALQAVVGAAEIPRTEALKRLWAYIKQHNLQDPADKKVIVCDEKLKVLFAGQERVGFLEVA  135

Query  442  ALLKLHFPK  416
             LL  HF K
Sbjct  136  KLLNPHFVK  144



>ref|XP_006430903.1| hypothetical protein CICLE_v10013159mg [Citrus clementina]
 gb|ESR44143.1| hypothetical protein CICLE_v10013159mg [Citrus clementina]
Length=114

 Score = 67.8 bits (164),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/74 (42%), Positives = 46/74 (62%), Gaps = 0/74 (0%)
 Frame = -1

Query  637  VNLPSALRDFMGQSQTSRLGCFKRIWSYIKENNLQDPNNKNLVNCDEKLKSILLGKSQVD  458
            V + + L  F+G ++ SR    K+IW YI++++LQ+P NK  + CD+KLK+I  GK  V 
Sbjct  39   VPVSAQLSKFLGANEASRSDAVKKIWQYIRQHDLQNPANKREIRCDDKLKTIFNGKDSVG  98

Query  457  LAELPALLKLHFPK  416
              E+  LL  HF K
Sbjct  99   FLEIAKLLSQHFVK  112



>ref|XP_004289737.1| PREDICTED: uncharacterized protein LOC101294411 [Fragaria vesca 
subsp. vesca]
Length=144

 Score = 68.6 bits (166),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 32/91 (35%), Positives = 49/91 (54%), Gaps = 0/91 (0%)
 Frame = -1

Query  694  KMKSFVAENPKKLGNLINLVNLPSALRDFMGQSQTSRLGCFKRIWSYIKENNLQDPNNKN  515
            K     A  P++   ++    +   ++  +G  + SR    K IW++IK NNLQDP NK 
Sbjct  53   KQAGAAATTPREPRGIMKPRKVSPEMQALVGVPEISRTQALKVIWAHIKGNNLQDPENKR  112

Query  514  LVNCDEKLKSILLGKSQVDLAELPALLKLHF  422
            ++ CD+KLK I  GK +V   E+  L+  HF
Sbjct  113  IIVCDDKLKKIFAGKDRVGFLEVAGLITPHF  143



>ref|XP_008792695.1| PREDICTED: upstream activation factor subunit spp27-like isoform 
X2 [Phoenix dactylifera]
 ref|XP_008792696.1| PREDICTED: upstream activation factor subunit spp27-like isoform 
X3 [Phoenix dactylifera]
Length=319

 Score = 71.2 bits (173),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 36/90 (40%), Positives = 56/90 (62%), Gaps = 1/90 (1%)
 Frame = -1

Query  673  ENPKKLGNLINLVNLPSALRDFMGQSQTSRLGCFKRIWSYIKENNLQDPNNKNLVNCDEK  494
            E  K+ G    L +L  AL+ F+G+S+ +R    K++W+YI++NNLQDPNNK  + CDE+
Sbjct  119  EVKKRGGGFTKLCSLSPALQQFVGESELARTEVVKKLWAYIRQNNLQDPNNKKKIICDER  178

Query  493  LKSILLGKSQVDLAELPALLKLHFPKPNSK  404
            L+SI    S +D+ ++   L  H    NS+
Sbjct  179  LQSI-FNVSTIDMFQMNKALSKHIWPLNSE  207


 Score = 50.8 bits (120),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 22/42 (52%), Positives = 30/42 (71%), Gaps = 0/42 (0%)
 Frame = -1

Query  604  GQSQTSRLGCFKRIWSYIKENNLQDPNNKNLVNCDEKLKSIL  479
            G++  SR    KR+W YIK+NNLQDP +K  + CD+KLK +L
Sbjct  256  GENALSRSDVVKRMWEYIKQNNLQDPADKRNIICDKKLKELL  297



>ref|XP_008792693.1| PREDICTED: upstream activation factor subunit UAF30-like isoform 
X1 [Phoenix dactylifera]
Length=337

 Score = 71.2 bits (173),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 36/90 (40%), Positives = 56/90 (62%), Gaps = 1/90 (1%)
 Frame = -1

Query  673  ENPKKLGNLINLVNLPSALRDFMGQSQTSRLGCFKRIWSYIKENNLQDPNNKNLVNCDEK  494
            E  K+ G    L +L  AL+ F+G+S+ +R    K++W+YI++NNLQDPNNK  + CDE+
Sbjct  119  EVKKRGGGFTKLCSLSPALQQFVGESELARTEVVKKLWAYIRQNNLQDPNNKKKIICDER  178

Query  493  LKSILLGKSQVDLAELPALLKLHFPKPNSK  404
            L+SI    S +D+ ++   L  H    NS+
Sbjct  179  LQSI-FNVSTIDMFQMNKALSKHIWPLNSE  207


 Score = 50.8 bits (120),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 33/90 (37%), Positives = 45/90 (50%), Gaps = 9/90 (10%)
 Frame = -1

Query  604  GQSQTSRLGCFKRIWSYIKENNLQDPNNKNLVNCDEKLKSILLGKSQVDLAELPALLKLH  425
            G++  SR    KR+W YIK+NNLQDP +K  + CD+KLK +L   S      +  LL  H
Sbjct  256  GENALSRSDVVKRMWEYIKQNNLQDPADKRNIICDKKLKELLKVDSFRGFT-VSKLLVAH  314

Query  424  FPKPNSK*LLLFNYFEPERCKLLIFMGRED  335
            F K          YF        IF+ R++
Sbjct  315  FIKT--------KYFSAIISNGFIFLRRQN  336



>ref|XP_007157220.1| hypothetical protein PHAVU_002G052700g [Phaseolus vulgaris]
 gb|ESW29214.1| hypothetical protein PHAVU_002G052700g [Phaseolus vulgaris]
Length=142

 Score = 68.2 bits (165),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 42/65 (65%), Gaps = 0/65 (0%)
 Frame = -1

Query  610  FMGQSQTSRLGCFKRIWSYIKENNLQDPNNKNLVNCDEKLKSILLGKSQVDLAELPALLK  431
             +G  + +R    K IW+YIK+NNLQDP +K  +NCDEKLK I  G+ +V + ++  L+ 
Sbjct  75   LVGAQEIARTQALKLIWAYIKDNNLQDPEDKRTINCDEKLKKIFDGRDRVGMLDVARLIS  134

Query  430  LHFPK  416
             HF K
Sbjct  135  PHFLK  139



>ref|XP_006664582.1| PREDICTED: upstream activation factor subunit UAF30-like [Oryza 
brachyantha]
Length=155

 Score = 68.6 bits (166),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 33/69 (48%), Positives = 45/69 (65%), Gaps = 1/69 (1%)
 Frame = -1

Query  619  LRDFMGQSQT-SRLGCFKRIWSYIKENNLQDPNNKNLVNCDEKLKSILLGKSQVDLAELP  443
            L++F+G ++   R    K IW++IK NNLQDPNNK ++ CDEKLK I  G+ +V   E+ 
Sbjct  87   LQEFVGGAEELPRTEALKIIWAHIKGNNLQDPNNKKIIVCDEKLKKIFGGRDRVGFLEIS  146

Query  442  ALLKLHFPK  416
             LL  HF K
Sbjct  147  GLLNPHFQK  155



>gb|EMT15267.1| hypothetical protein F775_31925 [Aegilops tauschii]
Length=78

 Score = 66.6 bits (161),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 33/69 (48%), Positives = 44/69 (64%), Gaps = 1/69 (1%)
 Frame = -1

Query  619  LRDFMG-QSQTSRLGCFKRIWSYIKENNLQDPNNKNLVNCDEKLKSILLGKSQVDLAELP  443
            LR+F+G  ++  R    K IW++IK NNLQDP NK ++ CDEKLK I  G+ +V   E+ 
Sbjct  10   LREFVGGAAELPRTEALKIIWAHIKGNNLQDPENKKIIVCDEKLKKIFGGRDRVGFLEIS  69

Query  442  ALLKLHFPK  416
             LL  HF K
Sbjct  70   GLLNPHFQK  78



>emb|CDY12300.1| BnaA09g25000D [Brassica napus]
Length=93

 Score = 67.0 bits (162),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 30/70 (43%), Positives = 43/70 (61%), Gaps = 0/70 (0%)
 Frame = -1

Query  625  SALRDFMGQSQTSRLGCFKRIWSYIKENNLQDPNNKNLVNCDEKLKSILLGKSQVDLAEL  446
            +A      +S+ SR    K++W +IK NNLQ+P N+  + CD+KLK+I  GK +V   E+
Sbjct  22   AAATGIAAESELSRATAVKKVWEHIKGNNLQNPENRKEIICDDKLKTIFEGKDKVGFTEI  81

Query  445  PALLKLHFPK  416
              LL  HFPK
Sbjct  82   AKLLSPHFPK  91



>ref|XP_006482358.1| PREDICTED: protein TRI1-like [Citrus sinensis]
Length=114

 Score = 66.6 bits (161),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 30/72 (42%), Positives = 45/72 (63%), Gaps = 0/72 (0%)
 Frame = -1

Query  637  VNLPSALRDFMGQSQTSRLGCFKRIWSYIKENNLQDPNNKNLVNCDEKLKSILLGKSQVD  458
            V + + L  F+G ++ SR    K+IW YI++++LQ+P NK  + CD+KLK+I  GK  V 
Sbjct  39   VPVSAQLSKFLGANEASRSDAVKKIWQYIRQHDLQNPANKREIRCDDKLKTIFNGKDSVG  98

Query  457  LAELPALLKLHF  422
              E+  LL  HF
Sbjct  99   FLEIAKLLSQHF  110



>emb|CDY49157.1| BnaA09g25180D [Brassica napus]
Length=93

 Score = 66.2 bits (160),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 29/64 (45%), Positives = 42/64 (66%), Gaps = 0/64 (0%)
 Frame = -1

Query  607  MGQSQTSRLGCFKRIWSYIKENNLQDPNNKNLVNCDEKLKSILLGKSQVDLAELPALLKL  428
            + +S+ SR    K++W +IK NNLQ+P N+  + CD+KLK+I  GK +V   E+  LL  
Sbjct  28   VAESELSRATAVKKVWEHIKGNNLQNPENRKEIICDDKLKTIFEGKDKVGFTEIAKLLSP  87

Query  427  HFPK  416
            HFPK
Sbjct  88   HFPK  91



>ref|XP_006422864.1| hypothetical protein CICLE_v10029545mg [Citrus clementina]
 gb|ESR36104.1| hypothetical protein CICLE_v10029545mg [Citrus clementina]
Length=139

 Score = 67.0 bits (162),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 41/66 (62%), Gaps = 0/66 (0%)
 Frame = -1

Query  619  LRDFMGQSQTSRLGCFKRIWSYIKENNLQDPNNKNLVNCDEKLKSILLGKSQVDLAELPA  440
            +  F+G  +  R    K IW++IK++NLQDP NK ++ CDEKLK I  G+ +V   E+  
Sbjct  73   MEAFVGAPEIPRTQALKLIWAHIKQHNLQDPENKKVIICDEKLKKIFGGRDRVGFLEIAG  132

Query  439  LLKLHF  422
            L+  HF
Sbjct  133  LISPHF  138



>ref|XP_006346331.1| PREDICTED: protein TRI1-like [Solanum tuberosum]
Length=145

 Score = 67.0 bits (162),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 29/61 (48%), Positives = 39/61 (64%), Gaps = 0/61 (0%)
 Frame = -1

Query  604  GQSQTSRLGCFKRIWSYIKENNLQDPNNKNLVNCDEKLKSILLGKSQVDLAELPALLKLH  425
            G S+  R    K IW++IK N+LQDP NK ++ CDEKLK+I  GK +V   E+  L+  H
Sbjct  83   GMSEVPRTQALKLIWAHIKANDLQDPQNKKVIICDEKLKTIFGGKERVGFLEIAGLISPH  142

Query  424  F  422
            F
Sbjct  143  F  143



>ref|XP_010512159.1| PREDICTED: protein TRI1-like [Camelina sativa]
Length=147

 Score = 67.0 bits (162),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 33/86 (38%), Positives = 49/86 (57%), Gaps = 1/86 (1%)
 Frame = -1

Query  673  ENPKKLGNLINLVNLPSALRDFMGQSQTSRLGCFKRIWSYIKENNLQDPNNKNLVNCDEK  494
            + P+  G +  +  +  AL  F+G  +T+R    K IW+YIK ++LQ+P +K  + CDE 
Sbjct  61   KTPRSTG-IFKVTPVSPALAQFLGIGETTRTDAIKEIWTYIKSHDLQNPADKREIFCDET  119

Query  493  LKSILLGKSQVDLAELPALLKLHFPK  416
            LK I  GK +V   E+  LL  HF K
Sbjct  120  LKLIFEGKDKVGFLEISKLLSPHFVK  145



>emb|CDO97251.1| unnamed protein product [Coffea canephora]
Length=69

 Score = 65.5 bits (158),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 30/63 (48%), Positives = 39/63 (62%), Gaps = 0/63 (0%)
 Frame = -1

Query  604  GQSQTSRLGCFKRIWSYIKENNLQDPNNKNLVNCDEKLKSILLGKSQVDLAELPALLKLH  425
            G S+  R    K IW+YIK +NLQDP NK ++ CDE+LK I  GK +V   E+  L+  H
Sbjct  7    GVSEIPRTQALKEIWAYIKRHNLQDPENKKVIICDEQLKKIFGGKDRVGFLEIAGLISPH  66

Query  424  FPK  416
            F K
Sbjct  67   FLK  69



>ref|XP_009361364.1| PREDICTED: upstream activation factor subunit spp27-like [Pyrus 
x bretschneideri]
Length=141

 Score = 67.0 bits (162),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 33/84 (39%), Positives = 49/84 (58%), Gaps = 0/84 (0%)
 Frame = -1

Query  667  PKKLGNLINLVNLPSALRDFMGQSQTSRLGCFKRIWSYIKENNLQDPNNKNLVNCDEKLK  488
            PK    ++    +  AL  F+G  ++SR    K+IW++IK +NLQ+P NK  + CD+KLK
Sbjct  56   PKATLGIMKPTPISPALGSFLGVKESSRAEAVKQIWAHIKLHNLQNPANKREIYCDDKLK  115

Query  487  SILLGKSQVDLAELPALLKLHFPK  416
             I  G+ +V   E+  LL  HF K
Sbjct  116  GIFEGREKVGFLEIGKLLSRHFVK  139



>ref|XP_008790042.1| PREDICTED: protein TRI1-like [Phoenix dactylifera]
Length=145

 Score = 67.0 bits (162),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 41/66 (62%), Gaps = 0/66 (0%)
 Frame = -1

Query  619  LRDFMGQSQTSRLGCFKRIWSYIKENNLQDPNNKNLVNCDEKLKSILLGKSQVDLAELPA  440
            L+  +G  +  R    ++IW+YIKENNLQDP NK ++ CDE LK I  G+ +V   E+  
Sbjct  78   LQVLLGVKEIPRTQALQQIWAYIKENNLQDPENKRVIVCDEMLKKIFGGRDRVGFLEISG  137

Query  439  LLKLHF  422
            LL  HF
Sbjct  138  LLNPHF  143



>ref|XP_004230716.1| PREDICTED: protein TRI1 [Solanum lycopersicum]
Length=146

 Score = 67.0 bits (162),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 30/63 (48%), Positives = 40/63 (63%), Gaps = 0/63 (0%)
 Frame = -1

Query  604  GQSQTSRLGCFKRIWSYIKENNLQDPNNKNLVNCDEKLKSILLGKSQVDLAELPALLKLH  425
            G S+  R    K IW++IK N+LQDP NK ++ CDEKLK+I  GK +V   E+  L+  H
Sbjct  84   GMSEVPRTQALKLIWAHIKANDLQDPQNKKVIICDEKLKTIFGGKERVGFLEIAGLISPH  143

Query  424  FPK  416
            F K
Sbjct  144  FLK  146



>ref|XP_006298716.1| hypothetical protein CARUB_v10014811mg [Capsella rubella]
 gb|EOA31614.1| hypothetical protein CARUB_v10014811mg [Capsella rubella]
Length=154

 Score = 67.0 bits (162),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 33/90 (37%), Positives = 49/90 (54%), Gaps = 1/90 (1%)
 Frame = -1

Query  685  SFVAENPKKLGNLINLVNLPSALRDFMGQSQTSRLGCFKRIWSYIKENNLQDPNNKNLVN  506
            S   + P+  G +  +  +   L  F+G  +T+R    K IW+YIK ++LQ+P +K  + 
Sbjct  64   SLAKKTPRSTG-IFKVTPVSPVLAQFLGTGETTRTDAIKEIWTYIKSHDLQNPADKREIF  122

Query  505  CDEKLKSILLGKSQVDLAELPALLKLHFPK  416
            CDE LK I  GK +V   E+  LL  HF K
Sbjct  123  CDETLKLIFEGKDKVGFLEVSKLLSPHFVK  152



>gb|AAL91165.1| unknown protein [Arabidopsis thaliana]
 gb|AAN65054.1| unknown protein [Arabidopsis thaliana]
Length=141

 Score = 66.6 bits (161),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 29/66 (44%), Positives = 42/66 (64%), Gaps = 0/66 (0%)
 Frame = -1

Query  619  LRDFMGQSQTSRLGCFKRIWSYIKENNLQDPNNKNLVNCDEKLKSILLGKSQVDLAELPA  440
            ++D +   + +R    KRIW+YIKE++LQDP NK  + CDEKLK I  G+ +V   E+  
Sbjct  75   MQDIVELPEIARTQALKRIWAYIKEHDLQDPQNKREILCDEKLKKIFEGRDRVGFLEIAK  134

Query  439  LLKLHF  422
            L+  HF
Sbjct  135  LIGPHF  140



>ref|NP_565366.1| SWIB/MDM2 domain-containing protein [Arabidopsis thaliana]
 gb|AAK49586.1|AF370580_1 Unknown protein [Arabidopsis thaliana]
 gb|AAC61285.1| expressed protein [Arabidopsis thaliana]
 gb|AEC06345.1| SWIB/MDM2 domain-containing protein [Arabidopsis thaliana]
Length=141

 Score = 66.6 bits (161),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 29/66 (44%), Positives = 42/66 (64%), Gaps = 0/66 (0%)
 Frame = -1

Query  619  LRDFMGQSQTSRLGCFKRIWSYIKENNLQDPNNKNLVNCDEKLKSILLGKSQVDLAELPA  440
            ++D +   + +R    KRIW+YIKE++LQDP NK  + CDEKLK I  G+ +V   E+  
Sbjct  75   MQDIVELPEIARTQALKRIWAYIKEHDLQDPQNKREILCDEKLKKIFEGRDRVGFLEIAK  134

Query  439  LLKLHF  422
            L+  HF
Sbjct  135  LIGPHF  140



>ref|XP_006298715.1| hypothetical protein CARUB_v10014811mg, partial [Capsella rubella]
 gb|EOA31613.1| hypothetical protein CARUB_v10014811mg, partial [Capsella rubella]
Length=159

 Score = 67.0 bits (162),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 33/90 (37%), Positives = 49/90 (54%), Gaps = 1/90 (1%)
 Frame = -1

Query  685  SFVAENPKKLGNLINLVNLPSALRDFMGQSQTSRLGCFKRIWSYIKENNLQDPNNKNLVN  506
            S   + P+  G +  +  +   L  F+G  +T+R    K IW+YIK ++LQ+P +K  + 
Sbjct  69   SLAKKTPRSTG-IFKVTPVSPVLAQFLGTGETTRTDAIKEIWTYIKSHDLQNPADKREIF  127

Query  505  CDEKLKSILLGKSQVDLAELPALLKLHFPK  416
            CDE LK I  GK +V   E+  LL  HF K
Sbjct  128  CDETLKLIFEGKDKVGFLEVSKLLSPHFVK  157



>ref|XP_006437339.1| hypothetical protein CICLE_v10033040mg [Citrus clementina]
 ref|XP_006484753.1| PREDICTED: upstream activation factor subunit UAF30-like [Citrus 
sinensis]
 gb|ESR50579.1| hypothetical protein CICLE_v10033040mg [Citrus clementina]
 gb|KDO49411.1| hypothetical protein CISIN_1g032632mg [Citrus sinensis]
Length=137

 Score = 66.6 bits (161),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 32/84 (38%), Positives = 49/84 (58%), Gaps = 0/84 (0%)
 Frame = -1

Query  667  PKKLGNLINLVNLPSALRDFMGQSQTSRLGCFKRIWSYIKENNLQDPNNKNLVNCDEKLK  488
            P +   +  +  +  AL  F+G  + SR    ++IW+++K +NLQ+P NK  + CDEKLK
Sbjct  52   PTRPTGISKVSPVSPALAKFLGAPEASRSDAVRQIWAHVKTHNLQNPENKREILCDEKLK  111

Query  487  SILLGKSQVDLAELPALLKLHFPK  416
            +I  GK+ V   E+  LL  HF K
Sbjct  112  AIFEGKNAVGFLEIGKLLSPHFVK  135



>ref|XP_002885945.1| SWIB complex BAF60b domain-containing protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH62204.1| SWIB complex BAF60b domain-containing protein [Arabidopsis lyrata 
subsp. lyrata]
Length=141

 Score = 66.6 bits (161),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 29/66 (44%), Positives = 42/66 (64%), Gaps = 0/66 (0%)
 Frame = -1

Query  619  LRDFMGQSQTSRLGCFKRIWSYIKENNLQDPNNKNLVNCDEKLKSILLGKSQVDLAELPA  440
            ++D +   + +R    KRIW+YIKE++LQDP NK  + CDEKLK I  G+ +V   E+  
Sbjct  75   MQDIVELPEIARTQALKRIWAYIKEHDLQDPQNKREILCDEKLKKIFEGRDRVGFLEIAK  134

Query  439  LLKLHF  422
            L+  HF
Sbjct  135  LIGPHF  140



>ref|XP_010549735.1| PREDICTED: protein TRI1 [Tarenaya hassleriana]
Length=140

 Score = 66.6 bits (161),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 32/69 (46%), Positives = 42/69 (61%), Gaps = 0/69 (0%)
 Frame = -1

Query  622  ALRDFMGQSQTSRLGCFKRIWSYIKENNLQDPNNKNLVNCDEKLKSILLGKSQVDLAELP  443
            AL  F+G  + SR    K IW+YIK ++LQ+P +K  V CDEKLK +  GK +V   E+ 
Sbjct  70   ALAQFLGAGEASRTDAIKGIWAYIKSHDLQNPADKREVICDEKLKHLFEGKDRVGFLEIG  129

Query  442  ALLKLHFPK  416
             LL  HF K
Sbjct  130  KLLSPHFVK  138



>ref|XP_004981679.1| PREDICTED: upstream activation factor subunit spp27-like [Setaria 
italica]
Length=149

 Score = 66.6 bits (161),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 30/69 (43%), Positives = 44/69 (64%), Gaps = 0/69 (0%)
 Frame = -1

Query  622  ALRDFMGQSQTSRLGCFKRIWSYIKENNLQDPNNKNLVNCDEKLKSILLGKSQVDLAELP  443
            AL+  +G  +  R    KR+W+YIK++NLQDP +K +V CDEKLK++   + +V   E+ 
Sbjct  81   ALQAIVGVPEIPRTEALKRLWAYIKQHNLQDPADKKVVVCDEKLKALFAERERVGFLEIA  140

Query  442  ALLKLHFPK  416
             LL  HF K
Sbjct  141  KLLNPHFVK  149



>gb|AAM65680.1| unknown [Arabidopsis thaliana]
Length=141

 Score = 66.6 bits (161),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 29/66 (44%), Positives = 42/66 (64%), Gaps = 0/66 (0%)
 Frame = -1

Query  619  LRDFMGQSQTSRLGCFKRIWSYIKENNLQDPNNKNLVNCDEKLKSILLGKSQVDLAELPA  440
            ++D +   + +R    KRIW+YIKE++LQDP NK  + CDEKLK I  G+ +V   E+  
Sbjct  75   MQDIVELPEIARTQALKRIWAYIKEHDLQDPQNKREILCDEKLKKIFEGRDRVGFLEIAK  134

Query  439  LLKLHF  422
            L+  HF
Sbjct  135  LIGPHF  140



>ref|XP_010463811.1| PREDICTED: protein TRI1-like [Camelina sativa]
Length=151

 Score = 66.6 bits (161),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 35/93 (38%), Positives = 51/93 (55%), Gaps = 1/93 (1%)
 Frame = -1

Query  694  KMKSFVAENPKKLGNLINLVNLPSALRDFMGQSQTSRLGCFKRIWSYIKENNLQDPNNKN  515
            K  S V + P+  G +  +  +   L  F+G  +T+R    K IW+YIK ++LQ+P +K 
Sbjct  58   KSDSPVKKTPRSTG-IFKVTPVSPVLAQFLGTGETTRTDAIKGIWTYIKSHDLQNPADKR  116

Query  514  LVNCDEKLKSILLGKSQVDLAELPALLKLHFPK  416
             + CDE LK I  GK +V   E+  LL  HF K
Sbjct  117  EIFCDETLKLIFEGKDKVGFLEISKLLSPHFVK  149



>ref|NP_566210.1| SWIB/MDM2 domain-containing protein [Arabidopsis thaliana]
 gb|AAF03473.1|AC009327_12 hypothetical protein [Arabidopsis thaliana]
 dbj|BAC42418.1| unknown protein [Arabidopsis thaliana]
 gb|AAO39929.1| At3g03590 [Arabidopsis thaliana]
 gb|AEE73960.1| SWIB/MDM2 domain-containing protein [Arabidopsis thaliana]
Length=143

 Score = 66.2 bits (160),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 33/86 (38%), Positives = 48/86 (56%), Gaps = 1/86 (1%)
 Frame = -1

Query  673  ENPKKLGNLINLVNLPSALRDFMGQSQTSRLGCFKRIWSYIKENNLQDPNNKNLVNCDEK  494
            + P+  G +  +  +   L  F+G  +TSR    K IW+YIK ++LQ+P +K  + CDE 
Sbjct  57   KTPRSTG-IFKVTPVSPVLAQFLGTGETSRTDAIKGIWTYIKSHDLQNPADKREIFCDET  115

Query  493  LKSILLGKSQVDLAELPALLKLHFPK  416
            LK I  GK +V   E+  LL  HF K
Sbjct  116  LKLIFEGKDKVGFLEISKLLSPHFVK  141



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2021556645944