BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c9811_g2_i1 len=1249 path=[1879:0-1248]

Length=1249
                                                                      Score     E

emb|CDP05873.1|  unnamed protein product                                400   3e-134   
ref|XP_007021327.1|  NAC domain protein, IPR003441                      400   9e-134   
ref|XP_009769986.1|  PREDICTED: NAC transcription factor 25             400   1e-133   
ref|XP_009594217.1|  PREDICTED: NAC transcription factor 25-like        398   5e-133   
ref|XP_011095244.1|  PREDICTED: NAC transcription factor 25-like        394   3e-131   
ref|XP_011098344.1|  PREDICTED: NAC domain-containing protein 18        386   1e-128   
ref|XP_002284654.2|  PREDICTED: NAC transcription factor 25 isofo...    385   8e-128   Vitis vinifera
emb|CBI20351.3|  unnamed protein product                                383   2e-127   
ref|XP_002532683.1|  NAC domain-containing protein, putative            381   2e-126   Ricinus communis
gb|AGL39684.1|  NAC transcription factor 028                            374   1e-123   
ref|XP_007149615.1|  hypothetical protein PHAVU_005G084600g             374   2e-123   
gb|AGT56012.1|  sinor-like protein 1                                    370   2e-122   
ref|NP_001266277.1|  uncharacterized protein LOC101247735               369   9e-122   
ref|XP_003540450.1|  PREDICTED: NAC domain-containing protein 18-...    366   4e-120   
ref|XP_006370307.1|  no apical meristem family protein                  365   9e-120   
gb|KHN36793.1|  NAC domain-containing protein 18                        364   3e-119   
ref|XP_011029435.1|  PREDICTED: NAC domain-containing protein 18-...    362   6e-119   
ref|XP_006362947.1|  PREDICTED: NAC transcription factor 25-like        362   1e-118   
ref|XP_002316919.2|  no apical meristem family protein                  360   4e-118   Populus trichocarpa [western balsam poplar]
ref|XP_003543257.1|  PREDICTED: NAC domain-containing protein 18        361   5e-118   
ref|XP_011042501.1|  PREDICTED: NAC domain-containing protein 18-...    358   2e-117   
gb|AEQ28762.1|  NAC domain class transcription factor                   358   2e-117   
ref|XP_010060527.1|  PREDICTED: NAC domain-containing protein 18-...    358   3e-117   
gb|AHJ79194.1|  NAC domain protein NAC53                                357   5e-117   
ref|XP_009609295.1|  PREDICTED: NAC transcription factor 25-like        356   6e-117   
ref|XP_008226677.1|  PREDICTED: NAC transcription factor 25             358   7e-117   
ref|XP_007211475.1|  hypothetical protein PRUPE_ppa007577mg             357   1e-116   
gb|KEH38791.1|  NAC transcription factor-like protein                   354   8e-116   
ref|XP_009759753.1|  PREDICTED: NAC transcription factor 25-like        353   9e-116   
ref|XP_009334622.1|  PREDICTED: NAC domain-containing protein 18        354   2e-115   
gb|EYU33415.1|  hypothetical protein MIMGU_mgv1a009589mg                352   2e-115   
ref|XP_008386130.1|  PREDICTED: NAC domain-containing protein 18-...    353   4e-115   
emb|CAG28971.1|  NAM-like protein                                       353   5e-115   Prunus persica
ref|NP_001234652.1|  NAC domain protein                                 351   2e-114   
gb|AAU43923.2|  NAC domain protein                                      349   7e-114   Solanum lycopersicum
ref|XP_010644222.1|  PREDICTED: NAC transcription factor 25 isofo...    348   1e-113   
ref|NP_001280984.1|  NAC domain-containing protein 18                   349   1e-113   
gb|AHJ79165.1|  NAC domain protein NAC24                                348   1e-113   
ref|XP_010268761.1|  PREDICTED: NAC transcription factor 25-like        348   2e-113   
gb|ACJ14498.1|  mutant NAC domain protein                               348   3e-113   Solanum lycopersicum
ref|XP_009378497.1|  PREDICTED: NAC domain-containing protein 18-...    348   3e-113   
gb|KHG20342.1|  NAC domain-containing 18 -like protein                  347   7e-113   
ref|XP_004487678.1|  PREDICTED: NAC domain-containing protein 18-...    347   8e-113   
gb|AGS08759.1|  NAC domain protein                                      345   4e-112   
gb|AGC27313.1|  NAC domain protein 10                                   344   7e-112   
ref|XP_010278293.1|  PREDICTED: NAC transcription factor NAM-B2-like    342   9e-111   
gb|KHG07368.1|  NAC domain-containing 18 -like protein                  341   1e-110   
gb|AGC27321.1|  NAC domain protein 10                                   335   1e-108   
ref|XP_007025712.1|  NAC domain containing protein 25                   332   3e-107   
ref|XP_010089502.1|  NAC domain-containing protein 18                   333   6e-107   
ref|XP_002519008.1|  transcription factor, putative                     327   5e-105   Ricinus communis
ref|XP_002316635.1|  no apical meristem family protein                  326   7e-105   Populus trichocarpa [western balsam poplar]
ref|XP_007133059.1|  hypothetical protein PHAVU_011G148000g             327   7e-105   
gb|AID55352.1|  NAC protein 1                                           325   9e-105   
gb|AGL39685.1|  NAC transcription factor 029                            327   1e-104   
ref|XP_011027905.1|  PREDICTED: NAC transcription factor 25-like        325   3e-104   
ref|XP_002305677.1|  no apical meristem family protein                  324   4e-104   Populus trichocarpa [western balsam poplar]
ref|XP_006451941.1|  hypothetical protein CICLE_v10008628mg             325   4e-104   
gb|AID55348.1|  NAC protein 1                                           323   4e-104   
ref|XP_006841705.1|  hypothetical protein AMTR_s00003p00252470          321   9e-103   
ref|XP_003635288.1|  PREDICTED: NAC transcription factor 25             320   1e-102   
ref|XP_004291668.1|  PREDICTED: NAC transcription factor ONAC010-...    319   3e-102   
ref|XP_003541120.1|  PREDICTED: NAC domain-containing protein 18-...    319   4e-102   
ref|XP_011047846.1|  PREDICTED: NAC transcription factor 25-like        319   6e-102   
ref|XP_008452274.1|  PREDICTED: NAC transcription factor 25-like        314   4e-100   
ref|XP_004149287.1|  PREDICTED: NAC transcription factor 25-like        314   5e-100   
ref|XP_004174082.1|  PREDICTED: LOW QUALITY PROTEIN: NAC transcri...    312   1e-99    
ref|XP_009392346.1|  PREDICTED: NAC transcription factor NAM-B2-like    310   4e-98    
gb|AID55354.1|  NAC protein 3                                           306   2e-97    
ref|XP_006449287.1|  hypothetical protein CICLE_v10015688mg             305   3e-96    
ref|XP_006467845.1|  PREDICTED: NAC transcription factor 25-like        303   1e-95    
gb|AID55353.1|  NAC protein 2                                           300   4e-95    
ref|XP_007211453.1|  hypothetical protein PRUPE_ppa007314mg             301   5e-95    
emb|CBI38329.3|  unnamed protein product                                300   6e-95    
gb|AID55350.1|  NAC protein 3                                           299   7e-95    
ref|NP_001274379.1|  NAC domain-containing protein 18-like              300   3e-94    
ref|XP_008224995.1|  PREDICTED: NAC transcription factor 25             300   3e-94    
gb|KHN36348.1|  NAC domain-containing protein 18                        300   3e-94    
gb|KFK38893.1|  hypothetical protein AALP_AA3G174600                    297   1e-93    
gb|AID55349.1|  NAC protein 2                                           295   4e-93    
ref|XP_004293567.1|  PREDICTED: NAC transcription factor 25-like        295   1e-92    
ref|XP_010535118.1|  PREDICTED: NAC domain-containing protein 18-...    294   1e-92    
ref|XP_006406961.1|  hypothetical protein EUTSA_v10022353mg             294   2e-92    
ref|XP_010503061.1|  PREDICTED: NAC domain-containing protein 18-...    293   6e-92    
ref|XP_008800137.1|  PREDICTED: NAC transcription factor 25             294   8e-92    
ref|XP_010686575.1|  PREDICTED: NAC transcription factor 25-like        291   2e-91    
ref|XP_010921105.1|  PREDICTED: NAC transcription factor NAM-B2-like    292   5e-91    
ref|XP_010542275.1|  PREDICTED: LOW QUALITY PROTEIN: NAC domain-c...    290   5e-91    
ref|XP_008799210.1|  PREDICTED: NAC transcription factor 25-like ...    291   2e-90    
ref|XP_007148205.1|  hypothetical protein PHAVU_006G188900g             288   6e-90    
ref|XP_010924066.1|  PREDICTED: NAC transcription factor 25-like        289   8e-90    
ref|XP_009146237.1|  PREDICTED: NAC domain-containing protein 18        287   1e-89    
ref|XP_010465520.1|  PREDICTED: NAC domain-containing protein 18-...    287   2e-89    
ref|XP_009418167.1|  PREDICTED: NAC transcription factor NAM-B2-like    288   3e-89    
ref|NP_188170.1|  NAC domain containing protein 2                       286   4e-89    Arabidopsis thaliana [mouse-ear cress]
gb|KHG21395.1|  NAC domain-containing 18 -like protein                  283   4e-89    
ref|XP_010100577.1|  NAC domain-containing protein 29                   285   4e-89    
ref|NP_001284435.1|  NAC domain-containing protein 18-like              284   6e-89    
ref|XP_004147807.1|  PREDICTED: NAC transcription factor ONAC010-...    284   6e-89    
ref|XP_010675608.1|  PREDICTED: NAC transcription factor 25             286   1e-88    
emb|CDY20131.1|  BnaA01g28710D                                          283   4e-88    
ref|XP_002882948.1|  ATNAC2                                             283   4e-88    
ref|XP_009115491.1|  PREDICTED: NAC domain-containing protein 18-...    282   9e-88    
ref|XP_004172388.1|  PREDICTED: LOW QUALITY PROTEIN: NAC transcri...    281   1e-87    
gb|KEH31125.1|  NAC transcription factor-like protein                   281   2e-87    
emb|CDX97675.1|  BnaA05g24040D                                          280   5e-87    
emb|CDY56427.1|  BnaCnng30350D                                          278   2e-86    
ref|NP_001281058.1|  NAC transcription factor 25-like                   278   1e-85    
emb|CDX98562.1|  BnaC05g38130D                                          276   2e-85    
ref|XP_009379434.1|  PREDICTED: NAC transcription factor 25             276   4e-85    
ref|XP_003528438.1|  PREDICTED: NAC transcription factor 25-like        276   4e-85    
emb|CAN81855.1|  hypothetical protein VITISV_041250                     269   2e-84    Vitis vinifera
ref|XP_006297968.1|  hypothetical protein CARUB_v10014008mg             274   2e-84    
gb|ACN62416.1|  NAC transcription factor                                271   2e-83    Lepidium latifolium
gb|EPS69130.1|  hypothetical protein M569_05637                         265   2e-83    
gb|ACJ48971.1|  cold stress-induced NAC domain protein                  271   3e-83    Lepidium latifolium
ref|XP_007159283.1|  hypothetical protein PHAVU_002G224900g             270   3e-83    
ref|XP_004505006.1|  PREDICTED: NAC transcription factor 25-like        270   5e-83    
ref|XP_003547137.1|  PREDICTED: NAC transcription factor 25-like        270   6e-83    
ref|XP_009135446.1|  PREDICTED: NAC domain-containing protein 18-...    265   3e-81    
gb|KHN08560.1|  NAC domain-containing protein 18                        265   5e-81    
ref|XP_003541742.1|  PREDICTED: NAC transcription factor 25-like        265   6e-81    
emb|CDX82430.1|  BnaA03g33910D                                          255   2e-79    
dbj|BAK04712.1|  predicted protein                                      262   3e-79    
gb|AIZ97668.1|  NAC transcription factor NAM-D2                         261   5e-79    
ref|XP_011096265.1|  PREDICTED: NAC transcription factor 25             259   1e-78    
ref|NP_001280970.1|  NAC transcription factor 25-like                   258   2e-78    
sp|A0SPJ9.1|NAM2_HORVD  RecName: Full=NAC transcription factor NA...    259   2e-78    Hordeum vulgare subsp. vulgare [barley]
gb|AIW49540.1|  NAC transcription factor NAM-A2                         259   4e-78    
gb|AEI00651.1|  NAC3                                                    258   5e-78    
sp|A0SPJ6.1|NAMB2_TRITD  RecName: Full=NAC transcription factor N...    256   4e-77    Triticum turgidum subsp. durum
emb|CDM83185.1|  unnamed protein product                                256   4e-77    
gb|AAM65392.1|  NAM protein, putative                                   253   6e-77    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010473311.1|  PREDICTED: NAC transcription factor 25-like        253   1e-76    
emb|CDY22671.1|  BnaC08g43050D                                          248   2e-76    
ref|XP_009113148.1|  PREDICTED: NAC transcription factor 25             251   3e-76    
emb|CDY12886.1|  BnaA09g13880D                                          251   3e-76    
ref|XP_002888109.1|  ANAC025                                            251   5e-76    
emb|CDY40970.1|  BnaCnng10130D                                          251   6e-76    
ref|XP_010533895.1|  PREDICTED: NAC transcription factor 25 isofo...    251   2e-75    
gb|EMT26194.1|  NAC domain-containing protein 18                        251   2e-75    
ref|XP_006392059.1|  hypothetical protein EUTSA_v10023591mg             248   5e-75    
gb|KFK42926.1|  hypothetical protein AALP_AA1G056200                    248   7e-75    
gb|ABI94356.1|  NAC transcription factor NAM-D2                         249   1e-74    Aegilops tauschii
gb|AEH68228.1|  NAC transcription factor                                249   1e-74    
sp|D2SMN4.1|NAMB1_HORVS  RecName: Full=NAC transcription factor N...    249   2e-74    Hordeum vulgare subsp. spontaneum [wild barley]
ref|XP_006300981.1|  hypothetical protein CARUB_v10021371mg             246   3e-74    
ref|XP_010418059.1|  PREDICTED: NAC transcription factor 25-like        246   9e-74    
ref|XP_009780447.1|  PREDICTED: NAC transcription factor 25-like        243   1e-73    
ref|XP_010430102.1|  PREDICTED: NAC transcription factor 25             245   1e-73    
gb|AAB71483.1|  similar to NAM (gp|X92205|1321924) and CUC2 (gp|A...    244   1e-73    Arabidopsis thaliana [mouse-ear cress]
sp|A0SPJ8.1|NAM1_HORVD  RecName: Full=NAC transcription factor NA...    247   2e-73    Hordeum vulgare subsp. vulgare [barley]
ref|XP_010533896.1|  PREDICTED: NAC transcription factor 25 isofo...    243   2e-73    
ref|NP_564771.1|  NAC domain containing protein 25                      244   3e-73    Arabidopsis thaliana [mouse-ear cress]
gb|AGH32785.1|  NAC transcription factor NAM-B1                         246   4e-73    
ref|XP_010052353.1|  PREDICTED: NAC transcription factor 25-like        243   8e-73    
gb|AGZ20132.1|  NAC transcription factor NAM-B1                         245   8e-73    
sp|A0SPJ4.1|NAMB1_TRIDC  RecName: Full=NAC transcription factor N...    245   9e-73    Triticum dicoccoides [wild emmer wheat]
gb|ABY67950.1|  NAM-1                                                   245   1e-72    Hordeum vulgare subsp. vulgare [barley]
gb|AGH32787.1|  NAC transcription factor NAM-B1                         245   1e-72    
gb|AGZ20123.1|  NAC transcription factor NAM-B1                         245   1e-72    
gb|EYU27944.1|  hypothetical protein MIMGU_mgv1a020591mg                241   1e-72    
gb|AGZ20119.1|  NAC transcription factor NAM-B1                         244   1e-72    
gb|AGZ20118.1|  NAC transcription factor NAM-B1                         244   2e-72    
gb|AGZ20133.1|  NAC transcription factor NAM-B1                         244   2e-72    
gb|AGZ20137.1|  NAC transcription factor NAM-B1                         244   3e-72    
gb|AEI98789.1|  NAC transcription factor NAM-G1                         243   4e-72    
gb|AEI98791.1|  NAC transcription factor NAM-G1                         243   5e-72    
gb|AEI98795.1|  NAC transcription factor NAM-G1                         243   5e-72    
ref|XP_003562891.1|  PREDICTED: NAC transcription factor NAM-B2-like    244   5e-72    
ref|XP_006392856.1|  hypothetical protein EUTSA_v10012308mg             239   6e-72    
gb|AGZ20124.1|  NAC transcription factor NAM-B1                         243   6e-72    
gb|AGS08767.1|  NAC domain protein                                      243   7e-72    
gb|AEI00650.1|  NAC2                                                    242   1e-71    
sp|A2YMR0.1|NAC10_ORYSI  RecName: Full=NAC transcription factor O...    243   1e-71    Oryza sativa Indica Group [Indian rice]
gb|AEI98793.1|  NAC transcription factor NAM-G1                         242   2e-71    
gb|AEI98794.1|  NAC transcription factor NAM-G1                         241   2e-71    
gb|AEI98788.1|  NAC transcription factor NAM-G1                         241   2e-71    
ref|XP_009593583.1|  PREDICTED: NAC transcription factor 25 isofo...    237   2e-71    
gb|AGZ20129.1|  NAC transcription factor NAM-B1                         241   3e-71    
sp|A0SPJ3.1|NAMA1_TRITD  RecName: Full=NAC transcription factor N...    241   3e-71    Triticum turgidum subsp. durum
gb|AEI98787.1|  NAC transcription factor NAM-G1                         241   3e-71    
gb|AEH68227.1|  NAC transcription factor                                241   3e-71    
ref|NP_001060017.1|  Os07g0566500                                       241   3e-71    Oryza sativa Japonica Group [Japonica rice]
ref|XP_002463039.1|  hypothetical protein SORBIDRAFT_02g036620          241   4e-71    Sorghum bicolor [broomcorn]
gb|AGZ20135.1|  NAC transcription factor NAM-B1                         240   5e-71    
gb|AGH32788.1|  NAC transcription factor NAM-B1                         240   5e-71    
ref|XP_010545895.1|  PREDICTED: NAC domain-containing protein 18-...    237   8e-71    
gb|AEI98790.1|  NAC transcription factor NAM-G1                         240   9e-71    
ref|XP_006305156.1|  hypothetical protein CARUB_v10009524mg             238   9e-71    
gb|AFD54037.1|  NAC transcription factor NAM-1                          239   2e-70    
gb|AFD54036.1|  NAC transcription factor NAM-1                          239   2e-70    
gb|AFD54033.1|  NAC transcription factor NAM-1                          238   3e-70    
gb|AFD54040.1|  NAC transcription factor NAM-1                          238   3e-70    
gb|AFD54038.1|  NAC transcription factor NAM-1                          238   3e-70    
ref|XP_006657850.1|  PREDICTED: NAC transcription factor ONAC010-...    239   4e-70    
gb|AGV29510.1|  putative NAC domain class transcription factor          231   5e-70    
tpg|DAA63172.1|  TPA: putative NAC domain transcription factor su...    238   9e-70    
emb|CDY53806.1|  BnaA06g01770D                                          234   1e-69    
ref|XP_009147651.1|  PREDICTED: NAC domain-containing protein 18 ...    234   1e-69    
emb|CDY69545.1|  BnaCnng64100D                                          234   1e-69    
ref|XP_009394856.1|  PREDICTED: NAC transcription factor 25-like        234   2e-69    
gb|AFD54034.1|  NAC transcription factor NAM-1                          236   2e-69    
gb|AFD54031.1|  NAC transcription factor NAM-1                          235   8e-69    
ref|XP_009387374.1|  PREDICTED: NAC transcription factor 29-like        232   9e-69    
gb|AEI00653.1|  NAC5                                                    234   1e-68    
ref|XP_010088481.1|  NAC domain-containing protein 29                   232   2e-68    
gb|AEI00649.1|  NAC1                                                    234   2e-68    
gb|ABI94354.1|  NAC transcription factor NAM-D1                         234   2e-68    Aegilops tauschii
gb|AFD54039.1|  NAC transcription factor NAM-1                          233   3e-68    
ref|XP_008799211.1|  PREDICTED: NAC transcription factor ONAC010-...    226   3e-68    
gb|AFD54035.1|  NAC transcription factor NAM-1                          232   1e-67    
ref|XP_008793367.1|  PREDICTED: NAC transcription factor 29-like        229   3e-67    
gb|AFD54032.1|  NAC transcription factor NAM-1                          231   3e-67    
gb|KFK35761.1|  hypothetical protein AALP_AA4G032900                    226   3e-67    
gb|ACD39374.1|  NAC domain protein                                      221   6e-67    Glycine max [soybeans]
ref|XP_009147650.1|  PREDICTED: NAC domain-containing protein 18 ...    228   6e-67    
ref|XP_010922870.1|  PREDICTED: NAC transcription factor 29-like        228   7e-67    
ref|XP_001771652.1|  predicted protein                                  223   7e-67    
ref|XP_001752718.1|  predicted protein                                  223   9e-67    
gb|AFD54030.1|  NAC transcription factor NAM-1                          229   1e-66    
ref|XP_010938117.1|  PREDICTED: NAC transcription factor 29-like        225   5e-66    
ref|XP_010921289.1|  PREDICTED: NAC transcription factor 25-like        225   6e-66    
ref|XP_004958056.1|  PREDICTED: NAC transcription factor NAM-2-like     227   8e-66    
ref|XP_010931442.1|  PREDICTED: NAC transcription factor 29-like        224   1e-65    
ref|XP_007030230.1|  NAC domain containing protein 47, putative i...    225   1e-65    
gb|KHN46799.1|  NAC domain-containing protein 29                        224   2e-65    
gb|AHB63580.1|  NAC transcription factor                                224   2e-65    
ref|NP_001236142.1|  transcriptional factor NAC11                       223   5e-65    
ref|XP_009366417.1|  PREDICTED: NAC transcription factor 29-like        224   6e-65    
ref|XP_008240449.1|  PREDICTED: NAC transcription factor 25             224   6e-65    
ref|XP_009406848.1|  PREDICTED: NAC transcription factor 29-like        223   6e-65    
gb|KHG14643.1|  NAC domain-containing 29 -like protein                  223   7e-65    
ref|XP_008782759.1|  PREDICTED: NAC transcription factor 25-like        222   8e-65    
gb|ACI15346.1|  NAC domain protein NAC5                                 223   1e-64    Gossypium hirsutum [American cotton]
ref|XP_009345059.1|  PREDICTED: NAC transcription factor 29-like        223   1e-64    
ref|XP_007030229.1|  NAC domain containing protein 47, putative i...    224   1e-64    
ref|XP_008442252.1|  PREDICTED: NAC transcription factor 25-like        222   2e-64    
gb|EPS59407.1|  hypothetical protein M569_15400                         216   2e-64    
dbj|BAF36563.1|  NAC domain protein                                     221   2e-64    Cymbidium hybrid cultivar
ref|NP_001238061.1|  NAC domain protein                                 221   2e-64    
ref|XP_001769642.1|  predicted protein                                  216   3e-64    
gb|AGC97438.1|  NAC protein 8                                           221   3e-64    
ref|XP_002319143.2|  hypothetical protein POPTR_0013s05080g             221   3e-64    Populus trichocarpa [western balsam poplar]
ref|XP_004493136.1|  PREDICTED: NAC transcription factor 25-like        220   4e-64    
ref|XP_007202090.1|  hypothetical protein PRUPE_ppa007445mg             221   4e-64    
ref|XP_003548053.1|  PREDICTED: NAC transcription factor NAM-2          221   5e-64    
ref|XP_007027296.1|  NAC domain protein, IPR003441, putative            221   6e-64    
ref|XP_009353167.1|  PREDICTED: NAC transcription factor 29-like        221   6e-64    
ref|XP_009392736.1|  PREDICTED: NAC domain-containing protein 67-...    219   6e-64    
ref|XP_007161811.1|  hypothetical protein PHAVU_001G100200g             220   7e-64    
gb|AAM20637.1|  NAM-like protein                                        219   7e-64    Arabidopsis thaliana [mouse-ear cress]
ref|NP_175696.1|  NAC domain-containing protein 18                      219   7e-64    Arabidopsis thaliana [mouse-ear cress]
ref|XP_001779494.1|  predicted protein                                  214   8e-64    
ref|XP_010524963.1|  PREDICTED: NAC domain-containing protein 18-...    220   1e-63    
ref|XP_010462140.1|  PREDICTED: NAC domain-containing protein 18-...    219   1e-63    
ref|XP_006443351.1|  hypothetical protein CICLE_v10020717mg             220   1e-63    
ref|XP_009416337.1|  PREDICTED: NAC transcription factor 29-like        218   1e-63    
ref|XP_010500912.1|  PREDICTED: NAC domain-containing protein 18-...    219   1e-63    
ref|XP_008792524.1|  PREDICTED: NAC transcription factor 29-like        219   1e-63    
ref|XP_011034424.1|  PREDICTED: NAC transcription factor 29-like        220   1e-63    
ref|XP_010479815.1|  PREDICTED: NAC domain-containing protein 18        219   1e-63    
ref|XP_010036180.1|  PREDICTED: NAC transcription factor 29-like        219   1e-63    
gb|ABK26029.1|  unknown                                                 220   2e-63    Picea sitchensis
ref|XP_002894407.1|  hypothetical protein ARALYDRAFT_474412             218   2e-63    
ref|XP_004146638.1|  PREDICTED: NAC transcription factor 25-like        219   2e-63    
gb|KGN64646.1|  hypothetical protein Csa_1G073060                       219   2e-63    
gb|AGS08758.1|  NAC domain protein                                      219   3e-63    
ref|NP_001280963.1|  NAC transcription factor 29                        219   3e-63    
gb|ABK23477.1|  unknown                                                 217   4e-63    Picea sitchensis
gb|AAM63301.1|  NAM-like protein                                        217   4e-63    Arabidopsis thaliana [mouse-ear cress]
gb|ABK22535.1|  unknown                                                 217   4e-63    Picea sitchensis
ref|XP_007151816.1|  hypothetical protein PHAVU_004G077400g             218   5e-63    
ref|XP_010276466.1|  PREDICTED: NAC transcription factor 25-like ...    219   6e-63    
ref|XP_003624592.1|  NAC domain transcription factor                    217   1e-62    
ref|XP_002525467.1|  transcription factor, putative                     218   1e-62    Ricinus communis
ref|XP_002991700.1|  hypothetical protein SELMODRAFT_133982             211   1e-62    
ref|XP_009410477.1|  PREDICTED: NAC transcription factor 29-like        215   1e-62    
ref|XP_002991033.1|  hypothetical protein SELMODRAFT_47266              213   1e-62    
ref|XP_006408226.1|  hypothetical protein EUTSA_v10021011mg             217   1e-62    
gb|KHN02351.1|  NAC domain-containing protein 29                        216   1e-62    
ref|XP_003553546.1|  PREDICTED: NAC transcription factor 25-like        216   2e-62    
ref|XP_003518189.1|  PREDICTED: NAC transcription factor NAM-2-like     216   2e-62    
ref|XP_010054307.1|  PREDICTED: NAC transcription factor 25-like        218   2e-62    
emb|CBI16292.3|  unnamed protein product                                217   2e-62    
ref|XP_008383789.1|  PREDICTED: NAC transcription factor 25-like ...    216   3e-62    
ref|XP_006344264.1|  PREDICTED: NAC transcription factor 29-like        214   3e-62    
ref|XP_003557998.1|  PREDICTED: NAC transcription factor NAM-B1-like    216   3e-62    
gb|AHC54052.1|  transcriptional factor NAC11                            216   3e-62    
gb|EYU28780.1|  hypothetical protein MIMGU_mgv1a021552mg                214   6e-62    
gb|KHG28640.1|  NAC domain-containing 29 -like protein                  213   6e-62    
ref|XP_004237044.1|  PREDICTED: NAC transcription factor 29-like        213   7e-62    
ref|XP_002519550.1|  transcription factor, putative                     213   7e-62    
ref|XP_001773582.1|  predicted protein                                  209   8e-62    
ref|XP_011075519.1|  PREDICTED: LOW QUALITY PROTEIN: NAC transcri...    213   1e-61    
gb|KFK37842.1|  hypothetical protein AALP_AA3G036200                    214   1e-61    
ref|XP_001773542.1|  predicted protein                                  209   1e-61    
ref|XP_010518139.1|  PREDICTED: NAC transcription factor 29-like        214   1e-61    
ref|XP_006297959.1|  hypothetical protein CARUB_v10014000mg             215   1e-61    
ref|XP_010485778.1|  PREDICTED: NAC transcription factor 29-like        214   2e-61    
ref|XP_002976404.1|  hypothetical protein SELMODRAFT_105213             208   2e-61    
ref|XP_009420951.1|  PREDICTED: NAC transcription factor 29-like        212   2e-61    
ref|XP_007015431.1|  NAC domain containing protein 25, putative         215   2e-61    
ref|XP_002987237.1|  hypothetical protein SELMODRAFT_125697             207   2e-61    
ref|XP_010470936.1|  PREDICTED: NAC transcription factor 29-like        211   2e-61    
ref|XP_010558707.1|  PREDICTED: NAC transcription factor 29-like        213   3e-61    
gb|AGL39678.1|  NAC transcription factor 022                            212   3e-61    
gb|AFI56994.1|  NAC2                                                    210   3e-61    
ref|XP_006843547.1|  hypothetical protein AMTR_s00007p00063550          214   3e-61    
ref|XP_002325400.1|  hypothetical protein POPTR_0019s04690g             214   3e-61    
ref|XP_007158644.1|  hypothetical protein PHAVU_002G170200g             210   3e-61    
ref|XP_004977420.1|  PREDICTED: NAC transcription factor 25-like        214   3e-61    
ref|XP_002275457.1|  PREDICTED: NAC domain-containing protein 2         213   3e-61    
ref|XP_002448919.1|  hypothetical protein SORBIDRAFT_05g001580          214   3e-61    
emb|CBI32712.3|  unnamed protein product                                213   4e-61    
ref|XP_010904917.1|  PREDICTED: NAC transcription factor NAM-B2-like    212   4e-61    
ref|XP_010999473.1|  PREDICTED: NAC transcription factor 29-like        213   4e-61    
ref|NP_001275015.1|  NAC transcription factor 29-like                   211   5e-61    
ref|NP_187057.2|  NAC domain containing protein 47                      213   6e-61    
gb|ABI34386.1|  NAC-domain containing protein 29 , putative             207   6e-61    
gb|AFK38271.1|  unknown                                                 210   6e-61    
ref|XP_002317321.2|  hypothetical protein POPTR_0011s05760g             212   7e-61    
gb|AGL39682.1|  NAC transcription factor 026                            213   8e-61    
ref|XP_010463881.1|  PREDICTED: NAC transcription factor 25-like        212   8e-61    
gb|KFK41373.1|  hypothetical protein AALP_AA2G121900                    209   9e-61    
ref|XP_002442733.1|  hypothetical protein SORBIDRAFT_08g001940          214   1e-60    
ref|NP_001118568.1|  NAC domain containing protein 47                   211   1e-60    
gb|AAW28573.2|  NAC-domain containing protein 29 , putative             207   1e-60    
emb|CDY40930.1|  BnaC06g30680D                                          209   1e-60    
gb|AET07181.1|  NAC transcription factor                                212   1e-60    
ref|XP_006645427.1|  PREDICTED: NAC transcription factor NAM-B1-like    211   1e-60    
ref|XP_004978485.1|  PREDICTED: NAC transcription factor 25-like        212   1e-60    
ref|XP_010415593.1|  PREDICTED: NAC transcription factor 29             209   1e-60    
ref|XP_002960864.1|  hypothetical protein SELMODRAFT_71307              205   2e-60    
ref|XP_009105493.1|  PREDICTED: NAC transcription factor 29             209   2e-60    
ref|XP_006829778.1|  hypothetical protein AMTR_s00119p00040230          211   2e-60    
ref|XP_002967149.1|  hypothetical protein SELMODRAFT_86855              206   2e-60    
ref|NP_001235915.1|  transcriptional factor NAC51                       207   2e-60    
gb|KHN28140.1|  NAC domain-containing protein 29                        207   2e-60    
gb|ADP69101.1|  NAC transcription factor 1                              211   2e-60    
gb|AAY44098.1|  NAC domain transcription factor                         211   2e-60    
ref|XP_008243919.1|  PREDICTED: NAC transcription factor 29-like        211   2e-60    
ref|XP_007046037.1|  NAC domain protein, IPR003441                      209   2e-60    
ref|XP_003625606.1|  NAC domain transcription factor                    210   2e-60    
ref|XP_011070984.1|  PREDICTED: NAC transcription factor 29-like        209   3e-60    
ref|XP_003556789.1|  PREDICTED: NAC transcription factor 29             209   3e-60    
gb|AAU08785.1|  NAC domain transcription factor                         211   3e-60    
ref|XP_009598866.1|  PREDICTED: NAC transcription factor 29-like        208   3e-60    
ref|XP_010651865.1|  PREDICTED: NAC transcription factor 29             208   3e-60    
gb|ACX47024.1|  NAP-like transcription factor                           208   3e-60    
ref|XP_011001235.1|  PREDICTED: NAC domain-containing protein 72-...    210   3e-60    
ref|XP_001754918.1|  predicted protein                                  204   3e-60    
gb|AGL39683.1|  NAC transcription factor 027                            208   4e-60    
ref|XP_003539409.1|  PREDICTED: NAC domain-containing protein 2-like    210   4e-60    
ref|XP_004984512.1|  PREDICTED: NAC transcription factor NAM-B1-like    211   4e-60    
gb|EYU22403.1|  hypothetical protein MIMGU_mgv1a012228mg                207   4e-60    
ref|XP_007150216.1|  hypothetical protein PHAVU_005G136400g             210   4e-60    
gb|AAM63330.1|  NAC domain protein NAC2                                 207   5e-60    
ref|XP_010549620.1|  PREDICTED: NAC transcription factor 29             210   5e-60    
ref|NP_564966.1|  NAC transcription factor protein family               207   5e-60    
ref|XP_008792531.1|  PREDICTED: NAC domain-containing protein 68-...    209   5e-60    
ref|XP_009781251.1|  PREDICTED: NAC transcription factor 29-like        207   5e-60    
ref|XP_002884426.1|  ANAC047                                            210   6e-60    
ref|XP_010108694.1|  NAC domain-containing protein 29                   208   6e-60    
gb|AIA57511.1|  NAC domain-containing protein                           208   7e-60    
ref|XP_004135168.1|  PREDICTED: NAC transcription factor 29-like        207   7e-60    
gb|ADP69102.1|  NAC transcription factor 1                              209   8e-60    
ref|XP_009773865.1|  PREDICTED: NAC transcription factor 29-like        207   8e-60    
ref|XP_006391010.1|  hypothetical protein EUTSA_v10018997mg             207   8e-60    
ref|XP_009130419.1|  PREDICTED: LOW QUALITY PROTEIN: NAC domain-c...    209   9e-60    
gb|AAY44097.1|  NAC domain transcription factor                         209   1e-59    
gb|EMT14095.1|  NAC domain-containing protein 29                        209   1e-59    
gb|KEH15120.1|  NAC transcription factor-like protein                   206   1e-59    
ref|XP_009606198.1|  PREDICTED: NAC transcription factor 29-like        207   1e-59    
ref|XP_010931441.1|  PREDICTED: NAC domain-containing protein 68-...    207   1e-59    
ref|XP_002283807.1|  PREDICTED: NAC domain-containing protein 68        207   1e-59    
ref|XP_007206224.1|  hypothetical protein PRUPE_ppa015363mg             209   1e-59    
ref|XP_004238810.1|  PREDICTED: NAC transcription factor 29             207   1e-59    
ref|XP_009394855.1|  PREDICTED: NAC domain-containing protein 68-...    207   1e-59    
gb|AHJ79180.1|  NAC domain protein NAC39                                209   1e-59    
ref|XP_002887238.1|  NAC domain protein NAC2                            206   1e-59    
ref|XP_002282566.1|  PREDICTED: NAC domain-containing protein 67        208   2e-59    
ref|XP_008782049.1|  PREDICTED: NAC transcription factor 29-like        208   2e-59    
emb|CDY50880.1|  BnaA05g37410D                                          208   2e-59    
emb|CDP00360.1|  unnamed protein product                                206   2e-59    
ref|XP_011017514.1|  PREDICTED: NAC transcription factor 29             206   2e-59    
gb|AAN64999.1|  Putative NAM (no apical meristem) protein               210   2e-59    
gb|EEE58985.1|  hypothetical protein OsJ_10691                          209   2e-59    
ref|XP_003541998.1|  PREDICTED: NAC transcription factor ONAC010-...    208   2e-59    
ref|XP_010257746.1|  PREDICTED: NAC domain-containing protein 68-...    207   2e-59    
ref|XP_010922868.1|  PREDICTED: NAC domain-containing protein 68-...    207   2e-59    
ref|XP_006302669.1|  hypothetical protein CARUB_v10020776mg             206   2e-59    
gb|KDO51071.1|  hypothetical protein CISIN_1g042614mg                   207   2e-59    
gb|EAZ19492.1|  hypothetical protein OsJ_35058                          205   3e-59    
ref|XP_009410478.1|  PREDICTED: NAC domain-containing protein 68-...    206   3e-59    
emb|CDY51500.1|  BnaC06g43410D                                          206   3e-59    
dbj|BAO57484.1|  transcription factor InNAP                             206   3e-59    
ref|XP_009406849.1|  PREDICTED: NAC domain-containing protein 68-...    206   3e-59    
ref|XP_006381471.1|  hypothetical protein POPTR_0006s13140g             204   3e-59    
ref|XP_009593586.1|  PREDICTED: NAC transcription factor ONAC010 ...    202   4e-59    
gb|EMS63328.1|  NAC domain-containing protein 29                        213   4e-59    
gb|EAY82108.1|  hypothetical protein OsI_37306                          209   4e-59    
ref|XP_001779492.1|  predicted protein                                  202   4e-59    
gb|EAZ17264.1|  hypothetical protein OsJ_32784                          209   4e-59    
gb|ABA95705.1|  NAC domain transcription factor, putative, expressed    209   5e-59    
ref|XP_002305109.1|  hypothetical protein POPTR_0004s04920g             207   6e-59    
dbj|BAJ99416.1|  predicted protein                                      207   6e-59    
ref|XP_007223324.1|  hypothetical protein PRUPE_ppa009530mg             205   6e-59    
gb|AGC27312.1|  NAC domain protein 9                                    205   6e-59    
emb|CBZ39285.1|  NAC transcription factor                               207   6e-59    
gb|AEQ61906.1|  NAC domain protein NAC2                                 205   7e-59    
ref|XP_010511986.1|  PREDICTED: NAC transcription factor 29-like        204   7e-59    
emb|CDY07348.1|  BnaA07g24270D                                          204   7e-59    
gb|AEQ94175.1|  NAC protein 1                                           204   7e-59    
ref|XP_009105596.1|  PREDICTED: NAC transcription factor 29-like        204   8e-59    
ref|XP_004493961.1|  PREDICTED: NAC transcription factor ONAC010-...    206   8e-59    
gb|AIA57531.1|  NAC domain-containing protein                           207   8e-59    
ref|XP_010921285.1|  PREDICTED: NAC domain-containing protein 68-...    206   9e-59    
ref|XP_002284668.1|  PREDICTED: NAC domain-containing protein 72        206   9e-59    
emb|CAN62145.1|  hypothetical protein VITISV_007842                     206   1e-58    
ref|XP_011027935.1|  PREDICTED: protein FEZ-like                        206   1e-58    
ref|XP_008355629.1|  PREDICTED: NAC transcription factor 29-like        206   1e-58    
ref|XP_008446385.1|  PREDICTED: NAC transcription factor 29             204   1e-58    
ref|XP_002312256.2|  hypothetical protein POPTR_0008s08850g             204   1e-58    
gb|ABZ89747.1|  NAC transcription factor NAP                            204   1e-58    
ref|XP_004147806.1|  PREDICTED: NAC domain-containing protein 72-...    205   1e-58    
ref|XP_003613866.1|  NAC domain protein                                 203   1e-58    
ref|XP_009377421.1|  PREDICTED: NAC transcription factor 29-like        206   1e-58    
gb|ACI15345.1|  NAC domain protein NAC4                                 206   2e-58    
gb|KHN01256.1|  NAC domain-containing protein 29                        204   2e-58    
ref|XP_003597198.1|  NAC domain-containing protein                      205   2e-58    
gb|ABK95173.1|  unknown                                                 202   2e-58    
ref|XP_008359072.1|  PREDICTED: NAC domain-containing protein 2-like    206   2e-58    
gb|KHG11072.1|  NAC domain-containing 29 -like protein                  206   2e-58    
ref|XP_004297288.1|  PREDICTED: NAC transcription factor 29-like        204   2e-58    
ref|NP_001236855.1|  NAC domain protein NAC1                            204   2e-58    
ref|XP_002961563.1|  hypothetical protein SELMODRAFT_69131              199   2e-58    
ref|XP_007153556.1|  hypothetical protein PHAVU_003G045600g             202   2e-58    
gb|EEC82702.1|  hypothetical protein OsI_27367                          205   2e-58    
gb|AHE80972.1|  NAC domain-containing protein                           203   2e-58    
ref|XP_010268760.1|  PREDICTED: NAC domain-containing protein 72-...    205   3e-58    
ref|XP_004487133.1|  PREDICTED: NAC transcription factor NAM-B2-like    205   3e-58    
ref|NP_001044617.1|  Os01g0816100                                       204   3e-58    
gb|EPS70298.1|  hypothetical protein M569_04459                         202   3e-58    
ref|XP_002522466.1|  NAC domain-containing protein, putative            203   3e-58    
gb|AIU47058.1|  NAC transcription factor                                203   3e-58    
dbj|BAA89798.1|  OsNAC4 protein                                         204   3e-58    
ref|XP_008221592.1|  PREDICTED: NAC transcription factor 29             203   3e-58    
gb|KHN14494.1|  NAC domain-containing protein 29                        203   4e-58    
ref|NP_001238204.1|  NAC domain protein                                 203   4e-58    
gb|EYU31768.1|  hypothetical protein MIMGU_mgv1a011129mg                203   4e-58    
ref|XP_002533913.1|  NAC domain-containing protein, putative            205   4e-58    
gb|AGL39677.1|  NAC transcription factor 021                            205   4e-58    
gb|EAY76267.1|  hypothetical protein OsI_04203                          204   4e-58    
ref|XP_006438726.1|  hypothetical protein CICLE_v10032304mg             203   4e-58    
emb|CBI18995.3|  unnamed protein product                                202   4e-58    
gb|EAY79778.1|  hypothetical protein OsI_34934                          206   4e-58    
ref|XP_010938113.1|  PREDICTED: NAC domain-containing protein 68-...    203   4e-58    
gb|ABA91266.1|  NAC domain transcription factor, putative, expressed    206   4e-58    
ref|XP_008454666.1|  PREDICTED: NAC domain-containing protein 72-...    204   5e-58    
ref|XP_006663768.1|  PREDICTED: NAC transcription factor 25-like        206   5e-58    
ref|XP_010066895.1|  PREDICTED: NAC transcription factor 29             202   5e-58    
gb|AFK39171.1|  unknown                                                 202   5e-58    
ref|XP_009395970.1|  PREDICTED: NAC domain-containing protein 68-...    203   5e-58    
gb|ABM67699.1|  NAC domain protein                                      202   5e-58    
ref|XP_002526377.1|  NAC domain-containing protein, putative            204   5e-58    
ref|XP_010258043.1|  PREDICTED: NAC transcription factor 29-like        202   5e-58    
ref|XP_009125011.1|  PREDICTED: NAC domain-containing protein 67-...    205   5e-58    
emb|CDP05874.1|  unnamed protein product                                205   6e-58    
gb|AGL39679.1|  NAC transcription factor 023                            204   6e-58    
ref|XP_008660189.1|  PREDICTED: NAC transcription factor 29-like        201   6e-58    
ref|XP_002459566.1|  hypothetical protein SORBIDRAFT_02g006680          202   6e-58    
ref|XP_010664191.1|  PREDICTED: NAC domain-containing protein 2         203   6e-58    
gb|ADM94307.1|  NAC transcription factor                                204   7e-58    
ref|XP_010089503.1|  NAC domain-containing protein 72                   204   7e-58    
ref|XP_009381356.1|  PREDICTED: NAC domain-containing protein 68-...    202   8e-58    
ref|XP_004490093.1|  PREDICTED: NAC transcription factor 29-like        202   8e-58    
ref|XP_010258284.1|  PREDICTED: NAC transcription factor 29-like        202   9e-58    
ref|XP_011095243.1|  PREDICTED: NAC domain-containing protein 72-...    204   9e-58    
ref|XP_011069419.1|  PREDICTED: NAC domain-containing protein 2         202   1e-57    
ref|XP_002454866.1|  hypothetical protein SORBIDRAFT_03g000330          204   1e-57    
ref|XP_010545806.1|  PREDICTED: NAC domain-containing protein 19-...    203   1e-57    
gb|ADK23915.1|  NAC protein                                             201   1e-57    
ref|XP_008782755.1|  PREDICTED: NAC domain-containing protein 68-...    202   1e-57    
ref|XP_006305484.1|  hypothetical protein CARUB_v10009926mg             202   1e-57    
ref|NP_001234219.1|  Nam-like protein 1                                 202   1e-57    
emb|CBI21612.3|  unnamed protein product                                201   1e-57    
ref|NP_001274970.1|  nam-like protein                                   202   1e-57    
ref|XP_008787999.1|  PREDICTED: NAC domain-containing protein 68-...    202   1e-57    
gb|KEH19435.1|  NAC transcription factor-like protein                   203   1e-57    
ref|XP_002316917.1|  no apical meristem family protein                  203   1e-57    
emb|CDY29983.1|  BnaC01g40250D                                          204   1e-57    
gb|ABU40779.1|  NAC-like protein 14                                     202   1e-57    
ref|XP_010479865.1|  PREDICTED: NAC domain-containing protein 2-like    202   1e-57    
gb|AFN55272.1|  NAC domain-containing protein                           202   1e-57    
ref|XP_007021328.1|  NAC domain class transcription factor isoform 1    203   1e-57    
ref|XP_010474793.1|  PREDICTED: NAC domain-containing protein 2         202   1e-57    
gb|KEH38789.1|  NAC transcription factor-like protein                   204   2e-57    
ref|XP_011048576.1|  PREDICTED: putative NAC domain-containing pr...    203   2e-57    
ref|XP_004514350.1|  PREDICTED: NAC domain-containing protein 72-...    203   2e-57    



>emb|CDP05873.1| unnamed protein product [Coffea canephora]
Length=329

 Score =   400 bits (1029),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 217/336 (65%), Positives = 252/336 (75%), Gaps = 40/336 (12%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EELVVHYLKKK ASAP+PV+IIAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA
Sbjct  26    EELVVHYLKKKAASAPLPVSIIAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  85

Query  1068  RPNRAATSGYWKATGTDKPVLTAGGTQKVGVKKALVFYGGKPPKGVKTNWIMHEYRLADN  889
             RPNRAATSGYWKATGTDKPVLT+GGTQKVGVKKALVFYGGKPPKG+KTNWIMHEYRL DN
Sbjct  86    RPNRAATSGYWKATGTDKPVLTSGGTQKVGVKKALVFYGGKPPKGIKTNWIMHEYRLVDN  145

Query  888   KTSNKPPGLDIANRSKGGSLRLDDWVLCRIYKKNNSQRPLDHESDDLNDMLQGSIPPFVT  709
             KTS KPPG DI N  K GSLRLDDWVLCRIYKKNN+ RP+DH+ DD NDM+    P    
Sbjct  146   KTSIKPPGCDIGN--KKGSLRLDDWVLCRIYKKNNTPRPMDHDRDDFNDMMPSIPPSLPP  203

Query  708   -------HQKMGLKPSNYGALLQTDhhhhhhHMFDQGLVPGDASLGGARTAQLPFVPSTP  550
                     + +GLK SN+GALL+ +                          ++P + ++ 
Sbjct  204   SMSMSSQQKILGLKASNFGALLENEQS----------------------AFEVPGMLTSN  241

Query  549   NLLPTKRSLPGLFWNVDDSSANNHHPADASPPTKRFLADNNEASISRS-DEQNGSIATLL  373
             +++P KR+LP L+WN + +          SP  KRFLAD+ + +I R+ +++N SIATLL
Sbjct  242   HVIPAKRALPALYWNDEGNP--------ISPSNKRFLADSGDGNIGRTNNDENSSIATLL  293

Query  372   SHLPQTPSLHQQTMLGALNDGVFRQPYQVSGINWYS  265
             S LPQT SLHQQ MLG+L DGVFRQPYQV+G+NWYS
Sbjct  294   SQLPQTTSLHQQAMLGSLGDGVFRQPYQVTGMNWYS  329



>ref|XP_007021327.1| NAC domain protein, IPR003441 [Theobroma cacao]
 gb|EOY12852.1| NAC domain protein, IPR003441 [Theobroma cacao]
Length=347

 Score =   400 bits (1028),  Expect = 9e-134, Method: Compositional matrix adjust.
 Identities = 219/339 (65%), Positives = 257/339 (76%), Gaps = 28/339 (8%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EELVVHYLKKK +SAP+PVAIIAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA
Sbjct  26    EELVVHYLKKKASSAPLPVAIIAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  85

Query  1068  RPNRAATSGYWKATGTDKPVLTAGGTQKVGVKKALVFYGGKPPKGVKTNWIMHEYRLADN  889
             RPNRAATSGYWKATGTDKPVLT+GGTQKVGVKKALVFYGGKPPKG+KTNWIMHEYRLADN
Sbjct  86    RPNRAATSGYWKATGTDKPVLTSGGTQKVGVKKALVFYGGKPPKGIKTNWIMHEYRLADN  145

Query  888   KTSNKPPGLDIANRSKGGSLRLDDWVLCRIYKKNNSQRPLDHESDDLNDMLQGSIPPFVT  709
             K SNKPPG D+ N  K  SLRLDDWVLCRIYKKNN+ RP+DH+ DD  D + G IPP ++
Sbjct  146   KASNKPPGCDLGN--KKNSLRLDDWVLCRIYKKNNTHRPMDHDKDDSMDEMLGPIPPSIS  203

Query  708   ----HQ---KMGLKPSNYGALLQTDhhhhhhHMFDQGLVPGDASLGGARTAQLPFVPSTP  550
                 H    ++  K +++G LL+       H +F +G++ G   +     +QL    S P
Sbjct  204   IGSQHNAKFQLATKGTSFGTLLENQ----EHSLF-EGMMAGSDGINSGSISQLGCSSSKP  258

Query  549   NLL---PTKRSLPGLFWNVDDSSANNHHPADASPPT-KRFLADNNEASISRSDEQNGSIA  382
             +L    P KR++P LFW  +D+         A P T KRF  D+N+ S+ ++D  NGSIA
Sbjct  259   DLSMVNPLKRTVPSLFWTDEDT---------AGPSTSKRFHGDSNDGSMEKTD-GNGSIA  308

Query  381   TLLSHLPQTPSLHQQTMLGALNDGVFRQPYQVSGINWYS  265
             TLLS LPQTP L QQTMLG++ DG+FR PYQ+SG+NWYS
Sbjct  309   TLLSQLPQTPPLQQQTMLGSMGDGIFRPPYQLSGLNWYS  347



>ref|XP_009769986.1| PREDICTED: NAC transcription factor 25 [Nicotiana sylvestris]
Length=353

 Score =   400 bits (1027),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 232/347 (67%), Positives = 269/347 (78%), Gaps = 39/347 (11%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EELVVHYLKKK AS P+PVAIIAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA
Sbjct  27    EELVVHYLKKKAASIPLPVAIIAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  86

Query  1068  RPNRAATSGYWKATGTDKPVLTAGGTQKVGVKKALVFYGGKPPKGVKTNWIMHEYRLADN  889
             RPNRAATSGYWKATGTDKPVLTAGGTQKVGVKKALVFYGGKPPKGVKTNWIMHEYRLADN
Sbjct  87    RPNRAATSGYWKATGTDKPVLTAGGTQKVGVKKALVFYGGKPPKGVKTNWIMHEYRLADN  146

Query  888   KTSNKPPGLDIANRSKGGSLRLDDWVLCRIYKKNNSQRPLDHESDDLNDMLQGSIPP-FV  712
             K +NKPPG D+AN+    SLRLDDWVLCRIYKKNN+QRP+DHE DDLND++  SIP   +
Sbjct  147   KANNKPPGCDVANKK---SLRLDDWVLCRIYKKNNTQRPIDHERDDLNDIMGSSIPATCI  203

Query  711   THQKMGL-----KPSNYGALLQTDhhhhhhHMFDQGLVPGDASLGGARTAQLP--FVPST  553
              +  M +       SNY  LL+T    H  +++DQG+           ++QLP   + ++
Sbjct  204   PNNSMSIFGQPKANSNYTTLLET----HDQNIYDQGM-----QFSSKSSSQLPVNVLSTS  254

Query  552   PNLLPTKRSLPGLFWNVDDSSANNHHPADASPPTKRFLADN-----NEASIS-RSD-EQN  394
             P+LLP+KRSL GL+WN ++++AN     D S  TKRFL +N     +  S++ RSD EQN
Sbjct  255   PSLLPSKRSLNGLYWN-EEAAAN-----DNSQSTKRFLTENINNMDDGLSMNVRSDHEQN  308

Query  393   GSIATLLSHLPQTPSL----HQQTMLGALNDGVFRQPYQVSGINWYS  265
             GSIA+LLS LPQTPSL     QQ + G+L+DGVFRQPY  SG+NWYS
Sbjct  309   GSIASLLSQLPQTPSLQQQQQQQILQGSLSDGVFRQPY--SGMNWYS  353



>ref|XP_009594217.1| PREDICTED: NAC transcription factor 25-like [Nicotiana tomentosiformis]
Length=350

 Score =   398 bits (1023),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 231/347 (67%), Positives = 269/347 (78%), Gaps = 42/347 (12%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EELVVHYLKK+VAS P+PVAIIAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA
Sbjct  27    EELVVHYLKKRVASVPLPVAIIAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  86

Query  1068  RPNRAATSGYWKATGTDKPVLTAGGTQKVGVKKALVFYGGKPPKGVKTNWIMHEYRLADN  889
             RPNRAATSGYWKATGTDKPVLTAGGTQKVGVKKALVFYGGKPPKGVKTNWIMHEYRLADN
Sbjct  87    RPNRAATSGYWKATGTDKPVLTAGGTQKVGVKKALVFYGGKPPKGVKTNWIMHEYRLADN  146

Query  888   KTSNKPPGLDIANRSKGGSLRLDDWVLCRIYKKNNSQRPLDHESDDLNDMLQGSIPPFVT  709
             K +NKPPG D+AN+    SLRLDDWVLCRIYKKNN+QRP+DHE DDLND++  +  P   
Sbjct  147   KANNKPPGCDVANKK---SLRLDDWVLCRIYKKNNTQRPIDHERDDLNDIIGATCIP---  200

Query  708   HQKMGL-------KPSNYGALLQTDhhhhhhHMFDQGLVPGDASLGGARTAQLP--FVPS  556
             +  M +       K SNY  LL+T    H  +++DQG+           ++QLP   + +
Sbjct  201   NNSMSMPNPFGQQKSSNYTTLLET----HDQNIYDQGM-----QFSSKSSSQLPVNVLST  251

Query  555   TPNLLPTKRSLPGLFWNVDDSSANNHHPADASPPTKRFLADN-----NEASIS-RSD-EQ  397
             + ++LP+KRSL GL+WN ++++AN     D S  TKRFL +N     +  S++ RSD EQ
Sbjct  252   SASVLPSKRSLTGLYWN-EEATAN-----DNSQSTKRFLTENINNLDDGLSMNLRSDHEQ  305

Query  396   NGSIATLLSHLPQTPSLH---QQTMLGALNDGVFRQPYQVSGINWYS  265
             NGSIA+LLS LPQTPSLH   QQ + G+L+DGVFRQPY  SGINWYS
Sbjct  306   NGSIASLLSQLPQTPSLHQQQQQILQGSLSDGVFRQPY--SGINWYS  350



>ref|XP_011095244.1| PREDICTED: NAC transcription factor 25-like [Sesamum indicum]
Length=354

 Score =   394 bits (1012),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 227/339 (67%), Positives = 263/339 (78%), Gaps = 36/339 (11%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EELVVHYLKKK ASAP+PVAIIAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA
Sbjct  41    EELVVHYLKKKAASAPLPVAIIAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  100

Query  1068  RPNRAATSGYWKATGTDKPVLTAGGTQKVGVKKALVFYGGKPPKGVKTNWIMHEYRLADN  889
             RPNRAATSGYWKATGTDKPVLTAGGTQKVGVKKALVFYGGKPPKG+KTNWIMHEYRLADN
Sbjct  101   RPNRAATSGYWKATGTDKPVLTAGGTQKVGVKKALVFYGGKPPKGIKTNWIMHEYRLADN  160

Query  888   KTSNKPPGLDIANRSKGGSLRLDDWVLCRIYKKNNSQRPLDHESDD-LNDMLQGSIPPFV  712
             K + KPPG D     K GSLRLDDWVLCRIYKK N+QRP+  E DD +NDM+ GS+ P +
Sbjct  161   KPNCKPPGCD-----KKGSLRLDDWVLCRIYKKTNAQRPMTQERDDHINDMI-GSVQPTL  214

Query  711   T-----HQKM-GLKPSNYGALLQTDhhhhhhHMFDQGLVPGDASLGGARTAQLPFVPSTP  550
             +     HQK+ G+K S+YG+LL++D + +   M +   +  ++ LG +         + P
Sbjct  215   SLPLGQHQKIHGIKASSYGSLLESDDNLYEGMMNNNESM--NSHLGSS---------ADP  263

Query  549   NLLPTKRSLPGLFWNVDDSSANNHHPADASPPTKRFLADNNEASISRSDE-QNGSIATLL  373
             NLL  KR+LP L+WN ++ +AN       SPPTKRFLA++ + SI R+DE    S  T+L
Sbjct  264   NLLQGKRTLPNLYWN-EEGNAN-------SPPTKRFLAESCDGSIGRADETTTSSHHTIL  315

Query  372   SHLPQTPSLHQQTML--GALNDGVFR-QPYQVSGINWYS  265
             S LPQTPSL QQ +L  GAL DGVFR QPYQVSG+NWYS
Sbjct  316   SQLPQTPSLQQQAILAAGALGDGVFRQQPYQVSGMNWYS  354



>ref|XP_011098344.1| PREDICTED: NAC domain-containing protein 18 [Sesamum indicum]
Length=338

 Score =   386 bits (992),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 224/336 (67%), Positives = 251/336 (75%), Gaps = 31/336 (9%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EELVVHYLKKK ASAP+PV+IIAEVDLYK+DPWELPAKA FGEQEWYFFSPRDRKYPNGA
Sbjct  26    EELVVHYLKKKAASAPLPVSIIAEVDLYKYDPWELPAKAIFGEQEWYFFSPRDRKYPNGA  85

Query  1068  RPNRAATSGYWKATGTDKPVLTAGGTQKVGVKKALVFYGGKPPKGVKTNWIMHEYRLADN  889
             RPNRAATSGYWKATGTDKPVLTAGGTQKVGVKKALVFYGGKPPKG+KTNWIMHEYRLADN
Sbjct  86    RPNRAATSGYWKATGTDKPVLTAGGTQKVGVKKALVFYGGKPPKGIKTNWIMHEYRLADN  145

Query  888   K-TSNKPPGLDIANRSKGGSLRLDDWVLCRIYKKNNSQRPLDHESDDLNDMLQGSIPPFV  712
             K  SNKPPG D +N  K  SLRLDDWVLCRIYKKNN+QRP+D E D+LND++ GSIPP +
Sbjct  146   KPASNKPPGCDFSN--KKASLRLDDWVLCRIYKKNNAQRPVDQERDELNDVI-GSIPPTI  202

Query  711   THQKMGLKPSN-----YGALLQTDhhhhhhHMFDQGLVPGDASLG-GARTAQLPFVPSTP  550
             +  +     +N     Y  ++  D         +  L    AS G      QLP V    
Sbjct  203   SIGQHKFLDNNDHQNYYEGMMMNDS-------MNSHLGTNKASTGHHHHHQQLPLVAH--  253

Query  549   NLLPTKRSLPGLFWNVDDSSANNHHPADASPPTKRFLADNNEASISRSDEQNGSIATLLS  370
             NLLPTKR+LP L+WN  D   N     D S  TKRFL++N    + R+DE   SIAT+LS
Sbjct  254   NLLPTKRALPNLYWN--DVEGN-----DNSASTKRFLSEN---CVGRTDETT-SIATILS  302

Query  369   HLPQTPSLHQQTMLGALNDGVF-RQPYQVSGINWYS  265
              LPQTPSL QQTMLG L +GVF +Q YQVSG+NWYS
Sbjct  303   QLPQTPSLQQQTMLGNLENGVFGQQTYQVSGMNWYS  338



>ref|XP_002284654.2| PREDICTED: NAC transcription factor 25 isoform X1 [Vitis vinifera]
Length=353

 Score =   385 bits (989),  Expect = 8e-128, Method: Compositional matrix adjust.
 Identities = 213/344 (62%), Positives = 253/344 (74%), Gaps = 32/344 (9%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EELVVHYLKKK +SAP+PVAIIAEVDLYKFDPWELPAKA+FGEQEWYFFSPRDRKYPNGA
Sbjct  26    EELVVHYLKKKASSAPLPVAIIAEVDLYKFDPWELPAKASFGEQEWYFFSPRDRKYPNGA  85

Query  1068  RPNRAATSGYWKATGTDKPVLTAGGTQKVGVKKALVFYGGKPPKGVKTNWIMHEYRLADN  889
             RPNRAATSGYWKATGTDKPVLT+GGTQKVGVKKALVFYGGKPPKG+KTNWIMHEYRLADN
Sbjct  86    RPNRAATSGYWKATGTDKPVLTSGGTQKVGVKKALVFYGGKPPKGIKTNWIMHEYRLADN  145

Query  888   KTSNKPPGLDIANRSKGGSLRLDDWVLCRIYKKNNSQRPLDHESDDLNDMLQGSIPPFVT  709
             K + KPPG D+ N  K  SLRLDDWVLCRIYKKNN+ R LD + DD  D + G +P  ++
Sbjct  146   KVNTKPPGCDMGN--KKNSLRLDDWVLCRIYKKNNTHRTLDPDKDDSMDDMLGPVPTSIS  203

Query  708   HQKMGLKPS-----NYGALLQTDhhhhhhHMFDQGLVPGDASLGGARTAQLPFVPSTPN-  547
               +  LK       NY ALL+ +       +F +G++  D        +QL    S P+ 
Sbjct  204   MGQQSLKLQFPKVPNYSALLENE-----QSLF-EGMINSDGINSSGTISQLACSSSKPDH  257

Query  546   ----------LLPTKRSLPGLFWNVDDSSANNHHPADASPPTKRFLADNNEASISRSDEQ  397
                       +LP KR+LP L+WN DD++  +         TKRF A+N + +I R+ + 
Sbjct  258   LSLVAATTSSILPLKRTLPSLYWNDDDTAGPST--------TKRFQAENTDGNIGRTTDG  309

Query  396   NGSIATLLSHLPQTPSLHQQTMLGALNDGVFRQPYQVSGINWYS  265
             N SIATLLS LPQTPSLHQQ+MLG+L +GVFRQP+Q+ G+NWY+
Sbjct  310   NNSIATLLSQLPQTPSLHQQSMLGSLGEGVFRQPFQLPGMNWYA  353



>emb|CBI20351.3| unnamed protein product [Vitis vinifera]
Length=331

 Score =   383 bits (984),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 212/333 (64%), Positives = 249/333 (75%), Gaps = 32/333 (10%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EELVVHYLKKK +SAP+PVAIIAEVDLYKFDPWELPAKA+FGEQEWYFFSPRDRKYPNGA
Sbjct  26    EELVVHYLKKKASSAPLPVAIIAEVDLYKFDPWELPAKASFGEQEWYFFSPRDRKYPNGA  85

Query  1068  RPNRAATSGYWKATGTDKPVLTAGGTQKVGVKKALVFYGGKPPKGVKTNWIMHEYRLADN  889
             RPNRAATSGYWKATGTDKPVLT+GGTQKVGVKKALVFYGGKPPKG+KTNWIMHEYRLADN
Sbjct  86    RPNRAATSGYWKATGTDKPVLTSGGTQKVGVKKALVFYGGKPPKGIKTNWIMHEYRLADN  145

Query  888   KTSNKPPGLDIANRSKGGSLRLDDWVLCRIYKKNNSQRPLDHESDDLNDMLQGSIPPFVT  709
             K + KPPG D+ N  K  SLRLDDWVLCRIYKKNN+ R LD + DD  D + G +P  ++
Sbjct  146   KVNTKPPGCDMGN--KKNSLRLDDWVLCRIYKKNNTHRTLDPDKDDSMDDMLGPVPTSIS  203

Query  708   HQKMGLKPS-----NYGALLQTDhhhhhhHMFDQGLVPGDASLGGARTAQLPFVPSTPNL  544
               +  LK       NY ALL+           +Q L  G  +  G  T       +T ++
Sbjct  204   MGQQSLKLQFPKVPNYSALLEN----------EQSLFEGMINSDGINT-------TTSSI  246

Query  543   LPTKRSLPGLFWNVDDSSANNHHPADASPPTKRFLADNNEASISRSDEQNGSIATLLSHL  364
             LP KR+LP L+WN DD++  +         TKRF A+N + +I R+ + N SIATLLS L
Sbjct  247   LPLKRTLPSLYWNDDDTAGPST--------TKRFQAENTDGNIGRTTDGNNSIATLLSQL  298

Query  363   PQTPSLHQQTMLGALNDGVFRQPYQVSGINWYS  265
             PQTPSLHQQ+MLG+L +GVFRQP+Q+ G+NWY+
Sbjct  299   PQTPSLHQQSMLGSLGEGVFRQPFQLPGMNWYA  331



>ref|XP_002532683.1| NAC domain-containing protein, putative [Ricinus communis]
 gb|EEF29696.1| NAC domain-containing protein, putative [Ricinus communis]
Length=346

 Score =   381 bits (979),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 217/338 (64%), Positives = 251/338 (74%), Gaps = 27/338 (8%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EELVVHYLKKK +SAP+PVAIIAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNG 
Sbjct  26    EELVVHYLKKKASSAPLPVAIIAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGV  85

Query  1068  RPNRAATSGYWKATGTDKPVLTAGGTQKVGVKKALVFYGGKPPKGVKTNWIMHEYRLADN  889
             RPNRAATSGYWKATGTDKPVLT+GGTQKVGVKKALVFYGGKPPKG+KTNWIMHEYRLADN
Sbjct  86    RPNRAATSGYWKATGTDKPVLTSGGTQKVGVKKALVFYGGKPPKGIKTNWIMHEYRLADN  145

Query  888   KTSNKPPGLDIANRSKGGSLRLDDWVLCRIYKKNNSQRPLDHESDD-LNDMLQGSIPPFV  712
             K SNKPPG D+AN  K  SLRLDDWVLCRIYKKNN+ RP+D E DD + DML GSIPP +
Sbjct  146   KVSNKPPGCDLAN--KKNSLRLDDWVLCRIYKKNNTNRPMDQEKDDSMEDML-GSIPPSL  202

Query  711   T------HQKMGLKPSNYGALLQTDhhhhhhHMFDQGLVPGDASLGGARTAQLPFVPSTP  550
             T       +   LK +NYG L++ D        F+   +    S+    ++     P   
Sbjct  203   TIGSQQNARLQLLKGTNYGTLVEND-----TSFFNDHSISNTNSISQLASSTCS-RPGDL  256

Query  549   NLLPTKRSLPGLFWNVDDSSANNHHPADASP-PTKRFLADNN-EASISRSDEQNGSIATL  376
             ++LP KR+LP L+W+ D   A       ASP  +KR+  D+  + S+ RSD  NGS  +L
Sbjct  257   SMLPLKRTLPSLYWSDDVDMA-------ASPSSSKRYQGDHTGDESVVRSD-GNGSFVSL  308

Query  375   LSHLPQTPSLH-QQTMLGALNDGVFRQPYQVSGINWYS  265
             LS LPQTP LH QQ  LG++ DG+FR PYQ+SG+NWYS
Sbjct  309   LSQLPQTPPLHQQQATLGSIGDGIFRPPYQLSGLNWYS  346



>gb|AGL39684.1| NAC transcription factor 028 [Jatropha curcas]
 gb|KDP38908.1| hypothetical protein JCGZ_00665 [Jatropha curcas]
Length=345

 Score =   374 bits (961),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 209/339 (62%), Positives = 250/339 (74%), Gaps = 30/339 (9%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EELVVHYLK+K +SAP+PVAIIAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNG 
Sbjct  26    EELVVHYLKRKASSAPLPVAIIAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGV  85

Query  1068  RPNRAATSGYWKATGTDKPVLTAGGTQKVGVKKALVFYGGKPPKGVKTNWIMHEYRLADN  889
             RPNRAATSGYWKATGTDKPVLT+GGTQKVGVKKALVFYGGKPPKG+KTNWIMHEYRLADN
Sbjct  86    RPNRAATSGYWKATGTDKPVLTSGGTQKVGVKKALVFYGGKPPKGIKTNWIMHEYRLADN  145

Query  888   KTSNKPPGLDIANRSKGGSLRLDDWVLCRIYKKNNSQRPLDHESDDLNDMLQGSIPPFVT  709
             K +NKPPG D+ N  K  SLRLDDWVLCRIYKKNN+ RPLDH+ DD  D + G IPP ++
Sbjct  146   KVNNKPPGCDLGN--KKNSLRLDDWVLCRIYKKNNTHRPLDHDKDDSVDDMLGLIPPSIS  203

Query  708   -----------HQKMGLKPSNYGALLQTDhhhhhhHMFDQGLVPGDASLGGARTAQLPFV  562
                         +   LK +NYG L++ + +     M   G +     +G +        
Sbjct  204   VGNTNNNSQQNAKLQFLKGTNYGLLVENEQNCLFEGMMHNGEI---NQMGSSNR------  254

Query  561   PSTPNLLPTKRSLPGLFWNVDDSSANNHHPADASPPTKRFLADNNEASISRSDEQNGSIA  382
             P   ++LP KR+LP L+WN +  +A        +  +KR+ AD+ + S+ R+D  NGSIA
Sbjct  255   PGELSVLPLKRTLPSLYWNEEIDAA-------GASSSKRYQADSGDGSVVRND-GNGSIA  306

Query  381   TLLSHLPQTPSLHQQTMLGALNDGVFRQPYQVSGINWYS  265
             +LLS LPQTP LHQQT LG+L DG++R P+Q SG+NW+S
Sbjct  307   SLLSQLPQTPPLHQQTALGSLGDGIYRPPFQFSGLNWFS  345



>ref|XP_007149615.1| hypothetical protein PHAVU_005G084600g [Phaseolus vulgaris]
 gb|ESW21609.1| hypothetical protein PHAVU_005G084600g [Phaseolus vulgaris]
Length=369

 Score =   374 bits (961),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 210/354 (59%), Positives = 249/354 (70%), Gaps = 37/354 (10%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EELVVHYLKKK AS P+PVAIIAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA
Sbjct  27    EELVVHYLKKKTASVPLPVAIIAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  86

Query  1068  RPNRAATSGYWKATGTDKPVLTAGGTQKVGVKKALVFYGGKPPKGVKTNWIMHEYRLADN  889
             RPNRAATSGYWKATGTDKPVLT+GGTQKVGVKKALVFYGGKPP+G+KTNWIMHEYRLADN
Sbjct  87    RPNRAATSGYWKATGTDKPVLTSGGTQKVGVKKALVFYGGKPPRGIKTNWIMHEYRLADN  146

Query  888   KTSNKPPGLDIANRSKGGSLRLDDWVLCRIYKKNNSQR-PLDHESDDLNDMLQGSIPPFV  712
             K +N+PPG D+ N  K  SLRLDDWVLCRIYKK+N+ R P++H+ +D  + + G IPP +
Sbjct  147   KPNNRPPGCDLGN--KKNSLRLDDWVLCRIYKKSNTHRSPMEHDREDSMEDMIGGIPPSI  204

Query  711   THQKMG-------LKPSNYGALLQTDhhhhhhHMFDQGLV-----------PGDASLGGA  586
                 M        +      ALL+ D +     M   G V           PG  ++   
Sbjct  205   NVGHMSGRYHLSKMSTGYSSALLENDQNLLEGMMIGNGSVMNTSTATTNTTPG--AMASN  262

Query  585   RTAQLPFVPS-TPNLLPTKRSLPGLFWNVDDSSANNHHPADASPPTKRF---LADNNEAS  418
               A+L FVPS T +   +KR+L  L+WN +D        A  S   KRF     DNN  S
Sbjct  263   SKAELSFVPSMTHSSNTSKRTLSSLYWNDEDV-------AGTSSSNKRFNLESGDNNHGS  315

Query  417   ISRSDEQNG---SIATLLSHLPQTPSLHQQTMLGALNDGVFRQPYQVSGINWYS  265
             + R+D++NG   SI TLL+ LPQTPSLHQQ+MLG++ DG+ R  YQ+ G+NWY+
Sbjct  316   VVRTDQENGTATSIVTLLNQLPQTPSLHQQSMLGSIGDGLLRTTYQIPGMNWYA  369



>gb|AGT56012.1| sinor-like protein 1 [Solanum lycopersicum]
 gb|AGT56013.1| sinor-like protein 1 [Solanum lycopersicum]
Length=329

 Score =   370 bits (950),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 218/346 (63%), Positives = 243/346 (70%), Gaps = 61/346 (18%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EELVVHYLKK+VAS P+PV+IIAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA
Sbjct  27    EELVVHYLKKRVASVPLPVSIIAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  86

Query  1068  RPNRAATSGYWKATGTDKPVLTAGGTQKVGVKKALVFYGGKPPKGVKTNWIMHEYRLADN  889
             RPNRAATSGYWKATGTDKPVLTAGGTQKVGVKKALVFYGGKPPKGVKTNWIMHEYRLADN
Sbjct  87    RPNRAATSGYWKATGTDKPVLTAGGTQKVGVKKALVFYGGKPPKGVKTNWIMHEYRLADN  146

Query  888   KTSNKPPGLDIANRSKGGSLRLDDWVLCRIYKKNNSQRPLDHESDDLN-DMLQG--SIPP  718
             KT+NKPPG D+AN+    SLRLDDWVLCRIYKKNN+QRP+DHE DDLN DM+ G  SI P
Sbjct  147   KTNNKPPGCDLANKK---SLRLDDWVLCRIYKKNNTQRPIDHERDDLNIDMMMGSSSIHP  203

Query  717   FVTHQKMG------------LKPSNYGALLQTDhhhhhhHMFDQGLVPGDASLGGARTAQ  574
                   M             LK SN+G  L  D +       DQ L  G +         
Sbjct  204   SCIPNSMSMPNIFGQPKIPQLKSSNFGTTLIHDQN-------DQNLYEGGSQYS------  250

Query  573   LPFVPSTPNLLPTKRSLPGLFWNVDDSSANNHHPADASPPTKRFLADNNEASI---SRSD  403
                         +KR L  L+WN  D  A+N    D S  TKRFL +N E  +   +R+D
Sbjct  251   ------------SKRPLANLYWNDQDGGASN----DNSQSTKRFLTENMEDGLNMNARAD  294

Query  402   EQNGSIATLLSHLPQTPSLHQQTMLGALNDGVFRQPYQVSGINWYS  265
             EQNGSI +LLS         QQ +LG+L++GVFRQPY  SG+NWYS
Sbjct  295   EQNGSIVSLLS---------QQQVLGSLSEGVFRQPY--SGMNWYS  329



>ref|NP_001266277.1| uncharacterized protein LOC101247735 [Solanum lycopersicum]
 gb|AFD22355.1| NAC3 [Solanum lycopersicum]
Length=329

 Score =   369 bits (946),  Expect = 9e-122, Method: Compositional matrix adjust.
 Identities = 217/345 (63%), Positives = 242/345 (70%), Gaps = 61/345 (18%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EELVVHYLKK+VAS P+PV+IIAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA
Sbjct  27    EELVVHYLKKRVASVPLPVSIIAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  86

Query  1068  RPNRAATSGYWKATGTDKPVLTAGGTQKVGVKKALVFYGGKPPKGVKTNWIMHEYRLADN  889
             RPNRAATSGYWKATGTDKPVLTAGGTQKVGVKKALVFYGGKPPKGVKTNWIMHEYRLADN
Sbjct  87    RPNRAATSGYWKATGTDKPVLTAGGTQKVGVKKALVFYGGKPPKGVKTNWIMHEYRLADN  146

Query  888   KTSNKPPGLDIANRSKGGSLRLDDWVLCRIYKKNNSQRPLDHESDDLN-DMLQG--SIPP  718
             KT+NKPPG D+AN+    SLRLDDWVLCRIYKKNN+QRP+DHE DDLN DM+ G  SI P
Sbjct  147   KTNNKPPGCDLANKK---SLRLDDWVLCRIYKKNNTQRPIDHERDDLNIDMMMGSSSIHP  203

Query  717   FVTHQKMG------------LKPSNYGALLQTDhhhhhhHMFDQGLVPGDASLGGARTAQ  574
                   M             LK SN+G  L  D +       DQ L  G +         
Sbjct  204   SCIPNSMSMPNIFGQPKIPQLKSSNFGTTLIHDQN-------DQNLYEGGSQYS------  250

Query  573   LPFVPSTPNLLPTKRSLPGLFWNVDDSSANNHHPADASPPTKRFLADNNEASI---SRSD  403
                         +KR L  L+WN  D  A+N    D S  TKRFL +N E  +   +R+D
Sbjct  251   ------------SKRPLANLYWNDQDGGASN----DNSQSTKRFLTENMEDGLNMNARAD  294

Query  402   EQNGSIATLLSHLPQTPSLHQQTMLGALNDGVFRQPYQVSGINWY  268
             EQNGSI +LLS         QQ +LG+L++GVFRQPY  SG+NWY
Sbjct  295   EQNGSIVSLLS---------QQQVLGSLSEGVFRQPY--SGMNWY  328



>ref|XP_003540450.1| PREDICTED: NAC domain-containing protein 18-like [Glycine max]
 gb|KHN28035.1| NAC domain-containing protein 18 [Glycine soja]
Length=375

 Score =   366 bits (940),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 211/360 (59%), Positives = 258/360 (72%), Gaps = 42/360 (12%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EELVVHYLKKK ASAP+PVAIIAEVDLYKFDPWELPAKA FGEQEWYFF+PRDRKYPNGA
Sbjct  26    EELVVHYLKKKTASAPLPVAIIAEVDLYKFDPWELPAKAAFGEQEWYFFTPRDRKYPNGA  85

Query  1068  RPNRAATSGYWKATGTDKPVLTAGGTQKVGVKKALVFYGGKPPKGVKTNWIMHEYRLADN  889
             RPNRAATSGYWKATGTDKPVLT+GGTQKVGVKKALVFYGGKPP+G+KTNWIMHEYRLADN
Sbjct  86    RPNRAATSGYWKATGTDKPVLTSGGTQKVGVKKALVFYGGKPPRGIKTNWIMHEYRLADN  145

Query  888   KTSNK-PPGLDIANRSKGGSLRLDDWVLCRIYKKNNSQR-PLDHESDDLNDMLQGSIPPF  715
             K +N+ PPG D+ N  K  +LRLDDWVLCRIYKK+N+ R P++HE +D  D + G IPP 
Sbjct  146   KPNNRPPPGCDLGN--KKNTLRLDDWVLCRIYKKSNTHRSPMEHEREDSMDDMIGGIPPS  203

Query  714   VTHQKMGLK---------PSNYGALLQTDhhhhhhHMF---DQGL--------VPGDAS-  598
             +    M  +           N GA+L+ +H+     M    + G+         PG  S 
Sbjct  204   INVGHMSARFHHLSKMTTAYNSGAMLENEHNLLEGMMIGNNNGGMNTTTTATTTPGAMSS  263

Query  597   -LGGARTAQLPFVPS-TPNLLPTKRSLPGLFWNVDDSSANNHHPADASPPTKRFLAD---  433
              LGG++ A+L FVP+ T +   +KR+L  L+WN +D +         S   +RF  +   
Sbjct  264   HLGGSK-AELSFVPTMTHSSNTSKRTLSSLYWNDEDVTG-------TSSSNRRFNLESGD  315

Query  432   -NNEASISRSDEQNG---SIATLLSHLPQTPSLHQQTMLGALNDGVFRQPYQVSGINWYS  265
              NN  S+ R+D++NG   SIATLL+ LPQTPSLHQQ+MLG++ DG+ R  YQ+ G+NWY+
Sbjct  316   NNNHGSVVRADQENGTASSIATLLNQLPQTPSLHQQSMLGSIGDGLLRTTYQIPGMNWYA  375



>ref|XP_006370307.1| no apical meristem family protein [Populus trichocarpa]
 gb|ERP66876.1| no apical meristem family protein [Populus trichocarpa]
Length=360

 Score =   365 bits (936),  Expect = 9e-120, Method: Compositional matrix adjust.
 Identities = 211/337 (63%), Positives = 244/337 (72%), Gaps = 24/337 (7%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EELVVHYLKKK  SAP+PVAIIAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA
Sbjct  39    EELVVHYLKKKTTSAPLPVAIIAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  98

Query  1068  RPNRAATSGYWKATGTDKPVLTAGGTQKVGVKKALVFYGGKPPKGVKTNWIMHEYRLADN  889
             RPNRAATSGYWKATGTDKPVL++GGTQKVGVKKALVFYGGKPPKG+KTNWIMHEYRLADN
Sbjct  99    RPNRAATSGYWKATGTDKPVLSSGGTQKVGVKKALVFYGGKPPKGIKTNWIMHEYRLADN  158

Query  888   KTSNKPPGLDIANRSKGGSLRLDDWVLCRIYKKNNSQRPLDHESDDLNDMLQGSIPPFV-  712
             K +NKPPG D+ N  K  SLRLDDWVLCRIYKKNN+QRP+DH+ DD  D + GSIPP + 
Sbjct  159   KVNNKPPGCDLGN--KKNSLRLDDWVLCRIYKKNNTQRPMDHDKDDSMDDVLGSIPPSIS  216

Query  711   --THQKMGL---KPSNYGALLQTDhhhhhhHMFDQGLVPGDASLGGARTAQLPFVPSTPN  547
               +HQ   L   K +N+GALL  D     H++F+  +   D     + +        T  
Sbjct  217   VGSHQNGTLHLAKGTNFGALLDND-----HNLFEGIISSSDGIRSSSSSLSHMASSVTKR  271

Query  546   ---LLPTKRSLPGLFWNVDDSSANNHHPADASPPTKRFLADNNEASISRSDEQNGSIATL  376
                +LP KR+LP L+W  +D    +         +KRF    N   I    + N S+ATL
Sbjct  272   DLLMLPPKRTLPSLYWTGEDMVGPSS--------SKRFQGGINGDEIVVRTDGNSSVATL  323

Query  375   LSHLPQTPSLHQQTMLGALNDGVFRQPYQVSGINWYS  265
             L  LPQTP LHQQTMLG++ DG+FR PYQ+  +NWYS
Sbjct  324   LGELPQTPQLHQQTMLGSMADGIFRSPYQIPSMNWYS  360



>gb|KHN36793.1| NAC domain-containing protein 18 [Glycine soja]
Length=375

 Score =   364 bits (934),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 212/360 (59%), Positives = 256/360 (71%), Gaps = 42/360 (12%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EELVVHYLKKK ASAP+PVAIIAEVDLYKFDPWELPAKA FGEQEWYFF+PRDRKYPNGA
Sbjct  26    EELVVHYLKKKAASAPLPVAIIAEVDLYKFDPWELPAKAAFGEQEWYFFTPRDRKYPNGA  85

Query  1068  RPNRAATSGYWKATGTDKPVLTAGGTQKVGVKKALVFYGGKPPKGVKTNWIMHEYRLADN  889
             RPNRAATSGYWKATGTDKPVLT+GGTQKVGVKKALVFYGGKPP+G+KTNWIMHEYRLADN
Sbjct  86    RPNRAATSGYWKATGTDKPVLTSGGTQKVGVKKALVFYGGKPPRGIKTNWIMHEYRLADN  145

Query  888   KTSNK-PPGLDIANRSKGGSLRLDDWVLCRIYKKNNSQR-PLDHESDDLNDMLQGSIPPF  715
             K +N+ PPG D+ N  K  +LRLDDWVLCRIYKK+N+ R P++HE +D  D + G IPP 
Sbjct  146   KPNNRPPPGCDLGN--KKNTLRLDDWVLCRIYKKSNTHRSPMEHEREDSMDDMIGGIPPS  203

Query  714   VTHQKMGLK---------PSNYGALLQTDhhhhhhHMF----DQGLV--------PGDAS  598
             +    M  +           N GALL+ DHH+    M     + G+         P  + 
Sbjct  204   INVGHMSARFHHLSKMTTAYNNGALLENDHHNLLEGMMIGNSNGGMNTTTTTTPGPMSSH  263

Query  597   LGGARTAQLPFVPS-TPNLLPTKRSLPGLFWNVDDSSANNHHPADASPPTKRFLAD----  433
             LGG++  +L FVP+ T +   +KR+L  L+WN +D        A  S   KRF  +    
Sbjct  264   LGGSK-EELSFVPTMTHSSNTSKRTLSSLYWNDEDV-------AGTSSSNKRFNLELSGD  315

Query  432   -NNEASISRSDEQNG---SIATLLSHLPQTPSLHQQTMLGALNDGVFRQPYQVSGINWYS  265
              NN  S+ R D++NG   SIATLL+ LPQTPSLHQQ++LG++ DG+ R  YQ+ G+NWY+
Sbjct  316   NNNHGSVVRDDQENGTASSIATLLNQLPQTPSLHQQSILGSIGDGLLRTTYQIPGMNWYA  375



>ref|XP_011029435.1| PREDICTED: NAC domain-containing protein 18-like [Populus euphratica]
Length=355

 Score =   362 bits (930),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 209/337 (62%), Positives = 241/337 (72%), Gaps = 24/337 (7%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EELVVHYLKKK  SAP+P+AIIAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNG 
Sbjct  34    EELVVHYLKKKTTSAPLPMAIIAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGT  93

Query  1068  RPNRAATSGYWKATGTDKPVLTAGGTQKVGVKKALVFYGGKPPKGVKTNWIMHEYRLADN  889
             RPNRAATSGYWKATGTDKP+LT GGTQKVGVKKALVFYGGKPPKG+KTNWIMHEYRLADN
Sbjct  94    RPNRAATSGYWKATGTDKPILTLGGTQKVGVKKALVFYGGKPPKGIKTNWIMHEYRLADN  153

Query  888   KTSNKPPGLDIANRSKGGSLRLDDWVLCRIYKKNNSQRPLDHESDDLNDMLQGSIPPFV-  712
             K  NKPPG D+ N  K  SLRLDDWVLCRIYKKNN+ RP+DH+ DD  D + GSIPP + 
Sbjct  154   KVKNKPPGCDLGN--KKNSLRLDDWVLCRIYKKNNTHRPIDHDRDDSMDDILGSIPPSIL  211

Query  711   --THQKMGL---KPSNYGALLQTDhhhhhhHMFDQGLVPGDASLGGARTAQLPFVPSTPN  547
                HQ   L   K +NY  LL  D     H++F+  +   D     +  + +    S P+
Sbjct  212   VGNHQNGTLHLAKGTNYETLLDND-----HNLFEGTISSNDGIRSSSSMSHVASTVSKPD  266

Query  546   ---LLPTKRSLPGLFWNVDDSSANNHHPADASPPTKRFLADNNEASISRSDEQNGSIATL  376
                 LP KR+LP L+W  +D +     P+ +    KRF  D N       +  NGSI T 
Sbjct  267   HLPRLPLKRTLPSLYWTGEDMAV----PSSS----KRFQGDINGDESVVGNGGNGSIVTP  318

Query  375   LSHLPQTPSLHQQTMLGALNDGVFRQPYQVSGINWYS  265
             LS LPQT  LHQQTMLG++ +G+FR PYQ+ G+NWYS
Sbjct  319   LSQLPQTSQLHQQTMLGSMGNGIFRPPYQIPGLNWYS  355



>ref|XP_006362947.1| PREDICTED: NAC transcription factor 25-like [Solanum tuberosum]
Length=351

 Score =   362 bits (928),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 210/344 (61%), Positives = 251/344 (73%), Gaps = 35/344 (10%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EELVVHYLKK+VA API V IIAE+DLYKFDPWELPAKA FGEQEWYFFSPRDRKYPNGA
Sbjct  27    EELVVHYLKKRVAGAPISVDIIAEIDLYKFDPWELPAKAIFGEQEWYFFSPRDRKYPNGA  86

Query  1068  RPNRAATSGYWKATGTDKPVLTAGGTQKVGVKKALVFYGGKPPKGVKTNWIMHEYRLADN  889
             RPNRAATSGYWKATGTDKP+ T+GGTQKVGVKKALVFYGGKPPKGVKTNWIMHEYR+ +N
Sbjct  87    RPNRAATSGYWKATGTDKPIFTSGGTQKVGVKKALVFYGGKPPKGVKTNWIMHEYRVVEN  146

Query  888   KTSNKPPGLDIANRSKGGSLRLDDWVLCRIYKKNNSQRPLDHESDDLNDMLQGSIPPFVT  709
             KT+NKPPG D    +K GSLRLDDWVLCRIYKKNN+QR +    DDLNDML GSIP  V 
Sbjct  147   KTNNKPPGCDHIVANKKGSLRLDDWVLCRIYKKNNTQRSI----DDLNDML-GSIPQNVP  201

Query  708   HQKM-GLKPSNYGALLQTDhhhhhhHMFDQGLVPGDASLGGARTAQLPFVPSTPNLLPTK  532
             +  + G+KPSNYG +L  +      +M+D G++     +       +P          +K
Sbjct  202   NSILQGVKPSNYGTILLEN----ESNMYD-GIMNNTNDMINNNNRSIP-------QFSSK  249

Query  531   RSLP-GLFWNVDDSSANNHHPADASPPTKRFLADNNE------ASISR--SDEQNGSIAT  379
             RS+  GL+WN+D+++       + SP TKRFL +NN        +I+R  + EQ+ SIA 
Sbjct  250   RSMHGGLYWNIDETTTTTE--GNHSPNTKRFLVENNRDDGLNMNNIARITNHEQSSSIAN  307

Query  378   LLSHLPQTPSL----HQQTMLGALNDG-VFRQPY-QVSGINWYS  265
              LSH PQ  S+     +Q +LG+L+DG VFRQPY QV+G+NWYS
Sbjct  308   FLSHFPQNTSIQQEQQEQQVLGSLSDGVVFRQPYNQVTGMNWYS  351



>ref|XP_002316919.2| no apical meristem family protein [Populus trichocarpa]
 gb|EEE97531.2| no apical meristem family protein [Populus trichocarpa]
Length=355

 Score =   360 bits (925),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 208/337 (62%), Positives = 242/337 (72%), Gaps = 24/337 (7%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EELVVHYLKKK  SAP+P+AIIAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNG 
Sbjct  34    EELVVHYLKKKTTSAPLPMAIIAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGT  93

Query  1068  RPNRAATSGYWKATGTDKPVLTAGGTQKVGVKKALVFYGGKPPKGVKTNWIMHEYRLADN  889
             RPNRAATSGYWKATGTDKP+LT GGTQKVGVKKALVFYGGKPPKG+KTNWIMHEYRLADN
Sbjct  94    RPNRAATSGYWKATGTDKPILTLGGTQKVGVKKALVFYGGKPPKGIKTNWIMHEYRLADN  153

Query  888   KTSNKPPGLDIANRSKGGSLRLDDWVLCRIYKKNNSQRPLDHESDDLNDMLQGSIPPFV-  712
             K  NKPPG D+ N  K  SLRLDDWVLCRIYKKNN+ RP+DH+ DD  D + GSIPP + 
Sbjct  154   KVKNKPPGCDLGN--KKNSLRLDDWVLCRIYKKNNTHRPIDHDKDDYMDDILGSIPPSIL  211

Query  711   --THQKMGL---KPSNYGALLQTDhhhhhhHMFDQGLVPGDASLGGARTAQLPFVPSTPN  547
                HQ   L   K +NY  LL  D     H++F+  +   D     +  + +    S P+
Sbjct  212   VGNHQNGTLHLAKGTNYETLLDND-----HNLFEGIISSNDGIRSSSSMSHVASSVSKPD  266

Query  546   ---LLPTKRSLPGLFWNVDDSSANNHHPADASPPTKRFLADNNEASISRSDEQNGSIATL  376
                +LP KR+LP L+W  +D +     P+ +    KRF  D N       ++ N SI TL
Sbjct  267   HLPMLPLKRTLPSLYWTDEDMAV----PSSS----KRFQGDINGDESVVGNDGNSSIVTL  318

Query  375   LSHLPQTPSLHQQTMLGALNDGVFRQPYQVSGINWYS  265
             LS LPQT  LHQ TMLG++ +G+FR PYQ+ G+NWYS
Sbjct  319   LSQLPQTSQLHQHTMLGSMGNGIFRPPYQIPGMNWYS  355



>ref|XP_003543257.1| PREDICTED: NAC domain-containing protein 18 [Glycine max]
Length=375

 Score =   361 bits (926),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 210/360 (58%), Positives = 255/360 (71%), Gaps = 42/360 (12%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EELVVHYLKKK ASAP+PVAIIAEVDLYKFDPWELPAKA FGEQEWYFF+PRDRKYPNGA
Sbjct  26    EELVVHYLKKKAASAPLPVAIIAEVDLYKFDPWELPAKAAFGEQEWYFFTPRDRKYPNGA  85

Query  1068  RPNRAATSGYWKATGTDKPVLTAGGTQKVGVKKALVFYGGKPPKGVKTNWIMHEYRLADN  889
             RPNRAATSGYWKATGTDKPVLT+GGTQKVGVKKALVFYGGKPP+G+KTNWIMHEYRL DN
Sbjct  86    RPNRAATSGYWKATGTDKPVLTSGGTQKVGVKKALVFYGGKPPRGIKTNWIMHEYRLTDN  145

Query  888   KTSNK-PPGLDIANRSKGGSLRLDDWVLCRIYKKNNSQR-PLDHESDDLNDMLQGSIPPF  715
             K +N+ PPG D+ N  K  +LRLDDWVLCRIYKK+N+ R P++H+ +D  D + G IPP 
Sbjct  146   KPNNRPPPGCDLGN--KKNTLRLDDWVLCRIYKKSNTHRSPMEHDREDSMDDMIGGIPPS  203

Query  714   VTHQKMGLK---------PSNYGALLQTDhhhhhhHMF----DQGLV--------PGDAS  598
             +    M  +           N GALL+ DHH+    M     + G+         P  + 
Sbjct  204   INVGHMSARFHHLSKMTTAYNNGALLENDHHNLLEGMMIGNSNGGMNTTTTTTPGPMSSH  263

Query  597   LGGARTAQLPFVPS-TPNLLPTKRSLPGLFWNVDDSSANNHHPADASPPTKRFLAD----  433
             LGG++  +L FVP+ T +   +KR+L  L+WN +D        A  S   KRF  +    
Sbjct  264   LGGSK-EELSFVPTMTHSSNTSKRTLSSLYWNDEDV-------AGTSSSNKRFNLELSGD  315

Query  432   -NNEASISRSDEQNG---SIATLLSHLPQTPSLHQQTMLGALNDGVFRQPYQVSGINWYS  265
              NN  S+ R D++NG   SIATLL+ LPQTPSLHQQ++LG++ DG+ R  YQ+ G+NWY+
Sbjct  316   NNNHGSVVRDDQENGTASSIATLLNQLPQTPSLHQQSILGSIGDGLLRTTYQIPGMNWYA  375



>ref|XP_011042501.1| PREDICTED: NAC domain-containing protein 18-like [Populus euphratica]
Length=358

 Score =   358 bits (920),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 209/342 (61%), Positives = 240/342 (70%), Gaps = 34/342 (10%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EELVVHYLKKK  SAP+PVAIIAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA
Sbjct  37    EELVVHYLKKKTTSAPLPVAIIAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  96

Query  1068  RPNRAATSGYWKATGTDKPVLTAGGTQKVGVKKALVFYGGKPPKGVKTNWIMHEYRLADN  889
             RPNRAATSGYWKATGTDKPVL++GGTQKVGVKKALVFYGGKPPKG+KTNWIMHEYRLADN
Sbjct  97    RPNRAATSGYWKATGTDKPVLSSGGTQKVGVKKALVFYGGKPPKGIKTNWIMHEYRLADN  156

Query  888   KTSNKPPGLDIANRSKGGSLRLDDWVLCRIYKKNNSQRPLDHESDDLNDMLQGSIPPFV-  712
             K +NKPPG D+ N  K  SLRLDDWVLCRIYKKNN+Q+P+DH+ DD  D + GS PP + 
Sbjct  157   KVNNKPPGYDLGN--KKNSLRLDDWVLCRIYKKNNTQKPMDHDKDDSMDDVLGSTPPSIS  214

Query  711   --THQKMGL---KPSNYGALLQTDhhhhhhHMFDQGLVPGDASLGGARTAQLPFVPSTPN  547
               +HQ   L   K +N+GALL            DQ L  G  S      +    +    +
Sbjct  215   VGSHQNGTLHLAKGTNFGALLDN----------DQNLFEGIISSSDGIRSSSSSLSHMAS  264

Query  546   --------LLPTKRSLPGLFWNVDDSSANNHHPADASPPTKRFLADNNEASISRSDEQNG  391
                     +LP KR+LP L+W  +D    +         +KRF    N   I    + N 
Sbjct  265   SVSKRDLLMLPPKRALPSLYWTGEDIIGPSS--------SKRFQGGINGDEIVVRTDGNS  316

Query  390   SIATLLSHLPQTPSLHQQTMLGALNDGVFRQPYQVSGINWYS  265
             S+ATLL  LPQTP LHQQTMLG++ DG+FR PYQ+  +NWYS
Sbjct  317   SVATLLGELPQTPQLHQQTMLGSMADGIFRPPYQIPSMNWYS  358



>gb|AEQ28762.1| NAC domain class transcription factor [Prunus salicina]
Length=358

 Score =   358 bits (920),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 210/343 (61%), Positives = 243/343 (71%), Gaps = 40/343 (12%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EELVVHYLKKKV SAP+PVAIIAEV+LYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA
Sbjct  36    EELVVHYLKKKVTSAPLPVAIIAEVELYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  95

Query  1068  RPNRAATSGYWKATGTDKPVLTAGGTQKVGVKKALVFYGGKPPKGVKTNWIMHEYRLADN  889
             RPNRAATSGYWKATGTDKPVLT+GGTQKVGVKKALVFYGGKPPKG+KTNWIMHEYRLADN
Sbjct  96    RPNRAATSGYWKATGTDKPVLTSGGTQKVGVKKALVFYGGKPPKGIKTNWIMHEYRLADN  155

Query  888   KTSNKPPGLDIANRSKGGSLRLDDWVLCRIYKKNNSQRPLDHESDD-LNDMLQGSIPPFV  712
             KTSNKPPG D+ N  K  SLRLDDWVLCRIYKKNNS RP+D E +D + DM+   +PP +
Sbjct  156   KTSNKPPGCDLGN--KKNSLRLDDWVLCRIYKKNNSHRPMDLEREDSMEDMMGPLMPPSI  213

Query  711   T----HQKMGL----KPSNYG-ALLQTDhhhhhhHMFDQGLVPGDASLGGARTAQLPFVP  559
             +    HQ M L      +NYG   ++ D       M       G ASL    T+QLP   
Sbjct  214   SHVGHHQNMNLHLPNSNTNYGPPFIENDQIIFDGIMSS---TDGSASLSNG-TSQLPL--  267

Query  558   STPNLLPTKRSL-PGLFWNVDDSSANNHHPADASPPTKRFLA----DNNEASISRSDEQN  394
                     KRS+ P L+WN   + A++         +KR +     D+   +   ++  +
Sbjct  268   --------KRSIVPSLYWNDRTAGASS---------SKRVVQLHQLDSGTNNSVAANNNS  310

Query  393   GSIATLLSHLPQTPSLHQQTMLGALNDGVFRQPYQVSGINWYS  265
              SIA LLS LPQTP LHQ  MLG+L DG+FR PYQ+ G+NW+S
Sbjct  311   TSIANLLSQLPQTPPLHQHAMLGSLGDGLFRTPYQLPGMNWFS  353



>ref|XP_010060527.1| PREDICTED: NAC domain-containing protein 18-like [Eucalyptus 
grandis]
 gb|KCW67303.1| hypothetical protein EUGRSUZ_F01091 [Eucalyptus grandis]
Length=366

 Score =   358 bits (920),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 204/347 (59%), Positives = 249/347 (72%), Gaps = 26/347 (7%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EELVVHYLKKK AS+P+PV++IAEVD+YKFDPWELPAKAT+GEQEWYFF+PRDRKYPNGA
Sbjct  27    EELVVHYLKKKAASSPLPVSVIAEVDIYKFDPWELPAKATYGEQEWYFFTPRDRKYPNGA  86

Query  1068  RPNRAATSGYWKATGTDKPVLTAGGTQKVGVKKALVFYGGKPPKGVKTNWIMHEYRLADN  889
             RPNRAATSGYWKATGTDKPVL+A G QKVGVKKALVFYGGKPPKGVKTNWIMHEYRL +N
Sbjct  87    RPNRAATSGYWKATGTDKPVLSAVGHQKVGVKKALVFYGGKPPKGVKTNWIMHEYRLIEN  146

Query  888   KTSNKPPGLDIANRSKGGSLRLDDWVLCRIYKKNNSQRPLDHESDD-LNDMLQGSIPPFV  712
             K SN+PPG D+ N  K  SLRLDDWVLCRIYKK+N  RP+DHE DD ++DML+ SIPP +
Sbjct  147   KVSNRPPGCDVGN--KKNSLRLDDWVLCRIYKKSNVHRPMDHERDDSMDDMLE-SIPPSL  203

Query  711   THQKMGLK-------PSNYGALLQTDhhhhhhHMFDQ--GLVPGD-----ASLGGARTAQ  574
             T    G+K        ++YG L + + +     M     G +PG+     AS  G +  +
Sbjct  204   TMNPHGMKLHLSKPSTTSYGVLFEHEQNLFEGMMGANGGGCIPGNVMSHLASSSGLK-PE  262

Query  573   LPFV--PSTPNLLPTKRSLPGLFWNVDDSSANNHHPADASPPTKRFLADNNE-ASISR-S  406
             L  V  P+  + LP KR+L  L+WN  D +A     +D S   ++F AD N+  S+ R +
Sbjct  263   LAMVQAPNISSPLPLKRTLHSLYWNDKDVAAET---SDPSSVKRQFSADRNDPGSVERNT  319

Query  405   DEQNGSIATLLSHLPQTPSLHQQTMLGALNDGVFRQPYQVSGINWYS  265
             +    SIA+LL  +PQTP LHQQT  G L DG FR  + + G+NWY+
Sbjct  320   NGGTSSIASLLGQIPQTPPLHQQTAYGPLGDGGFRPQFHMPGLNWYA  366



>gb|AHJ79194.1| NAC domain protein NAC53 [Gossypium hirsutum]
Length=335

 Score =   357 bits (915),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 214/338 (63%), Positives = 254/338 (75%), Gaps = 38/338 (11%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EELVVHYLKKK +SAP+PVAIIAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA
Sbjct  26    EELVVHYLKKKASSAPLPVAIIAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  85

Query  1068  RPNRAATSGYWKATGTDKPVLTAGGTQKVGVKKALVFYGGKPPKGVKTNWIMHEYRLADN  889
             RPNRAATSGYWKATGTDKPVLT+GGTQKVGVKKALVFYGGKPPKG+KTNWIMHEYRLADN
Sbjct  86    RPNRAATSGYWKATGTDKPVLTSGGTQKVGVKKALVFYGGKPPKGIKTNWIMHEYRLADN  145

Query  888   KTSNKPPGLDIANRSKGGSLRLDDWVLCRIYKKNNSQRPLDHESDDLNDMLQGSIPPFVT  709
             KT+NKPPG D+ N  K  SLRLDDWVLCRIYKKNN+ RPL+H+ DD  D + G++PP ++
Sbjct  146   KTNNKPPGCDLGN--KKNSLRLDDWVLCRIYKKNNANRPLEHDKDDSMDDMLGTVPPSIS  203

Query  708   ----HQ---KMGLKPSNYGALLQTDhhhhhhHMFDQGLVPGDASLGGARTAQLPFVPSTP  550
                 H        K +++G LL+   H  H+ +FD G++  D    G  +A +       
Sbjct  204   IGSQHNPKFHFSTKGTSFGTLLE---HQEHNSLFD-GMMGSD----GINSASM-------  248

Query  549   NLLPTKRSLPGLFWNVDDSSANNHHPADASPPT-KRFLADNNEASISRSDEQNGSIATLL  373
              + P KR+LP L+W  D++         A P T KRF  D+N+ S+ ++D  NGSIATLL
Sbjct  249   -VNPLKRTLPSLYWTDDET---------AGPSTSKRFHGDSNDGSMEKTD-GNGSIATLL  297

Query  372   SHLPQTPSLHQQ--TMLGALNDGVFRQPYQVSGINWYS  265
             S LPQTP L QQ   MLG++ DG+FR P+Q+ G+NWYS
Sbjct  298   SQLPQTPPLQQQQAAMLGSMGDGIFRPPHQLPGLNWYS  335



>ref|XP_009609295.1| PREDICTED: NAC transcription factor 25-like [Nicotiana tomentosiformis]
Length=329

 Score =   356 bits (914),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 206/337 (61%), Positives = 238/337 (71%), Gaps = 50/337 (15%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EELVVHYLKKK AS P+PV IIAEVDLYKFDPWELPAKA FGEQEWYFFSPRDRKYPNGA
Sbjct  34    EELVVHYLKKKAASVPLPVDIIAEVDLYKFDPWELPAKANFGEQEWYFFSPRDRKYPNGA  93

Query  1068  RPNRAATSGYWKATGTDKPVLTAGGTQKVGVKKALVFYGGKPPKGVKTNWIMHEYRLADN  889
             RPNRAATSGYWKATGTDKPVLTAGG QKVGVKKALVFYGGKPPKGVKTNWIMHEYR+ +N
Sbjct  94    RPNRAATSGYWKATGTDKPVLTAGGNQKVGVKKALVFYGGKPPKGVKTNWIMHEYRITEN  153

Query  888   KTSNKPPGLDIANRSKGGSLRLDDWVLCRIYKKNNSQRPLD-HESDDLNDMLQGSIPPFV  712
             KT+NKPPG DIANR   GSLRLDDWVLCRIYKKNN+QRP+D HE DD+NDM+  SIP  +
Sbjct  154   KTNNKPPGCDIANRK--GSLRLDDWVLCRIYKKNNTQRPIDHHERDDMNDMMGSSIPTCI  211

Query  711   THQKMGLKPSNYGALLQTDhhhhhhHMFDQGLVPGDASLGGARTAQLPFVPSTPNLLPTK  532
                   + P                  F+Q +  G  +   +          + ++LP K
Sbjct  212   A---TSISP------------------FEQNMYEGIINNNTSNMINNNVGSISSSVLPPK  250

Query  531   RSLP-GLFWNVDDSSANNHHPADASPPTKRFLADNN-----EASISRSDEQNGSIATLLS  370
             + LP GL+WN D ++        +SP  KRFLA+N+       +I+R DEQN    + LS
Sbjct  251   QPLPAGLYWNEDHNT--------SSPSAKRFLAENSLDDELNMNITRPDEQN----SFLS  298

Query  369   HLPQTPSLHQQTMLGALNDG-VFRQPY-QVSGINWYS  265
              LP      Q  +LG+L+DG VFRQPY QV+G+NWYS
Sbjct  299   QLP------QNQVLGSLSDGVVFRQPYNQVTGMNWYS  329



>ref|XP_008226677.1| PREDICTED: NAC transcription factor 25 [Prunus mume]
Length=371

 Score =   358 bits (918),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 214/349 (61%), Positives = 245/349 (70%), Gaps = 42/349 (12%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EELVVHYLKKKV SAP+PVAIIAEV+LYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA
Sbjct  39    EELVVHYLKKKVTSAPLPVAIIAEVELYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  98

Query  1068  RPNRAATSGYWKATGTDKPVLTAGGTQKVGVKKALVFYGGKPPKGVKTNWIMHEYRLADN  889
             RPNRAATSGYWKATGTDKPVLT+GGTQKVGVKKALVFYGGKPPKG+KTNWIMHEYRLADN
Sbjct  99    RPNRAATSGYWKATGTDKPVLTSGGTQKVGVKKALVFYGGKPPKGIKTNWIMHEYRLADN  158

Query  888   KTSNKPPGLDIANRSKGGSLRLDDWVLCRIYKKNNSQRPLDHESDD-LNDMLQGSIPPFV  712
             KTSNKPPG D+ N  K  SLRLDDWVLCRIYKKNNS RP+D E +D + DM+   + P +
Sbjct  159   KTSNKPPGCDLGN--KKNSLRLDDWVLCRIYKKNNSHRPMDLEREDSMEDMMGPLMLPSI  216

Query  711   T----HQKMGL----KPSNYG-ALLQTDhhhhhhHMFDQGLVP---GDASLGGARTAQLP  568
             +    HQ M L      +NYG   ++ D       +F  G++    G ASL    T+QLP
Sbjct  217   SHVGHHQNMNLHLPKSDTNYGPPFIEND------PIFFDGIMSSTNGSASLSNG-TSQLP  269

Query  567   FVPSTPNLLPTKRSL-PGLFWNVDDSSANNHHPADASPPTKRFLADNNEASISRSDEQNG  391
                        KRS+ P  +WN  D   N    A +S    +    ++  + S SD  NG
Sbjct  270   L----------KRSIVPSFYWN--DQDDNQTAGASSSKRVVQLHQLDSGTNNSASDGING  317

Query  390   -------SIATLLSHLPQTPSLHQQTMLGALNDGVFRQPYQVSGINWYS  265
                    SIA LLS LPQTP LHQ  MLG+L DG+FR PYQ+ G+NW+S
Sbjct  318   APNNNSTSIANLLSQLPQTPPLHQHAMLGSLGDGLFRTPYQLPGMNWFS  366



>ref|XP_007211475.1| hypothetical protein PRUPE_ppa007577mg [Prunus persica]
 gb|EMJ12674.1| hypothetical protein PRUPE_ppa007577mg [Prunus persica]
Length=363

 Score =   357 bits (915),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 210/345 (61%), Positives = 244/345 (71%), Gaps = 40/345 (12%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EELVVHYLKKKV SAP+PVAIIAE++LYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA
Sbjct  37    EELVVHYLKKKVTSAPLPVAIIAEIELYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  96

Query  1068  RPNRAATSGYWKATGTDKPVLTAGGTQKVGVKKALVFYGGKPPKGVKTNWIMHEYRLADN  889
             RPNRAATSGYWKATGTDKPVLT+GGTQKVGVKKALVFYGGKPPKG+KTNWIMHEYRLAD+
Sbjct  97    RPNRAATSGYWKATGTDKPVLTSGGTQKVGVKKALVFYGGKPPKGIKTNWIMHEYRLADS  156

Query  888   KTSNKPPGLDIANRSKGGSLRLDDWVLCRIYKKNNSQRPLDHESDD-LNDMLQGSIPPFV  712
             KTSNKPPG D+ N  K  SLRLDDWVLCRIYKKNNS RP+D E +D + DM+   +PP +
Sbjct  157   KTSNKPPGCDLGN--KKNSLRLDDWVLCRIYKKNNSHRPMDLEREDSMEDMMGPLMPPSI  214

Query  711   T----HQKMGL----KPSNYG-ALLQTDhhhhhhHMFDQGLVPGDASLGGARTAQLPFVP  559
             +    HQ M L      +NYG   ++ D       M       G ASL    T+QLP   
Sbjct  215   SHVGHHQNMNLHLPKSNTNYGPPFIENDQIIFDGIMSS---TDGSASLSNG-TSQLPL--  268

Query  558   STPNLLPTKRSL-PGLFWN--VDDSSANNHHPADASPPTKRFLA----DNNEASISRSDE  400
                     KRS+ P L+WN   DD +A        +  +KR +     D+   +   ++ 
Sbjct  269   --------KRSIVPSLYWNDQEDDQTA-------GASSSKRVVQLHQLDSGTNNSVAANN  313

Query  399   QNGSIATLLSHLPQTPSLHQQTMLGALNDGVFRQPYQVSGINWYS  265
              + SIA LLS LPQTP LHQ  MLG+L DG+FR PYQ+ G+NW+S
Sbjct  314   NSTSIANLLSQLPQTPPLHQHAMLGSLGDGLFRTPYQLPGMNWFS  358



>gb|KEH38791.1| NAC transcription factor-like protein [Medicago truncatula]
Length=354

 Score =   354 bits (909),  Expect = 8e-116, Method: Compositional matrix adjust.
 Identities = 207/350 (59%), Positives = 252/350 (72%), Gaps = 45/350 (13%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EELVVHYLKKK ASAP+PVAIIAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA
Sbjct  26    EELVVHYLKKKAASAPLPVAIIAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  85

Query  1068  RPNRAATSGYWKATGTDKPVLTAGGTQKVGVKKALVFYGGKPPKGVKTNWIMHEYRLADN  889
             RPNRAATSGYWKATGTDKPVLT+GGTQKVGVKKALVFYGGKPP+G+KTNWIMHEYRLADN
Sbjct  86    RPNRAATSGYWKATGTDKPVLTSGGTQKVGVKKALVFYGGKPPRGIKTNWIMHEYRLADN  145

Query  888   KTSNKPPGLDIANRSKGGSLRLDDWVLCRIYKKNNSQR-PLDHESDDLNDMLQGSIPPFV  712
             K +N+PPG D+ N  K  SLRLDDWVLCRIYKK+N+ R P++H+ +D  D + G +PP +
Sbjct  146   KPNNRPPGCDLGN--KKNSLRLDDWVLCRIYKKSNTHRSPVEHDREDSMDDMIGGVPPSI  203

Query  711   THQKMG----------LKPSNY-GALLQTDhhhhhhHMFDQGLVPGDASLGGART-AQLP  568
                +M           L  +NY  ALL+ D +     M +      + +LGG+ + A+L 
Sbjct  204   NVGQMSVASRFHNFSRLSSNNYNNALLENDQNLLEGMMMNN-----NNTLGGSNSKAELS  258

Query  567   FVP----STPNLLPTKRSLPGLF-WNVDDSSANNHHPADASPPTKRFLADNNEASISRSD  403
             FVP    S+    P+KR+L  L+ WN +D +A        S   KRF  +N    + R+D
Sbjct  259   FVPTMTTSSNANSPSKRTLSSLYNWNDEDVAAQ----VGTSSSNKRFSLEN----VVRND  310

Query  402   EQNGSIAT----LLSHLPQTPSLHQ-QTMLGALNDGVFRQPYQVSGINWY  268
             ++NG++AT    LL++LPQT SLHQ QTMLG++       PYQ+ G+NWY
Sbjct  311   QENGTVATSFASLLNNLPQTSSLHQPQTMLGSI-------PYQIQGMNWY  353



>ref|XP_009759753.1| PREDICTED: NAC transcription factor 25-like [Nicotiana sylvestris]
Length=330

 Score =   353 bits (906),  Expect = 9e-116, Method: Compositional matrix adjust.
 Identities = 208/338 (62%), Positives = 241/338 (71%), Gaps = 51/338 (15%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EELVVHYLKKK ASAP+PV IIAEVDLYKFDPWELPAKA FGEQEWYFFSPRDRKYPNGA
Sbjct  34    EELVVHYLKKKSASAPLPVDIIAEVDLYKFDPWELPAKANFGEQEWYFFSPRDRKYPNGA  93

Query  1068  RPNRAATSGYWKATGTDKPVLTAGGTQKVGVKKALVFYGGKPPKGVKTNWIMHEYRLADN  889
             RPNRAATSGYWKATGTDKPV TAGG QKVGVKKALVFYGGKPPKGVKTNWIMHEYR+A+N
Sbjct  94    RPNRAATSGYWKATGTDKPVFTAGGNQKVGVKKALVFYGGKPPKGVKTNWIMHEYRIAEN  153

Query  888   KTSNKPPGLDIANRSKGGSLRLDDWVLCRIYKKNNSQRPLD-HESDDLNDMLQGSIPPFV  712
             KT+NKPPG DIAN  K GSLRLDDWVLCRIYKKNN+QRP+D HE DD+N+M+  SIP  +
Sbjct  154   KTNNKPPGCDIAN--KKGSLRLDDWVLCRIYKKNNTQRPIDHHERDDMNEMMGRSIPTCI  211

Query  711   THQKMGLKPSNYGALLQTDhhhhhhHMFDQGLVPGDASLGGARTAQLPFVPS-TPNLLPT  535
              +    + P                  F+Q +  G  +   +    +  V S + ++LP 
Sbjct  212   ANS---ISP------------------FEQNMYEGIINNNTSDMINVNNVGSISSSVLPP  250

Query  534   KRSLP-GLFWNVDDSSANNHHPADASPPTKRFLADNN-----EASISRSDEQNGSIATLL  373
             KR LP GL+WN D ++         SP  KRFLA+N+       +I+R DE N    + L
Sbjct  251   KRPLPAGLYWNEDHNT--------NSPSAKRFLAENSLDNGLNMNITRPDEHN----SFL  298

Query  372   SHLPQTPSLHQQTMLGALNDGV-FRQPY-QVSGINWYS  265
             S LP      Q  +LG+L+DGV FRQPY QV+G+NWYS
Sbjct  299   SQLP------QNQVLGSLSDGVIFRQPYNQVTGMNWYS  330



>ref|XP_009334622.1| PREDICTED: NAC domain-containing protein 18 [Pyrus x bretschneideri]
Length=370

 Score =   354 bits (908),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 207/348 (59%), Positives = 243/348 (70%), Gaps = 44/348 (13%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EELVVHYLKKK  SAP+PVAIIAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA
Sbjct  42    EELVVHYLKKKATSAPLPVAIIAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  101

Query  1068  RPNRAATSGYWKATGTDKPVLTAGGTQKVGVKKALVFYGGKPPKGVKTNWIMHEYRLADN  889
             RPNRAATSGYWKATGTDKPVLT+GGTQKVGVKKALVFYGGKPPKG+KTNWIMHEYRLADN
Sbjct  102   RPNRAATSGYWKATGTDKPVLTSGGTQKVGVKKALVFYGGKPPKGIKTNWIMHEYRLADN  161

Query  888   KTSNKPPGLDIANRSKGGSLRLDDWVLCRIYKKNNSQRPLDHESDD-LNDMLQGSIPPFV  712
             K +NKPPG D+ N  K  SLRLDDWVLCRIYKKNN+ RP+DHE +D + D++   +PP +
Sbjct  162   KPNNKPPGCDLGN--KKNSLRLDDWVLCRIYKKNNTHRPMDHEREDSMEDIMGPLMPPSI  219

Query  711   T----HQKMGL----KPSNYG-ALLQTDhhhhhhHMFDQGLVPGDASLGGARTAQLPFVP  559
             +    HQ M L      S+YG   ++ D       +F  G++   ++ G A T QL    
Sbjct  220   SHVGHHQNMKLHFPKSNSSYGPPFMEND------QIFFDGIM--SSTDGSASTHQLQL--  269

Query  558   STPNLLPTKRSLPGLFWN--VDDSSANNHHPADASPPTKRFLADNNEASISRSDEQNG--  391
                     +  +P L+WN   DD +A     AD S   +  L   +  + S  D  NG  
Sbjct  270   -------KRPIVPSLYWNNQEDDQTA-----ADPSSSKRIQLHQLDNGTNSYGDGINGGS  317

Query  390   ------SIATLLSHLPQTPSLHQQTMLGALNDGVFRQPYQVSGINWYS  265
                   SIA LLS LP+TP LHQ  +LG+L DG++R PYQ+ G+NWYS
Sbjct  318   TNNNSTSIANLLSQLPRTPPLHQHAVLGSLGDGIYRTPYQLPGMNWYS  365



>gb|EYU33415.1| hypothetical protein MIMGU_mgv1a009589mg [Erythranthe guttata]
Length=337

 Score =   352 bits (904),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 205/337 (61%), Positives = 238/337 (71%), Gaps = 34/337 (10%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EELVVHYLKKK ASAP+PV+IIAEVDLYKFDPWELPAK+ FGEQEWYFFSPRDRKYPNGA
Sbjct  26    EELVVHYLKKKAASAPLPVSIIAEVDLYKFDPWELPAKSIFGEQEWYFFSPRDRKYPNGA  85

Query  1068  RPNRAATSGYWKATGTDKPVLTAGGTQKVGVKKALVFYGGKPPKGVKTNWIMHEYRLADN  889
             RPNRAATSGYWKATGTDKPV+TAGGTQKVGVKKALVFYGGKPPKG+KTNWIMHEYRL DN
Sbjct  86    RPNRAATSGYWKATGTDKPVMTAGGTQKVGVKKALVFYGGKPPKGIKTNWIMHEYRLTDN  145

Query  888   KTSN-KPPGLDIANRSKGGSLRLDDWVLCRIYKKNNSQRPLDHESDDLNDMLQGSIPPFV  712
             K  N KPPG D+ N  K  SLRLDDWVLCRIYKKNN+QRP+D E D+ +D++ GS     
Sbjct  146   KPPNMKPPGCDVTN--KKASLRLDDWVLCRIYKKNNAQRPVDQERDEGHDVIMGSF----  199

Query  711   THQKMGLKPSNYGALLQTDhhhhhhHMFDQGLVPGDASLGGARTAQLPFVPST----PN-  547
                K GL  +      Q     + H  F  G++ G       +  Q P + S+    PN 
Sbjct  200   ---KAGLPAAMAVVGEQQRFLENDHSSFYDGMMSGGDHHLKLQHHQFPLLVSSAAADPNS  256

Query  546   LLPTKRSLPGLFWNVDDSSANNHHPADASPPTKRFLADNNEASISRSDEQNGSIATLLSH  367
             +L  KR+LPGL+WN D         + +SPPTKRFL ++ + SI             +S 
Sbjct  257   ILAGKRALPGLYWNDDGGGGGG---SASSPPTKRFLTESCDGSI-------------VSQ  300

Query  366   LPQTPSLHQ--QTMLGALNDGVFR-QPYQVSGINWYS  265
             LPQTP+  Q  Q MLG+L DGVFR Q YQ+SG+NWY+
Sbjct  301   LPQTPATLQQHQAMLGSLGDGVFRQQQYQISGMNWYA  337



>ref|XP_008386130.1| PREDICTED: NAC domain-containing protein 18-like [Malus domestica]
Length=368

 Score =   353 bits (906),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 206/346 (60%), Positives = 241/346 (70%), Gaps = 39/346 (11%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EELVVHYLKKK  SAP+PV+IIA+VDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA
Sbjct  39    EELVVHYLKKKATSAPLPVSIIADVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  98

Query  1068  RPNRAATSGYWKATGTDKPVLTAGGTQKVGVKKALVFYGGKPPKGVKTNWIMHEYRLADN  889
             RPNRAATSGYWKATGTDKPVLT+GG QKVGVKKALVFYGGKPPKG+KTNWIMHEYRLADN
Sbjct  99    RPNRAATSGYWKATGTDKPVLTSGGIQKVGVKKALVFYGGKPPKGIKTNWIMHEYRLADN  158

Query  888   KTSNKPPGLDIANRSKGGSLRLDDWVLCRIYKKNNSQRPLDHESDD-LNDMLQGSIPPFV  712
             K +NKPPG D+ N  K  SLRLDDWVLCRIYKKNN+ RP+DHE +D + D+L   +PP +
Sbjct  159   KPNNKPPGCDLGN--KKNSLRLDDWVLCRIYKKNNTHRPMDHEREDSMEDILGPLMPPSI  216

Query  711   TH------QKMGLKPSN--YGALLQTDhhhhhhHMFDQGLVPGDASLGGARTAQLPFVPS  556
             +H       K+ L  SN  YG     +     + +F  G++   ++ G A T Q      
Sbjct  217   SHVGHHQNMKLHLPKSNLSYGPPFMEN-----NQIFFDGMM--SSTDGSASTHQ------  263

Query  555   TPNLLPTKRSL-PGLFWNVDDSSANNHHPADASPPTKRFLADNNEASISRSDEQNG----  391
                 LP KR + P L+WN  +   ++   AD S   +  L   +  + S  D  NG    
Sbjct  264   ----LPQKRPIVPSLYWN--NQEEDDQTAADPSSSKRIQLHQLDTGTNSNGDGINGGATN  317

Query  390   ----SIATLLSHLPQTPSLHQQTMLGALNDGVFRQPYQVSGINWYS  265
                 SIA LLS LPQTP LHQ  +LG+L DG+FR PYQ+ G NWYS
Sbjct  318   NNSTSIANLLSQLPQTPPLHQHAVLGSLGDGLFRTPYQLPGRNWYS  363



>emb|CAG28971.1| NAM-like protein [Prunus persica]
Length=363

 Score =   353 bits (905),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 209/345 (61%), Positives = 243/345 (70%), Gaps = 40/345 (12%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EELVVHYLKKKV SAP+PVAIIAE++LYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA
Sbjct  37    EELVVHYLKKKVTSAPLPVAIIAEIELYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  96

Query  1068  RPNRAATSGYWKATGTDKPVLTAGGTQKVGVKKALVFYGGKPPKGVKTNWIMHEYRLADN  889
             RPNRAATSGYWKATGTDKPVLT+GGTQKVGVKKALVFYGGKPPKG+KTNWIMHEYRLAD+
Sbjct  97    RPNRAATSGYWKATGTDKPVLTSGGTQKVGVKKALVFYGGKPPKGIKTNWIMHEYRLADS  156

Query  888   KTSNKPPGLDIANRSKGGSLRLDDWVLCRIYKKNNSQRPLDHESDD-LNDMLQGSIPPFV  712
             KTSNKPPG D+ N  K  SLRLDDWVLCRIYKKNNS RP+D E +D + DM+   +PP +
Sbjct  157   KTSNKPPGCDLGN--KKNSLRLDDWVLCRIYKKNNSHRPMDLEREDSMEDMMGPLMPPSI  214

Query  711   T----HQKMGL----KPSNYG-ALLQTDhhhhhhHMFDQGLVPGDASLGGARTAQLPFVP  559
             +    HQ M L      +NYG   ++ D       M       G ASL    T+QLP   
Sbjct  215   SHVGHHQNMNLHLPKSNTNYGPPFIENDQIIFDGIMSS---TDGSASLSNG-TSQLPL--  268

Query  558   STPNLLPTKRSL-PGLFWN--VDDSSANNHHPADASPPTKRFLA----DNNEASISRSDE  400
                     KRS+ P L+ N   DD +A        +  +KR +     D+   +   ++ 
Sbjct  269   --------KRSIVPSLYRNDQEDDQTA-------GASSSKRVVQLHQLDSGTNNSVAANN  313

Query  399   QNGSIATLLSHLPQTPSLHQQTMLGALNDGVFRQPYQVSGINWYS  265
              + SIA LLS LPQTP LHQ  MLG+L DG+FR PYQ+ G+NW+S
Sbjct  314   NSTSIANLLSQLPQTPPLHQHAMLGSLGDGLFRTPYQLPGMNWFS  358



>ref|NP_001234652.1| NAC domain protein [Solanum lycopersicum]
 gb|AAU43922.1| NAC domain protein [Solanum lycopersicum]
Length=355

 Score =   351 bits (901),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 210/346 (61%), Positives = 251/346 (73%), Gaps = 35/346 (10%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EEL+VHYLKK+VA APIPV II E+DLYKFDPWELPAKA FGEQEW+FFSPRDRKYPNGA
Sbjct  27    EELIVHYLKKRVAGAPIPVDIIGEIDLYKFDPWELPAKAIFGEQEWFFFSPRDRKYPNGA  86

Query  1068  RPNRAATSGYWKATGTDKPVLTAGGTQKVGVKKALVFYGGKPPKGVKTNWIMHEYRLADN  889
             RPNRAATSGYWKATGTDKPV T+GGTQKVGVKKALVFYGGKPPKGVKTNWIMHEYR+ +N
Sbjct  87    RPNRAATSGYWKATGTDKPVFTSGGTQKVGVKKALVFYGGKPPKGVKTNWIMHEYRVVEN  146

Query  888   KTSNKPPGLDIANRSKGGSLRLDDWVLCRIYKKNNSQRPLDHESDDLNDMLQGSIPPFVT  709
             KT+NKP G D    +K GSLRLDDWVLCRIYKKNN+QR +    DDL+DML GSIP  V 
Sbjct  147   KTNNKPLGCDNIVANKKGSLRLDDWVLCRIYKKNNTQRSI----DDLHDML-GSIPQNVP  201

Query  708   HQKM-GLKPSNYGALLQTDhhhhhhHMFDQGLVPGDASLGGARTAQLPFVPSTPNLLPTK  532
             +  + G+KPSNYG +L  +      +M+D G++     +       +P + S       K
Sbjct  202   NSILQGIKPSNYGTILLEN----ESNMYD-GIMNNTNDIINNNNRSIPQISS-------K  249

Query  531   RSLP-GLFWNVDDSSANNHH-PADASPPTKRFLADNNE------ASISR--SDEQNGSIA  382
             R++  GL+WN D+++        + SP TKRFL +NNE       +ISR  + EQ+ SIA
Sbjct  250   RTMHGGLYWNNDEATTTTTTIDRNHSPNTKRFLVENNEDDGLNMNNISRITNHEQSSSIA  309

Query  381   TLLSHLPQTPSL-----HQQTMLGALNDG-VFRQPY-QVSGINWYS  265
               LS  PQ PS+      Q+ +LG+LNDG VFRQPY QV+G+NWYS
Sbjct  310   NFLSQFPQNPSIQQQQQQQEEVLGSLNDGVVFRQPYNQVTGMNWYS  355



>gb|AAU43923.2| NAC domain protein [Solanum lycopersicum]
Length=355

 Score =   349 bits (896),  Expect = 7e-114, Method: Compositional matrix adjust.
 Identities = 209/346 (60%), Positives = 250/346 (72%), Gaps = 35/346 (10%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EEL+VHYLKK+VA APIPV II E+DLYKFDPWELP KA FGEQEW+FFSPRDRKYPNGA
Sbjct  27    EELIVHYLKKRVAGAPIPVDIIGEIDLYKFDPWELPGKAIFGEQEWFFFSPRDRKYPNGA  86

Query  1068  RPNRAATSGYWKATGTDKPVLTAGGTQKVGVKKALVFYGGKPPKGVKTNWIMHEYRLADN  889
             RPNRAATSGYWKATGTDKPV T+GGTQKVGVKKALVFYGGKPPKGVKTNWIMHEYR+ +N
Sbjct  87    RPNRAATSGYWKATGTDKPVFTSGGTQKVGVKKALVFYGGKPPKGVKTNWIMHEYRVVEN  146

Query  888   KTSNKPPGLDIANRSKGGSLRLDDWVLCRIYKKNNSQRPLDHESDDLNDMLQGSIPPFVT  709
             KT+NKP G D    +K GSLRLDDWVLCRIYKKNN+QR +    DDL+DML GSIP  V 
Sbjct  147   KTNNKPLGCDNIVANKKGSLRLDDWVLCRIYKKNNTQRSI----DDLHDML-GSIPQNVP  201

Query  708   HQKM-GLKPSNYGALLQTDhhhhhhHMFDQGLVPGDASLGGARTAQLPFVPSTPNLLPTK  532
             +  + G+KPSNYG +L  +      +M+D G++     +       +P + S       K
Sbjct  202   NSILQGIKPSNYGTILLEN----ESNMYD-GIMNNTNDIINNNNRSIPQISS-------K  249

Query  531   RSLP-GLFWNVDDSSANNHH-PADASPPTKRFLADNNE------ASISR--SDEQNGSIA  382
             R++  GL+WN D+++        + SP TKRFL +NNE       +ISR  + EQ+ SIA
Sbjct  250   RTMHGGLYWNNDEATTTTTTIDRNHSPNTKRFLVENNEDDGLNMNNISRITNHEQSSSIA  309

Query  381   TLLSHLPQTPSL-----HQQTMLGALNDG-VFRQPY-QVSGINWYS  265
               LS  PQ PS+      Q+ +LG+LNDG VFRQPY QV+G+NWYS
Sbjct  310   NFLSQFPQNPSIQQQQQQQEEVLGSLNDGVVFRQPYNQVTGMNWYS  355



>ref|XP_010644222.1| PREDICTED: NAC transcription factor 25 isoform X2 [Vitis vinifera]
Length=341

 Score =   348 bits (894),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 201/344 (58%), Positives = 241/344 (70%), Gaps = 44/344 (13%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EELVVHYLKKK +SAP+PVAIIAEVDLYKFDPWELPAKA+FGEQEWYFFSPRDRKYPNGA
Sbjct  26    EELVVHYLKKKASSAPLPVAIIAEVDLYKFDPWELPAKASFGEQEWYFFSPRDRKYPNGA  85

Query  1068  RPNRAATSGYWKATGTDKPVLTAGGTQKVGVKKALVFYGGKPPKGVKTNWIMHEYRLADN  889
             RPNRAATSGYWKATGTDKPVLT+GGTQKVGVKKALVFYGGKPPKG+KTNWIMHEYRLADN
Sbjct  86    RPNRAATSGYWKATGTDKPVLTSGGTQKVGVKKALVFYGGKPPKGIKTNWIMHEYRLADN  145

Query  888   KTSNKPPGLDIANRSKGGSLRLDDWVLCRIYKKNNSQRPLDHESDDLNDMLQGSIPPFVT  709
             K + KPPG D+ N  K  SLR            NN+ R LD + DD  D + G +P  ++
Sbjct  146   KVNTKPPGCDMGN--KKNSLR------------NNTHRTLDPDKDDSMDDMLGPVPTSIS  191

Query  708   HQKMGLKPS-----NYGALLQTDhhhhhhHMFDQGLVPGDASLGGARTAQLPFVPSTPN-  547
               +  LK       NY ALL+ +       +F+ G++  D        +QL    S P+ 
Sbjct  192   MGQQSLKLQFPKVPNYSALLENE-----QSLFE-GMINSDGINSSGTISQLACSSSKPDH  245

Query  546   ----------LLPTKRSLPGLFWNVDDSSANNHHPADASPPTKRFLADNNEASISRSDEQ  397
                       +LP KR+LP L+WN DD++  +         TKRF A+N + +I R+ + 
Sbjct  246   LSLVAATTSSILPLKRTLPSLYWNDDDTAGPST--------TKRFQAENTDGNIGRTTDG  297

Query  396   NGSIATLLSHLPQTPSLHQQTMLGALNDGVFRQPYQVSGINWYS  265
             N SIATLLS LPQTPSLHQQ+MLG+L +GVFRQP+Q+ G+NWY+
Sbjct  298   NNSIATLLSQLPQTPSLHQQSMLGSLGEGVFRQPFQLPGMNWYA  341



>ref|NP_001280984.1| NAC domain-containing protein 18 [Malus domestica]
 gb|ADL36807.1| NAC domain class transcription factor [Malus domestica]
Length=364

 Score =   349 bits (896),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 205/348 (59%), Positives = 244/348 (70%), Gaps = 44/348 (13%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EELVVHYLKKK  SAP+PVAIIAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA
Sbjct  36    EELVVHYLKKKATSAPLPVAIIAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  95

Query  1068  RPNRAATSGYWKATGTDKPVLTAGGTQKVGVKKALVFYGGKPPKGVKTNWIMHEYRLADN  889
             RPNRAATSGYWKATGTDKPVLT+G TQKVGVKKALVFYGGKPPKG+KTNWIMHEYRLADN
Sbjct  96    RPNRAATSGYWKATGTDKPVLTSGDTQKVGVKKALVFYGGKPPKGIKTNWIMHEYRLADN  155

Query  888   KTSNKPPGLDIANRSKGGSLRLDDWVLCRIYKKNNSQRPLDHESDD-LNDMLQGSIPPFV  712
             K +NKPPG D+ N  K  S+RLDDWVLCRIYKKNN+ RP+DHE +D + D++   +PP +
Sbjct  156   KPNNKPPGCDLGN--KKNSMRLDDWVLCRIYKKNNTHRPMDHEREDSMEDIMGPLMPPSI  213

Query  711   T----HQKMGL----KPSNYG-ALLQTDhhhhhhHMFDQGLVPGDASLGGARTAQLPFVP  559
             +    HQ M L      S+YG   ++ D       +F  G++   ++ G A T QL    
Sbjct  214   SHVGHHQNMKLHFPKSNSSYGPPFMEND------QIFFDGIM--SSTDGSASTHQLQL--  263

Query  558   STPNLLPTKRSLPGLFWN--VDDSSANNHHPADASPPTKRFL------ADNNEASIS--R  409
                     +  +P  +WN   DD +A     AD S   +  L       ++N A I+   
Sbjct  264   -------KRPIVPSWYWNNQEDDQTA-----ADPSSSKRIQLHQLDNGTNSNGAGINGGS  311

Query  408   SDEQNGSIATLLSHLPQTPSLHQQTMLGALNDGVFRQPYQVSGINWYS  265
             ++  + SIA LLS LPQTP LHQ  +LG+L DG+FR PYQ+ G+NWYS
Sbjct  312   TNNNSSSIANLLSQLPQTPPLHQHAVLGSLGDGIFRTPYQLPGMNWYS  359



>gb|AHJ79165.1| NAC domain protein NAC24 [Gossypium hirsutum]
Length=344

 Score =   348 bits (894),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 204/340 (60%), Positives = 246/340 (72%), Gaps = 33/340 (10%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EELVVHYLKKK +SAP+PVAIIAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNG 
Sbjct  26    EELVVHYLKKKASSAPLPVAIIAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGV  85

Query  1068  RPNRAATSGYWKATGTDKPVLTAGGTQKVGVKKALVFYGGKPPKGVKTNWIMHEYRLADN  889
             RPNRAATSGYWKATGTDKPVLT+GGTQKVGVKKALVFYGGKPPKG+KT+WIMHEYRLADN
Sbjct  86    RPNRAATSGYWKATGTDKPVLTSGGTQKVGVKKALVFYGGKPPKGIKTSWIMHEYRLADN  145

Query  888   KTSNKPPGLDIANRSKGGSLRLDDWVLCRIYKKNNSQRPLDHESDDLNDMLQGSIPPFVT  709
             K +NKPPG D +N  K  SLRLDDWVLCRIYKKNN+ RPLD + DD  D + GSI P ++
Sbjct  146   KNNNKPPGYDFSN--KKNSLRLDDWVLCRIYKKNNTHRPLDQDKDDSIDDMLGSIQPSIS  203

Query  708   HQKMGLKP----------SNYGALLQTDhhhhhhHMFDQGLVPGDASLGGARTAQLPFVP  559
                    P          +++G LL+       H +FD G++ G+ S  G     +    
Sbjct  204   IGNQHNNPKFQFASKGTATSFGTLLENH----EHSLFD-GMM-GNNSDEGINNGSM----  253

Query  558   STPNLLPTKRSLPGLFWNVDDSSANNHHPADASPPTKRFLADNNEASISRSDEQNGSIAT  379
             S   + P KR+LP LFW  D++S             K+F  D+N+ S+ + D  NGS+ T
Sbjct  254   SQSMVNPLKRNLPSLFW-TDETSIEPQ-------ANKKFHGDSNDGSMEKMD-GNGSVTT  304

Query  378   LLSHLPQTPSLHQQ--TMLGALNDGVFRQPYQVSGINWYS  265
             LLS LP++PSL QQ  TM+G++ DG++R P+Q+ G++WYS
Sbjct  305   LLSQLPESPSLQQQQETMMGSMGDGIYRPPFQLPGLHWYS  344



>ref|XP_010268761.1| PREDICTED: NAC transcription factor 25-like [Nelumbo nucifera]
Length=353

 Score =   348 bits (893),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 205/339 (60%), Positives = 243/339 (72%), Gaps = 23/339 (7%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EELVVHYLKKK +SAP+PV IIAEVDLYKFDPWELP KATFG+QEWYFFSPRDRKYPNGA
Sbjct  27    EELVVHYLKKKASSAPLPVTIIAEVDLYKFDPWELPGKATFGDQEWYFFSPRDRKYPNGA  86

Query  1068  RPNRAATSGYWKATGTDKPVLTAGGTQKVGVKKALVFYGGKPPKGVKTNWIMHEYRLADN  889
             RPNRAATSGYWKATGTDKP+LT+GGTQKVGVKKALVFYGG+PPKG+KTNWIMHEYRLADN
Sbjct  87    RPNRAATSGYWKATGTDKPILTSGGTQKVGVKKALVFYGGRPPKGIKTNWIMHEYRLADN  146

Query  888   K--TSNKPPGLDIANRSKGGSLRLDDWVLCRIYKKNNSQRPLDHESDDLNDMLQG--SIP  721
                TSNKPPG D +N  K  SLRLDDWVLCRIYKKNNS RP++ + +D  D + G  +  
Sbjct  147   NNTTSNKPPGADTSN--KKSSLRLDDWVLCRIYKKNNSNRPMERDKEDSMDDMLGLPTST  204

Query  720   PFVTHQKMGLKPS----NYGALLQTDhhhhhhHMFDQGLVPGDAS-LGGART-AQLPFVP  559
              F+  Q+   +P+     YG+LL+TD +     + D G+     + LG A +  +L  VP
Sbjct  205   SFMEVQQSSKQPTQRTATYGSLLETDENFFEGLLTDDGVNSTSITQLGSASSKTELSMVP  264

Query  558   STPNLLPTKRSLPGLFWNVDDSSANNHHPADASPPTKRFLADNNEASISRSDEQNGSIAT  379
             +  +L P KR+LP  +WN  D SA    P+ A    KRF A+N+  S S +   N  I T
Sbjct  265   AA-SLPPLKRTLPSPYWN--DVSAVG--PSSA----KRFHANNHNNSGSDTTNANSPITT  315

Query  378   -LLSHLPQTPSLHQQTMLGALNDGVFRQPYQVSGINWYS  265
              LL+ LPQ    H   +LG + DGVFRQPYQ SG+NW S
Sbjct  316   LLLNQLPQATPFHSP-LLGPMGDGVFRQPYQFSGMNWNS  353



>gb|ACJ14498.1| mutant NAC domain protein [Solanum lycopersicum]
Length=355

 Score =   348 bits (892),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 209/346 (60%), Positives = 250/346 (72%), Gaps = 35/346 (10%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EEL+VHYLKK+VA APIPV II E+DLYKFDPWELPAKA FGEQEW+FFSPRDRKYPNGA
Sbjct  27    EELIVHYLKKRVAGAPIPVDIIGEIDLYKFDPWELPAKAIFGEQEWFFFSPRDRKYPNGA  86

Query  1068  RPNRAATSGYWKATGTDKPVLTAGGTQKVGVKKALVFYGGKPPKGVKTNWIMHEYRLADN  889
             RPNRAATSGYWKATGTDKP  T+GGTQKVGVKKALVFYGGKPPKGVKTNWIMHEYR+ +N
Sbjct  87    RPNRAATSGYWKATGTDKPDFTSGGTQKVGVKKALVFYGGKPPKGVKTNWIMHEYRVVEN  146

Query  888   KTSNKPPGLDIANRSKGGSLRLDDWVLCRIYKKNNSQRPLDHESDDLNDMLQGSIPPFVT  709
             KT+NKP G D    +K GSLRLDDWVLCRIYKKNN+QR +    DDL+DML GSIP  V 
Sbjct  147   KTNNKPLGCDNIVANKKGSLRLDDWVLCRIYKKNNTQRSI----DDLHDML-GSIPQNVP  201

Query  708   HQKM-GLKPSNYGALLQTDhhhhhhHMFDQGLVPGDASLGGARTAQLPFVPSTPNLLPTK  532
             +  + G+KPSNYG +L  +      +M+D G++     +       +P + S       K
Sbjct  202   NSILQGIKPSNYGTILLEN----ESNMYD-GIMNNTNDIINNNNRSIPQISS-------K  249

Query  531   RSLP-GLFWNVDDSSANNHH-PADASPPTKRFLADNNE------ASISR--SDEQNGSIA  382
             R++  GL+WN D+++        + SP TKRFL +NNE       +ISR  + EQ+ SIA
Sbjct  250   RTMHGGLYWNNDEATTTTTTIDRNHSPNTKRFLVENNEDDGLNMNNISRITNHEQSSSIA  309

Query  381   TLLSHLPQTPSL-----HQQTMLGALNDG-VFRQPY-QVSGINWYS  265
               LS  PQ PS+      Q+ +LG+LNDG VFRQPY QV+G+NWYS
Sbjct  310   NFLSQFPQNPSIQQQQQQQEEVLGSLNDGVVFRQPYNQVTGMNWYS  355



>ref|XP_009378497.1| PREDICTED: NAC domain-containing protein 18-like [Pyrus x bretschneideri]
Length=368

 Score =   348 bits (893),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 204/346 (59%), Positives = 241/346 (70%), Gaps = 39/346 (11%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EELVV YLKKKV SAP+PV+IIA+VDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA
Sbjct  39    EELVVQYLKKKVTSAPLPVSIIADVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  98

Query  1068  RPNRAATSGYWKATGTDKPVLTAGGTQKVGVKKALVFYGGKPPKGVKTNWIMHEYRLADN  889
             RPNRAATSGYWKATGTDKPVLT+GG QKVGVKKALVFYGGKPPKG+KTNWIMHEYRLADN
Sbjct  99    RPNRAATSGYWKATGTDKPVLTSGGIQKVGVKKALVFYGGKPPKGIKTNWIMHEYRLADN  158

Query  888   KTSNKPPGLDIANRSKGGSLRLDDWVLCRIYKKNNSQRPLDHESDD-LNDMLQGSIPPFV  712
             K +NKPPG D+ N  K  SLRLDDWVLCRIYKKNN+  P+DHE +D + D++   +PP +
Sbjct  159   KPNNKPPGWDLGN--KKNSLRLDDWVLCRIYKKNNTHSPMDHEREDSMGDIMGPLMPPSM  216

Query  711   TH------QKMGLKPSN--YG-ALLQTDhhhhhhHMFDQGLVPGDASLGGARTAQLPFVP  559
             TH       K+ L  SN  YG   ++ D       +F  G++   ++ G A T QLP   
Sbjct  217   THVGHHQDMKLHLPKSNLSYGPPFMEND------QIFFDGIM--SSTDGSASTPQLPL--  266

Query  558   STPNLLPTKRSLPGLFWNVDDSSANNHHPADASPPTKRFLADNNEASISRSDEQNG----  391
                     +  +P L+WN  +   ++   AD S   +  L   +  + S  D  NG    
Sbjct  267   -------KRPIVPSLYWN--NQEEDDQTAADPSSSKRIQLHQLDTGTNSNGDGINGGATN  317

Query  390   ----SIATLLSHLPQTPSLHQQTMLGALNDGVFRQPYQVSGINWYS  265
                 SIA LLS LPQTPSLH+  +LG+L DG+FR PYQ+ G NWYS
Sbjct  318   NNSTSIANLLSQLPQTPSLHEHAVLGSLGDGLFRTPYQLPGRNWYS  363



>gb|KHG20342.1| NAC domain-containing 18 -like protein [Gossypium arboreum]
Length=349

 Score =   347 bits (889),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 205/337 (61%), Positives = 242/337 (72%), Gaps = 24/337 (7%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EELVVHYLKKK  SAP+PVAIIAEVDLYKFDPWELPAKATFGE+EWYFFSPRDRKYPNGA
Sbjct  26    EELVVHYLKKKATSAPLPVAIIAEVDLYKFDPWELPAKATFGEREWYFFSPRDRKYPNGA  85

Query  1068  RPNRAATSGYWKATGTDKPVLTAGGTQKVGVKKALVFYGGKPPKGVKTNWIMHEYRLADN  889
             RPNRAATSGYWKATGTDKPVL + GTQKVGVKKALVFYGGKPPKG+KTNWIMHEYRL DN
Sbjct  86    RPNRAATSGYWKATGTDKPVLNSKGTQKVGVKKALVFYGGKPPKGIKTNWIMHEYRLPDN  145

Query  888   KTSNKPPGLDIANRSKGGSLRLDDWVLCRIYKKNNSQRPLDHESDDLNDMLQGSIPPFVT  709
             K +NKPPG D+    K  SLRLDDWVLCRIYKKNN+ RPL +E D+  D + G +P   T
Sbjct  146   KNNNKPPGCDLG--YKKNSLRLDDWVLCRIYKKNNTNRPLGYEKDEAMDDMGGPVP---T  200

Query  708   HQKMG-LKPSNYGALLQTDhhhhhhHMFDQGLVPGDASLGGARTAQLPFVPST-PNLL--  541
                +G L+    G    T   +H H++FD G++  D        + L    S+ P+L   
Sbjct  201   SMSIGSLQFQTKGTSCGTFLENHEHNLFD-GMLGSDGMNNNGSMSHLGRCSSSKPDLSMV  259

Query  540   -PTKRS-LPGLFWNVDDSSANNHHPADASPPT-KRFLADN-NEASISRSDEQ-NGSIATL  376
              P KRS +P L+W  +D+         ASP T K F  D+ N+ S+ + D   + SIATL
Sbjct  260   NPLKRSTVPSLYWTDEDT---------ASPSTSKTFHGDHSNDGSLEKPDTNGSNSIATL  310

Query  375   LSHLPQTPSLHQQTMLGALNDGVFRQPYQVSGINWYS  265
             LS LPQTP L QQTM+G++ DG+FR  YQ+ G+NWY+
Sbjct  311   LSQLPQTPHLQQQTMVGSMEDGIFRPSYQLPGLNWYT  347



>ref|XP_004487678.1| PREDICTED: NAC domain-containing protein 18-like [Cicer arietinum]
Length=356

 Score =   347 bits (890),  Expect = 8e-113, Method: Compositional matrix adjust.
 Identities = 199/341 (58%), Positives = 243/341 (71%), Gaps = 25/341 (7%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EELVVHYLKKK ASAP+PVAIIAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA
Sbjct  26    EELVVHYLKKKAASAPLPVAIIAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  85

Query  1068  RPNRAATSGYWKATGTDKPVLTAGGTQKVGVKKALVFYGGKPPKGVKTNWIMHEYRLADN  889
             RPNRAATSGYWKATGTDKPVLT+GGTQKVGVKKALVFYGGKPP+G+KTNWIMHEYRLADN
Sbjct  86    RPNRAATSGYWKATGTDKPVLTSGGTQKVGVKKALVFYGGKPPRGIKTNWIMHEYRLADN  145

Query  888   KTSNKPPGLDIANRSKGGSLRLDDWVLCRIYKKNNSQ-RPLDHESDDLNDMLQGSIPPFV  712
             K +N+PPG D+ N  K  SLRLDDWVLCRIYKK+N+   P++H+ +D  D + G +PP +
Sbjct  146   KPNNRPPGCDLGN--KKNSLRLDDWVLCRIYKKSNTHWSPVEHDREDSMDDMIGGVPPSI  203

Query  711   THQKMG-------LKPSNYGALLQTDhhhhhhHMFDQGLVPGDASLGGARTAQLPFVPST  553
                +M        +  S    LL+ D +     M        +       ++QL    ST
Sbjct  204   NVGQMNARFHFSKMSNSYNNTLLENDQNLLEGMMLSNNNNNNNTV--ATLSSQLGGSAST  261

Query  552   PNLLPTKRSLPGLFWNVDDSSANNHHPADASPPTKRFLADNNEASISRSDEQNGSIAT--  379
              N   +KR+L  L+W       N+H    AS       +D++  S+ R+D+++G++AT  
Sbjct  262   SNASASKRTLSSLYW-------NDHEDVAASNKRFNLESDHHHGSVVRNDQESGTVATSF  314

Query  378   --LLSHLPQTP-SLHQQTMLGALNDGVFR-QPYQVSGINWY  268
               LL++LPQTP SLHQQTMLG++ DG+ R  PYQ+ G+NWY
Sbjct  315   ASLLNNLPQTPNSLHQQTMLGSIGDGLLRTTPYQIQGMNWY  355



>gb|AGS08759.1| NAC domain protein [Malus hupehensis]
Length=364

 Score =   345 bits (886),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 204/348 (59%), Positives = 242/348 (70%), Gaps = 44/348 (13%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EELVVHYLKKK  SAP+PVAIIAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA
Sbjct  36    EELVVHYLKKKATSAPLPVAIIAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  95

Query  1068  RPNRAATSGYWKATGTDKPVLTAGGTQKVGVKKALVFYGGKPPKGVKTNWIMHEYRLADN  889
             RPNRAATSGYWKATGTDKPVLT+G TQKVGVKKALVFYGGKPPKG+KTNWIMHEYRLADN
Sbjct  96    RPNRAATSGYWKATGTDKPVLTSGDTQKVGVKKALVFYGGKPPKGIKTNWIMHEYRLADN  155

Query  888   KTSNKPPGLDIANRSKGGSLRLDDWVLCRIYKKNNSQRPLDHESDD-LNDMLQGSIPPFV  712
             K +NKPPG D+ N  K  SLRLDDWVLCRIYKKNN+ RP+DHE +D + D++   +PP +
Sbjct  156   KPNNKPPGCDLGN--KKNSLRLDDWVLCRIYKKNNTHRPMDHEREDSMEDIMGPLMPPSI  213

Query  711   T----HQKMGL----KPSNYG-ALLQTDhhhhhhHMFDQGLVPGDASLGGARTAQLPFVP  559
             +    HQ M L      S+YG   ++ D       +F  G++   ++ G A T QL    
Sbjct  214   SHVGHHQNMKLHFPKSNSSYGPPFMEND------QIFFDGIM--SSTDGSASTHQLQL--  263

Query  558   STPNLLPTKRSLPGLFWN--VDDSSANNHHPADASPPTKRFL------ADNNEASIS--R  409
                     +  +P  +WN   DD +A     AD S   +  L       ++N A I+   
Sbjct  264   -------KRPIVPSWYWNNQEDDQTA-----ADPSSSKRIQLHQLDNGTNSNGAGINGGS  311

Query  408   SDEQNGSIATLLSHLPQTPSLHQQTMLGALNDGVFRQPYQVSGINWYS  265
             ++  + SI  LLS L QTP LHQ  +LG+L DG+FR PYQ+ G+NWYS
Sbjct  312   TNNNSSSITNLLSQLSQTPPLHQHAVLGSLGDGIFRTPYQLPGMNWYS  359



>gb|AGC27313.1| NAC domain protein 10 [Gossypium hirsutum]
Length=349

 Score =   344 bits (882),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 201/337 (60%), Positives = 240/337 (71%), Gaps = 24/337 (7%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EELVVHYLKKK  SAP+PVAIIAEVDLYKFDPWELPAKATFGE+EWYFFSPR+RKYPNGA
Sbjct  26    EELVVHYLKKKATSAPLPVAIIAEVDLYKFDPWELPAKATFGEREWYFFSPRERKYPNGA  85

Query  1068  RPNRAATSGYWKATGTDKPVLTAGGTQKVGVKKALVFYGGKPPKGVKTNWIMHEYRLADN  889
             RPNRAATSGYWKATGTDKPVL + GTQKVGVKKALVFYGGKPPKG+KTNWIMHEYRL DN
Sbjct  86    RPNRAATSGYWKATGTDKPVLNSKGTQKVGVKKALVFYGGKPPKGIKTNWIMHEYRLPDN  145

Query  888   KTSNKPPGLDIANRSKGGSLRLDDWVLCRIYKKNNSQRPLDHESDDLNDMLQGSIPPFVT  709
             K +NKPPG D+    K  SLRLDDWVLCRIYKKNN+ RPL +E D+  D + G +P   T
Sbjct  146   KNNNKPPGCDLG--YKKNSLRLDDWVLCRIYKKNNTNRPLGYEKDEAIDDMGGPVP---T  200

Query  708   HQKMG-LKPSNYGALLQTDhhhhhhHMFDQGLVPGDASLGGARTAQLPFVPST-PNLLPT  535
                +G L+    G    T   +H H++FD G++  D        + L    S+ P+L   
Sbjct  201   SMSIGSLQFQTKGTSCGTFLENHEHNLFD-GMLGSDGINNNGSMSHLGCCSSSKPDLSMV  259

Query  534   ----KRSLPGLFWNVDDSSANNHHPADASPPT-KRFLADN-NEASISRSDEQNG-SIATL  376
                 +R++P L+W  +D+         ASP T K F  D+ N+ S+ + D     SIATL
Sbjct  260   NPLKRRTVPSLYWTDEDT---------ASPSTSKTFHGDHSNDGSLEKPDTNGSISIATL  310

Query  375   LSHLPQTPSLHQQTMLGALNDGVFRQPYQVSGINWYS  265
             LS LPQTP L QQTM+G++ DG+FR  YQ+ G+NWY+
Sbjct  311   LSQLPQTPHLQQQTMVGSMEDGIFRPSYQLPGLNWYT  347



>ref|XP_010278293.1| PREDICTED: NAC transcription factor NAM-B2-like [Nelumbo nucifera]
Length=359

 Score =   342 bits (876),  Expect = 9e-111, Method: Compositional matrix adjust.
 Identities = 200/339 (59%), Positives = 241/339 (71%), Gaps = 25/339 (7%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EELVVHYLKKK +SAP+PV IIAEVDLYKFDPWELP KATFGEQEWYFFSPRDRKYPNGA
Sbjct  31    EELVVHYLKKKASSAPLPVTIIAEVDLYKFDPWELPGKATFGEQEWYFFSPRDRKYPNGA  90

Query  1068  RPNRAATSGYWKATGTDKPVLTAGGTQKVGVKKALVFYGGKPPKGVKTNWIMHEYRLADN  889
             RPNRAATSGYWKATGTDKP+LT+GGTQKVGVKKALVFYGG+PPKGVKTNWIMHEYRLADN
Sbjct  91    RPNRAATSGYWKATGTDKPILTSGGTQKVGVKKALVFYGGRPPKGVKTNWIMHEYRLADN  150

Query  888   KTSNKPPGLDIANRSKGGSLRLDDWVLCRIYKKNNSQRPLDHESDD-LNDMLQGSIP-PF  715
              TS+KPPG+D++N  K  SLRLDDWVLCRIYKKNNS R ++ + +D + DM+  ++P   
Sbjct  151   STSSKPPGVDVSN--KKSSLRLDDWVLCRIYKKNNSNRLMERDKEDSMTDMM--ALPTST  206

Query  714   VTHQKMGLKP-----SNYGA-LLQTDhhhhhhHMFDQGL----VPGDASLGGARTAQLPF  565
             V  Q+   +P     +NYG  LL++D +     + + G+    +P   S   + T    F
Sbjct  207   VEGQQSSKQPPAQRTTNYGGMLLESDDNFFEGLLSEDGVNSSSLPQFGSSSISTTELSMF  266

Query  564   VPSTPNLLPTKRSLPGLFWNVDDSSANNHHPADASPPTKRFLADNNEASISRSDEQNGSI  385
               +T   LP KR  P  ++N   +          S  TK+F  D+N +S S S   N  I
Sbjct  267   PAATATQLPLKRPFPSPYFNEVAA-------IGPSSSTKKFHPDHN-SSGSGSTNANNPI  318

Query  384   ATLLSHLPQTPS-LHQQTMLGALNDGVFRQPYQVSGINW  271
             ATLL+ LPQ  +  H  T+LG+L +GV RQPYQ+SGINW
Sbjct  319   ATLLNQLPQAATPFHNHTLLGSLGEGVLRQPYQLSGINW  357



>gb|KHG07368.1| NAC domain-containing 18 -like protein [Gossypium arboreum]
Length=347

 Score =   341 bits (874),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 203/343 (59%), Positives = 245/343 (71%), Gaps = 36/343 (10%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EELVVHYLKKK +SAP+PVAIIAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNG 
Sbjct  26    EELVVHYLKKKASSAPLPVAIIAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGV  85

Query  1068  RPNRAATSGYWKATGTDKPVLTAGGTQKVGVKKALVFYGGKPPKGVKTNWIMHEYRLADN  889
             RPNRAATSGYWKATGTDKPVLT+GGTQKVGVKKALVFYGGKPPKG+KT+WIMHEYRLADN
Sbjct  86    RPNRAATSGYWKATGTDKPVLTSGGTQKVGVKKALVFYGGKPPKGIKTSWIMHEYRLADN  145

Query  888   KTSNKPPGLDIANRSKGGSLRLDDWVLCRIYKKNNSQRPLDHESDDLNDMLQGSIPPFVT  709
             K +NKPPG D +N  K  SLRLDDWVLCRIYKKNN+ RPLD + DD  D + GSI P ++
Sbjct  146   KNNNKPPGYDFSN--KKNSLRLDDWVLCRIYKKNNTHRPLDQDKDDSMDDMLGSIQPSIS  203

Query  708   HQKMGLKP----------SNYGALLQTDhhhhhhHMFDQGLVPGDASLGGARTAQLPFVP  559
                    P          +++G LL+       H +FD G++ G+ S  G     +    
Sbjct  204   IGNQHNNPKFQFASKGTATSFGTLLENH----EHSLFD-GMM-GNNSDEGINNGSM----  253

Query  558   STPNLLPTKRSLPGLFWNVDDSSANNHHPADASPPTKRFLADNNEASISRSDEQNGSIAT  379
             S   + P KR+LP LFW  D++S             K+F  D+N+ S+ + D  NGS+ T
Sbjct  254   SQSMVNPLKRNLPSLFW-TDETSTEPQ-------ANKKFHGDSNDGSMEKMD-GNGSVTT  304

Query  378   LLSHLPQTPSL-----HQQTMLGALNDGVFRQPYQVSGINWYS  265
             LLS L Q+PSL      Q+TM+G++ DG++R P+Q+ G++WYS
Sbjct  305   LLSQLRQSPSLQQQQQQQETMMGSMGDGIYRPPFQLPGLHWYS  347



>gb|AGC27321.1| NAC domain protein 10 [Gossypium hirsutum]
Length=347

 Score =   335 bits (860),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 202/337 (60%), Positives = 240/337 (71%), Gaps = 26/337 (8%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EELVVHYLKKK  SAP+PVAIIAEVDLYKFDPWELPAKATFGE+EWYFFSPR  KYPNGA
Sbjct  26    EELVVHYLKKKATSAPLPVAIIAEVDLYKFDPWELPAKATFGEREWYFFSPR--KYPNGA  83

Query  1068  RPNRAATSGYWKATGTDKPVLTAGGTQKVGVKKALVFYGGKPPKGVKTNWIMHEYRLADN  889
             RPNRAATSGYWKATGTDKPVL + GTQKVGVKKALVFYGGKPPKG+KTNWIMHEYRL DN
Sbjct  84    RPNRAATSGYWKATGTDKPVLNSKGTQKVGVKKALVFYGGKPPKGIKTNWIMHEYRLPDN  143

Query  888   KTSNKPPGLDIANRSKGGSLRLDDWVLCRIYKKNNSQRPLDHESDDLNDMLQGSIPPFVT  709
             K +NKPPG D+    K  SLRL+DWVLCRIYKKNN+ RPL +E D+  D + G +P   T
Sbjct  144   KNNNKPPGCDLG--YKKNSLRLEDWVLCRIYKKNNTNRPLGYEKDEAMDDMGGPVP---T  198

Query  708   HQKMG-LKPSNYGALLQTDhhhhhhHMFDQGLVPGDASLGGARTAQLPFVPST-PNLL--  541
                +G L+    G    T   +H H++FD G++  D        + L    S+ P+L   
Sbjct  199   SMSIGSLQFQTKGTSCGTFLENHEHNLFD-GMLGSDGMNNNGSMSHLGRCSSSKPDLSMV  257

Query  540   -PTKRS-LPGLFWNVDDSSANNHHPADASPPT-KRFLADN-NEASISRSDEQ-NGSIATL  376
              P KRS +P L+W  +D+         ASP T K F  D+ N+ S+ + D   + SIATL
Sbjct  258   NPLKRSTVPSLYWTDEDT---------ASPSTSKTFHGDHSNDGSLEKPDTNGSNSIATL  308

Query  375   LSHLPQTPSLHQQTMLGALNDGVFRQPYQVSGINWYS  265
             LS LPQTP L QQTM+G++ DG+FR  YQ+ G+NWY+
Sbjct  309   LSQLPQTPHLQQQTMVGSMEDGIFRPSYQLPGLNWYT  345



>ref|XP_007025712.1| NAC domain containing protein 25 [Theobroma cacao]
 gb|EOY28334.1| NAC domain containing protein 25 [Theobroma cacao]
Length=351

 Score =   332 bits (852),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 186/338 (55%), Positives = 232/338 (69%), Gaps = 22/338 (7%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EELVVHYLK+K ASAP+PV IIAEVDLYKFDPWELP+KATFGEQEWYFFSPRDRKYPNGA
Sbjct  26    EELVVHYLKRKAASAPLPVTIIAEVDLYKFDPWELPSKATFGEQEWYFFSPRDRKYPNGA  85

Query  1068  RPNRAATSGYWKATGTDKPVLTAGGTQKVGVKKALVFYGGKPPKGVKTNWIMHEYRLADN  889
             RPNRAATSGYWKATGTDKP++T+ G QKVGVKKALVFYGGKPPKG+KTNWIMHEYRL DN
Sbjct  86    RPNRAATSGYWKATGTDKPIVTSNGNQKVGVKKALVFYGGKPPKGIKTNWIMHEYRLVDN  145

Query  888   KTSNKPPGLDIANRSKGGSLRLDDWVLCRIYKKNNSQRPLDHESDDLNDMLQGSIPPFVT  709
              +++KP   D+ANR   GSLRLDDWVLCRIYKKNN+QRP++ + D     +  ++P   T
Sbjct  146   NSTSKPQIADVANRK--GSLRLDDWVLCRIYKKNNTQRPMERDKDYSTVGMLATLPT-ST  202

Query  708   HQK---MGLKPSNYGALLQTDhhhhhhHMFDQGL-------VPGDASLGGARTAQLPFVP  559
             HQ       K ++YG+LL+ + +     +  +G+       +P  AS    +   +    
Sbjct  203   HQNPKPPTSKATSYGSLLENEENFFEGILTGEGMQHSTISQIPA-ASSSSKQDLSMSLAS  261

Query  558   STPNLLPTKRSLPGLFWNVDDSSANNHHPADASPPTKRFLADNNEASISRSDEQNGSIAT  379
             +T N  P KR++P  +WN  +SS         S   KRF  D N +S +  D+ N S  +
Sbjct  262   TTTNTFPVKRTIPPQYWNEPNSSF-------GSQSGKRFQGDLNSSSTAGIDDTN-SFVS  313

Query  378   LLSHLPQTPSLHQQTMLGALNDGVFRQPYQVSGINWYS  265
             LL HLPQ    +  T++G+L DGV RQ + +  +NW S
Sbjct  314   LLHHLPQNAPFYPGTLVGSLGDGVSRQQFILPSMNWNS  351



>ref|XP_010089502.1| NAC domain-containing protein 18 [Morus notabilis]
 gb|EXB37905.1| NAC domain-containing protein 18 [Morus notabilis]
Length=391

 Score =   333 bits (854),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 200/364 (55%), Positives = 239/364 (66%), Gaps = 46/364 (13%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EELVVHYLKKK  SAP+PVAIIAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA
Sbjct  38    EELVVHYLKKKATSAPLPVAIIAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  97

Query  1068  RPNRAATSGYWKATGTDKPVLTAGGTQKVGVKKALVFYGGKPPKGVKTNWIMHEYRLADN  889
             RPNRAATSGYWKATGTDKPVLT+GGTQKVGVKKALVFYGGKPPKG+KTNWIMHEYRLA+N
Sbjct  98    RPNRAATSGYWKATGTDKPVLTSGGTQKVGVKKALVFYGGKPPKGIKTNWIMHEYRLAEN  157

Query  888   KTSNKPPGLDIANRSKGGSLRLDDWVLCRIYKKNNSQRPLDHES---DDLNDMLQGSIPP  718
             K +NKPPG D+ N  K  SLRLDDWVLCRIYKKNN+ R LDH+    D ++DML    P 
Sbjct  158   KANNKPPGCDLGN--KKNSLRLDDWVLCRIYKKNNTNRLLDHQERDHDSIDDMLG---PI  212

Query  717   FVTHQKMGLKPSNYGALLQTDhhhhhhHMFDQGLVPGDASL-------------------  595
               +H    + P N G L Q          +   L   D +L                   
Sbjct  213   NQSHLSNLVGPQNIGKLQQQLPKSATLLSYGSALSENDHNLFDGMLSCSNDNGININAAA  272

Query  594   -----------GGARTAQLPFVPSTPNLLPTKRS-LPGLFWNVDDSSANNHHPADASPPT  451
                          + + Q P      + LP KR+ LPG++WN    + ++      S  T
Sbjct  273   AAAATTTTALASSSCSKQQP----DHHQLPMKRAVLPGMYWNDVVDNDDDGS-GPGSSST  327

Query  450   KRFLADNNE-ASISRSDEQNGSIATLLSHLP-QTPSLHQQTMLGALNDGVFRQPYQVSGI  277
             KR   D++   + +  +    S+ATLLS +P QT SLHQQ++LG L DG+F++P+Q+ G+
Sbjct  328   KRLQLDHDCLGTGTEGNSHANSLATLLSQIPAQTTSLHQQSVLGGLGDGLFQRPFQLPGM  387

Query  276   NWYS  265
             NW+S
Sbjct  388   NWFS  391



>ref|XP_002519008.1| transcription factor, putative [Ricinus communis]
 gb|EEF43219.1| transcription factor, putative [Ricinus communis]
Length=355

 Score =   327 bits (838),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 191/342 (56%), Positives = 227/342 (66%), Gaps = 26/342 (8%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EELVVHYLKKK ASAP+PV IIAEVDLYKFDPWELP+KATFGEQEWYFFSPRDRKYPNGA
Sbjct  26    EELVVHYLKKKAASAPLPVTIIAEVDLYKFDPWELPSKATFGEQEWYFFSPRDRKYPNGA  85

Query  1068  RPNRAATSGYWKATGTDKPVLTAGGTQKVGVKKALVFYGGKPPKGVKTNWIMHEYRLAD-  892
             RPNRAATSGYWKATGTDKP+L + G QKVGVKKALVFYGGKPPKG+KTNWIMHEYRL D 
Sbjct  86    RPNRAATSGYWKATGTDKPILASNGAQKVGVKKALVFYGGKPPKGIKTNWIMHEYRLVDN  145

Query  891   NKTSNKPPGLDIANRSKGGSLRLDDWVLCRIYKKNNSQRPLDHESDDLNDMLQGSIP--P  718
             N +S+KPPG D+AN  K GSLRLDDWVLCRIYKKNNSQR +D + +D  +    ++P  P
Sbjct  146   NNSSSKPPGFDLAN--KKGSLRLDDWVLCRIYKKNNSQRTMDRDKEDSMEGFLATLPINP  203

Query  717   FVTHQKMGLKPSNYGALLQTDhhhhhhHMFDQGLVPGDASLGGARTAQLPFVP-------  559
                   +      YG++L  +      + F+  L  GD     + + Q P          
Sbjct  204   KPASSSVSKPAHAYGSVLDNE-----ENFFEGILTGGDGMQNSSVSHQFPSSSPKQHMSI  258

Query  558   ---STPNLLPTKRSLPGLFWNVDDSSANNHHPADASPPTKRFLADNNEASISRSDEQNGS  388
                ST N L  KR +P  +WN +  + ++     A+   KRF  D N  S S   E N S
Sbjct  259   ASISTSNPLAIKRVIPSQYWNHEAIAGSS---IAAASSGKRFHGDLN--SCSTGTEDNTS  313

Query  387   IATLLSHLPQTPS-LHQQTMLGALNDGVFRQPYQVSGINWYS  265
               +LLS LPQ  +  H  T +G+L DGV RQ +Q+  +NW S
Sbjct  314   FVSLLSQLPQAGAPFHSNTFIGSLGDGVLRQQFQLPSMNWNS  355



>ref|XP_002316635.1| no apical meristem family protein [Populus trichocarpa]
 gb|EEE97247.1| no apical meristem family protein [Populus trichocarpa]
Length=335

 Score =   326 bits (835),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 192/334 (57%), Positives = 236/334 (71%), Gaps = 30/334 (9%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EELVVHYLKKKVAS P+PV IIAE+DLYKFDPWELP+KATFGEQEWYFFSPRDRKYPNGA
Sbjct  26    EELVVHYLKKKVASVPLPVTIIAEIDLYKFDPWELPSKATFGEQEWYFFSPRDRKYPNGA  85

Query  1068  RPNRAATSGYWKATGTDKPVLTAGGTQKVGVKKALVFYGGKPPKGVKTNWIMHEYRLADN  889
             RPNRAATSGYWKATGTDKP+LT+ G QKVGVKKALVFYGGKPPKG+KTNWIMHEYRL +N
Sbjct  86    RPNRAATSGYWKATGTDKPILTSNGAQKVGVKKALVFYGGKPPKGIKTNWIMHEYRLINN  145

Query  888   KTSNKPPGLDIANRSKGGSLRLDDWVLCRIYKKNNSQRPLDHESDDLNDMLQGSIPPFVT  709
               S+KPPG D AN+ KGGSLRLDDWVLCRIYKKNN QR +D   +D  + +  ++P   +
Sbjct  146   NPSSKPPG-DSANK-KGGSLRLDDWVLCRIYKKNNPQRQMDQMEEDSMEGMFTTLPSTSS  203

Query  708   HQK----MGLKPSNYGALLQTDhhhhhhHMFDQGLVPGDASLGGARTAQLPFVPSTPNLL  541
             ++        KP+ Y +LL+ +        F +G++ GD    G +         + N L
Sbjct  204   NKNPKHPSVSKPTGYASLLENE------DTFFEGILTGD----GMQNI-------STNTL  246

Query  540   PTKRSLP-GLFWNVDDSSANNHHPADASPPTKRFLADNNEASISRSDEQNGSIATLLSHL  364
               KRSLP   +WN  +++      A++S   KRF  D N + I+ + E N S  +LL+  
Sbjct  247   SEKRSLPYHQYWN--ETTGLPMGLANSS--AKRFHGDLN-SGITGTQEDNNSFVSLLNQF  301

Query  363   PQ-TPSLHQQTMLGALNDGVFRQPYQVSGINWYS  265
             PQ TP +H  T+LG+L DGV RQ +Q+S +NW S
Sbjct  302   PQSTPLVHPSTLLGSLGDGVLRQTFQLSSLNWNS  335



>ref|XP_007133059.1| hypothetical protein PHAVU_011G148000g [Phaseolus vulgaris]
 gb|ESW05053.1| hypothetical protein PHAVU_011G148000g [Phaseolus vulgaris]
Length=356

 Score =   327 bits (837),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 190/347 (55%), Positives = 232/347 (67%), Gaps = 39/347 (11%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EELVVHYLKKKV S P+PV+IIA+VDLYKFDPWELPAKA+FGE+EWYFFSPRDRKYPNGA
Sbjct  28    EELVVHYLKKKVDSVPLPVSIIADVDLYKFDPWELPAKASFGEEEWYFFSPRDRKYPNGA  87

Query  1068  RPNRAATSGYWKATGTDKPVLTAGGTQKVGVKKALVFYGGKPPKGVKTNWIMHEYRLADN  889
             RPNRAATSGYWKATGTDKP+ +  G QKVGVKK+LVFYGGKPPKGVKT+WIMHEYRLA+ 
Sbjct  88    RPNRAATSGYWKATGTDKPICS--GIQKVGVKKSLVFYGGKPPKGVKTDWIMHEYRLAET  145

Query  888   KTSNKPPGLDIANRSKGGSLRLDDWVLCRIYKKNNSQR-PLDHESDDLNDMLQGSIPPFV  712
             K +N+PPG D+ +  K  SLRLDDWVLCRIYKK N+QR P+DHE DD  D + G +PP +
Sbjct  146   KPNNRPPGCDLGH--KKNSLRLDDWVLCRIYKKGNTQRSPMDHERDDSMDDMIGEVPPSI  203

Query  711   THQKMGLK------PSNY-GALLQTDhhhhhhHMFDQGL---------VPGDASLGGART  580
                 M  +       +NY GALL+ D +     +   G+         +P       ++ 
Sbjct  204   NVGHMNARFHLSKMSTNYSGALLENDRNTLEGVVIGNGVNGISTTTSAMPSQFGTSNSKA  263

Query  579   AQLPFVPSTPNLLPTKRSLPGLFWNVDDSSANNHHPADASPPTKRFLADNNEASISRSDE  400
               LPF  S  N   +KR+L  L+ N +D S   H   D           N   S+ R+++
Sbjct  264   VHLPFALSN-NTSASKRTLSTLY-NWNDDSDEKHFNLDC----------NGNVSVVRTED  311

Query  399   QN---GSIATLLSHLPQTPSLHQQTMLGALNDGVFRQPYQVSGINWY  268
              N   GS ATLL+ LPQTPSL Q   +G++ DG+ R  YQ+ G NWY
Sbjct  312   NNATPGSFATLLNQLPQTPSLPQ---IGSMGDGLLRTQYQIQGTNWY  355



>gb|AID55352.1| NAC protein 1 [Actinidia chinensis]
Length=321

 Score =   325 bits (832),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 203/339 (60%), Positives = 233/339 (69%), Gaps = 54/339 (16%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EELVVHYLKKK ASAP+PV+IIAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA
Sbjct  26    EELVVHYLKKKAASAPLPVSIIAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  85

Query  1068  RPNRAATSGYWKATGTDKPVLTAGGTQKVGVKKALVFYGGKPPKGVKTNWIMHEYRLADN  889
             RPNRAATSGYWKATGTDKPVL++GG+QKVGVKKALVFYGGKPPKGVKTNWIMHEYRL +N
Sbjct  86    RPNRAATSGYWKATGTDKPVLSSGGSQKVGVKKALVFYGGKPPKGVKTNWIMHEYRLVEN  145

Query  888   KTSNKPPGLDIANRSKGGSLRLDDWVLCRIYKKNNSQRPLDHESDD-LNDMLQ----GSI  724
             K ++KPPG D AN  K  SLRLDDWVLCRIYKK+N  RP+DHE DD ++DML      SI
Sbjct  146   KLNSKPPGCDAAN--KKASLRLDDWVLCRIYKKSNLPRPMDHERDDTMSDMLARMPPSSI  203

Query  723   PPFVTHQKMGLKP---SNYGALLQTDhhhhhhHMFDQGLVPGDASLGGARTAQLPFVPST  553
             P  +  Q   L P   ++YG+ L  +     H +FD+ L        G   A +  + S 
Sbjct  204   P--LCQQTPKLPPEKATSYGSFLGNE-----HTLFDEML--------GHDNAYISHLASK  248

Query  552   PNLLPTKRSLPGLFWNVDDSSANNHHPADASPPTKRFLADNNEASISRSDEQNGSIATL-  376
             P  LP KR+LP ++W VDD        A +S   +    D NE S S++DE N S+ATL 
Sbjct  249   PQ-LPMKRALPSVYW-VDDVGE-----AGSSSSKRLIHLDGNEGSTSKTDETN-SMATLL  300

Query  375   --LSHLPQTPSLHQQTMLGALNDGVFRQPYQVSGINWYS  265
               LS LPQTPS+          D VFR         WYS
Sbjct  301   SSLSQLPQTPSMM---------DDVFR---------WYS  321



>gb|AGL39685.1| NAC transcription factor 029 [Jatropha curcas]
 gb|KDP20923.1| hypothetical protein JCGZ_21394 [Jatropha curcas]
Length=369

 Score =   327 bits (837),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 190/350 (54%), Positives = 231/350 (66%), Gaps = 28/350 (8%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EELVVHYLKKK ASAP+PV IIAEVDLYKFDPWELP+KATFGEQEWYFFSPRDRKYPNGA
Sbjct  26    EELVVHYLKKKAASAPLPVTIIAEVDLYKFDPWELPSKATFGEQEWYFFSPRDRKYPNGA  85

Query  1068  RPNRAATSGYWKATGTDKPVLTAGGTQKVGVKKALVFYGGKPPKGVKTNWIMHEYRLAD-  892
             RPNRAATSGYWKATGTDKP+LT+ G QKVGVKKALVFYGGKPPKG+KTNWIMHEYRL D 
Sbjct  86    RPNRAATSGYWKATGTDKPILTSNGAQKVGVKKALVFYGGKPPKGIKTNWIMHEYRLVDN  145

Query  891   -NKTSNKPPGLDIANRSKGGSLRLDDWVLCRIYKKNNSQRPLDHESDD-LNDMLQGSIPP  718
              N +S+KPPG+D AN  K GSLRLDDWVLCRIYKKNNSQRP++ + +D +  +   +   
Sbjct  146   NNNSSSKPPGIDSAN--KKGSLRLDDWVLCRIYKKNNSQRPMERDKEDSMEGLFANATHV  203

Query  717   FVTHQKMGLKPSN-YGALLQTDhhhhhhHMFDQGLVPGDASLGGARTAQLPFVPSTP---  550
                H K   KP+N Y ++L+ + +     +   G    ++S+            S+P   
Sbjct  204   LPIHPKPPSKPTNSYASVLENEENFFEGILTGGGDGMQNSSISHHHHHHQLAPSSSPKPH  263

Query  549   ---------------NLLPTKRSLPGLFWNVDDSSANNHHPADASPPTKRFLADNNEASI  415
                            + +P KR LP  +W+ +  S+     + +    KRF  D N  S 
Sbjct  264   ISMASASGSTNCDANSSIPVKRILPSQYWSNETGSSMAGGGSSS---GKRFHGDLNN-SC  319

Query  414   SRSDEQNGSIATLLSHLPQTPSLHQQTMLGALNDGVFRQPYQVSGINWYS  265
             S + E N S  +LLS +PQT   H  T LG+L DGV RQ +Q+  +NW S
Sbjct  320   STATEDNSSFVSLLSQIPQTAPFHPNTFLGSLGDGVLRQQFQLPSMNWNS  369



>ref|XP_011027905.1| PREDICTED: NAC transcription factor 25-like [Populus euphratica]
Length=351

 Score =   325 bits (832),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 187/338 (55%), Positives = 227/338 (67%), Gaps = 22/338 (7%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EELVVHYLKKK AS P+PV IIAE+DLYKFDPWELP+KATFGEQEWYFFSPRDRKYPNGA
Sbjct  26    EELVVHYLKKKAASVPLPVTIIAEIDLYKFDPWELPSKATFGEQEWYFFSPRDRKYPNGA  85

Query  1068  RPNRAATSGYWKATGTDKPVLTAGGTQKVGVKKALVFYGGKPPKGVKTNWIMHEYRLADN  889
             RPNRAATSGYWKATGTDKP+LT+ G QKVGVKKALVFYGGKPPKG+KTNWIMHEYRL +N
Sbjct  86    RPNRAATSGYWKATGTDKPILTSNGAQKVGVKKALVFYGGKPPKGIKTNWIMHEYRLIEN  145

Query  888   KTSNKPPGLDIANRSKGGSLRLDDWVLCRIYKKNNSQRPLDHESDDLNDMLQGSIPPFVT  709
              +S KPP  D AN+ KGGSLRLDDWVLCRIYKKNNSQRP+D    D  D ++G       
Sbjct  146   NSSPKPPAADSANK-KGGSLRLDDWVLCRIYKKNNSQRPMDQR--DREDSMEGMFAALQN  202

Query  708   HQKMGLKPSNYGALLQTDhhhhhhHMFDQGLVPGDASLGGARTA--------QLPFVPST  553
                   KP +            +   F +G++ GD    G+ +          +   P +
Sbjct  203   SSHQNSKPPSASKHTAYASLLVNEDTFFEGILTGDGIQNGSISQLPSSSSKPNMSLAPVS  262

Query  552   PNLLPTKRSL-PGLFWNVDDSSANNHHPADASPPTKRFLADNNEASISRSDEQNGSIATL  376
              N     R+L P  +WN  D++ +    A++S   KRF  + N + I+ + E N S  ++
Sbjct  263   TNTFTATRTLPPHQYWN--DATGSPVGLANSS--GKRFHGELN-SGITGTQEDNTSFVSM  317

Query  375   LSHLPQ-TPSLHQQTMLGALNDGVFRQPYQVSGINWYS  265
             L+ LPQ TP +H  T+L    DGV RQP+Q+S +NW S
Sbjct  318   LNQLPQSTPLVHPSTLL----DGVLRQPFQLSSLNWNS  351



>ref|XP_002305677.1| no apical meristem family protein [Populus trichocarpa]
 gb|EEE86188.1| no apical meristem family protein [Populus trichocarpa]
Length=351

 Score =   324 bits (831),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 190/344 (55%), Positives = 231/344 (67%), Gaps = 34/344 (10%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EELVVHYLKKK AS P+PV IIAE+DLYKFDPWELP+KATFGEQEWYFFSPRDRKYPNGA
Sbjct  26    EELVVHYLKKKAASVPLPVTIIAEIDLYKFDPWELPSKATFGEQEWYFFSPRDRKYPNGA  85

Query  1068  RPNRAATSGYWKATGTDKPVLTAGGTQKVGVKKALVFYGGKPPKGVKTNWIMHEYRLADN  889
             RPNRAATSGYWKATGTDKP+LT+ G QKVGVKKALVFYGGKPPKG+KTNWIMHEYRL +N
Sbjct  86    RPNRAATSGYWKATGTDKPILTSNGAQKVGVKKALVFYGGKPPKGIKTNWIMHEYRLIEN  145

Query  888   KTSNKPPGLDIANRSKGGSLRLDDWVLCRIYKKNNSQRPLDHESDDLNDMLQGSIPPFVT  709
              +S KPP  D AN+ KGGSLRLDDWVLCRIYKKNNSQRP+D    D  D ++G       
Sbjct  146   NSSPKPPAADSANK-KGGSLRLDDWVLCRIYKKNNSQRPMDQR--DKEDSMEGMFATLQN  202

Query  708   HQKMGLKP------SNYGALLQTDhhhhhhHMFDQGLVPGDASLGGARTA--------QL  571
                   KP      + Y +LL  +        F +G++ GD    G+ +          +
Sbjct  203   SSHQNPKPLSASKHTAYASLLVNEDT------FFEGILTGDGMQNGSISQLPSSSSKPNM  256

Query  570   PFVPSTPNLLPTKRSL-PGLFWNVDDSSANNHHPADASPPTKRFLADNNEASISRSDEQN  394
                P + N     R+L P  +WN  D++ +    A++S   KRF  + N + I+ + E N
Sbjct  257   SMAPVSANTFTATRTLPPHQYWN--DATGSPVGLANSS--GKRFHGELN-SGITGTQEDN  311

Query  393   GSIATLLSHLPQ-TPSLHQQTMLGALNDGVFRQPYQVSGINWYS  265
              S  ++L+ LPQ TP +H  T+L    DGV RQP+Q+S +NW S
Sbjct  312   TSFVSMLNQLPQSTPLVHPSTLL----DGVLRQPFQLSSLNWNS  351



>ref|XP_006451941.1| hypothetical protein CICLE_v10008628mg [Citrus clementina]
 ref|XP_006464707.1| PREDICTED: NAC transcription factor 25-like [Citrus sinensis]
 gb|ESR65181.1| hypothetical protein CICLE_v10008628mg [Citrus clementina]
 gb|KDO74152.1| hypothetical protein CISIN_1g016791mg [Citrus sinensis]
Length=382

 Score =   325 bits (834),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 205/369 (56%), Positives = 242/369 (66%), Gaps = 54/369 (15%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EELVVHYLKKK +SAP+PV+IIAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA
Sbjct  27    EELVVHYLKKKASSAPLPVSIIAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  86

Query  1068  RPNRAATSGYWKATGTDKPVLTAGGTQKVGVKKALVFYGGKPPKGVKTNWIMHEYRLADN  889
             RPNRAATSGYWKATGTDKPV+++G  QKVGVKKALVFYGGKPPKG+KTNWIMHEYRL DN
Sbjct  87    RPNRAATSGYWKATGTDKPVMSSGSNQKVGVKKALVFYGGKPPKGIKTNWIMHEYRLTDN  146

Query  888   KTSNKPPGLDIANRSKGGSLRLDDWVLCRIYKKNNSQRPL--DHESDDLNDMLQGSIPP-  718
             K SNKPPG D+ N  K  SLRLDDWVLCRIYKKNN  RPL    + D ++DML   IPP 
Sbjct  147   KVSNKPPGCDLGN--KKNSLRLDDWVLCRIYKKNNLHRPLMDHDKDDSMDDMLGVHIPPS  204

Query  717   -FVTHQKM-----------GLKPSNYGALLQTDhhhhhhHMFDQGLVPGDASLGGARTAQ  574
               ++ Q+            G   +++GALL  + +      F +GL   D     +    
Sbjct  205   LMISSQQQNTNLKLHMPTRGANLNSFGALLVNEPN------FFEGLTSHDGINNNSSNNN  258

Query  573   LP---------FVPSTPNLLPT------KRSLPGLFWNVDDSSANNHHPADASPPTKRFL  439
                        F  S+ + L        KR+LP   W   +       P+  +   KRF 
Sbjct  259   NGSISSHHHHQFAASSSSKLQVQAMDSLKRTLPSSSWTDHEDV-----PSGGALVNKRFH  313

Query  438   ADNN---EASISRSDEQNG----SIATLLSHLPQT---PSLHQQTMLGALNDGVFRQPY-  292
              +NN   + SI    + +G    SIATLLS LPQT   PS+HQQ +LG+L DG+FRQPY 
Sbjct  314   GENNVNDDQSIEGRTDHHGNGSSSIATLLSQLPQTPPPPSIHQQAILGSLGDGIFRQPYH  373

Query  291   QVSGINWYS  265
             Q+ G+NWYS
Sbjct  374   QLPGMNWYS  382



>gb|AID55348.1| NAC protein 1 [Actinidia arguta]
Length=321

 Score =   323 bits (828),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 201/337 (60%), Positives = 229/337 (68%), Gaps = 50/337 (15%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EELVVHYLKKK ASAP+PV+IIAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA
Sbjct  26    EELVVHYLKKKAASAPLPVSIIAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  85

Query  1068  RPNRAATSGYWKATGTDKPVLTAGGTQKVGVKKALVFYGGKPPKGVKTNWIMHEYRLADN  889
             RPNRAATSGYWKATGTDKPVL++GG+QKVGVKKALVFYGGKPPKGVKTNWIMHEYRL +N
Sbjct  86    RPNRAATSGYWKATGTDKPVLSSGGSQKVGVKKALVFYGGKPPKGVKTNWIMHEYRLVEN  145

Query  888   KTSNKPPGLDIANRSKGGSLRLDDWVLCRIYKKNNSQRPLDHESDD-LNDMLQGSIP---  721
             K ++KPPG D AN  K  SLRLDDWVLCRIYKK+N  RPLDHE DD ++DML    P   
Sbjct  146   KLNSKPPGCDAAN--KKASLRLDDWVLCRIYKKSNHPRPLDHERDDTMSDMLARMPPSSI  203

Query  720   PFVTHQKM--GLKPSNYGALLQTDhhhhhhHMFDQGLVPGDASLGGARTAQLPFVPSTPN  547
             P   H       K ++YG+ L  +     H +FD+ L        G     +  + S P 
Sbjct  204   PLCQHTPKLPPEKATSYGSFLGNE-----HTLFDEML--------GHDNTYISHLASKPQ  250

Query  546   LLPTKRSLPGLFWNVDDSSANNHHPADASPPTKRFLADNNEASISRSDEQNGSIATL---  376
              LP KR+LP ++W VDD        A +S   +    D NE S S++DE N S+ATL   
Sbjct  251   -LPMKRALPSVYW-VDDVGE-----AGSSSSKRVIHLDGNEGSTSKTDETN-SMATLLSS  302

Query  375   LSHLPQTPSLHQQTMLGALNDGVFRQPYQVSGINWYS  265
             LS LPQTPS+          D VFR         WYS
Sbjct  303   LSQLPQTPSMM---------DDVFR---------WYS  321



>ref|XP_006841705.1| hypothetical protein AMTR_s00003p00252470 [Amborella trichopoda]
 gb|ERN03380.1| hypothetical protein AMTR_s00003p00252470 [Amborella trichopoda]
Length=349

 Score =   321 bits (822),  Expect = 9e-103, Method: Compositional matrix adjust.
 Identities = 194/345 (56%), Positives = 226/345 (66%), Gaps = 39/345 (11%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EELVVHYLKKK +SAP+PV IIAEVDLYKFDPWELP KATFGEQEWYFFSPRDRKYPNGA
Sbjct  26    EELVVHYLKKKASSAPLPVTIIAEVDLYKFDPWELPGKATFGEQEWYFFSPRDRKYPNGA  85

Query  1068  RPNRAATSGYWKATGTDKPVLTAGGTQKVGVKKALVFYGGKPPKGVKTNWIMHEYRLADN  889
             RPNRAATSGYWKATGTDKP+LT+GGTQKVGVKKALVFYGG+PPKG+KTNWIMHEYRL D 
Sbjct  86    RPNRAATSGYWKATGTDKPILTSGGTQKVGVKKALVFYGGRPPKGIKTNWIMHEYRLTDG  145

Query  888   KTSNKPPGLDIANRSKGGSLRLDDWVLCRIYKKNN-SQRPLDHESDDLNDMLQGSIPPF-  715
                N  P  D++N +K  SLRLDDWVLCRIYKKNN S R ++ E +D  D +   +P   
Sbjct  146   --GNTKPNNDLSNNNKKSSLRLDDWVLCRIYKKNNQSPRLMEREREDSMDDMLAPLPSMD  203

Query  714   -VTHQKMGLKPSNYGALLQTDhhhhhhHMFDQGLVPGDASLGGARTAQLPF---------  565
                H+    KPS +GALL+ +      + FD  L     S       QLP          
Sbjct  204   GQPHKLPAQKPSTFGALLENE------NFFDGLLTDDGVSNNMNSMPQLPSSHQQNSTKS  257

Query  564   ---VPSTPNLLPTKRSLPGLFWNVDDSSANNHHPADASPPTKRFLADNNEASISRSDEQN  394
                +P  P  LP KR+LP  +WN             A P  KRF ++    S S S++ +
Sbjct  258   GGDLPLAPAALPFKRTLPSPYWN-----------EAAMPLAKRFQSNQ---STSGSNDGS  303

Query  393   GSIATLLSHLPQTPS-LHQQTMLGALNDGVFRQPY-QVSGINWYS  265
              SIATLL+ LP   +  H Q +L ++ DGVFR  Y Q SGINW S
Sbjct  304   NSIATLLNQLPGAAAPFHHQGLLSSIGDGVFRPQYQQFSGINWNS  348



>ref|XP_003635288.1| PREDICTED: NAC transcription factor 25 [Vitis vinifera]
Length=326

 Score =   320 bits (819),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 178/334 (53%), Positives = 231/334 (69%), Gaps = 39/334 (12%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EELVVHYLK+K AS P+PV IIA+VDLYKFDPWELP+KATFGEQEWYFFSPRDRKYPNGA
Sbjct  26    EELVVHYLKRKAASVPLPVTIIADVDLYKFDPWELPSKATFGEQEWYFFSPRDRKYPNGA  85

Query  1068  RPNRAATSGYWKATGTDKPVLTAGGTQKVGVKKALVFYGGKPPKGVKTNWIMHEYRLADN  889
             RPNRAATSGYWKATGTDKP+LT+ G+QKVGVKKALVFYGGKPPKG+KTNWIMHEYRL D+
Sbjct  86    RPNRAATSGYWKATGTDKPILTSNGSQKVGVKKALVFYGGKPPKGIKTNWIMHEYRLIDS  145

Query  888   KTSN-KPPGLDIANRSKGGSLRLDDWVLCRIYKKNNSQRPLDHESDDLNDMLQGSIPP-F  715
              +SN KPPG D+ N  K GSLRLDDWVLCRIYKKN SQRP++ + ++  + L  S+P   
Sbjct  146   TSSNTKPPGADMGN--KKGSLRLDDWVLCRIYKKNISQRPMERDKEESMEALLASLPASS  203

Query  714   VTHQK----MGLKPSNYGALLQTDhhhhhhHMFDQGLVPGDASLGGARTAQLPFVPSTPN  547
             +T Q+      L+ +N+GA+L+ +          +G++ G  S+ G +++ +        
Sbjct  204   MTSQQNTRAQTLRSTNFGAVLEHEEISF------EGMLTGQ-SIQGLQSSSM--------  248

Query  546   LLPTKRSLPGLFWNVDDSSANNHHPADASPPTKRFLADNNEASISRSDEQNGSIATLLSH  367
                        +WN     A +  P+ +    K    D+   + +   + N S  +LL+ 
Sbjct  249   ---------SQYWN----GAGSIGPSSSG---KHLHTDHTSGTSTSEMDGNSSFVSLLNQ  292

Query  366   LPQTPSLHQQTMLGALNDGVFRQPYQVSGINWYS  265
             LPQ+ + HQ T+LG+L DG +RQP+++ G+NW S
Sbjct  293   LPQSGTFHQNTLLGSLADGAYRQPHRLPGMNWNS  326



>ref|XP_004291668.1| PREDICTED: NAC transcription factor ONAC010-like [Fragaria vesca 
subsp. vesca]
Length=344

 Score =   319 bits (818),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 202/344 (59%), Positives = 230/344 (67%), Gaps = 44/344 (13%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EELVVHYLKKK +SAP+PVAIIAEVDLYKFDPW+LP KATFGEQEWYFFSPRDRKYPNGA
Sbjct  29    EELVVHYLKKKASSAPLPVAIIAEVDLYKFDPWQLPEKATFGEQEWYFFSPRDRKYPNGA  88

Query  1068  RPNRAATSGYWKATGTDKPVLT-----AGGTQKVGVKKALVFYGGKPPKGVKTNWIMHEY  904
             RPNRAATSGYWKATGTDKPVL+      GGT+KVGVKKALVFY GKPPKG+KTNWIMHEY
Sbjct  89    RPNRAATSGYWKATGTDKPVLSTTDEGGGGTRKVGVKKALVFYRGKPPKGIKTNWIMHEY  148

Query  903   RLADNKTSNKPP--GLDIANRSKGGSLRLDDWVLCRIYKKNNSQRPLDHESDDLNDMLQG  730
             R+ADN TSNKPP    D+ N  K  SLRLDDWVLCRIYKKNN+ RP+D E D ++  +  
Sbjct  149   RIADNNTSNKPPPGCHDLGN--KKNSLRLDDWVLCRIYKKNNTHRPMDLE-DSMDGTMGS  205

Query  729   SIPPFVTHQKMGLKP----SNYGALLQTDhhhhhhHMFDQGLVPGDASLGGARTAQLPFV  562
             S P    H    L P    S YG  +  DH+      F  G+V  +     A  + LP  
Sbjct  206   SFPLSKLHH---LPPKSTTSTYGQFMDNDHN------FYDGMVSSEGINTSA--SFLPNS  254

Query  561   PSTPNLLPTKRSLPGLFWNVDDSSANNHHPADASPPTKRFLADNNEASISRSDEQNGSIA  382
                 + LP KR LP L+W        NH P D + P++R   D+++ S       NGSIA
Sbjct  255   ALANSSLPLKRELPNLYW--------NHDPEDEAGPSRRLHMDSSDQSTG-----NGSIA  301

Query  381   TLLSHLPQT-PSLHQQTMLGALN---DGVFRQP-YQVSGINWYS  265
              LLS LPQT P LHQQ MLG      D +FR   YQ+ G NWYS
Sbjct  302   ILLSQLPQTPPPLHQQPMLGTSQLGGDALFRSTQYQLPG-NWYS  344



>ref|XP_003541120.1| PREDICTED: NAC domain-containing protein 18-like [Glycine max]
 gb|KHN48759.1| NAC domain-containing protein 18 [Glycine soja]
Length=360

 Score =   319 bits (818),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 191/359 (53%), Positives = 230/359 (64%), Gaps = 59/359 (16%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EELVVHYLKKKV S P+PV+IIA+VDLYKFDPWELPAKA+FG +EWYFFSPR+RKYPNGA
Sbjct  28    EELVVHYLKKKVDSVPLPVSIIADVDLYKFDPWELPAKASFGAEEWYFFSPRERKYPNGA  87

Query  1068  RPNRAATSGYWKATGTDKPVLTAGGTQKVGVKKALVFYGGKPPKGVKTNWIMHEYRLADN  889
             RPNRAATSGYWKATGTDKP+ +  GTQKVGVKK+LVFYGGKPPKGVKT+WIMHEYR+ +N
Sbjct  88    RPNRAATSGYWKATGTDKPICS--GTQKVGVKKSLVFYGGKPPKGVKTDWIMHEYRVTEN  145

Query  888   KTSNKPPGLDIANRSKGGSLRLDDWVLCRIYKKNNSQRPLDHESDDLNDMLQGSIPPFVT  709
             K +N+PPG D+ +  K  SLRLDDWVLCRIYKK N+QR   HE DD  D + G +PP + 
Sbjct  146   KPNNRPPGCDLGH--KKNSLRLDDWVLCRIYKKGNTQR--SHERDDSIDDMIGEVPPSIN  201

Query  708   HQKMG-------LKPSNYGALLQTDhhhhhhHMFDQGLVPGDAS---------------L  595
                M        +  S  GALL+ D +     +   G V G ++                
Sbjct  202   VGHMSARFHLSRMSTSYSGALLENDRNTLEGVVIGNGSVNGISNTNNITSVISSSHQFGT  261

Query  594   GGARTAQLPFVPS--TPNLLPTKRSLPGLFWNVDDSSANNHHPADASPPTKRFLADNNEA  421
               ++   LPFVPS  T N   +KR+L  L+WNVDD    N             L  N   
Sbjct  262   SNSKAELLPFVPSNNTSNSA-SKRTLSSLYWNVDDHKHFN-------------LDSNGNV  307

Query  420   SISRSDEQ--------NGSIATLLSHLPQTPSLHQQTMLGALNDGVFRQPYQVSGINWY  268
             S+ R+D++        +GS ATLL+ LPQTPSL Q        DG+ R PYQ+ G NWY
Sbjct  308   SVLRTDQENNNNNNGTSGSFATLLNQLPQTPSLPQI-------DGLLRTPYQIQGTNWY  359



>ref|XP_011047846.1| PREDICTED: NAC transcription factor 25-like [Populus euphratica]
Length=355

 Score =   319 bits (817),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 188/343 (55%), Positives = 230/343 (67%), Gaps = 28/343 (8%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EELVVHYLKKK AS P+PV IIAE+DLYKFDPWELP+KATFGEQEWYFFSPRDRKYPNGA
Sbjct  26    EELVVHYLKKKAASVPLPVTIIAEIDLYKFDPWELPSKATFGEQEWYFFSPRDRKYPNGA  85

Query  1068  RPNRAATSGYWKATGTDKPVLTAGGTQKVGVKKALVFYGGKPPKGVKTNWIMHEYRLADN  889
             RPNRAA SGYWKATGTDKP+LT+ G QKVGVKKALVFYGGKPPKG+KTNWIMHEYRL +N
Sbjct  86    RPNRAAPSGYWKATGTDKPILTSNGAQKVGVKKALVFYGGKPPKGIKTNWIMHEYRLINN  145

Query  888   KTSNKPPGLDIANRSKGGSLRLDDWVLCRIYKKNNSQRPLDH-ESDDLNDMLQGSIPPFV  712
               S+KPPG D AN+ KGGSLRLDDWVLCRIYKKNN QR +D  E +D  + +  ++P   
Sbjct  146   NPSSKPPG-DSANK-KGGSLRLDDWVLCRIYKKNNPQRQMDQMEEEDSIEGMFATLPSTS  203

Query  711   THQK----MGLKPSNYGALLQTDhhhhhhHMFDQGLVPGDASLGGARTA--------QLP  568
             +++        KP+ Y +LL+ +        F +G++ GD     + +          + 
Sbjct  204   SNKNPKHPSVSKPAGYASLLENEDT------FFEGILTGDGMQNSSISQLPSSSLRPNMS  257

Query  567   FVPSTPNLLPTKRSLP-GLFWNVDDSSANNHHPADASPPTKRFLADNNEASISRSDEQNG  391
                 + N L  KRSLP   +WN             A+   KRF  D N + I+ + E N 
Sbjct  258   MTSVSTNTLSEKRSLPYHQYWN----ETTGLPMGLATSSAKRFHGDLN-SGITGTQEDNN  312

Query  390   SIATLLSHLPQ-TPSLHQQTMLGALNDGVFRQPYQVSGINWYS  265
             S  +LL+  PQ TP +H  T+ G+L DGV RQ +Q+S +NW S
Sbjct  313   SFVSLLNQFPQSTPLVHPSTLHGSLGDGVLRQTFQLSSLNWNS  355



>ref|XP_008452274.1| PREDICTED: NAC transcription factor 25-like [Cucumis melo]
Length=353

 Score =   314 bits (805),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 195/351 (56%), Positives = 230/351 (66%), Gaps = 46/351 (13%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EELVVHYLKKK  S+P+PVAIIAEVDLYKFDPWELPAKATFGEQEWYFFSPR+RKYPNGA
Sbjct  26    EELVVHYLKKKANSSPLPVAIIAEVDLYKFDPWELPAKATFGEQEWYFFSPRERKYPNGA  85

Query  1068  RPNRAATSGYWKATGTDKPVLTAGGT-QKVGVKKALVFYGGKPPKGVKTNWIMHEYRLAD  892
             RPNRAATSGYWKATGTDKPVL A G+ QKVGVKKALVFYGGKPPKG+KTNWIMHEYRLAD
Sbjct  86    RPNRAATSGYWKATGTDKPVLAADGSNQKVGVKKALVFYGGKPPKGIKTNWIMHEYRLAD  145

Query  891   NKTS-NKPPGLDIANRSKGGSLRLDDWVLCRIYKKNNSQRPLDHESDDLNDMLQGSIPPF  715
             NK   NKPPG D+AN  K  SL+LDDWVLCRIYKKNNS RP+D E +D  + + GSIP  
Sbjct  146   NKPCINKPPGYDLAN--KKNSLKLDDWVLCRIYKKNNSHRPMDQEREDSMEEMIGSIPHS  203

Query  714   V----THQKMGLKPSNYGALLQTDhhhhhhHMFDQGLVPGDASLGGARTAQLPFVPSTPN  547
             +     + K+G+   NY  LL+ D +        QG+V  +++      A         N
Sbjct  204   LRLNDQYPKLGI---NYTTLLENDQN------LLQGIVANNSNDNNNNGA-------LSN  247

Query  546   LLPTKRSLPGLFWNVDDSSANNHHPADASPPTKRF---LADNNEASISRSDEQN------  394
                +KR    LFW  +D      H   +S     F     D    SI+R+   N      
Sbjct  248   ATNSKRPA-SLFWTDEDQD----HSGISSNKRLHFENTTTDGASTSITRTHSSNHNNLQS  302

Query  393   --GSIATLLSHLPQT--PSLHQ----QTMLGALNDGVFRQPYQVSGINWYS  265
                S  TLL++LPQT  P +H      ++L ++ DG+FR  YQ+ G NWYS
Sbjct  303   STSSFTTLLTNLPQTPPPPMHHHGGAHSVLASIGDGLFRPAYQIPGANWYS  353



>ref|XP_004149287.1| PREDICTED: NAC transcription factor 25-like [Cucumis sativus]
 gb|KGN56220.1| hypothetical protein Csa_3G100800 [Cucumis sativus]
Length=353

 Score =   314 bits (804),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 191/346 (55%), Positives = 228/346 (66%), Gaps = 37/346 (11%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EELVVHYLKKK  S+P+PVAIIAEVDLYKFDPWELPAKATFGEQEWYFFSPR+RKYPNGA
Sbjct  27    EELVVHYLKKKANSSPLPVAIIAEVDLYKFDPWELPAKATFGEQEWYFFSPRERKYPNGA  86

Query  1068  RPNRAATSGYWKATGTDKPVLTAGGT-QKVGVKKALVFYGGKPPKGVKTNWIMHEYRLAD  892
             RPNRAATSGYWKATGTDKPVL + G+ QKVGVKKALVFYGGKPPKG+KTNWIMHEYRLAD
Sbjct  87    RPNRAATSGYWKATGTDKPVLASDGSNQKVGVKKALVFYGGKPPKGIKTNWIMHEYRLAD  146

Query  891   NKTS-NKPPGLDIANRSKGGSLRLDDWVLCRIYKKNNSQRPLDHESDDLNDMLQGSIPPF  715
             NK   NKPPG D+AN  K  SL+LDDWVLCRIYKKNNS RP+D E +D  + + GSIP  
Sbjct  147   NKPCINKPPGYDLAN--KKNSLKLDDWVLCRIYKKNNSHRPMDQEREDSMEEMIGSIPHS  204

Query  714   V----THQKMGLKPSNYGALLQTDhhhhhhHMFDQGLVPGDASLGGARTAQLPFVPSTPN  547
             +     + K+G+   NY  LL+           DQ L+ G  +           V +  N
Sbjct  205   LRLNDQYPKLGI---NYSTLLEN----------DQNLLQGIVANNNNDNNNNGAVSNGTN  251

Query  546   LLPTKRSLPGLFWNVDD------SSANNHHPADASPPTKRFLADNNEASISRSDEQNGSI  385
                +KR    LFW+ +D      SS    H  + +      +   + +S +       S 
Sbjct  252   ---SKRPA-SLFWSDEDQDHSGISSNKRLHFENTTDGASTSITRTHSSSHNNLQNSTSSF  307

Query  384   ATLLSHLPQT--PSLHQ----QTMLGALNDGVFRQPYQVSGINWYS  265
              TLL++LPQT  P LH      ++L ++ DG+FR  YQ+ G NWYS
Sbjct  308   TTLLTNLPQTPPPPLHHHSGAHSVLASIGDGLFRPAYQIPGANWYS  353



>ref|XP_004174082.1| PREDICTED: LOW QUALITY PROTEIN: NAC transcription factor 25-like, 
partial [Cucumis sativus]
Length=333

 Score =   312 bits (800),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 190/346 (55%), Positives = 227/346 (66%), Gaps = 37/346 (11%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EELVVHYL KK  S+P+PVAIIAEVDLYKFDPWELPAKATFGEQEWYFFSPR+RKYPNGA
Sbjct  7     EELVVHYLXKKANSSPLPVAIIAEVDLYKFDPWELPAKATFGEQEWYFFSPRERKYPNGA  66

Query  1068  RPNRAATSGYWKATGTDKPVLTAGGT-QKVGVKKALVFYGGKPPKGVKTNWIMHEYRLAD  892
             RPNRAATSGYWKATGTDKPVL + G+ QKVGVKKALVFYGGKPPKG+KTNWIMHEYRLAD
Sbjct  67    RPNRAATSGYWKATGTDKPVLASDGSNQKVGVKKALVFYGGKPPKGIKTNWIMHEYRLAD  126

Query  891   NK-TSNKPPGLDIANRSKGGSLRLDDWVLCRIYKKNNSQRPLDHESDDLNDMLQGSIPPF  715
             NK   NKPPG D+AN  K  SL+LDDWVLCRIYKKNNS RP+D E +D  + + GSIP  
Sbjct  127   NKPCINKPPGYDLAN--KKNSLKLDDWVLCRIYKKNNSHRPMDQEREDSMEEMIGSIPHS  184

Query  714   V----THQKMGLKPSNYGALLQTDhhhhhhHMFDQGLVPGDASLGGARTAQLPFVPSTPN  547
             +     + K+G+   NY  LL+           DQ L+ G  +           V +  N
Sbjct  185   LRLNDQYPKLGI---NYSTLLEN----------DQNLLQGIVANNNNDNNNNGAVSNGTN  231

Query  546   LLPTKRSLPGLFWNVDD------SSANNHHPADASPPTKRFLADNNEASISRSDEQNGSI  385
                +KR    LFW+ +D      SS    H  + +      +   + +S +       S 
Sbjct  232   ---SKRPA-SLFWSDEDQDHSGISSNKRLHFENTTDGASTSITRTHSSSHNNLQNSTSSF  287

Query  384   ATLLSHLPQT--PSLHQ----QTMLGALNDGVFRQPYQVSGINWYS  265
              TLL++LPQT  P LH      ++L ++ DG+FR  YQ+ G NWYS
Sbjct  288   TTLLTNLPQTPPPPLHHHSGAHSVLASIGDGLFRPAYQIPGANWYS  333



>ref|XP_009392346.1| PREDICTED: NAC transcription factor NAM-B2-like [Musa acuminata 
subsp. malaccensis]
Length=389

 Score =   310 bits (794),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 193/375 (51%), Positives = 232/375 (62%), Gaps = 64/375 (17%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EELVVHYLKKK A+AP+PVAII EVDLYKFDPWELP KA FGEQEWYFFSPRDRKYPNGA
Sbjct  32    EELVVHYLKKKAAAAPLPVAIITEVDLYKFDPWELPGKANFGEQEWYFFSPRDRKYPNGA  91

Query  1068  RPNRAATSGYWKATGTDKPVLTAGGTQ-KVGVKKALVFYGGKPPKGVKTNWIMHEYRLAD  892
             RPNRAATSGYWKATGTDKPVLT+GG+Q KVGVKKALVFY G+PP+G KTNWIMHEYRLAD
Sbjct  92    RPNRAATSGYWKATGTDKPVLTSGGSQVKVGVKKALVFYRGRPPRGTKTNWIMHEYRLAD  151

Query  891   NKTSN-------KPP-GLDIANRSKGGSLRLDDWVLCRIYKKNNSQ----RPLDHESDDL  748
               +         +PP G  +AN+ KGGSLRLDDWVLCRIYKKNNS     RP   + +  
Sbjct  152   GSSPENSSSSSCRPPYGGHMANKKKGGSLRLDDWVLCRIYKKNNSVSDSLRPTHRDREGA  211

Query  747   NDMLQGSIPPFVTHQKMGLK----PSNYGALLQTDhhhhhhHMFDQGLVPGDASLGGART  580
              D + GS P  V HQ  G++    P+NY +LL+ D        F +GL+  +  L     
Sbjct  212   TDDMLGSAPS-VAHQ-TGMQPQRAPTNYNSLLEHD------ETFLEGLLANEVGLPTNSI  263

Query  579   AQL------------PFVPSTPNLLPTKRSLPGLFWNVDDSSANNHHPAD-ASPPTKRFL  439
               L            P  PST    PT+  L   +W           P D A+PP +RF 
Sbjct  264   THLAAAAARAKLNLSPVPPSTTGTFPTRHPLSSAYWT---------EPTDIAAPPAQRFH  314

Query  438   ADNNEASISRSDEQNGSIAT---------------LLSHLPQTPSLHQQTMLGALNDG--  310
             A +   S + +D+ N S  +               LL+ +P   + H Q +LG+L DG  
Sbjct  315   AGHGSGSNNAADKNNTSSCSNGSATNDDGGHTNQMLLNQIPYGTTYHDQMILGSLRDGGA  374

Query  309   VFRQPYQVSGINWYS  265
             +F+QPYQ+ G+NW S
Sbjct  375   IFQQPYQLPGVNWTS  389



>gb|AID55354.1| NAC protein 3 [Actinidia chinensis]
Length=319

 Score =   306 bits (783),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 185/328 (56%), Positives = 215/328 (66%), Gaps = 34/328 (10%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EELVVHYLKKKVASA +PVAII E+DLYKFDPWELPAKA FGEQE YFFSPRDRKYPNGA
Sbjct  26    EELVVHYLKKKVASATLPVAIITEIDLYKFDPWELPAKAMFGEQELYFFSPRDRKYPNGA  85

Query  1068  RPNRAATSGYWKATGTDKPVLTAGGTQKVGVKKALVFYGGKPPKGVKTNWIMHEYRLADN  889
             RPNR ATSGYWKATG DKPVLT+ GTQKVGVKKALVFY GKPPKGVKTNWIMHEYRL DN
Sbjct  86    RPNRTATSGYWKATGIDKPVLTSSGTQKVGVKKALVFYRGKPPKGVKTNWIMHEYRLIDN  145

Query  888   KTSNKPPGLDIANRSKGGSLRLDDWVLCRIYKKNNSQRPLDHESDDLNDMLQGSIPPFVT  709
             +  +KPPG D A  SK GSLRLDDWVLCRIYKKN   R + HE +D    L  +I     
Sbjct  146   RAKSKPPGYD-AGHSK-GSLRLDDWVLCRIYKKNYPSRLIGHEKEDSMTDLPPTIFSIPQ  203

Query  708   HQKMGLKPSNYGALLQTDhhhhhhHMFDQGLVPGDASLGGARTAQLPFVPSTPNLLPTKR  529
             +Q   L P+   +  Q     H HH+FD+ L     S     TA         +L   KR
Sbjct  204   NQTPKLPPTKPISYTQIPLLDHDHHLFDEML-----SHSSTDTAA--------SLSHLKR  250

Query  528   SLPGLFWNVDDSSANNHHPADASPPTKRFLADNNEASISRSDEQNGSIATLLSHLPQTPS  349
             +LP L+W            A+ S  +KR     +  +++R+ E + SIA+LLS +P    
Sbjct  251   TLPPLYW------------ANESEASKRLHEGTSNETVARTRENDSSIASLLSQMP----  294

Query  348   LHQQTMLGALNDGVFRQPYQVSGINWYS  265
                QT++  + DG FRQPY    +NWYS
Sbjct  295   ---QTVMRPIGDGGFRQPYSHPSLNWYS  319



>ref|XP_006449287.1| hypothetical protein CICLE_v10015688mg [Citrus clementina]
 gb|ESR62527.1| hypothetical protein CICLE_v10015688mg [Citrus clementina]
Length=365

 Score =   305 bits (780),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 186/352 (53%), Positives = 231/352 (66%), Gaps = 36/352 (10%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EELVVHYLKKK ASAP+PVAIIAEVDLYKFDPWELP+KATFGEQEWYFFSPRDRKYPNGA
Sbjct  26    EELVVHYLKKKAASAPLPVAIIAEVDLYKFDPWELPSKATFGEQEWYFFSPRDRKYPNGA  85

Query  1068  RPNRAATSGYWKATGTDKPVLTAGGTQKVGVKKALVFYGGKPPKGVKTNWIMHEYRLADN  889
             RPNRAATSGYWKATGTDKP+LT+ G QKVGVKKALVFYGGKPPKG+KTNWIMHEYR+ DN
Sbjct  86    RPNRAATSGYWKATGTDKPILTSKGNQKVGVKKALVFYGGKPPKGIKTNWIMHEYRIVDN  145

Query  888   KTSNKPP----GLDIANRSKGGSLRLDDWVLCRIYKKNNSQRPLDHESDDLNDMLQG---  730
              +  KPP      D+AN  K  SLRLDDWVLCRIYKKNN+QRP++ + D+  D  +G   
Sbjct  146   ISGTKPPPHQLPADLAN--KKHSLRLDDWVLCRIYKKNNAQRPMERDRDE--DSFEGMCV  201

Query  729   SIPPFVTHQKMGLKPS----NYGALLQTDhhhhhhHMFDQGL-VPGDASLGGAR----TA  577
             ++PP    +     P     +YG++ + D H     +   G  +  ++ +  ++    T 
Sbjct  202   TLPPNQNPKPFPAPPGRSTLSYGSIFEQDDHFFEGMLSSAGEGIHQNSCVSSSKPPPNTM  261

Query  576   QLPFVPSTPNLLPTKRSLPGLFWNVDDSSANNHHPADASPPTKRFLADNNEASISRSDEQ  397
              +  V  T N +  KR++P  FWN    S        +SP  K FL D N  S + +D +
Sbjct  262   SMSLVSPTSNSI--KRAIPPQFWNEASGS------MASSPSRKSFLGDLNSGSGTATDHE  313

Query  396   ----NGSIATLLSHLPQTPSLHQQT--MLGALND--GVFRQPYQVSGINWYS  265
                 N S  +LL+ LPQ+   +  T  +LG+L D     RQ +Q+  +NW S
Sbjct  314   HDHDNNSFVSLLNQLPQSAQFNPNTSALLGSLGDATATLRQQFQLPAMNWNS  365



>ref|XP_006467845.1| PREDICTED: NAC transcription factor 25-like [Citrus sinensis]
 gb|KDO75851.1| hypothetical protein CISIN_1g017854mg [Citrus sinensis]
Length=365

 Score =   303 bits (775),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 185/352 (53%), Positives = 231/352 (66%), Gaps = 36/352 (10%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EELVVHYLKKK ASAP+PVAIIAEVDLYKFDPWELP+KATFGEQEWYFFSPRDRKYPNGA
Sbjct  26    EELVVHYLKKKAASAPLPVAIIAEVDLYKFDPWELPSKATFGEQEWYFFSPRDRKYPNGA  85

Query  1068  RPNRAATSGYWKATGTDKPVLTAGGTQKVGVKKALVFYGGKPPKGVKTNWIMHEYRLADN  889
             RPNRAATSGYWKATGTDKP+LT+ G QKVGVKKALVFYGGKPPKG+KTNWIMHEYR+ DN
Sbjct  86    RPNRAATSGYWKATGTDKPILTSKGNQKVGVKKALVFYGGKPPKGIKTNWIMHEYRIVDN  145

Query  888   KTSNKPP----GLDIANRSKGGSLRLDDWVLCRIYKKNNSQRPLDHESDDLNDMLQG---  730
              +  KPP      D+AN  K  SLRLDDWVLCRIYKKNN+QRP++ + D+  D  +G   
Sbjct  146   ISGTKPPPHQLPADLAN--KKHSLRLDDWVLCRIYKKNNAQRPMERDRDE--DSFEGMCV  201

Query  729   SIPPFVTHQKMGLKPS----NYGALLQTDhhhhhhHMFDQGL-VPGDASLGGAR----TA  577
             ++PP    +     P     +YG++ + D H     +   G  +  ++ +  ++    T 
Sbjct  202   TLPPNQNPKPFPAPPGRSTLSYGSIFEQDDHFFEGMLSSAGEGIHQNSCVSSSKPPPNTM  261

Query  576   QLPFVPSTPNLLPTKRSLPGLFWNVDDSSANNHHPADASPPTKRFLADNNEASISRSDEQ  397
              +  V  T N +  KR++P  FWN    S        +SP  K FL D N  S + +D +
Sbjct  262   SMSLVSPTSNSI--KRAIPPQFWNEASGS------MASSPSRKSFLGDLNSGSGTATDHE  313

Query  396   N----GSIATLLSHLPQTPSLHQQT--MLGALND--GVFRQPYQVSGINWYS  265
             +     S  +LL+ LPQ+   +  T  +LG+L D     RQ +Q+  +NW S
Sbjct  314   HDHDSNSFVSLLNQLPQSAQFNPNTSALLGSLGDATATLRQQFQLPAMNWNS  365



>gb|AID55353.1| NAC protein 2 [Actinidia chinensis]
Length=315

 Score =   300 bits (768),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 183/328 (56%), Positives = 214/328 (65%), Gaps = 40/328 (12%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EELVVHYLKKKVASAP+PVAIIAE+DLYKFDPWELPAKATFGEQEWYFFSPR+RKYPNGA
Sbjct  26    EELVVHYLKKKVASAPLPVAIIAEIDLYKFDPWELPAKATFGEQEWYFFSPRNRKYPNGA  85

Query  1068  RPNRAATSGYWKATGTDKPVLTAGGTQKVGVKKALVFYGGKPPKGVKTNWIMHEYRLADN  889
             RPNRAATSGYWKATGTDKPVLT+ G QKVGVKKALVFY GKPPKGVKTNWIMHEYR+ DN
Sbjct  86    RPNRAATSGYWKATGTDKPVLTSSGNQKVGVKKALVFYRGKPPKGVKTNWIMHEYRIIDN  145

Query  888   KTSNK-PPGLDIANRSKGGSLRLDDWVLCRIYKKNNSQRPLDHESDDLNDMLQGSIPPFV  712
             +  +K PPG D  +    GSLRLDDWVLCRIYKKNN  R +D E DD    L+ +I P  
Sbjct  146   EAKSKPPPGYDAGHNK--GSLRLDDWVLCRIYKKNNPPRTIDDERDDSMTNLRSTIFPIP  203

Query  711   THQKMGLKPSNYGALLQTDhhhhhhHMFDQGLVPGDASLGGARTAQLPFVPSTPNLLPTK  532
              +     KP +Y  +   D     HH+FD+ L     S  G  TA         +L    
Sbjct  204   QNHTPSTKPISYTPIPLLD-----HHLFDEML-----SHSGMDTAA--------SLSHLN  245

Query  531   RSLPGLFWNVDDSSANNHHPADASPPTKRFLADNNEASISRSDEQNGSIATLLSHLPQTP  352
             R LP L+W             D    +KR     ++ +++R+ E + SIA+LL  +P   
Sbjct  246   RMLPPLYW------------GDEGEASKRLQEGTSDENVARNHESDSSIASLLRQMP---  290

Query  351   SLHQQTMLGALNDGVFRQPYQVSGINWY  268
                 QT +G + DG F  PY    +NWY
Sbjct  291   ----QTAMGPIGDGGFGIPYSHPSLNWY  314



>ref|XP_007211453.1| hypothetical protein PRUPE_ppa007314mg [Prunus persica]
 gb|EMJ12652.1| hypothetical protein PRUPE_ppa007314mg [Prunus persica]
Length=373

 Score =   301 bits (772),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 194/362 (54%), Positives = 227/362 (63%), Gaps = 49/362 (14%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EELVVHYLKKK ASAP+PV IIAEVDLYKFDPWELP+KATFGEQEWYFFSPRDRKYPNGA
Sbjct  27    EELVVHYLKKKAASAPLPVTIIAEVDLYKFDPWELPSKATFGEQEWYFFSPRDRKYPNGA  86

Query  1068  RPNRAATSGYWKATGTDKPVLTAGGTQKVGVKKALVFYGGKPPKGVKTNWIMHEYRLADN  889
             RPNRAATSGYWKATGTDKP+LT+ G QKVGVKKALVFYGGKPPKG+K+NWIMHEYRL +N
Sbjct  87    RPNRAATSGYWKATGTDKPILTSIGNQKVGVKKALVFYGGKPPKGIKSNWIMHEYRLVNN  146

Query  888   KTS-NKPPGLDIANRSKGGSLRLDDWVLCRIYKKNNSQRPLDHESDDLNDMLQG------  730
               + +KPP  D +N  K  SLRLDDWVLCRIYKKNN+QRP+  E D  N+ + G      
Sbjct  147   NNNFSKPP--DASN--KKASLRLDDWVLCRIYKKNNAQRPMMDE-DSSNNSMDGMFAHPS  201

Query  729   SIPPFVTHQKMGLK-PSNYGALLQTDhhhhhhHMFDQGLVPGDAS---------------  598
             SI P         K  +NY ALL+ D H      F +G++  +                 
Sbjct  202   SILPAPPPPPPQPKHTTNYTALLENDDHEG----FFEGILSSNDQQGSHSHHHHQHHQHH  257

Query  597   ------LGGARTAQLPFVPSTPNLLPTKRSLPGLFWNVDDSSANNHHPADASPPTKRFLA  436
                    GG  T+      S+ + LP KR L   FWN   S       A  S  +KRF A
Sbjct  258   QHHHDQFGGISTS------SSKSNLPVKRPLSSSFWNDAGSMGTAAAAATTSSSSKRFHA  311

Query  435   DNNEASISRS----DEQNGSIATLLSHLPQ-TPSLHQQTMLGALNDGVFRQPYQVSGINW  271
             D N    + +    DE N S  ++L+ LPQ T   H   +LG+L DGV RQ +Q   +NW
Sbjct  312   DLNSGISATAAGGVDESNSSFVSMLNQLPQGTAPFHSNALLGSLGDGVLRQQFQHPSMNW  371

Query  270   YS  265
              S
Sbjct  372   NS  373



>emb|CBI38329.3| unnamed protein product [Vitis vinifera]
Length=331

 Score =   300 bits (768),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 170/318 (53%), Positives = 218/318 (69%), Gaps = 39/318 (12%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EELVVHYLK+K AS P+PV IIA+VDLYKFDPWELP+KATFGEQEWYFFSPRDRKYPNGA
Sbjct  26    EELVVHYLKRKAASVPLPVTIIADVDLYKFDPWELPSKATFGEQEWYFFSPRDRKYPNGA  85

Query  1068  RPNRAATSGYWKATGTDKPVLTAGGTQKVGVKKALVFYGGKPPKGVKTNWIMHEYRLADN  889
             RPNRAATSGYWKATGTDKP+LT+ G+QKVGVKKALVFYGGKPPKG+KTNWIMHEYRL D+
Sbjct  86    RPNRAATSGYWKATGTDKPILTSNGSQKVGVKKALVFYGGKPPKGIKTNWIMHEYRLIDS  145

Query  888   KTSN-KPPGLDIANRSKGGSLRLDDWVLCRIYKKNNSQRPLDHESDDLNDMLQGSIPP-F  715
              +SN KPPG D+ N  K GSLRLDDWVLCRIYKKN SQRP++ + ++  + L  S+P   
Sbjct  146   TSSNTKPPGADMGN--KKGSLRLDDWVLCRIYKKNISQRPMERDKEESMEALLASLPASS  203

Query  714   VTHQK----MGLKPSNYGALLQTDhhhhhhHMFDQGLVPGDASLGGARTAQLPFVPSTPN  547
             +T Q+      L+ +N+GA+L+ +          +G++ G  S+ G +++ +        
Sbjct  204   MTSQQNTRAQTLRSTNFGAVLEHEEISF------EGMLTGQ-SIQGLQSSSM--------  248

Query  546   LLPTKRSLPGLFWNVDDSSANNHHPADASPPTKRFLADNNEASISRSDEQNGSIATLLSH  367
                        +WN     A +  P+ +    K    D+   + +   + N S  +LL+ 
Sbjct  249   ---------SQYWN----GAGSIGPSSSG---KHLHTDHTSGTSTSEMDGNSSFVSLLNQ  292

Query  366   LPQTPSLHQQTMLGALND  313
             LPQ+ + HQ T+LG+L D
Sbjct  293   LPQSGTFHQNTLLGSLAD  310



>gb|AID55350.1| NAC protein 3 [Actinidia arguta]
Length=319

 Score =   299 bits (766),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 183/331 (55%), Positives = 218/331 (66%), Gaps = 40/331 (12%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EELVVHYLKKKVASAP+PV IIAE+DLYKFDPWELPAKA FGEQEWYFFSPRDRKYPNGA
Sbjct  26    EELVVHYLKKKVASAPLPVTIIAEIDLYKFDPWELPAKAMFGEQEWYFFSPRDRKYPNGA  85

Query  1068  RPNRAATSGYWKATGTDKPVLTAGGTQKVGVKKALVFYGGKPPKGVKTNWIMHEYRLADN  889
             RPNRAATSGYWKATG DKPVLT+ GTQKVGVKKALVFY GKPPKGVKT+WIMHEYRL DN
Sbjct  86    RPNRAATSGYWKATGIDKPVLTSSGTQKVGVKKALVFYRGKPPKGVKTDWIMHEYRLIDN  145

Query  888   KTSNKPPGLDIANRSKGGSLRLDDWVLCRIYKKNNSQRPLDHESD-DLNDMLQG--SIPP  718
             +  +KPP  D  +    GSLRLDDWVLCRIYKKN+  RP+ HE D  + D+     SIP 
Sbjct  146   RAKSKPPEYDAGHNK--GSLRLDDWVLCRIYKKNHPSRPIGHERDYSMTDLPSTIFSIPQ  203

Query  717   FVTHQKMGLKPSNYGALLQTDhhhhhhHMFDQGLVPGDASLGGARTAQLPFVPSTPNLLP  538
               T +   ++P +Y  +   D     HH+FD+ L     S     TA         +L  
Sbjct  204   NQTPKLPPIEPISYTPIPLLD---PDHHLFDEML-----SHSITDTAA--------SLSH  247

Query  537   TKRSLPGLFWNVDDSSANNHHPADASPPTKRFLADNNEASISRSDEQNGSIATLLSHLPQ  358
              KR+LP L+W            A+ S  +KR     +  +++ + E + SIA+LLS +P 
Sbjct  248   LKRTLPPLYW------------ANESEASKRLHEGTSNETVATTRENDSSIASLLSQMP-  294

Query  357   TPSLHQQTMLGALNDGVFRQPYQVSGINWYS  265
                   QT+   + DG FRQP+    +NWYS
Sbjct  295   ------QTVTRPIGDGGFRQPHSHPSLNWYS  319



>ref|NP_001274379.1| NAC domain-containing protein 18-like [Glycine max]
 gb|AHB63578.1| NAC transcription factor [Glycine max]
Length=368

 Score =   300 bits (767),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 190/366 (52%), Positives = 233/366 (64%), Gaps = 66/366 (18%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EELVVHYLKKKV S P+PV+IIA+VDLYKFDPWELPA A+FG +EWYFFSPR+RKYPNGA
Sbjct  29    EELVVHYLKKKVDSVPLPVSIIADVDLYKFDPWELPAMASFGAEEWYFFSPRERKYPNGA  88

Query  1068  RPNRAATSGYWKATGTDKPVLTAGGTQKVGVKKALVFYGGKPPKGVKTNWIMHEYRLADN  889
             RPNRAATSGYWKATGTDKP+ +  GTQKVGVKK+LVFYGGKPPKGVKT+WIMHEYR+A+N
Sbjct  89    RPNRAATSGYWKATGTDKPICS--GTQKVGVKKSLVFYGGKPPKGVKTDWIMHEYRVAEN  146

Query  888   KTSNKPPGLDIANRSKGGSLRLDDWVLCRIYKKNNSQRPLDHESDDLNDMLQGSIPPFVT  709
             K +N+PPG D+ +  K  SLRLDDWVLCRIYKK N+QR   HE DD  D + G +PP + 
Sbjct  147   KPNNRPPGCDLGH--KKNSLRLDDWVLCRIYKKGNTQR--SHERDDSMDDMIGEVPPSIN  202

Query  708   HQKMG-------LKPSNYGALLQTDhhhhhhHMFDQGLVPGDASLGGARTAQ--------  574
                M        +  S  GALL+ D +        +G+V G+ ++ G  T          
Sbjct  203   VGHMNARFHLSKMSTSYSGALLENDRNTL------EGVVIGNGNVNGINTNSINAISSSS  256

Query  573   --------------LPFVP--STPNLLPTKRSLPGLFWNVDDSSANNHHPADASPPTKRF  442
                           LPF P  +  +   +KR+L  L+WNVDD + ++ H        K F
Sbjct  257   SHHQFASSNSKAELLPFAPSNNNTSNSASKRTLSSLYWNVDDDNDDDDH--------KHF  308

Query  441   -LADNNEASISR-------SDEQNGSIATLLSHLPQTPSLHQQTMLGALNDGVFRQPYQV  286
              L  N   S+ R       ++  +GS ATLL+ LPQTPSL Q        DG+ R PYQ+
Sbjct  309   NLDSNGNVSVLRTEENNNNTNGTSGSFATLLNQLPQTPSLPQI-------DGLLRTPYQI  361

Query  285   SGINWY  268
              G NWY
Sbjct  362   QGTNWY  367



>ref|XP_008224995.1| PREDICTED: NAC transcription factor 25 [Prunus mume]
Length=371

 Score =   300 bits (767),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 191/358 (53%), Positives = 221/358 (62%), Gaps = 43/358 (12%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EELVVHYLKKK ASAP+PV IIAEVDLYKFDPWELP+KATFGEQEWYFFSPRDRKYPNGA
Sbjct  27    EELVVHYLKKKAASAPLPVTIIAEVDLYKFDPWELPSKATFGEQEWYFFSPRDRKYPNGA  86

Query  1068  RPNRAATSGYWKATGTDKPVLTAGGTQKVGVKKALVFYGGKPPKGVKTNWIMHEYRLADN  889
             RPNRAATSGYWKATGTDKP+LT+ G QKVGVKKALVFYGGKPPKG+K+NWIMHEYRL +N
Sbjct  87    RPNRAATSGYWKATGTDKPILTSIGNQKVGVKKALVFYGGKPPKGIKSNWIMHEYRLVNN  146

Query  888   KTS----NKPPGLDIANRSKGGSLRLDDWVLCRIYKKNNSQRPLDHESDDLNDMLQGSIP  721
               +    +KPP  D +N  K  SLRLDDWVLCRIYKKNN+QRP+  E    N M    + 
Sbjct  147   NNNNNNFSKPP--DASN--KKASLRLDDWVLCRIYKKNNAQRPMMDEDSSNNSMDGMFVH  202

Query  720   P----FVTHQKMGLKPSNYGALLQTDhhhhhhHMFDQGLVPGDA----------------  601
             P               +NY ALL+ D    H   F+  L   D                 
Sbjct  203   PSSILPAPPPPQPKHTTNYTALLEND---DHEGFFEGILSSSDQQGSHSHHHHHHHQHHH  259

Query  600   -SLGGARTAQLPFVPSTPNLLPTKRSLPGLFWNVDDSSANNHHPADASPPTKRFLADNNE  424
                GG  T+      S+ + LP KR LP  FWN   S       A  +  +KRF AD N 
Sbjct  260   DQFGGISTS------SSKSNLPVKRPLPSSFWNDAGSMGTAAPAATTTSSSKRFHADLNS  313

Query  423   ASISRS----DEQNGSIATLLSHLPQ-TPSLHQQTMLGALNDGVFRQPYQVSGINWYS  265
                + +    DE N S  ++L+ LPQ T   H   +LG+L DGV RQ +Q   +NW S
Sbjct  314   GISATAAGGVDESNSSFVSMLNQLPQGTAPFHPNALLGSLGDGVLRQQFQHPSMNWNS  371



>gb|KHN36348.1| NAC domain-containing protein 18 [Glycine soja]
Length=369

 Score =   300 bits (767),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 190/366 (52%), Positives = 233/366 (64%), Gaps = 66/366 (18%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EELVVHYLKKKV S P+PV+IIA+VDLYKFDPWELPA A+FG +EWYFFSPR+RKYPNGA
Sbjct  30    EELVVHYLKKKVDSVPLPVSIIADVDLYKFDPWELPAMASFGAEEWYFFSPRERKYPNGA  89

Query  1068  RPNRAATSGYWKATGTDKPVLTAGGTQKVGVKKALVFYGGKPPKGVKTNWIMHEYRLADN  889
             RPNRAATSGYWKATGTDKP+ +  GTQKVGVKK+LVFYGGKPPKGVKT+WIMHEYR+A+N
Sbjct  90    RPNRAATSGYWKATGTDKPICS--GTQKVGVKKSLVFYGGKPPKGVKTDWIMHEYRVAEN  147

Query  888   KTSNKPPGLDIANRSKGGSLRLDDWVLCRIYKKNNSQRPLDHESDDLNDMLQGSIPPFVT  709
             K +N+PPG D+ +  K  SLRLDDWVLCRIYKK N+QR   HE DD  D + G +PP + 
Sbjct  148   KPNNRPPGCDLGH--KKNSLRLDDWVLCRIYKKGNTQR--SHERDDSMDDMIGEVPPSIN  203

Query  708   HQKMG-------LKPSNYGALLQTDhhhhhhHMFDQGLVPGDASLGGARTAQ--------  574
                M        +  S  GALL+ D +        +G+V G+ ++ G  T          
Sbjct  204   VGHMNARFHLSKMSTSYSGALLENDRNTL------EGVVIGNGNVNGINTNSINAISSSS  257

Query  573   --------------LPFVP--STPNLLPTKRSLPGLFWNVDDSSANNHHPADASPPTKRF  442
                           LPF P  +  +   +KR+L  L+WNVDD + ++ H        K F
Sbjct  258   SHHQFASSNSKAELLPFAPSNNNTSNSASKRTLSSLYWNVDDDNDDDDH--------KHF  309

Query  441   -LADNNEASISR-------SDEQNGSIATLLSHLPQTPSLHQQTMLGALNDGVFRQPYQV  286
              L  N   S+ R       ++  +GS ATLL+ LPQTPSL Q        DG+ R PYQ+
Sbjct  310   NLDSNGNVSVLRTEENNNNTNGTSGSFATLLNQLPQTPSLPQI-------DGLLRTPYQI  362

Query  285   SGINWY  268
              G NWY
Sbjct  363   QGTNWY  368



>gb|KFK38893.1| hypothetical protein AALP_AA3G174600 [Arabis alpina]
Length=342

 Score =   297 bits (761),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 182/345 (53%), Positives = 221/345 (64%), Gaps = 47/345 (14%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EELVVHYLK+K ASAP+PVAIIA+VDLYKFDPWELPAKA+FGEQEWYFFSPRDRKYPNGA
Sbjct  27    EELVVHYLKRKAASAPLPVAIIADVDLYKFDPWELPAKASFGEQEWYFFSPRDRKYPNGA  86

Query  1068  RPNRAATSGYWKATGTDKPVLTAGGTQKVGVKKALVFYGGKPPKGVKTNWIMHEYRLADN  889
             RPNRAATSGYWKATGTDKPVL + G QKVGVKKALVFY GKPPKG+K++WIMHEYRL DN
Sbjct  87    RPNRAATSGYWKATGTDKPVLASEGNQKVGVKKALVFYSGKPPKGIKSDWIMHEYRLIDN  146

Query  888   KTSNKPPGLDIANRSKGGSLRLDDWVLCRIYKKNNSQRPLDHESD-DLNDMLQGSIPPF-  715
             K +N+PPG D  N  K  SLRLDDWVLCRIYKKNN+ R +D++ D D+ D +   IPP  
Sbjct  147   KPNNRPPGCDYGN--KKNSLRLDDWVLCRIYKKNNAGRHVDNDKDHDMIDYIFRKIPPST  204

Query  714   -----VTHQKMGLKPSNYGALLQTDhhhhhhHMFDQGLVPG---------DASLGGARTA  577
                  V+   M   P  YG   + D       ++D G++ G         D  L  A ++
Sbjct  205   GIHHNVSRSSMNFFPGGYGGFAEGD-----QGLYDGGVMIGTNSMNHHNNDMGLNQASSS  259

Query  576   QLPFVPSTPNLLPTKRSLPGLFWNVDDSSANNHHPADASPPTKRFLADNNEASISRSDEQ  397
               P +     +   KR+LP  +W+V +   +         P+KRF            +  
Sbjct  260   SEPMM-----MANLKRALPVAYWSVTEEEND-------LSPSKRFHGGGG------GECS  301

Query  396   NGSIATLLSHLPQTPSLHQQTMLGALNDGVFR-QPYQVSGINWYS  265
             N S + +  +LP    L QQ   G L DG+FR   YQ+ G+NWYS
Sbjct  302   NMSSSMMEENLP----LMQQQG-GVLGDGLFRTTSYQLPGLNWYS  341



>gb|AID55349.1| NAC protein 2 [Actinidia arguta]
Length=316

 Score =   295 bits (754),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 177/327 (54%), Positives = 209/327 (64%), Gaps = 37/327 (11%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EELVVHYLKKKVASAP+PVAIIAE+DLYKFDPWELPAK+TFGEQEWYFFSPR+RKYPNGA
Sbjct  26    EELVVHYLKKKVASAPLPVAIIAEIDLYKFDPWELPAKSTFGEQEWYFFSPRNRKYPNGA  85

Query  1068  RPNRAATSGYWKATGTDKPVLTAGGTQKVGVKKALVFYGGKPPKGVKTNWIMHEYRLADN  889
             RPNRAATSGYWKATGTDKPVLT+ GTQKVGVKKALVFY GKPPKGVKTNWIMHEYRL DN
Sbjct  86    RPNRAATSGYWKATGTDKPVLTSSGTQKVGVKKALVFYLGKPPKGVKTNWIMHEYRLIDN  145

Query  888   KTSNKPPGLDIANRSKGGSLRLDDWVLCRIYKKNNSQRPLDHESDDLNDMLQGSIPPFVT  709
             +  +KPPG D  +    GSLRLD+WVLCRIYKKNN  R +D   DD    L  +I P   
Sbjct  146   EAKSKPPGYDAGHNK--GSLRLDEWVLCRIYKKNNPPRAIDDGRDDSMTNLPPTIFPTPQ  203

Query  708   HQKMGLKPSNYGALLQTDhhhhhhHMFDQGLVPGDASLGGARTAQLPFVPSTPNLLPTKR  529
             +     KP +Y  +   D         D  L     S  G  TA         +L    R
Sbjct  204   NHIPPTKPISYIPIPLLD--------HDHHLFEEMLSHSGTDTAA--------SLSHLNR  247

Query  528   SLPGLFWNVDDSSANNHHPADASPPTKRFLADNNEASISRSDEQNGSIATLLSHLPQTPS  349
              LP L+W             D    +KR     ++ +++R+ E + S+A+LL  +P    
Sbjct  248   MLPPLYW------------GDEGEASKRLQEGTSDETVARTHENDSSVASLLRQMP----  291

Query  348   LHQQTMLGALNDGVFRQPYQVSGINWY  268
                QT++G++ DG    PY    +NWY
Sbjct  292   ---QTVMGSIGDGGLGIPYSHPSLNWY  315



>ref|XP_004293567.1| PREDICTED: NAC transcription factor 25-like [Fragaria vesca subsp. 
vesca]
Length=360

 Score =   295 bits (756),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 178/347 (51%), Positives = 219/347 (63%), Gaps = 31/347 (9%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EELVVHYLKKK AS P+PV IIAE+DLYKFDPWELP+KATFGEQEWYFFSPRDRKYPNGA
Sbjct  26    EELVVHYLKKKAASVPLPVTIIAEIDLYKFDPWELPSKATFGEQEWYFFSPRDRKYPNGA  85

Query  1068  RPNRAATSGYWKATGTDKPVLTAGGTQKVGVKKALVFYGGKPPKGVKTNWIMHEYRLADN  889
             RPNRAATSGYWKATGTDKP+LT+ G+QKVGVKKALVFYGGKPPKG+KTNWIMHEYRL ++
Sbjct  86    RPNRAATSGYWKATGTDKPILTSNGSQKVGVKKALVFYGGKPPKGIKTNWIMHEYRLIND  145

Query  888   KTSN---KPPGLDIANRSKGGSLRLDDWVLCRIYKKNNSQRPLD------HESDDLNDML  736
             + S+   KPP  D  N  K  SLRLDDWVLCRIYKKNN+QRP+       H+ D   + +
Sbjct  146   ENSSAALKPP--DPTN--KKASLRLDDWVLCRIYKKNNAQRPMMECDHHLHKEDSTTNSM  201

Query  735   QGSIPPFVTHQKMGLKPSNYGALLQTDhhhhhhHMFDQGLVPGDASLGGARTAQLPFVPS  556
             +G     +T        +NY ALL+ D      + FD  L                F+ S
Sbjct  202   EGIFVQSMTKPSPPKAATNYTALLEND---EEDNFFDGILSSEGVQNSSHSNLSHQFMSS  258

Query  555   TPN--------LLPTKRSLPGLFWNVDDSSANNHHPADASPPTKRFLADNNEASISRS--  406
             + +           +K  LP  FWN  ++  ++    + S  +KRF  D N    S    
Sbjct  259   SKSDVVVMPVNNNNSKHQLPSPFWN--EAGGSSSMGTNNSLSSKRFHTDLNSGGGSGGGV  316

Query  405   DEQNGSIATLLSHLPQTPSLHQQTMLGALNDGVFRQPYQVSGINWYS  265
             DE N S  ++L+   Q  + H  ++LG+L DGV R  + +  +NW S
Sbjct  317   DENNASFVSMLN---QNAAFHHNSLLGSLGDGVLRPHFHLPSMNWNS  360



>ref|XP_010535118.1| PREDICTED: NAC domain-containing protein 18-like [Tarenaya hassleriana]
Length=339

 Score =   294 bits (753),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 179/336 (53%), Positives = 215/336 (64%), Gaps = 33/336 (10%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EELVVHYLK+K ASAP+PVAIIA+VDLYKFDPWELPAKA FGEQEWYFFSPRDRKYPNGA
Sbjct  29    EELVVHYLKRKAASAPLPVAIIADVDLYKFDPWELPAKAWFGEQEWYFFSPRDRKYPNGA  88

Query  1068  RPNRAATSGYWKATGTDKPVLTAGGTQKVGVKKALVFYGGKPPKGVKTNWIMHEYRLADN  889
             RPNRAATSGYWKATGTDKPVL++GGT KVGVKKALVFYGGKPPKGVKT+W+MHEYRL +N
Sbjct  89    RPNRAATSGYWKATGTDKPVLSSGGTHKVGVKKALVFYGGKPPKGVKTDWVMHEYRLVEN  148

Query  888   KTSNKPPGLDIANRSKGGSLRLDDWVLCRIYKKNNSQRPL-----DHESDDLNDMLQGSI  724
             K+SN+ PG D  N+ +  SLRLDDWVLCRIYKKNN+ R +     D   D      Q   
Sbjct  149   KSSNRHPGYDFGNKKQ--SLRLDDWVLCRIYKKNNTGRHVDNDKDDMIDDMNMIFRQFQP  206

Query  723   PPFVTHQKMGLKP---SNYGALLQTDhhhhhhHMFDQGLVPGDASLGGARTAQLPFVPST  553
             PP ++  +M   P   SN+G     +  +    + D       AS       +LP + + 
Sbjct  207   PPSISSGRMNFFPARVSNFGT-FSDNVINSTIDVTDTNAGLDLASPSYGSKPELPMMMTA  265

Query  552   PNLLPTKRSLPGLFWNVDDSSANNHHPADASPPTKRFLADNNEASISRSDEQNGSIATLL  373
              +L   KR LP  +W     +A      D S P+KRF                G  + + 
Sbjct  266   TSL---KRDLPRPYW--PRMAAEEEETVDGSSPSKRF--------------HGGECSNIT  306

Query  372   SHLPQTPSLHQQTMLGALNDGVFRQPYQVSGINWYS  265
                 QTP L QQ M   L++G++R  YQ+ G+NWYS
Sbjct  307   PMFAQTPPLMQQEM---LSEGLYRTSYQLHGLNWYS  339



>ref|XP_006406961.1| hypothetical protein EUTSA_v10022353mg [Eutrema salsugineum]
 dbj|BAJ34312.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ48414.1| hypothetical protein EUTSA_v10022353mg [Eutrema salsugineum]
Length=364

 Score =   294 bits (753),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 185/352 (53%), Positives = 221/352 (63%), Gaps = 40/352 (11%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EELVVHYLK+K ASAP+PVAIIAEVDLYKFDPWELPAKA+FGEQEWYFFSPRDRKYPNGA
Sbjct  28    EELVVHYLKRKAASAPLPVAIIAEVDLYKFDPWELPAKASFGEQEWYFFSPRDRKYPNGA  87

Query  1068  RPNRAATSGYWKATGTDKPVLTAGGTQKVGVKKALVFYGGKPPKGVKTNWIMHEYRLADN  889
             RPNRAATSGYWKATGTDKPVLT+ G QKVGVKKALVFY GKPPKGVK++WIMHEYRL DN
Sbjct  88    RPNRAATSGYWKATGTDKPVLTSEGNQKVGVKKALVFYSGKPPKGVKSDWIMHEYRLIDN  147

Query  888   KTSNKPPGLDIANRSKGGSLRLDDWVLCRIYKKNNSQRPLDHESD-DLNDMLQGSIPPFV  712
             K +N+PPG D  N  K  SLRLDDWVLCRIYKKNN+ R +D++ D D+ D +   IPP +
Sbjct  148   KPNNRPPGCDFGN--KKNSLRLDDWVLCRIYKKNNAGRHVDNDKDHDMIDYIFRKIPPSI  205

Query  711   T------------HQKMGLKPSNYGALLQTDhhhhhhHMFDQGLV--------PGDASLG  592
             +             + M   P  + +            ++D G++         G  S G
Sbjct  206   SMAAATTGLHHNVSRSMNFFPGKFSSGGYGIFSDGDPGLYDAGMINSIGTDHNHGSGSNG  265

Query  591   GARTAQL-PFVPSTPNLLPT-KRSLPGLFWNVDDSSANNHHPADASPPTKRFLADNNEAS  418
                   L P   S P ++   KR+LP  +W V +         D S P+KRF   +    
Sbjct  266   NTNAVGLNPASSSEPMMMANLKRALPASYWPVPEEE------QDVS-PSKRF---HGGGG  315

Query  417   ISRSDEQNGSIATLLSHLPQTPSLHQQTMLGALNDGVFR-QPYQVSGINWYS  265
                 D  N S + +    P  P + QQ   G L DG+FR   YQ+ G+NWYS
Sbjct  316   GGGGDCSNMSSSMMEETHP--PLMQQQG--GVLGDGLFRTTSYQLPGLNWYS  363



>ref|XP_010503061.1| PREDICTED: NAC domain-containing protein 18-like [Camelina sativa]
Length=344

 Score =   293 bits (749),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 181/336 (54%), Positives = 220/336 (65%), Gaps = 30/336 (9%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EELVVHYLK+K ASAP+PVAIIAEVDLYKFDPWELPAKA+FGEQEWYFFSPRDRKYPNGA
Sbjct  28    EELVVHYLKRKAASAPLPVAIIAEVDLYKFDPWELPAKASFGEQEWYFFSPRDRKYPNGA  87

Query  1068  RPNRAATSGYWKATGTDKPVLTAGGTQKVGVKKALVFYGGKPPKGVKTNWIMHEYRLADN  889
             RPNRAATSGYWKATGTDKPVL + G QKVGVKKALVFY GKPPKGVK++WIMHEYRL +N
Sbjct  88    RPNRAATSGYWKATGTDKPVLASDGNQKVGVKKALVFYSGKPPKGVKSDWIMHEYRLIEN  147

Query  888   KTSNKPPGLDIANRSKGGSLRLDDWVLCRIYKKNNSQRPLDHESD-DLNDMLQGSIPPFV  712
             K +N+PPG D  N  K  SLRLDDWVLCRIYKKNN+ R +D++ D D+ D +   IPP +
Sbjct  148   KLNNRPPGCDFGN--KKNSLRLDDWVLCRIYKKNNAGRHVDNDKDHDMIDYIFRKIPPSL  205

Query  711   TH--QKMGLKPSNYGALLQTDhhhhhhHMFDQGLVP-GDASL--GGARTAQLPFVPSTPN  547
             +      GL   ++      +           G+   G+ +L  GG          S P 
Sbjct  206   SMAAAATGLHHHHHNVSRSMNFFPGKFSGGGYGIYSDGNTNLYEGGGMINNNMGTDSVPM  265

Query  546   LL--PTKRSLPGLFWNVDDSSANNHHPADASPPTKRFLADNNEASISRSDEQNGSIATLL  373
             ++    KR+LP  +W V +         DAS P+KRF    + +++S             
Sbjct  266   MMMPNQKRALPVPYWPVAEEE------QDAS-PSKRFHGGGDCSNMSS------------  306

Query  372   SHLPQTPSLHQQTMLGALNDGVFR-QPYQVSGINWY  268
             S + +TP + QQ   G L DG+FR  PYQ+ G+NWY
Sbjct  307   SMMEETPPMMQQQGGGVLGDGLFRTTPYQLPGLNWY  342



>ref|XP_008800137.1| PREDICTED: NAC transcription factor 25 [Phoenix dactylifera]
Length=394

 Score =   294 bits (753),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 190/379 (50%), Positives = 229/379 (60%), Gaps = 64/379 (17%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EELVVHYLKKK ASAP+P  IIAEVDLYKFDPWELP KA +GEQEWYFFSPRDRKYPNGA
Sbjct  28    EELVVHYLKKKAASAPLPATIIAEVDLYKFDPWELPGKANYGEQEWYFFSPRDRKYPNGA  87

Query  1068  RPNRAATSGYWKATGTDKPVLTAGGTQKVGVKKALVFYGGKPPKGVKTNWIMHEYRLADN  889
             RPNRAA SGYWKATGTDKP+LT+GG  KVGVKKALVFYGGKPPKG+KT+WIMHEYRLAD+
Sbjct  88    RPNRAAPSGYWKATGTDKPILTSGGAHKVGVKKALVFYGGKPPKGIKTDWIMHEYRLADS  147

Query  888   K--TSNKPPGLDIANRSKGGSLRLDDWVLCRIYKK----NNSQRPLDHESDD-LNDMLQG  730
                ++ +PPG   A  SK  SLRLDDWVLCRIYKK    NN+ R +D + +D ++D +  
Sbjct  148   SPGSTFRPPG--SAAGSKKSSLRLDDWVLCRIYKKNSTNNNNARLVDRDREDSMDDRM--  203

Query  729   SIPPFVTHQ-----------KMGLKPSNYGALLQTDhhhhhhHMFDQGLVPGDASL---G  592
               PP +T Q           +    P+NY ALL +D       +    ++P +      G
Sbjct  204   -APPALTQQPAISTQPNPRPQHQRAPNNYTALLDSDETFFEGLLTTGDVLPTNRMTQLAG  262

Query  591   GAR-TAQLPFVPSTPNLLPTKRSLPGLFWNVDDSSANNHHPADASPPTKRFLADNNEASI  415
             G R    L  +P+  +  P KR+L   +W    S A    P    PP KRF A NN +S 
Sbjct  263   GPRPKLDLSTIPTNNSTRPPKRALTSPYW----SDAGRVTP----PPPKRFQACNNGSSS  314

Query  414   SRSDEQNG---------------------------SIATLLSHLPQTPSLHQQTMLGALN  316
             S                                  +IA LL+  PQ  +   QT+LG+L 
Sbjct  315   SNCTATTNNNTSSGSNSSAANNSSSSNSNSNHVVHTIAALLNQFPQGAAYQPQTILGSLG  374

Query  315   DG--VFRQPYQVSGINWYS  265
             DG  +F+QPYQ+SG NW S
Sbjct  375   DGSAIFQQPYQLSGANWSS  393



>ref|XP_010686575.1| PREDICTED: NAC transcription factor 25-like [Beta vulgaris subsp. 
vulgaris]
Length=341

 Score =   291 bits (745),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 177/345 (51%), Positives = 222/345 (64%), Gaps = 46/345 (13%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EEL+VHYLK+K +S+P+PV+IIAEVDLYKFDPWELP+KA FGEQEWYFFSPRDRKYPNGA
Sbjct  26    EELIVHYLKRKASSSPLPVSIIAEVDLYKFDPWELPSKAIFGEQEWYFFSPRDRKYPNGA  85

Query  1068  RPNRAATSGYWKATGTDKPVLTAGGTQKVGVKKALVFYGGKPPKGVKTNWIMHEYRLADN  889
             RPNRAATSGYWKATGTDKP+LT+ G QKVGVKKALVFYGGKPP+G+KT+WIMHEYR+ D 
Sbjct  86    RPNRAATSGYWKATGTDKPILTSNGNQKVGVKKALVFYGGKPPRGIKTDWIMHEYRIIDA  145

Query  888   KTSNKPPGLDIANRSKGGSLRLDDWVLCRIYKKNNSQRPLDHESDDLNDMLQGSIPPFVT  709
              +++K P   + + SK  SLRLDDWVLCRIYKKNN+QR +DHE DDL       I   + 
Sbjct  146   NSTSKLPHPLVDHPSKKASLRLDDWVLCRIYKKNNTQRTMDHERDDL-------IEEMIK  198

Query  708   HQKM--GLKPSNYGALLQTDhhhhhhHMFDQGLVPGDASLGGARTAQLPFVPSTPNLLPT  535
             HQK+   + P N  +++  +++       DQ L   D S  G  T++        N    
Sbjct  199   HQKLMRTICPKNTTSMMDHNNN-------DQNLF--DLSQLGTSTSRHDLYDMQGN--DH  247

Query  534   KRSLP-GLFWN-----VDDSSANN-HHPADASPPTKRFLADNNEASISRSDEQNGSIATL  376
             KR LP  L+W+     +  SS    HHP           +D    S   +D  + S  ++
Sbjct  248   KRELPVSLYWDDQMGSIGSSSGRRFHHPQ----------SDQTTGSTG-TDGNSSSFVSM  296

Query  375   LSHLPQ-------TP-SLHQQTMLGALNDGVFRQPYQVSGINWYS  265
             LS LPQ        P S+    ++G + DGV R P+Q+SG  W S
Sbjct  297   LSQLPQGINNTTTVPFSMGSPLLVGNIGDGVLRPPFQLSGGTWNS  341



>ref|XP_010921105.1| PREDICTED: NAC transcription factor NAM-B2-like [Elaeis guineensis]
Length=389

 Score =   292 bits (747),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 194/377 (51%), Positives = 228/377 (60%), Gaps = 63/377 (17%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EELVVHYLKKK AS P+PV IIAEVDLYKFDPWELP KA FGEQEWYFFSPRDRKYPNGA
Sbjct  27    EELVVHYLKKKAASVPLPVTIIAEVDLYKFDPWELPGKANFGEQEWYFFSPRDRKYPNGA  86

Query  1068  RPNRAATSGYWKATGTDKPVLTAGGTQKVGVKKALVFYGGKPPKGVKTNWIMHEYRLADN  889
             RPNRAATSGYWKATGTDKP+LT+GGTQKVGVKKALVFYGGKPPKG+KTNWIMHEYRLAD+
Sbjct  87    RPNRAATSGYWKATGTDKPILTSGGTQKVGVKKALVFYGGKPPKGIKTNWIMHEYRLADS  146

Query  888   KTSNKPPGLDIANRSKGGSLRLDDWVLCRIYKKNNSQRPLDHESD-DLNDMLQGSI-PPF  715
               S+          SK GSLRLDDWVLCRIYKKN+S       +D D  D + G + PP 
Sbjct  147   SPSSSARPPGGDVGSKKGSLRLDDWVLCRIYKKNSSSNNNGRLTDRDKEDSMDGMLAPPA  206

Query  714   VT-HQKMGLK----------PSNYGALLQTDhhhhhhHMFDQGLVPGDASL--------G  592
             +T H+ +G +          P+NY ALL  D        F +GL+  +  L         
Sbjct  207   LTPHRAIGTQTNPRPQPQRAPNNYTALLGND------ETFFEGLLTTEDGLAANPMTQFA  260

Query  591   GARTAQLPF--VPSTPNLLPTKRSLPGLFWNVDDSSANNHHPADASPPTKRFLADNNEAS  418
             GA  A+L    V +    L  KR L   +W    S      P    PPTKRF   N+ +S
Sbjct  261   GAPRAKLDLSTVQTNSGTLAPKRPLTSPYW----SDGGMGTP----PPTKRFQGCNHGSS  312

Query  417   ISRSDEQNG------------------------SIATLLSHLPQTPSLHQQTMLGALNDG  310
              + +   N                         +I  LL+ +PQ  +   QT+L +L DG
Sbjct  313   GNSTTTNNNTSSGSNSSATTNNNNNSNNNHGGHTITALLNQIPQGTAYQPQTILSSLGDG  372

Query  309   --VFRQPYQVSGINWYS  265
               +FRQPYQ+SG+NW S
Sbjct  373   SAIFRQPYQLSGMNWSS  389



>ref|XP_010542275.1| PREDICTED: LOW QUALITY PROTEIN: NAC domain-containing protein 
18 [Tarenaya hassleriana]
Length=345

 Score =   290 bits (743),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 176/340 (52%), Positives = 220/340 (65%), Gaps = 38/340 (11%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EELVVHYLK+K AS P+PV+IIAEVDLYKFDPWELPAKA+FGE+EWYFFSPRDRKYPNGA
Sbjct  32    EELVVHYLKRKAASVPLPVSIIAEVDLYKFDPWELPAKASFGEEEWYFFSPRDRKYPNGA  91

Query  1068  RPNRAATSGYWKATGTDKPVLTAGGTQKVGVKKALVFYGGKPPKGVKTNWIMHEYRLADN  889
             RPNRAATSGYWKATGTDKP+L +GG QKVGVKKALVFYGGKPPKGVKT+WIMHEYRLAD 
Sbjct  92    RPNRAATSGYWKATGTDKPILASGGNQKVGVKKALVFYGGKPPKGVKTDWIMHEYRLADT  151

Query  888   KTSNKPPGLDIANRSKGGSLRLDDWVLCRIYKKNNSQRPL-DHESDDLNDMLQGSIPPFV  712
             K+ N+PPG +  N  K  SLRLDDWVLCRIYKKNN+ R +   + D ++DM    IPP +
Sbjct  152   KSINRPPGCNFGN--KKNSLRLDDWVLCRIYKKNNTGRHVDSDKDDMIDDMFFRQIPPSI  209

Query  711   T-----HQKMGLKPSNYGA--LLQTDhhhhhhHMFDQGLVPG----DASLGGARTAQLPF  565
             +      ++M   P+ + +  +   + +     ++D G++      D S+       L  
Sbjct  210   SSGLNVSERMNFFPARFSSFGMFSDNVNDLPSGLYDVGVINSGNGNDTSMNNVANIGLNL  269

Query  564   VPSTPNLLPTKRSLPGLFWNVDDSSANNHHPADASPPTKRFLADNNEASISRSDEQNGSI  385
              PS+    P    LP  +W    +       AD S P+KRF                G  
Sbjct  270   APSSGXRSP----LPPPYW---PAEEEAVAAADGS-PSKRF--------------HGGEC  307

Query  384   ATLLSHLPQTPSLHQQTMLGALNDGVFRQPYQVSGINWYS  265
             + + S L QTP L Q    G L++G++R  Y++ G+NWYS
Sbjct  308   SNITSMLAQTPPLMQHQ--GMLSEGLYRTSYELHGLNWYS  345



>ref|XP_008799210.1| PREDICTED: NAC transcription factor 25-like isoform X1 [Phoenix 
dactylifera]
Length=414

 Score =   291 bits (745),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 197/400 (49%), Positives = 234/400 (59%), Gaps = 88/400 (22%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EELVVHYLKKK ASAP+PV IIAEVDLYKFDPWELP KA+FGEQEWYFFSPRDRKYPNGA
Sbjct  31    EELVVHYLKKKAASAPLPVTIIAEVDLYKFDPWELPGKASFGEQEWYFFSPRDRKYPNGA  90

Query  1068  RPNRAATSGYWKATGTDKPVLTAGGTQKVGVKKALVFYGGKPPKGVKTNWIMHEYRLADN  889
             RPNRAATSGYWKATGTDKP+LT+GGTQKVGVKKALVFYGGKPPKG+KTNWIMHEYRL D 
Sbjct  91    RPNRAATSGYWKATGTDKPILTSGGTQKVGVKKALVFYGGKPPKGIKTNWIMHEYRLTDT  150

Query  888   KTS--NKPPGLDIANRSKGGSLRLDDWVLCRIYKK-----------NNSQRPLDHESD--  754
               S  ++PP  D+   SK GSLRLDDWVLCRIYKK           +N+ R  +   D  
Sbjct  151   SPSSNSRPPCGDVG--SKKGSLRLDDWVLCRIYKKNSCSSSSNSSSSNNDRDKEDSMDGM  208

Query  753   -------DLNDMLQGSI-PPFVT-HQKMGLKPSN----------YGALLQTDhhhhhhHM  631
                    D+ D + G + PP VT H+ +G +P+           Y ALL  D        
Sbjct  209   LARLADRDMEDSMDGMLAPPAVTQHRAIGSQPNPRPQPQRAPNIYTALLDND------DT  262

Query  630   FDQGLVPGDASLGGARTAQLPFVPSTPNLLPT----------KRSLPGLFWNVDDSSANN  481
             F QGL+  +     +   QL   P T   L T          KR+L   +W+ D      
Sbjct  263   FFQGLLTSEDGPATSSMTQLAGAPRTKLDLSTVQTNNGTLAPKRALTSPYWS-DGGMV--  319

Query  480   HHPADASPPTKRFLADNNEAS------------------ISRSDEQNG--------SIAT  379
                  A PP KRF   NN +S                   + +D +N         +I  
Sbjct  320   -----APPPPKRFQGCNNGSSSTSCATTNNNTSSGSNNGATTNDNKNSNSNVHGGHTITA  374

Query  378   LLSHLPQTPSLHQQTMLGALNDG--VFRQPYQVSGINWYS  265
             LL+ +PQ  +   Q +L +L DG  +FRQPYQ+SG+NW S
Sbjct  375   LLNPIPQGTAYQHQAILSSLGDGSAIFRQPYQLSGMNWNS  414



>ref|XP_007148205.1| hypothetical protein PHAVU_006G188900g [Phaseolus vulgaris]
 gb|ESW20199.1| hypothetical protein PHAVU_006G188900g [Phaseolus vulgaris]
Length=355

 Score =   288 bits (737),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 176/347 (51%), Positives = 226/347 (65%), Gaps = 43/347 (12%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EELVVHYLK+K  S P+PVAIIAEVDLYKFDPWELP+KATFGEQEWYFFSPRDRKYPNGA
Sbjct  29    EELVVHYLKRKADSVPLPVAIIAEVDLYKFDPWELPSKATFGEQEWYFFSPRDRKYPNGA  88

Query  1068  RPNRAATSGYWKATGTDKPVLTAGGTQKVGVKKALVFYGGKPPKGVKTNWIMHEYRL--A  895
             RPNRAA+SGYWKATGTD+P+L + G  KVGVKKALVFYGGKPPKGVKTNWIMHEYRL   
Sbjct  89    RPNRAASSGYWKATGTDRPILASHGHHKVGVKKALVFYGGKPPKGVKTNWIMHEYRLIST  148

Query  894   DNKTSNKPPGL--DIANRSKGGSLRLDDWVLCRIYKKNNS----QRPLDHESDDLNDMLQ  733
              + +++KPP L  D A  +K  SLRLDDWVLCRIYKKNNS    + PL  ++ +L+   +
Sbjct  149   SSNSTSKPPSLPADHARSTKKNSLRLDDWVLCRIYKKNNSTIMPRFPLMEQNKELSS--E  206

Query  732   GSIPPFVT-----------HQKMGLKPS-NYGAL-LQTDhhhhhhHMFDQGLVPGDASLG  592
              ++ P ++           + K G   S +YG L L+ D      ++FD G++  D S+ 
Sbjct  207   STMVPMMSTLSMANNNTTQNSKAGTSTSASYGPLGLEND-----DNLFD-GILGVDHSM-  259

Query  591   GARTAQLPFVPSTPNLLPTKRSLPGLFWNVDDSSANNHHPADASPPTKRFLADNNEASIS  412
               +        S+  + P KR+L   FWN   SS++          ++RF  D N    S
Sbjct  260   -QQDVSDSHQVSSKGIYPVKRALSSQFWNDTGSSSS----------SRRFHCDLNAG--S  306

Query  411   RSDEQNGSIATLLSHLPQTPSLHQQTMLGALNDGVFRQPYQVSGINW  271
              + E++ S  ++LS LPQ    H   +LG +++ V RQ +Q+  +NW
Sbjct  307   NTVEEDNSFVSMLSQLPQNTGFHPNALLGPVSNDVLRQQFQLPSMNW  353



>ref|XP_010924066.1| PREDICTED: NAC transcription factor 25-like [Elaeis guineensis]
Length=392

 Score =   289 bits (739),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 186/374 (50%), Positives = 222/374 (59%), Gaps = 60/374 (16%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EELVVHYLKKK ASAP+PV IIAEVDLYKFDPWELP KA FGEQEWYFFSPRDRKYPNGA
Sbjct  32    EELVVHYLKKKAASAPLPVTIIAEVDLYKFDPWELPGKANFGEQEWYFFSPRDRKYPNGA  91

Query  1068  RPNRAATSGYWKATGTDKPVLTAGGTQKVGVKKALVFYGGKPPKGVKTNWIMHEYRLADN  889
             RPNRAATSGYWKATGTDKP+LT+ G QKVGVKKALVFYGGKPPKG+KTNWIMHEYRLAD+
Sbjct  92    RPNRAATSGYWKATGTDKPILTSRGAQKVGVKKALVFYGGKPPKGIKTNWIMHEYRLADS  151

Query  888   KTSNKPPGLDIANRSKGGSLRLDDWVLCRIYKK-----NNSQRPLDHESDDLNDMLQGSI  724
                +          S+  SLRLDDWVLCRIYKK     NN+Q    +  D ++D +    
Sbjct  152   SPGSSSRPPGCDAGSRRSSLRLDDWVLCRIYKKNSNNNNNAQLMDRNREDSMDDRM---A  208

Query  723   PPFVT--------HQKMGLKPSNYGALLQTDhhhhhhHMFDQGLVPGD--ASLGGARTAQ  574
             PP +         HQ+    P+NY ALL +D       +  +  +P +  + L GA   +
Sbjct  209   PPAINTQPNPRPHHQRA---PNNYTALLDSDETFFERLLTTEDGLPTNPTSQLAGASRPK  265

Query  573   LPF--VPSTPNLLPTKRSLPGLFWNVDDSSANNHHPADASPPTKRFLADNNEASISRSDE  400
             +    +P+  +    KR+L   +W    S A    P    PP KR    NN +S S+   
Sbjct  266   MDLSTIPTNNSTRAPKRALTSPYW----SDAGMATP----PPPKRLQVCNNGSSPSKCTT  317

Query  399   QNGS---------------------------IATLLSHLPQTPSLHQQTMLGALNDG--V  307
              N S                           IA LL+  PQ      QT+LG+L DG  +
Sbjct  318   TNNSNTRSGSNSSAANNSSSSNINSNHGGRTIAALLNQFPQGAVYQHQTILGSLGDGSAI  377

Query  306   FRQPYQVSGINWYS  265
             F+QPYQ+SG NW S
Sbjct  378   FQQPYQLSGANWSS  391



>ref|XP_009146237.1| PREDICTED: NAC domain-containing protein 18 [Brassica rapa]
Length=351

 Score =   287 bits (735),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 184/347 (53%), Positives = 218/347 (63%), Gaps = 44/347 (13%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EELVVHYLK+K ASAP+PVAIIAEVDLYKFDPWELPAKA+FGEQEWYFFSPRDRKYPNGA
Sbjct  29    EELVVHYLKRKAASAPLPVAIIAEVDLYKFDPWELPAKASFGEQEWYFFSPRDRKYPNGA  88

Query  1068  RPNRAATSGYWKATGTDKPVLTAGGTQKVGVKKALVFYGGKPPKGVKTNWIMHEYRLADN  889
             RPNRAATSGYWKATGTDKPVL + G QKVGVKKALVFY GKPPKG+K++WIMHEYRL DN
Sbjct  89    RPNRAATSGYWKATGTDKPVLASDGNQKVGVKKALVFYSGKPPKGIKSDWIMHEYRLIDN  148

Query  888   KTSNKPPGLDIANRSKGGSLRLDDWVLCRIYKKNNSQRPLDHESD-DLNDMLQGSIPPFV  712
             K +N+PPG D  N  K  SLRLDDWVLCRIYKKNN+ R +D++ D D+ D +   IPP +
Sbjct  149   KPNNRPPGCDFGN--KKNSLRLDDWVLCRIYKKNNAGRHVDNDKDHDMIDYIFRKIPPSL  206

Query  711   T------------HQKMGLKPSNYGALLQTD-hhhhhhHMFDQGLVP---GDASLGGART  580
             +             + M   P  YG     D   ++   M +  +     GD    G   
Sbjct  207   SMTAATTGLHHNVSRSMNFFPGGYGIFPDGDPGLYNGSGMINNNIAVCTNGDVVGNGLNH  266

Query  579   AQLPFVPSTPNLLPT-KRSLPGLFWNVDDSSANNHHPADASPPTKRFLADNNEASISRSD  403
             A      S P ++   KR+LP  FW V +         D S P KRF             
Sbjct  267   AS----SSGPMMMANLKRALPVPFWPVAEEE------QDVS-PNKRF----------HGG  305

Query  402   EQNGSIATLLSH-LPQTPSLHQQTMLGALNDGVFRQPYQVSGINWYS  265
             E  G  + + S  + +TP L QQ   G L DG+    YQ++G+NWYS
Sbjct  306   EGGGDCSNMSSSMMEETPPLMQQQG-GVLGDGL-TTSYQLTGLNWYS  350



>ref|XP_010465520.1| PREDICTED: NAC domain-containing protein 18-like [Camelina sativa]
Length=369

 Score =   287 bits (735),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 184/359 (51%), Positives = 217/359 (60%), Gaps = 52/359 (14%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EELVVHYLK+K ASAP+PVAIIAEVDLYKFDPWELPAKA+FGEQEWYFFSPRDRKYPNGA
Sbjct  29    EELVVHYLKRKAASAPLPVAIIAEVDLYKFDPWELPAKASFGEQEWYFFSPRDRKYPNGA  88

Query  1068  RPNRAATSGYWKATGTDKPVLTAGGTQKVGVKKALVFYGGKPPKGVKTNWIMHEYRLADN  889
             RPNRAATSGYWKATGTDKPVL + G QKVGVKKALVFY GKPPKGVK++WIMHEYRL +N
Sbjct  89    RPNRAATSGYWKATGTDKPVLASDGNQKVGVKKALVFYSGKPPKGVKSDWIMHEYRLIEN  148

Query  888   KTSNKPPGLDIANRSKGGSLRLDDWVLCRIYKKNNSQRPLDHESD-DLNDMLQGSIPPFV  712
             K +N+PPG D  N  K  SLRLDDWVLCRIYKKNN+ R +D++ D D+ D +   IPP +
Sbjct  149   KLNNRPPGCDFGN--KKNSLRLDDWVLCRIYKKNNAGRHVDNDKDHDMIDYIFRKIPPSL  206

Query  711   TH--QKMGLKPSNYGALLQTDhhhhhhHMFDQGLVP--------------------GDAS  598
             +      GL   N+      +           G+ P                    G  S
Sbjct  207   SMAAAATGLHHHNHNVSRSMNFFPGRFSGGGYGIFPDGNNASLYDGGGMGMINNNMGTDS  266

Query  597   LGGARTAQLPFV------PSTPNLLPT--KRSLPGLFWNVDDSSANNHHPADASPPTKRF  442
             L       +  V       S P ++    KR LP  +W V +         DAS P+KRF
Sbjct  267   LDHHDNNNVDVVGLNHASSSVPMMMMANQKRPLPVPYWPVAEEE------QDAS-PSKRF  319

Query  441   LADNNEASISRSDEQNGSIATLLSHLPQTPSLHQQTMLGALNDGVFR-QPYQVSGINWY  268
                  + S   S           S + +TP + QQ   G L DG+FR  PYQ+ G+NWY
Sbjct  320   HGGGGDCSNMSS-----------SMMEETPPMMQQQGGGVLGDGLFRTTPYQLPGLNWY  367



>ref|XP_009418167.1| PREDICTED: NAC transcription factor NAM-B2-like [Musa acuminata 
subsp. malaccensis]
Length=421

 Score =   288 bits (738),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 186/397 (47%), Positives = 226/397 (57%), Gaps = 83/397 (21%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EELVVHYLKKK ASAP+PVAII EVDLYKFDPWELP KA+FGEQEWYFFSPRDRKYPNGA
Sbjct  39    EELVVHYLKKKAASAPLPVAIITEVDLYKFDPWELPGKASFGEQEWYFFSPRDRKYPNGA  98

Query  1068  RPNRAATSGYWKATGTDKPVLTAGGTQ-KVGVKKALVFYGGKPPKGVKTNWIMHEYRLAD  892
             RPNRAATSGYWKATGTDKPVLT+GG Q KVGVKKALVFY G+PP+G+KTNWIMHEYRLAD
Sbjct  99    RPNRAATSGYWKATGTDKPVLTSGGNQVKVGVKKALVFYRGRPPRGIKTNWIMHEYRLAD  158

Query  891   NKT----------------------SNKPP-GLDIANRSKGGSLRLDDWVLCRIYKKNNS  781
               +                      S +PP G  +AN+ +GGSLRLDDWVLCRIYKKNNS
Sbjct  159   ASSRCCPDNNNNSNSNSNSNSSSSSSCRPPHGGHMANKKRGGSLRLDDWVLCRIYKKNNS  218

Query  780   ------QRPLDHESDDLNDMLQGSIPPFVTHQKMG-----------LKPSNYGALLQTDh  652
                    R +  + +D  D + G+ P                      P+NY ALL+ D 
Sbjct  219   SDVGVDMRAMQRDREDAMDDILGAAPSLAQQTAATGGQPDSGPLPQRPPTNYNALLEND-  277

Query  651   hhhhhHMFDQGLVPGDASL-----------GGARTAQLPFVPSTPNLLPTKRSLPGLFWN  505
                    F +GL+  +  L             A  AQL          PT+  L   +W 
Sbjct  278   -----ETFFEGLLANEVGLPSNPITHLAAAAAAPRAQLNLALLPAGTFPTRNPLASAYW-  331

Query  504   VDDSSANNHHPADASPPTKRFLADNNEASISRSDEQNGSIAT---------------LLS  370
             +D +         A+P  KRF   +  +S S +++ N S  +               +L+
Sbjct  332   IDSTDI-------AAPSAKRFHTGDGNSSSSAANKNNTSSYSNGSATNDDGGHENQMILN  384

Query  369   HLPQTPSLHQQTMLGALNDG--VFRQPYQVSGINWYS  265
              +P   + H Q ML  L DG  +F+QPYQ+ G+NW S
Sbjct  385   QMPHGATFHDQMMLRQLRDGGAIFQQPYQLPGVNWSS  421



>ref|NP_188170.1| NAC domain containing protein 2 [Arabidopsis thaliana]
 gb|AAF35417.1| putative jasmonic acid regulatory protein [Arabidopsis thaliana]
 dbj|BAB20600.1| AtNAC2 [Arabidopsis thaliana]
 dbj|BAB02380.1| jasmonic acid regulatory protein-like [Arabidopsis thaliana]
 gb|AAO42106.1| putative jasmonic acid regulatory protein [Arabidopsis thaliana]
 gb|AAO50577.1| putative jasmonic acid regulatory protein [Arabidopsis thaliana]
 gb|AEE75684.1| NAC domain containing protein 2 [Arabidopsis thaliana]
Length=364

 Score =   286 bits (732),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 188/354 (53%), Positives = 224/354 (63%), Gaps = 44/354 (12%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EELVVHYLK+K ASAP+PVAIIAEVDLYKFDPWELPAKA+FGEQEWYFFSPRDRKYPNGA
Sbjct  28    EELVVHYLKRKAASAPLPVAIIAEVDLYKFDPWELPAKASFGEQEWYFFSPRDRKYPNGA  87

Query  1068  RPNRAATSGYWKATGTDKPVLTAGGTQKVGVKKALVFYGGKPPKGVKTNWIMHEYRLADN  889
             RPNRAATSGYWKATGTDKPVL + G QKVGVKKALVFY GKPPKGVK++WIMHEYRL +N
Sbjct  88    RPNRAATSGYWKATGTDKPVLASDGNQKVGVKKALVFYSGKPPKGVKSDWIMHEYRLIEN  147

Query  888   KTSNKPPGLDIANRSKGGSLRLDDWVLCRIYKKNNSQRPLDHESD-DLNDMLQGSIPPFV  712
             K +N+PPG D  N  K  SLRLDDWVLCRIYKKNN+ R +D++ D D+ D +   IPP +
Sbjct  148   KPNNRPPGCDFGN--KKNSLRLDDWVLCRIYKKNNASRHVDNDKDHDMIDYIFRKIPPSL  205

Query  711   T--------HQ-------KMGLKPSNY-GALLQTDhhhhhhHMFDQGLV---PGDASLGG  589
             +        HQ        M   P  + G          +  ++D G +    G  S+  
Sbjct  206   SMAAASTGLHQHHHNVSRSMNFFPGKFSGGGYGIFSDGGNTSIYDGGGMINNIGTDSVDH  265

Query  588   ARTAQLPFV----PSTPNLLPT-KRSLPGLFWNVDDSSANNHHPADASPPTKRFLADNNE  424
                A +  +     S P ++   KR+LP  +W V D         DAS P+KRF    + 
Sbjct  266   DNNADVVGLNHASSSGPMMMANLKRTLPVPYWPVADEE------QDAS-PSKRF----HG  314

Query  423   ASISRSDEQNGSIATLLSHLPQTPSLHQQTMLGALNDGVFR-QPYQVSGINWYS  265
                   D  N S     S + +TP L QQ   G L DG+FR   YQ+ G+NWYS
Sbjct  315   VGGGGGDCSNMSS----SMMEETPPLMQQQG-GVLGDGLFRTTSYQLPGLNWYS  363



>gb|KHG21395.1| NAC domain-containing 18 -like protein [Gossypium arboreum]
Length=265

 Score =   283 bits (723),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 166/289 (57%), Positives = 203/289 (70%), Gaps = 38/289 (13%)
 Frame = -2

Query  1101  SPRDRKYPNGARPNRAATSGYWKATGTDKPVLTAGGTQKVGVKKALVFYGGKPPKGVKTN  922
             SPRDRKYPNGARPNRAATSGYWKATGTDKPVLT+GGTQKVGVKKALVFYGGKPPKG+KTN
Sbjct  5     SPRDRKYPNGARPNRAATSGYWKATGTDKPVLTSGGTQKVGVKKALVFYGGKPPKGIKTN  64

Query  921   WIMHEYRLADNKTSNKPPGLDIANRSKGGSLRLDDWVLCRIYKKNNSQRPLDHESDDLND  742
             WIMHEYRLADNKT+NKPPG D+ N+    SLRLDDWVLCRIYKKNN+ RPL+H+ DD  D
Sbjct  65    WIMHEYRLADNKTNNKPPGCDLGNKKN--SLRLDDWVLCRIYKKNNANRPLEHDKDDSMD  122

Query  741   MLQGSIPPFVTHQK-------MGLKPSNYGALLQTDhhhhhhHMFDQGLVPGDASLGGAR  583
              + G++PP ++             K +++G LL+   H  H+ +FD G++  D       
Sbjct  123   DMLGTVPPSISISSQHNPKFHFSTKGTSFGTLLE---HQEHNSLFD-GMMGSDG------  172

Query  582   TAQLPFVPSTPNLLPTKRSLPGLFWNVDDSSANNHHPADASPPT-KRFLADNNEASISRS  406
                   + S   + P KR+LP L+W  D++         A P T KRF  D+N+ S+ ++
Sbjct  173   ------INSASMVNPLKRALPSLYWTDDET---------AGPSTSKRFHGDSNDGSMEKT  217

Query  405   DEQNGSIATLLSHLPQTPSLHQQ--TMLGALNDGVFRQPYQVSGINWYS  265
             D  NGSIATLLS LPQTP L QQ   MLG++ DG+FR PYQ+ G+NWYS
Sbjct  218   D-GNGSIATLLSQLPQTPPLQQQQAAMLGSMGDGIFRPPYQLPGLNWYS  265



>ref|XP_010100577.1| NAC domain-containing protein 29 [Morus notabilis]
 gb|EXB82820.1| NAC domain-containing protein 29 [Morus notabilis]
Length=345

 Score =   285 bits (730),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 182/350 (52%), Positives = 212/350 (61%), Gaps = 52/350 (15%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EELVVHYLK+K +S P+PV IIAEVDLYKFDPWELP+KA+FGEQEWYFFSPRDRKYPNGA
Sbjct  26    EELVVHYLKRKASSVPLPVTIIAEVDLYKFDPWELPSKASFGEQEWYFFSPRDRKYPNGA  85

Query  1068  RPNRAATSGYWKATGTDKPVLTAGGTQKVGVKKALVFYGGKPPKGVKTNWIMHEYRLADN  889
             RPNRAATSGYWKATGTDKP+LT+ GTQKVGVKKALVFYGGKPPKG+KTNWIMHEYRL DN
Sbjct  86    RPNRAATSGYWKATGTDKPILTSNGTQKVGVKKALVFYGGKPPKGIKTNWIMHEYRLVDN  145

Query  888   KTSNKPPGLDIANRSKGGSLRLDDWVLCRIYKKNNSQRP-LDHESDDLNDMLQGSIPPFV  712
              T  K P    +   K  SLRLDDWVLCRIYKKNN+QRP +DH+ +D  D L        
Sbjct  146   ITKPKLPDHHTST-DKKASLRLDDWVLCRIYKKNNAQRPMMDHDKEDSMDALLMQSTTMQ  204

Query  711   THQKMGL-------KPSNYGALLQTDhhhhhhHMFDQGLVPGDASLGGARTAQLPFVPST  553
             T Q + +       KPSNY ALL+ D        F  GL+        +         + 
Sbjct  205   TTQNISIIPKLPTPKPSNYTALLENDES------FFDGLLSSADHHHSSSINN-----NK  253

Query  552   PNLLPTKRSLPGLFWNVDDSSANNHHPADASPPT------KRFLADNN-----EASISRS  406
              N+L  KR  P  FW          H A A PP       KRF  D N         + S
Sbjct  254   NNVLAVKRLPPSPFW----------HEAGAGPPVVGPGSAKRFHGDLNSGTSTGGGGTDS  303

Query  405   DEQNGSIATLLSHLPQ---TPSLHQQTMLGALNDGVFRQPYQVSGINWYS  265
             +  N S  ++LS +PQ   TP      +LG+         +Q+  +NW S
Sbjct  304   EINNNSFVSILSQIPQNNTTPFHPNGVLLGSQ--------FQLPTMNWSS  345



>ref|NP_001284435.1| NAC domain-containing protein 18-like [Cucumis melo]
 gb|ABM88940.1| NAC transcription factor [Cucumis melo]
Length=318

 Score =   284 bits (727),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 181/335 (54%), Positives = 210/335 (63%), Gaps = 51/335 (15%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EELVVHYLKKK  S P+PVAIIAEVDLYK+DPWELPAKA++GEQEWYFFSPRDRKYPNGA
Sbjct  28    EELVVHYLKKKATSLPLPVAIIAEVDLYKYDPWELPAKASYGEQEWYFFSPRDRKYPNGA  87

Query  1068  RPNRAATSGYWKATGTDKPVLTAG-GTQKVGVKKALVFYGGKPPKGVKTNWIMHEYRLAD  892
             RPNRAATSGYWKATGTDKPV+ +  G +KVGVKKALVFYGGKPPKG+KTNWIMHEYRLAD
Sbjct  88    RPNRAATSGYWKATGTDKPVIASSEGNRKVGVKKALVFYGGKPPKGIKTNWIMHEYRLAD  147

Query  891   NKT----SNKPPGLDIANRSKGGSLRLDDWVLCRIYKKNNSQRP-LDHESDDLNDMLQGS  727
             NK+    +NKPPG  I    K  SLRLDDWVLCRIYKKNNS +P  DHE +D  D + GS
Sbjct  148   NKSGGGNNNKPPGFIIG--GKKNSLRLDDWVLCRIYKKNNSNKPGTDHEREDCFDSMVGS  205

Query  726   IPPFVTHQKMGLKPSNYGALLQTDhhhhhhHMFDQGLVPGDASLGGARTAQLPFVPSTPN  547
             IP         ++ +NY   + T     +  M+ +      ASL                
Sbjct  206   IP-------SSIQINNYNQSMTTTTTATNFSMYSE-----LASLS---------------  238

Query  546   LLPTKRSLPGLFWNVDDSSANNHHPADASPPTKRFLADNNEASISRSDEQNGSIATLLSH  367
              LP KR L    W  ++     +  AD     KR    N           + SIA LLS 
Sbjct  239   -LPMKRLLQPPSWEEEE-----YRLADNRSSRKRLQLMNGGGG------GDNSIAALLSQ  286

Query  366   LPQTPSLHQQTMLGAL-NDGVFRQPYQVSGINWYS  265
             L   PSL Q T+ G +  D +FR  +Q+   NWYS
Sbjct  287   L---PSLQQPTLQGCIVGDEIFRPAFQLPETNWYS  318



>ref|XP_004147807.1| PREDICTED: NAC transcription factor ONAC010-like [Cucumis sativus]
 gb|KGN59897.1| hypothetical protein Csa_3G852460 [Cucumis sativus]
Length=318

 Score =   284 bits (727),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 180/335 (54%), Positives = 211/335 (63%), Gaps = 51/335 (15%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EELVVHYLKKK  S P+PVAIIAEVDLYK+DPWELPAKA++GEQEWYFFSPRDRKYPNGA
Sbjct  28    EELVVHYLKKKATSLPLPVAIIAEVDLYKYDPWELPAKASYGEQEWYFFSPRDRKYPNGA  87

Query  1068  RPNRAATSGYWKATGTDKPVLTAG-GTQKVGVKKALVFYGGKPPKGVKTNWIMHEYRLAD  892
             RPNRAATSGYWKATGTDKPV+ +  G +KVGVKKALVFYGGKPPKG+KTNWIMHEYRLAD
Sbjct  88    RPNRAATSGYWKATGTDKPVIASSEGNRKVGVKKALVFYGGKPPKGIKTNWIMHEYRLAD  147

Query  891   NKT----SNKPPGLDIANRSKGGSLRLDDWVLCRIYKKNNSQRP-LDHESDDLNDMLQGS  727
             NK+    +NKPPG +I    K  SLRLDDWVLCRIYKK NS +P +DHE +D  D L GS
Sbjct  148   NKSGGGNNNKPPGFNIG--GKKNSLRLDDWVLCRIYKKTNSNKPGMDHEREDCFDSLVGS  205

Query  726   IPPFVTHQKMGLKPSNYGALLQTDhhhhhhHMFDQGLVPGDASLGGARTAQLPFVPSTPN  547
             IP         ++ ++Y   + T     +  M+ +      ASL                
Sbjct  206   IP-------SSIQINSYNQSMTTTTTATNFSMYSE-----LASLS---------------  238

Query  546   LLPTKRSLPGLFWNVDDSSANNHHPADASPPTKRFLADNNEASISRSDEQNGSIATLLSH  367
              LP KR L    W  ++     +  AD     KR    N           + SIA LLS 
Sbjct  239   -LPMKRLLQPPSWEEEE-----YRLADNRSSRKRLQLMNGGGG------GDNSIAALLSQ  286

Query  366   LPQTPSLHQQTMLGAL-NDGVFRQPYQVSGINWYS  265
             L   PSL Q T+ G +  D +FR  +Q+   NWYS
Sbjct  287   L---PSLQQPTLQGCIVGDEIFRPAFQLPETNWYS  318



>ref|XP_010675608.1| PREDICTED: NAC transcription factor 25 [Beta vulgaris subsp. 
vulgaris]
Length=410

 Score =   286 bits (732),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 192/391 (49%), Positives = 228/391 (58%), Gaps = 78/391 (20%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EELVVHYLK+KV S  +PV+IIAEVDLYKFDPWELP KA FGEQEWYFFSPRDRKYPNGA
Sbjct  35    EELVVHYLKRKVQSTSLPVSIIAEVDLYKFDPWELPDKAVFGEQEWYFFSPRDRKYPNGA  94

Query  1068  RPNRAATSGYWKATGTDKPVLTAGGTQKVGVKKALVFYGGKPPKGVKTNWIMHEYRLADN  889
             RPNRAATSGYWKATGTDKPVL++ G+QKVGVKKALVFYGGKPP+GVKTNWIMHEYRL DN
Sbjct  95    RPNRAATSGYWKATGTDKPVLSS-GSQKVGVKKALVFYGGKPPRGVKTNWIMHEYRLVDN  153

Query  888   KTSNKPPGLDIANRSKGGSLRLDDWVLCRIYKKNNSQRPLDHESDDLNDMLQGSIPPFVT  709
             K +NKPP  D+ +  K GSLRLDDWVLCRIYKKNN+ RP+DHE +D  + +     P   
Sbjct  154   KPNNKPPAYDLCHNKK-GSLRLDDWVLCRIYKKNNTNRPMDHEREDSMEDMMMMGTPMSM  212

Query  708   HQKMGLKPS-----------------------NYGALLQTDhhhhhhHMFDQGLVPGDAS  598
                M +  S                       NY +LL  D H    H   +G++ G A 
Sbjct  213   SMSMSMPSSISNMGQHHHLHNHHPLTKVTGSLNYTSLL--DSHVDDQHGIYEGMMGGHAM  270

Query  597   LGGARTAQLPFVPSTPNLLPTKRSLPGLFWNVDDSSANNHHPADASPPTKRF--------  442
                   + +P           KR+LP L+W  +D +         S P+KR         
Sbjct  271   DPPTNISHMPL----------KRTLPSLYWGGNDHNTGGDIGCSHS-PSKRLSMLQMSNE  319

Query  441   --------------LADNN---EASISRSDEQ---------------NGSIATLLSHLPQ  358
                           +A NN   E S +RSD                 +  +  L S +P 
Sbjct  320   ANNNNNNNNNNNTKIAGNNNSSEESGARSDHHVNNNNNNNNNNMSSMSSLLNQLPSEIPP  379

Query  357   TPSLHQQTMLGALNDGVFRQPYQVSGINWYS  265
                  QQ MLG+L+DGVFRQPY + G+NWYS
Sbjct  380   PLHQQQQPMLGSLSDGVFRQPYPLPGLNWYS  410



>emb|CDY20131.1| BnaA01g28710D [Brassica napus]
Length=350

 Score =   283 bits (724),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 177/348 (51%), Positives = 211/348 (61%), Gaps = 46/348 (13%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EELVVHYLK+K ASAP+PV+IIA+VDLYKFDPWELPAKA+FGEQEWYFFSPRDRKYPNGA
Sbjct  28    EELVVHYLKRKAASAPLPVSIIADVDLYKFDPWELPAKASFGEQEWYFFSPRDRKYPNGA  87

Query  1068  RPNRAATSGYWKATGTDKPVLTAGGTQKVGVKKALVFYGGKPPKGVKTNWIMHEYRLADN  889
             RPNRAATSGYWKATGTDKPVL + G QKVGVKKALVFY GKPPKGVK++WIMHEYRL DN
Sbjct  88    RPNRAATSGYWKATGTDKPVLASDGNQKVGVKKALVFYSGKPPKGVKSDWIMHEYRLIDN  147

Query  888   KTSNKPPGLDIANRSKGGSLRLDDWVLCRIYKKNNSQRPLDHESD-DLNDMLQGSIPPFV  712
             K +N+PPG D  N  K  SLRLDDWVLCRIYKKNN+ R ++++ D D+ D +   IP  +
Sbjct  148   KPNNRPPGCDYGN--KKNSLRLDDWVLCRIYKKNNAGRHVENDKDHDMIDYIFRKIPSGL  205

Query  711   TH---QKMGLKPSNYGALLQTDhhhhhhHMF---DQGLVPGDASL--GGARTAQLPFVPS  556
              H   + M   P  + +            MF   D GL  G + +   G     L     
Sbjct  206   NHNVSRSMNFFPGRFSSAY---------GMFSDNDPGLYDGSSMMCSSGTDAVNLNVCNG  256

Query  555   TPNLLPTKRSLPGLFWNVDDSSANNHHPADASPPT-------KRFLADNNEASISRSDE-  400
              P               + D   N  +P  +S P        KR L +  E S S+    
Sbjct  257   NP---------------IADVVGNGLNPVSSSGPMMMMMANLKRALPEEQEVSPSKRFHG  301

Query  399   --QNGSIATLLSHLPQTPSLHQQTMLGALNDGVFR-QPYQVSGINWYS  265
                 G    + S + + P    Q   G L DG+FR   YQ+ G+NWYS
Sbjct  302   VGGGGDCTNMSSSMVEEPPPLMQQQGGVLGDGLFRATSYQLPGLNWYS  349



>ref|XP_002882948.1| ATNAC2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH59207.1| ATNAC2 [Arabidopsis lyrata subsp. lyrata]
Length=363

 Score =   283 bits (725),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 183/354 (52%), Positives = 221/354 (62%), Gaps = 45/354 (13%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EELVVHYLK+K ASAP+PVAIIAEVDLYKFDPWELPAKA+FGEQEWYFFSPRDRKYPNGA
Sbjct  28    EELVVHYLKRKAASAPLPVAIIAEVDLYKFDPWELPAKASFGEQEWYFFSPRDRKYPNGA  87

Query  1068  RPNRAATSGYWKATGTDKPVLTAGGTQKVGVKKALVFYGGKPPKGVKTNWIMHEYRLADN  889
             RPNRAATSGYWKATGTDKPVL + G QKVGVKKALVFY GKPPKGVK++WIMHEYRL +N
Sbjct  88    RPNRAATSGYWKATGTDKPVLASDGNQKVGVKKALVFYSGKPPKGVKSDWIMHEYRLIEN  147

Query  888   KTSNKPPGLDIANRSKGGSLRLDDWVLCRIYKKNNSQRPLDHESD-DLNDMLQGSIPPFV  712
             K +N+PPG D  N  K  SLRLDDWVLCRIYKKNN+ R +D++ D D+ D +   IPP +
Sbjct  148   KPNNRPPGCDFGN--KKNSLRLDDWVLCRIYKKNNASRHVDNDKDHDMIDYIFRKIPPPL  205

Query  711   T---------------HQKMGLKPSNY-GALLQTDhhhhhhHMFDQGLV---PGDASLGG  589
             +                + M   P  + G          +  ++D G +    G  S+  
Sbjct  206   SMAAAATGLHHHHHNVSRSMNFFPGKFSGGGYGIFSDGGNTSLYDGGGMINNIGTDSVDH  265

Query  588   ARTAQLPFV----PSTPNLLPT-KRSLPGLFWNVDDSSANNHHPADASPPTKRFLADNNE  424
                A +  +     S P ++ + KR+LP  +W V +         DAS P+KRF      
Sbjct  266   DNNADVVGLNHASSSGPMMMASLKRALPVPYWPVAEEE------QDAS-PSKRFHGGGGG  318

Query  423   ASISRSDEQNGSIATLLSHLPQTPSLHQQTMLGALNDGVFR-QPYQVSGINWYS  265
                S             S + +TP L QQ   G L DG+FR   YQ+ G+NWYS
Sbjct  319   GDCSNMSS---------SMMEETPPLMQQQG-GVLGDGLFRTTSYQLPGLNWYS  362



>ref|XP_009115491.1| PREDICTED: NAC domain-containing protein 18-like [Brassica rapa]
Length=358

 Score =   282 bits (722),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 178/358 (50%), Positives = 215/358 (60%), Gaps = 58/358 (16%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EELVVHYLK+K ASAP+PV+IIA+VDLYKFDPWELPAKA+FGEQEWYFFSPRDRKYPNGA
Sbjct  28    EELVVHYLKRKAASAPLPVSIIADVDLYKFDPWELPAKASFGEQEWYFFSPRDRKYPNGA  87

Query  1068  RPNRAATSGYWKATGTDKPVLTAGGTQKVGVKKALVFYGGKPPKGVKTNWIMHEYRLADN  889
             RPNRAATSGYWKATGTDKPVL + G QKVGVKKALVFY GKPPKGVK++WIMHEYRL DN
Sbjct  88    RPNRAATSGYWKATGTDKPVLASDGNQKVGVKKALVFYSGKPPKGVKSDWIMHEYRLIDN  147

Query  888   KTSNKPPGLDIANRSKGGSLRLDDWVLCRIYKKNNSQRPLDHESD-DLNDMLQGSIPPFV  712
             K +N+PPG D  N  K  SLRLDDWVLCRIYKKNN+ RP++++ D D+ D +   IP  +
Sbjct  148   KPNNRPPGCDYGN--KKNSLRLDDWVLCRIYKKNNAGRPVENDKDHDMIDYIFRKIPSGL  205

Query  711   TH---QKMGLKPSNYGALLQTDhhhhhhHMF---DQGLVPGDASLGGARTAQL-------  571
              H   + M   P  + +            MF   D GL  G + +  + T  +       
Sbjct  206   NHNVSRSMNFFPGRFSSAY---------GMFSDNDPGLYDGSSMMCSSGTDAVNLNVCNG  256

Query  570   ------------PFVPSTPNLLPT---KRSLPGLFWNVDDSSANNHHPADASPPTKRFLA  436
                         P   S P ++     KR+LP  +W V +             P+KRF  
Sbjct  257   NPIADVVGNGLNPVSSSGPMMMMMANLKRALPVPYWPVGEEE-------QEVSPSKRFHG  309

Query  435   DNNEASISRSDEQNGSIATLLSHLPQTPSLHQQTMLGALNDGVFR-QPYQVSGINWYS  265
                           G    + S + + P    Q   G L DG+FR   YQ+ G+NWYS
Sbjct  310   VGG----------GGDCTNMSSSMVEEPPPLMQQQGGVLGDGLFRATSYQLPGLNWYS  357



>ref|XP_004172388.1| PREDICTED: LOW QUALITY PROTEIN: NAC transcription factor ONAC010-like 
[Cucumis sativus]
Length=318

 Score =   281 bits (719),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 179/335 (53%), Positives = 210/335 (63%), Gaps = 51/335 (15%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EELVVHYLKKK  S P+PVAIIAEVDLYK+DPWELPAKA++GEQEWY FSPRDRKYPNGA
Sbjct  28    EELVVHYLKKKATSLPLPVAIIAEVDLYKYDPWELPAKASYGEQEWYXFSPRDRKYPNGA  87

Query  1068  RPNRAATSGYWKATGTDKPVLTAG-GTQKVGVKKALVFYGGKPPKGVKTNWIMHEYRLAD  892
             RPNRAATSGYWKATGTDKPV+ +  G +KVGVKKALVFYGGKPPKG+KTNWIMHEYRLAD
Sbjct  88    RPNRAATSGYWKATGTDKPVIASSEGNRKVGVKKALVFYGGKPPKGIKTNWIMHEYRLAD  147

Query  891   NKT----SNKPPGLDIANRSKGGSLRLDDWVLCRIYKKNNSQRP-LDHESDDLNDMLQGS  727
             NK+    +NKPPG +I    K  SLRLDDWVLCRIYKK NS +P +DHE +D  D L GS
Sbjct  148   NKSGGGNNNKPPGFNIG--GKKNSLRLDDWVLCRIYKKTNSNKPGMDHEREDCFDSLVGS  205

Query  726   IPPFVTHQKMGLKPSNYGALLQTDhhhhhhHMFDQGLVPGDASLGGARTAQLPFVPSTPN  547
             IP         ++ ++Y   + T     +  M+ +      ASL                
Sbjct  206   IP-------SSIQINSYNQSMTTTTTATNFSMYSE-----LASLS---------------  238

Query  546   LLPTKRSLPGLFWNVDDSSANNHHPADASPPTKRFLADNNEASISRSDEQNGSIATLLSH  367
              LP KR L    W  ++     +  AD     KR    N           + SIA LLS 
Sbjct  239   -LPMKRLLQPPSWEEEE-----YRLADNRSSRKRLQLMNGGGG------GDNSIAALLSQ  286

Query  366   LPQTPSLHQQTMLGAL-NDGVFRQPYQVSGINWYS  265
             L   PSL Q T+ G +  D +FR  +Q+   NWYS
Sbjct  287   L---PSLQQPTLQGCIVGDEIFRPAFQLPETNWYS  318



>gb|KEH31125.1| NAC transcription factor-like protein [Medicago truncatula]
Length=344

 Score =   281 bits (719),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 183/343 (53%), Positives = 212/343 (62%), Gaps = 42/343 (12%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EELVVHYLK+K ASAP+PVAIIAE+DLYKFDPWELP+KA+FGEQEWYFFSPRDRKYPNGA
Sbjct  26    EELVVHYLKRKAASAPLPVAIIAEIDLYKFDPWELPSKASFGEQEWYFFSPRDRKYPNGA  85

Query  1068  RPNRAATSGYWKATGTDKPVLTAGGTQKVGVKKALVFYGGKPPKGVKTNWIMHEYRL---  898
             RPNRAATSGYWKATGTDKP+LT+ G QKVGVKKALVFYGGKPPKGVKTNWIMHEYRL   
Sbjct  86    RPNRAATSGYWKATGTDKPILTSDGNQKVGVKKALVFYGGKPPKGVKTNWIMHEYRLITD  145

Query  897   -----ADNKTSNKP--PGLDIANRSKGGSLRLDDWVLCRIYKKNNSQ---RPL--DHESD  754
                  + N TS  P  P     N +K  SLRLDDWVLCRIYKK+NS    RPL  D   D
Sbjct  146   HNNHHSYNATSKTPPLPSDHPPNNNKKNSLRLDDWVLCRIYKKSNSSNMPRPLLMDQYDD  205

Query  753   DLNDMLQGSIPPFVTHQKMGLKPSNYGALLQTDhhhhhhHMFDQGLVPGDASLGGARTAQ  574
                +M Q S          GL+  +              + FD  L        G     
Sbjct  206   QTYNMQQNSKHSSSRSTSYGLENDD--------------NFFDGILASDHGMQNGCDINS  251

Query  573   LPFVPSTPNLLPTKRSL--PGLFWNVDDSSANNHHPADASPPTKRFLADNNEASISRSDE  400
                  +  +L P KR+L     FWN   S         +S  +KRF  D N + IS + E
Sbjct  252   KGDNNNNESLFPMKRALNASSQFWNETGSPG-------SSSSSKRFHGDLN-SGISSNAE  303

Query  399   QNGSIATLLSHLPQTPSLHQQTMLGALNDGVFRQPYQVSGINW  271
             +N S  +LLS LP + + HQ ++LG   DGV RQ +Q+  INW
Sbjct  304   ENNSFVSLLSQLPPSTTFHQNSILG---DGVMRQQFQLPDINW  343



>emb|CDX97675.1| BnaA05g24040D [Brassica napus]
Length=343

 Score =   280 bits (716),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 181/347 (52%), Positives = 214/347 (62%), Gaps = 52/347 (15%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EELVVHYLK+K ASAP+PVAIIAEVDLYKFDPWELPAKA+FGEQEWYFFSPRDRKYPNGA
Sbjct  29    EELVVHYLKRKAASAPLPVAIIAEVDLYKFDPWELPAKASFGEQEWYFFSPRDRKYPNGA  88

Query  1068  RPNRAATSGYWKATGTDKPVLTAGGTQKVGVKKALVFYGGKPPKGVKTNWIMHEYRLADN  889
             RPNRAATSGYWKATGTDKPVL + G QKVGVKKALVFY GKPPKG+K++WIMHEYRL DN
Sbjct  89    RPNRAATSGYWKATGTDKPVLASDGNQKVGVKKALVFYSGKPPKGIKSDWIMHEYRLIDN  148

Query  888   KTSNKPPGLDIANRSKGGSLRLDDWVLCRIYKKNNSQRPLDHESD-DLNDMLQGSIPPFV  712
             K +N+PPG D  N  K  SLRLDDWVLCRIYKKNN+ R +D++ D D+ D +   IPP +
Sbjct  149   KPNNRPPGCDFGN--KKNSLRLDDWVLCRIYKKNNAGRHVDNDKDHDMIDYIFRKIPPSL  206

Query  711   T------------HQKMGLKPSNYGALLQTD-hhhhhhHMFDQGLVP---GDASLGGART  580
             +             + M   P  YG     D   ++   M +  +     GD    G   
Sbjct  207   SMTAATTGLHHNVSRSMNFFPGGYGIFPDGDPGLYNGSGMINNNIAVCTNGDVVGNGLNH  266

Query  579   AQLPFVPSTPNLLPT-KRSLPGLFWNVDDSSANNHHPADASPPTKRFLADNNEASISRSD  403
             A      S P ++   KR+LP                 D S P KRF             
Sbjct  267   AS----SSGPMMMANLKRALP--------------EEQDVS-PNKRF----------HGG  297

Query  402   EQNGSIATLLSH-LPQTPSLHQQTMLGALNDGVFRQPYQVSGINWYS  265
             E  G  + + S  + +TP L QQ   G L DG+    YQ++G+NWYS
Sbjct  298   EGGGDCSNMSSSMMEETPPLMQQQG-GVLGDGL-TTSYQLTGLNWYS  342



>emb|CDY56427.1| BnaCnng30350D [Brassica napus]
Length=327

 Score =   278 bits (711),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 171/335 (51%), Positives = 204/335 (61%), Gaps = 43/335 (13%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EELVVHYLK+K ASAP+PV+IIA+VDLYKFDPWELPAKA+FGEQEWYFFSPRDRKYPNGA
Sbjct  28    EELVVHYLKRKAASAPLPVSIIADVDLYKFDPWELPAKASFGEQEWYFFSPRDRKYPNGA  87

Query  1068  RPNRAATSGYWKATGTDKPVLTAGGTQKVGVKKALVFYGGKPPKGVKTNWIMHEYRLADN  889
             RPNRAATSGYWKATGTDKPVL + G QKVGVKKALVFY GKPPKGVK++WIMHEYRL DN
Sbjct  88    RPNRAATSGYWKATGTDKPVLASDGNQKVGVKKALVFYSGKPPKGVKSDWIMHEYRLIDN  147

Query  888   KTSNKPPGLDIANRSKGGSLRLDDWVLCRIYKKNNSQRPLDHESD-DLNDMLQGSIPPFV  712
             K +N+PPG D  N  K  SLRLDDWVLCRIYKKNN+ R +D++ D D+ D +   IP  +
Sbjct  148   KPNNRPPGCDYGN--KKNSLRLDDWVLCRIYKKNNAGRHVDNDKDHDMIDYIFRKIPSGL  205

Query  711   TH---QKMGLKPSNY--GALLQTDhhhhhhHMFDQGLVPGDASLGGARTAQLPFVPSTPN  547
              H   + M   P  +  G  + +D         D G   G   +       +       N
Sbjct  206   NHSVSRSMNFFPGRFSGGYGMFSDG--------DPGFYDGSGMMCSNGADAVNLNVCNGN  257

Query  546   LLPTKRSLPGLFWNVDDSSANNHHPADASPPTKRFLADNNEASISRSDEQNGSIATLLSH  367
             L+              D  A+         P+KRF                G  + + S 
Sbjct  258   LIA-------------DVVADEEQEVS---PSKRFHGVGG----------GGDCSNMSSS  291

Query  366   LPQTPSLHQQTMLGALNDGVFR-QPYQVSGINWYS  265
             + + P    Q   G L DG+FR   YQ+ G+NWYS
Sbjct  292   MVEEPPPFMQQQGGVLGDGLFRTTSYQLPGLNWYS  326



>ref|NP_001281058.1| NAC transcription factor 25-like [Malus domestica]
 gb|ADL36805.1| NAC domain class transcription factor [Malus domestica]
Length=373

 Score =   278 bits (710),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 182/365 (50%), Positives = 217/365 (59%), Gaps = 54/365 (15%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EELVVHYLKKK AS P+PV IIAEVDLYKFDPWELP+KATFGEQEWYFF+PRDRKYPNGA
Sbjct  26    EELVVHYLKKKAASIPLPVTIIAEVDLYKFDPWELPSKATFGEQEWYFFTPRDRKYPNGA  85

Query  1068  RPNRAATSGYWKATGTDKPVLTAGGTQKVGVKKALVFYGGKPPKGVKTNWIMHEYRLADN  889
             RPNRAATSGYWKATGTDKP+LT+ G   VGVKKALVFYGGKPPKG+KTNWIMHEYRL +N
Sbjct  86    RPNRAATSGYWKATGTDKPILTSIGNHNVGVKKALVFYGGKPPKGIKTNWIMHEYRLINN  145

Query  888   KT-------SNKPPGLDIANRSKGGSLRLDDWVLCRIYKKNNSQRP--------LDHESD  754
              T       + KP   D AN  K  SLRLDDWVLCR+YKKNN+QRP          H+++
Sbjct  146   TTTANMSFSTTKPS--DAAN--KKASLRLDDWVLCRVYKKNNAQRPTMSMEGDHFLHKAE  201

Query  753   DLNDMLQGSI---PPFVTHQKMG---------LKPSNYGALLQTDhhhhhhHMFDQGLVP  610
             D N  ++  +   P     QK           L  +NY ALL++D   +H   F+  L  
Sbjct  202   DSNSSMEEGMFLHPSIWPTQKPSPFPPPPSSKLPTTNYTALLESD---YHESFFEGILSS  258

Query  609   GDASLGGARTAQLPFVPS--------TPNLLPTKRSLPGLFWNVDDSSANNHHPADASPP  454
              D   G                    +   +P KR L   FWN  D  +     A  +  
Sbjct  259   SDHQQGSHSHHHDHDHDQFGAISTSSSKTSIPLKRQLSSPFWN--DVGSIGSAAATTTSS  316

Query  453   TKRFLADNNEASISRSDEQNGSIATLLSHLPQ--TPSLHQQTMLGALNDGVFRQPYQVSG  280
             +KRF AD N         +N S  ++L+ +PQ   P  H   +LG L DGV R  +Q+  
Sbjct  317   SKRFHADLN--------SENNSFVSILNQMPQGTAPLYHNPALLGPLGDGVLRPQFQLPS  368

Query  279   INWYS  265
             +NW S
Sbjct  369   MNWNS  373



>emb|CDX98562.1| BnaC05g38130D [Brassica napus]
Length=359

 Score =   276 bits (707),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 179/350 (51%), Positives = 214/350 (61%), Gaps = 42/350 (12%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EELVVHYLK K ASAP+PVAIIAEV+LYKFDPWELPAKA+FGEQEWYFFSPRDRKYPNGA
Sbjct  29    EELVVHYLKPKAASAPLPVAIIAEVNLYKFDPWELPAKASFGEQEWYFFSPRDRKYPNGA  88

Query  1068  RPNRAATSGYWKATGTDKPVLTAGGTQKVGVKKALVFYGGKPPKGVKTNWIMHEYRLADN  889
             RPNRAATSGYWKATGTDKPVL + G QKVGVKKALVFY GKPPKG+K++WIMHEYRL DN
Sbjct  89    RPNRAATSGYWKATGTDKPVLASDGNQKVGVKKALVFYRGKPPKGIKSDWIMHEYRLIDN  148

Query  888   KTSNKPPGLDIANRSKGGSLRLDDWVLCRIYKKNNSQRPLDHESD-DLNDMLQGSIPPFV  712
             K +N+PPG D  N     SLRLDDWVLCRIYKKNN+ R +D++ D D+ D +   IPP +
Sbjct  149   KPNNRPPGCDFGNTKN--SLRLDDWVLCRIYKKNNAGRHVDNDKDHDMIDYIFRKIPPSL  206

Query  711   T------------HQKMGLKPSNYGALLQTDhh-hhhhHMFDQGLV-------PGDASLG  592
             +             + M   P  YG     DH  ++   M +  +        P ++   
Sbjct  207   SMAAATTGLHHNVSRSMNFFPGGYGIFSDGDHGLYNGSGMINNNIAVCSNVAGPVNSDPN  266

Query  591   GARTAQLPFVPSTPNLLPT-KRSLPGLFWNVDDSSANNHHPADASPPTKRFLADNNEASI  415
                    P   S P ++   KR+LP  FW     +A   H  D S P+KRF         
Sbjct  267   AVGNCLNPASSSGPMMMANLKRALPVPFW----PAAEEEH--DVS-PSKRFHGGAGGGDC  319

Query  414   SRSDEQNGSIATLLSHLPQTPSLHQQTMLGALNDGVFRQPYQVSGINWYS  265
             S             S + +TP L QQ   G L D +    YQ+ G+NWY+
Sbjct  320   SNMSS---------SMMEETPPLMQQQG-GVLGDELTTS-YQLPGLNWYA  358



>ref|XP_009379434.1| PREDICTED: NAC transcription factor 25 [Pyrus x bretschneideri]
Length=374

 Score =   276 bits (706),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 183/365 (50%), Positives = 219/365 (60%), Gaps = 53/365 (15%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EELVVHYLKKK AS P+PV IIAEVDLYKFDPWELP+KATFGEQEWYFF+PRDRKYPNGA
Sbjct  26    EELVVHYLKKKAASIPLPVTIIAEVDLYKFDPWELPSKATFGEQEWYFFTPRDRKYPNGA  85

Query  1068  RPNRAATSGYWKATGTDKPVLTAGGTQKVGVKKALVFYGGKPPKGVKTNWIMHEYRLADN  889
             RPNRAATSGYWKATGTDKP+LT+ G   VGVKKALVFYGGKPPKG+KTNWIMHEYRL +N
Sbjct  86    RPNRAATSGYWKATGTDKPILTSIGNHNVGVKKALVFYGGKPPKGIKTNWIMHEYRLINN  145

Query  888   KT-------SNKPPGLDIANRSKGGSLRLDDWVLCRIYKKNNSQRP--------LDHESD  754
              T       + KP   D AN  K  SLRLDDWVLCR+YKKNN+QRP          H+++
Sbjct  146   TTTANMSFSTTKPS--DAAN--KKASLRLDDWVLCRVYKKNNAQRPTMSMEGDHFLHKAE  201

Query  753   DLNDMLQGSI---PPFVTHQKMG---------LKPSNYGALLQTDhhhhhhHMFDQGLVP  610
             D N  ++  +   P  +  QK           L  +NY ALL++D   +H   F+  L  
Sbjct  202   DSNSSMEEGMFLHPSILPTQKPPPFPPPLSSKLPTTNYTALLESD---YHESFFEGILSS  258

Query  609   GDASLGGARTAQL--------PFVPSTPNLLPTKRSLPGLFWNVDDSSANNHHPADASPP  454
              D   G                   S+   +P KR L   FWN D  S  +   A  +  
Sbjct  259   SDHQQGSHSHHHDHDHDQFGAISTSSSKTSIPLKRQLSSPFWN-DVGSIGSAAAATTTSS  317

Query  453   TKRFLADNNEASISRSDEQNGSIATLLSHLPQ--TPSLHQQTMLGALNDGVFRQPYQVSG  280
             +KRF AD N         +N S  +LL+ +PQ   P      +LG+L D V R  +Q+  
Sbjct  318   SKRFQADLN--------SENNSFVSLLNQMPQGTAPFYPNPALLGSLGDEVLRPQFQLPS  369

Query  279   INWYS  265
             +NW S
Sbjct  370   MNWNS  374



>ref|XP_003528438.1| PREDICTED: NAC transcription factor 25-like [Glycine max]
 gb|KHN07294.1| NAC domain-containing protein 18 [Glycine soja]
Length=362

 Score =   276 bits (705),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 180/353 (51%), Positives = 225/353 (64%), Gaps = 44/353 (12%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EELVVHYLK+K ASAP+PVAIIA+VDLYKFDPWELP+KATFGEQEWYFFSPRDRKYPNGA
Sbjct  26    EELVVHYLKRKAASAPLPVAIIADVDLYKFDPWELPSKATFGEQEWYFFSPRDRKYPNGA  85

Query  1068  RPNRAATSGYWKATGTDKPVLTAGGTQKVGVKKALVFYGGKPPKGVKTNWIMHEYRLADN  889
             RPNRAATSGYWKATGTDKP+LT  G  KVGVKKALVFYGGKPPKGVKTNWIMHEYRL D+
Sbjct  86    RPNRAATSGYWKATGTDKPILTTYGHHKVGVKKALVFYGGKPPKGVKTNWIMHEYRLVDD  145

Query  888   K--TSNKPPGLDIANRSKGGSLRLDDWVLCRIYKKNNSQ---RP--LDHESD-DLNDMLQ  733
                +S+KPP L   N  K  SLRLDDWVLCRIYKK+N+    RP  ++HE +  +++ML 
Sbjct  146   SFNSSSKPPPLVPHN--KKNSLRLDDWVLCRIYKKSNNTTLPRPPMMEHEEELSMDNMLP  203

Query  732   GSIPPFVTHQKMG-----LKPSNYGAL-LQTDhhhhhhHMFDQGLVPGDASLGGARTAQL  571
                   + + KM       + ++YG L L+ D +      F +G++  D S+     + +
Sbjct  204   TMSTLSMANNKMQNPKPPSRSTSYGPLGLENDDN------FFEGVLAVDQSMQNGSDSHI  257

Query  570   PFVPST-----------PNLLPTKRSL-PGLFWNVDDSSANNHHPADASPPTKRFLADNN  427
              F P++            +  P KR+L     WN   S         +S   KRF  D N
Sbjct  258   -FSPNSKGDNNNNNNNNASNFPIKRALITSQLWNETGSPG-------SSSSCKRFHGDLN  309

Query  426   EASISRSDEQNGSIATLLSHLPQTPSLHQQTMLGAL-NDGVFRQPYQVSGINW  271
                 S +++ N S  +LLS  PQ  +     + G++ +DG  RQ + + GINW
Sbjct  310   -CGCSNAEDNNDSFISLLSQFPQNATFQPNAIHGSVEDDGAPRQQFHLHGINW  361



>emb|CAN81855.1| hypothetical protein VITISV_041250 [Vitis vinifera]
Length=226

 Score =   269 bits (688),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 137/170 (81%), Positives = 153/170 (90%), Gaps = 3/170 (2%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EELVVHYLK+K AS P+PV IIA+VDLYKFDPWELP+KATFGEQEWYFFSPRDRKYPNGA
Sbjct  26    EELVVHYLKRKAASVPLPVTIIADVDLYKFDPWELPSKATFGEQEWYFFSPRDRKYPNGA  85

Query  1068  RPNRAATSGYWKATGTDKPVLTAGGTQKVGVKKALVFYGGKPPKGVKTNWIMHEYRLADN  889
             RPNRAATSGYWKATGTDKP+LT+ G+QKVGVKKALVFYGGKPPKG+KTNWIMHEYRL D+
Sbjct  86    RPNRAATSGYWKATGTDKPILTSNGSQKVGVKKALVFYGGKPPKGIKTNWIMHEYRLIDS  145

Query  888   KTSN-KPPGLDIANRSKGGSLRLDDWVLCRIYKKNNSQRPLDHESDDLND  742
              +SN KPPG D+ N  K GSLRLDDWVLCRIYKKN SQRP++ + ++  D
Sbjct  146   TSSNTKPPGADMGN--KKGSLRLDDWVLCRIYKKNISQRPMERDKEEYVD  193



>ref|XP_006297968.1| hypothetical protein CARUB_v10014008mg [Capsella rubella]
 gb|EOA30866.1| hypothetical protein CARUB_v10014008mg [Capsella rubella]
Length=366

 Score =   274 bits (700),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 179/352 (51%), Positives = 221/352 (63%), Gaps = 40/352 (11%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EELVVHYLK+K ASAP+PVAIIAEVDLYKFDPWELPAKA+FGEQEWYFFSPRDRKYPNGA
Sbjct  28    EELVVHYLKRKAASAPLPVAIIAEVDLYKFDPWELPAKASFGEQEWYFFSPRDRKYPNGA  87

Query  1068  RPNRAATSGYWKATGTDKPVLTAGGTQKVGVKKALVFYGGKPPKGVKTNWIMHEYRLADN  889
             RPNRAATSGYWKATGTDKPVL + G QKVGVKKALVFY GKPPKG+K++WIMHEYRL +N
Sbjct  88    RPNRAATSGYWKATGTDKPVLASDGNQKVGVKKALVFYSGKPPKGIKSDWIMHEYRLIEN  147

Query  888   KTSNKPPGLDIANRSKGGSLRLDDWVLCRIYKKNNSQRPLDHESD-DLNDMLQGSIPPFV  712
             K +N+PPG D  N  K  SLRLDDWVLCRIYKKNN+ R +D++ D D+ D +   IPP +
Sbjct  148   KLNNRPPGCDFGN--KKNSLRLDDWVLCRIYKKNNAGRHVDNDKDHDMIDYIFRKIPPSL  205

Query  711   T---------------HQKMGLKPSNYGALLQTDhhhhhhHMFDQGLVP---GDASLGGA  586
             +                + M   P  +           +  ++D G +    G  S+   
Sbjct  206   SMAATATGLHHHHHNVSRSMNFFPGKFSGGGYGIFSDGNTSLYDGGGMINNMGTDSVDHD  265

Query  585   RTAQLPFV----PSTPNLLPT-KRSLPGLFWNVDDSSANNHHPADASPPTKRFLADNNEA  421
               +++  +     S P ++ + KR+LP  +W V +         DAS P+KRF       
Sbjct  266   NNSEVVGLNHASSSGPMMMASLKRALPVPYWPVAEEE------QDAS-PSKRF-----HG  313

Query  420   SISRSDEQNGSIATLLSHLPQTPSLHQQTMLGALNDGVFR-QPYQVSGINWY  268
                  D  N S +T++   P      Q    G L DG+FR  PYQ+ G+NWY
Sbjct  314   GGGGGDCSNMS-STMMEETPPILMQQQGGGGGVLGDGLFRTTPYQLPGLNWY  364



>gb|ACN62416.1| NAC transcription factor [Lepidium latifolium]
Length=360

 Score =   271 bits (694),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 167/355 (47%), Positives = 210/355 (59%), Gaps = 54/355 (15%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EELVVHYLK+K ASAP+PVAIIAEVDLYKFDPWELPAKA+FGEQEWYFFSPRDRKYPNGA
Sbjct  30    EELVVHYLKRKAASAPLPVAIIAEVDLYKFDPWELPAKASFGEQEWYFFSPRDRKYPNGA  89

Query  1068  RPNRAATSGYWKATGTDKPVLTAGGTQKVGVKKALVFYGGKPPKGVKTNWIMHEYRLADN  889
             RPNRAATSGYWKATGTD+PVL + G QKVGVKKALVFY GKPPKGVK++WIMHEYRL +N
Sbjct  90    RPNRAATSGYWKATGTDRPVLASDGNQKVGVKKALVFYSGKPPKGVKSDWIMHEYRLIEN  149

Query  888   KTSNKPPGLDIANRSKGGSLRLDDWVLCRIYKKNNSQRPLDHESD-DLNDMLQGSIPPFV  712
              ++N+PPG D  N++   SLRLDDWVLCRIYKKNN+ R +D++ D D+ D +   IP  +
Sbjct  150   NSNNRPPGCDFGNKN---SLRLDDWVLCRIYKKNNAGRHVDNDKDHDMIDYIFRKIPLSL  206

Query  711   T-----------HQKMGLKPSNYGALLQTDhhhhhhHMFDQGLVP---------------  610
             +            + M   P  +              ++D G++                
Sbjct  207   SMAAASGLHHNVSRSMNFFPGKFSGGYGIFSDGGDPSLYDAGMINNNIGINNCTAPVNHN  266

Query  609   GDASLGGARTAQLPFVPSTPNLLPTKRSLPGLFWNVDDSSANNHHPADASPPTKRFLADN  430
              DA + G             NL   KR+LP  +W V +                    + 
Sbjct  267   NDADVSGLNPVSSSGTMMMANL---KRALPVPYWPVAE--------------------EQ  303

Query  429   NEASISRSDEQNGSIATLLSHLPQTPSLHQQTMLGALNDGVFR-QPYQVSGINWY  268
              +AS ++     G  + + S + +      Q   G + DG+FR   YQ+ G+NWY
Sbjct  304   QDASTNKRFHGGGDCSNMSSSMMEENQQMMQQQGGVIGDGLFRTTSYQIPGLNWY  358



>gb|EPS69130.1| hypothetical protein M569_05637, partial [Genlisea aurea]
Length=188

 Score =   265 bits (678),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 136/166 (82%), Positives = 150/166 (90%), Gaps = 3/166 (2%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EELVVHYLKKK+ASAP+P +IIAEVDLYKFDPWELP+KA FG QEWYFFSPRDRKYPNGA
Sbjct  25    EELVVHYLKKKIASAPLPASIIAEVDLYKFDPWELPSKAIFGGQEWYFFSPRDRKYPNGA  84

Query  1068  RPNRAATSGYWKATGTDKPVLTAGGTQKVGVKKALVFYGGKPPKGVKTNWIMHEYRLAD-  892
             RPNRAATSGYWKATGTDKPV+T+GGT++VGVKKALVFY GKPP+G+K+NWIMHEYRL D 
Sbjct  85    RPNRAATSGYWKATGTDKPVMTSGGTERVGVKKALVFYNGKPPRGIKSNWIMHEYRLVDN  144

Query  891   NKTSNKPPGLDIANRSKGGSLRLDDWVLCRIYKKNNSQRPLDHESD  754
             NK S+KPPG DIAN  K  SLRLDDWVLCRIY+KNN QR +D E D
Sbjct  145   NKPSSKPPGCDIAN--KKTSLRLDDWVLCRIYQKNNLQRAMDQERD  188



>gb|ACJ48971.1| cold stress-induced NAC domain protein [Lepidium latifolium]
Length=360

 Score =   271 bits (692),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 167/352 (47%), Positives = 214/352 (61%), Gaps = 48/352 (14%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EELVVHYLK+K ASAP+PVAIIAEVDLYKFDPWELPAKA+FGEQEWYFFSPRDRKYPNGA
Sbjct  30    EELVVHYLKRKAASAPLPVAIIAEVDLYKFDPWELPAKASFGEQEWYFFSPRDRKYPNGA  89

Query  1068  RPNRAATSGYWKATGTDKPVLTAGGTQKVGVKKALVFYGGKPPKGVKTNWIMHEYRLADN  889
             RPNRAATSGYWKATGTD+PVL + G QKVGVKKALVFY GKPPKGVK++WIMHEYRL +N
Sbjct  90    RPNRAATSGYWKATGTDRPVLASDGNQKVGVKKALVFYSGKPPKGVKSDWIMHEYRLIEN  149

Query  888   KTSNKPPGLDIANRSKGGSLRLDDWVLCRIYKKNNSQRPLDHESD-DLNDMLQGSIPPFV  712
              ++N+PPG D  N++   SLRLDDWVLCRIYKKNN+ R +D++ D D+ D +   IP  +
Sbjct  150   NSNNRPPGCDFGNKN---SLRLDDWVLCRIYKKNNAGRHVDNDKDHDMIDYIFRKIPLSL  206

Query  711   T-----------HQKMGLKPSNYGALLQTDhhhhhhHMFDQGLVPGDASL----------  595
             +            + M   P  +              ++D G++  +  +          
Sbjct  207   SMAAASGLHHNVSRSMNFFPGKFSGGYGIFSDGGDPSLYDAGMINNNIGINNCTAPVNHN  266

Query  594   GGARTAQLPFVPSTPNLLPT--KRSLPGLFWNVDDSSANNHHPADASPPTKRFLADNNEA  421
               A T  L  V S+  ++    KR+LP  +W V +                    +  +A
Sbjct  267   NDADTPGLNPVSSSGTMIMANLKRALPVPYWPVAE--------------------EQQDA  306

Query  420   SISRSDEQNGSIATLLSHLPQTPSLHQQTMLGALNDGVFR-QPYQVSGINWY  268
             S ++     G  + + S + +      Q   G + DG+FR   YQ+ G+NWY
Sbjct  307   STNKRFHGGGDCSNMSSSMMEENQQMMQQQGGVIGDGLFRTTSYQIPGLNWY  358



>ref|XP_007159283.1| hypothetical protein PHAVU_002G224900g [Phaseolus vulgaris]
 gb|ESW31277.1| hypothetical protein PHAVU_002G224900g [Phaseolus vulgaris]
Length=350

 Score =   270 bits (691),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 176/345 (51%), Positives = 214/345 (62%), Gaps = 40/345 (12%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EELVVHYLK+K +S P+PVAIIA+VDLYKFDPWELP+KATFGEQEWYFFSPRDRKYPNG 
Sbjct  26    EELVVHYLKRKASSTPLPVAIIADVDLYKFDPWELPSKATFGEQEWYFFSPRDRKYPNGV  85

Query  1068  RPNRAATSGYWKATGTDKPVLTAGGTQKVGVKKALVFYGGKPPKGVKTNWIMHEYRLADN  889
             RPNRAATSGYWKATGTDKP+LT+ G QKVGVKKALVFYGGKPPKGVKTNWIMHEYRL  +
Sbjct  86    RPNRAATSGYWKATGTDKPILTSDGHQKVGVKKALVFYGGKPPKGVKTNWIMHEYRLVHD  145

Query  888   K--TSNKPPGLDIANRSKGGSLRLDDWVLCRIYKKNNS----QRPLDHESDDLNDMLQGS  727
                +++KPP L   N  K  SLRLD+WVLCRIYKK+NS    + PL  + ++L+  ++  
Sbjct  146   SFNSTSKPPPLVPPN--KKNSLRLDNWVLCRIYKKSNSSILTRPPLMEQGEELS--MENM  201

Query  726   IPPFVT-----HQKMGLKP-----SNYGAL-LQTDhhhhhhHMFDQGLVPGDASLGGART  580
             +P   T     +     KP     ++YG L L+ D      + FD  L     S+     
Sbjct  202   LPTMSTLSMANNNTQNSKPQSSRGTSYGPLGLEND-----DNFFDGILAVDHQSMQSGSD  256

Query  579   AQLPFVPSTPNLLPTKRSLPG-LFWNVDDSSANNHHPADASPPTKRFLADNNEASISRSD  403
             + L    S     P KR+L     WN   S         +S   KRF  D N  +     
Sbjct  257   SHLFSPNSKGGNFPMKRALTSQQLWNETGSPG-------SSSSCKRFHGDLNSGT-----  304

Query  402   EQNGSIATLLSHLPQTPSLHQQTMLGALNDGVFR-QPYQVSGINW  271
             E N S  +LLS  PQ  +     + G++ DG  R Q +Q+ GINW
Sbjct  305   EDNDSFVSLLSQFPQNATFQPNAIHGSVGDGAQRQQQFQLPGINW  349



>ref|XP_004505006.1| PREDICTED: NAC transcription factor 25-like [Cicer arietinum]
Length=364

 Score =   270 bits (691),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 182/358 (51%), Positives = 215/358 (60%), Gaps = 52/358 (15%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EELVVHYLK+K ASAP+PVAIIAE+DLYKFDPWELP+KA+FGEQEWYFFSPRDRKYPNGA
Sbjct  26    EELVVHYLKRKAASAPLPVAIIAEIDLYKFDPWELPSKASFGEQEWYFFSPRDRKYPNGA  85

Query  1068  RPNRAATSGYWKATGTDKPVLTAGGTQKVGVKKALVFYGGKPPKGVKTNWIMHEYRLAD-  892
             RPNRAATSGYWKATGTDKP+LT  G  KVGVKKALVFYGGKPPKGVKTNWIMHEYRL   
Sbjct  86    RPNRAATSGYWKATGTDKPILTTDGHMKVGVKKALVFYGGKPPKGVKTNWIMHEYRLITD  145

Query  891   --------NKTSNKPP-GLDIANRSKGGSLRLDDWVLCRIYKKNNSQ---RP--LDHESD  754
                     N TS  PP   D  N +K  SLRLDDWVLCRIYKK+NS    RP  +D    
Sbjct  146   HNHNIHSYNATSKTPPLPADPPNLNKKNSLRLDDWVLCRIYKKSNSSTMPRPPLMDQYDK  205

Query  753   DLNDMLQGSIPPFVTHQKMGLK------PSNYGALLQTDhhhhhhHMFDQGLVPGDASL-  595
             +L+     ++ P    Q+   K       S+YG  L+ D +      F  G++  D    
Sbjct  206   ELSMDHHHTMLPLTNMQQNNTKLPSSRSTSSYG--LENDDN------FFDGILAADQHQH  257

Query  594   --------GGARTAQLPFVPSTPNLLPTKRSLPG--LFWNVDDSSANNHHPADASPPTKR  445
                      G  +  +       +  P KR+L     FWN   S         +S  +KR
Sbjct  258   QHHHEEMQNGCGSHDINSKNDNNDSFPMKRALTASSQFWNETGSPG-------SSSSSKR  310

Query  444   FLADNNEASISRSDEQNGSIATLLSHLPQTPSLHQQTMLGALNDGVFRQPYQVSGINW  271
             F  D N  S + + E+N S  +LLS LP T + H   +LG   D V RQ +Q+  INW
Sbjct  311   FHGDLN--SGNSNAEENNSFVSLLSQLPTTTTFHPNAILG---DAVIRQQFQLPNINW  363



>ref|XP_003547137.1| PREDICTED: NAC transcription factor 25-like [Glycine max]
Length=354

 Score =   270 bits (689),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 174/344 (51%), Positives = 221/344 (64%), Gaps = 36/344 (10%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EELVVHYLK+K  S P+PV+IIAEVDLYKFDPWELP+KATFG+QEWYFFSPRDRKYPNG+
Sbjct  27    EELVVHYLKRKADSVPLPVSIIAEVDLYKFDPWELPSKATFGDQEWYFFSPRDRKYPNGS  86

Query  1068  RPNRAATSGYWKATGTDKPVLTA-GGTQKVGVKKALVFYGGKPPKGVKTNWIMHEYRLAD  892
             RPNRAA+SGYWKATGTDKP+L + G   KVGVKK+LVFYGGKPPKGVKTNWIMHEYRLAD
Sbjct  87    RPNRAASSGYWKATGTDKPILASHGHHHKVGVKKSLVFYGGKPPKGVKTNWIMHEYRLAD  146

Query  891   NKTSNKPP----GLDIANRSKGGSLRLDDWVLCRIYKKNNS----QRPLDHESDDLNDM-  739
             + +++         D A   K  SLRLDDWVLCRIYKK+NS    + PL  ++ +L+ + 
Sbjct  147   SNSNSSSKPPSMASDHAQSCKKNSLRLDDWVLCRIYKKSNSTNLPRLPLVEQNKELSMLP  206

Query  738   LQGSIPPFVTHQKMGLKP-----SNYGAL-LQTDhhhhhhHMFDQGLVPGDASLGGARTA  577
             ++ ++     +     KP     ++YG L ++ D      ++FD G++  D        +
Sbjct  207   MRSTLSMANNNTSQDSKPTSSISTSYGPLGVEND-----DNLFD-GILGVDHQSMQHDVS  260

Query  576   QLPFVPSTPNLLPTKRSLPG-LFWNVDDSSANNHHPADASPPTKRFLADNNEASISRSDE  400
                 V S  N  P KR L    FWN   SS++          ++RF  D N A  S  +E
Sbjct  261   DSQQVSSKGN-FPMKRELSSQYFWNDTGSSSS----------SRRFHCDLNYAGSSTVEE  309

Query  399   QNGSIATLLSHLPQ-TPSLHQQTMLGALNDGVFRQPYQVSGINW  271
              N S  +LLSHL Q T S H   +LG + +GV RQ +Q+  +NW
Sbjct  310   DN-SFVSLLSHLSQNTTSFHPNALLGPIGNGVLRQQFQLPSMNW  352



>ref|XP_009135446.1| PREDICTED: NAC domain-containing protein 18-like [Brassica rapa]
Length=350

 Score =   265 bits (678),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 178/345 (52%), Positives = 215/345 (62%), Gaps = 40/345 (12%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EELVVHYLK+KVASAP+PVAIIAEVDLYKFDPWELPAKA+FGEQEWYFFSPRDRKYPNGA
Sbjct  28    EELVVHYLKRKVASAPLPVAIIAEVDLYKFDPWELPAKASFGEQEWYFFSPRDRKYPNGA  87

Query  1068  RPNRAATSGYWKATGTDKPVLTAGGTQKVGVKKALVFYGGKPPKGVKTNWIMHEYRLADN  889
             RPNRAATSGYWKATGTDKPVL + G  KVGVKKALVFY GKPPKGVK++WIMHEYRL DN
Sbjct  88    RPNRAATSGYWKATGTDKPVLASDGKLKVGVKKALVFYSGKPPKGVKSDWIMHEYRLIDN  147

Query  888   KTSNKPPGLDIANRSKGGSLRLDDWVLCRIYKKNNSQRPLDHESD-DLNDMLQGSIPPFV  712
             K +N+PPG D  N+    SLRL DWVLCR YKKNN+ R + ++ D D+ D +    PP +
Sbjct  148   KPNNRPPGCDFGNKRN--SLRLGDWVLCRSYKKNNASRHVYNDKDPDMFDYIFRKNPPSL  205

Query  711   T---HQKMGLKPSNYGALLQTDhhhhhhHMFDQGLVPGDASL--GGARTAQLPFVPSTPN  547
             +   H  +    + +      D+    +   D GL  G   +   GA +  +      PN
Sbjct  206   SSGLHHNVSRSMNIFPGKFSGDYGIFSYG--DPGLYDGSGMVCSNGAGSVNINVSNGNPN  263

Query  546   LL-PTKRSLPGL--------FWNVDDSSANNHHPADASPPTKRFLADNNEASISRSDEQN  394
              L P   S P +         W V +         DAS P+KRF        ++      
Sbjct  264   GLNPASSSGPMMMMANLKRALWPVAEEE------QDAS-PSKRFHGVGGGDCLNMPS---  313

Query  393   GSIATLLSHLPQTPSLHQQ-TMLGALNDGVFR-QPYQVSGINWYS  265
                    S + +TP L QQ  +LG  +DG+FR   YQ+ G+NWYS
Sbjct  314   -------SVMEETPPLMQQGGVLG--DDGLFRTTSYQLHGLNWYS  349



>gb|KHN08560.1| NAC domain-containing protein 18 [Glycine soja]
Length=360

 Score =   265 bits (677),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 171/350 (49%), Positives = 217/350 (62%), Gaps = 42/350 (12%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EELVV YLKKK  S P+PV+IIAEVDLYKFDPWELP+KATFG+QEWYFFSPRDRKYPNG 
Sbjct  27    EELVVQYLKKKADSVPLPVSIIAEVDLYKFDPWELPSKATFGDQEWYFFSPRDRKYPNGT  86

Query  1068  RPNRAATSGYWKATGTDKPVLTAGGTQ-KVGVKKALVFYGGKPPKGVKTNWIMHEYRLAD  892
             RPNRAATSGYWKATGTDKP+L + G   KVGVKK+LVFYGGKPPKGVKTNWIMHEYRLAD
Sbjct  87    RPNRAATSGYWKATGTDKPILASHGHHNKVGVKKSLVFYGGKPPKGVKTNWIMHEYRLAD  146

Query  891   NKTSNKPPGLDI----ANRSKGGSLRLDDWVLCRIYKKNNSQR----PLDHESDDLNDML  736
             + +++           A+  K  SLRLDDWVLCRIYKK+NS      PL  ++ +++  +
Sbjct  147   SSSNSSSKPPSSASDHAHSGKKNSLRLDDWVLCRIYKKSNSTHLPRLPLMEQNKEISREI  206

Query  735   QGSIPPFVTHQKMG-------------LKPSNYGAL-LQTDhhhhhhHMFDQGLVPGDAS  598
               S+ P ++   M               + ++YG L ++ D      + FD        S
Sbjct  207   --SMLPMMSTLSMANDNNTPQDSKTASSRSTSYGPLGVEND-----DNFFDGIFGVDHQS  259

Query  597   LGGARTAQLPFVPSTPNLLPTKRSLPGLFWNVDDSSANNHHPADASPPTKRFLADNNEAS  418
             +    +     V S  N  P KR L   FWN   SS++          +++F  D N A 
Sbjct  260   MQQDVSDHSQQVSSKGN-FPMKRELSSQFWNGTGSSSS----------SRQFHYDLNYAG  308

Query  417   ISRSDEQNGSIATLLSHLPQ-TPSLHQQTMLGALNDGVFRQPYQVSGINW  271
              S + E++ S  +LLSHLPQ T + H   +LG + +GV RQ +Q+  +NW
Sbjct  309   NSTTVEEDNSFVSLLSHLPQNTTTFHPNALLGPVGNGVLRQQFQLPSMNW  358



>ref|XP_003541742.1| PREDICTED: NAC transcription factor 25-like [Glycine max]
Length=363

 Score =   265 bits (677),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 171/350 (49%), Positives = 217/350 (62%), Gaps = 42/350 (12%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EELVV YLKKK  S P+PV+IIAEVDLYKFDPWELP+KATFG+QEWYFFSPRDRKYPNG 
Sbjct  30    EELVVQYLKKKADSVPLPVSIIAEVDLYKFDPWELPSKATFGDQEWYFFSPRDRKYPNGT  89

Query  1068  RPNRAATSGYWKATGTDKPVLTAGGTQ-KVGVKKALVFYGGKPPKGVKTNWIMHEYRLAD  892
             RPNRAATSGYWKATGTDKP+L + G   KVGVKK+LVFYGGKPPKGVKTNWIMHEYRLAD
Sbjct  90    RPNRAATSGYWKATGTDKPILASHGHHNKVGVKKSLVFYGGKPPKGVKTNWIMHEYRLAD  149

Query  891   NKTSNKPPGLDI----ANRSKGGSLRLDDWVLCRIYKKNNSQR----PLDHESDDLNDML  736
             + +++           A+  K  SLRLDDWVLCRIYKK+NS      PL  ++ +++  +
Sbjct  150   SSSNSSSKPPSSASDHAHSGKKNSLRLDDWVLCRIYKKSNSTHLPRLPLMEQNKEISREI  209

Query  735   QGSIPPFVTHQKMG-------------LKPSNYGAL-LQTDhhhhhhHMFDQGLVPGDAS  598
               S+ P ++   M               + ++YG L ++ D      + FD        S
Sbjct  210   --SMLPMMSTLSMANDNNTPQDSKTASSRSTSYGPLGVEND-----DNFFDGIFGVDHQS  262

Query  597   LGGARTAQLPFVPSTPNLLPTKRSLPGLFWNVDDSSANNHHPADASPPTKRFLADNNEAS  418
             +    +     V S  N  P KR L   FWN   SS++          +++F  D N A 
Sbjct  263   MQQDVSDHSQQVSSKGN-FPMKRELSSQFWNGTGSSSS----------SRQFHYDLNYAG  311

Query  417   ISRSDEQNGSIATLLSHLPQ-TPSLHQQTMLGALNDGVFRQPYQVSGINW  271
              S + E++ S  +LLSHLPQ T + H   +LG + +GV RQ +Q+  +NW
Sbjct  312   NSTTVEEDNSFVSLLSHLPQNTTTFHPNALLGPVGNGVLRQQFQLPSMNW  361



>emb|CDX82430.1| BnaA03g33910D [Brassica napus]
Length=199

 Score =   255 bits (652),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 134/158 (85%), Positives = 143/158 (91%), Gaps = 2/158 (1%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EELVVHYLK+KVASAP+PVAIIAEVDLYKFDPWELPAKA+FGEQEWYFFSPRDRKYPNGA
Sbjct  28    EELVVHYLKRKVASAPLPVAIIAEVDLYKFDPWELPAKASFGEQEWYFFSPRDRKYPNGA  87

Query  1068  RPNRAATSGYWKATGTDKPVLTAGGTQKVGVKKALVFYGGKPPKGVKTNWIMHEYRLADN  889
             RPNRAATSGYWKATGTDKPVL + G  KVGVKKALVFY GKPPKGVK++WIMHEYRL DN
Sbjct  88    RPNRAATSGYWKATGTDKPVLASDGKLKVGVKKALVFYSGKPPKGVKSDWIMHEYRLIDN  147

Query  888   KTSNKPPGLDIANRSKGGSLRLDDWVLCRIYKKNNSQR  775
             K +N+PPG D  N  K  SLRLDDWVLCRIYKKNN+ R
Sbjct  148   KPNNRPPGCDFGN--KRNSLRLDDWVLCRIYKKNNASR  183



>dbj|BAK04712.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=405

 Score =   262 bits (669),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 180/377 (48%), Positives = 215/377 (57%), Gaps = 66/377 (18%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EELVVHYLKKK A  P+PV IIAEVDLYKFDPWELP KATFGEQEWYFFSPRDRKYPNGA
Sbjct  42    EELVVHYLKKKAAKVPLPVTIIAEVDLYKFDPWELPEKATFGEQEWYFFSPRDRKYPNGA  101

Query  1068  RPNRAATSGYWKATGTDKPVLTAG-GTQKVGVKKALVFYGGKPPKGVKTNWIMHEYRLAD  892
             RPNRAATSGYWKATGTDKP+L +G G +KVGVKKALVFY GKPPKG+KTNWIMHEYRL D
Sbjct  102   RPNRAATSGYWKATGTDKPILASGCGREKVGVKKALVFYRGKPPKGLKTNWIMHEYRLTD  161

Query  891   NKTS---NKPPGLDIANRSKGGSLRLDDWVLCRIYKKNNSQRPLDHE-SDDLNDMLQGSI  724
               +S   ++PP   +   S+  SLRLDDWVLCRIYKK N     D + S +  D ++ ++
Sbjct  162   ASSSAATSRPP--PVTGGSRAASLRLDDWVLCRIYKKINKAAAADQQRSMECEDSVEDAV  219

Query  723   ---PPFVTHQKM--GLKPSNYGALLQTDhhhhhhHM------FDQGLVPGDASL----GG  589
                PP+ T      G   SNY +LL     H  + +       D GL  G  SL      
Sbjct  220   TAYPPYATACMTGEGAHGSNYASLLHHQDSHEDNFLDGLLTAEDAGLSAGATSLSHLAAA  279

Query  588   ARTAQLP----FVP-----------STPNLLPTKRSLPGL--FWNVDDSSANNHHPADAS  460
             AR +  P      P           ST  +LP  R+ PG     NV + S ++       
Sbjct  280   ARGSPAPTKQFLAPSSSTQFNWLDASTVGILPHARNFPGFNRSRNVGNMSLSS-------  332

Query  459   PPTKRFLADNNEASISRSDEQNGSIATL----LSHLP-QTPSLHQQ-TMLGA--------  322
                    AD   A     D   G+   +    ++HLP Q  + HQQ  +LGA        
Sbjct  333   ------TADMAGAGTCAVDNGGGNAMNVMPPFMNHLPVQDGTYHQQHVILGAPLAPEATG  386

Query  321   LNDGVFRQPYQVSGINW  271
                  F+ P Q+SG+NW
Sbjct  387   AAASAFQHPVQISGVNW  403



>gb|AIZ97668.1| NAC transcription factor NAM-D2 [Triticum aestivum]
Length=396

 Score =   261 bits (667),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 179/375 (48%), Positives = 216/375 (58%), Gaps = 68/375 (18%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EELVVHYLKKK A  P+PV IIAEVDLYKFDPWELP KATFGEQEWYFFSPRDRKYPNGA
Sbjct  39    EELVVHYLKKKAAKVPLPVTIIAEVDLYKFDPWELPEKATFGEQEWYFFSPRDRKYPNGA  98

Query  1068  RPNRAATSGYWKATGTDKPVLTAG-GTQKVGVKKALVFYGGKPPKGVKTNWIMHEYRLAD  892
             RPNRAATSGYWKATGTDKP++ +G G +KVGVKKALVFY GKPPKG+KTNWIMHEYRL D
Sbjct  99    RPNRAATSGYWKATGTDKPIMASGCGREKVGVKKALVFYRGKPPKGLKTNWIMHEYRLTD  158

Query  891   ---NKTSNKPPGLDIANRSKGGSLRLDDWVLCRIYKKNN------SQRPLDHESDDLNDM  739
                + T+++PP   +   S+  SLRLDDWVLCRIYKK N       QR ++ E D + D 
Sbjct  159   ASSSATTSRPP--PVTGVSRAASLRLDDWVLCRIYKKINKAAAGDQQRSMECE-DSVEDA  215

Query  738   LQGSIPPFVT--HQKMGLKPSNYGALLQTDhhhhhhHM------FDQGLVPGDASLGG--  589
             +  + PP+ T      G   SNY +LL     H  + +       D GL  G  SL    
Sbjct  216   VT-AYPPYATAGMTGAGAHGSNYDSLLHHQDSHEDNFLDGLLTAEDAGLSAGATSLSHLA  274

Query  588   --------------ARTAQLPFV---PSTPNLLPTKRSLPGL--FWNVDDSSANNHHPAD  466
                           A ++  PF     ST  +LP  R+ PG     NV + S ++     
Sbjct  275   AVARASPAPTKQFLAPSSSTPFNWLDASTVGILPQARNFPGFNRSRNVGNMSLSS-----  329

Query  465   ASPPTKRFLADNNEASISRSDEQNGSIATLLSHLP-QTPSLHQQ-TMLG--------ALN  316
                 T     DN   +         ++   +SHLP Q  + HQQ  +LG        A  
Sbjct  330   ----TADMAVDNGGGNAIN------AMPPFMSHLPVQDGTYHQQHVILGAPLAPEATAAA  379

Query  315   DGVFRQPYQVSGINW  271
                F+ P Q+SG+NW
Sbjct  380   TSAFQHPVQISGVNW  394



>ref|XP_011096265.1| PREDICTED: NAC transcription factor 25 [Sesamum indicum]
Length=360

 Score =   259 bits (662),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 136/178 (76%), Positives = 156/178 (88%), Gaps = 7/178 (4%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EELVVHYLKKK ASAP+PVAIIAEVDLYK+DPWELP+KA+FGEQEWYFFSPR+RKYPNG 
Sbjct  27    EELVVHYLKKKAASAPLPVAIIAEVDLYKYDPWELPSKASFGEQEWYFFSPRERKYPNGE  86

Query  1068  RPNRAATSGYWKATGTDKPVLTAGGTQKVGVKKALVFYGGKPPKGVKTNWIMHEYRLAD-  892
             RPNRAATSGYWKATGTDKP+LTA GTQK+GVKKALVFYGGKPPKG+K+NWIMHEYRL D 
Sbjct  87    RPNRAATSGYWKATGTDKPILTANGTQKIGVKKALVFYGGKPPKGIKSNWIMHEYRLVDK  146

Query  891   NKTSNKPPGLDIANRSKGGSLRLDDWVLCRIYKKNN-SQRPLDHESDDLNDMLQGSIP  721
             N ++NKPPG+ +   +K GSL+LDDWVLCRI+KK N S RP+  E DD  + +  S+P
Sbjct  147   NSSANKPPGISL---TKKGSLQLDDWVLCRIFKKGNPSSRPI--EMDDSMEEMPVSMP  199



>ref|NP_001280970.1| NAC transcription factor 25-like [Malus domestica]
 gb|ADL36800.1| NAC domain class transcription factor [Malus domestica]
Length=366

 Score =   258 bits (660),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 177/368 (48%), Positives = 213/368 (58%), Gaps = 67/368 (18%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EELVVHYLKKK AS P+PV IIAEVDLYKFDPWELP+KATFGEQEWYFFSPRDRKYPNGA
Sbjct  26    EELVVHYLKKKAASIPLPVTIIAEVDLYKFDPWELPSKATFGEQEWYFFSPRDRKYPNGA  85

Query  1068  RPNRAATSGYWKATGTDKPVLTAGGTQKVGVKKALVFYGGKPPKGVKTNWIMHEYRLADN  889
             RPNRAATSGYWKATGTDKPVL++ G  KVGVKKALVFYGGKPPKG KTNWIMHEYRL +N
Sbjct  86    RPNRAATSGYWKATGTDKPVLSSIGNHKVGVKKALVFYGGKPPKGTKTNWIMHEYRLVNN  145

Query  888   KT--------SNKPPGLDIANRSKGGSLRLDDWVLCRIYKKNNS-QRPLD-----HESDD  751
              T        + KP   D AN  K  SLRLDDWVLCRIYKKN      +D     H+++D
Sbjct  146   TTTTINMSSSTTKPS--DAAN--KKPSLRLDDWVLCRIYKKNKGPVMSIDGDHFLHKAED  201

Query  750   LNDMLQGSIPPFVTHQKMGLKPS---------------------NYGALLQTDhhhhhhH  634
              N  ++         + M L PS                     +Y ALL++D H     
Sbjct  202   SNSSME---------EGMFLHPSILPTQKLPPLPPPPSSKLPTTDYTALLESDDHES---  249

Query  633   MFDQGLVPGDASLGGARTAQ---LPFVPSTPNLLPTKRSLPGLFWNVDDSSANNHHPADA  463
              + +G++       G+ +           + + LP KR LP  FWN  D  +     A  
Sbjct  250   -YLEGILSSSDHQPGSHSHDQFGTISTSISKSSLPLKRHLPSPFWN--DVGSIGTAAATT  306

Query  462   SPPTKRFLADNNEASISRSDEQNGSIATLLSHLPQ--TPSLHQQTMLGALNDGVFRQPYQ  289
             +  +K+F AD           +N S  ++L+  PQ   P      +L  L DGV R  +Q
Sbjct  307   TSSSKKFHAD--------LINENNSFVSMLNQTPQGTAPFHANAALLELLGDGVLRPQFQ  358

Query  288   VSGINWYS  265
             +  +NW S
Sbjct  359   LPSMNWNS  366



>sp|A0SPJ9.1|NAM2_HORVD RecName: Full=NAC transcription factor NAM-2; Short=HvNAM-2 [Hordeum 
vulgare subsp. vulgare]
 gb|ABI94358.1| NAC transcription factor NAM-2 [Hordeum vulgare subsp. vulgare]
Length=402

 Score =   259 bits (663),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 179/377 (47%), Positives = 214/377 (57%), Gaps = 66/377 (18%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EELVVHYLKKK A  P+PV IIAEVDLYKFDPWELP KATFGEQEWYFFSPRDRKYPNGA
Sbjct  39    EELVVHYLKKKAAKVPLPVTIIAEVDLYKFDPWELPEKATFGEQEWYFFSPRDRKYPNGA  98

Query  1068  RPNRAATSGYWKATGTDKPVLTAG-GTQKVGVKKALVFYGGKPPKGVKTNWIMHEYRLAD  892
             RPNRAATSGYWKATGTDKP+L +G G +KVGVK ALVFY GKPPKG+KTNWIMHEYRL D
Sbjct  99    RPNRAATSGYWKATGTDKPILASGCGREKVGVKXALVFYRGKPPKGLKTNWIMHEYRLTD  158

Query  891   NKTS---NKPPGLDIANRSKGGSLRLDDWVLCRIYKKNNSQRPLDHE-SDDLNDMLQGSI  724
               +S   ++PP   +   S+  SLRLDDWVLCRIYKK N     D + S +  D ++ ++
Sbjct  159   ASSSAATSRPP--PVTGGSRAASLRLDDWVLCRIYKKINKAAAADQQRSMECEDSVEDAV  216

Query  723   ---PPFVTHQKM--GLKPSNYGALLQTDhhhhhhHM------FDQGLVPGDASL----GG  589
                PP+ T      G   SNY +LL     H  + +       D GL  G  SL      
Sbjct  217   TAYPPYATACMTGEGAHGSNYASLLHHQDSHEDNFLDGLLTAEDAGLSAGATSLSHLAAA  276

Query  588   ARTAQLP----FVP-----------STPNLLPTKRSLPGL--FWNVDDSSANNHHPADAS  460
             AR +  P      P           ST  +LP  R+ PG     NV + S ++       
Sbjct  277   ARGSPAPTKQFLAPSSSTQFNWLDASTVGILPHARNFPGFNRSRNVGNMSLSS-------  329

Query  459   PPTKRFLADNNEASISRSDEQNGSIATL----LSHLP-QTPSLHQQ-TMLGA--------  322
                    AD   A     D   G+   +    ++HLP Q  + HQQ  +LGA        
Sbjct  330   ------TADMAGAGTCAVDNGGGNAMNVMPPFMNHLPVQDGTYHQQHVILGAPLAPEATG  383

Query  321   LNDGVFRQPYQVSGINW  271
                  F+ P Q+SG+NW
Sbjct  384   AAASAFQHPVQISGVNW  400



>gb|AIW49540.1| NAC transcription factor NAM-A2 [Triticum turgidum subsp. durum]
Length=397

 Score =   259 bits (661),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 178/375 (47%), Positives = 215/375 (57%), Gaps = 68/375 (18%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EELVVHYLKKK A  P+PV IIAEVDLYKFDPWELP KATFGEQEWYFFSPRDRKYPNGA
Sbjct  40    EELVVHYLKKKAAKVPLPVTIIAEVDLYKFDPWELPEKATFGEQEWYFFSPRDRKYPNGA  99

Query  1068  RPNRAATSGYWKATGTDKPVLTAG-GTQKVGVKKALVFYGGKPPKGVKTNWIMHEYRLAD  892
             RPNRAATSGYWKATGTDKP+L +G G +KVGVKKALVFY GKPPKG+KTNWIMHEYRL D
Sbjct  100   RPNRAATSGYWKATGTDKPILASGCGREKVGVKKALVFYRGKPPKGLKTNWIMHEYRLTD  159

Query  891   ---NKTSNKPPGLDIANRSKGGSLRLDDWVLCRIYKKNN------SQRPLDHESDDLNDM  739
                + T+++PP   +   S+  SLRLDDWVLCRIYKK N       QR ++ E D + D 
Sbjct  160   ASSSATTSRPP--PVTGGSRAASLRLDDWVLCRIYKKINKAAAGDQQRSMECE-DSVEDA  216

Query  738   LQGSIPPFVT--HQKMGLKPSNYGALL------QTDhhhhhhHMFDQGLVPGDASLGG--  589
             +  + PP+ T      G   SNY +LL      + +         D GL  G  SL    
Sbjct  217   VT-AYPPYATAGMTGAGAHGSNYDSLLHHLDSHEDNFLDGLLTAEDAGLSAGATSLSHLA  275

Query  588   --------------ARTAQLPFV---PSTPNLLPTKRSLPGL--FWNVDDSSANNHHPAD  466
                           A ++  PF     ST  +LP  R+ PG     NV + S ++     
Sbjct  276   AAARASPAPTKQFLAPSSSTPFNWLDASTVGILPQARNFPGFNRSRNVGNMSLSS-----  330

Query  465   ASPPTKRFLADNNEASISRSDEQNGSIATLLSHLP-QTPSLHQQ-TMLG--------ALN  316
                 T     DN   +         ++   ++HLP Q  + HQQ  +LG        A  
Sbjct  331   ----TADMAVDNGGGNAIN------AMPPFMNHLPVQDGTYHQQHVILGTPLAPEATAAA  380

Query  315   DGVFRQPYQVSGINW  271
                F+ P Q+SG+NW
Sbjct  381   TSAFQHPVQISGVNW  395



>gb|AEI00651.1| NAC3 [Triticum aestivum]
Length=396

 Score =   258 bits (660),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 178/375 (47%), Positives = 216/375 (58%), Gaps = 68/375 (18%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EELVVHYLKKK A  P+PV IIAEVDLYKFDPWELP KATFGEQEWYFFSPRDRKYPNGA
Sbjct  39    EELVVHYLKKKAAKVPLPVTIIAEVDLYKFDPWELPEKATFGEQEWYFFSPRDRKYPNGA  98

Query  1068  RPNRAATSGYWKATGTDKPVLTAG-GTQKVGVKKALVFYGGKPPKGVKTNWIMHEYRLAD  892
             RPNRAATSGYWKATGTDKP++ +G G +KVGVKKALVFY GKPPKG+KTNWIMHEYRL D
Sbjct  99    RPNRAATSGYWKATGTDKPIMASGCGREKVGVKKALVFYRGKPPKGLKTNWIMHEYRLTD  158

Query  891   ---NKTSNKPPGLDIANRSKGGSLRLDDWVLCRIYKKNN------SQRPLDHESDDLNDM  739
                + T+++PP   +   S+  SLRLDDWVLCRIYKK N       QR ++ E D + D 
Sbjct  159   ASSSATTSRPP--PVTGGSRAASLRLDDWVLCRIYKKINKAAAGDQQRSMECE-DSVEDA  215

Query  738   LQGSIPPFVT--HQKMGLKPSNYGALLQTDhhhhhhHM------FDQGLVPGDASLGG--  589
             +  + PP+ T      G   SNY +LL     H  + +       D GL  G  SL    
Sbjct  216   VT-AYPPYATAGMTGAGAHGSNYDSLLHHQDSHEDNFLDGLLTAEDAGLSAGATSLSHLA  274

Query  588   --------------ARTAQLPFV---PSTPNLLPTKRSLPGL--FWNVDDSSANNHHPAD  466
                           A ++  PF     ST  +LP  R+ PG     NV + S ++     
Sbjct  275   AAARASPAPTKQFLAPSSSTPFNWLDASTVGILPQARNFPGFNRSRNVGNMSLSS-----  329

Query  465   ASPPTKRFLADNNEASISRSDEQNGSIATLLSHLP-QTPSLHQQ-TMLG--------ALN  316
                 T     DN   +         ++   ++HLP Q  + HQQ  +LG        A  
Sbjct  330   ----TADMAVDNGGGNAIN------AMPPFMNHLPVQDGTYHQQHVILGAPLAPEATAAA  379

Query  315   DGVFRQPYQVSGINW  271
                F+ P Q+SG+NW
Sbjct  380   TSAFQHPVQISGVNW  394



>sp|A0SPJ6.1|NAMB2_TRITD RecName: Full=NAC transcription factor NAM-B2; Short=TtNAM-B2 
[Triticum turgidum subsp. durum]
 gb|ABI94355.1| NAC transcription factor NAM-B2 [Triticum turgidum subsp. durum]
 gb|AEI00652.1| NAC4 [Triticum aestivum]
 gb|AIZ97666.1| NAC transcription factor NAM-B2 [Triticum aestivum]
Length=396

 Score =   256 bits (654),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 173/374 (46%), Positives = 218/374 (58%), Gaps = 66/374 (18%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EELVVHYLKKK A  P+PV II EVDLYKFDPWELP KATFGEQEWYFFSPRDRKYPNGA
Sbjct  39    EELVVHYLKKKAAKVPLPVTIITEVDLYKFDPWELPEKATFGEQEWYFFSPRDRKYPNGA  98

Query  1068  RPNRAATSGYWKATGTDKPVLTAG-GTQKVGVKKALVFYGGKPPKGVKTNWIMHEYRLAD  892
             RPNRAATSGYWKATGTDKP+L +G G +KVGVKKALVFY GKPPKG+KTNWIMHEYRL D
Sbjct  99    RPNRAATSGYWKATGTDKPILASGCGREKVGVKKALVFYRGKPPKGLKTNWIMHEYRLTD  158

Query  891   ---NKTSNKPPGLDIANRSKGGSLRLDDWVLCRIYKKNNSQRPLDHE-SDDLNDMLQGSI  724
                + T+++PP +   +RS   SLRLDDWVLCRIYKK N     D + S +  D ++ ++
Sbjct  159   ASSSATTSRPPPVTGGSRS--ASLRLDDWVLCRIYKKINKAAAGDQQRSMECEDSVEDAV  216

Query  723   PPFVTHQKMGLK-----PSNYGALLQTDhhhhhhHM------FDQGLVPGDASLGG----  589
               +  +   G+       SNY +LL     H  + +       D GL  G  SL      
Sbjct  217   TAYPLYATAGMTGAGAHGSNYDSLLHHQDSHEDNFLDGLLTAEDAGLSAGPTSLSHLAAA  276

Query  588   ------------ARTAQLPFV---PSTPNLLPTKRSLPGLFWNVDDSSANNHHPADASPP  454
                         A ++  PF     ST  +LP  R+ PG  +N   +  N          
Sbjct  277   ARASPAPTKQFLAPSSSTPFNWLDASTVGILPQARNFPG--FNRSRNVGN----------  324

Query  453   TKRFLADNNEASISRSDEQNGSIATL---LSHLP-QTPSLHQQ-TMLG--------ALND  313
                 ++ ++ A ++  +    +I T+   ++HLP Q  + HQQ  +LG        A   
Sbjct  325   ----MSLSSTADMAVDNGGGNAINTMPPFMNHLPMQDGTYHQQHVILGAPLAPEATAAAT  380

Query  312   GVFRQPYQVSGINW  271
               F+ P Q+SG+NW
Sbjct  381   SAFQHPVQISGVNW  394



>emb|CDM83185.1| unnamed protein product [Triticum aestivum]
Length=399

 Score =   256 bits (654),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 173/374 (46%), Positives = 218/374 (58%), Gaps = 66/374 (18%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EELVVHYLKKK A  P+PV II EVDLYKFDPWELP KATFGEQEWYFFSPRDRKYPNGA
Sbjct  42    EELVVHYLKKKAAKVPLPVTIITEVDLYKFDPWELPEKATFGEQEWYFFSPRDRKYPNGA  101

Query  1068  RPNRAATSGYWKATGTDKPVLTAG-GTQKVGVKKALVFYGGKPPKGVKTNWIMHEYRLAD  892
             RPNRAATSGYWKATGTDKP+L +G G +KVGVKKALVFY GKPPKG+KTNWIMHEYRL D
Sbjct  102   RPNRAATSGYWKATGTDKPILASGCGREKVGVKKALVFYRGKPPKGLKTNWIMHEYRLTD  161

Query  891   ---NKTSNKPPGLDIANRSKGGSLRLDDWVLCRIYKKNNSQRPLDHE-SDDLNDMLQGSI  724
                + T+++PP +   +RS   SLRLDDWVLCRIYKK N     D + S +  D ++ ++
Sbjct  162   ASSSATTSRPPPVTGGSRS--ASLRLDDWVLCRIYKKINKAAAGDQQRSMECEDSVEDAV  219

Query  723   PPFVTHQKMGLK-----PSNYGALLQTDhhhhhhHM------FDQGLVPGDASLGG----  589
               +  +   G+       SNY +LL     H  + +       D GL  G  SL      
Sbjct  220   TAYPLYATAGMTGAGAHGSNYDSLLHHQDSHEDNFLDGLLTAEDAGLSAGPTSLSHLAAA  279

Query  588   ------------ARTAQLPFV---PSTPNLLPTKRSLPGLFWNVDDSSANNHHPADASPP  454
                         A ++  PF     ST  +LP  R+ PG  +N   +  N          
Sbjct  280   ARASPAPTKQFLAPSSSTPFNWLDASTVGILPQARNFPG--FNRSRNVGN----------  327

Query  453   TKRFLADNNEASISRSDEQNGSIATL---LSHLP-QTPSLHQQ-TMLG--------ALND  313
                 ++ ++ A ++  +    +I T+   ++HLP Q  + HQQ  +LG        A   
Sbjct  328   ----MSLSSTADMAVDNGGGNAINTMPPFMNHLPMQDGTYHQQHVILGAPLAPEATAAAT  383

Query  312   GVFRQPYQVSGINW  271
               F+ P Q+SG+NW
Sbjct  384   SAFQHPVQISGVNW  397



>gb|AAM65392.1| NAM protein, putative [Arabidopsis thaliana]
Length=323

 Score =   253 bits (647),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 160/334 (48%), Positives = 203/334 (61%), Gaps = 43/334 (13%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EELVVHYLKKK AS P+PV+IIAE+DLYKFDPWELP+KA+FGE EWYFFSPRDRKYPNG 
Sbjct  27    EELVVHYLKKKAASVPLPVSIIAEIDLYKFDPWELPSKASFGEHEWYFFSPRDRKYPNGV  86

Query  1068  RPNRAATSGYWKATGTDKPVLTAGGTQKVGVKKALVFYGGKPPKGVKTNWIMHEYRLADN  889
             RPNRAATSGYWKATGTDKP+ T   + KVGVKKALVFYGGKPPKG+KT+WIMHEYRL D 
Sbjct  87    RPNRAATSGYWKATGTDKPIFTC-NSHKVGVKKALVFYGGKPPKGIKTDWIMHEYRLTDG  145

Query  888   --KTSNKPPGLDIANRSKGGSLRLDDWVLCRIYKKNNSQRPLDHESDDLNDMLQGSIPPF  715
                T+ KPP L    ++   SLRLDDWVLCRIYKKN+SQRP         D+++G     
Sbjct  146   NLSTAAKPPDLTTTRKN---SLRLDDWVLCRIYKKNSSQRPTMERVLLREDLMEG----M  198

Query  714   VTHQKMGLKPSNYGALLQTDhhhhhhHMFDQGLVPGDASLGGARTAQLPFVPSTPNLLPT  535
             ++        ++       ++ ++  H FD  +V  D                       
Sbjct  199   LSKSSANSSSTSVLDNNDNNNBNNKEHFFDGMVVSSD-----------------------  235

Query  534   KRSLPGLFWNVDDSSANNHHPADASPPTKRFLADNNEASISRSDEQNGSIATLLSHLPQT  355
             KRSL G +   D+  A+      +   +KRF    +      +D  N S  ++LS +PQ+
Sbjct  236   KRSLCGQYRMGDE--ASGSSSFGSFLSSKRF----HHTGDLNNDNYNVSFVSMLSEIPQS  289

Query  354   PSLHQQTML---GALND-GVFRQPYQVSGINWYS  265
                H   ++    +L D GV RQ +Q+  +NW+S
Sbjct  290   SGFHANGVMDTTSSLADHGVLRQAFQLPNMNWHS  323



>ref|XP_010473311.1| PREDICTED: NAC transcription factor 25-like [Camelina sativa]
Length=328

 Score =   253 bits (646),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 157/334 (47%), Positives = 203/334 (61%), Gaps = 38/334 (11%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EELVVHYLKKK  S P+PV+IIAE+DLYKFDPWELP+KA+FGE EWYFFSPRDRKYPNG 
Sbjct  27    EELVVHYLKKKATSVPLPVSIIAEIDLYKFDPWELPSKASFGEHEWYFFSPRDRKYPNGV  86

Query  1068  RPNRAATSGYWKATGTDKPVLTAGGTQKVGVKKALVFYGGKPPKGVKTNWIMHEYRLADN  889
             RPNRAATSGYWKATGTDKP+ T   + KVGVKKALVFYGGKPPKG+KT+WIMHEYRL D 
Sbjct  87    RPNRAATSGYWKATGTDKPIFTC-NSHKVGVKKALVFYGGKPPKGIKTDWIMHEYRLTDG  145

Query  888   --KTSNKPPGLDIANRSKGGSLRLDDWVLCRIYKKNNSQRPLDHESDDLNDMLQGSIPPF  715
                T+ KPPG+    ++   SLRLDDWVLCRIYKKN+SQRP         D+++G +   
Sbjct  146   NLSTTAKPPGIATTRKN---SLRLDDWVLCRIYKKNSSQRPTMERVLLREDLMEGMLSKS  202

Query  714   VTHQKMGLKPSNYGALLQTDhhhhhhHMFDQGLVPGDASLGGARTAQLPFVPSTPNLLPT  535
               +        N       ++++++   F  G+V                      +   
Sbjct  203   SANSSSTSVLDNNENNNNNNNNNNNEEHFFDGMV----------------------VSSD  240

Query  534   KRSLPGLFWNVDDSSANNHHPADASPPTKRFLADNNEASISRSDEQNGSIATLLSHLPQT  355
             KRSL G +    ++S ++      S  +KRF    +      +D  N S  ++LS +PQ+
Sbjct  241   KRSLCGQYRMGHEASGSSSFGYFLS--SKRF----HHTGDLNNDNYNVSFVSMLSEIPQS  294

Query  354   PSLHQQTML---GALND-GVFRQPYQVSGINWYS  265
                H   ++    +L D G  RQ +Q+  +NW+S
Sbjct  295   SGFHANGVMDTTSSLGDHGDLRQAFQLPNMNWHS  328



>emb|CDY22671.1| BnaC08g43050D [Brassica napus]
Length=199

 Score =   248 bits (632),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 131/158 (83%), Positives = 139/158 (88%), Gaps = 2/158 (1%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EELVVHYLK KVASAP+PVAII EVDLYKFDPWELPAKA+FGEQEWYFFSPRDRKYPNGA
Sbjct  28    EELVVHYLKSKVASAPLPVAIIGEVDLYKFDPWELPAKASFGEQEWYFFSPRDRKYPNGA  87

Query  1068  RPNRAATSGYWKATGTDKPVLTAGGTQKVGVKKALVFYGGKPPKGVKTNWIMHEYRLADN  889
             RPNRAATSGYWKATGTDK VL + G  KVGVKKALVFY GKPPKGVK++WIMHEYRL DN
Sbjct  88    RPNRAATSGYWKATGTDKLVLASDGKLKVGVKKALVFYSGKPPKGVKSDWIMHEYRLIDN  147

Query  888   KTSNKPPGLDIANRSKGGSLRLDDWVLCRIYKKNNSQR  775
             K +N+PPG    N  K  SLRLDDWVLCRIYKKNN+ R
Sbjct  148   KPNNRPPGCVFGN--KRNSLRLDDWVLCRIYKKNNASR  183



>ref|XP_009113148.1| PREDICTED: NAC transcription factor 25 [Brassica rapa]
Length=322

 Score =   251 bits (642),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 161/333 (48%), Positives = 195/333 (59%), Gaps = 44/333 (13%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EELVVHYLKKK AS P+PV+IIAE+DLYKFDPWELP+KA+FGEQEWYFFSPRDRKYPNG 
Sbjct  27    EELVVHYLKKKAASIPLPVSIIAEIDLYKFDPWELPSKASFGEQEWYFFSPRDRKYPNGV  86

Query  1068  RPNRAATSGYWKATGTDKPVLTAGGTQKVGVKKALVFYGGKPPKGVKTNWIMHEYRLADN  889
             RPNRAATSGYWKATGTDKP+ T   + KVGVKKALVFYGGKPPKG+KT+WIMHEYRL D 
Sbjct  87    RPNRAATSGYWKATGTDKPIFTC-NSHKVGVKKALVFYGGKPPKGIKTDWIMHEYRLTDG  145

Query  888   --KTSNKPPGLDIANRSKGGSLRLDDWVLCRIYKKNNSQRPLDHESDDLNDMLQGSIPPF  715
                T+ KPP    +  S+  SLRLDDWVLCRIYKKN+SQRP         D+++G +   
Sbjct  146   NLNTAAKPPD---STTSRKNSLRLDDWVLCRIYKKNSSQRPTMERVLLREDLMEGMLSKS  202

Query  714   VTHQKMGLKPSNYGALLQTDhhhhhhHMFDQGLVPGDASLGGARTAQLPFVPSTPNLLPT  535
               +        N       +      H FD   V  D                       
Sbjct  203   SANSSSTSVLDNNNNNNNNE-----EHFFDGMAVSSD-----------------------  234

Query  534   KRSLPGLFWNVDDSSANNHHPADASPPTKRFLADNNEASISRSDEQNGSIATLLSHLPQT  355
             KRSL G +       A+      +   +KRF    +  S   +D  N S  ++LS +PQ+
Sbjct  235   KRSLCGQY--RIGHEASGSSSFGSFLSSKRF----HHTSDINNDNYNVSFVSMLSEIPQS  288

Query  354   PSLHQQ----TMLGALNDGVFRQPYQVSGINWY  268
                H      TM    + GV RQ +Q+  +NW+
Sbjct  289   SGFHGNGVIDTMSTLADHGVLRQAFQLPNMNWH  321



>emb|CDY12886.1| BnaA09g13880D [Brassica napus]
Length=321

 Score =   251 bits (642),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 161/333 (48%), Positives = 201/333 (60%), Gaps = 45/333 (14%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EELVVHYLKKK AS P+PV+IIAE+DLYKFDPWELP+KA+FGEQEWYFFSPRDRKYPNG 
Sbjct  27    EELVVHYLKKKAASIPLPVSIIAEIDLYKFDPWELPSKASFGEQEWYFFSPRDRKYPNGV  86

Query  1068  RPNRAATSGYWKATGTDKPVLTAGGTQKVGVKKALVFYGGKPPKGVKTNWIMHEYRLADN  889
             RPNRAATSGYWKATGTDKP+ T   + KVGVKKALVFYGGKPPKG+KT+WIMHEYRL D 
Sbjct  87    RPNRAATSGYWKATGTDKPIFTC-NSHKVGVKKALVFYGGKPPKGIKTDWIMHEYRLTDG  145

Query  888   --KTSNKPPGLDIANRSKGGSLRLDDWVLCRIYKKNNSQRPLDHESDDLNDMLQGSIPPF  715
                T+ KPP    +  S+  SLRLDDWVLCRIYKKN+SQRP         D+++G +   
Sbjct  146   NLNTAAKPPD---STTSRKNSLRLDDWVLCRIYKKNSSQRPTMERVLLREDLMEGML---  199

Query  714   VTHQKMGLKPSNYGALLQTDhhhhhhHMFDQGLVPGDASLGGARTAQLPFVPSTPNLLPT  535
                 K     S+   L   +++++  H FD   V  D                       
Sbjct  200   ---SKSSANSSSTSVLDNNNNNNNEEHFFDGMAVSSD-----------------------  233

Query  534   KRSLPGLFWNVDDSSANNHHPADASPPTKRFLADNNEASISRSDEQNGSIATLLSHLPQT  355
             KRSL G +       A+      +   +KRF    +  S   +D  N S  ++LS +PQ+
Sbjct  234   KRSLCGQY--RIGHEASGSSSFGSFLSSKRF----HHTSDLNNDNYNVSFVSMLSEIPQS  287

Query  354   PSLHQQTMLGAL----NDGVFRQPYQVSGINWY  268
                H   ++       + GV RQ +Q+  +NW+
Sbjct  288   SGFHGNGVIDTTSTLADHGVLRQAFQLPNMNWH  320



>ref|XP_002888109.1| ANAC025 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH64368.1| ANAC025 [Arabidopsis lyrata subsp. lyrata]
Length=326

 Score =   251 bits (641),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 159/332 (48%), Positives = 199/332 (60%), Gaps = 36/332 (11%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EELVVHYLKKK AS P+PV+IIAE+DLYKFDPWELP+KA+FGE EWYFFSPRDRKYPNG 
Sbjct  27    EELVVHYLKKKAASVPLPVSIIAEIDLYKFDPWELPSKASFGEHEWYFFSPRDRKYPNGV  86

Query  1068  RPNRAATSGYWKATGTDKPVLTAGGTQKVGVKKALVFYGGKPPKGVKTNWIMHEYRLADN  889
             RPNRAATSGYWKATGTDKP+ T   + KVGVKKALVFYGGKPPKG+KT+WIMHEYRL D 
Sbjct  87    RPNRAATSGYWKATGTDKPIFTC-NSHKVGVKKALVFYGGKPPKGIKTDWIMHEYRLTDG  145

Query  888   KTSNKPPGLDIANRSKGGSLRLDDWVLCRIYKKNNSQRPLDHESDDLNDMLQGSIPPFVT  709
               S      D+A   K  SLRLDDWVLCRIYKKN+SQRP         D+++G +     
Sbjct  146   NLSTAAKQPDLATTRK-NSLRLDDWVLCRIYKKNSSQRPTMERVLLREDLMEGMLSKSSA  204

Query  708   HQKMGLKPSNYGALLQTDhhhhhhHMFDQGLVPGDASLGGARTAQLPFVPSTPNLLPTKR  529
             +        N       +++++  H FD  +V  D                       KR
Sbjct  205   NSSSTSVLDN-SDNNNNNNNNNEEHFFDGMVVSSD-----------------------KR  240

Query  528   SLPGLFWNVDDSSANNHHPADASPPTKRFLADNNEASISRSDEQNGSIATLLSHLPQTPS  349
             SL G +    ++S ++   +  S        D N      +D  N S  ++LS +PQ+  
Sbjct  241   SLCGQYRMGHEASGSSSFGSFLSSKKFHHTGDFN------NDNYNVSFVSMLSEIPQSSG  294

Query  348   LHQQTML---GALND-GVFRQPYQVSGINWYS  265
              H   ++    +L D GV RQ +Q+  +NW+S
Sbjct  295   FHANGVMDTTSSLADHGVLRQAFQLPNMNWHS  326



>emb|CDY40970.1| BnaCnng10130D [Brassica napus]
Length=322

 Score =   251 bits (640),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 159/333 (48%), Positives = 196/333 (59%), Gaps = 44/333 (13%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EELVVHYLKKK AS P+PV+IIAE+DLYKFDPWELP+KA+FGEQEWYFFSPRDRKYPNG 
Sbjct  27    EELVVHYLKKKAASIPLPVSIIAEIDLYKFDPWELPSKASFGEQEWYFFSPRDRKYPNGV  86

Query  1068  RPNRAATSGYWKATGTDKPVLTAGGTQKVGVKKALVFYGGKPPKGVKTNWIMHEYRLADN  889
             RPNRAATSGYWKATGTDKP+ T   + KVGVKKALVFYGGKPPKG+KT+WIMHEYRL D 
Sbjct  87    RPNRAATSGYWKATGTDKPIFTC-NSHKVGVKKALVFYGGKPPKGIKTDWIMHEYRLTDG  145

Query  888   --KTSNKPPGLDIANRSKGGSLRLDDWVLCRIYKKNNSQRPLDHESDDLNDMLQGSIPPF  715
                T+ KPP    +  S+  SLRLDDWVLCRIYKKN+SQRP         D+++G +   
Sbjct  146   NLNTAAKPPD---STTSRKNSLRLDDWVLCRIYKKNSSQRPTMERVLLREDLMEGMLSKS  202

Query  714   VTHQKMGLKPSNYGALLQTDhhhhhhHMFDQGLVPGDASLGGARTAQLPFVPSTPNLLPT  535
               +        N       +      H FD   V  D                       
Sbjct  203   SANSSSTSVLDNNNNNNNNE-----EHFFDGMAVSSD-----------------------  234

Query  534   KRSLPGLFWNVDDSSANNHHPADASPPTKRFLADNNEASISRSDEQNGSIATLLSHLPQT  355
             KRSL G +       A+      +   +KRF    +  S   +D  N S  ++LS +PQ+
Sbjct  235   KRSLCGQY--RIGHEASGSSSFGSFLSSKRF----HHTSDLNNDNYNVSFVSMLSEIPQS  288

Query  354   PSLHQQTMLGA----LNDGVFRQPYQVSGINWY  268
                H   ++      ++ GV RQ +Q+  +NW+
Sbjct  289   SGFHGNGVIDTTSTLVDHGVLRQAFQLPNMNWH  321



>ref|XP_010533895.1| PREDICTED: NAC transcription factor 25 isoform X1 [Tarenaya hassleriana]
Length=357

 Score =   251 bits (640),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 171/345 (50%), Positives = 204/345 (59%), Gaps = 30/345 (9%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EELVVHYLKKKVAS P+PV+IIAEVDLYKFDPWELP KATFGEQEWYFFSPRDRKYPNGA
Sbjct  26    EELVVHYLKKKVASIPLPVSIIAEVDLYKFDPWELPCKATFGEQEWYFFSPRDRKYPNGA  85

Query  1068  RPNRAATSGYWKATGTDKPVLTAGGTQKVGVKKALVFYGGKPPKGVKTNWIMHEYRLADN  889
             RPNRAATSGYWKATGTDKP+LT+    KVGVKKALVFYGGKPPKG+KTNWIMHEYRL D 
Sbjct  86    RPNRAATSGYWKATGTDKPILTSNSHHKVGVKKALVFYGGKPPKGIKTNWIMHEYRLIDG  145

Query  888   KTSNKPPGLDIANRSKGGSLRLDDWVLCRIYKKNNSQRPLDHESDDLNDMLQGSIPPFVT  709
                  P      + SK  SLRLDDWVLCRIYKKN S RP+D  + +  D++ G I     
Sbjct  146   DV---PNSKPDLSSSKKSSLRLDDWVLCRIYKKNTSHRPMDQRAGE--DLMDGMIATVQN  200

Query  708   HQKMGLKPSNYGALLQTDhhhhhhHMFDQGLVPGDASLGGARTAQLPFVPSTPNLLPTKR  529
                   K S   +    D++   H   D   +   +S  G+    LP +       PT  
Sbjct  201   LHHQNQKSSANSSSSVLDNNEEQHFFMDCSTMVVSSSSNGSD--HLPLIKRNN---PTLS  255

Query  528   SLPGLFWNVDDSSANNHHPADASPPTKRFLAD------------NNEASISRSDEQNGSI  385
             +    +W  D +S +      +S   KRF  D              E + + +   N S 
Sbjct  256   NNDHQYWISDTNSGSF---GSSSLQNKRFHGDLNNGVDNNNNSIEEEDNDNNNSNNNNSF  312

Query  384   ATLLSHLPQTPSLHQQTML-GALND----GVFRQPYQVSGINWYS  265
              +LL  +PQ    H   ++  +L D    GV RQ +Q+  INW S
Sbjct  313   VSLLREIPQNSGFHGNGVIDSSLADHHHHGVLRQAFQLPNINWTS  357



>gb|EMT26194.1| NAC domain-containing protein 18 [Aegilops tauschii]
Length=396

 Score =   251 bits (642),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 176/375 (47%), Positives = 214/375 (57%), Gaps = 68/375 (18%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EELVVHYLKKK A  P+PV IIAEVDLYKFDPWELP KATFGEQEWYFFSPRDRKYPNGA
Sbjct  39    EELVVHYLKKKAAKVPLPVTIIAEVDLYKFDPWELPEKATFGEQEWYFFSPRDRKYPNGA  98

Query  1068  RPNRAATSGYWKATGTDKPVLTAG-GTQKVGVKKALVFYGGKPPKGVKTNWIMHEYRLAD  892
             RPNRAATSGYWKATGTDKP++ +G G +KVGVKKALVFY GKPPKG+KTN IM EYRL D
Sbjct  99    RPNRAATSGYWKATGTDKPIMASGCGREKVGVKKALVFYRGKPPKGLKTNGIMQEYRLTD  158

Query  891   ---NKTSNKPPGLDIANRSKGGSLRLDDWVLCRIYKKNN------SQRPLDHESDDLNDM  739
                + T+++PP   +   S+  SLRLDDWVLCRIYKK N       QR ++ E D + D 
Sbjct  159   ASSSATTSRPP--PVTGGSRAASLRLDDWVLCRIYKKINKAAAGDQQRSMECE-DSVEDA  215

Query  738   LQGSIPPFVT--HQKMGLKPSNYGALLQTDhhhhhhHM------FDQGLVPGDASLGG--  589
             +  + PP+ T      G   SNY +LL     H  + +       D GL  G  SL    
Sbjct  216   VT-AYPPYATAGMTGAGAHGSNYDSLLHHQDSHEDNFLDGLLTAEDAGLSAGATSLSHLA  274

Query  588   --------------ARTAQLPFV---PSTPNLLPTKRSLPGL--FWNVDDSSANNHHPAD  466
                           A ++  PF     ST  +LP  R+ PG     NV + S ++     
Sbjct  275   AAARASPAPTKQFLAPSSSTPFNWLDASTVGILPQARNFPGFNRSRNVGNMSLSS-----  329

Query  465   ASPPTKRFLADNNEASISRSDEQNGSIATLLSHLP-QTPSLHQQ-TMLG--------ALN  316
                 T     DN   +         ++   ++HLP Q  + HQQ  +LG        A  
Sbjct  330   ----TADMAVDNGGGNAIN------AMPPFMNHLPVQDGTYHQQHVILGAPLAPEATAAA  379

Query  315   DGVFRQPYQVSGINW  271
                F+ P Q+SG+NW
Sbjct  380   TSAFQHPVQISGVNW  394



>ref|XP_006392059.1| hypothetical protein EUTSA_v10023591mg [Eutrema salsugineum]
 gb|ESQ29345.1| hypothetical protein EUTSA_v10023591mg [Eutrema salsugineum]
Length=325

 Score =   248 bits (634),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 161/334 (48%), Positives = 203/334 (61%), Gaps = 41/334 (12%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EELVVHYLKKK +S P+PV+IIAE+DLYKFDPWELP+K +FGEQEWYFFSPRDRKYPNG 
Sbjct  27    EELVVHYLKKKASSIPLPVSIIAEIDLYKFDPWELPSKTSFGEQEWYFFSPRDRKYPNGV  86

Query  1068  RPNRAATSGYWKATGTDKPVLTAGGTQKVGVKKALVFYGGKPPKGVKTNWIMHEYRLADN  889
             RPNRAATSGYWKATGTDKP+ T   + KVGVKKALVFYGGKPPKG+KT+WIMHEYRL D 
Sbjct  87    RPNRAATSGYWKATGTDKPIFTC-NSHKVGVKKALVFYGGKPPKGIKTDWIMHEYRLTDG  145

Query  888   --KTSNKPPGLDIANRSKGGSLRLDDWVLCRIYKKNNSQRPLDHESDDLNDMLQGSIPPF  715
                T+ KPP  D A   K  SLRLDDWVLCRIYKKN+SQRP         D+++G +   
Sbjct  146   NLSTTAKPP--DSATTRK-NSLRLDDWVLCRIYKKNSSQRPTMERVLLREDLMEGMLSKS  202

Query  714   VTHQKMGLKPSNYGALLQTDhhhhhhHMFDQGLVPGDASLGGARTAQLPFVPSTPNLLPT  535
               +        N       +++++  H FD  +V  D                       
Sbjct  203   SANSSSTSVLDN--NDNNNNNNNNEEHFFDGMVVSSD-----------------------  237

Query  534   KRSLPGLFWNVDDSSANNHHPADASPPTKRFLADNNEASISRSDEQNGSIATLLSHLPQT  355
             KRSL G +   ++  A+      +   +KRF       S   ++  N S  ++LS +PQ+
Sbjct  238   KRSLCGQYRMGNE--ASGSSSFGSFLSSKRF----QHTSDLNNENYNVSFVSMLSEIPQS  291

Query  354   PSLHQQTML---GALND-GVFRQPYQVSGINWYS  265
                H   ++    +L D GV RQ +Q+  +NW+S
Sbjct  292   SGFHGNGVIDTTSSLADHGVLRQAFQLPNMNWHS  325



>gb|KFK42926.1| hypothetical protein AALP_AA1G056200 [Arabis alpina]
Length=324

 Score =   248 bits (633),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 158/334 (47%), Positives = 197/334 (59%), Gaps = 42/334 (13%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EELVVHYLKKK AS  +PV+IIAE+DLYKFDPWELP+KA+FGE EWYFFSPRDRKYPNG 
Sbjct  27    EELVVHYLKKKAASIQLPVSIIAEIDLYKFDPWELPSKASFGEHEWYFFSPRDRKYPNGV  86

Query  1068  RPNRAATSGYWKATGTDKPVLTAGGTQKVGVKKALVFYGGKPPKGVKTNWIMHEYRLADN  889
             RPNRAATSGYWKATGTDKP+ T   + KVGVKKALVFYGGKPPKG+KT+WIMHEYRL D 
Sbjct  87    RPNRAATSGYWKATGTDKPIFTC-NSHKVGVKKALVFYGGKPPKGIKTDWIMHEYRLTDG  145

Query  888   --KTSNKPPGLDIANRSKGGSLRLDDWVLCRIYKKNNSQRPLDHESDDLNDMLQGSIPPF  715
                T+ KPP       ++  SLRLDDWVLCRIYKKN+SQRP         D+++G +   
Sbjct  146   NLSTTAKPPD---PVTTRKNSLRLDDWVLCRIYKKNSSQRPTMERILLREDLMEGML---  199

Query  714   VTHQKMGLKPSNYGALLQTDhhhhhhHMFDQGLVPGDASLGGARTAQLPFVPSTPNLLPT  535
                       S        +++++  H FD  +V  D                       
Sbjct  200   SKSSANSSSTSVLDNNDNNNNNNNEEHFFDGMVVSSD-----------------------  236

Query  534   KRSLPGLFWNVDDSSANNHHPADASPPTKRFLADNNEASISRSDEQNGSIATLLSHLPQT  355
             KRSL G +    +  A+      +   +KRF    +  S   +D  N S  ++LS +PQ+
Sbjct  237   KRSLCGQYRMGHE--ASGSSSFGSFLSSKRF----HHTSDLNNDNYNVSFVSMLSEIPQS  290

Query  354   PSLHQQ----TMLGALNDGVFRQPYQVSGINWYS  265
                H      T     + GV RQ +Q+  +NW+S
Sbjct  291   SGFHGNGAIDTTSSLADHGVLRQAFQLPTMNWHS  324



>gb|ABI94356.1| NAC transcription factor NAM-D2 [Aegilops tauschii]
Length=383

 Score =   249 bits (636),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 155/282 (55%), Positives = 180/282 (64%), Gaps = 41/282 (15%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EELVVHYLKKK A  P+PV IIAEVDLYKFDPWELP KATFGEQEWYFFSPRDRKYPNGA
Sbjct  39    EELVVHYLKKKAAKVPLPVTIIAEVDLYKFDPWELPEKATFGEQEWYFFSPRDRKYPNGA  98

Query  1068  RPNRAATSGYWKATGTDKPVLTAG-GTQKVGVKKALVFYGGKPPKGVKTNWIMHEYRLAD  892
             RPNRAATSGYWKATGTDKP++ +G G +KVGVKKALVFY GKPPKG+KTNWIMHEYRL D
Sbjct  99    RPNRAATSGYWKATGTDKPIMASGCGREKVGVKKALVFYRGKPPKGLKTNWIMHEYRLTD  158

Query  891   ---NKTSNKPPGLDIANRSKGGSLRLDDWVLCRIYKKNN------SQRPLDHESDDLNDM  739
                + T+++PP   +   S+  SLRLDDWVLCRIYKK N       QR ++ E D + D 
Sbjct  159   ASSSATTSRPP--PVTGGSRAASLRLDDWVLCRIYKKINKAAAGDQQRSMECE-DSVEDA  215

Query  738   LQGSIPPFVT--HQKMGLKPSNYGALLQTDhhhhhhHM------FDQGLVPGDASLGG--  589
             +  + PP+ T      G   SNY +LL     H  + +       D GL  G  SL    
Sbjct  216   VT-AYPPYATAGMTGAGAHGSNYDSLLHHQDSHEDNFLDGLLTAEDAGLSAGATSLSHLA  274

Query  588   --------------ARTAQLPFV---PSTPNLLPTKRSLPGL  514
                           A ++  PF     ST  +LP  R+ PG 
Sbjct  275   AAARASPAPTKQFLAPSSSTPFNWLDASTVGILPQARNFPGF  316



>gb|AEH68228.1| NAC transcription factor [Triticum aestivum]
Length=383

 Score =   249 bits (636),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 155/282 (55%), Positives = 180/282 (64%), Gaps = 41/282 (15%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EELVVHYLKKK A  P+PV IIAEVDLYKFDPWELP KATFGEQEWYFFSPRDRKYPNGA
Sbjct  39    EELVVHYLKKKAAKVPLPVTIIAEVDLYKFDPWELPEKATFGEQEWYFFSPRDRKYPNGA  98

Query  1068  RPNRAATSGYWKATGTDKPVLTAG-GTQKVGVKKALVFYGGKPPKGVKTNWIMHEYRLAD  892
             RPNRAATSGYWKATGTDKP++ +G G +KVGVKKALVFY GKPPKG+KTNWIMHEYRL D
Sbjct  99    RPNRAATSGYWKATGTDKPIMASGCGREKVGVKKALVFYRGKPPKGLKTNWIMHEYRLTD  158

Query  891   ---NKTSNKPPGLDIANRSKGGSLRLDDWVLCRIYKKNN------SQRPLDHESDDLNDM  739
                + T+++PP   +   S+  SLRLDDWVLCRIYKK N       QR ++ E D + D 
Sbjct  159   ASSSATTSRPP--PVTGGSRAASLRLDDWVLCRIYKKINKAAAGDQQRSMECE-DSVEDA  215

Query  738   LQGSIPPFVT--HQKMGLKPSNYGALLQTDhhhhhhHM------FDQGLVPGDASLGG--  589
             +  + PP+ T      G   SNY +LL     H  + +       D GL  G  SL    
Sbjct  216   VT-AYPPYATAGMTGAGAHGSNYDSLLHHQDSHEDNFLDGLLTAEDAGLSAGATSLSHLA  274

Query  588   --------------ARTAQLPFV---PSTPNLLPTKRSLPGL  514
                           A ++  PF     ST  +LP  R+ PG 
Sbjct  275   AAARASPAPTKQFLAPSSSTPFNWLDASTVGILPQARNFPGF  316



>sp|D2SMN4.1|NAMB1_HORVS RecName: Full=NAC transcription factor NAM-B1 [Hordeum vulgare 
subsp. spontaneum]
 gb|ACL31422.1| NAM-B1 [Hordeum vulgare subsp. spontaneum]
Length=406

 Score =   249 bits (637),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 179/378 (47%), Positives = 214/378 (57%), Gaps = 71/378 (19%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EELVVHYLKKK A AP+PV IIAEVDLYKFDPWELP KATFGE EWYFFSPRDRKYPNGA
Sbjct  46    EELVVHYLKKKAAKAPLPVTIIAEVDLYKFDPWELPEKATFGEHEWYFFSPRDRKYPNGA  105

Query  1068  RPNRAATSGYWKATGTDKPVL---TAGGTQKVGVKKALVFYGGKPPKGVKTNWIMHEYRL  898
             RPNRAATSGYWKATGTDKP+L   T  G +KVGVKKALVFY GKPP+G+KTNWIMHEYRL
Sbjct  106   RPNRAATSGYWKATGTDKPILASATGCGREKVGVKKALVFYRGKPPRGLKTNWIMHEYRL  165

Query  897   ----ADNKTSNKPPGLDIANRSKGGSLRLDDWVLCRIYKKN--------NSQRPLDHESD  754
                 A + T+++PP +   +R+   SLRLDDWVLCRIYKK         + QR ++ E D
Sbjct  166   TGASAGSTTTSRPPPVTGGSRAP-ASLRLDDWVLCRIYKKTSKAAAAVGDEQRSMECE-D  223

Query  753   DLNDMLQGSIPPF--VTHQKMGLKPSNYGALLQTDhhhhhhHMFDQ-------GLVPGDA  601
              + D +  + PP+        G   SNY  LL     H  +   D        GL  G A
Sbjct  224   SVEDAVT-AYPPYATAGMAGAGAHGSNYVQLLHHHDSHEDNFQLDGLLTEHDVGLSAGAA  282

Query  600   SLG----GARTAQLPFVP--STP----------NLLPTKRSLPGL--FWNVDDSSANNHH  475
             SLG     AR  +    P  STP          ++LP  R+ PG     NV   S ++  
Sbjct  283   SLGHLAAAARATKQFLAPSSSTPFNWLEASTGGSILPQARNFPGFNRSRNVGSMSLSS--  340

Query  474   PADASPPTKRFLADNNEASISRSDEQNGSIATLLSHLP-QTPSLHQQTMLGA--------  322
                         AD+   ++  SD  N   A    +LP Q  + HQ  +LGA        
Sbjct  341   -----------TADDMAGAVDVSDGGNAVNAM---YLPVQDGTYHQHVILGAPLAPEAIA  386

Query  321   -LNDGVFRQPYQVSGINW  271
                   F+   Q+SG+NW
Sbjct  387   GAATSGFQHHVQISGVNW  404



>ref|XP_006300981.1| hypothetical protein CARUB_v10021371mg [Capsella rubella]
 gb|EOA33879.1| hypothetical protein CARUB_v10021371mg [Capsella rubella]
Length=324

 Score =   246 bits (629),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 130/177 (73%), Positives = 144/177 (81%), Gaps = 6/177 (3%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EELVVHYLKKK  S P+PV+IIAE+DLYKFDPWELP+KA+FGE EWYFFSPRDRKYPNG 
Sbjct  27    EELVVHYLKKKATSVPLPVSIIAEIDLYKFDPWELPSKASFGEHEWYFFSPRDRKYPNGV  86

Query  1068  RPNRAATSGYWKATGTDKPVLTAGGTQKVGVKKALVFYGGKPPKGVKTNWIMHEYRLADN  889
             RPNRAATSGYWKATGTDKP+ T   + KVGVKKALVFYGGKPPKG+KT+WIMHEYRL D 
Sbjct  87    RPNRAATSGYWKATGTDKPIFTC-NSHKVGVKKALVFYGGKPPKGIKTDWIMHEYRLTDG  145

Query  888   KTSN--KPPGLDIANRSKGGSLRLDDWVLCRIYKKNNSQRPLDHESDDLNDMLQGSI  724
               SN  KPP  DIA   K  SLRLDDWVLCRIYKKN+SQRP         D+++G +
Sbjct  146   NLSNTAKPP--DIATTRK-NSLRLDDWVLCRIYKKNSSQRPTMERVLLREDLMEGML  199



>ref|XP_010418059.1| PREDICTED: NAC transcription factor 25-like [Camelina sativa]
Length=340

 Score =   246 bits (627),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 126/175 (72%), Positives = 141/175 (81%), Gaps = 2/175 (1%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EELVVHYLKKK  S P+PV+IIAE+DLYKFDPWELP+KA+FGE EWYFF+PRDRKYPNG 
Sbjct  27    EELVVHYLKKKATSVPLPVSIIAEIDLYKFDPWELPSKASFGEHEWYFFTPRDRKYPNGV  86

Query  1068  RPNRAATSGYWKATGTDKPVLTAGGTQKVGVKKALVFYGGKPPKGVKTNWIMHEYRLADN  889
             RPNRAATSGYWKATGTDKP+ T   + KVGVKKALVFYGGKPPKG+KT+WIMHEYRL D 
Sbjct  87    RPNRAATSGYWKATGTDKPIFTC-NSHKVGVKKALVFYGGKPPKGIKTDWIMHEYRLTDG  145

Query  888   KTSNKPPGLDIANRSKGGSLRLDDWVLCRIYKKNNSQRPLDHESDDLNDMLQGSI  724
               S  P   DIA   K  SLRLDDWVLCRIYKKN+SQRP         D+++G +
Sbjct  146   NLSTTPKPPDIATTRK-NSLRLDDWVLCRIYKKNSSQRPTMERVLLREDLMEGML  199



>ref|XP_009780447.1| PREDICTED: NAC transcription factor 25-like [Nicotiana sylvestris]
Length=269

 Score =   243 bits (620),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 125/174 (72%), Positives = 141/174 (81%), Gaps = 10/174 (6%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EELVVHYLKKKVASAP+PV IIAEVDLYKFDPWELP+KA FGEQEWYFFSPRDRKYPNG 
Sbjct  26    EELVVHYLKKKVASAPLPVKIIAEVDLYKFDPWELPSKANFGEQEWYFFSPRDRKYPNGT  85

Query  1068  RPNRAATSGYWKATGTDKPVLTAGGTQKVGVKKALVFYGGKPPKGVKTNWIMHEYRLADN  889
             RPNRAATSGYWKATG DKP+ T GGT+K+GVKK LVFY GKPPKG+K+NW+MHEYRL DN
Sbjct  86    RPNRAATSGYWKATGIDKPIYTCGGTKKIGVKKTLVFYRGKPPKGIKSNWVMHEYRLVDN  145

Query  888   KTSNKPPGLDIANRSKGGSLRLDDWVLCRIYKKNNSQRPLDHESDDLNDMLQGS  727
              +S           +K  SLRLDDWVLCRIYKKN+S   ++ + +D  +   GS
Sbjct  146   NSS----------LTKKCSLRLDDWVLCRIYKKNSSSTIMEMDKEDSIEETTGS  189



>ref|XP_010430102.1| PREDICTED: NAC transcription factor 25 [Camelina sativa]
Length=324

 Score =   245 bits (625),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 129/177 (73%), Positives = 144/177 (81%), Gaps = 6/177 (3%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EELVVHYLKKK  S P+PV+IIAE+DLYKFDPWELP+KA+FGE EWYFFSPRDRKYPNG 
Sbjct  27    EELVVHYLKKKATSVPLPVSIIAEIDLYKFDPWELPSKASFGEHEWYFFSPRDRKYPNGV  86

Query  1068  RPNRAATSGYWKATGTDKPVLTAGGTQKVGVKKALVFYGGKPPKGVKTNWIMHEYRLADN  889
             RPNRAATSGYWKATGTDKP+ T   + KVGVKKALVFYGGKPPKG+KT+WIMHEYRL D 
Sbjct  87    RPNRAATSGYWKATGTDKPIFTC-NSHKVGVKKALVFYGGKPPKGIKTDWIMHEYRLTDG  145

Query  888   --KTSNKPPGLDIANRSKGGSLRLDDWVLCRIYKKNNSQRPLDHESDDLNDMLQGSI  724
                T+ KPP  DIA   K  SLRLDDWVLCRIYKKN+SQRP         D+++G +
Sbjct  146   NLSTTAKPP--DIATTRK-NSLRLDDWVLCRIYKKNSSQRPTMERVLLREDLMEGML  199



>gb|AAB71483.1| similar to NAM (gp|X92205|1321924) and CUC2 (gp|AB002560|1944132) 
proteins [Arabidopsis thaliana]
Length=300

 Score =   244 bits (622),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 126/177 (71%), Positives = 143/177 (81%), Gaps = 6/177 (3%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EELVVHYLKKK  S P+PV+IIAE+DLYKFDPWELP+KA+FGE EWYFFSPRDRKYPNG 
Sbjct  24    EELVVHYLKKKADSVPLPVSIIAEIDLYKFDPWELPSKASFGEHEWYFFSPRDRKYPNGV  83

Query  1068  RPNRAATSGYWKATGTDKPVLTAGGTQKVGVKKALVFYGGKPPKGVKTNWIMHEYRLADN  889
             RPNRAATSGYWKATGTDKP+ T   + KVGVKKALVFYGGKPPKG+KT+WIMHEYRL D 
Sbjct  84    RPNRAATSGYWKATGTDKPIFTC-NSHKVGVKKALVFYGGKPPKGIKTDWIMHEYRLTDG  142

Query  888   --KTSNKPPGLDIANRSKGGSLRLDDWVLCRIYKKNNSQRPLDHESDDLNDMLQGSI  724
                T+ KPP L     ++  SLRLDDWVLCRIYKKN+SQRP         D+++G +
Sbjct  143   NLSTAAKPPDL---TTTRKNSLRLDDWVLCRIYKKNSSQRPTMERVLLREDLMEGML  196



>sp|A0SPJ8.1|NAM1_HORVD RecName: Full=NAC transcription factor NAM-1; Short=HvNAM-1 [Hordeum 
vulgare subsp. vulgare]
 gb|ABI94357.1| NAC transcription factor NAM-1 [Hordeum vulgare subsp. vulgare]
 gb|ABY67949.1| NAM-1 [Hordeum vulgare subsp. vulgare]
Length=406

 Score =   247 bits (630),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 177/377 (47%), Positives = 211/377 (56%), Gaps = 69/377 (18%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EELVVHYLKKK A AP+PV IIAEVDLYKFDPWELP KATFGE EWYFFSPRDRKY NGA
Sbjct  46    EELVVHYLKKKAAKAPLPVTIIAEVDLYKFDPWELPEKATFGEHEWYFFSPRDRKYANGA  105

Query  1068  RPNRAATSGYWKATGTDKPVL---TAGGTQKVGVKKALVFYGGKPPKGVKTNWIMHEYRL  898
             RPNRAATSGYWKATGTDKP+L   T  G +KVGVKKALVFY GKPP+G+KTNWIMHEYRL
Sbjct  106   RPNRAATSGYWKATGTDKPILASATGCGREKVGVKKALVFYRGKPPRGLKTNWIMHEYRL  165

Query  897   ----ADNKTSNKPPGLDIANRSKGGSLRLDDWVLCRIYKKN--------NSQRPLDHESD  754
                 A + T+++PP +   +R+   SLRLDDWVLCRIYKK         + QR ++ E D
Sbjct  166   TGASAGSTTTSRPPPVTGGSRAP-ASLRLDDWVLCRIYKKTSKAAAAVGDEQRSMECE-D  223

Query  753   DLNDMLQGSIPPF--VTHQKMGLKPSNYGALLQTDhhhhhhHMFDQ-------GLVPGDA  601
              + D +  + PP+        G   SNY  LL     H  +   D        GL  G A
Sbjct  224   SVEDAVT-AYPPYATAGMAGAGAHGSNYVQLLHHHDSHEDNFQLDGLLTEHDVGLSAGAA  282

Query  600   SLG----GARTAQLPFVP--STP----------NLLPTKRSLPGL--FWNVDDSSANNHH  475
             SLG     AR  +    P  STP          ++LP  R+ PG     NV   S ++  
Sbjct  283   SLGHLAAAARATKQFLAPSSSTPFNWLEASTGGSILPQARNFPGFNRSRNVGSMSLSS--  340

Query  474   PADASPPTKRFLADNNEASISRSDEQNGSIATLLSHLPQTPSLHQQTMLGA---------  322
                         AD+   ++  SD  N   A  L    Q  + HQ  +LGA         
Sbjct  341   -----------TADDMAGAVDVSDGGNAVNAMYLP--VQDGTYHQHVILGAPLAPEAIAG  387

Query  321   LNDGVFRQPYQVSGINW  271
                  F+   Q+SG+NW
Sbjct  388   AATSGFQHHVQISGVNW  404



>ref|XP_010533896.1| PREDICTED: NAC transcription factor 25 isoform X2 [Tarenaya hassleriana]
Length=286

 Score =   243 bits (619),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 133/175 (76%), Positives = 144/175 (82%), Gaps = 5/175 (3%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EELVVHYLKKKVAS P+PV+IIAEVDLYKFDPWELP KATFGEQEWYFFSPRDRKYPNGA
Sbjct  26    EELVVHYLKKKVASIPLPVSIIAEVDLYKFDPWELPCKATFGEQEWYFFSPRDRKYPNGA  85

Query  1068  RPNRAATSGYWKATGTDKPVLTAGGTQKVGVKKALVFYGGKPPKGVKTNWIMHEYRLADN  889
             RPNRAATSGYWKATGTDKP+LT+    KVGVKKALVFYGGKPPKG+KTNWIMHEYRL D 
Sbjct  86    RPNRAATSGYWKATGTDKPILTSNSHHKVGVKKALVFYGGKPPKGIKTNWIMHEYRLIDG  145

Query  888   KTSNKPPGLDIANRSKGGSLRLDDWVLCRIYKKNNSQRPLDHESDDLNDMLQGSI  724
                N        + SK  SLRLDDWVLCRIYKKN S RP+D  + +  D++ G I
Sbjct  146   DVPNS---KPDLSSSKKSSLRLDDWVLCRIYKKNTSHRPMDQRAGE--DLMDGMI  195



>ref|NP_564771.1| NAC domain containing protein 25 [Arabidopsis thaliana]
 sp|Q8GY42.1|NAC25_ARATH RecName: Full=NAC transcription factor 25; Short=AtNAC025 [Arabidopsis 
thaliana]
 dbj|BAC42518.1| unknown protein [Arabidopsis thaliana]
 gb|AAP37705.1| At1g61110 [Arabidopsis thaliana]
 gb|AEE33783.1| NAC domain containing protein 25 [Arabidopsis thaliana]
Length=323

 Score =   244 bits (622),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 126/177 (71%), Positives = 143/177 (81%), Gaps = 6/177 (3%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EELVVHYLKKK  S P+PV+IIAE+DLYKFDPWELP+KA+FGE EWYFFSPRDRKYPNG 
Sbjct  27    EELVVHYLKKKADSVPLPVSIIAEIDLYKFDPWELPSKASFGEHEWYFFSPRDRKYPNGV  86

Query  1068  RPNRAATSGYWKATGTDKPVLTAGGTQKVGVKKALVFYGGKPPKGVKTNWIMHEYRLADN  889
             RPNRAATSGYWKATGTDKP+ T   + KVGVKKALVFYGGKPPKG+KT+WIMHEYRL D 
Sbjct  87    RPNRAATSGYWKATGTDKPIFTC-NSHKVGVKKALVFYGGKPPKGIKTDWIMHEYRLTDG  145

Query  888   --KTSNKPPGLDIANRSKGGSLRLDDWVLCRIYKKNNSQRPLDHESDDLNDMLQGSI  724
                T+ KPP L    ++   SLRLDDWVLCRIYKKN+SQRP         D+++G +
Sbjct  146   NLSTAAKPPDLTTTRKN---SLRLDDWVLCRIYKKNSSQRPTMERVLLREDLMEGML  199



>gb|AGH32785.1| NAC transcription factor NAM-B1 [Triticum ispahanicum]
Length=405

 Score =   246 bits (628),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 167/368 (45%), Positives = 208/368 (57%), Gaps = 51/368 (14%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EELVVHYLKKK   AP+PV IIAEVDLYKFDPWELP KAT GEQEWYFFSPRDRKYPNGA
Sbjct  45    EELVVHYLKKKADKAPLPVNIIAEVDLYKFDPWELPEKATIGEQEWYFFSPRDRKYPNGA  104

Query  1068  RPNRAATSGYWKATGTDKPVLTAGG-----TQKVGVKKALVFYGGKPPKGVKTNWIMHEY  904
             RPNRAATSGYWKATGTDKP+L +G       +K+GVKKALVFY GKPPKG+KTNWIMHEY
Sbjct  105   RPNRAATSGYWKATGTDKPILASGTGCGLVREKLGVKKALVFYRGKPPKGLKTNWIMHEY  164

Query  903   RLAD----NKTSNKPPGLDIANRSKGGSLRLDDWVLCRIYKKNNSQRPLDHESD-DLNDM  739
             RL D       +N+PP +   +R+   SLRLDDWVLCRIYKK N     D + + +  D 
Sbjct  165   RLTDASGSTTATNRPPPVTGGSRA-AASLRLDDWVLCRIYKKINKAAAGDQQRNTECEDS  223

Query  738   LQGSIPPFVTHQKMGL-----KPSNYG--ALLQTDhhhhhhHMF---DQGLVPGDASLGG  589
             ++ ++  +  +   G+     + SNY   +LL     H    +F   D GL  G  SL  
Sbjct  224   VEDAVTAYPLYATAGMTGAGARGSNYASPSLLHHQDSHFLDGLFTADDAGLSAGATSLNH  283

Query  588   ARTAQLPFVPSTPNLLPTKRSLPGLFWNVDDSSANNHHPADASPPTKRFLADNNE-----  424
                A       T   L    S P   +N  D+S     P    P  + F   N       
Sbjct  284   LAAAARASPAPTKQFLAPSSSTP---FNWLDAS-----PVGILPQARNFPGFNRSRNVGN  335

Query  423   ASISRSDEQNG--------SIATLLSHLP-QTPSLHQQTML--------GALNDGVFRQP  295
              S+S + +  G        ++  + ++LP Q  + HQQ ++         A     F+ P
Sbjct  336   MSLSSTADMAGAVDNGGGNAVNAMSTYLPVQDGTYHQQHVILGAPLVPEAAAATSGFQHP  395

Query  294   YQVSGINW  271
              Q+SG+NW
Sbjct  396   VQISGVNW  403



>ref|XP_010052353.1| PREDICTED: NAC transcription factor 25-like [Eucalyptus grandis]
 gb|KCW76294.1| hypothetical protein EUGRSUZ_D00665 [Eucalyptus grandis]
Length=343

 Score =   243 bits (621),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 157/342 (46%), Positives = 208/342 (61%), Gaps = 43/342 (13%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EELVV YL KKVA  P+PV+IIAE++LYKFDPWELP+KA FGE EWYFFSPRDRKYPNGA
Sbjct  26    EELVVQYLGKKVALEPLPVSIIAEINLYKFDPWELPSKAIFGEHEWYFFSPRDRKYPNGA  85

Query  1068  RPNRAATSGYWKATGTDKPVLTAGGTQKVGVKKALVFYGGKPPKGVKTNWIMHEYRLADN  889
             RPNRAATSGYWKATGTDKP+  + G  KVGVKKALVFY GKPPKG KT+WIMHEYR  D 
Sbjct  86    RPNRAATSGYWKATGTDKPIFASTGKCKVGVKKALVFYRGKPPKGTKTDWIMHEYRFTDG  145

Query  888   KTSNKPPGLDIANRSKGGSLRLDDWVLCRIYKKNNSQRPLDHESDDLNDMLQGSIPPFVT  709
              ++ KPP  D A  SK GSLRLDDWVLCRIYKK++  R ++  S++   +     PP   
Sbjct  146   NSAPKPPKADSA--SKKGSLRLDDWVLCRIYKKSSPVRLVEPRSENFAPLNMN--PP---  198

Query  708   HQKMGLKPSNYGALLQTDhhhhhhHMFDQGLVPGDASLGGARTAQLPFVPSTPNLLPTKR  529
                   K  NY + L  ++       F +G++P +     + + QLPF    P++  +  
Sbjct  199   ----ASKGVNYSSTLPGNNDGA----FFEGMLP-ETIHSTSISHQLPFSTMKPDVSISHS  249

Query  528   SL------------PGLFWNVDDSSANNHHPADASPPTKRFLADNNEASISRS--DEQNG  391
             ++            P  +W+ D S+ +           KR+   +++ +   +  D++N 
Sbjct  250   AMATSDESRRGCPAPVQYWSEDGSAISG----------KRYEGGHHDQNGGGNGMDDRN-  298

Query  390   SIATLLSHLPQ-TPSLHQQTML-GALNDGVFRQPYQVSGINW  271
             S  +LL  +PQ +   H    L   + DG F++ +Q  G+NW
Sbjct  299   SFVSLLHQIPQNSEPFHPHMFLENPIGDGDFQRQFQPLGMNW  340



>gb|AGZ20132.1| NAC transcription factor NAM-B1 [Triticum dicoccoides]
Length=405

 Score =   245 bits (626),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 167/374 (45%), Positives = 212/374 (57%), Gaps = 63/374 (17%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EELVVHYLKKK   AP+PV IIAEVDLYKFDPWELP KAT GEQEWYFFSPRDRKYPNGA
Sbjct  45    EELVVHYLKKKADKAPLPVNIIAEVDLYKFDPWELPEKATIGEQEWYFFSPRDRKYPNGA  104

Query  1068  RPNRAATSGYWKATGTDKPVLTAGG-----TQKVGVKKALVFYGGKPPKGVKTNWIMHEY  904
             RPNRAATSGYWKATGTDKP+L +G       +K+GVKKALVFY GKPPKG+KTNWIMHEY
Sbjct  105   RPNRAATSGYWKATGTDKPILASGTGCGLVREKLGVKKALVFYRGKPPKGLKTNWIMHEY  164

Query  903   RLAD----NKTSNKPPGLDIANRSKGGSLRLDDWVLCRIYKKNNSQRPLDHESD-DLNDM  739
             RL D       +N+PP +   +R+   SLRLDDWVLCRIYKK N     D + + +  D 
Sbjct  165   RLTDASGSTTATNRPPPVTGGSRA-AASLRLDDWVLCRIYKKINKAAAGDQQRNTECEDS  223

Query  738   LQGSIPPFVTHQKMGLK-----PSNYG--ALLQTDhhhhhhHMF---DQGLVPGDASLGG  589
             ++ ++  +  +   G+       SNY   +LL     H    +F   D GL  G  SL  
Sbjct  224   VEDAVTAYPLYATAGMTGAGAHGSNYASPSLLHHQDSHFLAGLFTADDAGLSAGATSLSH  283

Query  588   ----------------ARTAQLPF--VPSTP-NLLPTKRSLPGLFWNVDDSSANNHHPAD  466
                             A ++  PF  + ++P  +LP  R+ PG      D S N  + + 
Sbjct  284   LAAAARASPAPTKQFLAPSSSTPFNWLDASPVGILPQARNFPGF-----DRSRNVGNMSL  338

Query  465   ASPPTKRFLADNNEASISRSDEQNGSIATLLSHLP-QTPSLHQQTML--------GALND  313
             +S        DN   +         ++  + ++LP Q  + HQQ ++         A   
Sbjct  339   SSTADMAGAVDNGGGN---------AVNAMSTYLPVQDGTYHQQHVILGAPLVPEAAAAT  389

Query  312   GVFRQPYQVSGINW  271
               F+ P Q+SG+NW
Sbjct  390   SGFQHPVQISGVNW  403



>sp|A0SPJ4.1|NAMB1_TRIDC RecName: Full=NAC transcription factor NAM-B1; Short=TtNAM-B1 
[Triticum dicoccoides]
 gb|ABI15896.1| NAC transcription factor NAM-B1 [Triticum dicoccoides]
 gb|ABI94353.1| NAC transcription factor NAM-B1 [Triticum dicoccoides]
 gb|AGH32786.1| NAC transcription factor NAM-B1 [Triticum ispahanicum]
 gb|AGZ20120.1| NAC transcription factor NAM-B1 [Triticum dicoccoides]
 gb|AGZ20121.1| NAC transcription factor NAM-B1 [Triticum dicoccoides]
 gb|AGZ20122.1| NAC transcription factor NAM-B1 [Triticum dicoccoides]
 gb|AGZ20125.1| NAC transcription factor NAM-B1 [Triticum dicoccoides]
 gb|AGZ20126.1| NAC transcription factor NAM-B1 [Triticum dicoccoides]
 gb|AGZ20127.1| NAC transcription factor NAM-B1 [Triticum dicoccoides]
 gb|AGZ20128.1| NAC transcription factor NAM-B1 [Triticum dicoccoides]
 gb|AGZ20130.1| NAC transcription factor NAM-B1 [Triticum dicoccoides]
 gb|AGZ20134.1| NAC transcription factor NAM-B1 [Triticum dicoccoides]
 gb|AGZ20136.1| NAC transcription factor NAM-B1 [Triticum dicoccoides]
 gb|AIZ97665.1| NAC transcription factor NAM-B1 [Triticum aestivum]
Length=405

 Score =   245 bits (625),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 167/368 (45%), Positives = 207/368 (56%), Gaps = 51/368 (14%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EELVVHYLKKK   AP+PV IIAEVDLYKFDPWELP KAT GEQEWYFFSPRDRKYPNGA
Sbjct  45    EELVVHYLKKKADKAPLPVNIIAEVDLYKFDPWELPEKATIGEQEWYFFSPRDRKYPNGA  104

Query  1068  RPNRAATSGYWKATGTDKPVLTAGG-----TQKVGVKKALVFYGGKPPKGVKTNWIMHEY  904
             RPNRAATSGYWKATGTDKP+L +G       +K+GVKKALVFY GKPPKG+KTNWIMHEY
Sbjct  105   RPNRAATSGYWKATGTDKPILASGTGCGLVREKLGVKKALVFYRGKPPKGLKTNWIMHEY  164

Query  903   RLAD----NKTSNKPPGLDIANRSKGGSLRLDDWVLCRIYKKNNSQRPLDHESD-DLNDM  739
             RL D       +N+PP +   +R+   SLRLDDWVLCRIYKK N     D + + +  D 
Sbjct  165   RLTDASGSTTATNRPPPVTGGSRA-AASLRLDDWVLCRIYKKINKAAAGDQQRNTECEDS  223

Query  738   LQGSIPPFVTHQKMGLK-----PSNYG--ALLQTDhhhhhhHMF---DQGLVPGDASLGG  589
             ++ ++  +  +   G+       SNY   +LL     H    +F   D GL  G  SL  
Sbjct  224   VEDAVTAYPLYATAGMTGAGAHGSNYASPSLLHHQDSHFLDGLFTADDAGLSAGATSLSH  283

Query  588   ARTAQLPFVPSTPNLLPTKRSLPGLFWNVDDSSANNHHPADASPPTKRFLADNNE-----  424
                A       T   L    S P   +N  D+S     P    P  + F   N       
Sbjct  284   LAAAARASPAPTKQFLAPSSSTP---FNWLDAS-----PVGILPQARNFPGFNRSRNVGN  335

Query  423   ASISRSDEQNG--------SIATLLSHLP-QTPSLHQQTML--------GALNDGVFRQP  295
              S+S + +  G        ++  + ++LP Q  + HQQ ++         A     F+ P
Sbjct  336   MSLSSTADMAGAVDNGGGNAVNAMSTYLPVQDGTYHQQHVILGAPLVPEAAAATSGFQHP  395

Query  294   YQVSGINW  271
              Q+SG+NW
Sbjct  396   VQISGVNW  403



>gb|ABY67950.1| NAM-1 [Hordeum vulgare subsp. vulgare]
Length=406

 Score =   245 bits (625),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 178/378 (47%), Positives = 213/378 (56%), Gaps = 71/378 (19%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EELVVHYLKKK A AP+PV IIAEVDLYKFDP ELP KATFGE EWYFFSPRDRKYPNGA
Sbjct  46    EELVVHYLKKKAAKAPLPVTIIAEVDLYKFDPCELPEKATFGEHEWYFFSPRDRKYPNGA  105

Query  1068  RPNRAATSGYWKATGTDKPVL---TAGGTQKVGVKKALVFYGGKPPKGVKTNWIMHEYRL  898
             RPNRAATSGYWKATGTDKP+L   T  G +KVGVKKALVFY GKPP+G+KTNWIMHEYRL
Sbjct  106   RPNRAATSGYWKATGTDKPILASATGCGREKVGVKKALVFYRGKPPRGLKTNWIMHEYRL  165

Query  897   ----ADNKTSNKPPGLDIANRSKGGSLRLDDWVLCRIYKKN--------NSQRPLDHESD  754
                 A + T+++PP +   +R+   SLRLDDWVLCRIYKK         + QR ++ E D
Sbjct  166   TGASAGSTTTSRPPPVTGGSRAP-ASLRLDDWVLCRIYKKTSKAAAAVGDEQRSMECE-D  223

Query  753   DLNDMLQGSIPPF--VTHQKMGLKPSNYGALLQTDhhhhhhHMFDQ-------GLVPGDA  601
              + D +  + PP+        G   SNY  LL     H  +   D        GL  G A
Sbjct  224   SVEDAVT-AYPPYATAGMAGAGAHGSNYVQLLHHHDSHEDNFQLDGLLTEHDVGLSAGAA  282

Query  600   SLG----GARTAQLPFVP--STP----------NLLPTKRSLPGL--FWNVDDSSANNHH  475
             SLG     AR  +    P  STP          ++LP  R+ PG     NV   S ++  
Sbjct  283   SLGHLAAAARATKQFLAPSSSTPFNWLEASTGGSILPQARNFPGFNRSRNVGSMSLSS--  340

Query  474   PADASPPTKRFLADNNEASISRSDEQNGSIATLLSHLP-QTPSLHQQTMLGA--------  322
                         AD+   ++  SD  N   A    +LP Q  + HQ  +LGA        
Sbjct  341   -----------TADDMAGAVDVSDGGNTVNAM---YLPVQDGTYHQHVILGAPLAPEAIA  386

Query  321   -LNDGVFRQPYQVSGINW  271
                   F+   Q+SG+NW
Sbjct  387   GAATSGFQHHVQISGVNW  404



>gb|AGH32787.1| NAC transcription factor NAM-B1 [Triticum ispahanicum]
Length=405

 Score =   245 bits (625),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 167/368 (45%), Positives = 207/368 (56%), Gaps = 51/368 (14%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EELVVHYLKKK   AP+PV IIAEVDLYKFDPWELP KAT GEQEWYFFSPRDRKYPNGA
Sbjct  45    EELVVHYLKKKADKAPLPVNIIAEVDLYKFDPWELPEKATIGEQEWYFFSPRDRKYPNGA  104

Query  1068  RPNRAATSGYWKATGTDKPVLTAGG-----TQKVGVKKALVFYGGKPPKGVKTNWIMHEY  904
             RPNRAATSGYWKATGTDKP+L +G       +K+GVKKALVFY GKPPKG+KTNWIMHEY
Sbjct  105   RPNRAATSGYWKATGTDKPILASGTGCGLVREKLGVKKALVFYRGKPPKGLKTNWIMHEY  164

Query  903   RLAD----NKTSNKPPGLDIANRSKGGSLRLDDWVLCRIYKKNNSQRPLDHESD-DLNDM  739
             RL D       +N+PP +   +R+   SLRLDDWVLCRIYKK N     D + + +  D 
Sbjct  165   RLTDASGSTTATNRPPPVTGGSRA-AASLRLDDWVLCRIYKKINKAAAGDQQRNTECEDS  223

Query  738   LQGSIPPFVTHQKMGLK-----PSNYG--ALLQTDhhhhhhHMF---DQGLVPGDASLGG  589
             ++ ++  +  +   G+       SNY   +LL     H    +F   D GL  G  SL  
Sbjct  224   VEDAVTAYPLYATAGMTGAGAHGSNYASPSLLHHQDSHFLDGLFTADDAGLSAGATSLSH  283

Query  588   ARTAQLPFVPSTPNLLPTKRSLPGLFWNVDDSSANNHHPADASPPTKRFLADNNE-----  424
                A       T   L    S P   +N  D+S     P    P  + F   N       
Sbjct  284   LAAAARASPAPTKQFLAPSSSTP---FNWLDAS-----PVGILPQARNFPGFNRSRNVGN  335

Query  423   ASISRSDEQNG--------SIATLLSHLP-QTPSLHQQTML--------GALNDGVFRQP  295
              S+S + +  G        ++  + ++LP Q  + HQQ ++         A     F+ P
Sbjct  336   MSLSSTADMAGAVDNGGGNAVNAMSTYLPVQDGTYHQQHVILGAPLVPEAAAATSGFQHP  395

Query  294   YQVSGINW  271
              Q+SG+NW
Sbjct  396   VQISGVNW  403



>gb|AGZ20123.1| NAC transcription factor NAM-B1 [Triticum dicoccoides]
Length=405

 Score =   245 bits (625),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 167/368 (45%), Positives = 207/368 (56%), Gaps = 51/368 (14%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EELVVHYLKKK   AP+PV IIAEVDLYKFDPWELP KAT GEQEWYFFSPRDRKYPNGA
Sbjct  45    EELVVHYLKKKADKAPLPVNIIAEVDLYKFDPWELPEKATVGEQEWYFFSPRDRKYPNGA  104

Query  1068  RPNRAATSGYWKATGTDKPVLTAGG-----TQKVGVKKALVFYGGKPPKGVKTNWIMHEY  904
             RPNRAATSGYWKATGTDKP+L +G       +K+GVKKALVFY GKPPKG+KTNWIMHEY
Sbjct  105   RPNRAATSGYWKATGTDKPILASGTGCGLVREKLGVKKALVFYRGKPPKGLKTNWIMHEY  164

Query  903   RLAD----NKTSNKPPGLDIANRSKGGSLRLDDWVLCRIYKKNNSQRPLDHESD-DLNDM  739
             RL D       +N+PP +   +R+   SLRLDDWVLCRIYKK N     D + + +  D 
Sbjct  165   RLTDASGSTTATNRPPPVTGGSRA-AASLRLDDWVLCRIYKKINKAAAGDQQRNTECEDS  223

Query  738   LQGSIPPFVTHQKMGLK-----PSNYG--ALLQTDhhhhhhHMF---DQGLVPGDASLGG  589
             ++ ++  +  +   G+       SNY   +LL     H    +F   D GL  G  SL  
Sbjct  224   VEDAVTAYPLYATAGMTGAGAHGSNYASPSLLHHQDSHFLDGLFTADDAGLSAGATSLSH  283

Query  588   ARTAQLPFVPSTPNLLPTKRSLPGLFWNVDDSSANNHHPADASPPTKRFLADNNE-----  424
                A       T   L    S P   +N  D+S     P    P  + F   N       
Sbjct  284   LAAAARASPAPTKQFLAPSSSTP---FNWLDAS-----PVGILPQARNFPGFNRSRNVGN  335

Query  423   ASISRSDEQNG--------SIATLLSHLP-QTPSLHQQTML--------GALNDGVFRQP  295
              S+S + +  G        ++  + ++LP Q  + HQQ ++         A     F+ P
Sbjct  336   MSLSSTADMAGAVDNGGGNAVNAMSTYLPVQDGTYHQQHVILGAPLVPEAAAATSGFQHP  395

Query  294   YQVSGINW  271
              Q+SG+NW
Sbjct  396   VQISGVNW  403



>gb|EYU27944.1| hypothetical protein MIMGU_mgv1a020591mg, partial [Erythranthe 
guttata]
Length=304

 Score =   241 bits (615),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 130/182 (71%), Positives = 151/182 (83%), Gaps = 9/182 (5%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EELVVHYLKK+ ASAP+PVAIIAE+DLYK+DPWELP+KA+FGEQEWYFFS R+RKYPNG 
Sbjct  24    EELVVHYLKKRAASAPLPVAIIAELDLYKYDPWELPSKASFGEQEWYFFSRRERKYPNGE  83

Query  1068  RPNRAATSGYWKATGTDKPVLTAGGTQKVGVKKALVFYGGKPPKGVKTNWIMHEYRLAD-  892
             RPNRAATSGYWKATGTDKP+LTA G Q VGVKKALVFYGGKPPKG+K+NWIMHEYRL D 
Sbjct  84    RPNRAATSGYWKATGTDKPILTANGAQTVGVKKALVFYGGKPPKGIKSNWIMHEYRLVDG  143

Query  891   NKTSNKPPGLD-IANRSKGGSLRLDDWVLCRIYKKNNS--QRPLDH--ESDDLNDMLQGS  727
             N  + K PG+  I N++   S RLDDWVLCRI+KK+NS   RP++   +S  +N+    S
Sbjct  144   NSAAKKTPGIAFIGNKT---SSRLDDWVLCRIFKKSNSGTTRPVEESMQSSPINNGYHNS  200

Query  726   IP  721
             IP
Sbjct  201   IP  202



>gb|AGZ20119.1| NAC transcription factor NAM-B1 [Triticum dicoccoides]
Length=405

 Score =   244 bits (624),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 167/368 (45%), Positives = 207/368 (56%), Gaps = 51/368 (14%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EELVVHYLKKK   AP+PV IIAEVDLYKFDPWELP KAT GEQEWYFFSPRDRKYPNGA
Sbjct  45    EELVVHYLKKKADKAPLPVNIIAEVDLYKFDPWELPEKATIGEQEWYFFSPRDRKYPNGA  104

Query  1068  RPNRAATSGYWKATGTDKPVLTAGG-----TQKVGVKKALVFYGGKPPKGVKTNWIMHEY  904
             RPNRAATSGYWKATGTDKP+L +G       +K+GVKKALVFY GKPPKG+KTNWIMHEY
Sbjct  105   RPNRAATSGYWKATGTDKPILASGTGCGLVREKLGVKKALVFYRGKPPKGLKTNWIMHEY  164

Query  903   RLAD----NKTSNKPPGLDIANRSKGGSLRLDDWVLCRIYKKNNSQRPLDHESD-DLNDM  739
             RL D       +N+PP +   +R+   SLRLDDWVLCRIYKK N     D + + +  D 
Sbjct  165   RLTDASGSTTATNRPPPVTGGSRA-AASLRLDDWVLCRIYKKINKAAAGDQQRNTECEDS  223

Query  738   LQGSIPPFVTHQKMGL-----KPSNYG--ALLQTDhhhhhhHMF---DQGLVPGDASLGG  589
             ++ ++  +  +   G+       SNY   +LL     H    +F   D GL  G  SL  
Sbjct  224   VEDAVTAYPLYATAGMTGAGAHGSNYASPSLLHHQDSHFLDGLFTADDAGLSAGATSLSH  283

Query  588   ARTAQLPFVPSTPNLLPTKRSLPGLFWNVDDSSANNHHPADASPPTKRFLADNNE-----  424
                A       T   L    S P   +N  D+S     P    P  + F   N       
Sbjct  284   LAAAARASPAPTKQFLAPSSSTP---FNWLDAS-----PVGILPQARNFPGFNRSRNVGN  335

Query  423   ASISRSDEQNG--------SIATLLSHLP-QTPSLHQQTML--------GALNDGVFRQP  295
              S+S + +  G        ++  + ++LP Q  + HQQ ++         A     F+ P
Sbjct  336   MSLSSTADMAGAVDNGGGNAVNAMSTYLPVQDGTYHQQHVILGAPLVPEAAAATSGFQHP  395

Query  294   YQVSGINW  271
              Q+SG+NW
Sbjct  396   VQISGVNW  403



>gb|AGZ20118.1| NAC transcription factor NAM-B1 [Triticum dicoccoides]
Length=405

 Score =   244 bits (623),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 167/368 (45%), Positives = 207/368 (56%), Gaps = 51/368 (14%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EELVVHYLKKK   AP+PV IIAEVDLYKFDPWELP KAT GEQEWYFFSPRDRKYPNGA
Sbjct  45    EELVVHYLKKKADKAPLPVNIIAEVDLYKFDPWELPEKATIGEQEWYFFSPRDRKYPNGA  104

Query  1068  RPNRAATSGYWKATGTDKPVLTAGG-----TQKVGVKKALVFYGGKPPKGVKTNWIMHEY  904
             RPNRAATSGYWKATGTDKP+L +G       +K+GVKKALVFY GKPPKG+KTNWIMHEY
Sbjct  105   RPNRAATSGYWKATGTDKPILASGTGCGLVREKLGVKKALVFYRGKPPKGLKTNWIMHEY  164

Query  903   RLAD----NKTSNKPPGLDIANRSKGGSLRLDDWVLCRIYKKNNSQRPLDHESD-DLNDM  739
             RL D       +N+PP +   +R+   SLRLDDWVLCRIYKK N     D + + +  D 
Sbjct  165   RLTDASGSTTATNRPPPVTGGSRA-AASLRLDDWVLCRIYKKINKAAAGDQQRNTECEDS  223

Query  738   LQGSIPPFVTHQKMGL-----KPSNYG--ALLQTDhhhhhhHMF---DQGLVPGDASLGG  589
             ++ ++  +  +   G+       SNY   +LL     H    +F   D GL  G  SL  
Sbjct  224   VEDAVTAYPLYATAGMTGAGAHGSNYASPSLLHHQDSHFLDGLFTADDAGLSAGATSLSH  283

Query  588   ARTAQLPFVPSTPNLLPTKRSLPGLFWNVDDSSANNHHPADASPPTKRFLADNNE-----  424
                A       T   L    S P   +N  D+S     P    P  + F   N       
Sbjct  284   LAAAARASPAPTKQFLAPSSSTP---FNWLDAS-----PVGILPQARNFPGFNRSRNVGN  335

Query  423   ASISRSDEQNG--------SIATLLSHLP-QTPSLHQQTML--------GALNDGVFRQP  295
              S+S + +  G        ++  + ++LP Q  + HQQ ++         A     F+ P
Sbjct  336   MSLSSTADMAGAVDNGGGNAVNAMSTYLPVQDGTYHQQHVILGAPLVPEAAAATSGFQHP  395

Query  294   YQVSGINW  271
              Q+SG+NW
Sbjct  396   VQISGVNW  403



>gb|AGZ20133.1| NAC transcription factor NAM-B1 [Triticum dicoccoides]
Length=405

 Score =   244 bits (623),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 167/368 (45%), Positives = 207/368 (56%), Gaps = 51/368 (14%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EELVVHYLKKK   AP+PV IIAEVDLYKFDPWELP KAT GEQEWYFFSPRDRKYPNGA
Sbjct  45    EELVVHYLKKKADEAPLPVNIIAEVDLYKFDPWELPEKATIGEQEWYFFSPRDRKYPNGA  104

Query  1068  RPNRAATSGYWKATGTDKPVLTAGG-----TQKVGVKKALVFYGGKPPKGVKTNWIMHEY  904
             RPNRAATSGYWKATGTDKP+L +G       +K+GVKKALVFY GKPPKG+KTNWIMHEY
Sbjct  105   RPNRAATSGYWKATGTDKPILASGTGCGLVREKLGVKKALVFYRGKPPKGLKTNWIMHEY  164

Query  903   RLAD----NKTSNKPPGLDIANRSKGGSLRLDDWVLCRIYKKNNSQRPLDHESD-DLNDM  739
             RL D       +N+PP +   +R+   SLRLDDWVLCRIYKK N     D + + +  D 
Sbjct  165   RLTDASGSTTATNRPPPVTGGSRA-AASLRLDDWVLCRIYKKINKAAAGDQQRNTECEDS  223

Query  738   LQGSIPPFVTHQKMGLK-----PSNYG--ALLQTDhhhhhhHMF---DQGLVPGDASLGG  589
             ++ ++  +  +   G+       SNY   +LL     H    +F   D GL  G  SL  
Sbjct  224   VEDAVTAYPLYATAGMTGAGAHGSNYASPSLLHHQDSHFLDGLFTADDAGLSAGATSLSH  283

Query  588   ARTAQLPFVPSTPNLLPTKRSLPGLFWNVDDSSANNHHPADASPPTKRFLADNNE-----  424
                A       T   L    S P   +N  D+S     P    P  + F   N       
Sbjct  284   LAAAARASPAPTKQFLAPSSSTP---FNWLDAS-----PVGILPQARNFPGFNRSRNVGN  335

Query  423   ASISRSDEQNG--------SIATLLSHLP-QTPSLHQQTML--------GALNDGVFRQP  295
              S+S + +  G        ++  + ++LP Q  + HQQ ++         A     F+ P
Sbjct  336   MSLSSTADMAGAVDNGGGNAVNAMSTNLPVQDGTYHQQHVILGAPLVPEAAAATSGFQHP  395

Query  294   YQVSGINW  271
              Q+SG+NW
Sbjct  396   VQISGVNW  403



>gb|AGZ20137.1| NAC transcription factor NAM-B1 [Triticum dicoccoides]
Length=405

 Score =   244 bits (622),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 166/368 (45%), Positives = 207/368 (56%), Gaps = 51/368 (14%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EELVVHYLKKK   AP+PV IIAEVDLYKFDPWELP KAT GEQEWYFFSPRDRKYPNGA
Sbjct  45    EELVVHYLKKKADKAPLPVNIIAEVDLYKFDPWELPEKATIGEQEWYFFSPRDRKYPNGA  104

Query  1068  RPNRAATSGYWKATGTDKPVLTAGG-----TQKVGVKKALVFYGGKPPKGVKTNWIMHEY  904
             RPNRAATSGYWKATGTDKP+L +G       +K+GVKKALVFY GKPP+G+KTNWIMHEY
Sbjct  105   RPNRAATSGYWKATGTDKPILASGTGCGLVREKLGVKKALVFYRGKPPEGLKTNWIMHEY  164

Query  903   RLAD----NKTSNKPPGLDIANRSKGGSLRLDDWVLCRIYKKNNSQRPLDHESD-DLNDM  739
             RL D       +N+PP +   +R+   SLRLDDWVLCRIYKK N     D + + +  D 
Sbjct  165   RLTDASGSTTATNRPPPVTGGSRA-AASLRLDDWVLCRIYKKINKAAAGDQQRNTECEDS  223

Query  738   LQGSIPPFVTHQKMGLK-----PSNYG--ALLQTDhhhhhhHMF---DQGLVPGDASLGG  589
             ++ ++  +  +   G+       SNY   +LL     H    +F   D GL  G  SL  
Sbjct  224   VEDAVTAYPLYATAGMTGAGAHGSNYASPSLLHHQDSHFLDGLFTADDAGLSAGATSLSH  283

Query  588   ARTAQLPFVPSTPNLLPTKRSLPGLFWNVDDSSANNHHPADASPPTKRFLADNNE-----  424
                A       T   L    S P   +N  D+S     P    P  + F   N       
Sbjct  284   LAAAARASPAPTKQFLAPSSSTP---FNWLDAS-----PVGILPQARNFPGFNRSRNVGN  335

Query  423   ASISRSDEQNG--------SIATLLSHLP-QTPSLHQQTML--------GALNDGVFRQP  295
              S+S + +  G        ++  + ++LP Q  + HQQ ++         A     F+ P
Sbjct  336   MSLSSTADMAGAVDNGGGNAVNAMSTYLPVQDGTYHQQHVILGAPLVPEAAAATSGFQHP  395

Query  294   YQVSGINW  271
              Q+SG+NW
Sbjct  396   VQISGVNW  403



>gb|AEI98789.1| NAC transcription factor NAM-G1 [Triticum timopheevii subsp. 
timopheevii]
Length=407

 Score =   243 bits (621),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 169/361 (47%), Positives = 204/361 (57%), Gaps = 37/361 (10%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EELVVHYLKKK   AP+PV IIAEVDLYKFDPWELP KATFGEQEWYFFSPRDRKYPNGA
Sbjct  47    EELVVHYLKKKAGKAPLPVTIIAEVDLYKFDPWELPEKATFGEQEWYFFSPRDRKYPNGA  106

Query  1068  RPNRAATSGYWKATGTDKPVLTAGG-----TQKVGVKKALVFYGGKPPKGVKTNWIMHEY  904
             RPNRAATSGYWKATGTDKP+L +G       +K+GVKKALVFY GKPPKG+KTNWIMHEY
Sbjct  107   RPNRAATSGYWKATGTDKPILASGTGCGLVREKLGVKKALVFYRGKPPKGLKTNWIMHEY  166

Query  903   RLAD---NKTSNKPPGLDIANRSKGGSLRLDDWVLCRIYKKNNSQRPLDHE-SDDLNDML  736
             RL D   + T+++PP           SLRLDDWVLCRIYKK N     D + S +  D +
Sbjct  167   RLTDASGSTTTSRPPPPVTGGSRAAASLRLDDWVLCRIYKKINKAAAGDQQRSTECEDSV  226

Query  735   QGSIPPFVTHQKMGLKP-----SNYG--ALLQTDhhhhhhHMF---DQGLVPGDASLGGA  586
             + ++  +  +   G+       SNY   +LL     H    +F   D GL  G  SL   
Sbjct  227   EDAVTAYPLYATAGMAGAGAHVSNYASPSLLHHQDSHFLDGLFTADDAGLSAGATSLSHL  286

Query  585   RTAQLPFVPSTPNLLPTKRSLPGLFWNVDDSSANNHHPADASPPTKRFLADNNEASISRS  406
               A       T   L    S P  F  +D S       A   P   R     N +  S +
Sbjct  287   AAAAWASPAPTKQFLAPSSSTP--FNWLDASPVGILSQARNFPGFNRSRNVGNMSLSSTA  344

Query  405   DE----QNG---SIATLLSHLP-QTPSLHQQTML--------GALNDGVFRQPYQVSGIN  274
             D      NG   ++  + ++LP Q  + HQQ ++         A     F+ P Q+SG+N
Sbjct  345   DMAGAVDNGGGNAVNAMSTYLPVQDGTYHQQHVILVAPLVPEAAAATSGFQHPVQISGVN  404

Query  273   W  271
             W
Sbjct  405   W  405



>gb|AEI98791.1| NAC transcription factor NAM-G1 [Triticum timopheevii subsp. 
timopheevii]
 gb|AEI98792.1| NAC transcription factor NAM-G1 [Triticum timopheevii subsp. 
timopheevii]
 gb|AEI98796.1| NAC transcription factor NAM-G1 [Triticum timopheevii subsp. 
timopheevii]
 gb|AEI98797.1| NAC transcription factor NAM-G1 [Triticum timopheevii subsp. 
timopheevii]
 gb|AEI98798.1| NAC transcription factor NAM-G1 [Triticum timopheevii subsp. 
timopheevii]
Length=407

 Score =   243 bits (621),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 169/361 (47%), Positives = 204/361 (57%), Gaps = 37/361 (10%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EELVVHYLKKK   AP+PV IIAEVDLYKFDPWELP KATFGEQEWYFFSPRDRKYPNGA
Sbjct  47    EELVVHYLKKKADKAPLPVTIIAEVDLYKFDPWELPEKATFGEQEWYFFSPRDRKYPNGA  106

Query  1068  RPNRAATSGYWKATGTDKPVLTAGG-----TQKVGVKKALVFYGGKPPKGVKTNWIMHEY  904
             RPNRAATSGYWKATGTDKP+L +G       +K+GVKKALVFY GKPPKG+KTNWIMHEY
Sbjct  107   RPNRAATSGYWKATGTDKPILASGTGCGLVREKLGVKKALVFYRGKPPKGLKTNWIMHEY  166

Query  903   RLAD---NKTSNKPPGLDIANRSKGGSLRLDDWVLCRIYKKNNSQRPLDHE-SDDLNDML  736
             RL D   + T+++PP           SLRLDDWVLCRIYKK N     D + S +  D +
Sbjct  167   RLTDASGSTTTSRPPPPVTGGSRAAASLRLDDWVLCRIYKKINKAAAGDQQRSTECEDSV  226

Query  735   QGSIPPFVTHQKMGLKP-----SNYG--ALLQTDhhhhhhHMF---DQGLVPGDASLGGA  586
             + ++  +  +   G+       SNY   +LL     H    +F   D GL  G  SL   
Sbjct  227   EDAVTAYPLYATAGMAGAGAHVSNYASPSLLHHQDSHFLDGLFTADDAGLSAGATSLSHL  286

Query  585   RTAQLPFVPSTPNLLPTKRSLPGLFWNVDDSSANNHHPADASPPTKRFLADNNEASISRS  406
               A       T   L    S P  F  +D S       A   P   R     N +  S +
Sbjct  287   AAAARASPAPTKQFLAPSSSTP--FNWLDASPVGILSQARNFPGFNRSRNVGNMSLSSTA  344

Query  405   DE----QNG---SIATLLSHLP-QTPSLHQQTML--------GALNDGVFRQPYQVSGIN  274
             D      NG   ++  + ++LP Q  + HQQ ++         A     F+ P Q+SG+N
Sbjct  345   DMAGAVDNGGGNAVNAMSTYLPVQDGTYHQQHVILGAPLVPEAAAATSGFQHPVQISGVN  404

Query  273   W  271
             W
Sbjct  405   W  405



>gb|AEI98795.1| NAC transcription factor NAM-G1 [Triticum timopheevii subsp. 
timopheevii]
Length=407

 Score =   243 bits (621),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 169/361 (47%), Positives = 204/361 (57%), Gaps = 37/361 (10%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EELVVHYLKKK   AP+PV IIAEVDLYKFDPWELP KATFGEQEWYFFSPRDRKYPNGA
Sbjct  47    EELVVHYLKKKADKAPLPVTIIAEVDLYKFDPWELPEKATFGEQEWYFFSPRDRKYPNGA  106

Query  1068  RPNRAATSGYWKATGTDKPVLTAGG-----TQKVGVKKALVFYGGKPPKGVKTNWIMHEY  904
             RPNRAATSGYWKATGTDKP+L +G       +K+GVKKALVFY GKPPKG+KTNWIMHEY
Sbjct  107   RPNRAATSGYWKATGTDKPILASGTGCGLVREKLGVKKALVFYRGKPPKGLKTNWIMHEY  166

Query  903   RLAD---NKTSNKPPGLDIANRSKGGSLRLDDWVLCRIYKKNNSQRPLDHE-SDDLNDML  736
             RL D   + T+++PP           SLRLDDWVLCRIYKK N     D + S +  D +
Sbjct  167   RLTDASGSTTTSRPPPPVTGGSRAAASLRLDDWVLCRIYKKINKAAAGDQQRSTECEDSV  226

Query  735   QGSIPPFVTHQKMGLKP-----SNYG--ALLQTDhhhhhhHMF---DQGLVPGDASLGGA  586
             + ++  +  +   G+       SNY   +LL     H    +F   D GL  G  SL   
Sbjct  227   EDAVTAYPLYATAGMAGAGAHVSNYASPSLLHHQDSHFLDGLFTADDAGLSAGATSLSHL  286

Query  585   RTAQLPFVPSTPNLLPTKRSLPGLFWNVDDSSANNHHPADASPPTKRFLADNNEASISRS  406
               A       T   L    S P  F  +D S       A   P   R     N +  S +
Sbjct  287   AAAARASPAPTKQFLAPSSSTP--FNWLDASPVGILSQARNFPGFNRSRNVGNMSLSSTA  344

Query  405   DE----QNG---SIATLLSHLP-QTPSLHQQTML--------GALNDGVFRQPYQVSGIN  274
             D      NG   ++  + ++LP Q  + HQQ ++         A     F+ P Q+SG+N
Sbjct  345   DMAGAVDNGGGNAVNAMSTYLPVQDGTYHQQHVILGAPLVPEAAAATSGFQHPVQISGVN  404

Query  273   W  271
             W
Sbjct  405   W  405



>ref|XP_003562891.1| PREDICTED: NAC transcription factor NAM-B2-like [Brachypodium 
distachyon]
Length=435

 Score =   244 bits (623),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 136/213 (64%), Positives = 153/213 (72%), Gaps = 19/213 (9%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EELVVHYLKKK A AP+PV IIAEVDLYKFDPWELP KATFGEQEWYFFSPRDRKYPNGA
Sbjct  41    EELVVHYLKKKAAKAPLPVTIIAEVDLYKFDPWELPEKATFGEQEWYFFSPRDRKYPNGA  100

Query  1068  RPNRAATSGYWKATGTDKPVLTAG-GTQKVGVKKALVFYGGKPPKGVKTNWIMHEYRLAD  892
             RPNRAATSGYWKATGTDKP++ +G   +KVGVKKALVFY GKPPKG+KTNWIMHEYRLAD
Sbjct  101   RPNRAATSGYWKATGTDKPIMASGCAREKVGVKKALVFYRGKPPKGLKTNWIMHEYRLAD  160

Query  891   NKTSNK-----PPGLDIANRSKGGSLRLDDWVLCRIYKKNN------SQRPLDHESDDLN  745
             + +S       PP +   +  +  SLRLDDWVLCRIYKK N       QR ++ E D + 
Sbjct  161   SSSSGATASRPPPVVAGGSGGRAASLRLDDWVLCRIYKKINKAAAGDQQRSMECE-DSVE  219

Query  744   DMLQGSIPPFVTHQKM------GLKPSNYGALL  664
             D +    P       M      G   +NY +LL
Sbjct  220   DAVAAYHPSSYAMAGMVGAGAHGGSNNNYTSLL  252



>ref|XP_006392856.1| hypothetical protein EUTSA_v10012308mg, partial [Eutrema salsugineum]
 gb|ESQ30142.1| hypothetical protein EUTSA_v10012308mg, partial [Eutrema salsugineum]
Length=283

 Score =   239 bits (610),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 124/158 (78%), Positives = 135/158 (85%), Gaps = 7/158 (4%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EELV+HYLK+K  S+P+PVAIIA+VDLYKFDPWELP KA FGEQEWYFFSPRDRKYPNGA
Sbjct  27    EELVIHYLKRKADSSPLPVAIIADVDLYKFDPWELPEKALFGEQEWYFFSPRDRKYPNGA  86

Query  1068  RPNRAATSGYWKATGTDKPVLTAG--GTQKVGVKKALVFYGGKPPKGVKTNWIMHEYRLA  895
             RPNRAATSGYWKATGTDKPV++ G  G +KVGVKKALVFY GKPPKGVK++WIMHEYRL 
Sbjct  87    RPNRAATSGYWKATGTDKPVISTGGDGNKKVGVKKALVFYSGKPPKGVKSDWIMHEYRLT  146

Query  894   DNKTSNKPPGLDIANRSKGGSLRLDDWVLCRIYKKNNS  781
             DNK     P L     +K  SLRLDDWVLCRIYKKNNS
Sbjct  147   DNK-----PSLRCDFGNKKNSLRLDDWVLCRIYKKNNS  179



>gb|AGZ20124.1| NAC transcription factor NAM-B1 [Triticum dicoccoides]
Length=405

 Score =   243 bits (620),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 166/368 (45%), Positives = 206/368 (56%), Gaps = 51/368 (14%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EELVVHYLKKK   AP+PV IIAEVDLYKFDPWELP KAT GEQEWYFFSPRDRKYPN A
Sbjct  45    EELVVHYLKKKADKAPLPVNIIAEVDLYKFDPWELPEKATIGEQEWYFFSPRDRKYPNSA  104

Query  1068  RPNRAATSGYWKATGTDKPVLTAGG-----TQKVGVKKALVFYGGKPPKGVKTNWIMHEY  904
             RPNRAATSGYWKATGTDKP+L +G       +K+GVKKALVFY GKPPKG+KTNWIMHEY
Sbjct  105   RPNRAATSGYWKATGTDKPILASGTGCGLVREKLGVKKALVFYRGKPPKGLKTNWIMHEY  164

Query  903   RLAD----NKTSNKPPGLDIANRSKGGSLRLDDWVLCRIYKKNNSQRPLDHESD-DLNDM  739
             RL D       +N+PP +   +R+   SLRLDDWVLCRIYKK N     D + + +  D 
Sbjct  165   RLTDASGSTTATNRPPPVTGGSRA-AASLRLDDWVLCRIYKKINKAAAGDQQRNTECEDS  223

Query  738   LQGSIPPFVTHQKMGLK-----PSNYG--ALLQTDhhhhhhHMF---DQGLVPGDASLGG  589
             ++ ++  +  +   G+       SNY   +LL     H    +F   D GL  G  SL  
Sbjct  224   VEDAVTAYPLYATAGMTGAGAHGSNYASPSLLHHQDSHFLDGLFTADDAGLSAGATSLSH  283

Query  588   ARTAQLPFVPSTPNLLPTKRSLPGLFWNVDDSSANNHHPADASPPTKRFLADNNE-----  424
                A       T   L    S P   +N  D+S     P    P  + F   N       
Sbjct  284   LAAAARASPAPTKQFLAPSSSTP---FNWLDAS-----PVGILPQARNFPGFNRSRNVGN  335

Query  423   ASISRSDEQNG--------SIATLLSHLP-QTPSLHQQTML--------GALNDGVFRQP  295
              S+S + +  G        ++  + ++LP Q  + HQQ ++         A     F+ P
Sbjct  336   MSLSSTADMAGAVDNGGGNAVNAMSTYLPVQDGTYHQQHVILGAPLVPEAAAATSGFQHP  395

Query  294   YQVSGINW  271
              Q+SG+NW
Sbjct  396   VQISGVNW  403



>gb|AGS08767.1| NAC domain protein [Malus hupehensis]
Length=393

 Score =   243 bits (619),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 130/162 (80%), Positives = 136/162 (84%), Gaps = 12/162 (7%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EELVVHYLKKK AS P+PV IIAEVDLYKFDPWELP+KATFGEQEWYFFSPRDRKYPNGA
Sbjct  70    EELVVHYLKKKAASIPLPVTIIAEVDLYKFDPWELPSKATFGEQEWYFFSPRDRKYPNGA  129

Query  1068  RPNRAATSGYWKATGTDKPVLTAGGTQKVGVKKALVFYGGKPPKGVKTNWIMHEYRLADN  889
             RPNRAATSGYWKATGTDKPVL++ G  KVGVKKALVFYGGKPPKG KTNWIMHEYRL +N
Sbjct  130   RPNRAATSGYWKATGTDKPVLSSIGNHKVGVKKALVFYGGKPPKGTKTNWIMHEYRLVNN  189

Query  888   KT--------SNKPPGLDIANRSKGGSLRLDDWVLCRIYKKN  787
              T        + KP   D AN  K  SLRLDDWVLCRIYKKN
Sbjct  190   TTTTINMSSSTTKPS--DAAN--KKPSLRLDDWVLCRIYKKN  227



>gb|AEI00650.1| NAC2 [Triticum aestivum]
Length=405

 Score =   242 bits (618),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 170/369 (46%), Positives = 206/369 (56%), Gaps = 52/369 (14%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EELVVHYLKKK A  P+PV IIAEVDLYKFDPWELP KATFGEQEWYFFSPRDRKYPNGA
Sbjct  44    EELVVHYLKKKAAKVPLPVTIIAEVDLYKFDPWELPEKATFGEQEWYFFSPRDRKYPNGA  103

Query  1068  RPNRAATSGYWKATGTDKPVLTAGG-----TQKVGVKKALVFYGGKPPKGVKTNWIMHEY  904
             RPNRAATSGYWKATGTDKP+L +G       +K+GVKKALVFY GKPPKG+KTNWIMHEY
Sbjct  104   RPNRAATSGYWKATGTDKPILASGTGCGLVREKLGVKKALVFYRGKPPKGLKTNWIMHEY  163

Query  903   RLAD---NKTSNKPPGLDIANRSKGGSLRLDDWVLCRIYKKNNSQRPLDHE-SDDLNDML  736
             RL D   + T+++PP           SLRLDDWVLCRIYKK N     D + S +  D +
Sbjct  164   RLTDASGSTTTSRPPPPVTGGSRAAASLRLDDWVLCRIYKKINKAAAGDQQRSTECEDSV  223

Query  735   QGSIPPFVTH-----QKMGLKPSNYG--ALLQTDhhhhhhHMF---DQGLVPGDASLGGA  586
             + ++  +  +        G   SNY   +LL     H    +F   D GL  G  SL   
Sbjct  224   EDAVTAYPLYATAGMAGAGAHGSNYASPSLLHHQDSHFLEGLFTADDAGLSAGATSLSHL  283

Query  585   RTAQLPFVPSTPNLLPTKRSLPGLFWNVDDSSANNHHPADASPPTKRFLADN---NEASI  415
               A       T   L    S P   +N  D+S     PA   P  + F   N   N  ++
Sbjct  284   AAAARASPAPTKQFLAPSSSTP---FNWLDAS-----PAGILPQARNFPGSNRSRNVGNM  335

Query  414   SRSDEQN---------GSIATLLSHLP-QTPSLHQQTML-----------GALNDGVFRQ  298
             S S   +          +++  ++ LP Q  + HQ  ++           G    G F+ 
Sbjct  336   SLSSTADMAGAAGNAVNAMSAFMNPLPVQDGTYHQHHVILGAPLAPEATTGGATSG-FQH  394

Query  297   PYQVSGINW  271
             P QVSG+NW
Sbjct  395   PVQVSGVNW  403



>sp|A2YMR0.1|NAC10_ORYSI RecName: Full=NAC transcription factor ONAC010 [Oryza sativa 
Indica Group]
 gb|EAZ04371.1| hypothetical protein OsI_26514 [Oryza sativa Indica Group]
Length=425

 Score =   243 bits (619),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 133/193 (69%), Positives = 145/193 (75%), Gaps = 13/193 (7%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EELVVHYLKKK AS P+PV IIAEVDLYKFDPWELP KA FGEQEWYFFSPRDRKYPNGA
Sbjct  40    EELVVHYLKKKAASVPLPVTIIAEVDLYKFDPWELPEKANFGEQEWYFFSPRDRKYPNGA  99

Query  1068  RPNRAATSGYWKATGTDKPVLTAGGT-QKVGVKKALVFYGGKPPKGVKTNWIMHEYRLAD  892
             RPNRAATSGYWKATGTDKP++ +G T +KVGVKKALVFY GKPPKGVKTNWIMHEYRL D
Sbjct  100   RPNRAATSGYWKATGTDKPIMASGSTREKVGVKKALVFYRGKPPKGVKTNWIMHEYRLTD  159

Query  891   NKTS------NKPPGLDIANRSKGG-SLRLDDWVLCRIYKKNN----SQRPLDHESDDLN  745
               +S       + P   I   S+G  SLRLDDWVLCRIYKK N     QR ++ E D + 
Sbjct  160   TSSSAAAVATTRQPPPPITGGSRGAVSLRLDDWVLCRIYKKTNKAGAGQRSMECE-DSVE  218

Query  744   DMLQGSIPPFVTH  706
             D +    P    H
Sbjct  219   DAVAAYAPSSQQH  231



>gb|AEI98793.1| NAC transcription factor NAM-G1 [Triticum timopheevii subsp. 
timopheevii]
Length=407

 Score =   242 bits (617),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 169/361 (47%), Positives = 202/361 (56%), Gaps = 37/361 (10%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EELVVHYLKKK   AP+PV IIAEVDLYKFDPWELP KATFGEQEWYFFSPRDRKYPNGA
Sbjct  47    EELVVHYLKKKADKAPLPVTIIAEVDLYKFDPWELPEKATFGEQEWYFFSPRDRKYPNGA  106

Query  1068  RPNRAATSGYWKATGTDKPVLTAGG-----TQKVGVKKALVFYGGKPPKGVKTNWIMHEY  904
             RPNRAATSGYWKATGTDKP+L +G       +K+GVKKALVFY GKPPKG+KTNWIMHEY
Sbjct  107   RPNRAATSGYWKATGTDKPILASGTGCGLVREKLGVKKALVFYRGKPPKGLKTNWIMHEY  166

Query  903   RLAD---NKTSNKPPGLDIANRSKGGSLRLDDWVLCRIYKKNNSQRPLDHE-SDDLNDML  736
             RL D   + T+++PP           SLRLDDWVLCRIYKK N     D + S +  D +
Sbjct  167   RLTDASGSTTTSRPPPPVTGGSRAAASLRLDDWVLCRIYKKINKAAAGDQQRSTECEDSV  226

Query  735   QGSIPPFVTHQKMGLKP-----SNYG--ALLQTDhhhhhhHMF---DQGLVPGDASLGGA  586
               ++  +  +   G+       SNY   +LL     H    +F   D GL  G  SL   
Sbjct  227   GDAVTAYPLYATAGMAGAGAHVSNYASPSLLHHQDSHFLDGLFTADDAGLSAGATSLSHL  286

Query  585   RTAQLPFVPSTPNLLPTKRSLPGLFWNVDDSSANNHHPADASPPTKRFLADNNEASISRS  406
               A       T   L    S P  F  +D S       A   P   R     N +  S +
Sbjct  287   AAAARASPAPTKQFLAPSSSTP--FNWLDASPVGILSQARNFPGFNRSRNVGNMSLSSTA  344

Query  405   ------DEQNGSIATLLS-HLP-QTPSLHQQTML--------GALNDGVFRQPYQVSGIN  274
                   D   G++   +S +LP Q  + HQQ ++         A     F+ P Q+SG+N
Sbjct  345   DMAGAVDNDGGNVVNAMSTYLPVQDGTYHQQHVILGAPLVPEAAAATSGFQHPVQISGVN  404

Query  273   W  271
             W
Sbjct  405   W  405



>gb|AEI98794.1| NAC transcription factor NAM-G1 [Triticum timopheevii subsp. 
timopheevii]
Length=407

 Score =   241 bits (616),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 168/361 (47%), Positives = 204/361 (57%), Gaps = 37/361 (10%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EELVVHYLKKK   AP+PV IIAEVDLYKFDPWELP KATFGEQEWYFFSPRDRKYPNGA
Sbjct  47    EELVVHYLKKKADKAPLPVTIIAEVDLYKFDPWELPEKATFGEQEWYFFSPRDRKYPNGA  106

Query  1068  RPNRAATSGYWKATGTDKPVLTAGG-----TQKVGVKKALVFYGGKPPKGVKTNWIMHEY  904
             RPNRAATSGYWKATGTDKP+L +G       +K+GVKKALVFY GKPPKG+KTNWIMHEY
Sbjct  107   RPNRAATSGYWKATGTDKPILASGTGCGLVREKLGVKKALVFYRGKPPKGLKTNWIMHEY  166

Query  903   RLAD---NKTSNKPPGLDIANRSKGGSLRLDDWVLCRIYKKNNSQRPLDHE-SDDLNDML  736
             RL D   + T+++PP           SLRLDDWVLCRIYKK N     D + S +  D +
Sbjct  167   RLTDASGSTTTSRPPPPVTGGSRAAASLRLDDWVLCRIYKKINKAAAGDQQRSTECEDSV  226

Query  735   QGSIPPFVTHQKMGLKP-----SNYG--ALLQTDhhhhhhHMF---DQGLVPGDASLGGA  586
             + ++  +  +   G+       SNY   +LL     H    +F   D GL  G  SL   
Sbjct  227   EDAVTAYPLYATAGMAGAGAHVSNYASPSLLHHQDSHFLDGLFTADDAGLSAGATSLSHL  286

Query  585   RTAQLPFVPSTPNLLPTKRSLPGLFWNVDDSSANNHHPADASPPTKRFLADNNEASISRS  406
               A       T   L    S P  F  +D S       A   P   R     N +  S +
Sbjct  287   AAAARASPAPTKQFLAPSSSTP--FNWLDASPVGILSQARNFPGFNRSRNVGNMSLSSTA  344

Query  405   DE----QNG---SIATLLSHLP-QTPSLHQQTML--------GALNDGVFRQPYQVSGIN  274
             D      NG   ++  + ++LP Q  + HQQ ++         A     F+ P Q+SG++
Sbjct  345   DMAGAVDNGGGNAVNAMSTYLPVQDGTYHQQHVILGAPLVPEAAAATSGFQHPVQISGVD  404

Query  273   W  271
             W
Sbjct  405   W  405



>gb|AEI98788.1| NAC transcription factor NAM-G1 [Triticum timopheevii subsp. 
timopheevii]
Length=407

 Score =   241 bits (616),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 168/361 (47%), Positives = 203/361 (56%), Gaps = 37/361 (10%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EELVVHYLKKK   AP+PV IIAEVDLYKFDPWELP KATFGEQEWYFFSPRDRKYPNGA
Sbjct  47    EELVVHYLKKKADKAPLPVTIIAEVDLYKFDPWELPEKATFGEQEWYFFSPRDRKYPNGA  106

Query  1068  RPNRAATSGYWKATGTDKPVLTAGG-----TQKVGVKKALVFYGGKPPKGVKTNWIMHEY  904
             RPNRAATSGYWKA GTDKP+L +G       +K+GVKKALVFY GKPPKG+KTNWIMHEY
Sbjct  107   RPNRAATSGYWKAAGTDKPILASGTGCGLVREKLGVKKALVFYRGKPPKGLKTNWIMHEY  166

Query  903   RLAD---NKTSNKPPGLDIANRSKGGSLRLDDWVLCRIYKKNNSQRPLDHE-SDDLNDML  736
             RL D   + T+++PP           SLRLDDWVLCRIYKK N     D + S +  D +
Sbjct  167   RLTDASGSTTTSRPPPPVTGGSRAAASLRLDDWVLCRIYKKINKAAAGDQQRSTECEDSV  226

Query  735   QGSIPPFVTHQKMGLKP-----SNYG--ALLQTDhhhhhhHMF---DQGLVPGDASLGGA  586
             + ++  +  +   G+       SNY   +LL     H    +F   D GL  G  SL   
Sbjct  227   EDAVTAYPLYATAGMAGAGAHVSNYASPSLLHHQDSHFLDGLFTADDAGLSAGATSLSHL  286

Query  585   RTAQLPFVPSTPNLLPTKRSLPGLFWNVDDSSANNHHPADASPPTKRFLADNNEASISRS  406
               A       T   L    S P  F  +D S       A   P   R     N +  S +
Sbjct  287   AAAARASPAPTKQFLAPSSSTP--FNWLDASPVGILSQARNFPGFNRSRNVGNMSLSSTA  344

Query  405   DE----QNG---SIATLLSHLP-QTPSLHQQTML--------GALNDGVFRQPYQVSGIN  274
             D      NG   ++  + ++LP Q  + HQQ ++         A     F+ P Q+SG+N
Sbjct  345   DMAGAVDNGGGNAVNAMSTYLPVQDGTYHQQHVILGAPLVPEAAAATSGFQHPVQISGVN  404

Query  273   W  271
             W
Sbjct  405   W  405



>ref|XP_009593583.1| PREDICTED: NAC transcription factor 25 isoform X1 [Nicotiana 
tomentosiformis]
Length=269

 Score =   237 bits (604),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 121/174 (70%), Positives = 140/174 (80%), Gaps = 10/174 (6%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EELVVHYL+KKVASAP+ V IIAEV LYKFDPWELP+KA FGEQEWYFFSPRDRKYPNGA
Sbjct  26    EELVVHYLEKKVASAPLSVTIIAEVHLYKFDPWELPSKANFGEQEWYFFSPRDRKYPNGA  85

Query  1068  RPNRAATSGYWKATGTDKPVLTAGGTQKVGVKKALVFYGGKPPKGVKTNWIMHEYRLADN  889
             RPNRAATSGYWKATGTDKP+ T+ GT+K+GVKK L+FY GKP KG+K+NW+MHEYRL DN
Sbjct  86    RPNRAATSGYWKATGTDKPIFTSNGTKKIGVKKTLIFYRGKPLKGMKSNWVMHEYRLVDN  145

Query  888   KTSNKPPGLDIANRSKGGSLRLDDWVLCRIYKKNNSQRPLDHESDDLNDMLQGS  727
              +S           +K  SLRLDDWVLCRIYKKN+S   ++ + +D  +   GS
Sbjct  146   NSS----------LTKKCSLRLDDWVLCRIYKKNSSSTIMEMDKEDSIEDTTGS  189



>gb|AGZ20129.1| NAC transcription factor NAM-B1 [Triticum dicoccoides]
 gb|AGZ20131.1| NAC transcription factor NAM-B1 [Triticum dicoccoides]
Length=405

 Score =   241 bits (615),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 167/368 (45%), Positives = 205/368 (56%), Gaps = 51/368 (14%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EELVVHYLKKK   AP+PV IIAEVDLYKFDPWELP KAT GEQEWYFFSPRDRKYPNGA
Sbjct  45    EELVVHYLKKKADKAPLPVNIIAEVDLYKFDPWELPEKATIGEQEWYFFSPRDRKYPNGA  104

Query  1068  RPNRAATSGYWKATGTDKPVLTAGG-----TQKVGVKKALVFYGGKPPKGVKTNWIMHEY  904
             RPNRAATSGYWKATGTDKP+L +G       +K+GVKKALVFY GKPPKG+KTNWIMHEY
Sbjct  105   RPNRAATSGYWKATGTDKPILASGTGCGLVREKLGVKKALVFYRGKPPKGLKTNWIMHEY  164

Query  903   RLAD----NKTSNKPPGLDIANRSKGGSLRLDDWVLCRIYKKNNSQRPLDHE-SDDLNDM  739
             RL D       +N+PP +   +R+   SLRLDDWVLCRIYKK N     D + S +  D 
Sbjct  165   RLTDASGSTTATNRPPPVTGGSRA-AASLRLDDWVLCRIYKKINKAAAGDQQRSTECEDS  223

Query  738   LQGSIPPFVTH-----QKMGLKPSNYG--ALLQTDhhhhhhHMF---DQGLVPGDASLGG  589
             ++ ++  +  +            SNY   +LL     H    +F   D GL  G  SL  
Sbjct  224   VEDAVTAYPLYATAGMAGAAAHGSNYASPSLLHHQDSHFLDGLFTADDAGLSAGATSLRH  283

Query  588   ARTAQLPFVPSTPNLLPTKRSLPGLFWNVDDSSANNHHPADASPPTKRFLADNNE-----  424
                A       T   L    S P   +N  D+S     P    P  + F   N       
Sbjct  284   LAAAARASPAPTKQFLAPSSSTP---FNWLDAS-----PVGILPQARNFPGFNRSRNVGN  335

Query  423   ASISRSDEQNG--------SIATLLSHLP-QTPSLHQQTML--------GALNDGVFRQP  295
              S+S + +  G        ++  + ++LP Q  + HQQ ++         A     F+ P
Sbjct  336   MSLSSTADMAGAVDNGGGNAVNAMSTYLPVQDGTYHQQHVILGAPLVPEAAAATSGFQHP  395

Query  294   YQVSGINW  271
              Q+SG+NW
Sbjct  396   VQISGVNW  403



>sp|A0SPJ3.1|NAMA1_TRITD RecName: Full=NAC transcription factor NAM-A1; Short=TtNAM-A1 
[Triticum turgidum subsp. durum]
 gb|ABI94352.1| NAC transcription factor NAM-A1 [Triticum turgidum subsp. durum]
Length=405

 Score =   241 bits (615),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 170/369 (46%), Positives = 206/369 (56%), Gaps = 52/369 (14%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EELVVHYLKKK A  P+PV IIAEVDLYKFDPWELP KATFGEQEWYFFSPRDRKYPNGA
Sbjct  44    EELVVHYLKKKAAKVPLPVTIIAEVDLYKFDPWELPEKATFGEQEWYFFSPRDRKYPNGA  103

Query  1068  RPNRAATSGYWKATGTDKPVLTAGG-----TQKVGVKKALVFYGGKPPKGVKTNWIMHEY  904
             RPNRAATSGYWKATGTDKP+L +G       +K+GVKKALVFY GKPPKG+KTNWIMHEY
Sbjct  104   RPNRAATSGYWKATGTDKPILASGTGCGLVREKLGVKKALVFYRGKPPKGLKTNWIMHEY  163

Query  903   RLAD---NKTSNKPPGLDIANRSKGGSLRLDDWVLCRIYKKNNSQRPLDHE-SDDLNDML  736
             RL D   + T+++PP           SLRLDDWVLCRIYKK N     D + S +  D +
Sbjct  164   RLTDVSGSTTTSRPPPPVTGGSRAAASLRLDDWVLCRIYKKINKAAAGDQQRSTECEDSV  223

Query  735   QGSIPPFVTH-----QKMGLKPSNYG--ALLQTDhhhhhhHMF---DQGLVPGDASLGGA  586
             + ++  +  +        G   SNY   +LL     H    +F   D GL  G  SL   
Sbjct  224   EDAVTAYPLYATAGMAGAGAHGSNYASPSLLHHQDSHFLEGLFTADDAGLSAGATSLSHL  283

Query  585   RTAQLPFVPSTPNLLPTKRSLPGLFWNVDDSSANNHHPADASPPTKRFLADN---NEASI  415
               A       T   L    S P   +N  D+S     PA   P  + F   N   N  ++
Sbjct  284   AAAARASPAPTKQFLAPSSSTP---FNWLDAS-----PAGILPQARNFPGFNRSRNVGNM  335

Query  414   SRSDEQN---------GSIATLLSHLP-QTPSLHQQTML-----------GALNDGVFRQ  298
             S S   +          +++  ++ LP Q  + HQ  ++           G    G F+ 
Sbjct  336   SLSSTADMAGAAGNAVNAMSAFMNPLPVQDGTYHQHHVILGAPLAPEATTGGATSG-FQH  394

Query  297   PYQVSGINW  271
             P QVSG+NW
Sbjct  395   PVQVSGVNW  403



>gb|AEI98787.1| NAC transcription factor NAM-G1 [Triticum timopheevii subsp. 
timopheevii]
Length=407

 Score =   241 bits (615),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 168/361 (47%), Positives = 203/361 (56%), Gaps = 37/361 (10%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EELVVHYLKKK   AP+PV IIAEVDLYKFDPWELP KATFGEQEWYFFSPRDRKYPNGA
Sbjct  47    EELVVHYLKKKADKAPLPVTIIAEVDLYKFDPWELPEKATFGEQEWYFFSPRDRKYPNGA  106

Query  1068  RPNRAATSGYWKATGTDKPVLTAGG-----TQKVGVKKALVFYGGKPPKGVKTNWIMHEY  904
             RPNRAATSGYWKATGTDKP+L +G       +K+GVKKALV Y GKPPKG+KTNWIMHEY
Sbjct  107   RPNRAATSGYWKATGTDKPILASGTGCGLVREKLGVKKALVLYRGKPPKGLKTNWIMHEY  166

Query  903   RLAD---NKTSNKPPGLDIANRSKGGSLRLDDWVLCRIYKKNNSQRPLDHE-SDDLNDML  736
             RL D   + T+++PP           SLRLDDWVLCRIYKK N     D + S +  D +
Sbjct  167   RLTDASGSTTTSRPPPPVTGGSRAAASLRLDDWVLCRIYKKINKAAAGDQQRSTECEDSV  226

Query  735   QGSIPPFVTHQKMGLKP-----SNYG--ALLQTDhhhhhhHMF---DQGLVPGDASLGGA  586
             + ++  +  +   G+       SNY   +LL     H    +F   D GL  G  SL   
Sbjct  227   EDAVTAYPLYATAGMAGAGAHVSNYASPSLLHHQDSHFLDGLFTADDAGLSAGATSLSHL  286

Query  585   RTAQLPFVPSTPNLLPTKRSLPGLFWNVDDSSANNHHPADASPPTKRFLADNNEASISRS  406
               A       T   L    S P  F  +D S       A   P   R     N +  S +
Sbjct  287   AAAARASPAPTKQFLAPSSSTP--FNWLDASPVGILSQARNFPGFNRSRNVGNMSLSSTA  344

Query  405   DE----QNG---SIATLLSHLP-QTPSLHQQTML--------GALNDGVFRQPYQVSGIN  274
             D      NG   ++  + ++LP Q  + HQQ ++         A     F+ P Q+SG+N
Sbjct  345   DMAGAVDNGGGNAVNAMSTYLPVQDGTYHQQHVILGAPLVPEAAAATSGFQHPVQISGVN  404

Query  273   W  271
             W
Sbjct  405   W  405



>gb|AEH68227.1| NAC transcription factor [Triticum aestivum]
 gb|AIZ97664.1| NAC transcription factor NAM-A1 [Triticum aestivum]
Length=405

 Score =   241 bits (615),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 170/369 (46%), Positives = 206/369 (56%), Gaps = 52/369 (14%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EELVVHYLKKK A  P+PV IIAEVDLYKFDPWELP KATFGEQEWYFFSPRDRKYPNGA
Sbjct  44    EELVVHYLKKKAAKVPLPVTIIAEVDLYKFDPWELPEKATFGEQEWYFFSPRDRKYPNGA  103

Query  1068  RPNRAATSGYWKATGTDKPVLTAGG-----TQKVGVKKALVFYGGKPPKGVKTNWIMHEY  904
             RPNRAATSGYWKATGTDKP+L +G       +K+GVKKALVFY GKPPKG+KTNWIMHEY
Sbjct  104   RPNRAATSGYWKATGTDKPILASGTGCGLVREKLGVKKALVFYRGKPPKGLKTNWIMHEY  163

Query  903   RLAD---NKTSNKPPGLDIANRSKGGSLRLDDWVLCRIYKKNNSQRPLDHE-SDDLNDML  736
             RL D   + T+++PP           SLRLDDWVLCRIYKK N     D + S +  D +
Sbjct  164   RLTDASGSTTTSRPPPPVTGGSRAAASLRLDDWVLCRIYKKINKAAAGDQQRSTECEDSV  223

Query  735   QGSIPPFVTH-----QKMGLKPSNYG--ALLQTDhhhhhhHMF---DQGLVPGDASLGGA  586
             + ++  +  +        G   SNY   +LL     H    +F   D GL  G  SL   
Sbjct  224   EDAVTAYPLYATAGMAGAGAHGSNYASPSLLHHQDSHFLEGLFTADDAGLSAGATSLSHL  283

Query  585   RTAQLPFVPSTPNLLPTKRSLPGLFWNVDDSSANNHHPADASPPTKRFLADN---NEASI  415
               A       T   L    S P   +N  D+S     PA   P  + F   N   N  ++
Sbjct  284   AAAARASPAPTKQFLAPSSSTP---FNWLDAS-----PAGILPQARNFPGFNRSRNVGNM  335

Query  414   SRSDEQN---------GSIATLLSHLP-QTPSLHQQTML-----------GALNDGVFRQ  298
             S S   +          +++  ++ LP Q  + HQ  ++           G    G F+ 
Sbjct  336   SLSSTADMAGAAGNAVNAMSAFMNPLPVQDGTYHQHHVILGAPLAPEATTGGATSG-FQH  394

Query  297   PYQVSGINW  271
             P QVSG+NW
Sbjct  395   PVQVSGVNW  403



>ref|NP_001060017.1| Os07g0566500 [Oryza sativa Japonica Group]
 sp|Q8H4S4.1|NAC10_ORYSJ RecName: Full=NAC transcription factor ONAC010 [Oryza sativa 
Japonica Group]
 dbj|BAC22555.1| putative OsNAC5 protein [Oryza sativa Japonica Group]
 dbj|BAC55651.1| putative OsNAC5 protein [Oryza sativa Japonica Group]
 dbj|BAF21931.1| Os07g0566500 [Oryza sativa Japonica Group]
 gb|EAZ40329.1| hypothetical protein OsJ_24777 [Oryza sativa Japonica Group]
Length=425

 Score =   241 bits (616),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 133/193 (69%), Positives = 146/193 (76%), Gaps = 13/193 (7%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EELVVHYLKKK AS P+PV IIAEVDLYKFDPW+LP KA FGEQEWYFFSPRDRKYPNGA
Sbjct  40    EELVVHYLKKKAASVPLPVTIIAEVDLYKFDPWDLPEKANFGEQEWYFFSPRDRKYPNGA  99

Query  1068  RPNRAATSGYWKATGTDKPVLTAGGT-QKVGVKKALVFYGGKPPKGVKTNWIMHEYRLAD  892
             RPNRAATSGYWKATGTDKP++++G T +KVGVKKALVFY GKPPKGVKTNWIMHEYRL D
Sbjct  100   RPNRAATSGYWKATGTDKPIMSSGSTREKVGVKKALVFYRGKPPKGVKTNWIMHEYRLTD  159

Query  891   NKTS------NKPPGLDIANRSKGG-SLRLDDWVLCRIYKKNN----SQRPLDHESDDLN  745
               +S       + P   I   SKG  SLRLDDWVLCRIYKK N     QR ++ E D + 
Sbjct  160   TSSSAAAVATTRRPPPPITGGSKGAVSLRLDDWVLCRIYKKTNKAGAGQRSMECE-DSVE  218

Query  744   DMLQGSIPPFVTH  706
             D +    P    H
Sbjct  219   DAVAAYAPSSQQH  231



>ref|XP_002463039.1| hypothetical protein SORBIDRAFT_02g036620 [Sorghum bicolor]
 gb|EER99560.1| hypothetical protein SORBIDRAFT_02g036620 [Sorghum bicolor]
Length=418

 Score =   241 bits (615),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 132/178 (74%), Positives = 146/178 (82%), Gaps = 8/178 (4%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EELVVHYLKKK AS P+PVAIIAEVDLYKFDPWELP KATFGEQEWYFFSPRDRKYPNGA
Sbjct  38    EELVVHYLKKKAASVPLPVAIIAEVDLYKFDPWELPDKATFGEQEWYFFSPRDRKYPNGA  97

Query  1068  RPNRAATSGYWKATGTDKPVLTAGGT-QKVGVKKALVFYGGKPPKGVKTNWIMHEYRLAD  892
             RPNRAATSGYWKATGTDKP++ +GG  +KVGVKKALVFY GKPPKG+KTNWIMHEYRLAD
Sbjct  98    RPNRAATSGYWKATGTDKPIMASGGNREKVGVKKALVFYRGKPPKGLKTNWIMHEYRLAD  157

Query  891   --NKTSNKPPGLDIANRSKGGSLRLDDWVLCRIYKKNN----SQRPLDHESDDLNDML  736
               + T+++PP        K  SLRLDDWVLCRIYKK N     +R +D E D + D +
Sbjct  158   AASSTTSRPPPPCNVGGGKATSLRLDDWVLCRIYKKINKLGAGERSMDCE-DSVEDAV  214



>gb|AGZ20135.1| NAC transcription factor NAM-B1 [Triticum dicoccoides]
Length=405

 Score =   240 bits (613),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 167/368 (45%), Positives = 205/368 (56%), Gaps = 51/368 (14%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EELVVHYLKKK   AP+PV IIAEVDLYKFDPWELP KAT GEQEWYFFSPRDRKYPNGA
Sbjct  45    EELVVHYLKKKADKAPLPVNIIAEVDLYKFDPWELPEKATIGEQEWYFFSPRDRKYPNGA  104

Query  1068  RPNRAATSGYWKATGTDKPVLTAGG-----TQKVGVKKALVFYGGKPPKGVKTNWIMHEY  904
             RPNRAATSGYWKATGTDKP+L +G       +K+GVKKALVFY GKPPKG+KTNWIMHEY
Sbjct  105   RPNRAATSGYWKATGTDKPILASGTGCGLVREKLGVKKALVFYRGKPPKGLKTNWIMHEY  164

Query  903   RLAD----NKTSNKPPGLDIANRSKGGSLRLDDWVLCRIYKKNNSQRPLDHE-SDDLNDM  739
             RL D       +N+PP +   +R+   SLRLDDWVLCRIYKK N     D + S +  D 
Sbjct  165   RLTDASGSTTATNRPPPVTGGSRA-AASLRLDDWVLCRIYKKINKAAAGDQQRSTECEDS  223

Query  738   LQGSIPPFVTH-----QKMGLKPSNYG--ALLQTDhhhhhhHMF---DQGLVPGDASLGG  589
             ++ ++  +  +            SNY   +LL     H    +F   D GL  G  SL  
Sbjct  224   VEDAVTAYPLYATAGMAGAAAHGSNYASPSLLHHQDSHFLDGLFTADDAGLSAGATSLRH  283

Query  588   ARTAQLPFVPSTPNLLPTKRSLPGLFWNVDDSSANNHHPADASPPTKRFLADNNE-----  424
                A       T   L    S P   +N  D+S     P    P  + F   N       
Sbjct  284   LAAAARASPAPTKQFLAPSSSTP---FNWLDAS-----PVGILPQARNFPGFNRSRNVGN  335

Query  423   ASISRSDEQNG--------SIATLLSHLP-QTPSLHQQTML--------GALNDGVFRQP  295
              S+S + +  G        ++  + ++LP Q  + HQQ ++         A     F+ P
Sbjct  336   MSLSSTADMAGAVDNGGGNAVNAMSTYLPVQDGTYHQQHVILGAPLVPEAAAATSGFQHP  395

Query  294   YQVSGINW  271
              Q+SG+NW
Sbjct  396   VQISGVNW  403



>gb|AGH32788.1| NAC transcription factor NAM-B1 [Triticum ispahanicum]
Length=405

 Score =   240 bits (613),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 165/368 (45%), Positives = 206/368 (56%), Gaps = 51/368 (14%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EELVVHYLKKK   AP+PV IIAEVDLYKFDPWELP KAT GE+EWYFFSPRDRKYPNGA
Sbjct  45    EELVVHYLKKKADKAPLPVNIIAEVDLYKFDPWELPEKATIGEREWYFFSPRDRKYPNGA  104

Query  1068  RPNRAATSGYWKATGTDKPVLTAGG-----TQKVGVKKALVFYGGKPPKGVKTNWIMHEY  904
             RPNRAATSGYWKATGTDKP+L +G       +K+GVKKALVFY GKPPKG+KTNWIMHEY
Sbjct  105   RPNRAATSGYWKATGTDKPILASGTGCGLVREKLGVKKALVFYRGKPPKGLKTNWIMHEY  164

Query  903   RLAD----NKTSNKPPGLDIANRSKGGSLRLDDWVLCRIYKKNNSQRPLDHESD-DLNDM  739
             RL D       +N+PP +   +R+   SLRLDDWVLCRIYKK N     D + + +  D 
Sbjct  165   RLTDASGSTTATNRPPPVTGGSRA-AASLRLDDWVLCRIYKKINKAAAGDQQRNTECEDS  223

Query  738   LQGSIPPFVTHQKMGLK-----PSNYG--ALLQTDhhhhhhHMF---DQGLVPGDASLGG  589
             ++ ++  +  +   G+       SNY   +LL     H    +F   D GL  G  SL  
Sbjct  224   VEDAVTAYPLYATAGMTGAGAHGSNYASPSLLHHQDSHFLDGLFTADDAGLSAGATSLSH  283

Query  588   ARTAQLPFVPSTPNLLPTKRSLPGLFWNVDDSSANNHHPADASPPTKRFLADNNE-----  424
                A       T   L    S P   +N  D+S     P    P  + F   N       
Sbjct  284   LAAAARASPAPTKQFLAPSSSTP---FNWLDAS-----PVGILPQARNFPGFNRSRNVGN  335

Query  423   ASISRSDEQNG--------SIATLLSHL-PQTPSLHQQTML--------GALNDGVFRQP  295
              S+S + +  G        ++  + ++L  Q  + HQQ ++         A     F+ P
Sbjct  336   MSLSSTADMAGAVDNGGGNAVNAMSTYLRVQDGTYHQQHVILGAPLVPEAAAATSGFQHP  395

Query  294   YQVSGINW  271
              Q+SG+NW
Sbjct  396   VQISGVNW  403



>ref|XP_010545895.1| PREDICTED: NAC domain-containing protein 18-like, partial [Tarenaya 
hassleriana]
Length=305

 Score =   237 bits (604),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 149/329 (45%), Positives = 193/329 (59%), Gaps = 54/329 (16%)
 Frame = -2

Query  1164  KFDPWEL--PAKATFGEQEWYFFSPRDRKYPNGARPNRAATSGYWKATGTDKPVLTAGGT  991
             KF+ W++   AKA+FGE EWYFFSPRDRKYPNGARPNRAATSGYWKATGTDKP+L++GG+
Sbjct  2     KFEFWDVGFVAKASFGEHEWYFFSPRDRKYPNGARPNRAATSGYWKATGTDKPILSSGGS  61

Query  990   QKVGVKKALVFYGGKPPKGVKTNWIMHEYRLADNKTSNKPPGLDIANRSKGGSLRLDDWV  811
              KVGVKKALVFYGGKPPKGVKT+WIMHEYRLADNK++N+PP  D  N  K  SLRLDDWV
Sbjct  62    HKVGVKKALVFYGGKPPKGVKTDWIMHEYRLADNKSNNRPPVFDFGN--KKNSLRLDDWV  119

Query  810   LCRIYKKNNSQRPLDHESDDLNDMLQG--SIPPFVT-----HQKMGLKP---SNYGALLQ  661
             LCRIYKKNN+ R +D++ DD+ D +     IPP ++       +M   P   SN+G +  
Sbjct  120   LCRIYKKNNTGRHVDNDKDDMIDDMMIFRQIPPSISSGLNVSGRMNFFPARVSNFG-IFS  178

Query  660   TDhhhhhhHMFDQGLVPGD-----------------ASLGGARTAQLPFVPSTPNLLPTK  532
              + +     +++  +  G+                 AS       +LP + +T      K
Sbjct  179   DNVNDVPSSLYESVISSGNVTDTMNHNSDTNVGLNLASSSSGSKPELPMMTTT-----VK  233

Query  531   RSLPGLFWNVDDSSANNHHPADASPPTKRFLADNNEASISRSDEQNGSIATLLSHLPQTP  352
             + +P  +W    +       AD S P K F                G  + + S L Q P
Sbjct  234   QCIPPPYWPTAAAEEEEEVAADES-PGKCF--------------HGGECSNISSMLAQAP  278

Query  351   SLHQQTMLGALNDGVFRQPYQVSGINWYS  265
              L  Q   G L +G++R  YQ+ G+NWYS
Sbjct  279   PLMTQQ--GMLGEGLYRTSYQLHGLNWYS  305



>gb|AEI98790.1| NAC transcription factor NAM-G1 [Triticum timopheevii subsp. 
timopheevii]
Length=407

 Score =   240 bits (612),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 168/361 (47%), Positives = 203/361 (56%), Gaps = 37/361 (10%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EELVVHYLKKK   AP+PV IIAEVDLYKFDPWELP KATFGEQEWYFFSPRDRKYPNGA
Sbjct  47    EELVVHYLKKKADKAPLPVTIIAEVDLYKFDPWELPEKATFGEQEWYFFSPRDRKYPNGA  106

Query  1068  RPNRAATSGYWKATGTDKPVLTAGG-----TQKVGVKKALVFYGGKPPKGVKTNWIMHEY  904
             R NRAATSGYWKATGTDKP+L +G       +K+GVKKALVFY GKPPKG+KTNWIMHEY
Sbjct  107   RLNRAATSGYWKATGTDKPILASGTGCGLVREKLGVKKALVFYRGKPPKGLKTNWIMHEY  166

Query  903   RLAD---NKTSNKPPGLDIANRSKGGSLRLDDWVLCRIYKKNNSQRPLDHE-SDDLNDML  736
             RL D   + T+++PP           SLRLDDWVLCRIYKK N     D + S +  D +
Sbjct  167   RLTDASGSTTTSRPPPPVTGGSRAAASLRLDDWVLCRIYKKINKAAAGDQQRSTECEDSV  226

Query  735   QGSIPPFVTHQKMGLKP-----SNYG--ALLQTDhhhhhhHMF---DQGLVPGDASLGGA  586
             + ++  +  +   G+       SNY   +LL     H    +F   D GL  G  SL   
Sbjct  227   EDAVTAYPLYATAGMAGAGAHVSNYASPSLLHHQDSHFLDGLFTADDAGLSAGATSLSHL  286

Query  585   RTAQLPFVPSTPNLLPTKRSLPGLFWNVDDSSANNHHPADASPPTKRFLADNNEASISRS  406
               A       T   L    S P  F  +D S       A   P   R     N +  S +
Sbjct  287   AAAARASPAPTKQFLAPSSSTP--FNWLDASPVGILSQARNFPGFNRSRNVGNMSLSSTA  344

Query  405   DE----QNG---SIATLLSHLP-QTPSLHQQTML--------GALNDGVFRQPYQVSGIN  274
             D      NG   ++  + ++LP Q  + HQQ ++         A     F+ P Q+SG+N
Sbjct  345   DMAGAVDNGGGNAVNAMSTYLPVQDGTYHQQHVILGAPLVPEAAAATSGFQHPVQISGVN  404

Query  273   W  271
             W
Sbjct  405   W  405



>ref|XP_006305156.1| hypothetical protein CARUB_v10009524mg, partial [Capsella rubella]
 gb|EOA38054.1| hypothetical protein CARUB_v10009524mg, partial [Capsella rubella]
Length=363

 Score =   238 bits (608),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 124/158 (78%), Positives = 137/158 (87%), Gaps = 7/158 (4%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EELV+HYLK+K  S P+PV+IIA+VDLYKFDPWELPAKA+FGEQEWYFFSPRDRKYPNGA
Sbjct  65    EELVIHYLKRKADSVPLPVSIIADVDLYKFDPWELPAKASFGEQEWYFFSPRDRKYPNGA  124

Query  1068  RPNRAATSGYWKATGTDKPVLTAGG--TQKVGVKKALVFYGGKPPKGVKTNWIMHEYRLA  895
             RPNRAATSGYWKATGTDKPV++ GG   +KVGVKKALVFY GKPPKGVK++WIMHEYRL 
Sbjct  125   RPNRAATSGYWKATGTDKPVISTGGGVNKKVGVKKALVFYSGKPPKGVKSDWIMHEYRLT  184

Query  894   DNKTSNKPPGLDIANRSKGGSLRLDDWVLCRIYKKNNS  781
             DNK ++     D  N  K  SLRLDDWVLCRIYKKNNS
Sbjct  185   DNKPNHI---CDFGN--KKNSLRLDDWVLCRIYKKNNS  217



>gb|AFD54037.1| NAC transcription factor NAM-1 [Aegilops searsii]
Length=405

 Score =   239 bits (610),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 169/368 (46%), Positives = 206/368 (56%), Gaps = 50/368 (14%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EELVVHYLKKK A  P+PV IIAEVDLYKFDPWELP KATFGEQEWYFFSPRDRKYPNGA
Sbjct  44    EELVVHYLKKKAAKVPLPVTIIAEVDLYKFDPWELPEKATFGEQEWYFFSPRDRKYPNGA  103

Query  1068  RPNRAATSGYWKATGTDKPVLTAGG-----TQKVGVKKALVFYGGKPPKGVKTNWIMHEY  904
             RPNRAATSGYWKATGTDKP+L +G       +K+GVKKALVFY GKPPKG+KTNWIMHEY
Sbjct  104   RPNRAATSGYWKATGTDKPILASGTGCGLVREKLGVKKALVFYRGKPPKGLKTNWIMHEY  163

Query  903   RLAD---NKTSNKPPGLDIANRSKGGSLRLDDWVLCRIYKKNNSQRPLDHE-SDDLNDML  736
             RL D   + T+++PP           SLRLDDWVLCRIYKK N     D + S +  D +
Sbjct  164   RLTDASGSTTASRPPPPVTGGSRAAASLRLDDWVLCRIYKKINKAAAGDQQRSIECEDSV  223

Query  735   QGSIPPFVTH-----QKMGLKPSNYG--ALLQTDhhhhhhHMF---DQGLVPGDASLGGA  586
             + ++  +  +        G   SNY   +LL     H    +F   D G+  G  SL   
Sbjct  224   EDAVTAYPLYATAGMAGAGAHGSNYASSSLLHHQDSHFLDGLFTADDAGISAGATSLSHL  283

Query  585   RTAQLPFVPSTPNLLPTKRSLPGLFWNVDDSSANNHHPADASPPTKRFLADN---NEASI  415
               A       T   L    S P   +N  D+S     PA   P  + F   N   N  ++
Sbjct  284   AAAARASPAPTKQFLAPSSSTP---FNWLDAS-----PAGILPQARNFPGFNRSRNVGNM  335

Query  414   SRSDEQN---------GSIATLLSHLP-QTPSLHQ-QTMLGA---------LNDGVFRQP  295
             S S   +          +++  ++ LP Q  + HQ   +LGA              F+ P
Sbjct  336   SLSSTADMAGAAGNAVNAMSAFMNPLPVQDGAYHQHHVILGAPLAPEATASAATSGFQHP  395

Query  294   YQVSGINW  271
              Q+SG+NW
Sbjct  396   VQISGVNW  403



>gb|AFD54036.1| NAC transcription factor NAM-1 [Aegilops searsii]
Length=405

 Score =   239 bits (610),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 169/368 (46%), Positives = 206/368 (56%), Gaps = 50/368 (14%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EELVVHYLKKK A  P+PV IIAEVDLYKFDPWELP KATFGEQEWYFFSPRDRKYPNGA
Sbjct  44    EELVVHYLKKKAAKVPLPVTIIAEVDLYKFDPWELPEKATFGEQEWYFFSPRDRKYPNGA  103

Query  1068  RPNRAATSGYWKATGTDKPVLTAGG-----TQKVGVKKALVFYGGKPPKGVKTNWIMHEY  904
             RPNRAATSGYWKATGTDKP+L +G       +K+GVKKALVFY GKPPKG+KTNWIMHEY
Sbjct  104   RPNRAATSGYWKATGTDKPILASGTGCGLVREKLGVKKALVFYRGKPPKGLKTNWIMHEY  163

Query  903   RLAD---NKTSNKPPGLDIANRSKGGSLRLDDWVLCRIYKKNNSQRPLDHE-SDDLNDML  736
             RL D   + T+++PP           SLRLDDWVLCRIYKK N     D + S +  D +
Sbjct  164   RLTDASGSTTASRPPPPVTGGSRAAASLRLDDWVLCRIYKKINKAAAGDQQRSIECEDSV  223

Query  735   QGSIPPFVTH-----QKMGLKPSNYG--ALLQTDhhhhhhHMF---DQGLVPGDASLGGA  586
             + ++  +  +        G   SNY   +LL     H    +F   D G+  G  SL   
Sbjct  224   EDAVTAYPLYATAGMAGAGAHGSNYASSSLLHHQDSHFLDGLFTADDAGISAGATSLSHL  283

Query  585   RTAQLPFVPSTPNLLPTKRSLPGLFWNVDDSSANNHHPADASPPTKRFLADN---NEASI  415
               A       T   L    S P   +N  D+S     PA   P  + F   N   N  ++
Sbjct  284   AAAARASPAPTKQFLAPSSSTP---FNWLDAS-----PAGILPQARNFPGFNRSRNVGNM  335

Query  414   SRSDEQN---------GSIATLLSHLP-QTPSLHQ-QTMLGA---------LNDGVFRQP  295
             S S   +          +++  ++ LP Q  + HQ   +LGA              F+ P
Sbjct  336   SLSSTADMAGAAGNAVNAMSAFINPLPVQDGAYHQHHVILGAPLAPEATASAATSGFQHP  395

Query  294   YQVSGINW  271
              Q+SG+NW
Sbjct  396   VQISGVNW  403



>gb|AFD54033.1| NAC transcription factor NAM-1 [Aegilops speltoides]
Length=407

 Score =   238 bits (608),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 166/363 (46%), Positives = 202/363 (56%), Gaps = 39/363 (11%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EELVVHYLKKK   AP+PV IIAEVDLYKFDPWELP KATFGEQEWYFFSPRDRKYPNGA
Sbjct  45    EELVVHYLKKKADKAPLPVTIIAEVDLYKFDPWELPEKATFGEQEWYFFSPRDRKYPNGA  104

Query  1068  RPNRAATSGYWKATGTDKPVLTAGG-----TQKVGVKKALVFYGGKPPKGVKTNWIMHEY  904
             RPNRAATSGYWKATGTDKP+L +G       +K+GVKKALVFY GKPPKG+KTNWIMHEY
Sbjct  105   RPNRAATSGYWKATGTDKPILASGTGCGLVREKLGVKKALVFYRGKPPKGLKTNWIMHEY  164

Query  903   RLADNKTSNKPPGLDIANRSKGG-----SLRLDDWVLCRIYKKNNSQRPLDHE-SDDLND  742
             RL D   S             GG     SLRLDDWVLCRIYKK N     D + S +  D
Sbjct  165   RLTDASGSTTTSRPPPPPPVTGGSRAAASLRLDDWVLCRIYKKINKAAAGDQQRSTECED  224

Query  741   MLQGSIPPFVTH-----QKMGLKPSNYG--ALLQTDhhhhhhHMF---DQGLVPGDASLG  592
              ++ ++  +  +        G   SNY   +LL     H    +F   D GL  G  SL 
Sbjct  225   SVEDAVTAYPLYATAGMAGAGAHGSNYASPSLLHHQDSHFLDGLFTADDAGLSAGATSLS  284

Query  591   GARTAQLPFVPSTPNLLPTKRSLPGLFWNVDDSSANNHHPADASPPTKR-----FLADNN  427
                 A       T   L    S P  F  +D S       A   P   R      ++ ++
Sbjct  285   HLAAAARASPAPTKQFLAPSSSTP--FNWLDASPVGILSQARNFPGFNRSRNVGSMSLSS  342

Query  426   EASISRSDEQNG--SIATLLSHLP-QTPSLHQQTML--------GALNDGVFRQPYQVSG  280
              A ++ + +  G  ++  + ++LP Q  + HQQ ++         A     F+ P Q+SG
Sbjct  343   TADMAGAVDNGGGNAVNAMSTYLPVQDGTYHQQHVILGAPLVPEAAAATSGFQHPVQISG  402

Query  279   INW  271
             +NW
Sbjct  403   VNW  405



>gb|AFD54040.1| NAC transcription factor NAM-1 [Aegilops longissima]
Length=405

 Score =   238 bits (608),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 168/369 (46%), Positives = 205/369 (56%), Gaps = 52/369 (14%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EELVVHYLKKK A  P+PV IIAEVDLYKFDPWELP KATFGEQEWYFFSPRDRKYPNGA
Sbjct  44    EELVVHYLKKKAAKVPLPVTIIAEVDLYKFDPWELPEKATFGEQEWYFFSPRDRKYPNGA  103

Query  1068  RPNRAATSGYWKATGTDKPVLTAGG-----TQKVGVKKALVFYGGKPPKGVKTNWIMHEY  904
             RPNRAATSGYWKATGTDKP+L +G       +K+GVKKALVFY GKPPKG+KTNWIMHEY
Sbjct  104   RPNRAATSGYWKATGTDKPILASGTGCGLVREKLGVKKALVFYRGKPPKGLKTNWIMHEY  163

Query  903   RLAD----NKTSNKPPGLDIANRSKGGSLRLDDWVLCRIYKKNNSQRPLDHE-SDDLNDM  739
             RL D      TS  PP +   +R+   SLRLDDWVLCRIYKK N     D + S +  D 
Sbjct  164   RLTDASGSTNTSRPPPPVTGGSRA-AASLRLDDWVLCRIYKKINKAAAGDQQRSTECEDS  222

Query  738   LQGSIPPFVTHQKMGLK-----PSNYG--ALLQTDhhhhhhHMF---DQGLVPGDASLGG  589
             ++ ++  +  +   G+       S+Y   ++L     H    +F   D GL  G  SL  
Sbjct  223   MEDAVTAYPLYATPGMAGAGAHGSSYASPSMLHHQDSHFLDGLFTADDAGLSAGATSLSH  282

Query  588   ARTAQLPFVPSTPNLLPTKRSLPGLFWNVDDSSANNHHPADASPPTKRFLADN---NEAS  418
                A       T   L    S P   +N  D+S     PA   P  + F   N   N  +
Sbjct  283   LAAAARASPAPTKQFLAPSSSTP---FNWLDAS-----PAGILPQARNFPGFNRSRNVGN  334

Query  417   ISRSDEQN---------GSIATLLSHLPQTPSLHQQ--TMLGA---------LNDGVFRQ  298
             +S S   +          ++   ++ LP     + Q   +LGA              F+ 
Sbjct  335   MSLSSTADMAGAAGNAVNAMPAFMNPLPVLDGTYHQHHVILGAPLAPEATASAATSGFQH  394

Query  297   PYQVSGINW  271
             P Q+SG+NW
Sbjct  395   PVQISGVNW  403



>gb|AFD54038.1| NAC transcription factor NAM-1 [Aegilops searsii]
Length=405

 Score =   238 bits (608),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 168/368 (46%), Positives = 206/368 (56%), Gaps = 50/368 (14%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EELVVHYLKKK A  P+PV IIAEVDLYKFDPWELP KATFGEQEWYFFSPRDRKYPNGA
Sbjct  44    EELVVHYLKKKAAKVPLPVTIIAEVDLYKFDPWELPEKATFGEQEWYFFSPRDRKYPNGA  103

Query  1068  RPNRAATSGYWKATGTDKPVLTAGG-----TQKVGVKKALVFYGGKPPKGVKTNWIMHEY  904
             RPNRAATSGYWKATGTDKP+L +G       +K+GVKKALVFY GKPP+G+KTNWIMHEY
Sbjct  104   RPNRAATSGYWKATGTDKPILASGTGCGLVREKLGVKKALVFYRGKPPRGLKTNWIMHEY  163

Query  903   RLAD---NKTSNKPPGLDIANRSKGGSLRLDDWVLCRIYKKNNSQRPLDHE-SDDLNDML  736
             RL D   + T+++PP           SLRLDDWVLCRIYKK N     D + S +  D +
Sbjct  164   RLTDASGSTTASRPPPPVTGGSRAAASLRLDDWVLCRIYKKINKAAAGDQQRSIECEDSV  223

Query  735   QGSIPPFVTH-----QKMGLKPSNYG--ALLQTDhhhhhhHMF---DQGLVPGDASLGGA  586
             + ++  +  +        G   SNY   +LL     H    +F   D G+  G  SL   
Sbjct  224   EDAVTAYPLYATAGMAGAGAHGSNYASSSLLHHQDSHFLDGLFTADDAGISAGATSLSHL  283

Query  585   RTAQLPFVPSTPNLLPTKRSLPGLFWNVDDSSANNHHPADASPPTKRFLADN---NEASI  415
               A       T   L    S P   +N  D+S     PA   P  + F   N   N  ++
Sbjct  284   AAAARASPAPTKQFLAPSSSTP---FNWLDAS-----PAGILPQARNFPGFNRSRNVGNM  335

Query  414   SRSDEQN---------GSIATLLSHLP-QTPSLHQ-QTMLGA---------LNDGVFRQP  295
             S S   +          +++  ++ LP Q  + HQ   +LGA              F+ P
Sbjct  336   SLSSTADMAGAAGNAVNAMSAFINPLPVQDGAYHQHHVILGAPLAPEATASAATSGFQHP  395

Query  294   YQVSGINW  271
              Q+SG+NW
Sbjct  396   VQISGVNW  403



>ref|XP_006657850.1| PREDICTED: NAC transcription factor ONAC010-like [Oryza brachyantha]
Length=437

 Score =   239 bits (610),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 128/191 (67%), Positives = 143/191 (75%), Gaps = 16/191 (8%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EELVVHYLKKK AS P+PV IIAEVDLYKFDPWELP KA+FGEQEWYFFSPRDRKYPNGA
Sbjct  40    EELVVHYLKKKAASVPLPVTIIAEVDLYKFDPWELPEKASFGEQEWYFFSPRDRKYPNGA  99

Query  1068  RPNRAATSGYWKATGTDKPVLTAGGT-QKVGVKKALVFYGGKPPKGVKTNWIMHEYRLAD  892
             RPNRAATSGYWKATGTDKP++ +G + +KVGVKKALVFY GKPPKG+KTNWIMHEYRL D
Sbjct  100   RPNRAATSGYWKATGTDKPIMASGSSREKVGVKKALVFYRGKPPKGIKTNWIMHEYRLTD  159

Query  891   NKTSN----------KPPGLDIANRSKGGSLRLDDWVLCRIYKKNN----SQRPLDHESD  754
               +S+          +PP           SLRLDDWVLCRIYKK N     QR ++ E D
Sbjct  160   TTSSSLTAAGVATTRRPPPTITGGSRGAVSLRLDDWVLCRIYKKTNKAGAGQRSMECE-D  218

Query  753   DLNDMLQGSIP  721
              + D +    P
Sbjct  219   SIEDAVTAYAP  229



>gb|AGV29510.1| putative NAC domain class transcription factor, partial [Tamarix 
hispida]
Length=186

 Score =   231 bits (588),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 127/173 (73%), Positives = 141/173 (82%), Gaps = 14/173 (8%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRK----Y  1081
             EEL+VHYLK+K AS+P+PVAIIAEVDLYK DPWELP+KA FGEQEWYFFSPRDRK    Y
Sbjct  12    EELIVHYLKRKAASSPLPVAIIAEVDLYKSDPWELPSKAIFGEQEWYFFSPRDRKYPNQY  71

Query  1080  PNGARPNRAATSGYWKATGTDKPVLTAGGT--QKVGVKKALVFYGGKPPKGVKTNWIMHE  907
             PNGARPNRAATSGYWKATGTDKP+L+   T  +KVGVKKALVFYGGKPP+G+KT+WIMHE
Sbjct  72    PNGARPNRAATSGYWKATGTDKPILSTNDTPPRKVGVKKALVFYGGKPPRGIKTDWIMHE  131

Query  906   YRLADNKTSNKPPGL---DIANR-----SKGGSLRLDDWVLCRIYKKNNSQRP  772
             YRL D+ +   PP      I  R     SK  SLRLDDWVLCRIYKKNN+QRP
Sbjct  132   YRLLDSSSGGPPPACLFKSIPPRLDGTDSKKPSLRLDDWVLCRIYKKNNTQRP  184



>tpg|DAA63172.1| TPA: putative NAC domain transcription factor superfamily protein 
isoform 1 [Zea mays]
 tpg|DAA63173.1| TPA: putative NAC domain transcription factor superfamily protein 
isoform 2 [Zea mays]
Length=410

 Score =   238 bits (606),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 127/157 (81%), Positives = 135/157 (86%), Gaps = 6/157 (4%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EELVVHYLKKK AS P+PVAIIAEVDLYKFDPWELP KATFGEQEWYFFSPRDRKYPNGA
Sbjct  38    EELVVHYLKKKAASVPLPVAIIAEVDLYKFDPWELPDKATFGEQEWYFFSPRDRKYPNGA  97

Query  1068  RPNRAATSGYWKATGTDKPVLTAGGT-QKVGVKKALVFYGGKPPKGVKTNWIMHEYRLAD  892
             RPNRAATSGYWKATGTDKP++ +GG  +KVGVKKALVFY GKPPKG+KTNWIMHEYRLAD
Sbjct  98    RPNRAATSGYWKATGTDKPIMASGGNREKVGVKKALVFYRGKPPKGLKTNWIMHEYRLAD  157

Query  891   ---NKTSNKPPGLDIANRSKGGSLRLDDWVLCRIYKK  790
                + TS  PP  +     K  SLRLDDWVLCRIYKK
Sbjct  158   AASSTTSRPPPPCNAGG--KATSLRLDDWVLCRIYKK  192



>emb|CDY53806.1| BnaA06g01770D [Brassica napus]
Length=318

 Score =   234 bits (597),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 123/157 (78%), Positives = 134/157 (85%), Gaps = 6/157 (4%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EELV+HYLK+K  S+P+PVAIIA+VDLYK DPWELP KA FGEQEWYFFSPRDRKYPNGA
Sbjct  30    EELVIHYLKRKADSSPLPVAIIADVDLYKHDPWELPEKALFGEQEWYFFSPRDRKYPNGA  89

Query  1068  RPNRAATSGYWKATGTDKPVLTAG-GTQKVGVKKALVFYGGKPPKGVKTNWIMHEYRLAD  892
             RPNRAATSGYWKATGTDKPV++ G G +KVGVKKALVFY GKPPKG+K++WIMHEYRLAD
Sbjct  90    RPNRAATSGYWKATGTDKPVISTGDGNKKVGVKKALVFYTGKPPKGIKSDWIMHEYRLAD  149

Query  891   NKTSNKPPGLDIANRSKGGSLRLDDWVLCRIYKKNNS  781
             NK     P L      K  SLRLDDWVLCRIYKKNNS
Sbjct  150   NK-----PSLRCDFGHKKNSLRLDDWVLCRIYKKNNS  181



>ref|XP_009147651.1| PREDICTED: NAC domain-containing protein 18 isoform X2 [Brassica 
rapa]
Length=327

 Score =   234 bits (598),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 123/157 (78%), Positives = 134/157 (85%), Gaps = 6/157 (4%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EELV+HYLK+K  S+P+PVAIIA+VDLYK DPWELP KA FGEQEWYFFSPRDRKYPNGA
Sbjct  30    EELVIHYLKRKADSSPLPVAIIADVDLYKHDPWELPEKALFGEQEWYFFSPRDRKYPNGA  89

Query  1068  RPNRAATSGYWKATGTDKPVLTAG-GTQKVGVKKALVFYGGKPPKGVKTNWIMHEYRLAD  892
             RPNRAATSGYWKATGTDKPV++ G G +KVGVKKALVFY GKPPKG+K++WIMHEYRLAD
Sbjct  90    RPNRAATSGYWKATGTDKPVISTGDGNKKVGVKKALVFYTGKPPKGIKSDWIMHEYRLAD  149

Query  891   NKTSNKPPGLDIANRSKGGSLRLDDWVLCRIYKKNNS  781
             NK     P L      K  SLRLDDWVLCRIYKKNNS
Sbjct  150   NK-----PSLRCDFGHKKNSLRLDDWVLCRIYKKNNS  181



>emb|CDY69545.1| BnaCnng64100D [Brassica napus]
Length=312

 Score =   234 bits (596),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 123/157 (78%), Positives = 134/157 (85%), Gaps = 6/157 (4%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EELV+HYLK+K  S+P+PVAIIA+VDLYK DPWELP KA FGEQEWYFFSPRDRKYPNGA
Sbjct  27    EELVIHYLKRKADSSPLPVAIIADVDLYKHDPWELPEKALFGEQEWYFFSPRDRKYPNGA  86

Query  1068  RPNRAATSGYWKATGTDKPVLTAG-GTQKVGVKKALVFYGGKPPKGVKTNWIMHEYRLAD  892
             RPNRAATSGYWKATGTDKPV++ G G +KVGVKKALVFY GKPPKG+K++WIMHEYRLAD
Sbjct  87    RPNRAATSGYWKATGTDKPVISTGDGNKKVGVKKALVFYTGKPPKGIKSDWIMHEYRLAD  146

Query  891   NKTSNKPPGLDIANRSKGGSLRLDDWVLCRIYKKNNS  781
             NK     P L      K  SLRLDDWVLCRIYKKNNS
Sbjct  147   NK-----PSLRCDFGHKKNSLRLDDWVLCRIYKKNNS  178



>ref|XP_009394856.1| PREDICTED: NAC transcription factor 25-like [Musa acuminata subsp. 
malaccensis]
Length=334

 Score =   234 bits (597),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 120/186 (65%), Positives = 147/186 (79%), Gaps = 11/186 (6%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EEL++HYL+ + A+ P PV+IIAEVD+YKFDPW+LPAKATFG++EWYFFSPRDRKYPNG 
Sbjct  19    EELILHYLRNRAAAVPCPVSIIAEVDIYKFDPWDLPAKATFGDREWYFFSPRDRKYPNGV  78

Query  1068  RPNRAATSGYWKATGTDKPVLTAGGTQKVGVKKALVFYGGKPPKGVKTNWIMHEYRLAD-  892
             RPNRAA SGYWKATGTDKPV+ + G++ +GVKKALVFY G+PP+GVKT+WIMHEYRLAD 
Sbjct  79    RPNRAAASGYWKATGTDKPVMASKGSESIGVKKALVFYQGRPPRGVKTDWIMHEYRLADA  138

Query  891   -NKTSNKPPGLDIANRSKGGSLRLDDWVLCRIYKKNNSQRPLDHESDD--LNDMLQGSIP  721
              NK S +P  L      +  S+RLDDWVLCRIYKK++ Q  +D E DD  + D+   + P
Sbjct  139   HNKNSYRPIKL------RDCSMRLDDWVLCRIYKKSHHQPSMDAEKDDSGVEDVAMPT-P  191

Query  720   PFVTHQ  703
             P  T Q
Sbjct  192   PSATQQ  197



>gb|AFD54034.1| NAC transcription factor NAM-1 [Aegilops speltoides]
Length=406

 Score =   236 bits (602),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 168/368 (46%), Positives = 201/368 (55%), Gaps = 50/368 (14%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EELVVHYLKKK   AP+PV IIAEVDLYKFDPWELP KATFGEQEWYFFSPRDRKYPNGA
Sbjct  45    EELVVHYLKKKADKAPLPVTIIAEVDLYKFDPWELPEKATFGEQEWYFFSPRDRKYPNGA  104

Query  1068  RPNRAATSGYWKATGTDKPVL-TAGGT----QKVGVKKALVFYGGKPPKGVKTNWIMHEY  904
             RPNRAATSGYWKATGTDKP+L +A G     +K+GVKKALVFY GKPPKG+KTNWIMHEY
Sbjct  105   RPNRAATSGYWKATGTDKPILASAPGCGLVREKLGVKKALVFYRGKPPKGLKTNWIMHEY  164

Query  903   RLAD----NKTSNKPPGLDIANRSKGGSLRLDDWVLCRIYKKNNSQRPLDHE-SDDLNDM  739
             RL D      TS  PP           SLRLDDWVLCRIYKK N     D + S +  D 
Sbjct  165   RLTDASGSTTTSRLPPPPVTGGSRAAASLRLDDWVLCRIYKKINKAAAGDQQRSTECEDS  224

Query  738   LQGSIPPFVTH-----QKMGLKPSNYG--ALLQTDhhhhhhHMF---DQGLVPGDASLGG  589
             ++ ++  +  +        G   SNY   +LL     H    +F   D GL  G  SL  
Sbjct  225   VEDAVTAYPLYATAGMAGAGAHGSNYASPSLLHHQDSHFLDGLFTADDAGLSAGATSLSH  284

Query  588   ARTAQLPFVPSTPNLLPTKRSLPGLFWNVDDSSANNHHPADASPPTKRFLADNNE-----  424
                A       T   L    S P   +N  D+S     P       + F   N       
Sbjct  285   LAAAARASPAPTKQFLAPSSSTP---FNWLDAS-----PVGILSQARNFTGFNRSRNVGN  336

Query  423   ASISRSDEQNG--------SIATLLSHLP-QTPSLHQQTML--------GALNDGVFRQP  295
              S+S + +  G        ++  + ++LP Q  + HQQ ++         A     F+ P
Sbjct  337   MSLSSTADMAGAVDNGGGNAVNAMSTYLPVQDGTYHQQHVILGAPLVPEAAAATSGFQHP  396

Query  294   YQVSGINW  271
              Q+S +NW
Sbjct  397   VQISSVNW  404



>gb|AFD54031.1| NAC transcription factor NAM-1 [Aegilops bicornis]
Length=408

 Score =   235 bits (599),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 168/371 (45%), Positives = 206/371 (56%), Gaps = 53/371 (14%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EELVVHYLKKK A  P+PV IIAEVDLYKFDPWELP KATFGEQEWYFFSPRDRKYPNGA
Sbjct  44    EELVVHYLKKKAAKVPLPVTIIAEVDLYKFDPWELPEKATFGEQEWYFFSPRDRKYPNGA  103

Query  1068  RPNRAATSGYWKATGTDKPVLTAGG-----TQKVGVKKALVFYGGKPPKGVKTNWIMHEY  904
             RPNRAATSGYWKATGTDKP+L +G       +K+GVKKALVFY GKPPKG+KTNWIMHEY
Sbjct  104   RPNRAATSGYWKATGTDKPILASGTGCGLVREKLGVKKALVFYRGKPPKGLKTNWIMHEY  163

Query  903   RLAD-NKTSNKPPGLDIANRSKGG-----SLRLDDWVLCRIYKKNNSQRPLDHE-SDDLN  745
             RL D + ++N            GG     SLRLDDWVLCRIYKK N     D + S +  
Sbjct  164   RLTDASGSTNTSRPPPPPPPVTGGSRAAASLRLDDWVLCRIYKKINKAAAGDQQRSTECE  223

Query  744   DMLQGSIPPFVTHQKMGLK-----PSNYG--ALLQTDhhhhhhHMF---DQGLVPGDASL  595
             D ++ ++  +  +   G+       S+Y   ++L     H    +F   D GL  G  SL
Sbjct  224   DSMEDAVTAYPLYATPGMAGAGAHGSSYASPSMLHHQDSHFLDGLFTADDAGLSAGATSL  283

Query  594   GGARTAQLPFVPSTPNLLPTKRSLPGLFWNVDDSSANNHHPADASPPTKRFLADN---NE  424
                  A       T   L    S P   +N  D+S     PA   P  + F   N   N 
Sbjct  284   SHLAAAARASPAPTKQFLAPSSSTP---FNWLDAS-----PAGILPQARNFPGFNRSRNV  335

Query  423   ASISRSDEQN---------GSIATLLSHLP-QTPSLHQ-QTMLGA---------LNDGVF  304
              ++S S   +          +++  ++ LP Q  + HQ   +LGA              F
Sbjct  336   GNMSLSSTADMAGAAGNAVNAMSAFMNPLPVQDGTYHQHHVILGAPLAPEATASAATSGF  395

Query  303   RQPYQVSGINW  271
             + P Q+SG+NW
Sbjct  396   QHPVQISGVNW  406



>ref|XP_009387374.1| PREDICTED: NAC transcription factor 29-like [Musa acuminata subsp. 
malaccensis]
Length=327

 Score =   232 bits (592),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 115/167 (69%), Positives = 137/167 (82%), Gaps = 5/167 (3%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EEL++HYL+ + +S P PV+IIAEVD+YKFDPWELPAKA FG++EWYFFSPRDRKYPNG 
Sbjct  18    EELILHYLRNRASSMPCPVSIIAEVDIYKFDPWELPAKALFGDREWYFFSPRDRKYPNGV  77

Query  1068  RPNRAATSGYWKATGTDKPVLTAGG-TQKVGVKKALVFYGGKPPKGVKTNWIMHEYRLAD  892
             RPNRAA SGYWKATGTDKP++ + G +  +GVKKALVFY GKPPKGVKT+WIMHEYRLA+
Sbjct  78    RPNRAAASGYWKATGTDKPIVASKGMSDNIGVKKALVFYKGKPPKGVKTDWIMHEYRLAE  137

Query  891   NKTSNKPPGLDIANRSKGGSLRLDDWVLCRIYKKNNSQRPLDHESDD  751
                SN    + +    +G S+RLDDWVLCRIYKK+N Q PLD E +D
Sbjct  138   ALRSNNYQTIKL----RGSSMRLDDWVLCRIYKKSNHQLPLDAEQED  180



>gb|AEI00653.1| NAC5 [Triticum aestivum]
Length=406

 Score =   234 bits (598),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 166/368 (45%), Positives = 199/368 (54%), Gaps = 47/368 (13%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EELVVHYLKKK A  P+PV IIAEVDLYKFDPWELP KATFGEQEWYFFSPRDRKYPNGA
Sbjct  42    EELVVHYLKKKAAKVPLPVTIIAEVDLYKFDPWELPEKATFGEQEWYFFSPRDRKYPNGA  101

Query  1068  RPNRAATSGYWKATGTDKPVLTAGG-----TQKVGVKKALVFYGGKPPKGVKTNWIMHEY  904
             RPNRAATSGYWKATGTDKP+L +G       +K+GVKKALVFY GKPPKG+KTNWIMHEY
Sbjct  102   RPNRAATSGYWKATGTDKPILASGTGCGLVREKLGVKKALVFYRGKPPKGLKTNWIMHEY  161

Query  903   RLADNKTSNKPPGLDIANRSKGG-----SLRLDDWVLCRIYKKNNSQRPLDHE-SDDLND  742
             RL D   S             GG     SLRLDDWVLCRIYKK N     D + S +  D
Sbjct  162   RLTDASGSTTTSRPPPPPPVTGGSRAAASLRLDDWVLCRIYKKINKAAAGDQQRSMECED  221

Query  741   MLQGSIPPFVTH-----QKMGLKPSNYG--ALLQTDhhhhhhHMF---DQGLVPGDASLG  592
              ++ ++  +  +        G   SNY   +LL     H    +F   D GL  G  SL 
Sbjct  222   SVEDAVTAYPLYATAGMAGAGAHGSNYASSSLLHHQDSHFLDGLFTADDAGLSAGATSLS  281

Query  591   GARTAQLPFVPSTPNLLPTKRSLPGLFWNVDDSSANNHHPADASPPTKRFLADNNEASIS  412
                 A       T   L    S P   +N  ++SA    P   + P   F    N  ++S
Sbjct  282   HLAAAARASPAPTKQFLAPSSSTP---FNWLEASAAGILPQARNFPG--FNRSRNVGNMS  336

Query  411   RSDEQN---------GSIATLLSHLP-QTPSLHQQTML-----------GALNDGVFRQP  295
              S   +          +++  ++ LP Q  + HQ  ++           GA   G     
Sbjct  337   LSSTADMAGAAGNAVNAMSAFMNPLPVQDGTYHQHHVILGAPLAPEATAGAATSGFQHHA  396

Query  294   YQVSGINW  271
              Q+SG+NW
Sbjct  397   VQISGVNW  404



>ref|XP_010088481.1| NAC domain-containing protein 29 [Morus notabilis]
 gb|EXB36251.1| NAC domain-containing protein 29 [Morus notabilis]
Length=358

 Score =   232 bits (592),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 125/206 (61%), Positives = 148/206 (72%), Gaps = 11/206 (5%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EEL++HYL+K+V S P+PV+IIAEVD+YKFDPW+LPAKATFGE+EWYFFSPRDRKYPNGA
Sbjct  19    EELILHYLRKRVISIPLPVSIIAEVDIYKFDPWDLPAKATFGEKEWYFFSPRDRKYPNGA  78

Query  1068  RPNRAATSGYWKATGTDKPVLT----AGGTQKVGVKKALVFYGGKPPKGVKTNWIMHEYR  901
             RPNRAA SGYWKATGTDK ++T     GG Q +GVKKALVFY G+PPKGVKTNWIMHEYR
Sbjct  79    RPNRAAASGYWKATGTDKTIMTLVTPGGGQQNIGVKKALVFYKGRPPKGVKTNWIMHEYR  138

Query  900   LADNKTSNKPPGLDIANRSKGGSLRLDDWVLCRIYKKNNSQRPLDHESDDLNDMLQ----  733
             LA+  T          N+ K  S+RLDDWVLCRIYKK N   P+     D  +  Q    
Sbjct  139   LAETPTYTYSNVNKSNNKFKDSSMRLDDWVLCRIYKKTNVVHPIASFPSDQEEEEQFIQD  198

Query  732   GSIPPFVTHQKMGLKP---SNYGALL  664
               +P  +  Q+   KP   S++  LL
Sbjct  199   APLPSLIGDQQDSFKPQKSSSFSDLL  224



>gb|AEI00649.1| NAC1 [Triticum aestivum]
 gb|EMT33003.1| NAC domain-containing protein 18 [Aegilops tauschii]
 gb|AIZ97667.1| NAC transcription factor NAM-D1 [Triticum aestivum]
Length=408

 Score =   234 bits (596),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 166/368 (45%), Positives = 199/368 (54%), Gaps = 47/368 (13%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EELVVHYLKKK A  P+PV IIAEVDLYKFDPWELP KATFGEQEWYFFSPRDRKYPNGA
Sbjct  44    EELVVHYLKKKAAKVPLPVTIIAEVDLYKFDPWELPEKATFGEQEWYFFSPRDRKYPNGA  103

Query  1068  RPNRAATSGYWKATGTDKPVLTAGG-----TQKVGVKKALVFYGGKPPKGVKTNWIMHEY  904
             RPNRAATSGYWKATGTDKP+L +G       +K+GVKKALVFY GKPPKG+KTNWIMHEY
Sbjct  104   RPNRAATSGYWKATGTDKPILASGTGCGLVREKLGVKKALVFYRGKPPKGLKTNWIMHEY  163

Query  903   RLADNKTSNKPPGLDIANRSKGG-----SLRLDDWVLCRIYKKNNSQRPLDHE-SDDLND  742
             RL D   S             GG     SLRLDDWVLCRIYKK N     D + S +  D
Sbjct  164   RLTDASGSTTTSRPPPPPPVTGGSRAAASLRLDDWVLCRIYKKINKAAAGDQQRSMECED  223

Query  741   MLQGSIPPFVTH-----QKMGLKPSNYG--ALLQTDhhhhhhHMF---DQGLVPGDASLG  592
              ++ ++  +  +        G   SNY   +LL     H    +F   D GL  G  SL 
Sbjct  224   SVEDAVTAYPLYATAGMAGAGAHGSNYASSSLLHHQDSHFLDGLFTADDAGLSAGATSLS  283

Query  591   GARTAQLPFVPSTPNLLPTKRSLPGLFWNVDDSSANNHHPADASPPTKRFLADNNEASIS  412
                 A       T   L    S P   +N  ++SA    P   + P   F    N  ++S
Sbjct  284   HLAAAARASPAPTKQFLAPSSSTP---FNWLEASAAGILPQARNFPG--FNRSRNVGNMS  338

Query  411   RSDEQN---------GSIATLLSHLP-QTPSLHQQTML-----------GALNDGVFRQP  295
              S   +          +++  ++ LP Q  + HQ  ++           GA   G     
Sbjct  339   LSSTADMAGAAGNAVNAMSAFMNPLPVQDGTYHQHHVILGAPLAPEATAGAATSGFQHHA  398

Query  294   YQVSGINW  271
              Q+SG+NW
Sbjct  399   VQISGVNW  406



>gb|ABI94354.1| NAC transcription factor NAM-D1 [Aegilops tauschii]
Length=408

 Score =   234 bits (596),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 166/368 (45%), Positives = 199/368 (54%), Gaps = 47/368 (13%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EELVVHYLKKK A  P+PV IIAEVDLYKFDPWELP KATFGEQEWYFFSPRDRKYPNGA
Sbjct  44    EELVVHYLKKKAAKVPLPVTIIAEVDLYKFDPWELPEKATFGEQEWYFFSPRDRKYPNGA  103

Query  1068  RPNRAATSGYWKATGTDKPVLTAGG-----TQKVGVKKALVFYGGKPPKGVKTNWIMHEY  904
             RPNRAATSGYWKATGTDKP+L +G       +K+GVKKALVFY GKPPKG+KTNWIMHEY
Sbjct  104   RPNRAATSGYWKATGTDKPILASGTGCGLVREKLGVKKALVFYRGKPPKGLKTNWIMHEY  163

Query  903   RLADNKTSNKPPGLDIANRSKGG-----SLRLDDWVLCRIYKKNNSQRPLDHE-SDDLND  742
             RL D   S             GG     SLRLDDWVLCRIYKK N     D + S +  D
Sbjct  164   RLTDASGSTTTSRPPPPPPVTGGSRAAASLRLDDWVLCRIYKKINKAAAGDQQRSMECED  223

Query  741   MLQGSIPPFVTH-----QKMGLKPSNYG--ALLQTDhhhhhhHMF---DQGLVPGDASLG  592
              ++ ++  +  +        G   SNY   +LL     H    +F   D GL  G  SL 
Sbjct  224   SVEDAVTAYPLYATAGMAGAGAHGSNYASSSLLHHQDSHFLDGLFTADDAGLSAGATSLS  283

Query  591   GARTAQLPFVPSTPNLLPTKRSLPGLFWNVDDSSANNHHPADASPPTKRFLADNNEASIS  412
                 A       T   L    S P   +N  ++SA    P   + P   F    N  ++S
Sbjct  284   HLAPAARASPAPTKQFLAPSSSTP---FNWLEASAAGILPQARNFPG--FNRSRNVGNMS  338

Query  411   RSDEQN---------GSIATLLSHLP-QTPSLHQQTML-----------GALNDGVFRQP  295
              S   +          +++  ++ LP Q  + HQ  ++           GA   G     
Sbjct  339   LSSTADMAGAAGNAVNAMSAFMNPLPVQDGTYHQHHVILGAPLAPEATAGAATSGFQHHA  398

Query  294   YQVSGINW  271
              Q+SG+NW
Sbjct  399   VQISGVNW  406



>gb|AFD54039.1| NAC transcription factor NAM-1 [Aegilops longissima]
Length=408

 Score =   233 bits (595),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 168/371 (45%), Positives = 205/371 (55%), Gaps = 53/371 (14%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EELVVHYLKKK A  P+PV IIAEVDLYKFDPWELP KATFGEQEWYFFSPRDRKYPNGA
Sbjct  44    EELVVHYLKKKAAKVPLPVTIIAEVDLYKFDPWELPEKATFGEQEWYFFSPRDRKYPNGA  103

Query  1068  RPNRAATSGYWKATGTDKPVLTAGG-----TQKVGVKKALVFYGGKPPKGVKTNWIMHEY  904
             RPNRAATSGYWKATGTDKP+L +G       +K+GVKKALVFY GKPPKG+KTNWIMHEY
Sbjct  104   RPNRAATSGYWKATGTDKPILASGTGCGLVREKLGVKKALVFYRGKPPKGLKTNWIMHEY  163

Query  903   RLAD-NKTSNKPPGLDIANRSKGG-----SLRLDDWVLCRIYKKNNSQRPLDHE-SDDLN  745
             RL D + ++N            GG     SLRLDDWVLCRIYKK N     D + S +  
Sbjct  164   RLTDASGSTNTSRPPPPPPPVTGGSRAAASLRLDDWVLCRIYKKINKAAAGDQQRSTECE  223

Query  744   DMLQGSIPPFVTHQKMGLK-----PSNYG--ALLQTDhhhhhhHMF---DQGLVPGDASL  595
             D ++ ++  +  +   G+       S+Y   ++L     H    +F   D GL  G  SL
Sbjct  224   DSMEDAVTAYPLYATPGMAGAGAHGSSYASPSMLHHQDSHFLDGLFTADDAGLSAGATSL  283

Query  594   GGARTAQLPFVPSTPNLLPTKRSLPGLFWNVDDSSANNHHPADASPPTKRFLADN---NE  424
                  A       T   L    S P   +N  D+S     PA   P  + F   N   N 
Sbjct  284   SHLAAAARASPAPTKQFLAPSSSTP---FNWLDAS-----PAGILPQARNFPGFNRSRNV  335

Query  423   ASISRSDEQN---------GSIATLLSHLP-QTPSLHQ-QTMLGA---------LNDGVF  304
              ++S S   +          ++   ++ LP Q  + HQ   +LGA              F
Sbjct  336   GNMSLSSTADMAGAAGNAVNAMPAFMNPLPVQDGTYHQHHVILGAPLAPEATASAATSGF  395

Query  303   RQPYQVSGINW  271
             + P Q+SG+NW
Sbjct  396   QHPVQISGVNW  406



>ref|XP_008799211.1| PREDICTED: NAC transcription factor ONAC010-like isoform X2 [Phoenix 
dactylifera]
Length=188

 Score =   226 bits (576),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 123/153 (80%), Positives = 133/153 (87%), Gaps = 6/153 (4%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EELVVHYLKKK ASAP+PV IIAEVDLYKFDPWELP KA+FGEQEWYFFSPRDRKYPNGA
Sbjct  31    EELVVHYLKKKAASAPLPVTIIAEVDLYKFDPWELPGKASFGEQEWYFFSPRDRKYPNGA  90

Query  1068  RPNRAATSGYWKATGTDKPVLTAGGTQKVGVKKALVFYGGKPPKGVKTNWIMHEYRLADN  889
             RPNRAATSGYWKATGTDKP+LT+GGTQKVGVKKALVFYGGKPPKG+KTNWIMHEYRL D 
Sbjct  91    RPNRAATSGYWKATGTDKPILTSGGTQKVGVKKALVFYGGKPPKGIKTNWIMHEYRLTDT  150

Query  888   KTS--NKPPGLDIANRSKGGSLRL--DDWVLCR  802
               S  ++PP  D+   SK GSLR+  +D  L R
Sbjct  151   SPSSNSRPPCGDVG--SKKGSLRVTWNDTTLAR  181



>gb|AFD54035.1| NAC transcription factor NAM-1 [Aegilops speltoides]
Length=407

 Score =   232 bits (591),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 167/369 (45%), Positives = 201/369 (54%), Gaps = 51/369 (14%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EELVVHYLKKK   AP+PV IIAEVDLYKFDPWELP KATFGEQEWYFFSPRDRKYPNGA
Sbjct  45    EELVVHYLKKKADKAPLPVTIIAEVDLYKFDPWELPEKATFGEQEWYFFSPRDRKYPNGA  104

Query  1068  RPNRAATSGYWKATGTDKPVL-TAGGT----QKVGVKKALVFYGGKPPKGVKTNWIMHEY  904
             RPNRAATSGYWKATGTDKP+L +A G     +K+GVKKALVFY GKPPKG+KTNWIMHEY
Sbjct  105   RPNRAATSGYWKATGTDKPILASAPGCGLVREKLGVKKALVFYRGKPPKGLKTNWIMHEY  164

Query  903   RLADNKTSNKPPGLDIANRSKGG-----SLRLDDWVLCRIYKKNNSQRPLDHE-SDDLND  742
             RL D  +S             GG     SLRLDDWVLCRIYKK N     D + S +  D
Sbjct  165   RLTDASSSTTTSRPPPPPPVTGGSRAAASLRLDDWVLCRIYKKINKAAAGDQQRSTECED  224

Query  741   MLQGSIPPFVTH-----QKMGLKPSNYG--ALLQTDhhhhhhHMF---DQGLVPGDASLG  592
              ++ ++  +  +        G   SNY   +LL     H    +F   D GL  G  SL 
Sbjct  225   SVEDAVTAYPLYATAGMAGAGAHGSNYASPSLLHHQDSHFLDGLFTADDAGLSAGATSLS  284

Query  591   GARTAQLPFVPSTPNLLPTKRSLPGLFWNVDDSSANNHHPADASPPTKRFLADNNE----  424
                 A       T   L    S P   +N  D+S     P       + F   N      
Sbjct  285   HLAAAARASPAPTKQFLAPSSSTP---FNWLDAS-----PVGILSQARNFTGFNRSRNVG  336

Query  423   -ASISRSDEQNG--------SIATLLSHLP-QTPSLHQQTML--------GALNDGVFRQ  298
               S+S + +  G        ++  + ++LP Q  + HQQ ++         A     F+ 
Sbjct  337   NMSLSSTADVAGAVDNGGGNAVNAMSTYLPVQDGTYHQQHVILGAPLVPEAAAATSGFQH  396

Query  297   PYQVSGINW  271
             P Q+S +NW
Sbjct  397   PVQISSVNW  405



>ref|XP_008793367.1| PREDICTED: NAC transcription factor 29-like [Phoenix dactylifera]
Length=340

 Score =   229 bits (583),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 117/172 (68%), Positives = 136/172 (79%), Gaps = 12/172 (7%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EEL+VHYL+ + AS P PV+IIAEVD+YKFDPWELPAKA FG++EWYFFSPRDRKYPNG 
Sbjct  18    EELIVHYLRNQAASVPCPVSIIAEVDIYKFDPWELPAKAMFGDREWYFFSPRDRKYPNGM  77

Query  1068  RPNRAATSGYWKATGTDKPVLTAGGTQKVGVKKALVFYGGKPPKGVKTNWIMHEYRLADN  889
             RPNRAA SGYWKATGTDKP+  + G   +GVKKALVFY G+PPKG+KTNWIMHEYRLA+ 
Sbjct  78    RPNRAAASGYWKATGTDKPIRMSRGNGNIGVKKALVFYKGRPPKGLKTNWIMHEYRLAEA  137

Query  888   KTSN--KPPGLDIANRSKGGSLRLDDWVLCRIYKKNNSQRP----LDHESDD  751
             ++SN  KP       R +  S+RLDDWVLCRIYKK+N   P    +D E DD
Sbjct  138   QSSNSYKP------TRIRDSSMRLDDWVLCRIYKKSNHLEPVPPLIDQEQDD  183



>gb|AFD54032.1| NAC transcription factor NAM-1 [Aegilops bicornis]
Length=408

 Score =   231 bits (588),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 166/371 (45%), Positives = 205/371 (55%), Gaps = 53/371 (14%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EELVVHYLKKK A  P+PV IIAEVDL+KFDPWELP KATFGEQEWYFFSPRDRKYPNGA
Sbjct  44    EELVVHYLKKKAAKVPLPVTIIAEVDLHKFDPWELPEKATFGEQEWYFFSPRDRKYPNGA  103

Query  1068  RPNRAATSGYWKATGTDKPVLTAGG-----TQKVGVKKALVFYGGKPPKGVKTNWIMHEY  904
             RPNRAATSGYWKATGTDKP+L +G       +K+GVKKALVFY GKPPKG+KTNW MHEY
Sbjct  104   RPNRAATSGYWKATGTDKPILASGTGCGLVREKLGVKKALVFYRGKPPKGLKTNWTMHEY  163

Query  903   RLAD-NKTSNKPPGLDIANRSKGG-----SLRLDDWVLCRIYKKNNSQRPLDHE-SDDLN  745
             RL D + ++N            GG     SLRLDDWVLCRIYKK N     D + S +  
Sbjct  164   RLTDASGSTNTSRPPPPPPPVTGGSRAAASLRLDDWVLCRIYKKINKAAAGDQQRSTECE  223

Query  744   DMLQGSIPPFVTHQKMGLK-----PSNYG--ALLQTDhhhhhhHMF---DQGLVPGDASL  595
             D ++ ++  +  +   G+       S+Y   ++L     H    +F   D GL  G  SL
Sbjct  224   DSMEDAVTAYPLYATPGMAGAGAHGSSYASPSMLHHQDSHFLDGLFTADDAGLSAGATSL  283

Query  594   GGARTAQLPFVPSTPNLLPTKRSLPGLFWNVDDSSANNHHPADASPPTKRFLADN---NE  424
                  A       T   L    S P   +N  D+S     PA   P  + F   N   N 
Sbjct  284   SHLAAAARASPAPTKQFLAPSSSTP---FNWLDAS-----PAGILPQARNFPGFNRSRNV  335

Query  423   ASISRSDEQN---------GSIATLLSHLP-QTPSLHQ-QTMLGA---------LNDGVF  304
              ++S S   +          +++  ++ LP Q  + HQ   +LGA              F
Sbjct  336   GNMSLSSTADMAGAAGNAVNAMSAFMNPLPVQDGTYHQHHVILGAPLAPEATASAATSGF  395

Query  303   RQPYQVSGINW  271
             + P Q+SG+NW
Sbjct  396   QHPVQISGVNW  406



>gb|KFK35761.1| hypothetical protein AALP_AA4G032900 [Arabis alpina]
Length=280

 Score =   226 bits (577),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 121/156 (78%), Positives = 132/156 (85%), Gaps = 7/156 (4%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EELV HYLK K  S P+PVAIIA+V+LYKFDPWELP KA FGEQEWYFFSPRDRKYPNGA
Sbjct  27    EELVTHYLKPKTDSIPLPVAIIADVNLYKFDPWELPEKALFGEQEWYFFSPRDRKYPNGA  86

Query  1068  RPNRAATSGYWKATGTDKPVLTA--GGTQKVGVKKALVFYGGKPPKGVKTNWIMHEYRLA  895
             RPNRAATSGYWKATGTDKPV++   GG++K+GVKKALVFY GKPPKGVK++WIMHEYRL 
Sbjct  87    RPNRAATSGYWKATGTDKPVISTGDGGSKKIGVKKALVFYTGKPPKGVKSDWIMHEYRLI  146

Query  894   DNKTSNKPPGLDIANRSKGGSLRLDDWVLCRIYKKN  787
             DNK S +    D  N  K  SLRLDDWVLCRIYKKN
Sbjct  147   DNKPSFR---CDYGN--KKNSLRLDDWVLCRIYKKN  177



>gb|ACD39374.1| NAC domain protein, partial [Glycine max]
Length=149

 Score =   221 bits (564),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 114/124 (92%), Positives = 120/124 (97%), Gaps = 0/124 (0%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EELVVHYLKKK ASAP+PVAIIAEVDLYKFDPWELPAKA FGEQEWYFF+PRDRKYPNGA
Sbjct  26    EELVVHYLKKKAASAPLPVAIIAEVDLYKFDPWELPAKAAFGEQEWYFFTPRDRKYPNGA  85

Query  1068  RPNRAATSGYWKATGTDKPVLTAGGTQKVGVKKALVFYGGKPPKGVKTNWIMHEYRLADN  889
             RPNRAATSGYWKATGTDKPVLT+GGTQKVGVKKALVFYGGKPP+G+KTNWIMHEYRL DN
Sbjct  86    RPNRAATSGYWKATGTDKPVLTSGGTQKVGVKKALVFYGGKPPRGIKTNWIMHEYRLTDN  145

Query  888   KTSN  877
             K +N
Sbjct  146   KPNN  149



>ref|XP_009147650.1| PREDICTED: NAC domain-containing protein 18 isoform X1 [Brassica 
rapa]
Length=335

 Score =   228 bits (580),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 123/165 (75%), Positives = 134/165 (81%), Gaps = 14/165 (8%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAK--------ATFGEQEWYFFSPR  1093
             EELV+HYLK+K  S+P+PVAIIA+VDLYK DPWELP K        A FGEQEWYFFSPR
Sbjct  30    EELVIHYLKRKADSSPLPVAIIADVDLYKHDPWELPGKLNQNQTEKALFGEQEWYFFSPR  89

Query  1092  DRKYPNGARPNRAATSGYWKATGTDKPVLTAG-GTQKVGVKKALVFYGGKPPKGVKTNWI  916
             DRKYPNGARPNRAATSGYWKATGTDKPV++ G G +KVGVKKALVFY GKPPKG+K++WI
Sbjct  90    DRKYPNGARPNRAATSGYWKATGTDKPVISTGDGNKKVGVKKALVFYTGKPPKGIKSDWI  149

Query  915   MHEYRLADNKTSNKPPGLDIANRSKGGSLRLDDWVLCRIYKKNNS  781
             MHEYRLADNK     P L      K  SLRLDDWVLCRIYKKNNS
Sbjct  150   MHEYRLADNK-----PSLRCDFGHKKNSLRLDDWVLCRIYKKNNS  189



>ref|XP_010922870.1| PREDICTED: NAC transcription factor 29-like [Elaeis guineensis]
Length=341

 Score =   228 bits (580),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 112/170 (66%), Positives = 138/170 (81%), Gaps = 8/170 (5%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EEL++HYLK + AS P PV+IIAEVD+YKF+PW+LPAKA FG++EWYFFSPRDRKYPNG 
Sbjct  19    EELILHYLKNRAASFPCPVSIIAEVDIYKFNPWDLPAKAMFGDKEWYFFSPRDRKYPNGI  78

Query  1068  RPNRAATSGYWKATGTDKPVLTAGGTQKVGVKKALVFYGGKPPKGVKTNWIMHEYRLADN  889
             RPNRAA SGYWKATGTDKP++++ G Q +GVKKALVFY G+PPKGVKT+WIMHEYRLAD 
Sbjct  79    RPNRAAASGYWKATGTDKPIISSKGNQNIGVKKALVFYQGRPPKGVKTDWIMHEYRLADA  138

Query  888   KTSN--KPPGLDIANRSKGGSLRLDDWVLCRIYKKNNSQRPLDHESDDLN  745
               +N  +P  L      +  S+RLDDWVLCRIYKK+N    +D + +D++
Sbjct  139   HNNNIYRPMKL------RDTSMRLDDWVLCRIYKKSNHTLSMDRQQEDIS  182



>ref|XP_001771652.1| predicted protein [Physcomitrella patens]
 gb|EDQ63566.1| predicted protein [Physcomitrella patens]
Length=203

 Score =   223 bits (568),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 112/182 (62%), Positives = 136/182 (75%), Gaps = 8/182 (4%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EELV+HYL +K  S    + +IAE+DLYKFDPW+LP KA FGE+EWYFFSPRDRKYPNGA
Sbjct  28    EELVLHYLCRKAESHVFAIPVIAEIDLYKFDPWDLPGKAIFGEREWYFFSPRDRKYPNGA  87

Query  1068  RPNRAATSGYWKATGTDKPVLTA-GGTQKVGVKKALVFYGGKPPKGVKTNWIMHEYRLAD  892
             RPNRAA SGYWKATGTDKP+ T+ GG +K+GVKKALVFY G+ PKGVKTNWIMHEYRLA+
Sbjct  88    RPNRAAASGYWKATGTDKPIHTSVGGIRKIGVKKALVFYKGRAPKGVKTNWIMHEYRLAE  147

Query  891   NKTSNKPPGLDIANRSKGGSLRLDDWVLCRIYKKNNSQRPLDHESDDLNDMLQGSIPPFV  712
                ++        +  + GSLRLDDWVLCRIYKK+ + +    E D  + + + S   F 
Sbjct  148   GVCAS-------VHAHRKGSLRLDDWVLCRIYKKSTNAQRTGKERDSSSCVEEVSKLSFG  200

Query  711   TH  706
             +H
Sbjct  201   SH  202



>ref|XP_001752718.1| predicted protein [Physcomitrella patens]
 gb|EDQ82589.1| predicted protein [Physcomitrella patens]
Length=205

 Score =   223 bits (568),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 111/160 (69%), Positives = 129/160 (81%), Gaps = 9/160 (6%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EELV+HYL +K  S    + +IAE+DLYKFDPW+LP KA FGE+EWYFFSPRDRKYPNGA
Sbjct  25    EELVLHYLCRKAESKVFAIPVIAEIDLYKFDPWDLPGKAIFGEREWYFFSPRDRKYPNGA  84

Query  1068  RPNRAATSGYWKATGTDKPVLTA-GGTQKVGVKKALVFYGGKPPKGVKTNWIMHEYRLAD  892
             RPNRAA SGYWKATGTDKP+ TA GG +K+GVKKALVFY G+ PKGVKTNWIMHEYRLA+
Sbjct  85    RPNRAAASGYWKATGTDKPIHTAVGGIRKIGVKKALVFYEGRAPKGVKTNWIMHEYRLAE  144

Query  891   NKTSNKPPGLDIANRSKGGSLRLDDWVLCRIYKKN-NSQR  775
                ++        +  + GSLRLDDWVLCRIYKK+ N+QR
Sbjct  145   GVCAS-------VHAHRKGSLRLDDWVLCRIYKKSTNAQR  177



>gb|AFD54030.1| NAC transcription factor NAM-1 [Aegilops sharonensis]
Length=408

 Score =   229 bits (584),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 167/371 (45%), Positives = 204/371 (55%), Gaps = 53/371 (14%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EELVVHYLKKK A  P+PV IIAEVDL+KFDPWELP KATFGEQEWYFFSPRDRKYPNGA
Sbjct  44    EELVVHYLKKKAAKVPLPVTIIAEVDLFKFDPWELPEKATFGEQEWYFFSPRDRKYPNGA  103

Query  1068  RPNRAATSGYWKATGTDKPVLTAGG-----TQKVGVKKALVFYGGKPPKGVKTNWIMHEY  904
             RPNRAATSGYWKATGTDKP+L +G       +K+GVKKALVFY GKPPKG+KTNWIMHEY
Sbjct  104   RPNRAATSGYWKATGTDKPILASGTGCGLVREKLGVKKALVFYRGKPPKGLKTNWIMHEY  163

Query  903   RLAD-NKTSNKPPGLDIANRSKGG-----SLRLDDWVLCRIYKKNNSQRPLDHE-SDDLN  745
             RL D + ++N            GG     SLRLDDWVLCRIYKK N     D + S +  
Sbjct  164   RLTDASGSTNTSRPPPPPPPVTGGSRAAASLRLDDWVLCRIYKKINKAAAGDQQRSTECE  223

Query  744   DMLQGSIPPFVTH-----QKMGLKPSNYG--ALLQTDhhhhhhHMF---DQGLVPGDASL  595
             D ++ ++  +  +        G   S+Y   ++L     H    +F   D GL  G  SL
Sbjct  224   DSMEDAVTAYPLYATAGMAGAGAHGSSYASPSMLHHQDSHFLDGLFTADDAGLSAGATSL  283

Query  594   GGARTAQLPFVPSTPNLLPTKRSLPGLFWNVDDSSANNHHPADASPPTKRFLADN---NE  424
                  A       T   L    S P   +N  D+S     PA   P  + F   N   N 
Sbjct  284   SHLAAAARASPAPTKQFLAPSSSTP---FNWLDAS-----PAGILPQARNFPGFNRSRNV  335

Query  423   ASISRSDEQN---------GSIATLLSHLP-QTPSLHQ-QTMLGA---------LNDGVF  304
              ++S S   +          ++   ++ LP Q  + HQ   +LGA              F
Sbjct  336   GNMSLSSTADMAGAAGNAVNAMPAFMNPLPVQDGTYHQHHVILGAPLAPEATASAATSGF  395

Query  303   RQPYQVSGINW  271
             + P Q+SG+NW
Sbjct  396   QHPVQISGVNW  406



>ref|XP_010938117.1| PREDICTED: NAC transcription factor 29-like [Elaeis guineensis]
Length=339

 Score =   225 bits (574),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 113/170 (66%), Positives = 136/170 (80%), Gaps = 8/170 (5%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EEL++HYL+ + AS P PV+IIAEVD+YKFDPWELPAKA FG++EWYFFSPRDRKYPNG 
Sbjct  18    EELILHYLRNQAASLPCPVSIIAEVDIYKFDPWELPAKAMFGDREWYFFSPRDRKYPNGM  77

Query  1068  RPNRAATSGYWKATGTDKPVLTAGGTQKVGVKKALVFYGGKPPKGVKTNWIMHEYRLADN  889
             RPNR+A SGYWKATGTDKP+  + G + +GVKKALVFY G+PPKGVKTNWIMHEYRLA+ 
Sbjct  78    RPNRSAASGYWKATGTDKPIRLSKGNENIGVKKALVFYKGRPPKGVKTNWIMHEYRLAEP  137

Query  888   KTSNKPPGLDIANRSKGGSLRLDDWVLCRIYKKNNSQRP----LDHESDD  751
             + SN+   +    R +  S+RLDDWVLCRIYKK+N   P    +D E +D
Sbjct  138   ENSNRYKPM----RIRDSSMRLDDWVLCRIYKKSNHLPPVPPLIDREQED  183



>ref|XP_010921289.1| PREDICTED: NAC transcription factor 25-like [Elaeis guineensis]
Length=340

 Score =   225 bits (574),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 121/222 (55%), Positives = 154/222 (69%), Gaps = 10/222 (5%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EEL++HYLK + AS P PV+IIAEVD+YKFDPW+LPAKA FG++EWYFFSPRDRKYPNG 
Sbjct  18    EELILHYLKNRAASVPCPVSIIAEVDIYKFDPWDLPAKAMFGDREWYFFSPRDRKYPNGI  77

Query  1068  RPNRAATSGYWKATGTDKPVLTAGGTQKVGVKKALVFYGGKPPKGVKTNWIMHEYRLADN  889
             RPNRAA SGYWKATGTDKP+ T+ G + +GVKKALVFY G+PPKG+KTNWIMHEYRLA+ 
Sbjct  78    RPNRAAASGYWKATGTDKPIHTSKGNENIGVKKALVFYKGRPPKGLKTNWIMHEYRLAEA  137

Query  888   KTSNKPPGLDIANRSKGGSLRLDDWVLCRIYKKNNSQ----RPLDHESDD--LNDMLQGS  727
             + SN    +   +     S+RLDDWVLCRIYKK++       P+D E +D  + D    +
Sbjct  138   QNSNSYKPMKFGD----SSMRLDDWVLCRIYKKSHHLPSVPTPMDREQEDSGIEDSYYSN  193

Query  726   IPPFVTHQKMGLKPSNYGALLQTDhhhhhhHMFDQGLVPGDA  601
             +        + L  S+  + L  D+    H   +Q  +PG +
Sbjct  194   LTNITPQNPLRLHKSSSISELLEDYSSLSHLFDNQPEIPGSS  235



>ref|XP_004958056.1| PREDICTED: NAC transcription factor NAM-2-like [Setaria italica]
Length=413

 Score =   227 bits (579),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 128/173 (74%), Positives = 140/173 (81%), Gaps = 12/173 (7%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EELVVHYLKKK ASAP+PVAIIAEVDLYKFDPWELP KA+FGE EWYFFSPRDRKYPNGA
Sbjct  39    EELVVHYLKKKAASAPLPVAIIAEVDLYKFDPWELPDKASFGEHEWYFFSPRDRKYPNGA  98

Query  1068  RPNRAATSGYWKATGTDKPVL-TAGGTQKVGVKKALVFYGGKPPKGVKTNWIMHEYRL--  898
             RPNRAATSGYWKATGTDKP+L + G  +KVGVKKALVFY GKPPKG+KTNWIMHEYRL  
Sbjct  99    RPNRAATSGYWKATGTDKPILASTGNREKVGVKKALVFYRGKPPKGLKTNWIMHEYRLAD  158

Query  897   -ADNKTSNKPPGLDIANRSKGGSLRLDDWVLCRIYKKN------NSQRPLDHE  760
              A +  +N+PP    A   K  SLRLDDWVLCRIYKK       + QR ++ E
Sbjct  159   AASSAAANRPP--PGAGGGKATSLRLDDWVLCRIYKKTTKLGAGDQQRSMECE  209



>ref|XP_010931442.1| PREDICTED: NAC transcription factor 29-like [Elaeis guineensis]
Length=341

 Score =   224 bits (572),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 114/168 (68%), Positives = 132/168 (79%), Gaps = 8/168 (5%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EEL+ HYL+ +VAS P PV+IIAEVD+YKFDPW+LP KA FG++EWYFFSPRDRKYPNG 
Sbjct  19    EELIQHYLRNRVASLPCPVSIIAEVDIYKFDPWDLPVKAMFGDREWYFFSPRDRKYPNGI  78

Query  1068  RPNRAATSGYWKATGTDKPVLTAGGTQKVGVKKALVFYGGKPPKGVKTNWIMHEYRLAD-  892
             RPNRAA SGYWKATGTDKP++++ G + +GVKKALVFY G+PPKGVKT WIMHEYRLA  
Sbjct  79    RPNRAAASGYWKATGTDKPIVSSKGNENIGVKKALVFYKGRPPKGVKTGWIMHEYRLAQA  138

Query  891   -NKTSNKPPGLDIANRSKGGSLRLDDWVLCRIYKKNNSQRPLDHESDD  751
              N  S +P  L      +  S+RLDDWVLCRIYKKNN     D E DD
Sbjct  139   LNNNSFRPMKL------RDSSMRLDDWVLCRIYKKNNYTLSTDPEQDD  180



>ref|XP_007030230.1| NAC domain containing protein 47, putative isoform 2 [Theobroma 
cacao]
 gb|EOY10732.1| NAC domain containing protein 47, putative isoform 2 [Theobroma 
cacao]
Length=356

 Score =   225 bits (573),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 117/166 (70%), Positives = 137/166 (83%), Gaps = 16/166 (10%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EEL++HYLKKK++S+P PV+IIA+VD+YKFDPWELPAKA FGE+EWYFFSPRDRKYPNGA
Sbjct  19    EELILHYLKKKLSSSPFPVSIIADVDIYKFDPWELPAKAAFGEKEWYFFSPRDRKYPNGA  78

Query  1068  RPNRAATSGYWKATGTDKPVLTA------GGTQK-VGVKKALVFYGGKPPKGVKTNWIMH  910
             RPNRAA SGYWKATGTDK + T+      GG Q+ +GVKKALVFY G+PPKG+KTNWIMH
Sbjct  79    RPNRAAASGYWKATGTDKVIFTSSMVAGGGGVQENIGVKKALVFYKGRPPKGIKTNWIMH  138

Query  909   EYRLADNKTSNKPPGLDIANR---SKGGSLRLDDWVLCRIYKKNNS  781
             EYRLA+N  SN        NR   SK  S+RLDDWVLCRIYKK+++
Sbjct  139   EYRLAENPNSN------YNNRPVKSKDSSMRLDDWVLCRIYKKSHA  178



>gb|KHN46799.1| NAC domain-containing protein 29 [Glycine soja]
Length=353

 Score =   224 bits (571),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 116/157 (74%), Positives = 130/157 (83%), Gaps = 12/157 (8%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EEL++HYL KKVAS P+ V+IIAEVD+YK DPW+LPAKATFGE+EWYFFSPRDRKYPNGA
Sbjct  19    EELILHYLSKKVASIPLTVSIIAEVDIYKLDPWDLPAKATFGEKEWYFFSPRDRKYPNGA  78

Query  1068  RPNRAATSGYWKATGTDKPVLTA---GGTQKVGVKKALVFYGGKPPKGVKTNWIMHEYRL  898
             RPNRAA SGYWKATGTDK ++T+   G  + VGVKKALVFY G+PPKGVKTNWIMHEYRL
Sbjct  79    RPNRAAASGYWKATGTDKTIVTSLQGGAQESVGVKKALVFYKGRPPKGVKTNWIMHEYRL  138

Query  897   ADNKTSNKPPGLDIANRSKGGSLRLDDWVLCRIYKKN  787
              DN   NKP  L      K  S+RLDDWVLCRIYKK+
Sbjct  139   VDN---NKPIKL------KDSSMRLDDWVLCRIYKKS  166



>gb|AHB63580.1| NAC transcription factor [Glycine max]
Length=353

 Score =   224 bits (571),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 116/157 (74%), Positives = 130/157 (83%), Gaps = 12/157 (8%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EEL++HYL KKVAS P+ V+IIAEVD+YK DPW+LPAKATFGE+EWYFFSPRDRKYPNGA
Sbjct  19    EELILHYLSKKVASIPLTVSIIAEVDIYKLDPWDLPAKATFGEKEWYFFSPRDRKYPNGA  78

Query  1068  RPNRAATSGYWKATGTDKPVLTA---GGTQKVGVKKALVFYGGKPPKGVKTNWIMHEYRL  898
             RPNRAA SGYWKATGTDK ++T+   G  + VGVKKALVFY G+PPKGVKTNWIMHEYRL
Sbjct  79    RPNRAAASGYWKATGTDKTIVTSLQGGAQESVGVKKALVFYKGRPPKGVKTNWIMHEYRL  138

Query  897   ADNKTSNKPPGLDIANRSKGGSLRLDDWVLCRIYKKN  787
              DN   NKP  L      K  S+RLDDWVLCRIYKK+
Sbjct  139   VDN---NKPIKL------KDSSMRLDDWVLCRIYKKS  166



>ref|NP_001236142.1| transcriptional factor NAC11 [Glycine max]
 gb|ACC66315.1| transcriptional factor NAC11 [Glycine max]
 gb|KHN08169.1| NAC domain-containing protein 29 [Glycine soja]
Length=351

 Score =   223 bits (569),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 120/163 (74%), Positives = 134/163 (82%), Gaps = 14/163 (9%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EEL++HYL KKVAS P+PV+IIAEVD+YK DPW+LPAKATFGE+EWYFFSPRDRKYPNGA
Sbjct  19    EELILHYLSKKVASIPLPVSIIAEVDIYKLDPWDLPAKATFGEKEWYFFSPRDRKYPNGA  78

Query  1068  RPNRAATSGYWKATGTDKPVLTA---GGTQKVGVKKALVFYGGKPPKGVKTNWIMHEYRL  898
             RPNRAA SGYWKATGTDK ++T+   G  + VGVKKALVFY G+PPKGVKTNWIMHEYRL
Sbjct  79    RPNRAAASGYWKATGTDKTIVTSLQGGAQESVGVKKALVFYKGRPPKGVKTNWIMHEYRL  138

Query  897   ADNKTSNKPPGLDIANRSKGGSLRLDDWVLCRIYKKNNSQRPL  769
              DN   NKP  L      K  S+RLDDWVLCRIYKK  S+ PL
Sbjct  139   VDN---NKPIKL------KDSSMRLDDWVLCRIYKK--SKHPL  170



>ref|XP_009366417.1| PREDICTED: NAC transcription factor 29-like [Pyrus x bretschneideri]
Length=372

 Score =   224 bits (570),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 124/208 (60%), Positives = 149/208 (72%), Gaps = 14/208 (7%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EEL++HYL KKVAS P+PV++IAEVD+YKFDPWELPAKA FGE+EWYFFSPRDRKYPNGA
Sbjct  19    EELILHYLVKKVASTPLPVSVIAEVDIYKFDPWELPAKAAFGEKEWYFFSPRDRKYPNGA  78

Query  1068  RPNRAATSGYWKATGTDKPVLT-AGGTQKVGVKKALVFYGGKPPKGVKTNWIMHEYRLAD  892
             RPNRAA SGYWKATGTDK ++  +GG Q VGVKKALVFY G+PPKG+KTNWIMHEYRL +
Sbjct  79    RPNRAAASGYWKATGTDKTIVAPSGGGQNVGVKKALVFYKGRPPKGIKTNWIMHEYRLPE  138

Query  891   NKTSNKPPGLDI-ANRSKGGSLRLDDWVLCRIYKKNN-----------SQRPLDHESDDL  748
             N  ++          + K  S+RLDDWVLCRIYKK+N             + +  E D L
Sbjct  139   NPNNHTTTNHHHRVMKLKDLSMRLDDWVLCRIYKKSNVGTSAVALPSDQNQEVQEEEDFL  198

Query  747   NDMLQGSI-PPFVTHQKMGLKPSNYGAL  667
             +D+L  S+  PF       +  SN  +L
Sbjct  199   HDILSPSLKSPFTGLDHNMMSTSNTSSL  226



>ref|XP_008240449.1| PREDICTED: NAC transcription factor 25 [Prunus mume]
Length=384

 Score =   224 bits (571),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 124/187 (66%), Positives = 143/187 (76%), Gaps = 14/187 (7%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EEL++HYL KKVAS P+PV+IIAEVD+YKFDPWELPAKA FGE+EWYFFSPRDRKYPNGA
Sbjct  20    EELILHYLTKKVASTPLPVSIIAEVDIYKFDPWELPAKAAFGEKEWYFFSPRDRKYPNGA  79

Query  1068  RPNRAATSGYWKATGTDKPVLTA-GGTQKVGVKKALVFYGGKPPKGVKTNWIMHEYRLAD  892
             RPNRAA SGYWKATGTDK ++ + GG Q VGVKKALVFY G+PPKG+KTNWIMHEYRL +
Sbjct  80    RPNRAAASGYWKATGTDKTIVASLGGRQNVGVKKALVFYKGRPPKGIKTNWIMHEYRLPE  139

Query  891   NKTSNKPPGLDIANRSKGGSLRLDDWVLCRIYKKNNSQR-----PLDH------ESDDLN  745
             N   N         + K  S+RLDDWVLCRIYKK+N        P+DH      E D L+
Sbjct  140   N--PNNYTTTSKTMKLKDLSMRLDDWVLCRIYKKSNVSSSAAVPPIDHEEEVEEEEDFLH  197

Query  744   DMLQGSI  724
             D+L  S+
Sbjct  198   DVLLPSL  204



>ref|XP_009406848.1| PREDICTED: NAC transcription factor 29-like [Musa acuminata subsp. 
malaccensis]
Length=345

 Score =   223 bits (567),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 111/170 (65%), Positives = 133/170 (78%), Gaps = 8/170 (5%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EEL++HYL+ + +S P PV+IIAEVD+YKFDPW+LPAKA FGEQEWYFFSPRDRKYPNG 
Sbjct  18    EELILHYLRNQASSVPCPVSIIAEVDIYKFDPWDLPAKAMFGEQEWYFFSPRDRKYPNGV  77

Query  1068  RPNRAATSGYWKATGTDKPVLTAGGTQKVGVKKALVFYGGKPPKGVKTNWIMHEYRLADN  889
             RPNRAA SGYWKATGTDKP+  +GG + +GVKKALVFY G+PP+G KTNWIMHEYRLA+ 
Sbjct  78    RPNRAAASGYWKATGTDKPIHRSGGNEHIGVKKALVFYKGRPPRGRKTNWIMHEYRLAEA  137

Query  888   KTSNKPPGLDIANRSKGGSLRLDDWVLCRIYKKNNSQRP----LDHESDD  751
                N    +   N     S+RLDDWVLCRIYKKN++ +     +D E +D
Sbjct  138   HHGNTYKPMKFKN----ASMRLDDWVLCRIYKKNHNLQSVPPLVDQEQED  183



>gb|KHG14643.1| NAC domain-containing 29 -like protein [Gossypium arboreum]
Length=356

 Score =   223 bits (568),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 116/166 (70%), Positives = 135/166 (81%), Gaps = 16/166 (10%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EEL++HYLKKK+ S+P PV+IIA+VD+YKFDPW+LP KA FGE+EWYFFSPRDRKYPNGA
Sbjct  21    EELILHYLKKKITSSPFPVSIIADVDIYKFDPWDLPGKAAFGEKEWYFFSPRDRKYPNGA  80

Query  1068  RPNRAATSGYWKATGTDKPVLTA------GGTQK-VGVKKALVFYGGKPPKGVKTNWIMH  910
             RPNRAA SGYWKATGTDK ++T+      G  Q+ +GVKKALVFY G+PPKG+KTNWIMH
Sbjct  81    RPNRAAASGYWKATGTDKVIVTSSMADRRGEVQENIGVKKALVFYKGRPPKGMKTNWIMH  140

Query  909   EYRLADNKTSNKPPGLDIANR---SKGGSLRLDDWVLCRIYKKNNS  781
             EYRLADN  SN        NR   SK  S+RLDDWVLCRIYKK+N+
Sbjct  141   EYRLADNPNSN------FNNRPLKSKDSSMRLDDWVLCRIYKKSNA  180



>ref|XP_008782759.1| PREDICTED: NAC transcription factor 25-like [Phoenix dactylifera]
Length=339

 Score =   222 bits (566),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 111/170 (65%), Positives = 134/170 (79%), Gaps = 8/170 (5%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EEL++HYL+ + AS P PV+IIAEVD+YKFDPW+LPAKA FG++EWYFFSPRDRKYPNG 
Sbjct  18    EELILHYLRNRAASVPCPVSIIAEVDIYKFDPWDLPAKAMFGDREWYFFSPRDRKYPNGI  77

Query  1068  RPNRAATSGYWKATGTDKPVLTAGGTQKVGVKKALVFYGGKPPKGVKTNWIMHEYRLADN  889
             RPNRAA SGYWKATGTDKP+ T+ G + +GVKKALVFY G+PPKG+KTNWIMHEYRL + 
Sbjct  78    RPNRAAASGYWKATGTDKPIRTSKGNENIGVKKALVFYMGRPPKGLKTNWIMHEYRLFEA  137

Query  888   KTSNKPPGLDIANRSKGGSLRLDDWVLCRIYKKNNS----QRPLDHESDD  751
             + SN    +      +  S+RLDDWVLCRIYKK+N       P+D E +D
Sbjct  138   QNSNNYKPMKF----RDSSMRLDDWVLCRIYKKSNHLPSVPPPMDREQED  183



>gb|ACI15346.1| NAC domain protein NAC5 [Gossypium hirsutum]
 gb|ACI15351.1| NAC domain protein NAC5 [Gossypium hirsutum]
Length=356

 Score =   223 bits (567),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 116/166 (70%), Positives = 135/166 (81%), Gaps = 16/166 (10%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EEL++HYLKKK+ S+P PV+IIA+VD+YKFDPW+LP KA FGE+EWYFFSPRDRKYPNGA
Sbjct  21    EELILHYLKKKITSSPFPVSIIADVDIYKFDPWDLPDKAAFGEKEWYFFSPRDRKYPNGA  80

Query  1068  RPNRAATSGYWKATGTDKPVLTA------GGTQK-VGVKKALVFYGGKPPKGVKTNWIMH  910
             RPNRAA SGYWKATGTDK ++T+      G  Q+ +GVKKALVFY G+PPKG+KTNWIMH
Sbjct  81    RPNRAAASGYWKATGTDKVIVTSSMADRRGEVQENIGVKKALVFYKGRPPKGMKTNWIMH  140

Query  909   EYRLADNKTSNKPPGLDIANR---SKGGSLRLDDWVLCRIYKKNNS  781
             EYRLADN  SN        NR   SK  S+RLDDWVLCRIYKK+N+
Sbjct  141   EYRLADNPNSN------FNNRPLKSKDSSMRLDDWVLCRIYKKSNA  180



>ref|XP_009345059.1| PREDICTED: NAC transcription factor 29-like [Pyrus x bretschneideri]
Length=372

 Score =   223 bits (568),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 119/188 (63%), Positives = 142/188 (76%), Gaps = 13/188 (7%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EEL++HYL KKVAS P+PV++IAEVD+YKFDPWELPAKA FGE+EWYFFSPRDRKYPNGA
Sbjct  19    EELILHYLVKKVASTPLPVSVIAEVDIYKFDPWELPAKAAFGEKEWYFFSPRDRKYPNGA  78

Query  1068  RPNRAATSGYWKATGTDKPVLT-AGGTQKVGVKKALVFYGGKPPKGVKTNWIMHEYRLAD  892
             RPNRAA SGYWKATGTDK ++  +GG Q VGVKKALVFY G+PPKG+KTNWIMHEYRL +
Sbjct  79    RPNRAAASGYWKATGTDKTIVAPSGGGQNVGVKKALVFYKGRPPKGIKTNWIMHEYRLPE  138

Query  891   NKTSNKPPGLDI-ANRSKGGSLRLDDWVLCRIYKKNN-----------SQRPLDHESDDL  748
             N  ++          + K  S+RLDDWVLCRIYKK+N             + +  E D L
Sbjct  139   NPNNHTTTNHHHRVMKLKDLSMRLDDWVLCRIYKKSNVGTSAVALPSDQNQEVQEEEDFL  198

Query  747   NDMLQGSI  724
             +D+L  S+
Sbjct  199   HDILSPSL  206



>ref|XP_007030229.1| NAC domain containing protein 47, putative isoform 1 [Theobroma 
cacao]
 gb|EOY10731.1| NAC domain containing protein 47, putative isoform 1 [Theobroma 
cacao]
Length=422

 Score =   224 bits (571),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 115/163 (71%), Positives = 137/163 (84%), Gaps = 10/163 (6%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EEL++HYLKKK++S+P PV+IIA+VD+YKFDPWELPAKA FGE+EWYFFSPRDRKYPNGA
Sbjct  85    EELILHYLKKKLSSSPFPVSIIADVDIYKFDPWELPAKAAFGEKEWYFFSPRDRKYPNGA  144

Query  1068  RPNRAATSGYWKATGTDKPVLTA------GGTQK-VGVKKALVFYGGKPPKGVKTNWIMH  910
             RPNRAA SGYWKATGTDK + T+      GG Q+ +GVKKALVFY G+PPKG+KTNWIMH
Sbjct  145   RPNRAAASGYWKATGTDKVIFTSSMVAGGGGVQENIGVKKALVFYKGRPPKGIKTNWIMH  204

Query  909   EYRLADNKTSNKPPGLDIANRSKGGSLRLDDWVLCRIYKKNNS  781
             EYRLA+N  SN     +   +SK  S+RLDDWVLCRIYKK+++
Sbjct  205   EYRLAENPNSNYN---NRPVKSKDSSMRLDDWVLCRIYKKSHA  244



>ref|XP_008442252.1| PREDICTED: NAC transcription factor 25-like [Cucumis melo]
Length=367

 Score =   222 bits (566),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 151/357 (42%), Positives = 202/357 (57%), Gaps = 51/357 (14%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EELVVHYL +K++S+P+P  IIAE+DLYKFDPW+LP+KA FG+ EWYFF+PR+RKYPNGA
Sbjct  33    EELVVHYLTRKLSSSPLPAPIIAELDLYKFDPWDLPSKAVFGKNEWYFFTPRERKYPNGA  92

Query  1068  RPNRAATSGYWKATGTDKPVLTA------------------GGTQKVGVKKALVFYGGKP  943
             RPNRAA SGYWKATGTDKP+++                    G QKVGVKKALVFYGG+P
Sbjct  93    RPNRAAISGYWKATGTDKPIMSCNYNINNNGSNNNNNNNNNNGIQKVGVKKALVFYGGRP  152

Query  942   PKGVKTNWIMHEYRLADNKTSNKPPGLDIANRSKGGSLRLDDWVLCRIYKKNNSQRP-LD  766
             PKGVKTNWIMHEYRL     +N  P           SL+LDDWVLCRIY KN +Q   +D
Sbjct  153   PKGVKTNWIMHEYRLLHLPNNNPNPLHPHLTNPTKPSLKLDDWVLCRIYMKNIAQASIID  212

Query  765   HESDDLNDMLQGSIPPFVT----HQKMGLKPSNYGALLQTDhhhhhhHMFDQGLVPGDAS  598
              E ++L+ +   + PP       H+  G    +  AL                   GD  
Sbjct  213   REMEELSRV--AARPPKTVVGGGHKGTGNCYMDVVAL----------------STEGDHD  254

Query  597   LGGARTAQLPFVPSTPNL-LPTKRSLPGLFWNVDDSSANNHHPADASPPTKRFLADNNE-  424
             +          +   P+    +KR L    W+   ++A+N    +   P +  L ++   
Sbjct  255   IINNHQNNSNNISELPSSNCSSKRGLTCQLWSSGGATASN----EGGKPLRLDLMNSYSG  310

Query  423   -ASISRSDEQNGSIATLLSHLPQTPSLHQQT--MLGALNDGVFRQPYQV-SGINWYS  265
              A+ + ++E   S  +LL+ LP   +  Q    ++G+LNDGV RQ +Q+ + INW S
Sbjct  311   GATTAGTEENTVSYMSLLNQLPVQNAAFQSGAPLIGSLNDGVLRQHFQLPTNINWNS  367



>gb|EPS59407.1| hypothetical protein M569_15400, partial [Genlisea aurea]
Length=171

 Score =   216 bits (549),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 114/166 (69%), Positives = 130/166 (78%), Gaps = 6/166 (4%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EELV+ YLK+KVA AP+P +IIA++DLYKFDPWELP KA FGE  WYFF+PR+RKYPNGA
Sbjct  12    EELVIDYLKRKVAGAPLPASIIADIDLYKFDPWELPDKALFGEHVWYFFTPRERKYPNGA  71

Query  1068  RPNRAATSGYWKATGTDKPVLTAGGTQKVGVKKALVFYGGKPPKGVKTNWIMHEYRLADN  889
             RPNRAA SGYWKATGTDK ++  GG  +VGVKKALVFY GKPPKG+KTNWIMHEYRL DN
Sbjct  72    RPNRAAISGYWKATGTDKSIMAEGGASRVGVKKALVFYTGKPPKGLKTNWIMHEYRLVDN  131

Query  888   KTSNKPPGLDIANRSKGGSLRLDDWVLCRIYKKNNSQRPLDHESDD  751
                  P  L     S+  S RLD+WVLCRIY+K  + RP DHE  D
Sbjct  132   NPGPIPEFL-----SRRDSSRLDEWVLCRIYEKRAASRP-DHEYRD  171



>dbj|BAF36563.1| NAC domain protein [Cymbidium hybrid cultivar]
Length=339

 Score =   221 bits (563),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 113/196 (58%), Positives = 146/196 (74%), Gaps = 9/196 (5%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EEL++HYL+ + AS+P P +IIAEVD+YKFDPW+LP KA FG++EWYFF+PRDRKYPNG 
Sbjct  19    EELILHYLRNRAASSPCPASIIAEVDIYKFDPWDLPEKAAFGDREWYFFTPRDRKYPNGN  78

Query  1068  RPNRAATSGYWKATGTDKPVLTAGGTQKVGVKKALVFYGGKPPKGVKTNWIMHEYRLADN  889
             RPNRAA SGYWKATGTDKP+  + G++ +GVKKALVFY G+PPKG+KTNWIMHE+RLAD 
Sbjct  79    RPNRAAGSGYWKATGTDKPI--SSGSENIGVKKALVFYKGRPPKGLKTNWIMHEFRLADA  136

Query  888   KTSNKPPGLDIANRSKGGSLRLDDWVLCRIYKKNNSQRPLDHESDDLNDMLQGSIPPFVT  709
               SN    +    R +  S+RLDDWVLCRIY+K+N   P + + +  +   + +  P + 
Sbjct  137   NKSNSYKPI----RLRDHSMRLDDWVLCRIYRKSNHLSPTEMDQEQEDPCGEETCFPAMQ  192

Query  708   HQKMGLKPSNYGALLQ  661
             +Q M   P N+G  LQ
Sbjct  193   NQMM---PMNHGMKLQ  205



>ref|NP_001238061.1| NAC domain protein [Glycine max]
 gb|ACD39371.1| NAC domain protein [Glycine max]
Length=353

 Score =   221 bits (564),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 114/157 (73%), Positives = 129/157 (82%), Gaps = 12/157 (8%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EEL++HYL KKVAS P+ V+IIAEVD+YK DPW+LPAKATFGE+EWYFFSPRDRKYPNGA
Sbjct  19    EELILHYLSKKVASIPLTVSIIAEVDIYKLDPWDLPAKATFGEKEWYFFSPRDRKYPNGA  78

Query  1068  RPNRAATSGYWKATGTDKPVLTA---GGTQKVGVKKALVFYGGKPPKGVKTNWIMHEYRL  898
             RPNRAA SGYWKATGTDK ++T+   G  +  GVKKALVFY G+PPKGVKTNWIMHEYRL
Sbjct  79    RPNRAAASGYWKATGTDKTIVTSLQGGAQESAGVKKALVFYKGRPPKGVKTNWIMHEYRL  138

Query  897   ADNKTSNKPPGLDIANRSKGGSLRLDDWVLCRIYKKN  787
              DN   NKP  +      K  S+RLDDWVLCRIYKK+
Sbjct  139   VDN---NKPIKI------KDSSMRLDDWVLCRIYKKS  166



>ref|XP_001769642.1| predicted protein [Physcomitrella patens]
 gb|EDQ65443.1| predicted protein [Physcomitrella patens]
Length=207

 Score =   216 bits (551),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 113/178 (63%), Positives = 135/178 (76%), Gaps = 10/178 (6%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EELV+HYL++K  S    + +IAEV+LYKFDPW+LP KA FGE+EWYFFSPRDRKYPNGA
Sbjct  23    EELVLHYLRRKADSHVFQIPVIAEVNLYKFDPWDLPDKALFGEREWYFFSPRDRKYPNGA  82

Query  1068  RPNRAATSGYWKATGTDKPVLTAGGTQKVGVKKALVFYGGKPPKGVKTNWIMHEYRLADN  889
             RPNRAA SGYWKATGTDKP+    G  KVGVKKALVFY GK PKG KTNWIMHEYRLA+ 
Sbjct  83    RPNRAAASGYWKATGTDKPIHMTNGHSKVGVKKALVFYRGKAPKGEKTNWIMHEYRLAEG  142

Query  888   KTSNKPPGLDIANRSKGGSLRLDDWVLCRIYKK-NNSQRP-LDHESDDLNDMLQGSIP  721
              + +       A+  + GSLRLDDWVLCRIY+K  ++QR   +H+   + D+L  S+P
Sbjct  143   VSPS-------AHHHRRGSLRLDDWVLCRIYEKCTHAQRAGKEHDRASVEDVL-ASLP  192



>gb|AGC97438.1| NAC protein 8 [Gossypium hirsutum]
Length=356

 Score =   221 bits (564),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 115/166 (69%), Positives = 135/166 (81%), Gaps = 16/166 (10%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EEL++HYLKKK+ S+P PV+IIA+VD+YKFDPW+LP KA FGE+EWYFFSPRDRKYPNGA
Sbjct  21    EELILHYLKKKITSSPFPVSIIADVDIYKFDPWDLPGKAAFGEKEWYFFSPRDRKYPNGA  80

Query  1068  RPNRAATSGYWKATGTDKPVLTA------GGTQK-VGVKKALVFYGGKPPKGVKTNWIMH  910
             RPNRAA SGYWKATGTDK ++T+      G  Q+ +GVKKALVFY G+PPKG+KT+WIMH
Sbjct  81    RPNRAAASGYWKATGTDKVIVTSSMADRRGEVQENIGVKKALVFYKGRPPKGMKTDWIMH  140

Query  909   EYRLADNKTSNKPPGLDIANR---SKGGSLRLDDWVLCRIYKKNNS  781
             EYRLADN  SN        NR   SK  S+RLDDWVLCRIYKK+N+
Sbjct  141   EYRLADNPNSN------FNNRPLKSKDSSMRLDDWVLCRIYKKSNA  180



>ref|XP_002319143.2| hypothetical protein POPTR_0013s05080g [Populus trichocarpa]
 gb|EEE95066.2| hypothetical protein POPTR_0013s05080g [Populus trichocarpa]
Length=368

 Score =   221 bits (564),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 113/164 (69%), Positives = 133/164 (81%), Gaps = 11/164 (7%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EEL++HYLKKK+AS P PV+IIA+VD+YKFDPW+LPAKA+ GE+EWYFFSPRDRKYPNGA
Sbjct  19    EELILHYLKKKLASTPFPVSIIADVDIYKFDPWDLPAKASLGEKEWYFFSPRDRKYPNGA  78

Query  1068  RPNRAATSGYWKATGTDKPVLTA--------GGTQKVGVKKALVFYGGKPPKGVKTNWIM  913
             RPNRAA SGYWKATGTDK ++ +        GG + +GVKKALVFY GKPPKGVKTNWIM
Sbjct  79    RPNRAAASGYWKATGTDKIIMASTMAPGGVVGGQENIGVKKALVFYKGKPPKGVKTNWIM  138

Query  912   HEYRLADNKTSNKPPGLDIANRSKGGSLRLDDWVLCRIYKKNNS  781
             HEYRLADN   N       + + K  S+RLDDWVLCRIYKK+++
Sbjct  139   HEYRLADNPACNNNKK---SMKPKDSSMRLDDWVLCRIYKKSHA  179



>ref|XP_004493136.1| PREDICTED: NAC transcription factor 25-like [Cicer arietinum]
Length=335

 Score =   220 bits (561),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 119/179 (66%), Positives = 136/179 (76%), Gaps = 16/179 (9%)
 Frame = -2

Query  1245  ELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGAR  1066
             EL++HYL+KK+AS P+PV+IIAEVD+YK DPWELPAKA+FGE+EWYFFSPRDRKYPNGAR
Sbjct  20    ELILHYLRKKIASIPLPVSIIAEVDIYKLDPWELPAKASFGEKEWYFFSPRDRKYPNGAR  79

Query  1065  PNRAATSGYWKATGTDKPV---LTAGGTQK----VGVKKALVFYGGKPPKGVKTNWIMHE  907
             PNRAA SGYWKATGTDK +   L +GG +     +GVKKALVFY GKPPKGVKTNWIMHE
Sbjct  80    PNRAAASGYWKATGTDKTIVASLPSGGRRSHDNIIGVKKALVFYKGKPPKGVKTNWIMHE  139

Query  906   YRLADNKTSNKPPGLDIANRSKGGSLRLDDWVLCRIYKKNNSQRPLDHESDDLNDMLQG  730
             YRL DN   NKP  L      K  S+RLDDWVLCRIYKK+     L      + D+ Q 
Sbjct  140   YRLVDN---NKPIKL------KDSSMRLDDWVLCRIYKKSKCALSLTEAETMVGDVDQA  189



>ref|XP_007202090.1| hypothetical protein PRUPE_ppa007445mg [Prunus persica]
 gb|EMJ03289.1| hypothetical protein PRUPE_ppa007445mg [Prunus persica]
Length=367

 Score =   221 bits (564),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 124/187 (66%), Positives = 143/187 (76%), Gaps = 14/187 (7%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EEL++HYL KKVAS P+PV+IIAEVD+YKFDPWELPAKA FGE+EWYFFSPRDRKYPNGA
Sbjct  20    EELILHYLTKKVASTPLPVSIIAEVDIYKFDPWELPAKAAFGEKEWYFFSPRDRKYPNGA  79

Query  1068  RPNRAATSGYWKATGTDKPVLTA-GGTQKVGVKKALVFYGGKPPKGVKTNWIMHEYRLAD  892
             RPNRAA SGYWKATGTDK ++ + GG Q VGVKKALVFY G+PPKG+KTNWIMHEYRL +
Sbjct  80    RPNRAAASGYWKATGTDKTIVASLGGRQNVGVKKALVFYKGRPPKGIKTNWIMHEYRLPE  139

Query  891   NKTSNKPPGLDIANRSKGGSLRLDDWVLCRIYKKNNSQR-----PLDH------ESDDLN  745
             N   N         + K  S+RLDDWVLCRIYKK+N        P+DH      E D L+
Sbjct  140   N--PNNYTTTTKTMKLKDLSMRLDDWVLCRIYKKSNVSSSAAVPPIDHEEEVEEEEDFLH  197

Query  744   DMLQGSI  724
             D+L  S+
Sbjct  198   DVLLPSL  204



>ref|XP_003548053.1| PREDICTED: NAC transcription factor NAM-2 [Glycine max]
 gb|KHN32743.1| NAC domain-containing protein 29 [Glycine soja]
Length=363

 Score =   221 bits (563),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 118/156 (76%), Positives = 131/156 (84%), Gaps = 12/156 (8%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EEL++HYL+KKVAS P+PVAIIAEVD+YKFDPWELPAKA FGE+EWYFFSPRDRKYPNGA
Sbjct  20    EELILHYLRKKVASIPLPVAIIAEVDIYKFDPWELPAKAAFGEKEWYFFSPRDRKYPNGA  79

Query  1068  RPNRAATSGYWKATGTDKPVLT--AGGTQK-VGVKKALVFYGGKPPKGVKTNWIMHEYRL  898
             RPNRAA SGYWKATGTDK ++   AGG ++  GVKKALVFY GKPPKGVKTNWIMHEYRL
Sbjct  80    RPNRAAASGYWKATGTDKNIVASLAGGVREHFGVKKALVFYKGKPPKGVKTNWIMHEYRL  139

Query  897   ADNKTSNKPPGLDIANRSKGGSLRLDDWVLCRIYKK  790
              D   +N+P       R K  S+RLDDWVLCRIYKK
Sbjct  140   VD---TNRPI------RIKDTSMRLDDWVLCRIYKK  166



>ref|XP_007027296.1| NAC domain protein, IPR003441, putative [Theobroma cacao]
 gb|EOY07798.1| NAC domain protein, IPR003441, putative [Theobroma cacao]
Length=362

 Score =   221 bits (562),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 107/158 (68%), Positives = 129/158 (82%), Gaps = 9/158 (6%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EEL+VHYLK KV S+P+P +IIAE+DLYK++PWELP+KA FGE EWYFFSPRDRKYPNGA
Sbjct  34    EELIVHYLKNKVTSSPLPASIIAEIDLYKYNPWELPSKALFGEDEWYFFSPRDRKYPNGA  93

Query  1068  RPNRAATSGYWKATGTDKPVLTAGGTQKVGVKKALVFYGGKPPKGVKTNWIMHEYRLADN  889
             RPNRAA SGYWKATGTDKP+LT+ GT+ +GVKKALVFY G+PP+G KT WIMHEYRL + 
Sbjct  94    RPNRAAASGYWKATGTDKPILTSCGTESIGVKKALVFYEGRPPRGTKTEWIMHEYRLRET  153

Query  888   KTSNKPPGLDIANRSKGGSLRLDDWVLCRIYKKNNSQR  775
                       I    + GS+RLDDWVLCR+ +K+++QR
Sbjct  154   M---------IWTPKRKGSMRLDDWVLCRVRQKSSTQR  182



>ref|XP_009353167.1| PREDICTED: NAC transcription factor 29-like [Pyrus x bretschneideri]
Length=373

 Score =   221 bits (563),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 123/205 (60%), Positives = 148/205 (72%), Gaps = 24/205 (12%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EEL++HYL KKVAS P+PV+IIAEVD+YKFDPWELPAKA FGE+EWYFFSPRDRKYPNGA
Sbjct  19    EELILHYLIKKVASTPLPVSIIAEVDIYKFDPWELPAKAAFGEKEWYFFSPRDRKYPNGA  78

Query  1068  RPNRAATSGYWKATGTDKPVLT-AGGTQKVGVKKALVFYGGKPPKGVKTNWIMHEYRLAD  892
             RPNRAA SGYWKATGTDK ++  +GG Q VGVKKALVFY G+PPKG+KTNWIMHEYRL +
Sbjct  79    RPNRAAASGYWKATGTDKTIVAPSGGRQNVGVKKALVFYKGRPPKGIKTNWIMHEYRLPE  138

Query  891   N-----KTSNKPPGLDIANRSKGGSLRLDDWVLCRIYKK-----------NNSQRPLDHE  760
             +      T+N    + + +     S+RLDDWVLCRIYKK           N+  + +  E
Sbjct  139   SPNNYTTTTNHHRAMKLNDL----SMRLDDWVLCRIYKKSNVVTSAAALPNDQDQDVQGE  194

Query  759   SDDLNDMLQGSIP---PFVTHQKMG  694
              D L+D+L  S+    P + H  M 
Sbjct  195   EDFLHDILLPSLKSPFPILDHNMMS  219



>ref|XP_009392736.1| PREDICTED: NAC domain-containing protein 67-like [Musa acuminata 
subsp. malaccensis]
Length=322

 Score =   219 bits (559),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 106/155 (68%), Positives = 126/155 (81%), Gaps = 4/155 (3%)
 Frame = -2

Query  1248  EELVVHYLKKKvasapipvaiiAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGA  1069
             EEL++HYL+ + +++P PV IIAEVD+YK+DPW+LPAKA +G++EWYFFSPRDRKYPNG 
Sbjct  18    EELILHYLRNRASASPCPVPIIAEVDIYKYDPWDLPAKAAYGDREWYFFSPRDRKYPNGF  77

Query  1068  RPNRAATSGYWKATGTDKPVLTAGGTQKVGVKKALVFYGGKPPKGVKTNWIMHEYRLADN  889
             RPNRAA SGYWKATGTDKP+    G + VGVKKALVFY G+PPKGVKTNWIMHEYRLA+ 
Sbjct  78    RPNRAAASGYWKATGTDKPIHATHGNESVGVKKALVFYRGRPPKGVKTNWIMHEYRLAEA  137

Query  888   KTSNKPPGLDIANRSKGGSLRLDDWVLCRIYKKNN  784
               SN    +    +    S+RLDDWVLCRIYKKNN
Sbjct  138   HASNSYRPV----KPSDSSMRLDDWVLCRIYKKNN  168



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3153915041376