BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c9802_g1_i1 len=1566 path=[1544:0-1168 2713:1169-1565]

Length=1566
                                                                      Score     E

ref|XP_006381548.1|  hypothetical protein POPTR_0006s13740g             573   0.0      
ref|XP_011039901.1|  PREDICTED: pectinesterase                          567   0.0      
ref|XP_011093899.1|  PREDICTED: pectinesterase-like                     565   0.0      
ref|XP_011078156.1|  PREDICTED: pectinesterase                          561   0.0      
ref|XP_007012509.1|  Plant invertase/pectin methylesterase inhibi...    557   0.0      
gb|EYU25795.1|  hypothetical protein MIMGU_mgv1a024664mg                556   0.0      
gb|EYU28292.1|  hypothetical protein MIMGU_mgv1a004362mg                538   0.0      
emb|CDP03022.1|  unnamed protein product                                530   2e-180   
ref|XP_002277293.3|  PREDICTED: probable pectinesterase/pectinest...    530   2e-180   Vitis vinifera
ref|XP_010107089.1|  putative pectinesterase/pectinesterase inhib...    530   2e-180   
ref|XP_002516196.1|  Pectinesterase-2 precursor, putative               529   6e-180   Ricinus communis
ref|XP_007203752.1|  hypothetical protein PRUPE_ppa016574mg             524   3e-178   
gb|KDP33950.1|  hypothetical protein JCGZ_07521                         522   5e-178   
ref|XP_010047430.1|  PREDICTED: pectinesterase                          522   3e-177   
ref|XP_008242147.1|  PREDICTED: pectinesterase                          517   2e-175   
ref|XP_006474559.1|  PREDICTED: probable pectinesterase/pectinest...    514   3e-174   
ref|XP_004287680.1|  PREDICTED: probable pectinesterase/pectinest...    512   5e-174   
gb|KDO73738.1|  hypothetical protein CISIN_1g009418mg                   512   3e-173   
ref|XP_006452911.1|  hypothetical protein CICLE_v10007964mg             511   5e-173   
gb|KDO73740.1|  hypothetical protein CISIN_1g009418mg                   510   9e-173   
ref|XP_007138602.1|  hypothetical protein PHAVU_009G222700g             506   5e-171   
ref|XP_003534978.2|  PREDICTED: LOW QUALITY PROTEIN: probable pec...    506   6e-171   
gb|KDO73739.1|  hypothetical protein CISIN_1g009418mg                   501   3e-169   
ref|XP_010272261.1|  PREDICTED: pectinesterase                          479   1e-160   
gb|KDO73741.1|  hypothetical protein CISIN_1g009418mg                   476   9e-160   
gb|KDO73742.1|  hypothetical protein CISIN_1g009418mg                   465   1e-155   
ref|XP_010541678.1|  PREDICTED: probable pectinesterase/pectinest...    457   6e-152   
ref|XP_009126485.1|  PREDICTED: probable pectinesterase/pectinest...    438   3e-144   
ref|XP_006400651.1|  hypothetical protein EUTSA_v10013149mg             430   4e-141   
ref|XP_010493198.1|  PREDICTED: probable pectinesterase/pectinest...    429   5e-141   
ref|XP_006828612.1|  hypothetical protein AMTR_s00129p00073090          429   6e-141   
gb|EPS62949.1|  pectinesterase                                          424   1e-140   
ref|XP_010420931.1|  PREDICTED: probable pectinesterase/pectinest...    428   2e-140   
ref|XP_010454395.1|  PREDICTED: probable pectinesterase/pectinest...    426   2e-139   
gb|EPS67632.1|  pectinesterase                                          401   9e-132   
ref|XP_002874018.1|  pectinesterase family protein                      400   1e-129   
emb|CDY67251.1|  BnaC02g44290D                                          386   2e-124   
ref|NP_197586.1|  putative pectinesterase/pectinesterase inhibito...    373   2e-119   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006290070.1|  hypothetical protein CARUB_v10003708mg             365   2e-116   
emb|CAA69206.1|  pectinesterase                                         347   3e-113   Carica papaya [mamon]
gb|ABK24761.1|  unknown                                                 358   3e-113   Picea sitchensis
ref|XP_010259481.1|  PREDICTED: pectinesterase-like                     344   3e-107   
gb|ABK24883.1|  unknown                                                 338   5e-105   Picea sitchensis
gb|KHN30453.1|  Pectinesterase 2.2                                      334   7e-105   
ref|XP_010684811.1|  PREDICTED: pectinesterase-like                     336   1e-104   
ref|XP_006573891.1|  PREDICTED: pectinesterase/pectinesterase inh...    335   3e-104   
ref|XP_010930858.1|  PREDICTED: pectinesterase-like                     331   1e-103   
ref|XP_004514851.1|  PREDICTED: pectinesterase 2-like                   332   1e-103   
ref|XP_004492228.1|  PREDICTED: pectinesterase 2.1-like                 333   1e-103   
dbj|BAC67662.1|  pectin methylesterase                                  333   2e-103   Pisum sativum [garden pea]
ref|XP_010672022.1|  PREDICTED: pectinesterase-like                     332   2e-103   
gb|AFK44272.1|  unknown                                                 332   3e-103   
emb|CAA47810.1|  pectinesterase                                         331   8e-103   Pisum sativum [garden pea]
ref|XP_007157172.1|  hypothetical protein PHAVU_002G048700g             331   1e-102   
dbj|BAC67661.1|  pectin methylesterase                                  331   1e-102   Pisum sativum [garden pea]
ref|XP_008232606.1|  PREDICTED: pectinesterase 2                        329   2e-102   
ref|XP_009385345.1|  PREDICTED: pectinesterase-like                     329   2e-102   
gb|AAC14742.1|  pectin methylesterase                                   330   2e-102   Pisum sativum [garden pea]
ref|XP_010271283.1|  PREDICTED: pectinesterase                          329   3e-102   
ref|XP_010271268.1|  PREDICTED: pectinesterase-like                     328   6e-102   
ref|XP_007220661.1|  hypothetical protein PRUPE_ppa004413mg             327   1e-101   
ref|XP_002511679.1|  Pectinesterase-2 precursor, putative               327   1e-101   Ricinus communis
ref|XP_010544633.1|  PREDICTED: probable pectinesterase/pectinest...    327   1e-101   
ref|XP_010056338.1|  PREDICTED: pectinesterase 2-like                   327   1e-101   
ref|XP_010056337.1|  PREDICTED: pectinesterase 2-like                   327   2e-101   
ref|XP_010271269.1|  PREDICTED: pectinesterase-like                     327   2e-101   
ref|XP_010271267.1|  PREDICTED: pectinesterase-like                     327   3e-101   
ref|XP_003517029.1|  PREDICTED: pectinesterase 2-like                   326   3e-101   
ref|XP_006838619.1|  hypothetical protein AMTR_s00002p00230630          326   4e-101   
ref|XP_006576426.1|  PREDICTED: pectinesterase 2-like                   325   1e-100   
gb|KDP28780.1|  hypothetical protein JCGZ_14551                         325   1e-100   
gb|AFK35109.1|  unknown                                                 326   1e-100   
ref|XP_003622688.1|  Pectinesterase                                     326   1e-100   
ref|XP_004306939.1|  PREDICTED: probable pectinesterase/pectinest...    324   1e-100   
gb|AFW03479.1|  pectin methylesterase 5                                 325   1e-100   
ref|XP_003622699.1|  Pectinesterase                                     326   1e-100   
gb|ACJ85768.1|  unknown                                                 326   1e-100   Medicago truncatula
emb|CDO99718.1|  unnamed protein product                                325   1e-100   
ref|XP_010056336.1|  PREDICTED: pectinesterase 2-like                   324   2e-100   
ref|XP_002265599.1|  PREDICTED: pectinesterase 2                        324   2e-100   Vitis vinifera
ref|XP_002265740.2|  PREDICTED: pectinesterase 2-like                   324   2e-100   Vitis vinifera
emb|CAN83663.1|  hypothetical protein VITISV_017689                     323   3e-100   Vitis vinifera
ref|XP_010654104.1|  PREDICTED: pectinesterase                          324   3e-100   
emb|CAD29733.1|  pectin methylesterase                                  325   3e-100   Sesbania rostrata
gb|KHG19575.1|  Uncharacterized protein F383_07269                      323   4e-100   
ref|XP_007157169.1|  hypothetical protein PHAVU_002G048400g             323   9e-100   
ref|XP_010098938.1|  Pectinesterase 2                                   322   9e-100   
gb|KDP38089.1|  hypothetical protein JCGZ_04732                         323   1e-99    
ref|XP_006841486.1|  hypothetical protein AMTR_s00003p00120050          323   1e-99    
ref|XP_008812473.1|  PREDICTED: pectinesterase-like                     322   1e-99    
gb|KHN35617.1|  Pectinesterase 2                                        321   2e-99    
ref|XP_010264200.1|  PREDICTED: pectinesterase 2-like                   321   3e-99    
ref|XP_010273801.1|  PREDICTED: pectinesterase                          323   3e-99    
ref|XP_003521947.1|  PREDICTED: pectinesterase 2-like                   320   4e-99    
ref|XP_011000694.1|  PREDICTED: pectinesterase                          322   4e-99    
ref|XP_010524372.1|  PREDICTED: probable pectinesterase/pectinest...    320   4e-99    
gb|KHG05999.1|  putative pectinesterase/pectinesterase inhibitor ...    322   4e-99    
ref|XP_010910186.1|  PREDICTED: pectinesterase-like                     320   5e-99    
gb|KDP20786.1|  hypothetical protein JCGZ_21257                         321   5e-99    
ref|XP_010259034.1|  PREDICTED: pectinesterase 2-like                   320   6e-99    
ref|XP_004293266.1|  PREDICTED: pectinesterase/pectinesterase inh...    320   6e-99    
ref|XP_006828586.1|  hypothetical protein AMTR_s00129p00044320          322   6e-99    
ref|XP_002523113.1|  Pectinesterase-3 precursor, putative               321   7e-99    Ricinus communis
ref|XP_009628696.1|  PREDICTED: pectinesterase 2                        321   7e-99    
gb|AER38244.1|  PME5                                                    320   8e-99    
ref|XP_003521940.1|  PREDICTED: pectinesterase 2-like                   320   8e-99    
ref|XP_011010963.1|  PREDICTED: pectinesterase-like                     321   9e-99    
ref|XP_011090444.1|  PREDICTED: pectinesterase 2                        320   9e-99    
ref|XP_010056339.1|  PREDICTED: pectinesterase 2-like                   320   9e-99    
ref|XP_008795768.1|  PREDICTED: pectinesterase-like                     320   1e-98    
gb|KCW73020.1|  hypothetical protein EUGRSUZ_E01454                     318   1e-98    
emb|CDO97716.1|  unnamed protein product                                319   2e-98    
emb|CAN76835.1|  hypothetical protein VITISV_043176                     318   2e-98    Vitis vinifera
gb|KEH29121.1|  pectinesterase/pectinesterase inhibitor                 319   2e-98    
ref|XP_010316615.1|  PREDICTED: pectinesterase-like                     320   2e-98    
ref|XP_007157170.1|  hypothetical protein PHAVU_002G048500g             320   2e-98    
ref|XP_008359413.1|  PREDICTED: pectinesterase-like                     321   2e-98    
gb|AFI23414.1|  pectin methylesterase                                   321   2e-98    
gb|AFW03484.1|  pectin methylesterase 5                                 318   3e-98    
ref|XP_007213952.1|  hypothetical protein PRUPE_ppa003697mg             320   3e-98    
ref|XP_007024770.1|  Pectin methylesterase 3 isoform 1                  320   3e-98    
ref|XP_009382521.1|  PREDICTED: pectinesterase-like                     320   3e-98    
ref|XP_009766156.1|  PREDICTED: pectinesterase 2-like                   318   3e-98    
emb|CAN78759.1|  hypothetical protein VITISV_000562                     318   3e-98    Vitis vinifera
ref|XP_007045218.1|  Plant invertase/pectin methylesterase inhibi...    318   3e-98    
ref|XP_004232737.1|  PREDICTED: pectinesterase-like                     319   4e-98    
ref|XP_004492227.1|  PREDICTED: pectinesterase/pectinesterase inh...    319   4e-98    
ref|XP_007012502.1|  Pectin methylesterase 3                            320   4e-98    
ref|XP_004231483.1|  PREDICTED: probable pectinesterase/pectinest...    320   4e-98    
ref|XP_010056335.1|  PREDICTED: pectinesterase 2-like                   318   4e-98    
ref|XP_010062184.1|  PREDICTED: pectinesterase-like                     318   5e-98    
ref|XP_008809854.1|  PREDICTED: pectinesterase-like                     319   5e-98    
ref|XP_010266280.1|  PREDICTED: pectinesterase-like                     318   5e-98    
ref|XP_003622696.1|  Pectinesterase                                     319   5e-98    
ref|XP_009589755.1|  PREDICTED: pectinesterase-like                     319   5e-98    
ref|XP_011076284.1|  PREDICTED: probable pectinesterase/pectinest...    320   5e-98    
ref|XP_007145198.1|  hypothetical protein PHAVU_007G218500g             319   6e-98    
ref|XP_011015915.1|  PREDICTED: pectinesterase-like                     318   7e-98    
ref|XP_004297462.1|  PREDICTED: probable pectinesterase/pectinest...    318   7e-98    
ref|XP_010267745.1|  PREDICTED: pectinesterase                          318   8e-98    
gb|AFB77929.1|  pectin methylesterase                                   319   8e-98    
ref|XP_007052106.1|  Pectinesterase 2                                   317   1e-97    
ref|XP_004171768.1|  PREDICTED: probable pectinesterase/pectinest...    319   1e-97    
emb|CDO97788.1|  unnamed protein product                                320   1e-97    
ref|XP_002317208.1|  pectin methylesterase family protein               318   1e-97    Populus trichocarpa [western balsam poplar]
gb|AHC69829.1|  pectin methylesterase PME2.1                            318   1e-97    
ref|XP_009768199.1|  PREDICTED: pectinesterase 2.1-like                 318   1e-97    
gb|KDP22414.1|  hypothetical protein JCGZ_26245                         317   1e-97    
gb|AGG23325.1|  pectin methylesterase 1                                 318   1e-97    
ref|XP_010101471.1|  Pectinesterase/pectinesterase inhibitor            318   1e-97    
emb|CDX95641.1|  BnaC03g25220D                                          314   1e-97    
ref|XP_002865971.1|  pectinesterase family protein                      318   2e-97    
ref|XP_006841646.1|  hypothetical protein AMTR_s00003p00238240          318   2e-97    
emb|CBI24285.3|  unnamed protein product                                314   2e-97    
gb|ACQ85264.1|  pectin methylesterase                                   318   2e-97    Musa acuminata AAA Group [Cavendish banana]
ref|XP_002271665.2|  PREDICTED: pectinesterase-like                     318   2e-97    Vitis vinifera
ref|XP_009599511.1|  PREDICTED: pectinesterase 2-like                   317   2e-97    
ref|XP_002320714.1|  putative pectin methylesterase LuPME1 family...    316   2e-97    Populus trichocarpa [western balsam poplar]
ref|XP_008235121.1|  PREDICTED: pectinesterase-like                     318   2e-97    
ref|XP_006367330.1|  PREDICTED: probable pectinesterase/pectinest...    318   2e-97    
ref|XP_007160398.1|  hypothetical protein PHAVU_002G318500g             316   2e-97    
ref|XP_006467993.1|  PREDICTED: pectinesterase/pectinesterase inh...    317   2e-97    
gb|AFW03475.1|  pectin methylesterase 1                                 318   2e-97    
ref|XP_006449081.1|  hypothetical protein CICLE_v10014787mg             317   3e-97    
gb|AFW03480.1|  pectin methylesterase 1                                 318   3e-97    
ref|XP_011034009.1|  PREDICTED: pectinesterase 2                        316   3e-97    
ref|XP_006348082.1|  PREDICTED: pectinesterase/pectinesterase inh...    315   3e-97    
ref|XP_004136014.1|  PREDICTED: probable pectinesterase/pectinest...    317   4e-97    
gb|KHN26433.1|  Putative pectinesterase/pectinesterase inhibitor 24     317   4e-97    
ref|XP_006445298.1|  hypothetical protein CICLE_v10019773mg             315   4e-97    
gb|AHB84678.1|  pectin methylesterase                                   317   4e-97    
ref|XP_007141001.1|  hypothetical protein PHAVU_008G158900g             318   4e-97    
ref|XP_006826911.1|  hypothetical protein AMTR_s00010p00161740          315   4e-97    
ref|XP_007134831.1|  hypothetical protein PHAVU_010G079900g             315   5e-97    
ref|XP_009769268.1|  PREDICTED: pectinesterase-like                     316   5e-97    
gb|KHG08631.1|  Pectinesterase 3                                        317   5e-97    
ref|XP_003526361.1|  PREDICTED: putative pectinesterase/pectinest...    317   6e-97    
ref|XP_010264199.1|  PREDICTED: pectinesterase 2-like                   315   6e-97    
ref|XP_004290811.1|  PREDICTED: probable pectinesterase/pectinest...    317   6e-97    
gb|KDP28190.1|  hypothetical protein JCGZ_13961                         312   6e-97    
ref|XP_002264156.1|  PREDICTED: pectinesterase 2                        315   6e-97    Vitis vinifera
gb|AAB67739.1|  pectin methylesterase PME2.1                            316   7e-97    Solanum lycopersicum
gb|KGN44975.1|  Pectinesterase                                          318   7e-97    
ref|NP_001233948.1|  pectinesterase 2.1                                 316   8e-97    
emb|CAB95025.1|  pectin methylesterase                                  317   8e-97    Nicotiana tabacum [American tobacco]
ref|XP_003519757.1|  PREDICTED: probable pectinesterase/pectinest...    316   9e-97    
gb|AFQ23194.1|  pectin methylesterase                                   317   9e-97    
ref|XP_011016647.1|  PREDICTED: pectinesterase-like                     315   1e-96    
emb|CDX83392.1|  BnaA03g21140D                                          312   1e-96    
ref|XP_009762395.1|  PREDICTED: pectinesterase/pectinesterase inh...    316   1e-96    
ref|NP_001275775.1|  pectinesterase 2 precursor                         314   1e-96    
ref|XP_008389982.1|  PREDICTED: pectinesterase                          315   1e-96    
ref|XP_011030843.1|  PREDICTED: pectinesterase-like                     315   2e-96    
ref|XP_006397702.1|  hypothetical protein EUTSA_v10001409mg             314   2e-96    
ref|XP_011015792.1|  PREDICTED: LOW QUALITY PROTEIN: putative pec...    316   2e-96    
ref|XP_002518523.1|  Pectinesterase precursor, putative                 315   2e-96    Ricinus communis
gb|KHN21591.1|  Putative pectinesterase/pectinesterase inhibitor 6      313   2e-96    
ref|XP_006580436.1|  PREDICTED: probable pectinesterase/pectinest...    313   2e-96    
ref|XP_002304257.2|  pectinesterase family protein                      315   2e-96    Populus trichocarpa [western balsam poplar]
ref|XP_002301486.2|  hypothetical protein POPTR_0002s20370g             315   2e-96    Populus trichocarpa [western balsam poplar]
ref|XP_006843574.1|  hypothetical protein AMTR_s00007p00101250          315   2e-96    
gb|KEH24404.1|  pectinesterase/pectinesterase inhibitor                 315   2e-96    
ref|XP_006444399.1|  hypothetical protein CICLE_v100237231mg            314   3e-96    
ref|XP_010101977.1|  putative pectinesterase/pectinesterase inhib...    313   3e-96    
gb|KEH21379.1|  pectinesterase/pectinesterase inhibitor                 314   3e-96    
ref|XP_011031815.1|  PREDICTED: pectinesterase-like                     315   3e-96    
ref|XP_006279604.1|  hypothetical protein CARUB_v10026136mg             315   3e-96    
ref|XP_009133718.1|  PREDICTED: probable pectinesterase/pectinest...    313   3e-96    
ref|NP_200149.1|  pectin methylesterase PCR fragment F                  315   4e-96    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006377839.1|  hypothetical protein POPTR_0011s13830g             314   4e-96    
ref|XP_010044212.1|  PREDICTED: pectinesterase                          314   4e-96    
ref|XP_009383893.1|  PREDICTED: pectinesterase-like                     314   5e-96    
ref|XP_007157171.1|  hypothetical protein PHAVU_002G048600g             313   5e-96    
ref|XP_002324181.2|  pectinesterase family protein                      315   5e-96    Populus trichocarpa [western balsam poplar]
ref|XP_009592542.1|  PREDICTED: pectinesterase-like                     314   5e-96    
ref|XP_004502642.1|  PREDICTED: probable pectinesterase/pectinest...    315   5e-96    
gb|KFK26958.1|  hypothetical protein AALP_AA8G315400                    315   6e-96    
ref|XP_008228106.1|  PREDICTED: pectinesterase 3                        315   6e-96    
ref|XP_010259035.1|  PREDICTED: pectinesterase 2-like                   313   6e-96    
ref|XP_006480001.1|  PREDICTED: probable pectinesterase/pectinest...    314   6e-96    
ref|XP_008224789.1|  PREDICTED: pectinesterase                          313   6e-96    
ref|XP_009589961.1|  PREDICTED: LOW QUALITY PROTEIN: pectinestera...    313   6e-96    
emb|CDY27388.1|  BnaC04g50170D                                          312   7e-96    
gb|AFC98398.1|  pectin methylesterase                                   313   8e-96    
ref|XP_004307817.1|  PREDICTED: pectinesterase 2-like                   310   8e-96    
ref|XP_006360083.1|  PREDICTED: pectinesterase 2.1-like                 313   9e-96    
ref|XP_006360163.1|  PREDICTED: probable pectinesterase/pectinest...    314   9e-96    
emb|CDP00815.1|  unnamed protein product                                312   1e-95    
ref|XP_009378667.1|  PREDICTED: pectinesterase 2-like                   311   1e-95    
ref|XP_010537086.1|  PREDICTED: probable pectinesterase/pectinest...    314   1e-95    
ref|XP_010925933.1|  PREDICTED: probable pectinesterase/pectinest...    313   1e-95    
ref|XP_010915944.1|  PREDICTED: probable pectinesterase/pectinest...    313   1e-95    
gb|KDO85751.1|  hypothetical protein CISIN_1g010441mg                   311   1e-95    
ref|XP_002516186.1|  Pectinesterase-3 precursor, putative               313   1e-95    Ricinus communis
ref|XP_011078159.1|  PREDICTED: pectinesterase-like isoform X1          313   1e-95    
gb|KDO75533.1|  hypothetical protein CISIN_1g008722mg                   312   2e-95    
ref|XP_002302526.1|  putative pectin methylesterase LuPME1 family...    311   2e-95    Populus trichocarpa [western balsam poplar]
ref|XP_009118185.1|  PREDICTED: pectinesterase/pectinesterase inh...    312   2e-95    
ref|XP_002280446.1|  PREDICTED: pectinesterase 2                        311   2e-95    Vitis vinifera
ref|XP_002318284.2|  pectinesterase family protein                      311   2e-95    Populus trichocarpa [western balsam poplar]
ref|XP_010269596.1|  PREDICTED: pectinesterase-like                     312   2e-95    
sp|O04887.1|PME2_CITSI  RecName: Full=Pectinesterase 2; Short=PE ...    311   2e-95    Citrus sinensis [apfelsine]
ref|XP_008438193.1|  PREDICTED: pectinesterase 2                        311   2e-95    
ref|XP_011016743.1|  PREDICTED: pectinesterase-like                     312   2e-95    
ref|XP_010684346.1|  PREDICTED: pectinesterase-like                     313   2e-95    
ref|XP_010656074.1|  PREDICTED: pectinesterase-like                     313   2e-95    
ref|XP_002265171.1|  PREDICTED: pectinesterase                          313   2e-95    Vitis vinifera
ref|XP_009783075.1|  PREDICTED: pectinesterase-like                     312   3e-95    
ref|XP_010271372.1|  PREDICTED: pectinesterase-like                     311   3e-95    
ref|XP_006578909.1|  PREDICTED: probable pectinesterase/pectinest...    312   4e-95    
emb|CAN77092.1|  hypothetical protein VITISV_026596                     310   4e-95    Vitis vinifera
ref|XP_010271266.1|  PREDICTED: pectinesterase-like                     311   4e-95    
ref|XP_010932734.1|  PREDICTED: pectinesterase-like                     310   4e-95    
ref|XP_010518135.1|  PREDICTED: probable pectinesterase/pectinest...    310   5e-95    
ref|XP_002522859.1|  Pectinesterase-2 precursor, putative               311   5e-95    Ricinus communis
ref|XP_010508199.1|  PREDICTED: probable pectinesterase/pectinest...    310   5e-95    
gb|EAY76103.1|  hypothetical protein OsI_04029                          311   6e-95    Oryza sativa Indica Group [Indian rice]
ref|XP_004503381.1|  PREDICTED: probable pectinesterase/pectinest...    311   6e-95    
gb|EYU29496.1|  hypothetical protein MIMGU_mgv1a003055mg                312   6e-95    
ref|XP_010047424.1|  PREDICTED: pectinesterase-like                     311   6e-95    
ref|XP_010506460.1|  PREDICTED: probable pectinesterase/pectinest...    310   6e-95    
ref|XP_004498516.1|  PREDICTED: probable pectinesterase/pectinest...    312   7e-95    
ref|NP_001044480.1|  Os01g0788400                                       310   8e-95    Oryza sativa Japonica Group [Japonica rice]
ref|XP_006293950.1|  hypothetical protein CARUB_v10022941mg             310   8e-95    
ref|XP_009596446.1|  PREDICTED: probable pectinesterase/pectinest...    312   8e-95    
gb|AAK69696.1|AF355057_1  putative pectin methylesterase LuPME5         310   9e-95    Linum usitatissimum
ref|XP_010534986.1|  PREDICTED: pectinesterase/pectinesterase inh...    311   1e-94    
ref|XP_004511148.1|  PREDICTED: probable pectinesterase/pectinest...    311   1e-94    
gb|KHN08672.1|  Putative pectinesterase/pectinesterase inhibitor 40     308   1e-94    
ref|XP_010029512.1|  PREDICTED: pectinesterase-like                     311   1e-94    
ref|XP_011076334.1|  PREDICTED: probable pectinesterase/pectinest...    308   1e-94    
ref|XP_011017474.1|  PREDICTED: pectinesterase 2                        309   1e-94    
ref|XP_011095339.1|  PREDICTED: pectinesterase 2.1-like                 310   1e-94    
ref|XP_008228105.1|  PREDICTED: pectinesterase                          311   1e-94    
ref|XP_002322402.2|  putative pectin methylesterase family protein      307   1e-94    Populus trichocarpa [western balsam poplar]
ref|NP_172624.1|  methylesterase PCR A                                  310   2e-94    Arabidopsis thaliana [mouse-ear cress]
ref|NP_566038.1|  putative pectinesterase/pectinesterase inhibito...    308   2e-94    Arabidopsis thaliana [mouse-ear cress]
ref|XP_003588521.1|  Pectinesterase                                     311   2e-94    
gb|AAK59760.1|  At1g11580/T23J18_33                                     310   2e-94    Arabidopsis thaliana [mouse-ear cress]
gb|EYU29495.1|  hypothetical protein MIMGU_mgv1a005211mg                308   2e-94    
ref|XP_010056340.1|  PREDICTED: pectinesterase 2-like                   308   2e-94    
ref|XP_008806757.1|  PREDICTED: LOW QUALITY PROTEIN: probable pec...    310   2e-94    
gb|EYU19641.1|  hypothetical protein MIMGU_mgv1a003247mg                311   2e-94    
ref|XP_009606552.1|  PREDICTED: pectinesterase/pectinesterase inh...    310   2e-94    
emb|CDP16868.1|  unnamed protein product                                310   2e-94    
gb|KHN25547.1|  Pectinesterase 2                                        303   3e-94    
ref|XP_004303758.1|  PREDICTED: pectinesterase/pectinesterase inh...    310   3e-94    
sp|P83948.1|PME3_CITSI  RecName: Full=Pectinesterase 3; Short=PE ...    310   3e-94    
gb|AAO85706.1|  pectin methyl-esterase                                  310   3e-94    
gb|KHN35618.1|  Pectinesterase 2                                        303   3e-94    
ref|XP_004148139.1|  PREDICTED: pectinesterase 2-like                   308   3e-94    
ref|XP_004133929.1|  PREDICTED: pectinesterase 2-like                   308   3e-94    
ref|XP_002882002.1|  predicted protein                                  308   3e-94    
gb|KHN47891.1|  Pectinesterase 2                                        308   4e-94    
ref|XP_002527782.1|  Pectinesterase-1 precursor, putative               308   4e-94    
ref|XP_011070723.1|  PREDICTED: LOW QUALITY PROTEIN: pectinesterase     308   4e-94    
ref|XP_006417343.1|  hypothetical protein EUTSA_v10007263mg             309   4e-94    
ref|XP_010057974.1|  PREDICTED: pectinesterase-like                     308   4e-94    
ref|XP_007217169.1|  hypothetical protein PRUPE_ppa003285mg             310   4e-94    
ref|XP_006490218.1|  PREDICTED: probable pectinesterase/pectinest...    308   4e-94    
ref|XP_002456465.1|  hypothetical protein SORBIDRAFT_03g036790          308   4e-94    
ref|XP_008451545.1|  PREDICTED: pectinesterase-like                     310   4e-94    
gb|KEH19215.1|  pectinesterase/pectinesterase inhibitor                 309   5e-94    
gb|AFI23411.1|  pectin methylesterase                                   310   5e-94    
ref|NP_001274969.1|  pectin methyl esterase                             309   5e-94    
gb|EYU25006.1|  hypothetical protein MIMGU_mgv1a022121mg                309   5e-94    
gb|KGN57272.1|  hypothetical protein Csa_3G175720                       309   6e-94    
gb|KHG26245.1|  Pectinesterase/pectinesterase inhibitor                 306   6e-94    
gb|AFW03476.1|  pectin methylesterase 2                                 307   6e-94    
ref|XP_008234391.1|  PREDICTED: pectinesterase 2-like                   307   6e-94    
ref|XP_010101979.1|  putative pectinesterase/pectinesterase inhib...    305   6e-94    
ref|XP_009765668.1|  PREDICTED: pectinesterase-like                     308   7e-94    
ref|XP_007163135.1|  hypothetical protein PHAVU_001G209400g             309   7e-94    
ref|XP_009612569.1|  PREDICTED: probable pectinesterase/pectinest...    308   8e-94    
ref|XP_009398948.1|  PREDICTED: probable pectinesterase/pectinest...    308   8e-94    
ref|XP_007136533.1|  hypothetical protein PHAVU_009G053000g             309   8e-94    
ref|XP_011029954.1|  PREDICTED: probable pectinesterase/pectinest...    307   8e-94    
ref|XP_008386148.1|  PREDICTED: pectinesterase-like                     308   9e-94    
ref|XP_002889876.1|  At1g11580/T23J18_33                                308   9e-94    
ref|XP_007011069.1|  Root hair specific 12                              309   9e-94    
ref|XP_010443353.1|  PREDICTED: probable pectinesterase/pectinest...    307   1e-93    
ref|XP_009351519.1|  PREDICTED: pectinesterase-like                     307   1e-93    
emb|CDX96216.1|  BnaC02g14350D                                          305   1e-93    
ref|XP_010553426.1|  PREDICTED: pectinesterase/pectinesterase inh...    308   1e-93    
ref|XP_003632058.1|  PREDICTED: probable pectinesterase/pectinest...    308   1e-93    
ref|XP_010482485.1|  PREDICTED: probable pectinesterase/pectinest...    307   1e-93    
ref|XP_011090455.1|  PREDICTED: probable pectinesterase/pectinest...    305   1e-93    
gb|AER38243.1|  PME2                                                    306   1e-93    
emb|CDY34642.1|  BnaC08g42010D                                          304   1e-93    
ref|XP_008781656.1|  PREDICTED: pectinesterase-like                     305   1e-93    
ref|XP_007038413.1|  Pectinesterase                                     306   1e-93    
dbj|BAA89480.1|  pectin methylesterase                                  308   1e-93    
ref|XP_002278061.1|  PREDICTED: probable pectinesterase/pectinest...    308   1e-93    
ref|XP_010532250.1|  PREDICTED: probable pectinesterase/pectinest...    307   1e-93    
emb|CDX74715.1|  BnaA05g04610D                                          304   1e-93    
gb|ABQ42392.1|  pectin methylesterase-like protein                      308   1e-93    
ref|XP_006401715.1|  hypothetical protein EUTSA_v10013056mg             308   2e-93    
ref|XP_003526711.1|  PREDICTED: probable pectinesterase/pectinest...    308   2e-93    
gb|EYU19222.1|  hypothetical protein MIMGU_mgv1a003983mg                307   2e-93    
ref|XP_004160886.1|  PREDICTED: pectinesterase 2-like                   312   2e-93    
ref|XP_009397166.1|  PREDICTED: pectinesterase-like                     307   2e-93    
ref|XP_006281620.1|  hypothetical protein CARUB_v10027747mg             306   2e-93    
ref|XP_004499740.1|  PREDICTED: putative pectinesterase/pectinest...    308   2e-93    
ref|XP_002314796.1|  pectin methylesterase 6 family protein             306   2e-93    
gb|KHN47892.1|  Pectinesterase 2                                        305   2e-93    
ref|XP_002266980.1|  PREDICTED: pectinesterase                          306   2e-93    
ref|XP_002516193.1|  Pectinesterase-1 precursor, putative               308   2e-93    
ref|XP_011079629.1|  PREDICTED: pectinesterase-like                     307   2e-93    
emb|CDX98441.1|  BnaC05g39340D                                          307   2e-93    
ref|XP_004240956.1|  PREDICTED: probable pectinesterase/pectinest...    308   2e-93    
ref|XP_011078160.1|  PREDICTED: pectinesterase-like isoform X2          307   2e-93    
ref|XP_007220109.1|  hypothetical protein PRUPE_ppa021446mg             305   2e-93    
dbj|BAK05307.1|  predicted protein                                      306   2e-93    
ref|NP_001060620.1|  Os07g0675100                                       307   3e-93    
ref|XP_004141734.1|  PREDICTED: pectinesterase 3-like                   308   3e-93    
ref|XP_010047423.1|  PREDICTED: pectinesterase-like                     307   3e-93    
ref|XP_010057972.1|  PREDICTED: pectinesterase-like                     306   3e-93    
ref|XP_006828588.1|  hypothetical protein AMTR_s00129p00047530          306   3e-93    
gb|EEC82670.1|  hypothetical protein OsI_27314                          307   3e-93    
ref|XP_003598363.1|  Pectinesterase                                     307   3e-93    
gb|KDP33985.1|  hypothetical protein JCGZ_07556                         307   4e-93    
ref|XP_006307176.1|  hypothetical protein CARUB_v10008769mg             306   4e-93    
ref|XP_003517028.1|  PREDICTED: pectinesterase 2-like                   305   4e-93    
gb|KHG26122.1|  putative pectinesterase/pectinesterase inhibitor ...    306   4e-93    
ref|XP_007201179.1|  hypothetical protein PRUPE_ppa003400mg             307   4e-93    
ref|XP_010476087.1|  PREDICTED: pectinesterase/pectinesterase inh...    306   4e-93    
ref|XP_003602238.1|  Pectinesterase                                     307   4e-93    
ref|XP_010443361.1|  PREDICTED: probable pectinesterase/pectinest...    305   4e-93    
emb|CDP15270.1|  unnamed protein product                                307   4e-93    
ref|XP_006401970.1|  hypothetical protein EUTSA_v10013190mg             306   4e-93    
ref|XP_009763675.1|  PREDICTED: probable pectinesterase/pectinest...    307   4e-93    
ref|XP_002510940.1|  Pectinesterase-2 precursor, putative               303   5e-93    
ref|XP_004172115.1|  PREDICTED: pectinesterase 3-like                   307   5e-93    
ref|XP_006853048.1|  hypothetical protein AMTR_s00038p00046180          305   5e-93    
ref|XP_011029953.1|  PREDICTED: pectinesterase 2-like                   305   5e-93    
ref|XP_007025998.1|  Pectinesterase/pectinesterase inhibitor, put...    306   5e-93    
ref|XP_009143104.1|  PREDICTED: probable pectinesterase/pectinest...    305   5e-93    
sp|Q96575.1|PME22_SOLLC  RecName: Full=Pectinesterase 2.2; Short=...    306   5e-93    
ref|XP_008439095.1|  PREDICTED: pectinesterase-like                     306   5e-93    
ref|XP_006388348.1|  hypothetical protein POPTR_0214s00200g             306   5e-93    
gb|AAG17110.1|AF188895_1  putative pectin methylesterase 3              306   5e-93    
ref|XP_010445741.1|  PREDICTED: probable pectinesterase/pectinest...    307   5e-93    
ref|XP_010482487.1|  PREDICTED: probable pectinesterase/pectinest...    305   6e-93    
ref|XP_008391160.1|  PREDICTED: pectinesterase-like                     306   6e-93    
gb|KHF97383.1|  Pectinesterase/pectinesterase inhibitor U1              306   6e-93    
gb|KEH29125.1|  pectinesterase/pectinesterase inhibitor                 304   7e-93    
ref|XP_008343201.1|  PREDICTED: pectinesterase 2                        304   7e-93    
gb|AFB77928.1|  pectin methylesterase                                   306   7e-93    
ref|XP_010029511.1|  PREDICTED: pectinesterase-like                     306   7e-93    
gb|KHN44643.1|  Putative pectinesterase/pectinesterase inhibitor 61     307   7e-93    
ref|XP_008460358.1|  PREDICTED: pectinesterase-like                     305   8e-93    
ref|XP_006852649.1|  hypothetical protein AMTR_s00021p00242180          307   8e-93    
ref|XP_009339900.1|  PREDICTED: probable pectinesterase/pectinest...    306   9e-93    
ref|XP_004307984.1|  PREDICTED: probable pectinesterase/pectinest...    306   9e-93    
ref|XP_010482728.1|  PREDICTED: probable pectinesterase/pectinest...    306   9e-93    
gb|KHN35620.1|  Pectinesterase 2                                        299   1e-92    
ref|XP_011005056.1|  PREDICTED: putative pectinesterase/pectinest...    306   1e-92    
ref|XP_006490097.1|  PREDICTED: pectinesterase 2-like                   304   1e-92    
ref|XP_004499656.1|  PREDICTED: probable pectinesterase/pectinest...    304   1e-92    
ref|XP_009766961.1|  PREDICTED: probable pectinesterase/pectinest...    306   1e-92    
ref|XP_010277646.1|  PREDICTED: pectinesterase 2-like                   304   1e-92    
emb|CAC01624.1|  putative pectin methylesterase                         306   1e-92    
ref|XP_006421695.1|  hypothetical protein CICLE_v10004742mg             304   1e-92    
ref|XP_011076457.1|  PREDICTED: probable pectinesterase/pectinest...    306   1e-92    
gb|KDO65446.1|  hypothetical protein CISIN_1g010103mg                   304   1e-92    
ref|XP_010692197.1|  PREDICTED: pectinesterase 2                        304   1e-92    
ref|XP_010230835.1|  PREDICTED: pectinesterase-like                     305   1e-92    
ref|XP_003530788.1|  PREDICTED: probable pectinesterase/pectinest...    304   1e-92    
ref|XP_010259196.1|  PREDICTED: pectinesterase 2-like                   303   1e-92    
ref|XP_004234960.1|  PREDICTED: probable pectinesterase/pectinest...    305   1e-92    
ref|XP_002318285.1|  putative pectin methylesterase family protein      303   2e-92    
ref|XP_009771845.1|  PREDICTED: pectinesterase-like                     305   2e-92    
ref|XP_010501842.1|  PREDICTED: pectinesterase/pectinesterase inh...    306   2e-92    
emb|CDX97564.1|  BnaA05g25150D                                          305   2e-92    
ref|XP_010442652.1|  PREDICTED: probable pectinesterase/pectinest...    304   2e-92    
ref|XP_007222925.1|  hypothetical protein PRUPE_ppa005208mg             302   2e-92    
gb|KHG13344.1|  Uncharacterized protein F383_18528                      303   2e-92    
ref|XP_009127175.1|  PREDICTED: probable pectinesterase/pectinest...    305   2e-92    
ref|XP_009364480.1|  PREDICTED: pectinesterase                          305   2e-92    
ref|XP_003564371.1|  PREDICTED: pectinesterase                          304   2e-92    
ref|XP_010458561.1|  PREDICTED: pectinesterase/pectinesterase inh...    304   2e-92    
ref|XP_010047425.1|  PREDICTED: pectinesterase-like                     305   2e-92    
gb|AFW03481.1|  pectin methylesterase 2                                 303   2e-92    
ref|XP_010923950.1|  PREDICTED: pectinesterase-like                     304   3e-92    
ref|XP_008783207.1|  PREDICTED: probable pectinesterase/pectinest...    305   3e-92    
ref|NP_001274785.1|  pectin methyl esterase                             303   3e-92    
emb|CDY49170.1|  BnaA02g10290D                                          301   3e-92    
gb|KDP33984.1|  hypothetical protein JCGZ_07555                         305   3e-92    
gb|AAF23891.1|  pectin methyl esterase                                  303   3e-92    
ref|XP_010062172.1|  PREDICTED: probable pectinesterase/pectinest...    303   3e-92    
ref|XP_006401969.1|  hypothetical protein EUTSA_v10013189mg             303   4e-92    
ref|XP_006350555.1|  PREDICTED: probable pectinesterase/pectinest...    304   5e-92    
ref|XP_009771261.1|  PREDICTED: pectinesterase-like                     303   5e-92    
ref|XP_011084508.1|  PREDICTED: probable pectinesterase/pectinest...    304   5e-92    
gb|EYU33116.1|  hypothetical protein MIMGU_mgv1a022674mg                302   6e-92    
gb|KHN21590.1|  Putative pectinesterase/pectinesterase inhibitor 6      302   6e-92    
ref|XP_008234390.1|  PREDICTED: probable pectinesterase/pectinest...    302   6e-92    
ref|XP_009146386.1|  PREDICTED: pectinesterase/pectinesterase inh...    304   6e-92    
ref|XP_010442899.1|  PREDICTED: probable pectinesterase/pectinest...    304   7e-92    
ref|XP_010058465.1|  PREDICTED: probable pectinesterase/pectinest...    301   8e-92    
ref|XP_009628637.1|  PREDICTED: pectinesterase-like                     303   8e-92    
gb|AES69711.2|  pectinesterase/pectinesterase inhibitor                 302   8e-92    
ref|XP_011012638.1|  PREDICTED: pectinesterase-like                     303   9e-92    
ref|XP_003553658.2|  PREDICTED: probable pectinesterase/pectinest...    304   9e-92    
gb|KDP40627.1|  hypothetical protein JCGZ_24626                         303   9e-92    
dbj|BAJ96804.1|  predicted protein                                      303   9e-92    
ref|XP_002510939.1|  Pectinesterase-2 precursor, putative               301   9e-92    
ref|XP_008371117.1|  PREDICTED: pectinesterase                          303   1e-91    
ref|XP_010661658.1|  PREDICTED: probable pectinesterase/pectinest...    300   1e-91    
ref|XP_006580437.1|  PREDICTED: probable pectinesterase/pectinest...    301   1e-91    
ref|XP_003546684.1|  PREDICTED: putative pectinesterase/pectinest...    303   1e-91    
gb|EYU25005.1|  hypothetical protein MIMGU_mgv1a003670mg                303   1e-91    
ref|XP_006404164.1|  hypothetical protein EUTSA_v10010220mg             304   1e-91    
ref|NP_199963.1|  putative pectinesterase/pectinesterase inhibito...    302   1e-91    
ref|XP_006282103.1|  hypothetical protein CARUB_v10028350mg             302   1e-91    
ref|XP_007215024.1|  hypothetical protein PRUPE_ppa003307mg             303   1e-91    
gb|KHN10154.1|  Putative pectinesterase/pectinesterase inhibitor 24     303   1e-91    
ref|XP_010999998.1|  PREDICTED: probable pectinesterase/pectinest...    303   1e-91    
ref|XP_009142324.1|  PREDICTED: probable pectinesterase/pectinest...    301   1e-91    
emb|CAN75818.1|  hypothetical protein VITISV_005130                     300   1e-91    
ref|XP_009150156.1|  PREDICTED: probable pectinesterase/pectinest...    303   1e-91    
ref|XP_003634048.1|  PREDICTED: pectinesterase 2-like                   301   1e-91    
ref|XP_002265217.1|  PREDICTED: pectinesterase 3                        303   1e-91    
ref|XP_003599460.1|  Pectinesterase                                     301   1e-91    
gb|KFK37315.1|  hypothetical protein AALP_AA4G241100                    301   1e-91    
pir||S00629  pectinesterase (EC 3.1.1.11) precursor (clone PE1) -...    297   1e-91 
ref|XP_010049073.1|  PREDICTED: probable pectinesterase/pectinest...    303   1e-91    
ref|XP_010069353.1|  PREDICTED: pectinesterase-like                     301   1e-91    
gb|KHN16553.1|  Pectinesterase 2                                        298   1e-91    
ref|XP_010493017.1|  PREDICTED: pectinesterase/pectinesterase inh...    302   1e-91    
ref|XP_011010932.1|  PREDICTED: probable pectinesterase/pectinest...    301   2e-91    
ref|XP_009351517.1|  PREDICTED: pectinesterase-like                     301   2e-91    
ref|XP_008348472.1|  PREDICTED: pectinesterase-like                     303   2e-91    
ref|XP_002865863.1|  pectinesterase family protein                      301   2e-91    
ref|XP_002320448.2|  hypothetical protein POPTR_0014s14720g             302   2e-91    
ref|XP_004494389.1|  PREDICTED: probable pectinesterase/pectinest...    301   2e-91    
gb|EPS66234.1|  hypothetical protein M569_08543                         303   2e-91    
ref|XP_009355064.1|  PREDICTED: putative pectinesterase/pectinest...    302   2e-91    
ref|XP_007012506.1|  Pectinesterase                                     303   2e-91    
gb|EYU21270.1|  hypothetical protein MIMGU_mgv1a003278mg                303   3e-91    
ref|XP_010534984.1|  PREDICTED: pectinesterase-like                     302   3e-91    
gb|KDP40628.1|  hypothetical protein JCGZ_24627                         302   3e-91    
gb|KEH22545.1|  pectinesterase/pectinesterase inhibitor                 300   3e-91    
ref|XP_004154436.1|  PREDICTED: pectinesterase/pectinesterase inh...    301   3e-91    
ref|XP_004139621.1|  PREDICTED: pectinesterase/pectinesterase inh...    301   3e-91    
gb|KDP22413.1|  hypothetical protein JCGZ_26244                         301   3e-91    
emb|CDO99717.1|  unnamed protein product                                301   3e-91    
ref|XP_006381543.1|  hypothetical protein POPTR_0006s13690g             302   3e-91    
gb|KDP33981.1|  hypothetical protein JCGZ_07552                         302   3e-91    
gb|EEC70505.1|  hypothetical protein OsI_01594                          301   3e-91    
ref|XP_007148762.1|  hypothetical protein PHAVU_005G012000g             301   3e-91    
ref|XP_007220895.1|  hypothetical protein PRUPE_ppa003047mg             303   3e-91    
gb|EPS62329.1|  pectinesterase                                          301   4e-91    
gb|KFK43434.1|  hypothetical protein AALP_AA1G125000                    301   4e-91    
ref|XP_010058468.1|  PREDICTED: pectinesterase 2-like                   305   4e-91    
ref|XP_009776000.1|  PREDICTED: probable pectinesterase/pectinest...    302   4e-91    
ref|XP_010442655.1|  PREDICTED: probable pectinesterase/pectinest...    300   4e-91    
ref|XP_010443373.1|  PREDICTED: probable pectinesterase/pectinest...    300   4e-91    
ref|XP_010321856.1|  PREDICTED: pectinesterase                          301   5e-91    
ref|XP_009339254.1|  PREDICTED: putative pectinesterase/pectinest...    301   5e-91    



>ref|XP_006381548.1| hypothetical protein POPTR_0006s13740g [Populus trichocarpa]
 gb|ERP59345.1| hypothetical protein POPTR_0006s13740g [Populus trichocarpa]
Length=533

 Score =   573 bits (1476),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/461 (64%), Positives = 354/461 (77%), Gaps = 10/461 (2%)
 Frame = -2

Query  1382  QIRIQCGYTRFPRLCVQTLSGLVSGERVDFAAALLLNKTIAHADLHIAHFDQLSSHFVSS  1203
             Q++ QC YTR+P LC+Q+L        +D   AL+ NKTI+   L  ++F+ LSSH + +
Sbjct  32    QVQTQCSYTRYPGLCLQSLKEF-QDHPLDIMTALV-NKTISETRLPNSYFETLSSH-LEA  88

Query  1202  QPPQPRLQAIGYCEELMGMARQRLNEALVAMKESPGKNRQEDIQTWLSAAVTFQQACKDW  1023
             Q  +  L    YC+ LM M+ +RL+++L+A+K+SP KN+  DIQTWLSAA+TFQQACKD 
Sbjct  89    QEAERVLSVTDYCKNLMSMSLKRLDQSLLALKDSPRKNKH-DIQTWLSAALTFQQACKDS  147

Query  1022  ADQYAFSDELFARISRSMDYQSQLASNALALVNRNTEISAAGRQLSEEdidddddggffp  843
              D  + S +L  RIS  MDY SQLASN+LALV+R T       + S +    ++    FP
Sbjct  148   TDSLSLSGDLMPRISEKMDYLSQLASNSLALVSRITHDYGTKLKNSTKRRRAEEKSQGFP  207

Query  842   DWVSGRDLRLLETTTDKTKANVVVAKDGTGNFRTVAEAIGAASGRQRFVIYVKSGVYKEK  663
              WVS +D +LL+T+T   KAN VVAKDGTGN++T++EAI AA G+ RFVIYVK+GVYKEK
Sbjct  208   KWVSAKDRKLLQTST--IKANAVVAKDGTGNYKTISEAINAAPGK-RFVIYVKAGVYKEK  264

Query  662   IRSSKDGITLIGDGKYSTIITWDDSVGGGSSLTGSATFGITGDGFIAKDIGFQNTAGPGA  483
             IRS+KDGITLIGDGKYSTII  DDSV GGSS+ GSATF ITGD FIA+DIGFQNTAGPG 
Sbjct  265   IRSNKDGITLIGDGKYSTIIVGDDSVAGGSSMPGSATFTITGDDFIARDIGFQNTAGPGG  324

Query  482   HQAVALTVASDHSVFYRCSISGYQDTLYALSLRQFYRECDISGTVDFIFGNAAAVFQACN  303
              QA+AL VASDHSVFYRCSI+GYQDTLYA++LRQFYRECDI GT+DFIFGNAAAVFQ+CN
Sbjct  325   EQALALHVASDHSVFYRCSIAGYQDTLYAVALRQFYRECDIFGTIDFIFGNAAAVFQSCN  384

Query  302   LVLRRP--SSYNVILANGRSDPGQNTGFSVQKCKITPGPDFSPVKNSYNSYLGRPWKPYS  129
             LVLR+P   SYNVILANGR DPGQNTGFSVQ C+IT   DFSPV ++YNSYLGRPWK YS
Sbjct  385   LVLRKPHGDSYNVILANGRDDPGQNTGFSVQSCRITASSDFSPVMHNYNSYLGRPWKQYS  444

Query  128   RAVVMESDIDGAISARGWIEWPGTSSSSVRELYFGEYANVG  6
             R VVMES I  AIS+RGWIEWPG  S + + LYF EY+N G
Sbjct  445   RTVVMESSIGDAISSRGWIEWPGEGSYA-KSLYFAEYSNTG  484



>ref|XP_011039901.1| PREDICTED: pectinesterase [Populus euphratica]
Length=533

 Score =   567 bits (1462),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/461 (63%), Positives = 351/461 (76%), Gaps = 10/461 (2%)
 Frame = -2

Query  1382  QIRIQCGYTRFPRLCVQTLSGLVSGERVDFAAALLLNKTIAHADLHIAHFDQLSSHFVSS  1203
             Q++ QC YTR+P LC+Q+L        +D   AL+ NKTI+   L  ++F+ LSSH + +
Sbjct  32    QVQTQCSYTRYPGLCLQSLKEF-QDHPLDVMTALV-NKTISETRLPNSYFETLSSH-LEA  88

Query  1202  QPPQPRLQAIGYCEELMGMARQRLNEALVAMKESPGKNRQEDIQTWLSAAVTFQQACKDW  1023
             Q  +  L    YC+ LM M+ +RL+++L+A+K SP K++  DIQTWLSAA+TFQQACKD 
Sbjct  89    QEAESVLSVTDYCKNLMSMSLKRLDQSLLALKYSPRKSKH-DIQTWLSAALTFQQACKDS  147

Query  1022  ADQYAFSDELFARISRSMDYQSQLASNALALVNRNTEISAAGRQLSEEdidddddggffp  843
              D    S +   RIS  MDY SQLASN+LALVNR T       + S +    ++    FP
Sbjct  148   TDSLGLSGDFMPRISEKMDYLSQLASNSLALVNRITHDYGTKLKNSTKRRRAEEKSQGFP  207

Query  842   DWVSGRDLRLLETTTDKTKANVVVAKDGTGNFRTVAEAIGAASGRQRFVIYVKSGVYKEK  663
              WVS +D +LL+T+T   KAN VVAKDGTGN+ T++EAI AA G+ RFVIYVK+GVYKEK
Sbjct  208   KWVSAKDRKLLQTST--IKANAVVAKDGTGNYNTISEAINAAPGK-RFVIYVKAGVYKEK  264

Query  662   IRSSKDGITLIGDGKYSTIITWDDSVGGGSSLTGSATFGITGDGFIAKDIGFQNTAGPGA  483
             IRS+KDGITLIGDGKYST+I  DDSV GGSS+ GSATF ITGDGFIA+DIGFQNTAGPG 
Sbjct  265   IRSNKDGITLIGDGKYSTVIVGDDSVAGGSSMPGSATFTITGDGFIARDIGFQNTAGPGG  324

Query  482   HQAVALTVASDHSVFYRCSISGYQDTLYALSLRQFYRECDISGTVDFIFGNAAAVFQACN  303
              QA+AL VASDHSVFYRCSI+GYQDTLYA++LRQFYRECDI GT+DFIFGNAAAVFQ+CN
Sbjct  325   EQALALHVASDHSVFYRCSIAGYQDTLYAVALRQFYRECDIFGTIDFIFGNAAAVFQSCN  384

Query  302   LVLRRP--SSYNVILANGRSDPGQNTGFSVQKCKITPGPDFSPVKNSYNSYLGRPWKPYS  129
             LVLR+P   SYNVILANGR DPGQNTGFSVQ C+IT   DFSPV +++NSYLGRPWK YS
Sbjct  385   LVLRKPLGDSYNVILANGRDDPGQNTGFSVQSCRITASSDFSPVMHNHNSYLGRPWKRYS  444

Query  128   RAVVMESDIDGAISARGWIEWPGTSSSSVRELYFGEYANVG  6
             R VVMES I  AIS+RGWIEWPG  S + + LYF EY+N G
Sbjct  445   RTVVMESSIGDAISSRGWIEWPGEGSYA-KSLYFAEYSNTG  484



>ref|XP_011093899.1| PREDICTED: pectinesterase-like [Sesamum indicum]
Length=530

 Score =   565 bits (1456),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/466 (63%), Positives = 354/466 (76%), Gaps = 20/466 (4%)
 Frame = -2

Query  1385  DQIRIQCGYTRFPRLCVQTLSGLVSGERVDFAAALLLNKTIAHADLHIAHFDQLSSHFVS  1206
             +++R QCG+TR+P LCVQTL+GL SG       + L+N+TI+   L  ++F+ LS HF+S
Sbjct  30    EEVRTQCGFTRYPTLCVQTLTGLGSGNPSFDILSALVNRTISETKLPDSNFEILSYHFIS  89

Query  1205  SQPPQPRLQAIGYCEELMGMARQRLNEALVAMKESPGKNRQEDIQTWLSAAVTFQQACKD  1026
              +  Q R+ A+  C+ELM M+ +RL +AL A+++SP K  + DIQ WLSAA+TFQQ CKD
Sbjct  90    PEAQQARI-AMDNCQELMSMSEKRLKQALDALQKSP-KKHKADIQAWLSAALTFQQECKD  147

Query  1025  WADQYAFSDELFARISRSMDYQSQLASNALALVNRNTEISAAG--RQLSEEdidddddgg  852
               + +  S+     I + MDY S+L SN LAL NR T  S  G  R L +E   +     
Sbjct  148   SVENHVPSNVYMGEIYKKMDYLSELGSNPLALANRITGKSPTGGRRLLGQESFPN-----  202

Query  851   ffpDWVSGRDLRLLETTTDKTKANVVVAKDGTGNFRTVAEAIGAASGRQRFVIYVKSGVY  672
                 WVS  D +LL++T  + KAN VVAKDG+GNF+TV+EAIGAA+G  RFVIYVK+G Y
Sbjct  203   ----WVSASDRKLLQST--EIKANAVVAKDGSGNFKTVSEAIGAATG-SRFVIYVKAGTY  255

Query  671   KEKIRSSKDGITLIGDGKYSTIIT-WDDSVGGGSSLTGSATFGITGDGFIAKDIGFQNTA  495
              EKI ++KDGITLIGDGKYST+IT       GGSSL GSATF ITGDGFIA+DIGFQNTA
Sbjct  256   NEKINTNKDGITLIGDGKYSTVITAGGSVGKGGSSLRGSATFTITGDGFIARDIGFQNTA  315

Query  494   GPGAHQAVALTVASDHSVFYRCSISGYQDTLYALSLRQFYRECDISGTVDFIFGNAAAVF  315
             GPGA QAVALT++SDHSV YRCSI+GYQDTLYALSLRQFYRECDI GTVDF+FGNAAAVF
Sbjct  316   GPGAEQAVALTISSDHSVLYRCSIAGYQDTLYALSLRQFYRECDIYGTVDFVFGNAAAVF  375

Query  314   QACNLVLRRPSS---YNVILANGRSDPGQNTGFSVQKCKITPGPDFSPVKNSYNSYLGRP  144
             Q+C LVLRRP S   YNVILANGR+DPGQ+TGFS+Q CKIT G DFSPVKNSYNSYLGRP
Sbjct  376   QSCTLVLRRPRSGGAYNVILANGRTDPGQSTGFSLQNCKITVGSDFSPVKNSYNSYLGRP  435

Query  143   WKPYSRAVVMESDIDGAISARGWIEWPGTSSSSVRELYFGEYANVG  6
             WK YSRAVVM+S+ID AIS RGW+EWPGT  S+ + LYF EYAN+G
Sbjct  436   WKAYSRAVVMQSNIDAAISTRGWVEWPGTGGSTYKTLYFAEYANMG  481



>ref|XP_011078156.1| PREDICTED: pectinesterase [Sesamum indicum]
Length=529

 Score =   561 bits (1445),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/465 (63%), Positives = 350/465 (75%), Gaps = 21/465 (5%)
 Frame = -2

Query  1379  IRIQCGYTRFPRLCVQTLSGLVSGERVDFAAALLLNKTIAHADLHIAHFDQLSSHFVSSQ  1200
             +R QC YTRFP LCVQTL+GL  G R     + L+N+TI+ + L       +SSHFVS  
Sbjct  30    VRNQCLYTRFPALCVQTLTGLGPGNRTVDVLSALVNRTISESRL--PDHSLISSHFVSPG  87

Query  1199  PPQPRLQAIGYCEELMGMARQRLNEALVAMKESPGKNRQEDIQTWLSAAVTFQQACKDWA  1020
               QP   A+  C ELM M+ +RLN+AL  +++SP K++  D+QT LSAA+TFQQ CKD  
Sbjct  88    A-QPTRMAVDECNELMEMSLKRLNQALDLLQKSPSKHKV-DVQTLLSAALTFQQTCKDAI  145

Query  1019  DQYAFSDELFARISRSMDYQSQLASNALALVNR----NTEISAAGRQLSEEdidddddgg  852
             +++  S+     I + MDY S+L SN LALVNR     T  S  GR+L            
Sbjct  146   EEHVPSNLYIEEIYKKMDYLSELVSNPLALVNRIAGNPTGKSPPGRRL--------LARP  197

Query  851   ffpDWVSGRDLRLLETTTDKTKANVVVAKDGTGNFRTVAEAIGAASGRQRFVIYVKSGVY  672
              FPDWVS RD +LL+++  + KA+VVVAKDG+GNF+TV+EAI AASG +RFVIYVKSG Y
Sbjct  198   VFPDWVSARDRKLLQSS--EIKADVVVAKDGSGNFKTVSEAIEAASGGRRFVIYVKSGTY  255

Query  671   KEKIRSSKDGITLIGDGKYSTIITWDDSVGGGSSLTGSATFGITGDGFIAKDIGFQNTAG  492
              EKI ++KDGITLIGDGKYSTIIT   SV  GSSL GSATF ITGDGFIA+DIGF+NTAG
Sbjct  256   NEKINTNKDGITLIGDGKYSTIITGGSSVAKGSSLRGSATFTITGDGFIARDIGFENTAG  315

Query  491   PGAHQAVALTVASDHSVFYRCSISGYQDTLYALSLRQFYRECDISGTVDFIFGNAAAVFQ  312
             P  HQAVALT++SD+SV YRCSI+GYQDTLYAL+LRQFYRECD+ GTVDFIFGNAAAVFQ
Sbjct  316   PEGHQAVALTISSDNSVLYRCSIAGYQDTLYALALRQFYRECDVYGTVDFIFGNAAAVFQ  375

Query  311   ACNLVLRRPSS---YNVILANGRSDPGQNTGFSVQKCKITPGPDFSPVKNSYNSYLGRPW  141
             +CNLVLRRP S   +N ILANGRSDPGQNTGFSVQ CKIT G DFSPV++ YNSYLGRPW
Sbjct  376   SCNLVLRRPRSGGAFNAILANGRSDPGQNTGFSVQNCKITVGSDFSPVRDKYNSYLGRPW  435

Query  140   KPYSRAVVMESDIDGAISARGWIEWPGTSSSSVRELYFGEYANVG  6
             KPYSRAVVM+S+IDG ISARGW+EW G   S+ + LYF EY N+G
Sbjct  436   KPYSRAVVMQSNIDGEISARGWVEWEGAGGSTYKTLYFAEYENMG  480



>ref|XP_007012509.1| Plant invertase/pectin methylesterase inhibitor superfamily [Theobroma 
cacao]
 gb|EOY30128.1| Plant invertase/pectin methylesterase inhibitor superfamily [Theobroma 
cacao]
Length=535

 Score =   557 bits (1435),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/494 (59%), Positives = 366/494 (74%), Gaps = 20/494 (4%)
 Frame = -2

Query  1472  RTWVIMLVLFFGCCVTTIaaaavsqvaaQDQIRIQCGYTRFPRLCVQTLSGLVSG-ERVD  1296
             R   + +    GC +     +  ++ + Q  +  QC +TR+P LCV  ++ L SG ++VD
Sbjct  8     RMLELTMFWLIGCALVVTPVSWAAKDSYQKHVHEQCSFTRYPGLCVDAVARLRSGNQQVD  67

Query  1295  FAAALLLNKTIAHADLHIAHFDQLSSHFVSSQPPQPRLQAIGYCEELMGMARQRLNEALV  1116
               +AL+ NKTI   +L  +++ + SS+ +  +  Q      GYC+EL+ M+ +RL+++L+
Sbjct  68    IMSALI-NKTILETNLPTSYYTKFSSN-LDIEEAQHVNSITGYCQELLSMSLKRLDQSLL  125

Query  1115  AMKESPGKNRQEDIQTWLSAAVTFQQACKDWADQYAFSD-ELFARISRSMDYQSQLASNA  939
             A++ S   N+Q D+QTW+SAA+T+QQACKD AD ++FS+ +L  +ISR MDY SQL SN+
Sbjct  126   ALQNSQNTNKQ-DVQTWISAALTYQQACKDSADGHSFSNSDLVGQISRKMDYLSQLGSNS  184

Query  938   LALVNRNTE--ISAAGRQLSEEdidddddggffpDWVSGRDLRLLETTTDKTKANVVVAK  765
             LALVNR T     +  R LSE+ +           WVS +D +LL+  T   KAN VVAK
Sbjct  185   LALVNRMTGKLTDSTARLLSEDHVFPS--------WVSAKDRKLLQAPT--IKANAVVAK  234

Query  764   DGTGNFRTVAEAIGAASGRQRFVIYVKSGVYKEKIRSSKDGITLIGDGKYSTIITWDDSV  585
             DG+GN++T++EAI AASG  RFVIYVK+GVY EKIR+ KDGITLIGDGKY TII  DDSV
Sbjct  235   DGSGNYKTISEAINAASG-GRFVIYVKAGVYNEKIRTKKDGITLIGDGKYRTIIVGDDSV  293

Query  584   GGGSSLTGSATFGITGDGFIAKDIGFQNTAGPGAHQAVALTVASDHSVFYRCSISGYQDT  405
              GGSS+ GSATF +TGDGFIA+DIGFQNTAGP   QA+A+ VASDHSVFYRCS++GYQDT
Sbjct  294   NGGSSMPGSATFTVTGDGFIARDIGFQNTAGPQGEQALAVYVASDHSVFYRCSMAGYQDT  353

Query  404   LYALSLRQFYRECDISGTVDFIFGNAAAVFQACNLVLRRP-SSYNVILANGRSDPGQNTG  228
             LYAL+LRQFYRECDI GTVDFIFGNAAAVFQ+C+L LRRP  SYNVILANGRSDPGQNTG
Sbjct  354   LYALALRQFYRECDIYGTVDFIFGNAAAVFQSCSLTLRRPHGSYNVILANGRSDPGQNTG  413

Query  227   FSVQKCKITPGPDFSPVKNSYNSYLGRPWKPYSRAVVMESDIDGAISARGWIEWPGTSSS  48
             FS+Q C+I P  DFSPVK+S+ SYLGRPWK YSRAVVMES ID AI++RGWIEWPG  + 
Sbjct  414   FSIQNCRIVPSSDFSPVKHSFASYLGRPWKQYSRAVVMESTIDDAIASRGWIEWPGAGAY  473

Query  47    SVRELYFGEYANVG  6
             S + LYF EYAN G
Sbjct  474   S-KSLYFAEYANAG  486



>gb|EYU25795.1| hypothetical protein MIMGU_mgv1a024664mg [Erythranthe guttata]
Length=539

 Score =   556 bits (1434),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/468 (63%), Positives = 352/468 (75%), Gaps = 18/468 (4%)
 Frame = -2

Query  1385  DQIRIQCGYTRFPRLCVQTLSGLVS-GERVDFAAALLLNKTIAHADL--HIAHFDQLSSH  1215
             + +R QCG+TR+P LCVQTL+G  S    VDF + +L+NKT+    +    ++F  LSSH
Sbjct  36    ENVRTQCGFTRYPTLCVQTLTGSGSLNPNVDFLS-VLINKTMFETKIPSFSSNFQILSSH  94

Query  1214  FVSSQPPQPRLQAIGYCEELMGMARQRLNEALVAMKESPGKNRQEDIQTWLSAAVTFQQA  1035
             FVS Q  Q R  A+ YC+ELM M+ +RLN+A+ A+++   + ++ DIQT+LSA +TFQQ 
Sbjct  95    FVSPQAQQARF-AMDYCDELMSMSMKRLNQAMEALQKPSPEKQKVDIQTYLSAVLTFQQT  153

Query  1034  CKDWADQYAFSDELFARISRSMDYQSQLASNALALVNRNT-EISAAGRQLSEEdiddddd  858
             CKD  + +  S+   + + + MD  S+L SN LAL NR T  I A  R L         D
Sbjct  154   CKDSVEDHITSNVYMSEMYKKMDRLSELCSNTLALANRITGNIPAIRRNL------LTGD  207

Query  857   ggffpDWVSGRDLRLLETTTDKTKANVVVAKDGTGNFRTVAEAIGAASGRQRFVIYVKSG  678
             G  FP W+S  D +LL++T  K KAN VVAKDG+G+++TV EAI AASG  RFVIYVKSG
Sbjct  208   GYNFPGWLSAGDRKLLQST--KIKANAVVAKDGSGDYKTVTEAIQAASG-GRFVIYVKSG  264

Query  677   VYKEKIRSSKDGITLIGDGKYSTIITWDDSVGGGSSLTGSATFGITGDGFIAKDIGFQNT  498
              Y EKI ++KDGITLIGDGKYST+IT   SVG GS+L GSATF ITGDGFIA+DIGFQNT
Sbjct  265   TYNEKINTNKDGITLIGDGKYSTVITASSSVGKGSTLRGSATFTITGDGFIARDIGFQNT  324

Query  497   AGPGAHQAVALTVASDHSVFYRCSISGYQDTLYALSLRQFYRECDISGTVDFIFGNAAAV  318
             AGP A QAVALTV SDHSV YRCS++GYQDTLYALS RQFYRECDI GTVDFIFGNAAAV
Sbjct  325   AGPQAEQAVALTVVSDHSVLYRCSVAGYQDTLYALSFRQFYRECDIYGTVDFIFGNAAAV  384

Query  317   FQACNLVLRRPSS---YNVILANGRSDPGQNTGFSVQKCKITPGPDFSPVKNSYNSYLGR  147
             FQ+CN+VLRRP S   YNVILANGRSDPGQNTGFSVQ CKI+ G DFS VKNSY SYLGR
Sbjct  385   FQSCNIVLRRPRSGGAYNVILANGRSDPGQNTGFSVQNCKISIGSDFSAVKNSYKSYLGR  444

Query  146   PWKPYSRAVVMESDIDGAISARGWIEWPGTSSSSVRELYFGEYANVGA  3
             PWK YSRAVVM+S+IDGAIS RGW+EWPG + S+ + LYF EY N+GA
Sbjct  445   PWKQYSRAVVMQSNIDGAISPRGWVEWPGAAGSTYKTLYFAEYENMGA  492



>gb|EYU28292.1| hypothetical protein MIMGU_mgv1a004362mg [Erythranthe guttata]
Length=531

 Score =   538 bits (1385),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/465 (62%), Positives = 349/465 (75%), Gaps = 22/465 (5%)
 Frame = -2

Query  1379  IRIQCGYTRFPRLCVQTLSGLVSGERVDFAAALLLNKTIAHADLHIAHFDQLS-SHFVSS  1203
             I+ +CGYTR+P LCVQTL+   + + +D  +AL+ NKTI   +L +++FD L  +  ++S
Sbjct  34    IKRECGYTRYPTLCVQTLTA-TNDQNIDLLSALV-NKTIHETNLPLSYFDSLIINSRLNS  91

Query  1202  QPPQPRLQAIGYCEELMGMARQRLNEALVAMKESPGKNRQEDIQTWLSAAVTFQQACKDW  1023
                QP   AI  C+ELM M+ +RLN+A+  +++SP KN + DIQTWLSAA+TFQQ CKD 
Sbjct  92    PAAQPIRTAIDDCDELMKMSLKRLNQAMELLQKSP-KNHKADIQTWLSAALTFQQTCKDT  150

Query  1022  ADQYAFSDELFARISRSMDYQSQLASNALALVNR---NTEISAAGRQLSEEdidddddgg  852
              +++  S+    +I   MDY S+L SN LALVNR   N   S AGR+             
Sbjct  151   MEEHVASNAYVGKIYNKMDYLSELISNPLALVNRITGNPSESPAGRR----------SLL  200

Query  851   ffpDWVSGRDLRLLETTTDKTKANVVVAKDGTGNFRTVAEAIGAASGRQRFVIYVKSGVY  672
              FP WVS  D +LL++T    KA+ VVAKDG+G+F TV+ AI AA+G  RFVIYVKSG Y
Sbjct  201   QFPAWVSAGDRKLLQST-GAVKASAVVAKDGSGDFTTVSGAIQAATG-GRFVIYVKSGTY  258

Query  671   KEKIRSSKDGITLIGDGKYSTIITWDDSVGGGSSLTGSATFGITGDGFIAKDIGFQNTAG  492
              EKI ++KDGITLIGDGKYST+I+   SVG GS+L GSATF ITGDGFIA+DIGFQNTAG
Sbjct  259   NEKINTNKDGITLIGDGKYSTVISGGSSVGKGSNLRGSATFTITGDGFIARDIGFQNTAG  318

Query  491   PGAHQAVALTVASDHSVFYRCSISGYQDTLYALSLRQFYRECDISGTVDFIFGNAAAVFQ  312
             P  HQA+ALTVASDHSV YRCSISGYQDTLYALSLRQFYRECDI GTVDFIFGNAAAVFQ
Sbjct  319   PENHQAIALTVASDHSVVYRCSISGYQDTLYALSLRQFYRECDIYGTVDFIFGNAAAVFQ  378

Query  311   ACNLVLRRP---SSYNVILANGRSDPGQNTGFSVQKCKITPGPDFSPVKNSYNSYLGRPW  141
             +C LVLRRP    ++N ILANGRSDPGQNTGFSVQ CKIT G DFSPVK+SY+SYLGRPW
Sbjct  379   SCTLVLRRPRNGGAFNTILANGRSDPGQNTGFSVQNCKITVGADFSPVKSSYDSYLGRPW  438

Query  140   KPYSRAVVMESDIDGAISARGWIEWPGTSSSSVRELYFGEYANVG  6
             K YSRAVVM+++IDG IS+RGW EW G + S+ R LYF EY N+G
Sbjct  439   KQYSRAVVMQTNIDGEISSRGWAEWEGAAGSTYRTLYFAEYENMG  483



>emb|CDP03022.1| unnamed protein product [Coffea canephora]
Length=524

 Score =   530 bits (1365),  Expect = 2e-180, Method: Compositional matrix adjust.
 Identities = 285/467 (61%), Positives = 340/467 (73%), Gaps = 44/467 (9%)
 Frame = -2

Query  1367  CGYTRFPRLCVQTLSGLVS-GERVDFAAALLLNKTIAHADLHIAHFDQLSSHFVSSQPPQ  1191
             C +TRFP LC ++LSGL S  + VDF +AL+ NKTI+ ++L +++F+ LS HF+S +   
Sbjct  40    CQFTRFPGLCAESLSGLPSQNQYVDFVSALI-NKTISASNLPVSNFESLSYHFISEEAQN  98

Query  1190  PRLQAIGYCEELMGMARQRLNEALVAMKESPGKNRQEDIQTWLSAAVTFQQACKDWADQY  1011
              R +AIG C ELM MA +RLN+ALVA+K+SP KN+ EDIQTWLSAA+T+Q+ CKD A+ +
Sbjct  99    TR-KAIGDCRELMNMAVKRLNQALVAIKQSPTKNK-EDIQTWLSAALTYQETCKDIANVH  156

Query  1010  AFSDELFARISRSMDYQSQLASNALALVNRNT---------EISAAGRQLSEEdiddddd  858
             A S+     IS+ MDY SQ+ SN L LVNR T           S  GR L E+       
Sbjct  157   ATSNSFMQEISKKMDYLSQMGSNPLTLVNRITAENSKNTGPHTSIKGRGLVEQQNFPT--  214

Query  857   ggffpDWVSGRDLRLLETTTDKTKANVVVAKDGTGNFRTVAEAIGAASGRQRFVIYVKSG  678
                   W+S RD +LL+ TT   +AN VVAKDG+GN++T++EAI AA G  RF       
Sbjct  215   ------WISARDRKLLQATT--IRANAVVAKDGSGNYKTISEAIRAAGG-GRF-------  258

Query  677   VYKEKIRSSKDGITLIGDGKYSTIITWDDSVGGGSSLTGSATFGITGDGFIAKDIGFQNT  498
                       DGITL+GDGKYST+IT   SV GGSSL  SAT  ITGDGFIAKDIGFQNT
Sbjct  259   ----------DGITLVGDGKYSTVITGSSSVAGGSSLQDSATVTITGDGFIAKDIGFQNT  308

Query  497   AGPGAHQAVALTVASDHSVFYRCSISGYQDTLYALSLRQFYRECDISGTVDFIFGNAAAV  318
             AGP   QAVA+ +ASD +V YRC+++GYQDTLYALSLRQFYRECDI GTVDFIFGNAAAV
Sbjct  309   AGPNGDQAVAVLIASDRAVLYRCTLAGYQDTLYALSLRQFYRECDIYGTVDFIFGNAAAV  368

Query  317   FQACNLVLRRPS---SYNVILANGRSDPGQNTGFSVQKCKITPGPDFSPVKNSYNSYLGR  147
             FQ CNLVLRRP    +YNVILANGRSDPGQNTGFS+Q C I PG DFSPVKNS+NSYLGR
Sbjct  369   FQNCNLVLRRPRNRVAYNVILANGRSDPGQNTGFSLQNCGIIPGSDFSPVKNSFNSYLGR  428

Query  146   PWKPYSRAVVMESDIDGAISARGWIEWPGTSSSSVRELYFGEYANVG  6
             PWK YSRAVVM+S IDGAI++RGWIEWPG  SSS+R LYF EY N+G
Sbjct  429   PWKVYSRAVVMQSTIDGAITSRGWIEWPGAPSSSLRTLYFAEYGNMG  475



>ref|XP_002277293.3| PREDICTED: probable pectinesterase/pectinesterase inhibitor 54 
[Vitis vinifera]
Length=532

 Score =   530 bits (1365),  Expect = 2e-180, Method: Compositional matrix adjust.
 Identities = 276/465 (59%), Positives = 342/465 (74%), Gaps = 21/465 (5%)
 Frame = -2

Query  1382  QIRIQCGYTRFPRLCVQTLSGLVSGERVDFAAALLLNKTIAHADLHIAHFDQLSSHFVSS  1203
             +++ +CG+T +P+LCVQTL GL    +VD    +L+NK ++   L  ++  + S    + 
Sbjct  34    RVQSECGFTTYPKLCVQTLLGL-GHSKVDIPF-VLVNKILSETRLPTSNIAKFSYQLATP  91

Query  1202  QPPQPRLQAIGYCEELMGMARQRLNEALVAMKESPGKNRQEDIQTWLSAAVTFQQACKDW  1023
             +     L     C+ LM M+ ++LN++L+A+KES  KN+  DIQTWLSAA+TFQQ CKD 
Sbjct  92    EAHSAHL-VRDSCDMLMSMSLKQLNQSLLALKESARKNKH-DIQTWLSAALTFQQTCKDL  149

Query  1022  A-DQYAFSDELFARISRSMDYQSQLASNALALVNRNT---EISAAGRQLSEEdidddddg  855
             A +   +      +IS  MD+ SQL +NALA++NR T   + + +GR LSEE +      
Sbjct  150   AVEMTRYFGTSMVQISSKMDHLSQLTNNALAVINRITPGPKKTTSGRGLSEEQVFPS---  206

Query  854   gffpDWVSGRDLRLLETTTDKTKANVVVAKDGTGNFRTVAEAIGAASGRQRFVIYVKSGV  675
                  WVS RD +LL+TTT   KAN +VA+DGTGN+ T+++AI AA+G+ RFVIYVKSGV
Sbjct  207   -----WVSPRDRKLLQTTT--IKANAIVAQDGTGNYETISDAIQAATGK-RFVIYVKSGV  258

Query  674   YKEKIRSSKDGITLIGDGKYSTIITWDDSVGGGSSLTGSATFGITGDGFIAKDIGFQNTA  495
             YKEKI ++KDGITLIGDGKYST I  DDSVGGG+SL  +ATF ITGDGFIAKDIGF+N A
Sbjct  259   YKEKIHTNKDGITLIGDGKYSTRIVGDDSVGGGASLLSTATFTITGDGFIAKDIGFENAA  318

Query  494   GPGAHQAVALTVASDHSVFYRCSISGYQDTLYALSLRQFYRECDISGTVDFIFGNAAAVF  315
             GP   QAVAL V+SDHSV Y+CSI+GYQDTLYA +LRQFYRECDI GT+DFIFGNAAAVF
Sbjct  319   GPKGEQAVALMVSSDHSVLYKCSIAGYQDTLYAQALRQFYRECDIYGTIDFIFGNAAAVF  378

Query  314   QACNLVLRRP--SSYNVILANGRSDPGQNTGFSVQKCKITPGPDFSPVKNSYNSYLGRPW  141
             Q C L+LRRP   S+NVILANGRS PGQNTGFS+QKC I P  DFS VK+SY SYLGRPW
Sbjct  379   QNCYLILRRPLGDSFNVILANGRSSPGQNTGFSIQKCTIIPSSDFSAVKHSYKSYLGRPW  438

Query  140   KPYSRAVVMESDIDGAISARGWIEWPGTSSSSVRELYFGEYANVG  6
             K YSRAVVMES ID AI  RGWIEWPG  SS ++ LYF EY+N+G
Sbjct  439   KEYSRAVVMESSIDDAIEGRGWIEWPGYGSSVLKSLYFAEYSNIG  483



>ref|XP_010107089.1| putative pectinesterase/pectinesterase inhibitor 54 [Morus notabilis]
 gb|EXC13610.1| putative pectinesterase/pectinesterase inhibitor 54 [Morus notabilis]
Length=540

 Score =   530 bits (1366),  Expect = 2e-180, Method: Compositional matrix adjust.
 Identities = 287/498 (58%), Positives = 350/498 (70%), Gaps = 14/498 (3%)
 Frame = -2

Query  1484  DLVTRTWVIMLVLFFGCCVTTIaaaavsqvaaQDQIRIQCGYTRFPRLCVQTLSGLVSG-  1308
             +++   +V+   L   C +             Q +I+  C +TR+P LCVQTL  L  G 
Sbjct  4     NMLEHYFVVFWALLGYCALGVANIDNRYSHQLQHEIQSDCHFTRYPSLCVQTLLALRPGS  63

Query  1307  -ERVDFAAALLLNKTIAHADLHIAHFDQLSS--HFVSSQPPQPRLQAIGYCEELMGMARQ  1137
                 D  +AL+ NKTI  + L  +  D  S+    + ++  +      G CE LM ++ +
Sbjct  64    YHYTDVISALV-NKTIEESKLPSSTSDDFSTLNSQLGAEAAKSAQSITGDCEALMSLSVK  122

Query  1136  RLNEALVAMKESPGKNRQEDIQTWLSAAVTFQQACKDWADQYAFSDELFARISRSMDYQS  957
             RL ++L A+K+SP K ++EDIQTWLSAA+TFQQACKD AD       L ++IS+ M Y +
Sbjct  123   RLRQSLTAIKQSPTK-KKEDIQTWLSAALTFQQACKDSADGLT----LASQISKKMSYLT  177

Query  956   QLASNALALVNRNT-EISAAGRQLSEEdidddddggffpDWVSGRDLRLLETTTDKTKAN  780
             +L+SNALAL NR T   S      +         G  FP WVS RD +LL++TT    AN
Sbjct  178   ELSSNALALTNRITGSKSPEPFDAATHTARGRLKGQIFPKWVSPRDRKLLQSTT--INAN  235

Query  779   VVVAKDGTGNFRTVAEAIGAASGRQRFVIYVKSGVYKEKIRSSKDGITLIGDGKYSTIIT  600
              VVA+DG+GN++T++EAI AASG  RFVIYVK+GVYKEKI +SKDGITLIG+GKY+TIIT
Sbjct  236   AVVAQDGSGNYKTISEAIRAASG-GRFVIYVKAGVYKEKIHASKDGITLIGEGKYTTIIT  294

Query  599   WDDSVGGGSSLTGSATFGITGDGFIAKDIGFQNTAGPGAHQAVALTVASDHSVFYRCSIS  420
              DDSV GGSS+ GSATF +TGDGFIA+DIGF NTAG    QA+AL +ASDHS  YRCSI+
Sbjct  295   GDDSVAGGSSMPGSATFTVTGDGFIARDIGFHNTAGSQGEQALALYIASDHSALYRCSIA  354

Query  419   GYQDTLYALSLRQFYRECDISGTVDFIFGNAAAVFQACNLVLRRPSSYNVILANGRSDPG  240
             GYQDTLYAL+LRQFYRECDI GTVDFIFGNAAAVFQ CNL LRRPS  NVILANGRSDPG
Sbjct  355   GYQDTLYALALRQFYRECDIYGTVDFIFGNAAAVFQKCNLALRRPSGANVILANGRSDPG  414

Query  239   QNTGFSVQKCKITPGPDFSPVKNSYNSYLGRPWKPYSRAVVMESDIDGAISARGWIEWPG  60
             QNTGFSVQ C+IT   +FS VK+SY SYLGRPWK YSRAVVM+S+ID AI  RGWIEWPG
Sbjct  415   QNTGFSVQNCQITASSEFSAVKHSYESYLGRPWKAYSRAVVMQSNIDDAIEPRGWIEWPG  474

Query  59    TSSSSVRELYFGEYANVG  6
               SS ++ LYF EYANVG
Sbjct  475   YGSSVLKSLYFAEYANVG  492



>ref|XP_002516196.1| Pectinesterase-2 precursor, putative [Ricinus communis]
 gb|EEF46198.1| Pectinesterase-2 precursor, putative [Ricinus communis]
Length=527

 Score =   529 bits (1362),  Expect = 6e-180, Method: Compositional matrix adjust.
 Identities = 291/470 (62%), Positives = 346/470 (74%), Gaps = 26/470 (6%)
 Frame = -2

Query  1382  QIRIQCGYTRFPRLCVQTLSGLVSGERVDFAAALLLNKTIAHADLHIAHFDQLSSHFVSS  1203
             QI+ +C +TR+P LC+QTL GL   + V   +AL+ NK+I+   L ++ F  L+S  +  
Sbjct  24    QIQEECSFTRYPSLCLQTLRGL-RDDSVHIVSALV-NKSISETKLPVSFFTSLTSQ-LGI  80

Query  1202  QPPQPRLQAIGYCEELMGMARQRLNEALVAMKESPGKNRQEDIQTWLSAAVTFQQACKDW  1023
             Q  Q       YCE LM M+ + L+++L+A+K+SP KN+  DIQTWLSAA+T+QQACKD 
Sbjct  81    QEAQYTQSTTDYCENLMKMSLKLLDKSLLALKQSPEKNKN-DIQTWLSAALTYQQACKDS  139

Query  1022  ADQYAF-SDELFARISRSMDYQSQLASNALALVNRNT--------EISAAGRQLSEEdid  870
              D     +  L ++ISR MDY S+L SN LALVNR T        + S   R L EE  D
Sbjct  140   VDSLGLPTGGLTSQISRKMDYLSELVSNPLALVNRITGDHDNKLKKNSTRSRYLGEEIQD  199

Query  869   ddddggffpDWVSGRDLRLLETTTDKTKANVVVAKDGTGNFRTVAEAIGAASGRQRFVIY  690
                       WVS +D +LL+++T   KAN VVAKDGTGN+ TV+EAI AA G  RFVIY
Sbjct  200   FPK-------WVSAKDRKLLQSST--IKANAVVAKDGTGNYETVSEAIKAAGG-GRFVIY  249

Query  689   VKSGVYKEKIRSSKDGITLIGDGKYSTIITWDDSVGGGSSLTGSATFGITGDGFIAKDIG  510
             VK+GVYKEKIR++KDGITLIG+GKYSTII  DDSVG GSS+ GSATF ITGDGFIA+DIG
Sbjct  250   VKAGVYKEKIRTNKDGITLIGEGKYSTIIVGDDSVGDGSSMPGSATFTITGDGFIARDIG  309

Query  509   FQNTAGPGAHQAVALTVASDHSVFYRCSISGYQDTLYALSLRQFYRECDISGTVDFIFGN  330
             FQN AGP   QA+AL +ASDHSV YRCSI+GYQDTLYALS RQFYRECDI GT+DFIFGN
Sbjct  310   FQNAAGPQGEQALALYIASDHSVLYRCSIAGYQDTLYALSQRQFYRECDIYGTIDFIFGN  369

Query  329   AAAVFQACNLVLRRPS--SYNVILANGRSDPGQNTGFSVQKCKITPGPDFSPVKNSYNSY  156
             AAAVFQ C LVLRRP   SYNVILANGRSDPGQNTGFSVQ C+IT   DFSPVK+SYNSY
Sbjct  370   AAAVFQNCYLVLRRPDHGSYNVILANGRSDPGQNTGFSVQNCRITASSDFSPVKHSYNSY  429

Query  155   LGRPWKPYSRAVVMESDIDGAISARGWIEWPGTSSSSVRELYFGEYANVG  6
             LGRPWK YSR+++MES ID AIS +GWIEWPG  S S + LYF EY+N G
Sbjct  430   LGRPWKQYSRSIIMESYIDDAISWKGWIEWPGAGSYS-KSLYFAEYSNTG  478



>ref|XP_007203752.1| hypothetical protein PRUPE_ppa016574mg [Prunus persica]
 gb|EMJ04951.1| hypothetical protein PRUPE_ppa016574mg [Prunus persica]
Length=522

 Score =   524 bits (1350),  Expect = 3e-178, Method: Compositional matrix adjust.
 Identities = 279/468 (60%), Positives = 337/468 (72%), Gaps = 30/468 (6%)
 Frame = -2

Query  1382  QIRIQ--CGYTRFPRLCVQTLSGLVSGERVDFAAALLLNKTIAHADLHIAHFDQLSSHF-  1212
             QI +Q  C +TR+P +CVQT+ G   G  VD   AL  NKTI+   L    F   SS F 
Sbjct  27    QIYVQKECSFTRYPSICVQTMMGSGLGH-VDIMLALA-NKTISETMLATFEFVNFSSQFK  84

Query  1211  ----VSSQPPQPRLQAIG--YCEELMGMARQRLNEALVAMKESPGKNRQEDIQTWLSAAV  1050
                 + +  PQ R+ ++   YCEELM M+ +RL+++L+A+K+SP KN+  DIQ WLSAA+
Sbjct  85    LGGKLGACEPQ-RVHSVKDYYCEELMNMSLKRLDQSLLALKQSPRKNKH-DIQAWLSAAL  142

Query  1049  TFQQACKDWADQYAFSDELFARISRSMDYQSQLASNALALVNRNTEISAAGRQLSEEdid  870
             TFQ  CKD+A           +IS+ +D  SQL SN LALVNR T         +     
Sbjct  143   TFQDTCKDYAS---------GQISKRIDNASQLVSNLLALVNRITS-----NHTTTVTNH  188

Query  869   ddddggffpDWVSGRDLRLLETTTDKTKANVVVAKDGTGNFRTVAEAIGAASGRQRFVIY  690
                D G F  WVS RD +LL+ TT   KA+ VVAKDG+G+++TV+EA+ AASG  RFVIY
Sbjct  189   RSVDQGLFAKWVSQRDRKLLQATT--IKADAVVAKDGSGDYKTVSEAVNAASG-GRFVIY  245

Query  689   VKSGVYKEKIRSSKDGITLIGDGKYSTIITWDDSVGGGSSLTGSATFGITGDGFIAKDIG  510
             VK+GVY+EKI + KDGITLIGDGKYSTIITWDDSV  G+S+ GSATF +TGDGFIA+DIG
Sbjct  246   VKAGVYEEKIHTKKDGITLIGDGKYSTIITWDDSVAKGASMPGSATFTVTGDGFIARDIG  305

Query  509   FQNTAGPGAHQAVALTVASDHSVFYRCSISGYQDTLYALSLRQFYRECDISGTVDFIFGN  330
             FQNTAGP   QA+AL ++SD SV YRCSI GYQDTLYA +LRQFYRECDI GT+DFIFGN
Sbjct  306   FQNTAGPQGEQALALYISSDRSVLYRCSIVGYQDTLYAYALRQFYRECDIYGTIDFIFGN  365

Query  329   AAAVFQACNLVLRRPSSYNVILANGRSDPGQNTGFSVQKCKITPGPDFSPVKNSYNSYLG  150
             AAAVFQ+C+LVLRR   YN ILANGRSDPGQ TGFSVQ C+I P  DFSPVK+SY+SYLG
Sbjct  366   AAAVFQSCDLVLRRHKGYNAILANGRSDPGQKTGFSVQNCRIIPSSDFSPVKHSYSSYLG  425

Query  149   RPWKPYSRAVVMESDIDGAISARGWIEWPGTSSSSVRELYFGEYANVG  6
             RPWK YSRA+VMES ID  I+ +GW+EWPG   SS++ LYF EYAN G
Sbjct  426   RPWKQYSRAIVMESTIDDVIAPQGWVEWPGAGGSSLKTLYFAEYANGG  473



>gb|KDP33950.1| hypothetical protein JCGZ_07521 [Jatropha curcas]
Length=482

 Score =   522 bits (1344),  Expect = 5e-178, Method: Compositional matrix adjust.
 Identities = 270/433 (62%), Positives = 329/433 (76%), Gaps = 21/433 (5%)
 Frame = -2

Query  1280  LLNKTIAHADLHIAHFD-QLSSHFVSSQPPQPRLQAIGYCEELMGMARQRLNEALVAMKE  1104
             L+ +TI+   L  + F  QL+S     +   P+     YCE+L+ M+ +RL+++L+A+KE
Sbjct  14    LVQRTISETKLPTSFFKTQLNSQLEVQEAQHPK-SVTDYCEKLIRMSLKRLDQSLLALKE  72

Query  1103  SPGKNRQEDIQTWLSAAVTFQQACKDWADQYAF-SDELFARISRSMDYQSQLASNALALV  927
             SP KN+  D+Q+WLSAA+TFQQACKD AD + F +  L +RIS  MDY S+LASN LAL+
Sbjct  73    SPKKNKN-DVQSWLSAALTFQQACKDSADSFGFPAGGLTSRISTKMDYLSELASNPLALI  131

Query  926   NRNTEISAAG---RQLSEEdidddddggffpDWVSGRDLRLLETTTDKTKANVVVAKDGT  756
             NR T  +      R+L  E  +          WVS +D +LL+T+T   KAN VVAKDGT
Sbjct  132   NRVTNKAKNNIKKRRLGGEVKEFPK-------WVSAKDRKLLQTST--VKANAVVAKDGT  182

Query  755   GNFRTVAEAIGAASGRQRFVIYVKSGVYKEKIRSSKDGITLIGDGKYSTIITWDDSVGGG  576
             GN++T+ +AI AA+G  RFVIYVKSGVY EKIR++KDGITLIG+GKYSTII  DDSV GG
Sbjct  183   GNYKTITDAIKAATG-SRFVIYVKSGVYNEKIRTNKDGITLIGEGKYSTIIANDDSVAGG  241

Query  575   SSLTGSATFGITGDGFIAKDIGFQNTAGPGAHQAVALTVASDHSVFYRCSISGYQDTLYA  396
             SS+  +ATF ITGDGFIA+DIGFQNTAGP   QA+AL +ASD SV YRCSI+GYQDTLYA
Sbjct  242   SSMPDTATFTITGDGFIARDIGFQNTAGPQGEQALALYIASDKSVLYRCSIAGYQDTLYA  301

Query  395   LSLRQFYRECDISGTVDFIFGNAAAVFQACNLVLRRPS---SYNVILANGRSDPGQNTGF  225
             L+LRQFYRECDI GT+DFIFGNAAAVFQ C LVLRRPS   SYNVILANGRSDPGQNTGF
Sbjct  302   LALRQFYRECDIYGTIDFIFGNAAAVFQNCYLVLRRPSSHESYNVILANGRSDPGQNTGF  361

Query  224   SVQKCKITPGPDFSPVKNSYNSYLGRPWKPYSRAVVMESDIDGAISARGWIEWPGTSSSS  45
             S+Q C+IT   DFSPVK+++ SYLGRPWK YSR+V+MES+ID AIS+RGWIEWPG +S  
Sbjct  362   SIQNCRITASSDFSPVKHNFKSYLGRPWKQYSRSVIMESNIDDAISSRGWIEWPGAASYG  421

Query  44    VRELYFGEYANVG  6
              + LYF EYAN G
Sbjct  422   -KTLYFAEYANTG  433



>ref|XP_010047430.1| PREDICTED: pectinesterase [Eucalyptus grandis]
 gb|KCW79340.1| hypothetical protein EUGRSUZ_C00760 [Eucalyptus grandis]
Length=534

 Score =   522 bits (1345),  Expect = 3e-177, Method: Compositional matrix adjust.
 Identities = 288/493 (58%), Positives = 356/493 (72%), Gaps = 24/493 (5%)
 Frame = -2

Query  1466  WVIMLVLFFGCCVTTIaaaavsqvaaQDQIRIQCGYTRFPRLCVQTLSGLVSGERVDFAA  1287
             WV+  ++ +G   T++A   V       Q++ QCG+TR+P LCV+TL+G  S + +    
Sbjct  12    WVVACMVLYGGTTTSLAGGVVEGQEPSRQVQEQCGFTRYPALCVRTLAGSGSADIL----  67

Query  1286  ALLLNKTIAHADLHIAHFDQLSSHFVSSQPPQPRLQAI-GYCEELMGMARQRLNEALVAM  1110
             + L+NKTI   +L  ++F Q++S   +        +A+  +CE+ M ++ +RL ++  A+
Sbjct  68    SALVNKTILETNLPPSYFAQITSLSETQGAQAQHAKAVTDHCEDAMTLSLKRLEQSREAL  127

Query  1109  KESPGKNRQEDIQTWLSAAVTFQQACKDWA---DQYAFSDELFARISRSMDYQSQLASNA  939
             +E PGKN+  D+QTWLSAA+T Q +CKD A      + S +  AR+S+ MDY +QL SNA
Sbjct  128   RE-PGKNK-ADVQTWLSAAMTLQDSCKDSARGVGPLSLSGDAAARLSQKMDYLAQLTSNA  185

Query  938   LALVNRNTEISAAGRQLSEEdidddddggffpDWVSGRDLRLLETTTDKTKANVVVAKDG  759
             LALVNR T     G+    +   D  +   FP+WV  RD RLL++TT+K  AN VVAKDG
Sbjct  186   LALVNRITHRRKPGK---TDKDRDASETRGFPNWVYKRDRRLLQSTTEK--ANAVVAKDG  240

Query  758   TGNFRTVAEAIGAASGRQRFVIYVKSGVYKEKIRSSKDGITLIGDGKYSTIITWDDSVGG  579
             TGN+ TV+EAI AASG  RFVIYVK+GVYKEKI + KD ITLIGDGKYSTIIT DDSV G
Sbjct  241   TGNYETVSEAIQAASG-GRFVIYVKAGVYKEKIVADKDEITLIGDGKYSTIITGDDSVAG  299

Query  578   GSSLTGSATFGITGDGFIAKDIGFQNTAGPGAHQAVALTVASDHSVFYRCSISGYQDTLY  399
             GSSL GSATF ITGDGFIA+DIGFQNTAGP   QAVALTVASDH+ FYRCSI+GYQDTLY
Sbjct  300   GSSLRGSATFTITGDGFIARDIGFQNTAGPQGQQAVALTVASDHAAFYRCSIAGYQDTLY  359

Query  398   ALSLRQFYRECDISGTVDFIFGNAAAVFQACNLVLRRP--SSYNVILANGRSDPGQNTGF  225
             AL LRQFYRECDI GT+DFIFGNAAAVFQ C LVLR+   S+Y VILANGRSDPGQNTGF
Sbjct  360   ALVLRQFYRECDIYGTIDFIFGNAAAVFQNCELVLRKSGNSAYTVILANGRSDPGQNTGF  419

Query  224   SVQKCKITPGPDFSPVKNSYNSYLGRPWKPYSRAVVMESDIDGAISARGWIEWPGTSSSS  45
             ++Q C+IT         +S +SYLGRPWK YSRAVVM+S IDGAI+ARGWIEWPG  SS 
Sbjct  420   TIQGCRITSDA------SSGSSYLGRPWKYYSRAVVMQSTIDGAIAARGWIEWPGYGSSV  473

Query  44    VRELYFGEYANVG  6
             ++ LYF EYAN G
Sbjct  474   LKTLYFAEYANQG  486



>ref|XP_008242147.1| PREDICTED: pectinesterase [Prunus mume]
Length=526

 Score =   517 bits (1332),  Expect = 2e-175, Method: Compositional matrix adjust.
 Identities = 276/471 (59%), Positives = 338/471 (72%), Gaps = 32/471 (7%)
 Frame = -2

Query  1382  QIRIQ--CGYTRFPRLCVQTLSGLVSG---ERVDFAAALLLNKTIAHADLHIAHFDQLSS  1218
             QI +Q  C +TR+P +CVQT+ G   G   + VD   AL  NKTI+   L  + F   SS
Sbjct  27    QIYVQKECSFTRYPSICVQTMMGSGLGHEQQHVDIMLALA-NKTISETMLATSKFVNFSS  85

Query  1217  HF-----VSSQPPQPRLQAIG--YCEELMGMARQRLNEALVAMKESPGKNRQEDIQTWLS  1059
              F     + ++  Q R+ ++   YCEELM M+ +RL+++L+A+K+SP KN+  DIQ WLS
Sbjct  86    QFKLGGELGAREAQ-RVHSVKDYYCEELMNMSLKRLDQSLLALKQSPRKNKH-DIQAWLS  143

Query  1058  AAVTFQQACKDWADQYAFSDELFARISRSMDYQSQLASNALALVNRNTEISAAGRQLSEE  879
             AA+TFQ  CKD+A           +IS+ ++  SQL SN LALVNR T         +  
Sbjct  144   AALTFQDTCKDYAS---------GQISKRINNASQLVSNLLALVNRITS-----NHTTTV  189

Query  878   didddddggffpDWVSGRDLRLLETTTDKTKANVVVAKDGTGNFRTVAEAIGAASGRQRF  699
                   D G F  WVS RD +LL+ TT   KA+ VVAKDG+G+++TV+EA+ AASG  RF
Sbjct  190   TNHRSVDRGLFAKWVSQRDRKLLQATT--IKADAVVAKDGSGDYKTVSEAVNAASG-GRF  246

Query  698   VIYVKSGVYKEKIRSSKDGITLIGDGKYSTIITWDDSVGGGSSLTGSATFGITGDGFIAK  519
             VIYVK+GVY+EKI + KDGITLIGDGKYSTIIT DDSV  G+S+ GSATF +TGDGFIA+
Sbjct  247   VIYVKAGVYEEKIHTKKDGITLIGDGKYSTIITGDDSVAKGASMPGSATFTVTGDGFIAR  306

Query  518   DIGFQNTAGPGAHQAVALTVASDHSVFYRCSISGYQDTLYALSLRQFYRECDISGTVDFI  339
             DIGFQNTAGP   QA+AL ++SD SV YRCSI GYQDTLYA +LRQFYRECDI GT+DFI
Sbjct  307   DIGFQNTAGPQGKQALALYISSDRSVLYRCSIVGYQDTLYAYALRQFYRECDIYGTIDFI  366

Query  338   FGNAAAVFQACNLVLRRPSSYNVILANGRSDPGQNTGFSVQKCKITPGPDFSPVKNSYNS  159
             FGNAAAVFQ+C+LVLRR   YN ILANGRSDPGQ TGFSVQ C+I P  DFSPVK+SY+S
Sbjct  367   FGNAAAVFQSCDLVLRRHKGYNAILANGRSDPGQKTGFSVQNCRIIPSSDFSPVKHSYSS  426

Query  158   YLGRPWKPYSRAVVMESDIDGAISARGWIEWPGTSSSSVRELYFGEYANVG  6
             YLGRPWK YSRA+VMES ID  I+ +GW+EWPG   SS++ LYF EYAN G
Sbjct  427   YLGRPWKQYSRAIVMESTIDDVIAPQGWVEWPGAGGSSLKTLYFAEYANGG  477



>ref|XP_006474559.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 54-like 
[Citrus sinensis]
Length=535

 Score =   514 bits (1325),  Expect = 3e-174, Method: Compositional matrix adjust.
 Identities = 273/470 (58%), Positives = 342/470 (73%), Gaps = 23/470 (5%)
 Frame = -2

Query  1385  DQIRIQCGYTRFPRLCVQTLSGLVSGERVDFAAAL--LLNKTIAHADLHIAHFDQLSSHF  1212
             ++I+ +C +TRFP LCVQTL G  S +       +  L+NK+IA + L  ++F   SS  
Sbjct  31    NKIQKECSFTRFPILCVQTLMGFESTKHQQHIHLMSALVNKSIAESKLPTSYFSNFSSQL  90

Query  1211  VSSQPPQPRLQAIGYCEELMGMARQRLNEALVAMKESPGKNRQEDIQTWLSAAVTFQQAC  1032
             ++      R     +CEE+M M+ +RL ++L+A++ SP KN+ +DIQTWL AA+TFQQ C
Sbjct  91    LAKDSQGVR-AVTDHCEEMMSMSLKRLEKSLLALQNSPTKNK-DDIQTWLGAALTFQQTC  148

Query  1031  KDWADQYAFSD--ELFARISRSMDYQSQLASNALALVNR-----NTEISAAGRQLSEEdi  873
             KD  +    S+  E+  +IS+ MDY SQL SN LALVNR       + S   R+L EE  
Sbjct  149   KDSVNSLGLSERNEVIKKISQKMDYLSQLTSNPLALVNRIARASYPKNSTYNRRLDEEQG  208

Query  872   dddddggffpDWVSGRDLRLLETTTDKTKANVVVAKDGTGNFRTVAEAIGAASGRQRFVI  693
             D  +       WVS ++ +LL+    +  ANV+VA+DGTGN+RTV+EAI AASG  RFVI
Sbjct  209   DFPN-------WVSAKNRKLLQAP--RINANVIVAQDGTGNYRTVSEAISAASG-NRFVI  258

Query  692   YVKSGVYKEKIRSSKDGITLIGDGKYSTIITWDDSVGGGSSLTGSATFGITGDGFIAKDI  513
             YVK+GVYKEKIR++KDGITLIGDGKY+TIIT DD+   G+S+  +ATF ITGDGFIA+DI
Sbjct  259   YVKAGVYKEKIRTNKDGITLIGDGKYTTIITGDDNARRGTSMPATATFTITGDGFIARDI  318

Query  512   GFQNTAGPGAHQAVALTVASDHSVFYRCSISGYQDTLYALSLRQFYRECDISGTVDFIFG  333
             GF NTAGP   QA+AL VASDH+VFYRCSI+GYQDTLYAL+LRQFYR+ DI GT+DFIFG
Sbjct  319   GFHNTAGPQGEQALALNVASDHTVFYRCSIAGYQDTLYALALRQFYRDTDIYGTIDFIFG  378

Query  332   NAAAVFQACNLVLRRPS-SYNVILANGRSDPGQNTGFSVQKCKITPGPDFSPVKNSYNSY  156
             NAAAVFQ C LVLRRP  SYN I ANGR+DPGQNTGFS+Q CKI  G D++PVK+ YNSY
Sbjct  379   NAAAVFQNCYLVLRRPKGSYNAITANGRTDPGQNTGFSLQNCKIAAGSDYAPVKHKYNSY  438

Query  155   LGRPWKPYSRAVVMESDIDGAISARGWIEWPGTSSSSVRELYFGEYANVG  6
             LGRPWK YSRAVVM+S ID +IS+ GW+EWPG +    + LYF EYANVG
Sbjct  439   LGRPWKQYSRAVVMQSSIDDSISSSGWVEWPG-AGGYAKTLYFAEYANVG  487



>ref|XP_004287680.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 54-like 
[Fragaria vesca subsp. vesca]
Length=489

 Score =   512 bits (1319),  Expect = 5e-174, Method: Compositional matrix adjust.
 Identities = 265/447 (59%), Positives = 331/447 (74%), Gaps = 19/447 (4%)
 Frame = -2

Query  1325  SGLVSGERVDFAAALLLNKTIAHADLHIAHFDQLSSHFVSSQPPQPRLQA--IGYCEELM  1152
             SG    + VD  +AL+ NKTI    L  + F + SS     +  QP   +    YCEELM
Sbjct  8     SGHQDPQHVDIMSALV-NKTIYETRLTSSEFSKFSSQLFEVRDSQPTHDSGSKDYCEELM  66

Query  1151  GMARQRLNEALVAMKESPGKNRQEDIQTWLSAAVTFQQACKDWADQYAFS----DELFAR  984
              M+ +RL ++L+A+K+SP KN+Q DIQ WLSAA+TFQ+ CKD+A  +  S    + L   
Sbjct  67    TMSLKRLEQSLIALKKSPSKNKQ-DIQAWLSAALTFQETCKDYAADHGLSLTSSENLRLD  125

Query  983   ISRSMDYQSQLASNALALVNRNTEISAAGRQLSEEdidddddggffpDWVSGRDLRLLET  804
             +S+ + Y SQL SN LALVNR +  S   +  +            FP WVS ++ +LL+ 
Sbjct  126   LSKRIGYTSQLGSNLLALVNRVSSNSDNPKNTTR-----GKKAEMFPKWVSPKNRKLLQA  180

Query  803   TTDKTKANVVVAKDGTGNFRTVAEAIGAASGRQRFVIYVKSGVYKEKIRSSKDGITLIGD  624
             TT   KANVVVAKDG+GN++TV+EAI AA+G  RFVIYVK+GVYKEKI+++KDGITLIGD
Sbjct  181   TT--VKANVVVAKDGSGNYKTVSEAIQAATG-GRFVIYVKAGVYKEKIKTNKDGITLIGD  237

Query  623   GKYSTIITWDDSVGGGSSLTGSATFGITGDGFIAKDIGFQNTAGPGAHQAVALTVASDHS  444
             G+YSTIIT D SV  GS++ GSATF +TGDGFIA+DIGFQNTAGP A QA+AL ++SDHS
Sbjct  238   GQYSTIITGDSSVSKGSTMPGSATFTVTGDGFIARDIGFQNTAGPDAEQALALYISSDHS  297

Query  443   VFYRCSISGYQDTLYALSLRQFYRECDISGTVDFIFGNAAAVFQACNLVLRRPSSYNVIL  264
             V Y+CSI GYQDTLYAL+LRQFYRECDI G++DFIFGNAAAVFQ+CN+VLRR   YN IL
Sbjct  298   VLYKCSIVGYQDTLYALALRQFYRECDIYGSIDFIFGNAAAVFQSCNIVLRRHKGYNAIL  357

Query  263   ANGRSDPGQNTGFSVQKCKITPGPDFSPVKNSYNSYLGRPWKPYSRAVVMESDIDGAISA  84
             A+GRSDPGQ TGFSVQ C+I PG D SP+K+SY+SYLGRPWK Y+RAVVM+S+ID  IS 
Sbjct  358   ASGRSDPGQKTGFSVQNCRIVPGSDLSPIKHSYSSYLGRPWKDYARAVVMQSNIDDVISP  417

Query  83    RGWIEWPGTSSSSVRELYFGEYANVGA  3
             RGW+EWPG+S  S+   YF E+ANVG+
Sbjct  418   RGWVEWPGSSPKSI---YFAEFANVGS  441



>gb|KDO73738.1| hypothetical protein CISIN_1g009418mg [Citrus sinensis]
Length=535

 Score =   512 bits (1318),  Expect = 3e-173, Method: Compositional matrix adjust.
 Identities = 273/470 (58%), Positives = 340/470 (72%), Gaps = 23/470 (5%)
 Frame = -2

Query  1385  DQIRIQCGYTRFPRLCVQTLSGLVSGERVDFAAAL--LLNKTIAHADLHIAHFDQLSSHF  1212
             ++I+ +C +TRFP LCVQTL G  S +       +  L+NK+IA   L  ++F   SS  
Sbjct  31    NKIQKECSFTRFPILCVQTLMGFESTKHQQHIHLMSALVNKSIAETKLPTSYFSNFSSQL  90

Query  1211  VSSQPPQPRLQAIGYCEELMGMARQRLNEALVAMKESPGKNRQEDIQTWLSAAVTFQQAC  1032
             ++      R     +CEE+M M+ +RL ++L+A++ SP KN+ +DIQTWL AA+TFQQ C
Sbjct  91    LAKDFQGVR-AVTDHCEEMMSMSLKRLEKSLLALQNSPTKNK-DDIQTWLGAALTFQQTC  148

Query  1031  KDWADQYAFSD--ELFARISRSMDYQSQLASNALALVNR-----NTEISAAGRQLSEEdi  873
             KD  +    S+  E+  +IS+ MDY SQL SN LALVNR       + S   R+L EE  
Sbjct  149   KDSVNSLGLSERNEVIKKISQKMDYLSQLTSNPLALVNRIARASYPKNSTYNRRLDEEQG  208

Query  872   dddddggffpDWVSGRDLRLLETTTDKTKANVVVAKDGTGNFRTVAEAIGAASGRQRFVI  693
             D  +       WVS ++ +LL+    +  ANV+VA+DGTGN+RTV+EAI AASG  RFVI
Sbjct  209   DFPN-------WVSAKNRKLLQAP--RINANVIVAQDGTGNYRTVSEAISAASG-NRFVI  258

Query  692   YVKSGVYKEKIRSSKDGITLIGDGKYSTIITWDDSVGGGSSLTGSATFGITGDGFIAKDI  513
             YVK+GVYKEKIR++KDGITLIGDGKY+TIIT DD+   G+S+  +ATF ITGDGFIA+DI
Sbjct  259   YVKAGVYKEKIRTNKDGITLIGDGKYTTIITGDDNARRGTSMPATATFTITGDGFIARDI  318

Query  512   GFQNTAGPGAHQAVALTVASDHSVFYRCSISGYQDTLYALSLRQFYRECDISGTVDFIFG  333
             GF NTAGP   QA+AL VASDH+VFYRCSI+GYQDTLYAL+LRQFYR+ DI GT+DFIFG
Sbjct  319   GFHNTAGPQGEQALALNVASDHTVFYRCSIAGYQDTLYALALRQFYRDTDIYGTIDFIFG  378

Query  332   NAAAVFQACNLVLRRPS-SYNVILANGRSDPGQNTGFSVQKCKITPGPDFSPVKNSYNSY  156
             NAAAVFQ C LVLRRP  SYN I ANGR+DPGQNTGFS+Q CKI  G D++PVK+ YNSY
Sbjct  379   NAAAVFQNCYLVLRRPKGSYNAITANGRTDPGQNTGFSLQNCKIAAGSDYAPVKHKYNSY  438

Query  155   LGRPWKPYSRAVVMESDIDGAISARGWIEWPGTSSSSVRELYFGEYANVG  6
             LGRPWK YSRAVVM+S ID +IS+ GW+EWPG +      LYF EYANVG
Sbjct  439   LGRPWKQYSRAVVMQSSIDDSISSSGWVEWPG-AGGYANTLYFAEYANVG  487



>ref|XP_006452911.1| hypothetical protein CICLE_v10007964mg [Citrus clementina]
 gb|ESR66151.1| hypothetical protein CICLE_v10007964mg [Citrus clementina]
Length=535

 Score =   511 bits (1317),  Expect = 5e-173, Method: Compositional matrix adjust.
 Identities = 274/470 (58%), Positives = 340/470 (72%), Gaps = 23/470 (5%)
 Frame = -2

Query  1385  DQIRIQCGYTRFPRLCVQTLSGLVSGERVDFAAAL--LLNKTIAHADLHIAHFDQLSSHF  1212
             ++I+ +C +TRFP LCVQTL G  S +       +  L+NK+IA   L  ++F   SS  
Sbjct  31    NKIQKECSFTRFPILCVQTLMGFESTKHQQHIHLMSALVNKSIAETKLPTSYFSNFSSQL  90

Query  1211  VSSQPPQPRLQAIGYCEELMGMARQRLNEALVAMKESPGKNRQEDIQTWLSAAVTFQQAC  1032
             ++      R     +CEE+M M+ +RL ++L+A++ SP KN+  DIQTWL AA+TFQQ C
Sbjct  91    LAKDFQGVR-AVTDHCEEMMSMSLKRLEKSLLALQNSPTKNKH-DIQTWLGAALTFQQTC  148

Query  1031  KDWADQYAFS--DELFARISRSMDYQSQLASNALALVNR-----NTEISAAGRQLSEEdi  873
             KD  +    S  +E+  +IS+ MDY SQL SN LALVNR       + S   R+L EE  
Sbjct  149   KDSVNSLGLSARNEVIKKISQKMDYLSQLTSNPLALVNRIDRASYPKNSTYNRRLDEEQG  208

Query  872   dddddggffpDWVSGRDLRLLETTTDKTKANVVVAKDGTGNFRTVAEAIGAASGRQRFVI  693
             D  +       WVS ++ +LL+    +  ANV+VA+DGTGN+RTV+EAI AASG  RFVI
Sbjct  209   DFPN-------WVSAKNRKLLQAP--RINANVIVAQDGTGNYRTVSEAISAASG-NRFVI  258

Query  692   YVKSGVYKEKIRSSKDGITLIGDGKYSTIITWDDSVGGGSSLTGSATFGITGDGFIAKDI  513
             YVK+GVYKEKIR++KDGITLIGDGKY+TIIT DD+   G+S+ G+ATF ITGDGFIA+DI
Sbjct  259   YVKAGVYKEKIRTNKDGITLIGDGKYTTIITGDDNARRGTSMPGTATFTITGDGFIARDI  318

Query  512   GFQNTAGPGAHQAVALTVASDHSVFYRCSISGYQDTLYALSLRQFYRECDISGTVDFIFG  333
             GF NTAGP   QA+AL VASDH+VFYRCSI+GYQDTLYAL+LRQFYR+ DI GT+DFIFG
Sbjct  319   GFHNTAGPQGEQALALNVASDHTVFYRCSIAGYQDTLYALALRQFYRDTDIYGTIDFIFG  378

Query  332   NAAAVFQACNLVLRRP-SSYNVILANGRSDPGQNTGFSVQKCKITPGPDFSPVKNSYNSY  156
             NAAAVFQ C LVLRRP  SYNVI ANGR+DPGQNTGFS+Q CKI  G D++ VK+ YNSY
Sbjct  379   NAAAVFQNCYLVLRRPGGSYNVITANGRTDPGQNTGFSLQNCKIAAGSDYAQVKHKYNSY  438

Query  155   LGRPWKPYSRAVVMESDIDGAISARGWIEWPGTSSSSVRELYFGEYANVG  6
             LGRPWK YSRAVVM+S ID +IS+ GW+EWPG +      LYF EYANVG
Sbjct  439   LGRPWKQYSRAVVMQSSIDDSISSSGWVEWPG-AGGYANTLYFAEYANVG  487



>gb|KDO73740.1| hypothetical protein CISIN_1g009418mg [Citrus sinensis]
Length=529

 Score =   510 bits (1314),  Expect = 9e-173, Method: Compositional matrix adjust.
 Identities = 272/470 (58%), Positives = 339/470 (72%), Gaps = 29/470 (6%)
 Frame = -2

Query  1385  DQIRIQCGYTRFPRLCVQTLSGLVSGERVDFAAAL--LLNKTIAHADLHIAHFDQLSSHF  1212
             ++I+ +C +TRFP LCVQTL G  S +       +  L+NK+IA   L  ++F   SS  
Sbjct  31    NKIQKECSFTRFPILCVQTLMGFESTKHQQHIHLMSALVNKSIAETKLPTSYFSNFSSQL  90

Query  1211  VSSQPPQPRLQAIGYCEELMGMARQRLNEALVAMKESPGKNRQEDIQTWLSAAVTFQQAC  1032
             ++            +CEE+M M+ +RL ++L+A++ SP KN+ +DIQTWL AA+TFQQ C
Sbjct  91    LAKDFQD-------HCEEMMSMSLKRLEKSLLALQNSPTKNK-DDIQTWLGAALTFQQTC  142

Query  1031  KDWADQYAFSD--ELFARISRSMDYQSQLASNALALVNR-----NTEISAAGRQLSEEdi  873
             KD  +    S+  E+  +IS+ MDY SQL SN LALVNR       + S   R+L EE  
Sbjct  143   KDSVNSLGLSERNEVIKKISQKMDYLSQLTSNPLALVNRIARASYPKNSTYNRRLDEEQG  202

Query  872   dddddggffpDWVSGRDLRLLETTTDKTKANVVVAKDGTGNFRTVAEAIGAASGRQRFVI  693
             D  +       WVS ++ +LL+    +  ANV+VA+DGTGN+RTV+EAI AASG  RFVI
Sbjct  203   DFPN-------WVSAKNRKLLQAP--RINANVIVAQDGTGNYRTVSEAISAASG-NRFVI  252

Query  692   YVKSGVYKEKIRSSKDGITLIGDGKYSTIITWDDSVGGGSSLTGSATFGITGDGFIAKDI  513
             YVK+GVYKEKIR++KDGITLIGDGKY+TIIT DD+   G+S+  +ATF ITGDGFIA+DI
Sbjct  253   YVKAGVYKEKIRTNKDGITLIGDGKYTTIITGDDNARRGTSMPATATFTITGDGFIARDI  312

Query  512   GFQNTAGPGAHQAVALTVASDHSVFYRCSISGYQDTLYALSLRQFYRECDISGTVDFIFG  333
             GF NTAGP   QA+AL VASDH+VFYRCSI+GYQDTLYAL+LRQFYR+ DI GT+DFIFG
Sbjct  313   GFHNTAGPQGEQALALNVASDHTVFYRCSIAGYQDTLYALALRQFYRDTDIYGTIDFIFG  372

Query  332   NAAAVFQACNLVLRRPS-SYNVILANGRSDPGQNTGFSVQKCKITPGPDFSPVKNSYNSY  156
             NAAAVFQ C LVLRRP  SYN I ANGR+DPGQNTGFS+Q CKI  G D++PVK+ YNSY
Sbjct  373   NAAAVFQNCYLVLRRPKGSYNAITANGRTDPGQNTGFSLQNCKIAAGSDYAPVKHKYNSY  432

Query  155   LGRPWKPYSRAVVMESDIDGAISARGWIEWPGTSSSSVRELYFGEYANVG  6
             LGRPWK YSRAVVM+S ID +IS+ GW+EWPG +      LYF EYANVG
Sbjct  433   LGRPWKQYSRAVVMQSSIDDSISSSGWVEWPG-AGGYANTLYFAEYANVG  481



>ref|XP_007138602.1| hypothetical protein PHAVU_009G222700g [Phaseolus vulgaris]
 gb|ESW10596.1| hypothetical protein PHAVU_009G222700g [Phaseolus vulgaris]
Length=534

 Score =   506 bits (1303),  Expect = 5e-171, Method: Compositional matrix adjust.
 Identities = 270/463 (58%), Positives = 334/463 (72%), Gaps = 25/463 (5%)
 Frame = -2

Query  1370  QCGYTRFPRLCVQTL--SGLVSGERVDFAAALLLNKTIAHADLHIAHFDQLSSHFVSSQP  1197
             +C  TR+P LC +TL  SG  S   VD   AL+ NKTI   +L  ++F    + F ++  
Sbjct  42    ECSLTRYPNLCAETLMQSG-SSNHTVDNILALV-NKTILETNLPSSYF----AEFKTADA  95

Query  1196  PQPRLQAIGYCEELMGMARQRLNEALVAMKESPGKNRQEDIQTWLSAAVTFQQACKDWAD  1017
                      YCEELM M+ +RL+++L A+K SPG+N   DIQTWLSA++TFQQ+CKD+A 
Sbjct  96    HVAHSVVADYCEELMSMSLKRLDQSLRALK-SPGRN-NNDIQTWLSASLTFQQSCKDYAH  153

Query  1016  QYAF---SDELFARISRSMDYQSQLASNALALVNRNTEISAAGRQLSEEdidddddggff  846
              +A    +D L  R+   M++ SQL SN+LALVN  +  ++     +EE+ +        
Sbjct  154   AHATVLSADGLMQRMCNKMEFLSQLGSNSLALVNHMSTKASHKVGTNEEEDEFPK-----  208

Query  845   pDWVSGRDLRLLETTTDKTKANVVVAKDGTGNFRTVAEAIGAASGRQRFVIYVKSGVYKE  666
               WVS +  +LL+  T   KAN +VA+DG+GN++TV++AI AASG+ RFVIYVK G+YKE
Sbjct  209   --WVSAKGRKLLQGGT--IKANAIVAQDGSGNYKTVSDAIKAASGK-RFVIYVKEGIYKE  263

Query  665   KIRSSKDGITLIGDGKYSTIITWDDSVGGGSSLTGSATFGITGDGFIAKDIGFQNTAGPG  486
             KIR+SKDGITL+GDGKYST+I  DDSV  GS L  SATF ITGDGFIA+DIGFQN AGP 
Sbjct  264   KIRTSKDGITLVGDGKYSTLIVGDDSVAKGSILPDSATFTITGDGFIARDIGFQNNAGPQ  323

Query  485   AHQAVALTVASDHSVFYRCSISGYQDTLYALSLRQFYRECDISGTVDFIFGNAAAVFQAC  306
               QAVAL +ASD SV YRCSI+GYQDTLYA +LRQFY ECDI GT+DFIFGNAAAVFQ C
Sbjct  324   GEQAVALNMASDRSVLYRCSIAGYQDTLYAHALRQFYAECDIYGTIDFIFGNAAAVFQRC  383

Query  305   NLVLRRP--SSYNVILANGRSDPGQNTGFSVQKCKITPGPDFSPVKNSYNSYLGRPWKPY  132
             N++LRRP  SSYNVILANGR+DPGQNTGFS+ KC I+   DFS VK+SY S+LGRPWK Y
Sbjct  384   NILLRRPRGSSYNVILANGRTDPGQNTGFSIHKCSISATSDFSSVKHSYGSFLGRPWKEY  443

Query  131   SRAVVMESDIDGAISARGWIEWPGTSSSSVRELYFGEYANVGA  3
             SRAVVMES ID  I+ARGW+EWPG  SS ++ LYF EY N GA
Sbjct  444   SRAVVMESRIDDTIAARGWVEWPGYGSSVLKNLYFAEYGNEGA  486



>ref|XP_003534978.2| PREDICTED: LOW QUALITY PROTEIN: probable pectinesterase/pectinesterase 
inhibitor 54-like [Glycine max]
Length=550

 Score =   506 bits (1304),  Expect = 6e-171, Method: Compositional matrix adjust.
 Identities = 270/497 (54%), Positives = 339/497 (68%), Gaps = 25/497 (5%)
 Frame = -2

Query  1463  VIMLVLFFGCCVTTIaaaavsqvaaQDQIRIQCGYTRFPRLCVQTLSGL-VSGERVDFAA  1287
             +++  L  GC +T ++ +       Q+    +C  TR+P LC +TL  L +  + VD   
Sbjct  21    LVVTFLVLGCALTWVSMSDGLVGGHQEHAHNECNLTRYPNLCAETLMELGLGNQNVDNNI  80

Query  1286  ALLLNKTIAHADLHIAHFDQLSSHFVSSQPPQPRLQAIGYCEELMGMARQRLNEALVAMK  1107
               L+NKTI    L  ++F +  +    +QP    +    YCEELM M+ +RL+++L A+K
Sbjct  81    EALVNKTIFETSLPSSYFAEFKTG--EAQPAHSVVA--DYCEELMSMSLKRLDQSLRALK  136

Query  1106  ESPGKNRQEDIQTWLSAAVTFQQACKDWADQYAFS----DELFARISRSMDYQSQLASNA  939
              SP +N   DIQTWLSA++TFQQ+CKD    +  +    D L  R+S  MDY SQL SN+
Sbjct  137   -SPKRNTN-DIQTWLSASLTFQQSCKDHVHAHTSTLSTDDHLMERMSNKMDYLSQLGSNS  194

Query  938   LALVNRNTEISAA--GRQLSEEdidddddggffpDWVSGRDLRLLETTTDKTKANVVVAK  765
             LALVN+ +  ++   G   +E++ +          WVS +  +LL+  T   KAN +VA+
Sbjct  195   LALVNQMSTTTSHNIGDNNNEKEHEFPI-------WVSSKGRKLLQGAT--IKANAIVAQ  245

Query  764   DGTGNFRTVAEAIGAASGRQRFVIYVKSGVYKEKIRSSKDGITLIGDGKYSTIITWDDSV  585
             DG+GN++TV+EAI AASG  RFVIYVK GVYKEKI ++KDGITLIGDGKYST+I  DDSV
Sbjct  246   DGSGNYKTVSEAIEAASGTTRFVIYVKEGVYKEKINTNKDGITLIGDGKYSTLIVGDDSV  305

Query  584   GGGSSLTGSATFGITGDGFIAKDIGFQNTAGPGAHQAVALTVASDHSVFYRCSISGYQDT  405
               G+ L  SATF ITGDGFIA+DIGF N AGP   QAVAL +ASD S  YRCSI+GYQDT
Sbjct  306   AKGAILPDSATFTITGDGFIARDIGFHNNAGPEGQQAVALNIASDRSXLYRCSIAGYQDT  365

Query  404   LYALSLRQFYRECDISGTVDFIFGNAAAVFQACNLVLRRP---SSYNVILANGRSDPGQN  234
             LYA  LRQFYRECDI GT+DFIFGNAAAVFQ C+LVLRRP   +SYN +LANGR+DPGQN
Sbjct  366   LYAHVLRQFYRECDIYGTIDFIFGNAAAVFQRCSLVLRRPHGHASYNAVLANGRTDPGQN  425

Query  233   TGFSVQKCKITPGPDFSPVKNSYNSYLGRPWKPYSRAVVMESDIDGAISARGWIEWPGTS  54
             TGFSV KC I+P  + S VK SY S+LGRPWK YSRAVVMES ID A++A GWIEWPG  
Sbjct  426   TGFSVHKCTISPSSELSSVKGSYLSFLGRPWKEYSRAVVMESSIDDAVAASGWIEWPGYG  485

Query  53    SSSVRELYFGEYANVGA  3
              S +R LYF EY N GA
Sbjct  486   GSVLRTLYFAEYGNEGA  502



>gb|KDO73739.1| hypothetical protein CISIN_1g009418mg [Citrus sinensis]
Length=532

 Score =   501 bits (1291),  Expect = 3e-169, Method: Compositional matrix adjust.
 Identities = 270/470 (57%), Positives = 337/470 (72%), Gaps = 26/470 (6%)
 Frame = -2

Query  1385  DQIRIQCGYTRFPRLCVQTLSGLVSGERVDFAAAL--LLNKTIAHADLHIAHFDQLSSHF  1212
             ++I+ +C +TRFP LCVQTL G  S +       +  L+NK+IA   L  ++F   SS  
Sbjct  31    NKIQKECSFTRFPILCVQTLMGFESTKHQQHIHLMSALVNKSIAETKLPTSYFSNFSSQL  90

Query  1211  VSSQPPQPRLQAIGYCEELMGMARQRLNEALVAMKESPGKNRQEDIQTWLSAAVTFQQAC  1032
             ++      R     +CEE+M M+ +RL ++L+A++ SP KN+ +DIQTWL AA+TFQQ C
Sbjct  91    LAKDFQGVR-AVTDHCEEMMSMSLKRLEKSLLALQNSPTKNK-DDIQTWLGAALTFQQTC  148

Query  1031  KDWADQYAFSD--ELFARISRSMDYQSQLASNALALVNR-----NTEISAAGRQLSEEdi  873
             KD  +    S+  E+  +IS+ MDY SQL SN LALVNR       + S   R+L EE  
Sbjct  149   KDSVNSLGLSERNEVIKKISQKMDYLSQLTSNPLALVNRIARASYPKNSTYNRRLDEEQG  208

Query  872   dddddggffpDWVSGRDLRLLETTTDKTKANVVVAKDGTGNFRTVAEAIGAASGRQRFVI  693
             D  +       WVS ++ +LL+    +  ANV+VA+DGTGN+RTV+EAI AASG  RFVI
Sbjct  209   DFPN-------WVSAKNRKLLQAP--RINANVIVAQDGTGNYRTVSEAISAASG-NRFVI  258

Query  692   YVKSGVYKEKIRSSKDGITLIGDGKYSTIITWDDSVGGGSSLTGSATFGITGDGFIAKDI  513
             YVK+GVYKEKIR++KDGITLIGDGKY+TIIT DD+   G+S+  +ATF    DGFIA+DI
Sbjct  259   YVKAGVYKEKIRTNKDGITLIGDGKYTTIITGDDNARRGTSMPATATFS---DGFIARDI  315

Query  512   GFQNTAGPGAHQAVALTVASDHSVFYRCSISGYQDTLYALSLRQFYRECDISGTVDFIFG  333
             GF NTAGP   QA+AL VASDH+VFYRCSI+GYQDTLYAL+LRQFYR+ DI GT+DFIFG
Sbjct  316   GFHNTAGPQGEQALALNVASDHTVFYRCSIAGYQDTLYALALRQFYRDTDIYGTIDFIFG  375

Query  332   NAAAVFQACNLVLRRPS-SYNVILANGRSDPGQNTGFSVQKCKITPGPDFSPVKNSYNSY  156
             NAAAVFQ C LVLRRP  SYN I ANGR+DPGQNTGFS+Q CKI  G D++PVK+ YNSY
Sbjct  376   NAAAVFQNCYLVLRRPKGSYNAITANGRTDPGQNTGFSLQNCKIAAGSDYAPVKHKYNSY  435

Query  155   LGRPWKPYSRAVVMESDIDGAISARGWIEWPGTSSSSVRELYFGEYANVG  6
             LGRPWK YSRAVVM+S ID +IS+ GW+EWPG +      LYF EYANVG
Sbjct  436   LGRPWKQYSRAVVMQSSIDDSISSSGWVEWPG-AGGYANTLYFAEYANVG  484



>ref|XP_010272261.1| PREDICTED: pectinesterase [Nelumbo nucifera]
Length=523

 Score =   479 bits (1234),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 271/466 (58%), Positives = 330/466 (71%), Gaps = 26/466 (6%)
 Frame = -2

Query  1385  DQIRIQCGYTRFPRLCVQTL--SGLVSGERVDFAAALLLNKTIAHADLHIAHFDQLSSHF  1212
             D +  QC +TR+P LCV+T+  SGL  G  +D  +AL+  K++             S+  
Sbjct  29    DNLHSQCSFTRYPDLCVETMLGSGLGHGN-IDIVSALV-KKSMDETKFPTP---DSSNPL  83

Query  1211  VSSQPPQPRLQAIGYCEELMGMARQRLNEALVAMKESPGK-NRQEDIQTWLSAAVTFQQA  1035
               +   + +    G+C ELM M+ +RLN++L+A+K S     R+ DIQTWLSAA+TFQ+ 
Sbjct  84    YDTDSLKAQHSNDGHCLELMNMSLKRLNQSLLALKSSHSTTKRKNDIQTWLSAALTFQET  143

Query  1034  CKDWADQYAFSDELFARISRSMDYQSQLASNALALVNR--NTEISAAGRQLSEEdidddd  861
             C+D  +    S  L  +IS  MDY S+L SNALAL NR  +   + + R L+        
Sbjct  144   CRDSLE--GLSGSLVDQISSKMDYLSRLTSNALALANRFLSNPRNNSSRHLTS-------  194

Query  860   dggffpDWVSGRDLRLLETTTDKTKANVVVAKDGTGNFRTVAEAIGAASGRQRFVIYVKS  681
                 FP WVS RD +LL++T  + KAN VVAKDG+GN++T++EAI AASG  RFVIYVKS
Sbjct  195   -MDDFPKWVSARDRKLLQST--EIKANAVVAKDGSGNYKTISEAIEAASG-GRFVIYVKS  250

Query  680   GVYKEKIRSSKDGITLIGDGKYSTIITWDDSVGGGSSLTGSATFGITGDGFIAKDIGFQN  501
             G YKE I ++KDGITLIGDGKYSTII  DDSVGGGSSL GSATF ITGDGF+A+DIGFQN
Sbjct  251   GTYKEAISTNKDGITLIGDGKYSTIIVGDDSVGGGSSLRGSATFAITGDGFMARDIGFQN  310

Query  500   TAGPGAHQAVALTVASDHSVFYRCSISGYQDTLYALSLRQFYRECDISGTVDFIFGNAAA  321
             TAGP A QAVAL V SD SV YRCSI+GYQDTLYA +LRQFYRECDI GTVDFIFGNA A
Sbjct  311   TAGPQAQQAVALNVVSDRSVLYRCSIAGYQDTLYAHALRQFYRECDIYGTVDFIFGNAIA  370

Query  320   VFQACNLVLRRPS-SYNVILANGRSDPGQNTGFSVQKCKITPGPDFSPVKNSYNSYLGRP  144
             VFQ C L LRR S SYNVILANGRSDPGQNTGFS+Q CKI+   D + VK+S +SYLGRP
Sbjct  371   VFQNCFLALRRHSGSYNVILANGRSDPGQNTGFSIQNCKISVASDSASVKHSSSSYLGRP  430

Query  143   WKPYSRAVVMESDIDGAISARGWIEWPGTSSSSVRELYFGEYANVG  6
             WK YSRAVVM+S ID  I+ RGWIEW G  + +++ LYF EY N+G
Sbjct  431   WKEYSRAVVMQSYIDDVIAPRGWIEWSG--NFALKTLYFAEYNNLG  474



>gb|KDO73741.1| hypothetical protein CISIN_1g009418mg [Citrus sinensis]
Length=484

 Score =   476 bits (1224),  Expect = 9e-160, Method: Compositional matrix adjust.
 Identities = 258/468 (55%), Positives = 320/468 (68%), Gaps = 70/468 (15%)
 Frame = -2

Query  1385  DQIRIQCGYTRFPRLCVQTLSGLVSGERVDFAAALLLNKTIAHADLHIAHFDQLSSHFVS  1206
             ++I+ +C +TRFP LCV+ ++                                       
Sbjct  31    NKIQKECSFTRFPILCVRAVTD--------------------------------------  52

Query  1205  SQPPQPRLQAIGYCEELMGMARQRLNEALVAMKESPGKNRQEDIQTWLSAAVTFQQACKD  1026
                         +CEE+M M+ +RL ++L+A++ SP KN+ +DIQTWL AA+TFQQ CKD
Sbjct  53    ------------HCEEMMSMSLKRLEKSLLALQNSPTKNK-DDIQTWLGAALTFQQTCKD  99

Query  1025  WADQYAFSD--ELFARISRSMDYQSQLASNALALVNR-----NTEISAAGRQLSEEdidd  867
               +    S+  E+  +IS+ MDY SQL SN LALVNR       + S   R+L EE  D 
Sbjct  100   SVNSLGLSERNEVIKKISQKMDYLSQLTSNPLALVNRIARASYPKNSTYNRRLDEEQGDF  159

Query  866   dddggffpDWVSGRDLRLLETTTDKTKANVVVAKDGTGNFRTVAEAIGAASGRQRFVIYV  687
              +       WVS ++ +LL+    +  ANV+VA+DGTGN+RTV+EAI AASG  RFVIYV
Sbjct  160   PN-------WVSAKNRKLLQAP--RINANVIVAQDGTGNYRTVSEAISAASG-NRFVIYV  209

Query  686   KSGVYKEKIRSSKDGITLIGDGKYSTIITWDDSVGGGSSLTGSATFGITGDGFIAKDIGF  507
             K+GVYKEKIR++KDGITLIGDGKY+TIIT DD+   G+S+  +ATF ITGDGFIA+DIGF
Sbjct  210   KAGVYKEKIRTNKDGITLIGDGKYTTIITGDDNARRGTSMPATATFTITGDGFIARDIGF  269

Query  506   QNTAGPGAHQAVALTVASDHSVFYRCSISGYQDTLYALSLRQFYRECDISGTVDFIFGNA  327
              NTAGP   QA+AL VASDH+VFYRCSI+GYQDTLYAL+LRQFYR+ DI GT+DFIFGNA
Sbjct  270   HNTAGPQGEQALALNVASDHTVFYRCSIAGYQDTLYALALRQFYRDTDIYGTIDFIFGNA  329

Query  326   AAVFQACNLVLRRPS-SYNVILANGRSDPGQNTGFSVQKCKITPGPDFSPVKNSYNSYLG  150
             AAVFQ C LVLRRP  SYN I ANGR+DPGQNTGFS+Q CKI  G D++PVK+ YNSYLG
Sbjct  330   AAVFQNCYLVLRRPKGSYNAITANGRTDPGQNTGFSLQNCKIAAGSDYAPVKHKYNSYLG  389

Query  149   RPWKPYSRAVVMESDIDGAISARGWIEWPGTSSSSVRELYFGEYANVG  6
             RPWK YSRAVVM+S ID +IS+ GW+EWPG +      LYF EYANVG
Sbjct  390   RPWKQYSRAVVMQSSIDDSISSSGWVEWPG-AGGYANTLYFAEYANVG  436



>gb|KDO73742.1| hypothetical protein CISIN_1g009418mg [Citrus sinensis]
Length=481

 Score =   465 bits (1197),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 255/468 (54%), Positives = 317/468 (68%), Gaps = 73/468 (16%)
 Frame = -2

Query  1385  DQIRIQCGYTRFPRLCVQTLSGLVSGERVDFAAALLLNKTIAHADLHIAHFDQLSSHFVS  1206
             ++I+ +C +TRFP LCV+ ++                                       
Sbjct  31    NKIQKECSFTRFPILCVRAVTD--------------------------------------  52

Query  1205  SQPPQPRLQAIGYCEELMGMARQRLNEALVAMKESPGKNRQEDIQTWLSAAVTFQQACKD  1026
                         +CEE+M M+ +RL ++L+A++ SP KN+ +DIQTWL AA+TFQQ CKD
Sbjct  53    ------------HCEEMMSMSLKRLEKSLLALQNSPTKNK-DDIQTWLGAALTFQQTCKD  99

Query  1025  WADQYAFSD--ELFARISRSMDYQSQLASNALALVNR-----NTEISAAGRQLSEEdidd  867
               +    S+  E+  +IS+ MDY SQL SN LALVNR       + S   R+L EE  D 
Sbjct  100   SVNSLGLSERNEVIKKISQKMDYLSQLTSNPLALVNRIARASYPKNSTYNRRLDEEQGDF  159

Query  866   dddggffpDWVSGRDLRLLETTTDKTKANVVVAKDGTGNFRTVAEAIGAASGRQRFVIYV  687
              +       WVS ++ +LL+    +  ANV+VA+DGTGN+RTV+EAI AASG  RFVIYV
Sbjct  160   PN-------WVSAKNRKLLQAP--RINANVIVAQDGTGNYRTVSEAISAASG-NRFVIYV  209

Query  686   KSGVYKEKIRSSKDGITLIGDGKYSTIITWDDSVGGGSSLTGSATFGITGDGFIAKDIGF  507
             K+GVYKEKIR++KDGITLIGDGKY+TIIT DD+   G+S+  +ATF    DGFIA+DIGF
Sbjct  210   KAGVYKEKIRTNKDGITLIGDGKYTTIITGDDNARRGTSMPATATFS---DGFIARDIGF  266

Query  506   QNTAGPGAHQAVALTVASDHSVFYRCSISGYQDTLYALSLRQFYRECDISGTVDFIFGNA  327
              NTAGP   QA+AL VASDH+VFYRCSI+GYQDTLYAL+LRQFYR+ DI GT+DFIFGNA
Sbjct  267   HNTAGPQGEQALALNVASDHTVFYRCSIAGYQDTLYALALRQFYRDTDIYGTIDFIFGNA  326

Query  326   AAVFQACNLVLRRPS-SYNVILANGRSDPGQNTGFSVQKCKITPGPDFSPVKNSYNSYLG  150
             AAVFQ C LVLRRP  SYN I ANGR+DPGQNTGFS+Q CKI  G D++PVK+ YNSYLG
Sbjct  327   AAVFQNCYLVLRRPKGSYNAITANGRTDPGQNTGFSLQNCKIAAGSDYAPVKHKYNSYLG  386

Query  149   RPWKPYSRAVVMESDIDGAISARGWIEWPGTSSSSVRELYFGEYANVG  6
             RPWK YSRAVVM+S ID +IS+ GW+EWPG +      LYF EYANVG
Sbjct  387   RPWKQYSRAVVMQSSIDDSISSSGWVEWPG-AGGYANTLYFAEYANVG  433



>ref|XP_010541678.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 54 
[Tarenaya hassleriana]
Length=535

 Score =   457 bits (1177),  Expect = 6e-152, Method: Compositional matrix adjust.
 Identities = 243/474 (51%), Positives = 312/474 (66%), Gaps = 30/474 (6%)
 Frame = -2

Query  1385  DQIRIQCGYTRFPRLCVQTLSGLVSGERVDFAAALLLNKTIAHADLHIAHFDQLSSHFVS  1206
             ++ R QC  T +P LCVQ+L     G R     +L++NKTI+ ++        LSS  VS
Sbjct  30    NRFRRQCSQTLYPSLCVQSLQEFGYGARGFELVSLIVNKTISDSEKLT-----LSSQLVS  84

Query  1205  SQPPQ--PRLQAIGYCEELMGMARQRLNEALVAMKESPGKNR-----QEDIQTWLSAAVT  1047
              +  +    L     C   M M+ +RLN+A+ A+ E P   +     ++D+ TWLSAA+T
Sbjct  85    LEDSEYTSLLSVSDSCGRFMKMSTKRLNQAMEALNELPSSRKRRRSIKDDVTTWLSAAMT  144

Query  1046  FQQACKDWADQYAFSDE----LFARISRSMDYQSQLASNALALVNRNTEISAAGRQLSEE  879
             FQQACKD A     S E    + +RI++ MD+ S+  SN+LALV+R   +    R+ S+ 
Sbjct  145   FQQACKDSASSGDISGEASAAMISRIAQMMDHLSRHVSNSLALVDR---VKVKSRKRSKS  201

Query  878   didddddggffpDWVSGRDLRLLETTTDKTKANVVVAKDGTGNFRTVAEAIGAASGRQRF  699
              +           WVS  + RLL   T + + + VVAKDG+G+FRTVA+AI AA    R 
Sbjct  202   TVFPR--------WVSTGERRLLGAPTSRGRVHAVVAKDGSGDFRTVADAIAAAPREGRI  253

Query  698   VIYVKSGVYKEKIRSSKDGITLIGDGKYSTIITWDDSVGGGSSLTGSATFGITGDGFIAK  519
             VIYVK+G+YKEK+   +D +TLIGDGK  T+    DSV GG+S+  SATF +TGDGFI +
Sbjct  254   VIYVKAGIYKEKVNIERDDVTLIGDGKDRTVFVGGDSVAGGASMPDSATFTVTGDGFIGR  313

Query  518   DIGFQNTAGPGAHQAVALTVASDHSVFYRCSISGYQDTLYALSLRQFYRECDISGTVDFI  339
             DIGF+NTAGP   QA+AL++ASD SV YRCSISGYQDTLY ++LRQFYRECDI GTVDFI
Sbjct  314   DIGFKNTAGPMGQQAIALSIASDRSVLYRCSISGYQDTLYTVALRQFYRECDIYGTVDFI  373

Query  338   FGNAAAVFQACNLVLRRP---SSYNVILANGRSDPGQNTGFSVQKCKITPGPDFSPVKNS  168
             FGNAAA+FQ CNL+L RP    +YNVI+ANGR+DP QNTGFS+Q CKIT    FSPVK  
Sbjct  374   FGNAAAIFQHCNLILGRPYDTRAYNVIMANGRTDPKQNTGFSLQNCKITTDSQFSPVKRR  433

Query  167   YNSYLGRPWKPYSRAVVMESDIDGAISARGWIEWPGTSSSSVRELYFGEYANVG  6
             Y+SYLGRPWK YSR +VME+ ID AIS  GW++W  + S     LYFGEY N G
Sbjct  434   YSSYLGRPWKAYSRCIVMETYIDEAISGEGWVKWLNSGSDDEGTLYFGEYKNYG  487



>ref|XP_009126485.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 54 
[Brassica rapa]
Length=534

 Score =   438 bits (1126),  Expect = 3e-144, Method: Compositional matrix adjust.
 Identities = 234/474 (49%), Positives = 312/474 (66%), Gaps = 32/474 (7%)
 Frame = -2

Query  1385  DQIRIQCGYTRFPRLCVQTLSGLVSGE--RVDFAAALLLNKTIAHADLHI-------AHF  1233
             +Q++  C  T +  LCVQTL     G    +DF +  L+NKT++ +   I       A +
Sbjct  32    NQLQRLCSSTEYTSLCVQTLREFRHGSPTSLDFVS-FLVNKTMSGSSNLIPPLSSSMASY  90

Query  1232  DQLSSHFVSSQPPQPRLQAIGYCEELMGMARQRLNEALVAMKESPGK-NRQEDIQTWLSA  1056
             + +S    ++  P P +     CE LM M+ +RL +A+ A+  S  K   + D+QTWLSA
Sbjct  91    EVISLDDSTNTLPSPSVA--DSCERLMKMSTRRLQQAMEALNGSSRKRTTKHDVQTWLSA  148

Query  1055  AVTFQQACKDWA-DQYAFSDELFARISRSMDYQSQLASNALALVNRNTEISAAGRQLSEE  879
             A+TFQQ+CKD   D    S    + I++ MD+ S+L SN+LALV    E           
Sbjct  149   AMTFQQSCKDSVLDSGGHSSSAVSHITQKMDHLSRLVSNSLALVGTFME-----------  197

Query  878   didddddggffpDWVSGRDLRLLETTTDKTKANVVVAKDGTGNFRTVAEAIGAASGRQRF  699
                 +      P WVS  + +LL + T +++ +V+VAKDG+G++RTV EA+ AASG  RF
Sbjct  198   ----NPKPTVLPRWVSAGERKLLASRTSRSRPHVLVAKDGSGDYRTVMEAVNAASGNGRF  253

Query  698   VIYVKSGVYKEKIRSSKDGITLIGDGKYSTIITWDDSVGGGSSLTGSATFGITGDGFIAK  519
             +IYVK G+YKEK+R  KD ITLIG+GK  T+I  DDS  GG+S+  +AT  +TGDGFIA+
Sbjct  254   IIYVKRGIYKEKVRIEKDEITLIGEGKDLTVIVGDDSAAGGTSVPDTATMTVTGDGFIAR  313

Query  518   DIGFQNTAGPGAHQAVALTVASDHSVFYRCSISGYQDTLYALSLRQFYRECDISGTVDFI  339
             DIG +NTAGP   QA+AL++ SD SV YRCSISGYQDTLYA +LRQFYRECDI GT+DFI
Sbjct  314   DIGIKNTAGPRGKQAIALSITSDQSVLYRCSISGYQDTLYAAALRQFYRECDIYGTIDFI  373

Query  338   FGNAAAVFQACNLVLRRPS---SYNVILANGRSDPGQNTGFSVQKCKITPGPDFSPVKNS  168
             FGNAAAVFQ+CNL+LRRPS   +YNVILANGR+D  QNTGF++  C+I    DFS +K+ 
Sbjct  374   FGNAAAVFQSCNLILRRPSDVKAYNVILANGRTDQRQNTGFALHSCRILTDLDFSGMKHR  433

Query  167   YNSYLGRPWKPYSRAVVMESDIDGAISARGWIEWPGTSSSSVRELYFGEYANVG  6
             Y+SYLGRPWK YSR++VME+ ID AI+  GW  W  +    ++ LYFGE+ N G
Sbjct  434   YSSYLGRPWKKYSRSIVMETYIDDAIAEEGWAGWLNSGDEVLKTLYFGEFKNYG  487



>ref|XP_006400651.1| hypothetical protein EUTSA_v10013149mg [Eutrema salsugineum]
 gb|ESQ42104.1| hypothetical protein EUTSA_v10013149mg [Eutrema salsugineum]
Length=556

 Score =   430 bits (1106),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 234/474 (49%), Positives = 311/474 (66%), Gaps = 27/474 (6%)
 Frame = -2

Query  1382  QIRIQCGYTRFPRLCVQTLSGLVSG--ERVDFAAALLLNKTIAHADLHIAHFDQL--SSH  1215
             Q++  C  T++  LCVQTL     G  + +DF +  L+N+TI+ +DL I        SS 
Sbjct  33    QLQRHCSTTKYTSLCVQTLQEFGHGSLQGLDFVS-FLVNRTISDSDLLIPPLSSSMGSSK  91

Query  1214  FVSSQPPQ---PRLQAIGYCEELMGMARQRLNEALVAMKESPGK-NRQEDIQTWLSAAVT  1047
              VS +      P       CE LM M+ +RL +A+ A+  S  K + + D++TWLSAA+T
Sbjct  92    LVSLEDSTYNLPSASISDLCERLMKMSTRRLGQAMEALNGSSRKRHNKHDVKTWLSAAMT  151

Query  1046  FQQACKDWA----DQYAFSDELFARISRSMDYQSQLASNALALVNRNTEISAAGRQLSEE  879
             FQQ+CKD      +  + S    + I++ MD+ S+L SN+LAL++   E      + +  
Sbjct  152   FQQSCKDSILDSRETSSSSSVTVSHITQKMDHLSRLVSNSLALLDTLMENPKPNSKPT--  209

Query  878   didddddggffpDWVSGRDLRLLETTTDKTKANVVVAKDGTGNFRTVAEAIGAASGRQRF  699
                        P WVS  + RLL   T + +A+VVVAKDG+G++RTV EA+ AA+G  RF
Sbjct  210   ---------VLPRWVSAGERRLLAGRTSRRRAHVVVAKDGSGDYRTVMEAVTAANGNGRF  260

Query  698   VIYVKSGVYKEKIRSSKDGITLIGDGKYSTIITWDDSVGGGSSLTGSATFGITGDGFIAK  519
             VIYVK G+YKEK+R  KD ITLIG+GK  T+I  DDSV GG+S+  +AT  +TGD FI +
Sbjct  261   VIYVKRGIYKEKVRIEKDEITLIGEGKDRTVIVGDDSVAGGTSVPETATMTVTGDEFIGR  320

Query  518   DIGFQNTAGPGAHQAVALTVASDHSVFYRCSISGYQDTLYALSLRQFYRECDISGTVDFI  339
             DIG +NTAGP   QA+AL++ SD SV YRCSISGYQDTLYA +LRQFYRECDI GT+DFI
Sbjct  321   DIGIKNTAGPRGKQAIALSITSDRSVLYRCSISGYQDTLYAAALRQFYRECDIYGTIDFI  380

Query  338   FGNAAAVFQACNLVLRRPS---SYNVILANGRSDPGQNTGFSVQKCKITPGPDFSPVKNS  168
             FGNAAAVFQ+CN+ LRRPS   +YNVILANGR+D  QNTGF++  C+I    +FS VK+ 
Sbjct  381   FGNAAAVFQSCNIFLRRPSDIRAYNVILANGRTDQRQNTGFALHSCRIHTDLEFSAVKDM  440

Query  167   YNSYLGRPWKPYSRAVVMESDIDGAISARGWIEWPGTSSSSVRELYFGEYANVG  6
             Y+SYLGRPWK YSR++VME+ I  AI+  GW  W  +    ++ LYFGE+ N G
Sbjct  441   YSSYLGRPWKMYSRSIVMETYIGDAIAEEGWAGWLNSGEEVLKTLYFGEFKNYG  494



>ref|XP_010493198.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 54 
[Camelina sativa]
Length=537

 Score =   429 bits (1104),  Expect = 5e-141, Method: Compositional matrix adjust.
 Identities = 234/475 (49%), Positives = 307/475 (65%), Gaps = 42/475 (9%)
 Frame = -2

Query  1370  QCGYTRFPRLCVQTLSGLVSG---ERVDFAAALLLNKTIAHADLHIAHFDQLSS--HFVS  1206
              C  T++  LCVQ L     G   + +DF +  L+NKTI+ +++ +      +S    VS
Sbjct  37    HCSSTKYTSLCVQNLREFRHGSIDQGLDFVS-FLVNKTISDSNMLLPPLSSPTSSSQLVS  95

Query  1205  SQPPQ---PRLQAIGYCEELMGMARQRLNEALVAMKESPGK-NRQEDIQTWLSAAVTFQQ  1038
              + P    P      YCE LM M+ +RL +A+ A+  S  K + + D+QTWLSAA+TFQQ
Sbjct  96    LEVPDDALPSTSVSDYCERLMKMSTRRLGQAMEALNGSSRKRHSKHDVQTWLSAAMTFQQ  155

Query  1037  ACKDWADQYAFSDEL-FARISRSMDYQSQLASNALALVNR-------NTEISAAGRQLSE  882
             ACKD    +  S     + +++ MD+ S+L SN+LALV+         TE +A  R    
Sbjct  156   ACKDSILDFGDSSSASISHVTQKMDHLSRLVSNSLALVDTIMENPKPKTESTALPR----  211

Query  881   EdidddddggffpDWVSGRDLRLLETTTDKTKANVVVAKDGTGNFRTVAEAIGAASGRQR  702
                           WV+  + RLL     + +A+VVVAKDG+G++RTV EA+ AA GR R
Sbjct  212   --------------WVTAGERRLL---VGRARAHVVVAKDGSGDYRTVMEAVTAAHGRGR  254

Query  701   FVIYVKSGVYKEKIRSSKDGITLIGDGKYSTIITWDDSVGGGSSLTGSATFGITGDGFIA  522
             F+IYVK GVYKEK+   K  ITLIG+GK  T+I  DDS  GG+S+  +AT  +TGDGFIA
Sbjct  255   FIIYVKRGVYKEKVSIHKHEITLIGEGKDQTVIVSDDSFAGGTSVPETATMTVTGDGFIA  314

Query  521   KDIGFQNTAGPGAHQAVALTVASDHSVFYRCSISGYQDTLYALSLRQFYRECDISGTVDF  342
             +DIG +NTAGP   QA+AL++ SD SV YRCSISGYQDTLYA +LRQFYRECDI GT+DF
Sbjct  315   RDIGIKNTAGPRGQQAIALSITSDQSVLYRCSISGYQDTLYAAALRQFYRECDIYGTIDF  374

Query  341   IFGNAAAVFQACNLVLRRP---SSYNVILANGRSDPGQNTGFSVQKCKITPGPDFSPVKN  171
             IFGNAAAVFQ+CN+ +RRP    + NVILANGR+D  QN+GF++  CKI    D SPVK+
Sbjct  375   IFGNAAAVFQSCNIFMRRPHGVKAINVILANGRTDQRQNSGFALHSCKIRTDSDLSPVKH  434

Query  170   SYNSYLGRPWKPYSRAVVMESDIDGAISARGWIEWPGTSSSSVRELYFGEYANVG  6
              Y+SYLGRPWK YSRAVV+ES ID AI+  GW+ W  +    ++ LYFGE+ N G
Sbjct  435   RYSSYLGRPWKMYSRAVVIESYIDEAIAEEGWVGWLNSGDEVLKTLYFGEFKNYG  489



>ref|XP_006828612.1| hypothetical protein AMTR_s00129p00073090 [Amborella trichopoda]
 gb|ERM96028.1| hypothetical protein AMTR_s00129p00073090 [Amborella trichopoda]
Length=546

 Score =   429 bits (1104),  Expect = 6e-141, Method: Compositional matrix adjust.
 Identities = 239/500 (48%), Positives = 320/500 (64%), Gaps = 26/500 (5%)
 Frame = -2

Query  1472  RTWVIMLVLFFGCCVTTIaaaavsqvaaQD---QIRIQCGYTRFPRLCVQTLSGLVSGER  1302
             R +V MLV   G    +++    S    +D    +   C +TR+P LC+QTL+   SG  
Sbjct  7     RVFVCMLVCILGHGSVSLSQNVTSLFEDKDLGLNMAQTCNFTRYPGLCIQTLT---SGRG  63

Query  1301  V-DFAAALL--LNKTIAHADLHIAHFDQLSSHFVSSQPPQPRLQAIGYCEELMGMARQRL  1131
             V  F    L  L K+  H    ++     SS     + P+   +   YC EL+ ++ +RL
Sbjct  64    VLQFRNGFLRELVKSTVHEIRKLSSIMSQSSQAGKLENPKSHDKTTDYCVELLHLSLKRL  123

Query  1130  NEALVAMKESPGKNRQEDIQTWLSAAVTFQQACKDWADQY---AFSDELFARISRSMDYQ  960
             +++L A+  +       DIQTWLSA ++F   C D  + +   +  D        S+ + 
Sbjct  124   HQSLSALNAATTHPNALDIQTWLSAVLSFLDGCNDALNIHISNSIHDPSAVHNPTSVSHV  183

Query  959   SQLASNALALVNR-NTEISAAGRQLSEEdidddddggffpDWVSGRDLRLLETTTDKTKA  783
             S LASNALA+ NR   +    GR+L  +             W++  + RLL+    +  A
Sbjct  184   SSLASNALAVANRLPKKRREKGRRLLVDADFPS--------WLTETERRLLQAP--EIAA  233

Query  782   NVVVAKDGTGNFRTVAEAIGAASGRQRFVIYVKSGVYKEKIRSSKDGITLIGDGKYSTII  603
             + VVA+DGTGNF TV+EA+  A G +R+VI+VK+G+YKE+I ++KDGITLIGDGK +TI+
Sbjct  234   DAVVAQDGTGNFLTVSEALDKAPGDRRYVIHVKAGIYKERIVTAKDGITLIGDGKAATIV  293

Query  602   TWDDSVGGGSSLTGSATFGITGDGFIAKDIGFQNTAGPGAHQAVALTVASDHSVFYRCSI  423
             T   SVGGGS++  SATF + GDGFIA+DIGFQN+AGP A QA+A+ V SDHSVFYRC++
Sbjct  294   TGSRSVGGGSTMPESATFAVIGDGFIARDIGFQNSAGPSAGQALAVRVLSDHSVFYRCNL  353

Query  422   SGYQDTLYALSLRQFYRECDISGTVDFIFGNAAAVFQACNLVLRRPSSY-NVILANGRSD  246
              GYQDTLYA++LRQFYRECD+ GT+DFIFGNAAAVFQ+CNL LR P++  NVILANGR+D
Sbjct  354   IGYQDTLYAMALRQFYRECDVYGTIDFIFGNAAAVFQSCNLYLRLPATKENVILANGRND  413

Query  245   PGQNTGFSVQKCKITPGPDFSPVKNSYNSYLGRPWKPYSRAVVMESDIDGAISARGWIEW  66
             P QNTGFSV  C+I    D  PV+NS  SYLGRPWK YSR+VVMES IDG I+ +GW +W
Sbjct  414   PCQNTGFSVHNCRIAAASDLFPVRNSIRSYLGRPWKKYSRSVVMESSIDGIINPKGWQQW  473

Query  65    PGTSSSSVRELYFGEYANVG  6
              G  S +++ LYFGEY N G
Sbjct  474   EG--SFALKTLYFGEYRNQG  491



>gb|EPS62949.1| pectinesterase [Genlisea aurea]
Length=413

 Score =   424 bits (1091),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 220/386 (57%), Positives = 282/386 (73%), Gaps = 24/386 (6%)
 Frame = -2

Query  1154  MGMARQRLNEALVAMKESPGKNRQEDIQTWLSAAVTFQQACKDWADQYAFS-DELFARIS  978
             M M+++RL++A+ A+++S  K +  DIQTWLSAAVTF QACKD  + +A   +   A++ 
Sbjct  1     MVMSKKRLDQAMNAIQQSRRKYK-FDIQTWLSAAVTFNQACKDALESHAPPRNSSLAQLY  59

Query  977   RSMDYQSQLASNALALVNRNTEISAAGRQLSEEdidddddggffpDWVSGRDLRLLETTT  798
               +DY S+L SN+LALV R   I    ++  E              W +    +LL++  
Sbjct  60    DKVDYISRLISNSLALVIR---IPDPAKRTGE--------------WATAGAGKLLQS--  100

Query  797   DKTKANVVVAKDGTGNFRTVAEAIGAASGRQRFVIYVKSGVYKEKIRSSKDGITLIGDGK  618
                +A+ VV+KDGTG++ +++EAIGAA+G +RFVIYVKSGVY E +   +DGI LIGDGK
Sbjct  101   KDIEADAVVSKDGTGDYGSISEAIGAATG-ERFVIYVKSGVYAENVIVHRDGIVLIGDGK  159

Query  617   YSTIITWDDSVGGGSSLTGSATFGITGDGFIAKDIGFQNTAGPGAHQAVALTVASDHSVF  438
              ST+IT + +V  G+SL+GSAT  +TGDGF+A+DIG  NTAGP A QAVAL + SDH+V 
Sbjct  160   NSTVITGNRNVAAGASLSGSATLSVTGDGFMARDIGISNTAGPSAAQAVALNIVSDHAVL  219

Query  437   YRCSISGYQDTLYALSLRQFYRECDISGTVDFIFGNAAAVFQACNLVLRRPS--SYNVIL  264
             YRCSI+GYQDTLYA++LRQFYRECDISGT+DFIFGNAAAVFQ CNL+LRRP+  + NVIL
Sbjct  220   YRCSITGYQDTLYAVALRQFYRECDISGTIDFIFGNAAAVFQVCNLILRRPNYGASNVIL  279

Query  263   ANGRSDPGQNTGFSVQKCKITPGPDFSPVKNSYNSYLGRPWKPYSRAVVMESDIDGAISA  84
             ANGR+DPGQNTGF++Q C I+ GPD  P K SY SYLGRPWK +SRAVVMES ID A+S 
Sbjct  280   ANGRTDPGQNTGFALQMCTISVGPDLYPDKGSYRSYLGRPWKAFSRAVVMESTIDAAVSP  339

Query  83    RGWIEWPGTSSSSVRELYFGEYANVG  6
              GW+EWP  S+ +   LYF EYAN G
Sbjct  340   SGWLEWPDASAGTYSTLYFAEYANYG  365



>ref|XP_010420931.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 54 
[Camelina sativa]
Length=538

 Score =   428 bits (1100),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 235/481 (49%), Positives = 310/481 (64%), Gaps = 44/481 (9%)
 Frame = -2

Query  1385  DQIRIQCGYTRFPRLCVQTLSGLVSG---ERVDFAAALLLNKTIAHADLHIAHFD-----  1230
             ++++  C  T++  LCVQ L     G   + +DF +  L+NKTI+ +++ +         
Sbjct  33    NELQRHCSSTKYTSLCVQNLREFRHGSIDQGLDFVS-FLVNKTISDSNMLLPSLPPSMSS  91

Query  1229  -QLSSHFVSSQPPQPRLQAIGYCEELMGMARQRLNEALVAMKESPGK-NRQEDIQTWLSA  1056
              QL S  VS     P      YCE LM M+ +RL +A+ A+  S  K + + D+QTWLSA
Sbjct  92    SQLVSLEVSDDT-LPSTSVSDYCERLMKMSTRRLGQAMEALNGSSRKRHSKHDVQTWLSA  150

Query  1055  AVTFQQACKDWADQYAFSDEL-FARISRSMDYQSQLASNALALVNR-------NTEISAA  900
             A+TFQQACKD    +  S     + I++ MD+ S+L SN+LALV+         TE +A 
Sbjct  151   AMTFQQACKDSILDFGDSSSASISHITQKMDHLSRLVSNSLALVDTIMYNPKPKTESTAL  210

Query  899   GRQLSEEdidddddggffpDWVSGRDLRLLETTTDKTKANVVVAKDGTGNFRTVAEAIGA  720
              R                  WV+  + RLL     + +A+VVVAKDG+G++RTV EA+ A
Sbjct  211   PR------------------WVTAGERRLL---VGRARAHVVVAKDGSGDYRTVMEAVTA  249

Query  719   ASGRQRFVIYVKSGVYKEKIRSSKDGITLIGDGKYSTIITWDDSVGGGSSLTGSATFGIT  540
             A GR RF+IYVK GVYKEK+   K  ITLIG+GK  T+I  DDS  GG+S+  +AT  +T
Sbjct  250   AHGRGRFIIYVKRGVYKEKVSIHKHEITLIGEGKDQTVIVGDDSFAGGTSVPETATMTVT  309

Query  539   GDGFIAKDIGFQNTAGPGAHQAVALTVASDHSVFYRCSISGYQDTLYALSLRQFYRECDI  360
             GDGFIA+DIG +NTAGP   QA+AL++ SD SV YRCSISGYQDTLYA +LRQFYRECDI
Sbjct  310   GDGFIARDIGIKNTAGPKGQQAIALSITSDQSVLYRCSISGYQDTLYAAALRQFYRECDI  369

Query  359   SGTVDFIFGNAAAVFQACNLVLRRP---SSYNVILANGRSDPGQNTGFSVQKCKITPGPD  189
              GT+DFIFGNAAAVFQ+CN+ +RRP    + NVILANGR+D  QN+GF++  C+I    D
Sbjct  370   YGTIDFIFGNAAAVFQSCNIFMRRPHGVKAINVILANGRTDQRQNSGFALHSCRIRTDSD  429

Query  188   FSPVKNSYNSYLGRPWKPYSRAVVMESDIDGAISARGWIEWPGTSSSSVRELYFGEYANV  9
              SPVK+ Y+SYLGRPWK YSRAVV+ES ID AI+  GW+ W  +    ++ LYFGE+ N 
Sbjct  430   LSPVKHRYSSYLGRPWKMYSRAVVIESYIDEAIAEEGWVGWLNSGDEVLKTLYFGEFKNY  489

Query  8     G  6
             G
Sbjct  490   G  490



>ref|XP_010454395.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 54 
[Camelina sativa]
Length=538

 Score =   426 bits (1094),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 231/480 (48%), Positives = 308/480 (64%), Gaps = 42/480 (9%)
 Frame = -2

Query  1385  DQIRIQCGYTRFPRLCVQTLSGLVSG---ERVDFAAALLLNKTIAHADLHIAHFDQLSSH  1215
             ++++  C  T++  LCVQ L     G   + +DF +  L+NKTI+ +++ +       S 
Sbjct  33    NELQRHCSSTKYSSLCVQNLREFRHGSIDQGLDFVS-FLVNKTISDSNMLLPPLSSSMSS  91

Query  1214  FVS-----SQPPQPRLQAIGYCEELMGMARQRLNEALVAMKESPGK-NRQEDIQTWLSAA  1053
                     S    P      YCE L+ M+ +RL +A+ A+  S  K +R+ D+QTWLSAA
Sbjct  92    SQLVSLEVSDDTLPSTLVSDYCERLLNMSTRRLGQAMEALNGSSRKRHRKHDVQTWLSAA  151

Query  1052  VTFQQACKDWADQYAFSDEL-FARISRSMDYQSQLASNALALVNR-------NTEISAAG  897
             +TFQQACKD    +  S     + I++ MD+ S+L SN+LALV+         TE +A  
Sbjct  152   MTFQQACKDSILDFGDSSSASISHITQKMDHLSRLVSNSLALVDTIMHNPKPKTESTALP  211

Query  896   RQLSEEdidddddggffpDWVSGRDLRLLETTTDKTKANVVVAKDGTGNFRTVAEAIGAA  717
             R                  WV+  + RLL     + +A+VVV+KDG+G++RTV EA+ AA
Sbjct  212   R------------------WVTAGERRLL---VGRARAHVVVSKDGSGDYRTVMEAVTAA  250

Query  716   SGRQRFVIYVKSGVYKEKIRSSKDGITLIGDGKYSTIITWDDSVGGGSSLTGSATFGITG  537
              GR RF+IYVK GVYKEK+   K  ITLIG+GK  T+I  DDS  GG+S+  +AT  +TG
Sbjct  251   HGRGRFIIYVKRGVYKEKVSIHKHEITLIGEGKDQTVIVGDDSFAGGTSVPDTATMTVTG  310

Query  536   DGFIAKDIGFQNTAGPGAHQAVALTVASDHSVFYRCSISGYQDTLYALSLRQFYRECDIS  357
             DGFIA+DIG +NTAGP   QA+AL++ SD SV YRCSISGYQDTLYA +LRQFYRECDI 
Sbjct  311   DGFIARDIGIKNTAGPRGQQAIALSITSDQSVLYRCSISGYQDTLYAAALRQFYRECDIY  370

Query  356   GTVDFIFGNAAAVFQACNLVLRRP---SSYNVILANGRSDPGQNTGFSVQKCKITPGPDF  186
             GT+DFIFGNAAAVFQ+CN+ +RRP    + NVILANGR+D  QN+GF++  C+I    D 
Sbjct  371   GTIDFIFGNAAAVFQSCNIFMRRPHGVKAINVILANGRTDQRQNSGFALHSCRIRTDSDL  430

Query  185   SPVKNSYNSYLGRPWKPYSRAVVMESDIDGAISARGWIEWPGTSSSSVRELYFGEYANVG  6
             SPVK+ Y+SYLGRPWK YSRAVV+ES ID AI+  GW+ W  +    ++ LYFGE+ N G
Sbjct  431   SPVKHRYSSYLGRPWKMYSRAVVIESYIDEAIAEEGWVGWLNSGDEVLKTLYFGEFKNYG  490



>gb|EPS67632.1| pectinesterase, partial [Genlisea aurea]
Length=417

 Score =   401 bits (1031),  Expect = 9e-132, Method: Compositional matrix adjust.
 Identities = 235/389 (60%), Positives = 280/389 (72%), Gaps = 24/389 (6%)
 Frame = -2

Query  1166  CEELMGMARQRLNEALVAMKESPGKNRQEDIQTWLSAAVTFQQACKDWADQYAFSDELFA  987
             C E++GM+R+RL +AL A+K SP K +  DIQTWLSAAVT  + CKD A+ +A   E++ 
Sbjct  3     CGEVVGMSRERLKQALAAVKISPEKYK-SDIQTWLSAAVTLVETCKDEAEPHAHMSEIYN  61

Query  986   RISRSMDYQSQLASNALALVNRNTEISAAGRQLSEEdidddddggffpDWVSGRDLRLLE  807
             +    M+  S+ ASNALAL N     ++   Q + E  +          WVS    +LL+
Sbjct  62    K----MNQTSRSASNALALSNLIAGNASLPPQQTNEFPN----------WVSPGQRKLLQ  107

Query  806   TTTDKTKANVVVAKDGTGNFRTVAEAIGAASGRQRFVIYVKSGVYKEKIRSSKDGITLIG  627
             TT    +AN VV+KDG+GNF+TVAEAI AASG   FVIYVK+GVY E++   K GITLIG
Sbjct  108   TT--GLRANAVVSKDGSGNFKTVAEAIAAASGGGGFVIYVKAGVYSEQVVCRKSGITLIG  165

Query  626   DGKYSTIITWDDSVGGGSSLTGSATFGITGDGFIAKDIGFQNTAGPGAHQAVALTVASDH  447
             DGKYSTII+   SVGGGSSL GS+TF I GDGF+A+DIGF+NTA P  HQAVALTVASD 
Sbjct  166   DGKYSTIISGGKSVGGGSSLLGSSTFTIYGDGFVARDIGFENTAPPENHQAVALTVASDR  225

Query  446   SVFYRCSISGYQDTLYALSLRQFYRECDISGTVDFIFGNAAAVFQACNLVLRRP--SSYN  273
             SVFYRCS S YQDTL+ALSLRQFYRECD+ GT+DFIFGNAAAVFQ  NL+LR+P    YN
Sbjct  226   SVFYRCSFSSYQDTLFALSLRQFYRECDVQGTIDFIFGNAAAVFQNSNLILRQPPHGGYN  285

Query  272   VILANGRSDPGQNTGFSVQKCKITPGPDFSPVKNSYNSYLGRPWKPYSRAVVMESDIDGA  93
              ILANGR+DPGQNTGFSV  CKI         + +Y SYLGRPWK YSRAVVM+SDIDGA
Sbjct  286   AILANGRTDPGQNTGFSVHNCKIAVAS-----RGAYQSYLGRPWKAYSRAVVMKSDIDGA  340

Query  92    ISARGWIEWPGTSSSSVRELYFGEYANVG  6
             IS +GW +W G  SS+   LYF EYAN G
Sbjct  341   ISGKGWSQWEGAGSSTYTTLYFAEYANRG  369



>ref|XP_002874018.1| pectinesterase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH50277.1| pectinesterase family protein [Arabidopsis lyrata subsp. lyrata]
Length=527

 Score =   400 bits (1027),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 224/478 (47%), Positives = 296/478 (62%), Gaps = 53/478 (11%)
 Frame = -2

Query  1385  DQIRIQCGYTRFPRLCVQTLSGLVSG--ERVDFAAALLLNKTIAHADLHIAHFDQL--SS  1218
             ++++  C  T++  LCVQ L     G  + +DF + +L+NKTI+ ++L I        SS
Sbjct  33    NELQRHCSSTKYTSLCVQNLREFRHGSLDGLDFVS-VLVNKTISDSNLLIPPLSSSMGSS  91

Query  1217  HFVSSQP-----PQPRLQAIGYCEELMGMARQRLNEALVAMKESPGKNR-QEDIQTWLSA  1056
               VS +      P P +     CE LM M+ +RL +A+ A+  S  K   + D+QTWLSA
Sbjct  92    ELVSLEDSTYTLPSPSVS--DSCERLMKMSTRRLRQAMEALNGSSRKRHTKHDVQTWLSA  149

Query  1055  AVTFQQACKDWADQYAFSDE--LFARISRSMDYQSQLASNALALVN---RNTEISAAGRQ  891
             A+TFQQACKD    Y  +      + I + MD+ S+L SN+LALV+   +N +       
Sbjct  150   AITFQQACKDSILDYRETSPSAAISHIKQKMDHLSRLVSNSLALVDTIMQNPKPKTKSTG  209

Query  890   LSEEdidddddggffpDWVSGRDLRLLETTTDKTKANVVVAKDGTGNFRTVAEAIGAASG  711
             L                WV+  + RLL     + +A+VVVAKDG+G++RTV EA+ AA  
Sbjct  210   LPR--------------WVTAGERRLL---AGRARAHVVVAKDGSGDYRTVMEAVTAAHA  252

Query  710   RQRFVIYVKSGVYKEKIRSSKDGITLIGDGKYSTIITWDDSVGGGSSLTGSATFGITGDG  531
               R                 K  ITLIG+GK  T+I  DDS  GG+S+  +AT  +TGDG
Sbjct  253   NGRI---------------HKHEITLIGEGKDETVIVGDDSATGGTSVPDTATMTVTGDG  297

Query  530   FIAKDIGFQNTAGPGAHQAVALTVASDHSVFYRCSISGYQDTLYALSLRQFYRECDISGT  351
             FIA+DIG +NTAGPG HQA+AL++ SD SV YRCSISGYQDTLYA +LRQFYRECDI GT
Sbjct  298   FIARDIGIKNTAGPGGHQAIALSITSDQSVLYRCSISGYQDTLYAAALRQFYRECDIYGT  357

Query  350   VDFIFGNAAAVFQACNLVLRRP---SSYNVILANGRSDPGQNTGFSVQKCKITPGPDFSP  180
             +DFIFGNAAAVFQ+CN+ LRRP    +YNVILANGR+D  QNTGF++  C+I    D SP
Sbjct  358   IDFIFGNAAAVFQSCNIFLRRPHGVKAYNVILANGRTDQLQNTGFALHSCRIRTDSDLSP  417

Query  179   VKNSYNSYLGRPWKPYSRAVVMESDIDGAISARGWIEWPGTSSSSVRELYFGEYANVG  6
             VK+ Y+SYLGRPW+ YSR++VMES ID AI+  GW  W  +    ++ LYFGE+ N G
Sbjct  418   VKHMYSSYLGRPWRKYSRSIVMESYIDDAIAEEGWAGWLDSGDEVLKTLYFGEFKNYG  475



>emb|CDY67251.1| BnaC02g44290D [Brassica napus]
Length=506

 Score =   386 bits (991),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 217/474 (46%), Positives = 290/474 (61%), Gaps = 61/474 (13%)
 Frame = -2

Query  1385  DQIRIQCGYTRFPRLCVQTLSGL--VSGERVDFAAALLLNKTIAHADLHI-------AHF  1233
             +Q++  C  T +  LCVQTL      S   +DF +  L+NKTI+ +   I       A +
Sbjct  32    NQLQRHCSSTEYTSLCVQTLREFRHESTTSLDFVS-FLVNKTISGSSNLIPPLSSSMASY  90

Query  1232  DQLSSHFVSSQPPQPRLQAIGYCEELMGMARQRLNEALVAMKESPGK-NRQEDIQTWLSA  1056
             + +S    ++  P P +     CE LM M+ +RL +A+ A+  S  K   + D+QTWLSA
Sbjct  91    EVISLDDSTNTLPSPSVA--DSCERLMKMSTRRLQQAMEALNGSSRKRTTKHDVQTWLSA  148

Query  1055  AVTFQQACKDWA-DQYAFSDELFARISRSMDYQSQLASNALALVNRNTEISAAGRQLSEE  879
             A+TFQQ+CKD   D    S    + I++ MD+ S+L SN+LALV    E           
Sbjct  149   AMTFQQSCKDSVLDSGGHSSSAVSHITQKMDHLSRLVSNSLALVGTFME-----------  197

Query  878   didddddggffpDWVSGRDLRLLETTTDKTKANVVVAKDGTGNFRTVAEAIGAASGRQRF  699
                 +      P WVS  + +LL + T +++ +V+VAKDG+G++RTV EAI         
Sbjct  198   ----NPKPTVLPRWVSAGERKLLASRTSRSRPHVLVAKDGSGDYRTVMEAI---------  244

Query  698   VIYVKSGVYKEKIRSSKDGITLIGDGKYSTIITWDDSVGGGSSLTGSATFGITGDGFIAK  519
                                 TLIG+GK  T+I  DDS  GG+S+  +AT  +TGDGFIA+
Sbjct  245   --------------------TLIGEGKDLTVIVGDDSAAGGTSVPDTATMTVTGDGFIAR  284

Query  518   DIGFQNTAGPGAHQAVALTVASDHSVFYRCSISGYQDTLYALSLRQFYRECDISGTVDFI  339
             DIG +NTAGP   QA+AL++ SD SV YRCSISGYQDTLYA +LRQFYRECDI GT+DFI
Sbjct  285   DIGIKNTAGPRGKQAIALSITSDQSVLYRCSISGYQDTLYAAALRQFYRECDIYGTIDFI  344

Query  338   FGNAAAVFQACNLVLRRPS---SYNVILANGRSDPGQNTGFSVQKCKITPGPDFSPVKNS  168
             FGNAAAVFQ+CNL+LRRPS   +YNVILANGR+D  QNTGF++  C+I    DFS +K+ 
Sbjct  345   FGNAAAVFQSCNLILRRPSDVKAYNVILANGRTDQRQNTGFALHSCRILTDLDFSGMKHR  404

Query  167   YNSYLGRPWKPYSRAVVMESDIDGAISARGWIEWPGTSSSSVRELYFGEYANVG  6
             Y+SYLGRPWK YSR++VME+ ID AI+  GW  W  +    ++ LYFGE+ N G
Sbjct  405   YSSYLGRPWKKYSRSIVMETYIDDAIAEEGWAGWLNSGDEVLKTLYFGEFKNYG  458



>ref|NP_197586.1| putative pectinesterase/pectinesterase inhibitor 54 [Arabidopsis 
thaliana]
 sp|Q3E989.1|PME54_ARATH RecName: Full=Probable pectinesterase/pectinesterase inhibitor 
54; Includes: RecName: Full=Pectinesterase inhibitor 54; AltName: 
Full=Pectin methylesterase inhibitor 54; Includes: RecName: 
Full=Pectinesterase 54; Short=PE 54; AltName: Full=Pectin 
methylesterase 54; Short=AtPME54; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AED92898.1| putative pectinesterase/pectinesterase inhibitor 54 [Arabidopsis 
thaliana]
Length=512

 Score =   373 bits (958),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 225/508 (44%), Positives = 298/508 (59%), Gaps = 70/508 (14%)
 Frame = -2

Query  1463  VIMLVLFFGCCVTTIaaaavsqvaa----QDQIRIQCGYTRFPRLCVQTLSGLVSG--ER  1302
             VI +VLF+   V  +     S        Q++++  C  T++  LCVQ L     G  + 
Sbjct  3     VIDMVLFWVLLVNALLIVDASSRNMPFAYQNEMQRHCSSTKYTSLCVQNLREFRHGSLDG  62

Query  1301  VDFAAALLLNKTIAHADLHIAHFDQL--SSHFVSSQP-----PQPRLQAIGYCEELMGMA  1143
             +DF +  L+NKTI+ ++L I        SS  VS +      P P +     CE LM M+
Sbjct  63    LDFVS-FLVNKTISDSNLLIPPLSSSMGSSKLVSLEDSTYTLPSPSVS--DSCERLMKMS  119

Query  1142  RQRLNEALVAMKESPGKNR-QEDIQTWLSAAVTFQQACKD--WADQYAFSDELFARISRS  972
              +RL +A+ A+  S  K   + D+QTWLSAA+TFQQACKD       + S    + IS+ 
Sbjct  120   TRRLRQAMEALNGSSRKRHTKHDVQTWLSAAMTFQQACKDSILDSGGSSSASAISHISQK  179

Query  971   MDYQSQLASNALALVN---RNTEISAAGRQLSEEdidddddggffpDWVSGRDLRLLETT  801
             MD+ S+L SN+L LV+   +N +       L                WV+  + RLL   
Sbjct  180   MDHLSRLVSNSLTLVDTIMKNPKPKTKSTALPR--------------WVTAGERRLL---  222

Query  800   TDKTKANVVVAKDGTGNFRTVAEAIGAASGRQRFVIYVKSGVYKEKIRSSKDGITLIGDG  621
               + +A+VVVAKDG+G++RTV EA+ AA G                            +G
Sbjct  223   VGRARAHVVVAKDGSGDYRTVMEAVTAAHG----------------------------NG  254

Query  620   KYSTIITWDDSVGGGSSLTGSATFGITGDGFIAKDIGFQNTAGPGAHQAVALTVASDHSV  441
             K  T+I  DDS  GG+S+  +AT  +TGDGFIA+DIG +N AGP  HQA+AL++ SD SV
Sbjct  255   KDLTVIVGDDSATGGTSVPDTATMTVTGDGFIARDIGIKNIAGPRGHQAIALSITSDQSV  314

Query  440   FYRCSISGYQDTLYALSLRQFYRECDISGTVDFIFGNAAAVFQACNLVLRRP---SSYNV  270
              YRCSISGYQDTLYA +LRQFYRECDI GT+DFIFGNAAAVFQ+CN+ LRRP    +YNV
Sbjct  315   LYRCSISGYQDTLYAAALRQFYRECDIYGTIDFIFGNAAAVFQSCNIFLRRPHGVKAYNV  374

Query  269   ILANGRSDPGQNTGFSVQKCKITPGPDFSPVKNSYNSYLGRPWKPYSRAVVMESDIDGAI  90
             ILANGR+D  QNTGF++  C+I    D SPVK+ Y+SYLGRPW+ YSRA+VMES ID AI
Sbjct  375   ILANGRTDQRQNTGFALHSCRIRTDSDLSPVKHKYSSYLGRPWRKYSRAIVMESYIDDAI  434

Query  89    SARGWIEWPGTSSSSVRELYFGEYANVG  6
             +  GW  W  +    ++ LYFGE+ N G
Sbjct  435   AEGGWAGWLDSGDEVLKTLYFGEFKNYG  462



>ref|XP_006290070.1| hypothetical protein CARUB_v10003708mg [Capsella rubella]
 gb|EOA22968.1| hypothetical protein CARUB_v10003708mg [Capsella rubella]
Length=509

 Score =   365 bits (937),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 211/472 (45%), Positives = 279/472 (59%), Gaps = 55/472 (12%)
 Frame = -2

Query  1385  DQIRIQCGYTRFPRLCVQTLSGLVSG--ERVDFAAALLLNKTIAHADLHIAHFDQLSSHF  1212
             + ++  C  T +  LCVQ L     G  + +DF +  L+NKTI+H+++         S  
Sbjct  33    NDLQRHCSSTTYTSLCVQNLREFRHGSLQGLDFVS-FLVNKTISHSNMLTPPLSSSMSSS  91

Query  1211  VS-----SQPPQPRLQAIGYCEELMGMARQRLNEALVAMKESPGK-NRQEDIQTWLSAAV  1050
                    S    P      YCE L+ M+ +RL + + A+  S  K + + D+QTWLSAA+
Sbjct  92    ELVSLEVSDDTLPSTSVSDYCERLIKMSTRRLGQVMEALNSSSRKRHSKHDVQTWLSAAM  151

Query  1049  TFQQACK-DWADQYAFSDELFARISRSMDYQSQLASNALALVNRNTEISAAGRQLSEEdi  873
             TFQQACK    D    S    +R+++ MD+ S+L SN+LALV+              E+ 
Sbjct  152   TFQQACKDSILDSGDSSSSSISRMTQKMDHLSRLVSNSLALVD-----------TIMENP  200

Query  872   dddddggffpDWVSGRDLRLLETTTDKTKANVVVAKDGTGNFRTVAEAIGAASGRQRFVI  693
               +      P WV+  + RLL     + +A+VVVAKDG+G++RTV EA+ AA G      
Sbjct  201   KPETKSTVLPRWVTAGERRLL---VGRERAHVVVAKDGSGDYRTVMEAVTAAHGH-----  252

Query  692   YVKSGVYKEKIRSSKDGITLIGDGKYSTIITWDDSVGGGSSLTGSATFGITGDGFIAKDI  513
                                    GK  T+I   DS  GG+S+  +AT  +TGDGFIA+DI
Sbjct  253   -----------------------GKDQTVIVGGDSYAGGTSVPDTATMTVTGDGFIARDI  289

Query  512   GFQNTAGPGAHQAVALTVASDHSVFYRCSISGYQDTLYALSLRQFYRECDISGTVDFIFG  333
             G +N AGP   QA+AL++ SD SV YRCSISGYQDTLYA +LRQFYRECDI GT+DFIFG
Sbjct  290   GIKNNAGPRGQQAIALSITSDQSVLYRCSISGYQDTLYAAALRQFYRECDIYGTIDFIFG  349

Query  332   NAAAVFQACNLVLRRP---SSYNVILANGRSDPGQNTGFSVQKCKITPGPDFSPVKNSYN  162
             NAAAVFQ+CN+ LRRP    +YNVILANGR+D  QN+GF++  C+I    D SPVK+ Y+
Sbjct  350   NAAAVFQSCNIFLRRPYGVKAYNVILANGRTDQRQNSGFALHSCRIRTDTDLSPVKHRYS  409

Query  161   SYLGRPWKPYSRAVVMESDIDGAISARGWIEWPGTSSSSVRELYFGEYANVG  6
             SYLGRPWK YSRAVVMES ID AI+  GW  W  +    ++ LYFGE+ N G
Sbjct  410   SYLGRPWKMYSRAVVMESYIDDAIAEEGWAGWLNSGDEVLKTLYFGEFKNYG  461



>emb|CAA69206.1| pectinesterase [Carica papaya]
Length=216

 Score =   347 bits (889),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 167/215 (78%), Positives = 184/215 (86%), Gaps = 2/215 (1%)
 Frame = -2

Query  776  VVAKDGTGNFRTVAEAIGAASGRQRFVIYVKSGVYKEKIRSSKDGITLIGDGKYSTIITW  597
            VVAKDGTGNF+TV EA+ AA G++RFVIYVK+GVYKEKI S+KDGITLIGDGKYSTII  
Sbjct  2    VVAKDGTGNFQTVKEAMDAADGKKRFVIYVKAGVYKEKIHSNKDGITLIGDGKYSTIIVG  61

Query  596  DDSVGGGSSLTGSATFGITGDGFIAKDIGFQNTAGPGAHQAVALTVASDHSVFYRCSISG  417
            DDSV GGS++ GSAT  +TGDGFIA+DIGFQNTAGP   QA+AL +ASDHSV YRCSI+G
Sbjct  62   DDSVAGGSTMPGSATITMTGDGFIARDIGFQNTAGPQGEQALALNIASDHSVLYRCSIAG  121

Query  416  YQDTLYALSLRQFYRECDISGTVDFIFGNAAAVFQACNLVLRRP--SSYNVILANGRSDP  243
            YQDTLYA +LRQFYRECDI GTVDFIFGNAAAVFQ C LVLR P    YNVILANGRSDP
Sbjct  122  YQDTLYAHALRQFYRECDIYGTVDFIFGNAAAVFQNCYLVLRLPRKKGYNVILANGRSDP  181

Query  242  GQNTGFSVQKCKITPGPDFSPVKNSYNSYLGRPWK  138
            GQNTGFSV  C+I P  +FSPVK+ Y SYLGRPWK
Sbjct  182  GQNTGFSVHNCRIVPSSEFSPVKHKYESYLGRPWK  216



>gb|ABK24761.1| unknown [Picea sitchensis]
Length=557

 Score =   358 bits (920),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 209/474 (44%), Positives = 278/474 (59%), Gaps = 31/474 (7%)
 Frame = -2

Query  1385  DQIRIQCGYTRFPRLCVQTLSGLVSGERVDFAAALLLNKTIAHADLHIAHFDQLSSHFVS  1206
             + +   C  T +P +C  +LS           ++    K + H  L IA  ++ +  F  
Sbjct  50    ESVEAVCSKTLYPEICYYSLSP-------HLGSSPAQPKKLLHVALMIA-LEEANKAFAL  101

Query  1205  SQPPQPRLQAIGYCEELMGMARQRLNEALVAMKESPGK----NRQEDIQTWLSAAVTFQQ  1038
                   +  A+  C ELM + R +L+ ++  +K    K     +  D+QTWLSA++T Q 
Sbjct  102   VLRFVKQTSALQDCMELMDITRDQLDSSIALLKRHDLKALMREQASDLQTWLSASITNQD  161

Query  1037  ACKDWADQYAFSDELFARISRSMDYQSQLASNALALVNRNTE----ISAAGRQLSEEdid  870
              C D    Y+ S    A +  S+    +L SN+LA+     E     S A R  S+   D
Sbjct  162   TCLDGISDYSKSIAR-ALVENSVQNVRKLISNSLAIAKAAYESRPYPSPALRLPSDSIKD  220

Query  869   ddddggffpDWVSGRDLRLLETTTDKTKANVVVAKDGTGNFRTVAEAIGAASGR--QRFV  696
             D         W+S  D RLL T+ +    NV+VA+DG+GNF+T+ +AI AA  +  +R+V
Sbjct  221   DFPS------WLSPGDRRLLRTSANDVVPNVIVAQDGSGNFKTITQAIAAAPEKSPKRYV  274

Query  695   IYVKSGVYKEKIR--SSKDGITLIGDGKYSTIITWDDSVGGGSSLTGSATFGITGDGFIA  522
             I VK G YKE ++   +K  I LIG+G  +TI+T   +V  GS+   SATF   G+GF+A
Sbjct  275   IKVKKGTYKENVQVGKTKTNIMLIGEGMEATIVTGSRNVIDGSTTFNSATFAAVGNGFMA  334

Query  521   KDIGFQNTAGPGAHQAVALTVASDHSVFYRCSISGYQDTLYALSLRQFYRECDISGTVDF  342
             +D+ F NTAGP  HQAVAL V SD SV YRC I+ YQDTLYA SLRQFYREC ISGTVDF
Sbjct  335   QDMAFVNTAGPQKHQAVALRVGSDQSVLYRCKIAAYQDTLYAHSLRQFYRECKISGTVDF  394

Query  341   IFGNAAAVFQACNLVLRRP--SSYNVILANGRSDPGQNTGFSVQKCKITPGPDFSPVKNS  168
             IFGNAA VFQ+C LV R+P  +  N I A GR+DP QNTG S+  CKITPG D  PVK+S
Sbjct  395   IFGNAAVVFQSCILVPRKPGANQKNAITAQGRTDPNQNTGISIHNCKITPGTDLVPVKSS  454

Query  167   YNSYLGRPWKPYSRAVVMESDIDGAISARGWIEWPGTSSSSVRELYFGEYANVG  6
             + +YLGRPWK YSR V M+S IDG I   GW+EW G    +++ LY+GEY N G
Sbjct  455   FPTYLGRPWKEYSRTVFMQSYIDGFIQPAGWLEWDG--DFALKTLYYGEYMNTG  506



>ref|XP_010259481.1| PREDICTED: pectinesterase-like [Nelumbo nucifera]
Length=583

 Score =   344 bits (882),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 210/503 (42%), Positives = 288/503 (57%), Gaps = 25/503 (5%)
 Frame = -2

Query  1472  RTWVIMLVLFFGCCVTTIaaaavsqvaaQDQI-RIQCGYTRFPRLCVQTLSGL--VSGER  1302
             RT + +LVL     +  + A++   V    QI    C  T +P LCV TLS    ++ + 
Sbjct  42    RTKIQLLVLTISITLFLVQASSSIPVLHHLQIAHSACEGTLYPELCVSTLSSFPDLTSKT  101

Query  1301  VDFAAALLLNKTIAHADLHIAHFDQLSSHFVSSQPPQPRLQAIGYCEELMGMARQRLNEA  1122
             +    +  +N T+   ++  ++   +  +  +  P + R  A+  C EL       L  A
Sbjct  102   ISQMISSTVNYTVKEVEISASNCTDIRKNLKAQDPLEQR--ALDDCLELFDETISELQTA  159

Query  1121  L--VAMKESPGKNRQEDIQTWLSAAVTFQQACKDWADQYAFSDELFAR--ISRSMDYQSQ  954
             L  ++ K SP K+   D+QT LSAA+T Q  C    D  +  +E   R  I ++++  S 
Sbjct  160   LSDLSPKSSPSKH-YNDLQTLLSAAMTNQYTC---LDGLSLGNEQVIREEIKQNLNNISH  215

Query  953   LASNALALVNRNTEISAAGRQLSEEdidddddggffpD-WVSGRDLRLLETTTDKTKANV  777
             L SN+LA++   T++  A   L +E   +          WVS +D +LL+ +T+  K ++
Sbjct  216   LVSNSLAML---TKMPKAADTLKDEVFPEYGKMAGRFPGWVSPKDRKLLQASTNTMKFDL  272

Query  776   VVAKDGTGNFRTVAEAIGAA--SGRQRFVIYVKSGVYKEKIRSSKDGITL--IGDGKYST  609
             VVAKDG+GNFRT+ EA+ AA  S   RFVIY+K+G Y E +   K    L  +GDG   T
Sbjct  273   VVAKDGSGNFRTIGEAVAAAPNSSATRFVIYIKAGTYFENVDVGKKKTMLMFVGDGIGKT  332

Query  608   IITWDDSVGGGSSLTGSATFGITGDGFIAKDIGFQNTAGPGAHQAVALTVASDHSVFYRC  429
             ++    +V  G +   SAT  + G+GFIA+D+  +N AGP  HQAVAL   SD S FYRC
Sbjct  333   VVKASRNVVDGWTTFRSATVAVVGNGFIARDMTIENAAGPSKHQAVALRSGSDLSAFYRC  392

Query  428   SISGYQDTLYALSLRQFYRECDISGTVDFIFGNAAAVFQACNLVLRRPSS--YNVILANG  255
             S  GYQDTLY  SLRQFYRECDI GTVDFIFGNAA VFQ CNL  RRP++   N+  A G
Sbjct  393   SFVGYQDTLYVHSLRQFYRECDIYGTVDFIFGNAAVVFQNCNLYARRPNANQKNIFTAQG  452

Query  254   RSDPGQNTGFSVQKCKITPGPDFSPVKNSYNSYLGRPWKPYSRAVVMESDIDGAISARGW  75
             R DP QNTG S+  CK+T   D SPVK+S+++YLGRPWK YSR V + S +D  I+  GW
Sbjct  453   REDPNQNTGISILNCKVTLAADLSPVKSSFHTYLGRPWKEYSRTVFIGSYLDDLINPAGW  512

Query  74    IEWPGTSSSSVRELYFGEYANVG  6
             +EW G    S   LY+GEY N G
Sbjct  513   LEWSGNFGLST--LYYGEYMNKG  533



>gb|ABK24883.1| unknown [Picea sitchensis]
Length=571

 Score =   338 bits (866),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 199/468 (43%), Positives = 282/468 (60%), Gaps = 31/468 (7%)
 Frame = -2

Query  1367  CGYTRFPRLCVQTLSGLVSGERVDFAAALLLNKTIAHADLHIAHFDQLSSHFVSSQPPQ-  1191
             C  T +P +CV +L  L   E    A++  L   +    L+      LS+   S    Q 
Sbjct  69    CSVTLYPDVCVSSL--LAHPESRKAASSKELATIVVKVTLY--ELKNLSASLGSEMSRQR  124

Query  1190  ---PRLQ-AIGYCEELMGMARQRLNEALVAMKESPGKNRQ-EDIQTWLSAAVTFQQACKD  1026
                 R Q A+  C EL G + ++LN++L +++ S  + ++ +D+QTWLSA++T Q  C +
Sbjct  125   ITDQRSQSAVDDCLELFGYSLRQLNDSLGSLQSSEWRRQEADDVQTWLSASLTNQDTCIE  184

Query  1025  WADQYAFSDELFARISRSMDYQSQLASNALALVNRNTEISAAGRQLSEEdidddddggff  846
               + + + + +      ++    +L SN+LA+V +N   +   R+L  + I   D+  F 
Sbjct  185   GVNGHNYGNPMLP--DGALRKVWKLLSNSLAMV-KNISPAGIDRRLLIDPIASLDNELFS  241

Query  845   p-----DWVSGRDLRLLETTTDKTKANVVVAKDGTGNFRTVAEAIGAASGRQ--RFVIYV  687
                    W+S  D RLL+      +AN VVAKDG+G+++T+ EAI AA  +   R++IYV
Sbjct  242   VADGFPSWLSPADRRLLQVLPSGIRANAVVAKDGSGHYKTITEAINAAPSKSKGRYIIYV  301

Query  686   KSGVYKEKIRSSKDGITLIGDGKYSTIITWDDSVGGGSSLTGSATFGITGDGFIAKDIGF  507
             ++G+Y E+++ SKDGI L+GDGK  TI+T   S   G SL   + F  TG+GFIA+D+GF
Sbjct  302   RAGIYAERVKVSKDGIMLVGDGKDVTIVTGKLS---GVSLKSISNFIATGNGFIARDMGF  358

Query  506   QNTAGPGAHQAVALTVASDHSVFYRCSISGYQDTLYALSLRQFYRECDISGTVDFIFGNA  327
             +NTAGP  HQA+AL V SDHS  YRCSI GYQDTLYA + RQFYRECDI G+VDFIFGNA
Sbjct  359   ENTAGPRNHQAIALLVGSDHSALYRCSIKGYQDTLYAYTQRQFYRECDIYGSVDFIFGNA  418

Query  326   AAVFQACNLVLRRP-SSYNVILANGRSDPGQNTGFSVQKCKITPGPDFSPVKNSYNSYLG  150
              AVFQ+CN++ R+     + I A GR DP QNTGFS+  C++         KNS  +YLG
Sbjct  419   VAVFQSCNILARKGLGGRSFITAQGRIDPNQNTGFSIHMCRVIAAD-----KNSDPTYLG  473

Query  149   RPWKPYSRAVVMESDIDGAISARGWIEWPGTSSSSVRELYFGEYANVG  6
             RPWKPYSR V M+S  D  I+  GW  W G  + +++ LY+GEY N G
Sbjct  474   RPWKPYSRTVYMQSYFDKIIAPAGWYPWSG--NFALKTLYYGEYMNTG  519



>gb|KHN30453.1| Pectinesterase 2.2 [Glycine soja]
Length=461

 Score =   334 bits (856),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 185/401 (46%), Positives = 245/401 (61%), Gaps = 25/401 (6%)
 Frame = -2

Query  1181  QAIGYCEELMGMARQRLNEALVAMKESPGKNRQEDIQTWLSAAVTFQQACKDWADQYA--  1008
             +A+  C ELM ++  R+ +++V + +   ++ Q+D  TWLS+ +T    C D  +  A  
Sbjct  28    EALHDCVELMDLSISRVRDSMVTLTKQTIES-QQDAHTWLSSVLTNHATCLDGLEGSASA  86

Query  1007  -FSDELFARISRSMDYQSQLASNALALVNRNTEISAAGRQLSEEdidddddggffpDWVS  831
                DEL   ISR+   ++ LA     L  +  +I      LS +             WVS
Sbjct  87    FMKDELEDLISRA---RTSLAMFVAVLPPKVEQI--IDEPLSGDFPS----------WVS  131

Query  830   GRDLRLLETTTDKTKANVVVAKDGTGNFRTVAEAIGAA--SGRQRFVIYVKSGVYKEKIR  657
              +D RLLE+T    KANVVVAKDG+G F+TVAEA+ +A  +G+ R+VIYVK G YKE + 
Sbjct  132   SKDRRLLESTVGDIKANVVVAKDGSGKFKTVAEAVASAPDNGKTRYVIYVKKGTYKENVE  191

Query  656   --SSKDGITLIGDGKYSTIITWDDSVGGGSSLTGSATFGITGDGFIAKDIGFQNTAGPGA  483
                 K  + L+GDGK +T+IT + +   G++   +AT    GDGFIA+DI FQNTAGP  
Sbjct  192   IGKKKTNVMLVGDGKDATVITGNLNFIDGTTTFKTATVAAVGDGFIAQDIWFQNTAGPQK  251

Query  482   HQAVALTVASDHSVFYRCSISGYQDTLYALSLRQFYRECDISGTVDFIFGNAAAVFQACN  303
             HQAVAL V +D SV  RC I  +QDTLYA S RQFYR+  I+GTVDFIFGNAA VFQ C+
Sbjct  252   HQAVALRVGADQSVINRCRIDAFQDTLYAHSNRQFYRDSFITGTVDFIFGNAAVVFQKCD  311

Query  302   LVLRRP--SSYNVILANGRSDPGQNTGFSVQKCKITPGPDFSPVKNSYNSYLGRPWKPYS  129
             LV R+P     N++ A GR DP QNTG S+Q+C +TP  D  PV  S  ++LGRPWK YS
Sbjct  312   LVARKPMDKQNNMVTAQGREDPNQNTGTSIQQCNLTPSSDLKPVVGSIKTFLGRPWKKYS  371

Query  128   RAVVMESDIDGAISARGWIEWPGTSSSSVRELYFGEYANVG  6
             R VVM+S +D  I   GW EW   S   ++ LY+GEY N G
Sbjct  372   RTVVMQSTLDSHIDPTGWAEWDAQSKDFLQTLYYGEYMNNG  412



>ref|XP_010684811.1| PREDICTED: pectinesterase-like [Beta vulgaris subsp. vulgaris]
Length=537

 Score =   336 bits (861),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 202/480 (42%), Positives = 274/480 (57%), Gaps = 42/480 (9%)
 Frame = -2

Query  1367  CGYTRFPRLCVQTLSG--LVSGERVDFAA-ALLLNKTIAHAD-LHIAHFDQLSSHFVSSQ  1200
             C  T +P+LC   ++   LVS +  +     + LN T+ HA  +H      +SS  +SS 
Sbjct  25    CNQTPYPQLCNSLITSKVLVSSQESNLEVRNIFLNITLDHAQKVHTL----ISSMDISSF  80

Query  1199  PPQPRLQAIGYCEELMGMARQRLNEALVAMKESPGKNRQEDIQTWLSAAVTFQQACKDWA  1020
                 +  A   C EL      +LN+ ++  K+       +DIQT+LSAA T  + CK+  
Sbjct  81    QDLAKF-AWEDCLELYEDTIYQLNQTILLSKDF---TTIQDIQTYLSAATTNYETCKNGF  136

Query  1019  DQYAFSD--ELFARISRSMDYQSQLASNALALVNRNTEISAAGRQ------------LSE  882
                  S   E F   S      SQ  +NALA+   N  IS    +               
Sbjct  137   VDLNISTNLEFFTFTSSKF---SQFLTNALAI---NQAISTTSFKPYTRERGGGGIGGRG  190

Query  881   EdidddddggffpDWVSGRDLRLLETTTDKTKANVVVAKDGTGNFRTVAEAIGAAS----  714
                         P W+   D +LL+T+   TKA++VVAKDGTGN++T++EAI AA     
Sbjct  191   GSGGRRLLANGLPSWMFKADHKLLQTSMPTTKADLVVAKDGTGNYKTISEAITAAKNLRI  250

Query  713   GRQRFVIYVKSGVYKEK--IRSSKDGITLIGDGKYSTIITWDDSVGGGSSLTGSATFGIT  540
             G +RF+IYVK+G+YKE   I +    + LIGDG  +TI+T + +V  GS+   SATF I+
Sbjct  251   GTKRFIIYVKAGIYKENVVITNKMKNLMLIGDGIDATIVTCNKNVQDGSTTFRSATFAIS  310

Query  539   GDGFIAKDIGFQNTAGPGAHQAVALTVASDHSVFYRCSISGYQDTLYALSLRQFYRECDI  360
             GDGFIAKDI F+NTAGP  HQAVAL   SD+S+FYRCS  GYQDTLY  S RQFY+ECDI
Sbjct  311   GDGFIAKDITFENTAGPQKHQAVALRSGSDYSIFYRCSFKGYQDTLYVYSKRQFYKECDI  370

Query  359   SGTVDFIFGNAAAVFQACNLVLRRP--SSYNVILANGRSDPGQNTGFSVQKCKITPGPDF  186
              GT+DFIFGNAAA+ Q+CN+ +R+P  +  N I A GRSDP +NTG  +    I    D 
Sbjct  371   YGTIDFIFGNAAAILQSCNIYVRKPMNNQMNTITAQGRSDPNENTGIVIHDSIIKAAQDL  430

Query  185   SPVKNSYNSYLGRPWKPYSRAVVMESDIDGAISARGWIEWPGTSSSSVRELYFGEYANVG  6
              PV+ S+ ++LGRPW+ YSR ++M+S IDG +   GW  W G    +++ LY+GEY N G
Sbjct  431   KPVQGSFQTFLGRPWRMYSRTMIMKSHIDGLVDIAGWAPWSG--DFALKTLYYGEYMNYG  488



>ref|XP_006573891.1| PREDICTED: pectinesterase/pectinesterase inhibitor 18-like [Glycine 
max]
Length=553

 Score =   335 bits (859),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 185/401 (46%), Positives = 245/401 (61%), Gaps = 25/401 (6%)
 Frame = -2

Query  1181  QAIGYCEELMGMARQRLNEALVAMKESPGKNRQEDIQTWLSAAVTFQQACKDWADQYA--  1008
             +A+  C ELM ++  R+ +++V + +   ++ Q+D  TWLS+ +T    C D  +  A  
Sbjct  120   EALHDCVELMDLSISRVRDSMVTLTKQTIES-QQDAHTWLSSVLTNHATCLDGLEGSARA  178

Query  1007  -FSDELFARISRSMDYQSQLASNALALVNRNTEISAAGRQLSEEdidddddggffpDWVS  831
                DEL   ISR+   ++ LA     L  +  +I      LS +             WVS
Sbjct  179   FMKDELEDLISRA---RTSLAMFVAVLPPKVEQI--IDEPLSGDFPS----------WVS  223

Query  830   GRDLRLLETTTDKTKANVVVAKDGTGNFRTVAEAIGAA--SGRQRFVIYVKSGVYKEKIR  657
              +D RLLE+T    KANVVVAKDG+G F+TVAEA+ +A  +G+ R+VIYVK G YKE + 
Sbjct  224   SKDRRLLESTVGDIKANVVVAKDGSGKFKTVAEAVASAPDNGKTRYVIYVKKGTYKENVE  283

Query  656   --SSKDGITLIGDGKYSTIITWDDSVGGGSSLTGSATFGITGDGFIAKDIGFQNTAGPGA  483
                 K  + L+GDGK +T+IT + +   G++   +AT    GDGFIA+DI FQNTAGP  
Sbjct  284   IGKKKTNVMLVGDGKDATVITGNLNFIDGTTTFKTATVAAVGDGFIAQDIWFQNTAGPQK  343

Query  482   HQAVALTVASDHSVFYRCSISGYQDTLYALSLRQFYRECDISGTVDFIFGNAAAVFQACN  303
             HQAVAL V +D SV  RC I  +QDTLYA S RQFYR+  I+GTVDFIFGNAA VFQ C+
Sbjct  344   HQAVALRVGADQSVINRCRIDAFQDTLYAHSNRQFYRDSFITGTVDFIFGNAAVVFQKCD  403

Query  302   LVLRRP--SSYNVILANGRSDPGQNTGFSVQKCKITPGPDFSPVKNSYNSYLGRPWKPYS  129
             LV R+P     N++ A GR DP QNTG S+Q+C +TP  D  PV  S  ++LGRPWK YS
Sbjct  404   LVARKPMDKQNNMVTAQGREDPNQNTGTSIQQCNLTPSSDLKPVVGSIKTFLGRPWKKYS  463

Query  128   RAVVMESDIDGAISARGWIEWPGTSSSSVRELYFGEYANVG  6
             R VVM+S +D  I   GW EW   S   ++ LY+GEY N G
Sbjct  464   RTVVMQSTLDSHIDPTGWAEWDAQSKDFLQTLYYGEYMNNG  504



>ref|XP_010930858.1| PREDICTED: pectinesterase-like [Elaeis guineensis]
Length=472

 Score =   331 bits (849),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 181/392 (46%), Positives = 240/392 (61%), Gaps = 26/392 (7%)
 Frame = -2

Query  1166  CEELMGMARQRLNEALVAMKESPGKNRQEDIQTWLSAAVTFQQACKDWADQYAFSDELFA  987
             C EL      +LN  L      P  N   D  +WL AA+T    C+     +A  +   +
Sbjct  53    CIELYEATVHQLNLTLKLQPLHP--NSHFDEFSWLGAALTNLDTCRT---SFAEVNVSGS  107

Query  986   RISRSMDYQSQLASNALALVNRNTEISAAGRQLSEEdidddddggffpDWVSGRDLRLLE  807
              I   + + S+L SN+LA+     +  +  R+L +              WV  +D +LLE
Sbjct  108   GIEPLLTHVSELISNSLAITRVGHQEDSYNRRLPD--------------WVLPKDRKLLE  153

Query  806   TTTDKTKANVVVAKDGTGNFRTVAEAIGAAS---GRQRFVIYVKSGVYKEKIRSSKDGIT  636
              +  + KA++VVAKDGTG+F ++++A+  AS   G +RFVIYVK GVYKE +      + 
Sbjct  154   VSEREVKADLVVAKDGTGDFSSISKAVDEASKGSGNKRFVIYVKKGVYKEYVNVGMRNLM  213

Query  635   LIGDGKYSTIITWDDSVGGGSSLTGSATFGITGDGFIAKDIGFQNTAGPGAHQAVALTVA  456
             L+GDG   T+IT   S GGGS+   SATF +TG+ FIA+ I F+NTAGP  HQAVAL  +
Sbjct  214   LVGDGIGKTVITGSRSAGGGSTTYNSATFAVTGERFIARGITFRNTAGPAKHQAVALRSS  273

Query  455   SDHSVFYRCSISGYQDTLYALSLRQFYRECDISGTVDFIFGNAAAVFQACNLVLRRPSSY  276
             SD SVFY+CS  GYQDTLYA SLRQFYREC I GTVDFIFGNAA VFQ CN+ +RRP S 
Sbjct  274   SDLSVFYQCSFQGYQDTLYAHSLRQFYRECKIYGTVDFIFGNAAVVFQNCNIYVRRPMSQ  333

Query  275   --NVILANGRSDPGQNTGFSVQKCKITPGPDFSPVKNSYNSYLGRPWKPYSRAVVMESDI  102
               N I A GR+DP QNTG S+Q C++T   D  PV++S+ ++LGRP K YSR V ME+ +
Sbjct  334   QKNTITAQGRTDPNQNTGISIQNCRVTAAKDLRPVRSSFQTFLGRPLKEYSRTVYMETYM  393

Query  101   DGAISARGWIEWPGTSSSSVRELYFGEYANVG  6
             D  IS  GW+EW G    ++  L++GE+ N G
Sbjct  394   DDLISPAGWLEWSG--DFALETLFYGEFRNTG  423



>ref|XP_004514851.1| PREDICTED: pectinesterase 2-like [Cicer arietinum]
Length=515

 Score =   332 bits (852),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 199/470 (42%), Positives = 268/470 (57%), Gaps = 39/470 (8%)
 Frame = -2

Query  1385  DQIRIQCGYTRFPRLCVQTLSGLVS------GERVDFAAALLLNKTIAHADLHIAHFDQL  1224
             +++++ C  T  P  C   LS   S       ++ DF     L+  +A       H + L
Sbjct  26    NEVKLWCNQTPNPEPCEYFLSNNPSYQHKLIEQKADF---FKLSLELAQERALKGHANTL  82

Query  1223  SSHFVSSQPPQPRLQ-AIGYCEELMGMARQRLNEALVAMKESPGKNRQEDIQTWLSAAVT  1047
             S   + S+   PR + A   C EL      +LN+ L    ++  K  Q D QTWLS A+T
Sbjct  83    S---LGSKCNNPREKSAWADCVELYEQTILKLNKTL----DTNTKCSQVDAQTWLSTALT  135

Query  1046  FQQACKDWADQYAFSDELFARISRSMDYQSQLASNALALVNRNTEISAAGRQLSEEdidd  867
               + CK    +    D +   +S ++   ++L SN LAL     +    G +        
Sbjct  136   NLETCKAGFYELGVQDYVLPLMSNNV---TKLLSNTLAL--NKVQYQEPGYK--------  182

Query  866   dddggffpDWVSGRDLRLLETTTDKTKANVVVAKDGTGNFRTVAEAIGAA--SGRQRFVI  693
                   FP WV   D +LL+T++  ++ANVVV+KDG+G + T+  A+ AA  + + R+VI
Sbjct  183   ----NGFPKWVKQGDRKLLQTSSPSSQANVVVSKDGSGKYTTIGAAVNAAPKNNKGRYVI  238

Query  692   YVKSGVYKEKIRSSKDGITLIGDGKYSTIITWDDSVGGGSSLTGSATFGITGDGFIAKDI  513
             +VK+GVY E++    + I L+GDG   TIIT   SVGGG++   SAT  + GDGFIA+DI
Sbjct  239   HVKTGVYNEQVEIKANNIMLVGDGIGKTIITGSKSVGGGTTTFRSATVAVVGDGFIAQDI  298

Query  512   GFQNTAGPGAHQAVALTVASDHSVFYRCSISGYQDTLYALSLRQFYRECDISGTVDFIFG  333
              F+NTAG   HQAVAL   SD SVFYRCS  GYQDTLY  S RQFY+EC+I GTVDFIFG
Sbjct  299   TFRNTAGANNHQAVALRSGSDLSVFYRCSFEGYQDTLYVHSDRQFYKECNIYGTVDFIFG  358

Query  332   NAAAVFQACNLVLRR-PSSYNVILANGRSDPGQNTGFSVQKCKITPGPDFSPVKNSYNSY  156
             NAAAVFQ CN+  R  P+  N I A GR+DP QNTG S+   ++T   D  PV+NS  +Y
Sbjct  359   NAAAVFQNCNIFARNPPNKVNTITAQGRTDPNQNTGISIHNSRVTAASDLKPVQNSVKTY  418

Query  155   LGRPWKPYSRAVVMESDIDGAISARGWIEWPGTSSSSVRELYFGEYANVG  6
             LGRPWK YSR V M++ +D  I   GW+EW G  + S   LY+GEY N G
Sbjct  419   LGRPWKQYSRTVFMKTSLDSLIHPAGWLEWSGNFALST--LYYGEYMNTG  466



>ref|XP_004492228.1| PREDICTED: pectinesterase 2.1-like [Cicer arietinum]
Length=555

 Score =   333 bits (855),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 188/416 (45%), Positives = 256/416 (62%), Gaps = 23/416 (6%)
 Frame = -2

Query  1223  SSHFVSSQPPQPRLQ-AIGYCEELMGMARQRLNEALVAMKESPGKNRQEDIQTWLSAAVT  1047
             +++ + S+   PR + A+  CE+LM ++  R+ ++++A+ ++   + Q+D  TWLS+ +T
Sbjct  106   TTNAIKSRINSPREETALRDCEQLMEISMDRIWDSMLALTKNT-IDSQQDAHTWLSSVLT  164

Query  1046  FQQACKDWADQYAFSDELFARISRSMDYQSQL--ASNALALVNRNTEISAAGRQLSEEdi  873
                 C D         E  +++    D+Q  +  A  +LA+        A   Q   +  
Sbjct  165   NHVTCLDGL-------EAISQVLMESDFQDLISRARTSLAV------FLAVFPQQGHDQF  211

Query  872   dddddggffpDWVSGRDLRLLETTTDKTKANVVVAKDGTGNFRTVAEAIGAA--SGRQRF  699
              D+   G FP W++ +D RLLE++    KANVVVAKDG+G F+TVAEA+  A  +G+ R+
Sbjct  212   VDETLNGDFPSWITSKDRRLLESSVGDIKANVVVAKDGSGKFKTVAEAVATAPDNGKTRY  271

Query  698   VIYVKSGVYKEKIR--SSKDGITLIGDGKYSTIITWDDSVGGGSSLTGSATFGITGDGFI  525
             VIYVK G YKE I   S K  + L+GDG  +TIIT + +   G++   SAT    GDGFI
Sbjct  272   VIYVKKGTYKENIEIGSIKKNVMLVGDGMDATIITGNLNFIDGTTTFKSATVAAVGDGFI  331

Query  524   AKDIGFQNTAGPGAHQAVALTVASDHSVFYRCSISGYQDTLYALSLRQFYRECDISGTVD  345
             A+DIGFQNTAG   HQAVAL V +D SV  RC I  +QDTLYA S RQFYR+  I+GT+D
Sbjct  332   AQDIGFQNTAGAEKHQAVALRVGADQSVINRCRIDAFQDTLYAHSNRQFYRDSVITGTID  391

Query  344   FIFGNAAAVFQACNLVLRRP--SSYNVILANGRSDPGQNTGFSVQKCKITPGPDFSPVKN  171
             FIFGNAA VFQ C LV R+P  +  N+  A GR DPGQNTG S+Q+C +TP  D  PV  
Sbjct  392   FIFGNAAVVFQKCKLVARKPMANQNNMYTAQGREDPGQNTGTSIQQCDLTPTADLKPVVG  451

Query  170   SYNSYLGRPWKPYSRAVVMESDIDGAISARGWIEWPGTSSSSVRELYFGEYANVGA  3
             S  ++LGRPWK YSR VVM+S +D  I   GW EW   S   ++ LY+GEY N GA
Sbjct  452   SIKTFLGRPWKKYSRTVVMQSFLDSHIDPTGWAEWDAASKDFLQTLYYGEYMNNGA  507



>dbj|BAC67662.1| pectin methylesterase [Pisum sativum]
Length=553

 Score =   333 bits (854),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 187/400 (47%), Positives = 246/400 (62%), Gaps = 24/400 (6%)
 Frame = -2

Query  1178  AIGYCEELMGMARQRLNEALVAMKESPGKNRQEDIQTWLSAAVTFQQACKDWAD---QYA  1008
             A+  CE+LM ++ +R+ ++++ + +    + Q+D  TWLS+ +T    C D  +   +  
Sbjct  121   ALNDCEQLMKLSIERVWDSVLTLTQD-NMDSQQDAHTWLSSVLTNHATCLDGLEGTSRMV  179

Query  1007  FSDELFARISRSMDYQSQLASNALALVNRNTEISAAGRQLSEEdidddddggffpDWVSG  828
                +L   ISR        A ++LA+      + A   + S +   D+   G FP WV+ 
Sbjct  180   MESDLQDLISR--------ARSSLAV------LVAVLPEKSNDGFIDESLNGEFPSWVTS  225

Query  827   RDLRLLETTTDKTKANVVVAKDGTGNFRTVAEAIGAA--SGRQRFVIYVKSGVYKE--KI  660
             +D RLLE++     ANVVVAKDG+G F+TVAEA+ +    G+ R+VIYVK G YKE  +I
Sbjct  226   KDRRLLESSVGDITANVVVAKDGSGKFKTVAEAVASVPNKGKTRYVIYVKKGTYKENVEI  285

Query  659   RSSKDGITLIGDGKYSTIITWDDSVGGGSSLTGSATFGITGDGFIAKDIGFQNTAGPGAH  480
              S K  + L+GDG  +TIIT   +V  G+    SAT    GDGFIA+DIGF+NTAGP  H
Sbjct  286   SSQKTNVMLVGDGMDATIITGSLNVVDGTGTFQSATVAAVGDGFIAQDIGFKNTAGPEKH  345

Query  479   QAVALTVASDHSVFYRCSISGYQDTLYALSLRQFYRECDISGTVDFIFGNAAAVFQACNL  300
             QAVAL V SD SV  RC I  +QDTLYA S RQFYR+C I+GT+DFIFGNAAAVFQ   L
Sbjct  346   QAVALRVGSDQSVINRCRIDAFQDTLYAHSNRQFYRDCFITGTIDFIFGNAAAVFQKSKL  405

Query  299   VLRRPSS--YNVILANGRSDPGQNTGFSVQKCKITPGPDFSPVKNSYNSYLGRPWKPYSR  126
             V R+P S   N++ A GR DP QNT  S+Q+C I P  D  PV  S  +YLGRPWKPYSR
Sbjct  406   VARKPMSNQKNMVTAQGRLDPNQNTATSIQQCDIIPSTDLKPVLGSIKTYLGRPWKPYSR  465

Query  125   AVVMESDIDGAISARGWIEWPGTSSSSVRELYFGEYANVG  6
              VVM+S I   I   GW EW   S + ++ LY+GEY N G
Sbjct  466   TVVMQSPIGNHIDPTGWAEWDDASKAFLKTLYYGEYLNSG  505



>ref|XP_010672022.1| PREDICTED: pectinesterase-like [Beta vulgaris subsp. vulgaris]
Length=521

 Score =   332 bits (851),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 191/404 (47%), Positives = 249/404 (62%), Gaps = 44/404 (11%)
 Frame = -2

Query  1166  CEELMGMARQRLNEALVAMKESPGKNRQE-DIQTWLSAAVTFQQACKDWADQYAFSDELF  990
             C  L       LN+ L   K    K R E D QTWLS A+T  + CK          ELF
Sbjct  96    CLTLYENTISELNKTLNPTK----KYRTEFDKQTWLSTALTNLETCKS---------ELF  142

Query  989   ARISRSMDY--------QSQLASNALALVNRNTEISAAGRQLSEEdidddddggffpDWV  834
              ++   +D+         S+L SN LA+ N+         +L             FP WV
Sbjct  143   DQLGHVLDFIPPHIYNNVSELISNGLAMHNKLAIPQTQTYKLG------------FPTWV  190

Query  833   SGRDLRLLETTTDKTKANVVVAKDGTGNFRTVAEAIGAASGRQR----FVIYVKSGVYKE  666
             + RD +LL++++ K  AN+VVAKDG+GNF+T+ EA+ AA+ R R    FVI++KSGVY E
Sbjct  191   TRRDRKLLQSSSTKA-ANLVVAKDGSGNFKTIREALDAAAKRTRSSGRFVIHIKSGVYAE  249

Query  665   KIRSSKD--GITLIGDGKYSTIITWDDSVGGGSSLTGSATFGITGDGFIAKDIGFQNTAG  492
              +R   D   I L+GDG  STIIT + S GGG ++  SAT  +T DGFIA+DI F+NTAG
Sbjct  250   YLRIGTDLKNIMLVGDGMESTIITGNRSKGGGFTIFTSATVAVTSDGFIARDITFRNTAG  309

Query  491   PGAHQAVALTVASDHSVFYRCSISGYQDTLYALSLRQFYRECDISGTVDFIFGNAAAVFQ  312
             P  +QAVAL V SD SVFY+C   GYQDTLYA S RQFYREC+I GT+DFIFGNAA++FQ
Sbjct  310   PQNNQAVALRVGSDLSVFYKCGFEGYQDTLYAHSQRQFYRECNIYGTIDFIFGNAASIFQ  369

Query  311   ACNLVLRRP--SSYNVILANGRSDPGQNTGFSVQKCKITPGPDFSPVKNSYNSYLGRPWK  138
              CN+ +R+P  S  NV+ A GR+DP QNTG  +QK +I P  D  PV +S+ +YLGRPWK
Sbjct  370   NCNIFVRKPLSSQKNVVTAQGRTDPNQNTGIIIQKSRIAPSSDLKPVISSFPTYLGRPWK  429

Query  137   PYSRAVVMESDIDGAISARGWIEWPGTSSSSVRELYFGEYANVG  6
              YSR + ME+ +D  I+  GW++W G S  +   L++GEY N G
Sbjct  430   KYSRTIFMENFLDSFINPSGWLKWDG-SKFAPNTLFYGEYKNYG  472



>gb|AFK44272.1| unknown [Lotus japonicus]
Length=554

 Score =   332 bits (852),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 189/406 (47%), Positives = 249/406 (61%), Gaps = 24/406 (6%)
 Frame = -2

Query  1190  PRLQA-IGYCEELMGMARQRLNEALVAMKESPGKNRQEDIQTWLSAAVTFQQACKDWAD-  1017
             PR +A +  CE+LM ++  R+ ++++A+ +    +  +D   WLS  +T    C D  + 
Sbjct  115   PREEAALSDCEQLMDLSIDRVWDSVMALTKD-NTDSHQDAHAWLSGVLTNHATCLDGLEG  173

Query  1016  --QYAFSDELFARISRSMDYQSQLASNALALVNRNTEISAAGRQLSEEdidddddggffp  843
               +     E+   ISRS          +LAL+     +S    +   E I D+   G FP
Sbjct  174   PSRALMEAEIEDLISRS--------KTSLALL-----VSVLAPKGGNEQIIDEPLDGDFP  220

Query  842   DWVSGRDLRLLETTTDKTKANVVVAKDGTGNFRTVAEAIGAA--SGRQRFVIYVKSGVYK  669
              WV+ +D RLLE++     ANVVVAKDG+G F+TVAEA+ +A  SG+ R+VIYVK G YK
Sbjct  221   SWVTRKDRRLLESSVGDVNANVVVAKDGSGRFKTVAEAVASAPDSGKTRYVIYVKKGTYK  280

Query  668   EKIR--SSKDGITLIGDGKYSTIITWDDSVGGGSSLTGSATFGITGDGFIAKDIGFQNTA  495
             E I     K  + L GDG  +TIIT + +V  GS+   SAT    GDGFIA+DI FQNTA
Sbjct  281   ENIEIGKKKTNVMLTGDGMDATIITGNLNVIDGSTTFKSATVAAVGDGFIAQDIWFQNTA  340

Query  494   GPGAHQAVALTVASDHSVFYRCSISGYQDTLYALSLRQFYRECDISGTVDFIFGNAAAVF  315
             GP  HQAVAL V +D S+  RC I  YQDTLYA + RQF R+  I+GTVDFIFGNAA VF
Sbjct  341   GPEKHQAVALRVGADQSIINRCRIDAYQDTLYAHTNRQFSRDSFITGTVDFIFGNAAVVF  400

Query  314   QACNLVLRRPSS--YNVILANGRSDPGQNTGFSVQKCKITPGPDFSPVKNSYNSYLGRPW  141
             Q CN+V R+P S   N++ A GR DP QNTG S+Q+C +TP  D  PV  S  +YLGRPW
Sbjct  401   QKCNIVARKPMSNQKNMLTAQGREDPNQNTGTSIQQCNLTPSQDLKPVAGSIKTYLGRPW  460

Query  140   KPYSRAVVMESDIDGAISARGWIEWPGTSSSSVRELYFGEYANVGA  3
             K YSR +V++S ID  I   GW EW   S   ++ LY+GEY+N+GA
Sbjct  461   KKYSRTIVLQSSIDSHIDPTGWAEWDAQSKDFLQTLYYGEYSNIGA  506



>emb|CAA47810.1| pectinesterase [Pisum sativum]
Length=554

 Score =   331 bits (849),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 191/464 (41%), Positives = 271/464 (58%), Gaps = 21/464 (5%)
 Frame = -2

Query  1367  CGYTRFPRLCVQTLSGLVSGERVDFAAALLLNKTIAHADLHIAHFDQL--SSHFVSSQPP  1194
             C +    + C+  +S +V G+ +       L+  I+      +H  +   +++ +  +  
Sbjct  55    CEHAVDTKSCLTHVSEVVQGQALANTKDHKLSTLISLLTKSTSHIQKAMETANVIKRRVN  114

Query  1193  QPRLQ-AIGYCEELMGMARQRLNEALVAMKESPGKNRQEDIQTWLSAAVTFQQACKDWAD  1017
              PR + A+  CE+LM ++  R+ ++++ + ++   + Q+D  TWLS+ +T    C +   
Sbjct  115   SPREETALNDCEQLMDLSMDRVWDSVLTLTKN-NIDSQQDAHTWLSSVLTNHATCLNGL-  172

Query  1016  QYAFSDELFARISRSMDYQSQLASNALALVNRNTEISAAGRQLSEEdidddddggffpDW  837
                   E  +R+    D Q  ++    +L    + + A     S +   D+   G FP W
Sbjct  173   ------EGTSRVVMESDLQDLISRARSSLAVLVSVLPAK----SNDGFIDESLNGEFPSW  222

Query  836   VSGRDLRLLETTTDKTKANVVVAKDGTGNFRTVAEAIGAA--SGRQRFVIYVKSGVYKEK  663
             V+ +D RLLE+T    KANVVVAKDG+G F+TVAEA+ +A  +G+ R+VIYVK G YKEK
Sbjct  223   VTSKDRRLLESTVGDIKANVVVAKDGSGKFKTVAEAVASAPDNGKARYVIYVKRGTYKEK  282

Query  662   IR--SSKDGITLIGDGKYSTIITWDDSVGGGSSLTGSATFGITGDGFIAKDIGFQNTAGP  489
             +     K  + L+GDG  +TIIT + +   G++   SAT    GDGFIA+DIGFQNTAGP
Sbjct  283   VEIGKKKTNVMLVGDGMDATIITGNLNFIDGTTTFNSATVAAVGDGFIAQDIGFQNTAGP  342

Query  488   GAHQAVALTVASDHSVFYRCSISGYQDTLYALSLRQFYRECDISGTVDFIFGNAAAVFQA  309
               HQAVAL V +D SV  RC I  +QDTLYA S RQFYR+  I+GTVDFIFGNA  VFQ 
Sbjct  343   EKHQAVALRVGADQSVINRCKIDAFQDTLYAHSNRQFYRDSFITGTVDFIFGNAGVVFQK  402

Query  308   CNLVLRRPSS--YNVILANGRSDPGQNTGFSVQKCKITPGPDFSPVKNSYNSYLGRPWKP  135
               LV R+P S   N++ A GR DP QNT  S+Q+C + P  D  PV+ S  +YLGRPWK 
Sbjct  403   SKLVARKPMSNQKNMVTAQGREDPNQNTATSIQQCNVIPSSDLKPVQGSIKTYLGRPWKK  462

Query  134   YSRAVVMESDIDGAISARGWIEWPGTSSSSVRELYFGEYANVGA  3
             YSR VV++S +D  I   GW EW   S   ++ LY+GEY N GA
Sbjct  463   YSRTVVLQSVVDSHIDPAGWAEWDAASKDFLQTLYYGEYLNSGA  506



>ref|XP_007157172.1| hypothetical protein PHAVU_002G048700g [Phaseolus vulgaris]
 gb|ESW29166.1| hypothetical protein PHAVU_002G048700g [Phaseolus vulgaris]
Length=549

 Score =   331 bits (848),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 193/408 (47%), Positives = 247/408 (61%), Gaps = 29/408 (7%)
 Frame = -2

Query  1190  PRLQA-IGYCEELMGMARQRLNEALVAMKESPGKNRQEDIQTWLSAAVTFQQACKDW---  1023
             PR +A +  C ELM ++  R+  +++A+ E   ++RQ D  TWLS+ +T    C D    
Sbjct  111   PREEAALRDCAELMDLSLDRVWSSMLAVTEQSIESRQ-DAHTWLSSVLTNHATCLDGLEG  169

Query  1022  ADQYAFSDELFARISRSMDYQSQLASNALALVNRNTEISAAGRQLSE--Edidddddggf  849
             A +     E+   ISR        A  +LA++         G  L    E+I D+   G 
Sbjct  170   ASRSVMEGEVEDLISR--------ARTSLAIL--------VGSVLPPKVEEIIDEPLNGE  213

Query  848   fpDWVSGRDLRLLETTTDKTKANVVVAKDGTGNFRTVAEAIGAA--SGRQRFVIYVKSGV  675
             FP WVS +D RLLE+     KANVVVAKDG+G F+TV EA+ +A  +G+ R+VIYVK G 
Sbjct  214   FPSWVSSKDRRLLESGVGDIKANVVVAKDGSGKFKTVTEAVASAPDNGKTRYVIYVKKGT  273

Query  674   YKEKIR--SSKDGITLIGDGKYSTIITWDDSVGGGSSLTGSATFGITGDGFIAKDIGFQN  501
             YKE +     K  + L+GDG  +TIIT   +   G++   SAT    GDGFI +DI FQN
Sbjct  274   YKENVEIGKKKKNVMLVGDGMDATIITGSLNFIDGTTTFNSATVAAVGDGFIGQDIWFQN  333

Query  500   TAGPGAHQAVALTVASDHSVFYRCSISGYQDTLYALSLRQFYRECDISGTVDFIFGNAAA  321
             TAGP  HQAVAL V +D SV  RC I  +QDTLYA S RQFYR+  I+GTVDFIFGNAA 
Sbjct  334   TAGPEKHQAVALRVGADQSVINRCRIDAFQDTLYAHSNRQFYRDSFITGTVDFIFGNAAV  393

Query  320   VFQACNLVLRRPSS--YNVILANGRSDPGQNTGFSVQKCKITPGPDFSPVKNSYNSYLGR  147
             VFQ CNLV R+P S   N++ A GR DP QNTG S+Q+C +TP  D  PV  S  ++LGR
Sbjct  394   VFQKCNLVARKPMSNQKNMVTAQGREDPNQNTGTSIQQCNLTPSSDLKPVVGSIKTFLGR  453

Query  146   PWKPYSRAVVMESDIDGAISARGWIEWPGTSSSSVRELYFGEYANVGA  3
             PWK YSR VVM+S ID  +   GW EW   S   ++ LY+GEY N GA
Sbjct  454   PWKKYSRTVVMQSTIDNHVDPTGWAEWDAQSKDFLQTLYYGEYMNSGA  501



>dbj|BAC67661.1| pectin methylesterase [Pisum sativum]
Length=554

 Score =   331 bits (848),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 191/464 (41%), Positives = 271/464 (58%), Gaps = 21/464 (5%)
 Frame = -2

Query  1367  CGYTRFPRLCVQTLSGLVSGERVDFAAALLLNKTIAHADLHIAHFDQL--SSHFVSSQPP  1194
             C +    + C+  +S +V G+ +       L+  I+      +H  +   +++ +  +  
Sbjct  55    CEHAVDTKSCLTHVSEVVQGQALANTKDHKLSTLISLLTKSTSHIQKAMETANVIKRRVN  114

Query  1193  QPRLQ-AIGYCEELMGMARQRLNEALVAMKESPGKNRQEDIQTWLSAAVTFQQACKDWAD  1017
              PR + A+  CE+LM ++  R+ ++++ + ++   + Q+D  TWLS+ +T    C +   
Sbjct  115   SPREETALNDCEQLMDLSMDRVWDSVLTLTKN-NIDSQQDAHTWLSSVLTNHATCLNGL-  172

Query  1016  QYAFSDELFARISRSMDYQSQLASNALALVNRNTEISAAGRQLSEEdidddddggffpDW  837
                   E  +R+    D Q  ++    +L    + + A     S +   D+   G FP W
Sbjct  173   ------EGTSRVVMEGDLQDLISRARSSLAVLVSVLPAK----SNDGFIDESLNGEFPSW  222

Query  836   VSGRDLRLLETTTDKTKANVVVAKDGTGNFRTVAEAIGAA--SGRQRFVIYVKSGVYKEK  663
             V+ +D RLLE+T    KANVVVAKDG+G F+TVAEA+ +A  +G+ R+VIYVK G YKEK
Sbjct  223   VTSKDRRLLESTVGDIKANVVVAKDGSGKFKTVAEAVASAPDNGKARYVIYVKRGTYKEK  282

Query  662   IR--SSKDGITLIGDGKYSTIITWDDSVGGGSSLTGSATFGITGDGFIAKDIGFQNTAGP  489
             +     K  + L+GDG  +TIIT + +   G++   SAT    GDGFIA+DIGFQNTAGP
Sbjct  283   VEIGKKKTNVMLVGDGMDATIITGNLNFIDGTTTFNSATVAAVGDGFIAQDIGFQNTAGP  342

Query  488   GAHQAVALTVASDHSVFYRCSISGYQDTLYALSLRQFYRECDISGTVDFIFGNAAAVFQA  309
               HQAVAL V +D SV  RC I  +QDTLYA S RQFYR+  I+GTVDFIFGNA  VFQ 
Sbjct  343   EKHQAVALRVGADQSVINRCKIDAFQDTLYAHSNRQFYRDSFITGTVDFIFGNAGVVFQK  402

Query  308   CNLVLRRPSS--YNVILANGRSDPGQNTGFSVQKCKITPGPDFSPVKNSYNSYLGRPWKP  135
               LV R+P S   N++ A GR DP QNT  S+Q+C + P  D  PV+ S  +YLGRPWK 
Sbjct  403   SKLVARKPMSNQKNMVTAQGREDPNQNTATSIQQCNVIPSSDLKPVQGSIKTYLGRPWKK  462

Query  134   YSRAVVMESDIDGAISARGWIEWPGTSSSSVRELYFGEYANVGA  3
             YSR VV++S +D  I   GW EW   S   ++ LY+GEY N GA
Sbjct  463   YSRTVVLQSVVDSHIDPAGWAEWDAASKDFLQTLYYGEYLNSGA  506



>ref|XP_008232606.1| PREDICTED: pectinesterase 2 [Prunus mume]
Length=511

 Score =   329 bits (844),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 201/471 (43%), Positives = 274/471 (58%), Gaps = 44/471 (9%)
 Frame = -2

Query  1385  DQIRIQCGYTRFPRLCVQTLSGLVS----GERVDF---AAALLLNKTIAHADLHIAHFDQ  1227
             + ++  C  T  P+LC   LS   +     E+  F   +  L L++ I HA  ++     
Sbjct  25    NDVKTWCTQTPHPKLCKDFLSHNPTTTPIKEKSQFFKISTQLALDRAI-HAQTNMY---S  80

Query  1226  LSSHFVSSQPPQPRLQAIGYCEELMGMARQRLNEALVAMKESPGKNRQEDIQTWLSAAVT  1047
             L S F ++        A   C EL     Q+LN+ +  +     K  Q+D QTWLS A+T
Sbjct  81    LGSKFQNAH----EKTAWDDCHELFDFTIQKLNKTVNPIT----KCTQDDSQTWLSTALT  132

Query  1046  FQQACKD-WADQYAFSDELFARISRSMDYQSQLASNALALVNRNTEISAAGRQLSEEdid  870
               + C++ +AD    ++ +F  +S ++   S L SN LA +N+    S    +       
Sbjct  133   NLETCREGFADLGVSNNYIFPSMSNNV---SNLISNTLA-INKAPFTSQPNYK-------  181

Query  869   ddddggffpDWVSGRDLRLLETTTDKTKANVVVAKDGTGNFRTVAEAIGAASGRQ---RF  699
                    FP WV   D +LL++++   KA+VVVAKDG+GN++T++EA+ AAS R+   R+
Sbjct  182   -----NGFPTWVKPGDRKLLQSSS--AKADVVVAKDGSGNYKTISEAVSAASKRKGSARY  234

Query  698   VIYVKSGVYKEKIRSSKDGITLIGDGKYSTIITWDDSVGGGSSLTGSATFGITGDGFIAK  519
             VIYVK+G YKE ++     I L GDG   TIIT   SVGGGS+   SAT  + GDGFIA+
Sbjct  235   VIYVKAGTYKENVQIKSKNIMLRGDGIGKTIITGSKSVGGGSTTFNSATVAVVGDGFIAQ  294

Query  518   DIGFQNTAGPGAHQAVALTVASDHSVFYRCSISGYQDTLYALSLRQFYRECDISGTVDFI  339
             DI FQNTAGP + QAVAL   SD SVFY+C   G QDTLY  S RQFYRECDI GTVDFI
Sbjct  295   DITFQNTAGPTSGQAVALRSGSDLSVFYKCGFEGNQDTLYVHSDRQFYRECDIYGTVDFI  354

Query  338   FGNAAAVFQACNLVLRRPSSYNVILANGRSDPGQNTGFSVQKCKITPGPDFSPVKNSYNS  159
             FGNAA V Q CN+ +    + N + A GRSDP QNTG S+  CK+T   D   V++S  +
Sbjct  355   FGNAAVVLQNCNIYVHNHKT-NTVTAQGRSDPNQNTGISIHNCKVTAASDLKSVQSSVKT  413

Query  158   YLGRPWKPYSRAVVMESDIDGAISARGWIEWPGTSSSSVRELYFGEYANVG  6
             YLGRPW+ YSR V M++ +D  I   GW+EW G  + +++ LY+GEY N G
Sbjct  414   YLGRPWREYSRTVFMKTYLDSLIDPAGWMEWSG--NFALKTLYYGEYMNTG  462



>ref|XP_009385345.1| PREDICTED: pectinesterase-like [Musa acuminata subsp. malaccensis]
Length=522

 Score =   329 bits (844),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 201/476 (42%), Positives = 268/476 (56%), Gaps = 48/476 (10%)
 Frame = -2

Query  1373  IQCGYTRFPRLCVQTLSGL---VSGERVDFAAALLLNKTIAHADLHIAHFDQLSSHFVSS  1203
             + C  T +P++C   +SG+      E       LLL  T+    L   H    +S    +
Sbjct  28    LSCSQTPYPQVCSSMVSGVPLFAQSETQSGFRDLLLQTTLDRTLLAHKH----ASAMNLA  83

Query  1202  QPPQPRLQAIGYCEELMGMARQRLNEALVAMKESPGKNRQEDIQTWLSAAVTFQQACK--  1029
                +P   A   C EL       LN +L         +  ED QTWLSAA+  QQ CK  
Sbjct  84    PLDEPAKAAWADCLELFEDTIGHLNRSL------GHSSSAEDAQTWLSAAMANQQTCKNG  137

Query  1028  --DWADQYAFSDELFA--RISRSMDYQSQLASNALALVNRNTEISAAG--RQLSEEdidd  867
               +    + F+  LF    IS S+       SN+LA+ N      A G  R LS+     
Sbjct  138   FAELGTSFLFTSSLFMANNISESL-------SNSLAVNNAMPRGKAPGNRRLLSQ-----  185

Query  866   dddggffpDWVSGRDLRLLETTTDKTKANVVVAKDGTGNFRTVAEAIGAA----SGRQRF  699
                   FP WV   D +LL++++   KAN+VVAKDG+G+++T++EA+ A+    SG  RF
Sbjct  186   -----GFPGWVKAADRKLLQSSSSTIKANLVVAKDGSGDYKTISEAVAASAKLRSGTSRF  240

Query  698   VIYVKSGVYKEK--IRSSKDGITLIGDGKYSTIITWDDSVGGGSSLTGSATFGITGDGFI  525
             VI VKSG+Y E   I +S   I +IGDG  +T++T   +V  GS+   SATF ++G GFI
Sbjct  241   VILVKSGIYNENVVITNSMKNIMMIGDGMDATVVTGSKNVQDGSTTFRSATFAVSGGGFI  300

Query  524   AKDIGFQNTAGPGAHQAVALTVASDHSVFYRCSISGYQDTLYALSLRQFYRECDISGTVD  345
             A+D+ FQNTAGP  HQAVAL   SD SVFYRCS  GYQDTLY  S RQFYR CDI GTVD
Sbjct  301   ARDMTFQNTAGPQKHQAVALRSGSDLSVFYRCSFKGYQDTLYVYSQRQFYRNCDIYGTVD  360

Query  344   FIFGNAAAVFQACNLVLRRPSS--YNVILANGRSDPGQNTGFSVQKCKITPGPDFSPVKN  171
             FIFG+A  VFQ+CN+ +R+P S   N + A GR+D  +NTG S+    +T   D  PV+ 
Sbjct  361   FIFGDAVVVFQSCNIYVRKPMSGQQNTVTAQGRTDHNENTGISIHNSIVTAASDLRPVQG  420

Query  170   SYNSYLGRPWKPYSRAVVMESDIDGAISARGWIEWPGTSSSSVRELYFGEYANVGA  3
             S+ +YLGRPW+ YSR V M++ +D  I+  GW+EW G  S  +  LY+ EY N GA
Sbjct  421   SFKTYLGRPWQKYSRTVFMKTSLDSLINPAGWLEWSG--SFGLSTLYYAEYMNTGA  474



>gb|AAC14742.1| pectin methylesterase [Pisum sativum]
 gb|AAC32273.1| pectin methylesterase [Pisum sativum]
Length=554

 Score =   330 bits (847),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 190/464 (41%), Positives = 271/464 (58%), Gaps = 21/464 (5%)
 Frame = -2

Query  1367  CGYTRFPRLCVQTLSGLVSGERVDFAAALLLNKTIAHADLHIAHFDQL--SSHFVSSQPP  1194
             C +    + C+  +S +V G+ +       L+  I+      +H  +   +++ +  +  
Sbjct  55    CEHAVDTKSCLTHVSEVVQGQALANTKDHKLSTLISLLTKSTSHIQKAMETANVIKRRVN  114

Query  1193  QPRLQ-AIGYCEELMGMARQRLNEALVAMKESPGKNRQEDIQTWLSAAVTFQQACKDWAD  1017
              P+ + A+  CE+LM ++  R+ ++++ + ++   + Q+D  TWLS+ +T    C +   
Sbjct  115   SPKKETALNDCEQLMDLSMDRVWDSVLTLTKN-NIDSQQDAHTWLSSVLTNHATCLNGL-  172

Query  1016  QYAFSDELFARISRSMDYQSQLASNALALVNRNTEISAAGRQLSEEdidddddggffpDW  837
                   E  +R+    D Q  ++    +L    + + A     S +   D+   G FP W
Sbjct  173   ------EGTSRVVMESDLQDLISRARSSLAVLVSVLPAK----SNDGFIDESLNGEFPSW  222

Query  836   VSGRDLRLLETTTDKTKANVVVAKDGTGNFRTVAEAIGAA--SGRQRFVIYVKSGVYKEK  663
             V+ +D RLLE+T    KANVVVAKDG+G F+TVAEA+ +A  +G+ R+VIYVK G YKEK
Sbjct  223   VTSKDRRLLESTVGDIKANVVVAKDGSGKFKTVAEAVASAPDNGKARYVIYVKRGTYKEK  282

Query  662   IR--SSKDGITLIGDGKYSTIITWDDSVGGGSSLTGSATFGITGDGFIAKDIGFQNTAGP  489
             +     K  + L+GDG  +TIIT + +   G++   SAT    GDGFIA+DIGFQNTAGP
Sbjct  283   VEIGKKKTNVMLVGDGMDATIITGNLNFIDGTTTFNSATVAAVGDGFIAQDIGFQNTAGP  342

Query  488   GAHQAVALTVASDHSVFYRCSISGYQDTLYALSLRQFYRECDISGTVDFIFGNAAAVFQA  309
               HQAVAL V +D SV  RC I  +QDTLYA S RQFYR+  I+GTVDFIFGNA  VFQ 
Sbjct  343   EKHQAVALRVGADQSVINRCKIDAFQDTLYAHSNRQFYRDSFITGTVDFIFGNAGVVFQK  402

Query  308   CNLVLRRPSS--YNVILANGRSDPGQNTGFSVQKCKITPGPDFSPVKNSYNSYLGRPWKP  135
               LV R+P S   N++ A GR DP QNT  S+Q+C + P  D  PV+ S  +YLGRPWK 
Sbjct  403   SKLVARKPMSNQKNMVTAQGREDPNQNTATSIQQCNVIPSSDLKPVQGSIKTYLGRPWKK  462

Query  134   YSRAVVMESDIDGAISARGWIEWPGTSSSSVRELYFGEYANVGA  3
             YSR VV++S +D  I   GW EW   S   ++ LY+GEY N GA
Sbjct  463   YSRTVVLQSVVDSHIDPAGWAEWDAASKDFLQTLYYGEYLNSGA  506



>ref|XP_010271283.1| PREDICTED: pectinesterase [Nelumbo nucifera]
Length=531

 Score =   329 bits (844),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 176/391 (45%), Positives = 242/391 (62%), Gaps = 11/391 (3%)
 Frame = -2

Query  1166  CEELMGMARQRLNEALVAMKESPGKNRQEDIQTWLSAAVTFQQACKDWADQYAFSDELFA  987
             C EL      +LN  + + K      R  D QTWLSAA+T QQ C++   +   S  L  
Sbjct  100   CVELYADTITQLNRTMGSNKNPL---RWSDAQTWLSAAITNQQTCQNGFTELNLSSYLSN  156

Query  986   RISRSMDYQSQLASNALALVNRNTEISAAGRQLSEEdidddddggffpDWVSGRDLRLLE  807
                  +   S++ SN+LA+       S+    + ++  +       FP WVS  D +LL+
Sbjct  157   SFPFMLSNFSKMISNSLAI--NKAAASSVASLMGKQGGNRRLLSDGFPTWVSAADRKLLQ  214

Query  806   TTTDKTKANVVVAKDGTGNFRTVAEAIGAASGR--QRFVIYVKSGVYKEKIRSSKDGITL  633
             +++  ++A+VVVA DG+GN+RT+++A+ A+S R  +RFVIYVK GVYKE +      I L
Sbjct  215   SSSAASQADVVVAADGSGNYRTISQAVAASSKRSGKRFVIYVKRGVYKENVEIKASNIML  274

Query  632   IGDGKYSTIITWDDSVGGGSSLTGSATFGITGDGFIAKDIGFQNTAGPGAHQAVALTVAS  453
             IGDG  +TI+T   +V  GS+   SAT  +T D F+A+D+ F+NTAGP  HQAVAL   S
Sbjct  275   IGDGIDATIVTGSKNVQDGSTTFRSATVAVTRDRFMARDMTFENTAGPQKHQAVALRSGS  334

Query  452   DHSVFYRCSISGYQDTLYALSLRQFYRECDISGTVDFIFGNAAAVFQACNLVLRRPSS--  279
             D SVFYRCS  GYQDTLY  S RQFYR+CDI GTVDFIFG+A AV Q CN+ +R+P S  
Sbjct  335   DLSVFYRCSFKGYQDTLYVYSQRQFYRDCDIYGTVDFIFGDAVAVLQNCNIYVRKPMSGQ  394

Query  278   YNVILANGRSDPGQNTGFSVQKCKITPGPDFSPVKNSYNSYLGRPWKPYSRAVVMESDID  99
              N + A GR+DP +NTG S+   ++T   D  P++ S+ +YLGRPW+ YSR V M++ +D
Sbjct  395   RNTLTAQGRTDPNENTGISIHNSRVTAASDLRPLQGSFKTYLGRPWQKYSRTVFMKTSLD  454

Query  98    GAISARGWIEWPGTSSSSVRELYFGEYANVG  6
               I   GW+EW G  S ++  LY+GEY N G
Sbjct  455   SLIDPDGWLEWSG--SFALSTLYYGEYMNTG  483



>ref|XP_010271268.1| PREDICTED: pectinesterase-like [Nelumbo nucifera]
Length=529

 Score =   328 bits (841),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 178/392 (45%), Positives = 240/392 (61%), Gaps = 13/392 (3%)
 Frame = -2

Query  1166  CEELMGMARQRLNEALVAMKESPGKNRQEDIQTWLSAAVTFQQACKDWADQYAFSDELFA  987
             C EL      +LN  +     S       D QTWLSAA+T +Q C++   +      L +
Sbjct  100   CVELYADTVTQLNRTM----GSKNPLSWSDAQTWLSAAITNEQTCQNGFTELNLPSYL-S  154

Query  986   RISRSMDYQSQLASNALALVNRNTEISAAGRQLSEEdidddddggffpDWVSGRDLRLLE  807
                  +   S++ SN+LA+       S+    + ++  +       FP WVS  D +LL+
Sbjct  155   SFPFMLSNFSKMVSNSLAI--NKAAASSVASLMGKQGGNRRLLSDGFPTWVSAADRKLLQ  212

Query  806   TTTDKTKANVVVAKDGTGNFRTVAEAIGAASGR--QRFVIYVKSGVYKEKIRSSKDGITL  633
             +++  ++A+VVVA DG+GN+RT+++A+ A+S R  +RFVIYVK GVYKE +      I L
Sbjct  213   SSSAASQADVVVAADGSGNYRTISQAVAASSKRSGKRFVIYVKRGVYKENVEIKASNIML  272

Query  632   IGDGKYSTIITWDDSVGGGSSLTGSATFGITGDGFIAKDIGFQNTAGPGAHQAVALTVAS  453
             IGDG  +TI+T   +V  GS+   SAT  +TG GFIA+D+ FQNTAGP  HQAVAL   S
Sbjct  273   IGDGIDATIVTGSKNVQDGSTTFRSATVAVTGGGFIARDMTFQNTAGPQKHQAVALRSGS  332

Query  452   DHSVFYRCSISGYQDTLYALSLRQFYRECDISGTVDFIFGNAAAVFQACNLVLRRPSS--  279
             D SVFYRCS  GYQDTLY  S RQFYR+CDI GTVDFIFG+A AV Q CN+ +R+P S  
Sbjct  333   DLSVFYRCSFKGYQDTLYVYSQRQFYRDCDIYGTVDFIFGDAVAVLQNCNIYVRKPMSGQ  392

Query  278   YNVILANGRSDPGQNTGFSVQKCKITPGPDFSPVKNSYNSYLGRPWKPYSRAVVMESDID  99
              N + A GR DP +NTG S+   ++T   D  PV+ S+ +YLGRPW+ YSR V M++ +D
Sbjct  393   KNTVTAQGRKDPNENTGISIHNSRVTAASDLRPVQGSFKTYLGRPWQKYSRTVFMKTSLD  452

Query  98    GAISARGWIEWPGTSSSSVRELYFGEYANVGA  3
               I   GW+EW G  + S   LY+GEY N GA
Sbjct  453   SLIDPAGWLEWSGNFALST--LYYGEYMNTGA  482



>ref|XP_007220661.1| hypothetical protein PRUPE_ppa004413mg [Prunus persica]
 gb|EMJ21860.1| hypothetical protein PRUPE_ppa004413mg [Prunus persica]
Length=511

 Score =   327 bits (838),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 200/472 (42%), Positives = 270/472 (57%), Gaps = 46/472 (10%)
 Frame = -2

Query  1385  DQIRIQCGYTRFPRLCVQTLSGLVS----GERVDF---AAALLLNKTI-AHADLHIAHFD  1230
             + ++  C  T  P+LC   LS   +     E+  F   +  L L++ I A  ++H     
Sbjct  25    NDVKTWCSQTPHPKLCEDFLSHNPTTTPIKEKSQFFKISTQLALDRAIHAQTNMH-----  79

Query  1229  QLSSHFVSSQPPQPRLQAIGYCEELMGMARQRLNEALVAMKESPGKNRQEDIQTWLSAAV  1050
              L S F ++        A   C EL     Q+LN  +        K  Q D QTWLS A+
Sbjct  80    SLGSKFQNAH----EKTAWADCLELFDFTIQKLNRTV----NPSTKCTQYDKQTWLSTAL  131

Query  1049  TFQQACKD-WADQYAFSDELFARISRSMDYQSQLASNALALVNRNTEISAAGRQLSEEdi  873
             T  + C++ +AD    ++ +F  +S ++   S L SN LA +N+         +      
Sbjct  132   TNLETCREGFADLGVSNNYIFPSVSNNV---SNLISNTLA-INKAPYTPQPNHK------  181

Query  872   dddddggffpDWVSGRDLRLLETTTDKTKANVVVAKDGTGNFRTVAEAIGAASGRQ---R  702
                     FP WV   D +LL++++    A+VVVAKDG+GN++T++EA+ AAS R+   R
Sbjct  182   ------NGFPTWVKPGDRKLLQSSSPT--ADVVVAKDGSGNYKTISEAVSAASKRKGSAR  233

Query  701   FVIYVKSGVYKEKIRSSKDGITLIGDGKYSTIITWDDSVGGGSSLTGSATFGITGDGFIA  522
             +VIYVK+G YKE ++     I L GDG   TIIT   SVGGGS+   SAT  + GDGFIA
Sbjct  234   YVIYVKAGTYKENVQIKSKNIMLRGDGIGKTIITGSKSVGGGSTTFNSATVAVVGDGFIA  293

Query  521   KDIGFQNTAGPGAHQAVALTVASDHSVFYRCSISGYQDTLYALSLRQFYRECDISGTVDF  342
             +DI FQNTAGP + QAVAL   SD SVFY+C   G QDTLY  S RQFYRECDI GTVDF
Sbjct  294   QDITFQNTAGPTSGQAVALRSGSDLSVFYKCGFEGNQDTLYVYSDRQFYRECDIYGTVDF  353

Query  341   IFGNAAAVFQACNLVLRRPSSYNVILANGRSDPGQNTGFSVQKCKITPGPDFSPVKNSYN  162
             IFGNAA VFQ CN+ +    + N I A GRSDP QNTG S+  C++T   D   V++S  
Sbjct  354   IFGNAAVVFQNCNIYVHNHKT-NTITAQGRSDPNQNTGISIHNCRVTAASDLKSVQSSVK  412

Query  161   SYLGRPWKPYSRAVVMESDIDGAISARGWIEWPGTSSSSVRELYFGEYANVG  6
             +YLGRPW+ YSR V M++ +D  I   GW+EW G  + +++ LY+GEY N G
Sbjct  413   TYLGRPWREYSRTVFMKTYLDSLIDPAGWMEWSG--NFALKTLYYGEYMNTG  462



>ref|XP_002511679.1| Pectinesterase-2 precursor, putative [Ricinus communis]
 gb|EEF50348.1| Pectinesterase-2 precursor, putative [Ricinus communis]
Length=514

 Score =   327 bits (839),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 183/393 (47%), Positives = 240/393 (61%), Gaps = 31/393 (8%)
 Frame = -2

Query  1166  CEELMGMARQRLNEALVAMKESPGKNRQEDIQTWLSAAVTFQQACKDWADQYAFSDELFA  987
             C EL   A   LN    +      K  + D QTWLS A+T  + C+    +   SD +  
Sbjct  98    CLELYEYAVLWLNHTTTS------KCTKYDAQTWLSTALTNLETCRTGFMELGVSDYVLP  151

Query  986   RISRSMDYQSQLASNALALVNRNTEISAAGRQLSEEdidddddggffpDWVSGRDLRLLE  807
              +S ++   S+L SN LA+ N   E              +    G FP WV   D +LL+
Sbjct  152   LMSNNV---SKLISNTLAINNVPYE--------------EPTYKGGFPTWVKPGDRKLLQ  194

Query  806   TTTDKTKANVVVAKDGTGNFRTVAEAIGAASGRQ---RFVIYVKSGVYKEKIR--SSKDG  642
             TTT  ++AN+VVAKDG+GNF+T+ EA+ AAS R    RF+IYVK+GVY E +   +    
Sbjct  195   TTTPASQANIVVAKDGSGNFKTINEAVAAASKRSGSGRFIIYVKAGVYNENVEIGTKLKN  254

Query  641   ITLIGDGKYSTIITWDDSVGGGSSLTGSATFGITGDGFIAKDIGFQNTAGPGAHQAVALT  462
             +  +GDG   TI+T   SVGGG++   SATF + G+GFIA+D+ F+NTAGP  HQAVAL 
Sbjct  255   LMFVGDGIGKTIVTGSKSVGGGATTFRSATFAVVGEGFIARDMTFRNTAGPENHQAVALR  314

Query  461   VASDHSVFYRCSISGYQDTLYALSLRQFYRECDISGTVDFIFGNAAAVFQACNLVLRRPS  282
               +D SVFY+CS  GYQDTLY  S RQFYRECDI GTVDFIFGNAA V Q CN+  R P 
Sbjct  315   SGADLSVFYKCSFEGYQDTLYVHSQRQFYRECDIYGTVDFIFGNAAVVLQNCNIFARNPP  374

Query  281   S-YNVILANGRSDPGQNTGFSVQKCKITPGPDFSPVKNSYNSYLGRPWKPYSRAVVMESD  105
             +  N + A GR+DP QNTG S+   ++T   D SPV++S  +YLGRPWK YSR V M++ 
Sbjct  375   NRTNTLTAQGRTDPNQNTGISIHNSRVTAASDLSPVQSSVRTYLGRPWKEYSRTVFMKTF  434

Query  104   IDGAISARGWIEWPGTSSSSVRELYFGEYANVG  6
             +D  I+  GW+EW G  + ++  LY+GEY N G
Sbjct  435   LDSLINPAGWMEWSG--NFALDTLYYGEYMNTG  465



>ref|XP_010544633.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 17 
[Tarenaya hassleriana]
Length=513

 Score =   327 bits (838),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 188/391 (48%), Positives = 235/391 (60%), Gaps = 28/391 (7%)
 Frame = -2

Query  1166  CEELMGMARQRLNEALVAMKESPGKNRQEDIQTWLSAAVTFQQACKDWADQYAFSDELFA  987
             C +L      +LNE +    +   K  + D QTWLS+A+T  + C+    +    D L  
Sbjct  98    CLKLYDYTVSKLNETV----DPYVKCSKVDAQTWLSSALTNLETCRTGFIELGVPDFLLP  153

Query  986   RISRSMDYQSQLASNALALVNRNTEISAAGRQLSEEdidddddggffpDWVSGRDLRLLE  807
              +S ++   S+L SN LA+       + +      E             WV   D +LL+
Sbjct  154   LMSNNV---SKLISNTLAINKVPFNYTPSQENGFPE-------------WVRPGDRKLLQ  197

Query  806   TTTDKTKANVVVAKDGTGNFRTVAEAIGAASGRQ---RFVIYVKSGVYKEKIRSSKDGIT  636
             ++T +  ANVVVAKDG+GNFRT+ EA+ AAS R    RFVIYVK GVY E I      I 
Sbjct  198   SSTPQ--ANVVVAKDGSGNFRTIKEAVNAASRRSGSGRFVIYVKQGVYNENIEIRAKNIM  255

Query  635   LIGDGKYSTIITWDDSVGGGSSLTGSATFGITGDGFIAKDIGFQNTAGPGAHQAVALTVA  456
             L GDG   TIIT   SVGGGS+   SAT  + GDGFIA+ I F+NTAGP   QAVAL   
Sbjct  256   LRGDGIGKTIITGSKSVGGGSTTFNSATVAVVGDGFIARGITFRNTAGPNNGQAVALRSG  315

Query  455   SDHSVFYRCSISGYQDTLYALSLRQFYRECDISGTVDFIFGNAAAVFQACNLVLRRP-SS  279
             SD SVFY+CS  GYQDTLY  S RQFYREC+I GTVDFIFGNAAAVFQ CN+  RRP + 
Sbjct  316   SDLSVFYQCSFEGYQDTLYVHSNRQFYRECNIYGTVDFIFGNAAAVFQNCNIFARRPQNK  375

Query  278   YNVILANGRSDPGQNTGFSVQKCKITPGPDFSPVKNSYNSYLGRPWKPYSRAVVMESDID  99
              N + A GRSDP QNTG  +   +IT G D  PV  S  +YLGRPW+ YSR VVM++ +D
Sbjct  376   TNTVTAQGRSDPNQNTGIVIHNSRITAGSDLRPVLGSVKTYLGRPWRQYSRTVVMKTFLD  435

Query  98    GAISARGWIEWPGTSSSSVRELYFGEYANVG  6
             G I  RGW+EW G  + ++R L++ EY N G
Sbjct  436   GLIDPRGWLEWNG--NFALRTLFYAEYQNTG  464



>ref|XP_010056338.1| PREDICTED: pectinesterase 2-like [Eucalyptus grandis]
Length=515

 Score =   327 bits (838),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 185/422 (44%), Positives = 249/422 (59%), Gaps = 32/422 (8%)
 Frame = -2

Query  1250  LHIAHFDQLSSHFVSSQPPQPRLQAI-GYCEELMGMARQRLNEALVAMKESPGKNRQEDI  1074
             L  A      +H + S+    R +A    C +L      RLN  +        +  Q++ 
Sbjct  70    LERAQLAHDHTHSLESKCSNEREKAAWADCLQLYEHTVLRLNRTI------GHECTQDEA  123

Query  1073  QTWLSAAVTFQQACKDWADQYAFSDELFARISRSMDYQSQLASNALALVNRNTEISAAGR  894
             QTWLS A+T  + C+    +   SD +   +S ++   S+L SN LAL            
Sbjct  124   QTWLSTALTNLETCRAGFVELGISDNVLPLMSNNV---SKLISNTLAL------------  168

Query  893   QLSEEdidddddggffpDWVSGRDLRLLETTTDKTKANVVVAKDGTGNFRTVAEAIGAAS  714
               +       +    FP WV   D +LL++++  +KAN+VVA+DG+GN++T++EAI AAS
Sbjct  169   --NYAPFTTPNYTKKFPTWVRPSDRKLLQSSSAVSKANIVVARDGSGNYKTISEAITAAS  226

Query  713   ---GRQRFVIYVKSGVYKEKIR--SSKDGITLIGDGKYSTIITWDDSVGGGSSLTGSATF  549
                G  R++IY+K+G Y E I   S  D I  +GDG   TIIT   SVGGGS+   SAT 
Sbjct  227   KQTGAARYIIYIKAGTYNENIEVGSKLDNIMFVGDGIGKTIITGSKSVGGGSTTFKSATV  286

Query  548   GITGDGFIAKDIGFQNTAGPGAHQAVALTVASDHSVFYRCSISGYQDTLYALSLRQFYRE  369
              + GDGF+A+DI F+NTAG   HQAVAL   SD SVFYRCS  GYQDTLY  S RQFYRE
Sbjct  287   AVVGDGFVAQDITFRNTAGAANHQAVALRSGSDLSVFYRCSFEGYQDTLYVHSERQFYRE  346

Query  368   CDISGTVDFIFGNAAAVFQACNLVLRR-PSSYNVILANGRSDPGQNTGFSVQKCKITPGP  192
             CDI GTVDFIFGNAA VFQ CN+  R  P+  N + A GR+DP QNTG S+  CK+T   
Sbjct  347   CDIYGTVDFIFGNAAVVFQNCNIYARNPPNKVNTLTAQGRTDPNQNTGISIHNCKVTAAS  406

Query  191   DFSPVKNSYNSYLGRPWKPYSRAVVMESDIDGAISARGWIEWPGTSSSSVRELYFGEYAN  12
             D   +++S  +YLGRPWK YSR V M++ +D  +++ GW+EW G  + ++  LY+GEY N
Sbjct  407   DLKSIQSSVKTYLGRPWKQYSRTVFMKTYLDSLVNSAGWMEWDG--NFALDTLYYGEYVN  464

Query  11    VG  6
              G
Sbjct  465   TG  466



>ref|XP_010056337.1| PREDICTED: pectinesterase 2-like [Eucalyptus grandis]
Length=515

 Score =   327 bits (838),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 183/393 (47%), Positives = 238/393 (61%), Gaps = 31/393 (8%)
 Frame = -2

Query  1166  CEELMGMARQRLNEALVAMKESPGKNRQEDIQTWLSAAVTFQQACKDWADQYAFSDELFA  987
             C EL      RLN  +        K  QED+QTWLS A+T  + C+    +   SD +  
Sbjct  99    CLELYEQTILRLNRTVDL------KCTQEDVQTWLSTALTNLETCRTGFVELGVSDYVLP  152

Query  986   RISRSMDYQSQLASNALALVNRNTEISAAGRQLSEEdidddddggffpDWVSGRDLRLLE  807
              +S ++   ++L SN LAL              +            +P+WV   D +LL+
Sbjct  153   LMSNNV---TKLISNTLAL--------------NHVPYKPPSYTNGYPNWVRPGDRKLLQ  195

Query  806   TTTDKTKANVVVAKDGTGNFRTVAEAIGAAS---GRQRFVIYVKSGVYKEKIR--SSKDG  642
             +++  +KAN+VVAKDG+G ++T+ EAI AAS   G  R+VIYVK+G YKE I   S    
Sbjct  196   SSSPSSKANIVVAKDGSGKYKTIKEAITAASKRFGTARYVIYVKAGTYKENIEVGSKLKN  255

Query  641   ITLIGDGKYSTIITWDDSVGGGSSLTGSATFGITGDGFIAKDIGFQNTAGPGAHQAVALT  462
             I  +GDG   TIIT   SVGGGS+   SAT  + GDGFIA+DI F+NTAG   HQAVAL 
Sbjct  256   IMFVGDGIGKTIITGSRSVGGGSTTFKSATVAVVGDGFIARDITFRNTAGAANHQAVALR  315

Query  461   VASDHSVFYRCSISGYQDTLYALSLRQFYRECDISGTVDFIFGNAAAVFQACNLVLRR-P  285
               SD SVFY+CS  GYQDTLY  S RQFYREC+I GTVDFIFGNAA VFQ CN+  R  P
Sbjct  316   SGSDLSVFYKCSFEGYQDTLYVHSERQFYRECNIYGTVDFIFGNAAVVFQNCNIYPRNPP  375

Query  284   SSYNVILANGRSDPGQNTGFSVQKCKITPGPDFSPVKNSYNSYLGRPWKPYSRAVVMESD  105
             +  N I A GR+DP QNTG S+  C++T   +   V++S  +YLGRPWK YSR V M++ 
Sbjct  376   NKTNTITAQGRTDPNQNTGISIHNCRVTAASELKRVQSSVKTYLGRPWKEYSRTVFMKTY  435

Query  104   IDGAISARGWIEWPGTSSSSVRELYFGEYANVG  6
             +D  I+  GW+EW G  + +++ LY+GEY N G
Sbjct  436   LDSLINPAGWMEWNG--NFALKTLYYGEYMNTG  466



>ref|XP_010271269.1| PREDICTED: pectinesterase-like [Nelumbo nucifera]
Length=529

 Score =   327 bits (838),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 193/461 (42%), Positives = 272/461 (59%), Gaps = 20/461 (4%)
 Frame = -2

Query  1367  CGYTRFPRLCVQTLSG--LVSGERVDFA-AALLLNKTIAHADLHIAHFDQLSSHFVSSQP  1197
             C  T +P +C   +    L + +   F+     L  T+  A      +  +S+  VSS  
Sbjct  34    CSLTPYPEICESFMGSKPLATLDETQFSFRDAALGSTLDQAQ---RAYGLISAMDVSSFD  90

Query  1196  PQPRLQAIGYCEELMGMARQRLNEALVAMKESPGKNRQEDIQTWLSAAVTFQQACKDWAD  1017
              + R+ A   C EL      +LN AL     S       D QTWLSAA+T QQ C++   
Sbjct  91    EKARI-AWDDCVELYADTVTQLNRAL----GSKNPLSWSDAQTWLSAAITNQQTCQNGFI  145

Query  1016  QYAFSDELFARISRSMDYQSQLASNALALVNRNTEISAAGRQLSEEdidddddggffpDW  837
             +   S  L +     +   S++ SN+LA +N+    SAA   L ++  +       FP W
Sbjct  146   ELGKSSYL-SSFPFMLSNFSKMVSNSLA-INKEAASSAASL-LGKQGGNRRLLSDGFPTW  202

Query  836   VSGRDLRLLETTTDKTKANVVVAKDGTGNFRTVAEAIGAASGR--QRFVIYVKSGVYKEK  663
             VS  D +LL++ +  ++A+VVVA DG+GN++T+++A+ A+  R  +RFVIYVK GVY+E 
Sbjct  203   VSAADRKLLQSPSAASQADVVVAADGSGNYKTISQAVAASPKRSGKRFVIYVKRGVYREN  262

Query  662   IRSSKDGITLIGDGKYSTIITWDDSVGGGSSLTGSATFGITGDGFIAKDIGFQNTAGPGA  483
             +  +   I LIGDG  +T +T   +V  GS+   +AT  +TGDGFIA+D+ F+NTAGP  
Sbjct  263   VEITASNIMLIGDGIDATTVTGSKNVQDGSTTFRTATVAVTGDGFIARDMTFENTAGPQK  322

Query  482   HQAVALTVASDHSVFYRCSISGYQDTLYALSLRQFYRECDISGTVDFIFGNAAAVFQACN  303
             HQAV+L   SD SVFYRCS  GYQDTLY  S RQFYR+CDI GTVDFIFG+A AV Q CN
Sbjct  323   HQAVSLRSGSDLSVFYRCSFKGYQDTLYVYSQRQFYRDCDIYGTVDFIFGDAVAVLQNCN  382

Query  302   LVLRRPSS--YNVILANGRSDPGQNTGFSVQKCKITPGPDFSPVKNSYNSYLGRPWKPYS  129
             + +R+P S   N + A GR+DP +NTG S+   ++T   D  PV+ S+ +YLGRPW+ YS
Sbjct  383   IYVRKPMSGQQNTVTAQGRTDPNENTGISIHNSRVTAASDLRPVQGSFKTYLGRPWQKYS  442

Query  128   RAVVMESDIDGAISARGWIEWPGTSSSSVRELYFGEYANVG  6
             R V M++ +D  +   GW+EW G  + S   LY+GEY N+G
Sbjct  443   RTVFMKTSLDSLVDPAGWLEWSGNFALST--LYYGEYMNIG  481



>ref|XP_010271267.1| PREDICTED: pectinesterase-like [Nelumbo nucifera]
Length=526

 Score =   327 bits (837),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 193/464 (42%), Positives = 271/464 (58%), Gaps = 23/464 (5%)
 Frame = -2

Query  1367  CGYTRFPRLCVQTLSG-----LVSGERVDFAAA-LLLNKTIAHADLHIAHFDQLSSHFVS  1206
             CG T +P +C           L + +   F+     L  T+  A      +  +S+  VS
Sbjct  28    CGQTPYPEICESYFMSYSNKPLATLDETQFSLRDAALGSTLDQAQ---RAYGLISAMDVS  84

Query  1205  SQPPQPRLQAIGYCEELMGMARQRLNEALVAMKESPGKNRQEDIQTWLSAAVTFQQACKD  1026
             S   + ++ A   C EL      +LN A+     S       D QTWLSAA+T QQ C++
Sbjct  85    SFDEKAKM-AWADCVELYSDTVTQLNRAM----GSKNPLSWSDAQTWLSAAITNQQTCQN  139

Query  1025  WADQYAFSDELFARISRSMDYQSQLASNALALVNRNTEISAAGRQLSEEdidddddggff  846
                +   S  L +     +   S++ SN+LA +N+  + SAA   L ++  +       F
Sbjct  140   GFVELGKSSYL-SSFPFMLSNFSKMVSNSLA-INKEADSSAASL-LGKQGGNRRLLSDGF  196

Query  845   pDWVSGRDLRLLETTTDKTKANVVVAKDGTGNFRTVAEAIGAASGR--QRFVIYVKSGVY  672
             P WVS  D +LL++ +  ++A+VVVA DG+GN++T++EA+ A+S R  +RFVIYVK GVY
Sbjct  197   PTWVSAADRKLLQSPSAASQADVVVAADGSGNYKTISEAVAASSKRSGKRFVIYVKKGVY  256

Query  671   KEKIRSSKDGITLIGDGKYSTIITWDDSVGGGSSLTGSATFGITGDGFIAKDIGFQNTAG  492
             KE +      I LIGDG  +TI+T   +   GS+   +AT G+TGDGF+A+D+ F+NTAG
Sbjct  257   KENVEIKASNIMLIGDGIDATIVTDSKNAQDGSTTFRTATVGVTGDGFMARDMTFENTAG  316

Query  491   PGAHQAVALTVASDHSVFYRCSISGYQDTLYALSLRQFYRECDISGTVDFIFGNAAAVFQ  312
             P  HQAVAL   SD SVFY CS  GYQDTLY  S RQFYR+CDI GTVDFIFG+A AV Q
Sbjct  317   PQKHQAVALRSGSDLSVFYSCSFKGYQDTLYVYSQRQFYRDCDIYGTVDFIFGDAVAVLQ  376

Query  311   ACNLVLRRPSS--YNVILANGRSDPGQNTGFSVQKCKITPGPDFSPVKNSYNSYLGRPWK  138
              CN+ +R+P S   N + A GR+DP +NTG S+   ++T   D   V+ S+ +YLGRPW+
Sbjct  377   NCNIYVRKPMSGQKNTVTAQGRTDPNENTGISIHNSRVTAASDLRAVQGSFKTYLGRPWQ  436

Query  137   PYSRAVVMESDIDGAISARGWIEWPGTSSSSVRELYFGEYANVG  6
              YSR V M++ +D  +   GW+EW G    ++  LY+GEY N G
Sbjct  437   KYSRTVFMKTSLDSLVDRAGWLEWSG--KFALSSLYYGEYMNTG  478



>ref|XP_003517029.1| PREDICTED: pectinesterase 2-like [Glycine max]
 ref|XP_003517030.1| PREDICTED: pectinesterase 2-like [Glycine max]
Length=515

 Score =   326 bits (836),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 200/470 (43%), Positives = 267/470 (57%), Gaps = 39/470 (8%)
 Frame = -2

Query  1385  DQIRIQCGYTRFPRLCVQTLSGLVS------GERVDFAAALLLNKTIAHADLHIAHFDQL  1224
             +++++ C  T  P+ C   LS   +       ++ DF   L L+  +A       H + L
Sbjct  26    NEVKLWCNQTPNPQPCEYFLSNNPTYQYKPLKQKSDF---LKLSLQLAQERALKGHENTL  82

Query  1223  SSHFVSSQPPQPRLQ-AIGYCEELMGMARQRLNEALVAMKESPGKNRQEDIQTWLSAAVT  1047
             S   + S+   PR + A   C EL     ++LN+ L    +   K  Q D QTWLS A+T
Sbjct  83    S---LGSKCRNPRERVAWADCVELYEQTIRKLNQTL----KPNTKLSQVDAQTWLSTALT  135

Query  1046  FQQACKDWADQYAFSDELFARISRSMDYQSQLASNALALVNRNTEISAAGRQLSEEdidd  867
               + CK    +    D +   +S ++   ++L SN LAL              ++    +
Sbjct  136   NLETCKAGFYELGVQDYVLPLMSNNV---TKLLSNTLAL--------------NKVPYQE  178

Query  866   dddggffpDWVSGRDLRLLETTTDKTKANVVVAKDGTGNFRTVAEAIGAA--SGRQRFVI  693
                   FP WV   D +LL+ ++  ++ANVVVAKDG+G F TV+ AI AA  S   R+VI
Sbjct  179   PSYKEGFPTWVKPGDRKLLQASSPASRANVVVAKDGSGRFTTVSAAINAAPKSSSGRYVI  238

Query  692   YVKSGVYKEKIRSSKDGITLIGDGKYSTIITWDDSVGGGSSLTGSATFGITGDGFIAKDI  513
             YVK GVY E++      I L+GDG   TIIT   SVGGG++   SAT  + GDGFIA+ I
Sbjct  239   YVKGGVYDEQVEVKAKNIMLVGDGIGKTIITGSKSVGGGTTTFRSATVAVVGDGFIAQGI  298

Query  512   GFQNTAGPGAHQAVALTVASDHSVFYRCSISGYQDTLYALSLRQFYRECDISGTVDFIFG  333
              F+NTAG   HQAVAL   SD SVFY+CS  GYQDTLY  S RQFYREC+I GTVDFIFG
Sbjct  299   TFRNTAGAKNHQAVALRSGSDLSVFYKCSFEGYQDTLYVHSERQFYRECNIYGTVDFIFG  358

Query  332   NAAAVFQACNLVLRR-PSSYNVILANGRSDPGQNTGFSVQKCKITPGPDFSPVKNSYNSY  156
             NAA V Q CN+  R  P+  N I A GR+DP QNTG S+   ++T   D  PV+NS  +Y
Sbjct  359   NAAVVLQNCNIFARNPPNKVNTITAQGRTDPNQNTGISIHNSRVTAASDLRPVQNSVRTY  418

Query  155   LGRPWKPYSRAVVMESDIDGAISARGWIEWPGTSSSSVRELYFGEYANVG  6
             LGRPWK YSR V M++ +DG I+  GW+EW G  + ++  LY+GEY N G
Sbjct  419   LGRPWKQYSRTVFMKTYLDGLINPAGWMEWSG--NFALDTLYYGEYMNTG  466



>ref|XP_006838619.1| hypothetical protein AMTR_s00002p00230630 [Amborella trichopoda]
 gb|ERN01188.1| hypothetical protein AMTR_s00002p00230630 [Amborella trichopoda]
Length=520

 Score =   326 bits (835),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 183/395 (46%), Positives = 252/395 (64%), Gaps = 24/395 (6%)
 Frame = -2

Query  1166  CEELMGMARQRLNEALVAMKESPGKNRQEDIQTWLSAAVTFQQACKDWADQYAFSDELFA  987
             C EL       LN  L     SP +  + D QTWLSA++T  + C +         ++ A
Sbjct  93    CFELYKATIVHLNRTL----RSPTRT-ELDTQTWLSASLTNLETCTNGFIDLDVQAQIPA  147

Query  986   RISRSMDYQSQLASNALALVNRNTEISAAGRQLSEEdidddddggffpDWVSGRDLRLLE  807
             ++++++   SQL  NALA+   N   S+ G    +  ++       FP WVS  D R L+
Sbjct  148   KLAKNV---SQLICNALAI---NKPPSSNG---PKTRLNGRFLHDRFPGWVSVGDQRFLQ  198

Query  806   TTTDKTKANVVVAKDGTGNFRTVAEAIGAAS----GRQRFVIYVKSGVYKE--KIRSSKD  645
               T  ++AN+ VA DG+GN++T+ EA+  AS    G QRF+I+VK+GVY E  +I +S  
Sbjct  199   AKTLASQANLKVAADGSGNYKTIREALRVASNQISGTQRFIIHVKAGVYNENVQITNSMK  258

Query  644   GITLIGDGKYSTIITWDDSVGGGSSLTGSATFGITGDGFIAKDIGFQNTAGPGAHQAVAL  465
              +  +GDGK +TIIT   SV GGS+   SATF ++GD F+A+D+ F+NTAGP  HQAVAL
Sbjct  259   NLMFVGDGKGNTIITASRSVRGGSTTFSSATFAVSGDRFMARDMTFRNTAGPENHQAVAL  318

Query  464   TVASDHSVFYRCSISGYQDTLYALSLRQFYRECDISGTVDFIFGNAAAVFQACNLVLRRP  285
              V+SD + FYRCSI GYQDTL+A +LRQFYRECDI GTVDFIFGNA AVFQ CN+ +RRP
Sbjct  319   RVSSDFAAFYRCSIDGYQDTLHADTLRQFYRECDIYGTVDFIFGNAIAVFQNCNIFVRRP  378

Query  284   SSY--NVILANGRSDPGQNTGFSVQKCKITPGPDFSPVKNSYNSYLGRPWKPYSRAVVME  111
              S   N I A GRSDP QNTG S+   +I+  PD SPV+ S+ +YLGRPW+ ++R + ++
Sbjct  379   MSQQKNTITAQGRSDPNQNTGISIHNSRISAAPDLSPVQGSFATYLGRPWQKHARTIFLK  438

Query  110   SDIDGAISARGWIEWPGTSSSSVRELYFGEYANVG  6
               +D  I+  GW+EW  + + ++  LY+GEY N G
Sbjct  439   CFLDDLINPAGWLEW--SENFALSTLYYGEYRNTG  471



>ref|XP_006576426.1| PREDICTED: pectinesterase 2-like [Glycine max]
Length=517

 Score =   325 bits (832),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 194/470 (41%), Positives = 265/470 (56%), Gaps = 37/470 (8%)
 Frame = -2

Query  1385  DQIRIQCGYTRFPRLCVQTLSGLVS------GERVDFAAALLLNKTIAHADLHIAHFDQL  1224
             + +++ C  T  P+ C   LS   +       ++ DF   L L+  +A       H + L
Sbjct  26    NDVKLWCNQTPNPQPCEYFLSNNPTYQYKALKQKSDF---LKLSLQLAQERALKGHANTL  82

Query  1223  SSHFVSSQPPQPRLQ-AIGYCEELMGMARQRLNEALVAMKESPGKNRQEDIQTWLSAAVT  1047
             S   + S+   PR + A   C EL     ++LNE L     +  K  Q D QTWLS A+T
Sbjct  83    S---LGSKCRNPRERGAWADCVELYEQTIRKLNETLNPDPNT--KYSQVDAQTWLSTALT  137

Query  1046  FQQACKDWADQYAFSDELFARISRSMDYQSQLASNALALVNRNTEISAAGRQLSEEdidd  867
               + CK    +    D +   +S ++   ++L SN L+L     E  +      +     
Sbjct  138   NLETCKAGFYELGVQDYVLPLMSNNV---TKLLSNTLSLNKVEYEEPSYKEGFPK-----  189

Query  866   dddggffpDWVSGRDLRLLETTTDKTKANVVVAKDGTGNFRTVAEAIGAA--SGRQRFVI  693
                      WV   D +LL++++  ++ANVVVAKDG+G + TV+ A+ +A  + R R+VI
Sbjct  190   ---------WVKPDDRKLLQSSSPASRANVVVAKDGSGKYTTVSAAVNSAPKNSRGRYVI  240

Query  692   YVKSGVYKEKIRSSKDGITLIGDGKYSTIITWDDSVGGGSSLTGSATFGITGDGFIAKDI  513
             YVK G+Y E++      I L+GDG   TIIT   SVGGG++   SAT  + GDGFIA+ I
Sbjct  241   YVKGGIYNEQVEVKSKNIMLVGDGIGKTIITGSKSVGGGTTTFRSATVAVVGDGFIAQGI  300

Query  512   GFQNTAGPGAHQAVALTVASDHSVFYRCSISGYQDTLYALSLRQFYRECDISGTVDFIFG  333
              F+NTAG   HQAVAL   SD SVFY+CS  GYQDTLY  S RQFYREC+I GTVDFIFG
Sbjct  301   TFRNTAGAKNHQAVALRSGSDLSVFYKCSFEGYQDTLYVHSERQFYRECNIYGTVDFIFG  360

Query  332   NAAAVFQACNLVLRR-PSSYNVILANGRSDPGQNTGFSVQKCKITPGPDFSPVKNSYNSY  156
             NAA V Q CN+  R  P+  N I A GR+DP QNTG S+   ++T   D  PV+NS  +Y
Sbjct  361   NAAVVLQNCNIFARNPPNKVNTITAQGRTDPNQNTGISIHNSRVTAASDLRPVQNSVRTY  420

Query  155   LGRPWKPYSRAVVMESDIDGAISARGWIEWPGTSSSSVRELYFGEYANVG  6
             LGRPWK YSR V M++ +DG I+  GW+EW G  + ++  LY+ EY N G
Sbjct  421   LGRPWKQYSRTVFMKTYLDGLINPSGWMEWSG--NFALNTLYYREYMNTG  468



>gb|KDP28780.1| hypothetical protein JCGZ_14551 [Jatropha curcas]
Length=514

 Score =   325 bits (832),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 178/393 (45%), Positives = 241/393 (61%), Gaps = 31/393 (8%)
 Frame = -2

Query  1166  CEELMGMARQRLNEALVAMKESPGKNRQEDIQTWLSAAVTFQQACKDWADQYAFSDELFA  987
             C EL       LN+   +      K  + D QTWLS A+T  + CK   ++   SD +  
Sbjct  98    CLELYEYTVLWLNQTTTS------KCSKYDAQTWLSTALTNLETCKTGFEELGVSDYILP  151

Query  986   RISRSMDYQSQLASNALALVNRNTEISAAGRQLSEEdidddddggffpDWVSGRDLRLLE  807
              +S ++   S+L  N LAL N+      + ++              FP W+   D +LL+
Sbjct  152   LMSNNV---SKLICNTLAL-NKVPYTEPSYKE-------------GFPTWLKPGDRKLLQ  194

Query  806   TTTDKTKANVVVAKDGTGNFRTVAEAIGAASGRQ---RFVIYVKSGVYKEKIRSSKD--G  642
             +T+  ++AN+VVA+DG+GN++T+ EA+ AAS R    R++IYVKSG YKE ++  K    
Sbjct  195   STSPASQANIVVAQDGSGNYKTINEAVAAASKRSGTGRYIIYVKSGTYKENVQIGKSLKN  254

Query  641   ITLIGDGKYSTIITWDDSVGGGSSLTGSATFGITGDGFIAKDIGFQNTAGPGAHQAVALT  462
             I  +GDG   TI+T   SVGGG++   SATF + GDGFIA+D+ F+NTAGP  HQAVAL 
Sbjct  255   IMFVGDGIGKTIVTGSKSVGGGATTFNSATFAVVGDGFIARDMTFRNTAGPQNHQAVALR  314

Query  461   VASDHSVFYRCSISGYQDTLYALSLRQFYRECDISGTVDFIFGNAAAVFQACNLVLRR-P  285
               +D SVFY+CS  GYQDTLY  S RQFYRECDI GTVDFIFGNAA V Q CN+  R  P
Sbjct  315   SGADLSVFYKCSFEGYQDTLYVHSQRQFYRECDIYGTVDFIFGNAAVVLQNCNIYPRNPP  374

Query  284   SSYNVILANGRSDPGQNTGFSVQKCKITPGPDFSPVKNSYNSYLGRPWKPYSRAVVMESD  105
             +  N + A GR+DP QNTG S+   ++T   D +PV+ S  +YLGRPWK YSR V M++ 
Sbjct  375   NKTNTLTAQGRTDPNQNTGISIHNSRVTAASDLTPVQGSVRTYLGRPWKQYSRTVFMKTY  434

Query  104   IDGAISARGWIEWPGTSSSSVRELYFGEYANVG  6
             +D  I+  GW+EW G  + ++  LY+GEY N G
Sbjct  435   LDSLINPAGWMEWSG--NFALDTLYYGEYMNTG  465



>gb|AFK35109.1| unknown [Medicago truncatula]
Length=554

 Score =   326 bits (835),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 188/467 (40%), Positives = 266/467 (57%), Gaps = 27/467 (6%)
 Frame = -2

Query  1367  CGYTRFPRLCVQTLSGLVSGERVDFAAALLLNKTIAHADLHIAHFDQL--SSHFVSSQPP  1194
             C +    + C+  +S +V G  +       L+  ++      AH  +   +++ +  +  
Sbjct  55    CEHALDTKSCLTHVSEVVQGSTLSNTKDHKLSTLVSLLTKSTAHIRKAMDTANVIKRRVN  114

Query  1193  QPRLQ-AIGYCEELMGMARQRLNEALVAMKESPGKNRQEDIQTWLSAAVTFQQACKDWAD  1017
              PR + A+  CEELM ++  R+ ++++ + ++   + Q D  TWLS+ +T    C D  +
Sbjct  115   SPREEIALNDCEELMDLSMDRVWDSVLTLTKN-NIDSQHDAHTWLSSVLTNHATCLDGLE  173

Query  1016  ---QYAFSDELFARISRSMDYQSQLASNALALVNRNTEISAAGRQLSEEdidddddggff  846
                +     +L   ISR        A ++LA++       A    + E+   D       
Sbjct  174   GSSRVVMESDLHDLISR--------ARSSLAVLVSVLPPKANDGFIDEKLNGDFPS----  221

Query  845   pDWVSGRDLRLLETTTDKTKANVVVAKDGTGNFRTVAEAIGAA--SGRQRFVIYVKSGVY  672
               WV+ +D RLLE++    KANVVVA+DG+G F+TVA+A+ +A  +G+ R+VIYVK G Y
Sbjct  222   --WVTSKDRRLLESSVGDIKANVVVAQDGSGKFKTVAQAVASAPDNGKTRYVIYVKKGTY  279

Query  671   KEKIR--SSKDGITLIGDGKYSTIITWDDSVGGGSSLTGSATFGITGDGFIAKDIGFQNT  498
             KE I     K  + L+GDG  +TIIT   +   G++   SAT    GDGFIA+DI FQNT
Sbjct  280   KENIEIGKKKTNVMLVGDGMDATIITGSLNFIDGTTTFKSATVAAVGDGFIAQDIRFQNT  339

Query  497   AGPGAHQAVALTVASDHSVFYRCSISGYQDTLYALSLRQFYRECDISGTVDFIFGNAAAV  318
             AGP  HQAVAL V +D SV  RC I  +QDTLYA S RQFYR+  I+GTVDFIFGNAA V
Sbjct  340   AGPQKHQAVALRVGADQSVINRCKIDAFQDTLYAHSNRQFYRDSYITGTVDFIFGNAAVV  399

Query  317   FQACNLVLRRP--SSYNVILANGRSDPGQNTGFSVQKCKITPGPDFSPVKNSYNSYLGRP  144
             FQ   L  R+P  +  N++ A GR DP QNT  S+Q+C + P  D  PV+ S  +YLGRP
Sbjct  400   FQKSKLATRKPMANQKNMVTAQGREDPNQNTATSIQQCDVIPSSDLKPVQGSIKTYLGRP  459

Query  143   WKPYSRAVVMESDIDGAISARGWIEWPGTSSSSVRELYFGEYANVGA  3
             WK YSR VV++S +DG I   GW EW   S   ++ LY+GEY N GA
Sbjct  460   WKKYSRTVVLQSVVDGHIDPAGWAEWDAASKDFLQTLYYGEYMNSGA  506



>ref|XP_003622688.1| Pectinesterase [Medicago truncatula]
 gb|AES78906.1| pectinesterase/pectinesterase inhibitor [Medicago truncatula]
Length=554

 Score =   326 bits (835),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 188/467 (40%), Positives = 266/467 (57%), Gaps = 27/467 (6%)
 Frame = -2

Query  1367  CGYTRFPRLCVQTLSGLVSGERVDFAAALLLNKTIAHADLHIAHFDQL--SSHFVSSQPP  1194
             C +    + C+  +S +V G  +       L+  ++      AH  +   +++ +  +  
Sbjct  55    CEHALDTKSCLTHVSEVVQGSTLSNTKDHKLSTLVSLLTKSTAHIRKAMDTANVIKRRVN  114

Query  1193  QPRLQ-AIGYCEELMGMARQRLNEALVAMKESPGKNRQEDIQTWLSAAVTFQQACKDWAD  1017
              PR + A+  CEELM ++  R+ ++++ + ++   + Q D  TWLS+ +T    C D  +
Sbjct  115   SPREEIALNDCEELMDLSMDRVWDSVLTLTKN-NIDSQHDAHTWLSSVLTNHATCLDGLE  173

Query  1016  ---QYAFSDELFARISRSMDYQSQLASNALALVNRNTEISAAGRQLSEEdidddddggff  846
                +     +L   ISR        A ++LA++       A    + E+   D       
Sbjct  174   GSSRVVMESDLHDLISR--------ARSSLAVLVSVLPPKANDGFIDEKLNGDFPS----  221

Query  845   pDWVSGRDLRLLETTTDKTKANVVVAKDGTGNFRTVAEAIGAA--SGRQRFVIYVKSGVY  672
               WV+ +D RLLE++    KANVVVA+DG+G F+TVA+A+ +A  +G+ R+VIYVK G Y
Sbjct  222   --WVTSKDRRLLESSVGDIKANVVVAQDGSGKFKTVAQAVASAPDNGKTRYVIYVKKGTY  279

Query  671   KEKIR--SSKDGITLIGDGKYSTIITWDDSVGGGSSLTGSATFGITGDGFIAKDIGFQNT  498
             KE I     K  + L+GDG  +TIIT   +   G++   SAT    GDGFIA+DI FQNT
Sbjct  280   KENIEIGKKKTNVMLVGDGMDATIITGSLNFIDGTTTFKSATVAAVGDGFIAQDIRFQNT  339

Query  497   AGPGAHQAVALTVASDHSVFYRCSISGYQDTLYALSLRQFYRECDISGTVDFIFGNAAAV  318
             AGP  HQAVAL V +D SV  RC I  +QDTLYA S RQFYR+  I+GTVDFIFGNAA V
Sbjct  340   AGPQKHQAVALRVGADQSVINRCKIDAFQDTLYAHSNRQFYRDSYITGTVDFIFGNAAVV  399

Query  317   FQACNLVLRRP--SSYNVILANGRSDPGQNTGFSVQKCKITPGPDFSPVKNSYNSYLGRP  144
             FQ   L  R+P  +  N++ A GR DP QNT  S+Q+C + P  D  PV+ S  +YLGRP
Sbjct  400   FQKSKLAARKPMANQKNMVTAQGREDPNQNTATSIQQCDVIPSSDLKPVQGSIKTYLGRP  459

Query  143   WKPYSRAVVMESDIDGAISARGWIEWPGTSSSSVRELYFGEYANVGA  3
             WK YSR VV++S +DG I   GW EW   S   ++ LY+GEY N GA
Sbjct  460   WKKYSRTVVLQSVVDGHIDPAGWAEWDAASKDFLQTLYYGEYMNSGA  506



>ref|XP_004306939.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 17-like 
[Fragaria vesca subsp. vesca]
Length=508

 Score =   324 bits (831),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 201/471 (43%), Positives = 270/471 (57%), Gaps = 47/471 (10%)
 Frame = -2

Query  1385  DQIRIQCGYTRFPRLCVQTLSG----LVSGERVDF---AAALLLNKTIAHADLHIAHFDQ  1227
             + I+  C  T  P+ C + LS     +   ++  F   +  L L++ + HA     +F  
Sbjct  25    NDIKTWCSKTPNPKPCEELLSHNKNQIPIKQKSQFFQISTQLALDRAM-HAH---TNFLS  80

Query  1226  LSSHFVSSQPPQPRLQAI-GYCEELMGMARQRLNEALVAMKESPGKNRQEDIQTWLSAAV  1050
             L S FV+     PR +A    C EL  +  Q+LN  +        K  QED QTWLS A+
Sbjct  81    LGSKFVN-----PRAKAAWDDCLELYDLTIQKLNTTV----NPSTKCTQEDTQTWLSTAL  131

Query  1049  TFQQACKDWADQYAFSDELFARISRSMDYQSQLASNALALVNRNTEISAAGRQLSEEdid  870
             T  + C++   +   SD     +S ++   S L SN L++       +   +        
Sbjct  132   TNLETCREGFSELGVSDFFLPVMSNNV---SNLISNTLSINYVPYNPAPPSKD-------  181

Query  869   ddddggffpDWVSGRDLRLLETTTDKTKANVVVAKDGTGNFRTVAEAIGAASGRQ---RF  699
                    FP WV+  + RLL++++    AN+VVAKDG+GN++TV EAI  AS R    R+
Sbjct  182   ------GFPTWVNPGNRRLLQSSSPT--ANLVVAKDGSGNYKTVTEAITTASKRSGTARY  233

Query  698   VIYVKSGVYKEKIRSSKDGITLIGDGKYSTIITWDDSVGGGSSLTGSATFGITGDGFIAK  519
             VIYVK+G YKE +  +   I L+GDG   TIIT   SVGGGS+   SAT  +TGDGFIA+
Sbjct  234   VIYVKAGTYKENVVITSKNIMLMGDGIGKTIITGSKSVGGGSTTFNSATVAVTGDGFIAR  293

Query  518   DIGFQNTAGPGAHQAVALTVASDHSVFYRCSISGYQDTLYALSLRQFYRECDISGTVDFI  339
             DI FQNTAG   +QAVAL   SD SVFY+CS  GYQDTLY  S RQFYREC+I GTVDFI
Sbjct  294   DITFQNTAGVSNNQAVALRSGSDLSVFYKCSFEGYQDTLYVYSDRQFYRECNIYGTVDFI  353

Query  338   FGNAAAVFQACNLVLRRPSSYNVILANGRSDPGQNTGFSVQKCKITPGPDFSPVKNSYNS  159
             FGNAA V Q CN+ +    + N + A GRSDP QNTG S+  CK+T   D   V +S  +
Sbjct  354   FGNAAVVLQNCNIYVHNHKT-NTVTAQGRSDPNQNTGISIHNCKVTAASDL--VLSSTKT  410

Query  158   YLGRPWKPYSRAVVMESDIDGAISARGWIEWPGTSSSSVRELYFGEYANVG  6
             YLGRPW+ YSR + M++ +D  I++ GW+EW GT   ++  LY+GEY N G
Sbjct  411   YLGRPWREYSRTIFMKTYLDSLINSAGWLEWDGT--FALETLYYGEYMNTG  459



>gb|AFW03479.1| pectin methylesterase 5 [Gossypium barbadense]
Length=519

 Score =   325 bits (832),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 192/467 (41%), Positives = 264/467 (57%), Gaps = 32/467 (7%)
 Frame = -2

Query  1385  DQIRIQCGYTRFPRLCVQTLSGLVSGERVDFAAALLLNKTIAHADLHIAHFDQLSSHFVS  1206
             + +R  C  T  P+ C   LS     ++          K   H  L  A   + ++H + 
Sbjct  29    NDVRSWCRKTPNPQPCEYFLSH--DPKKTPIKDEFQFFKISTHLALERAARAESNTHSLG  86

Query  1205  SQPPQPRLQAI-GYCEELMGMARQRLNEALVAMKESPGKNRQEDIQTWLSAAVTFQQACK  1029
             ++    R +A    C  L  +   RLN+ +    +S   + ++D QTWLS A+T  + C+
Sbjct  87    TKCRNEREKAAWSDCVNLYELTILRLNKTV----DSGTNHNKDDAQTWLSTALTNLETCR  142

Query  1028  DWADQYAFSDELFARISRSMDYQSQLASNALALVNRNTEISAAGRQLSEEdidddddggf  849
                 +    D L   +S ++   SQL SN LAL              ++    +      
Sbjct  143   TGFMELGVPDYLLPMMSNNV---SQLISNTLAL--------------NKAPYKEPTYKDG  185

Query  848   fpDWVSGRDLRLLETTTDKTKANVVVAKDGTGNFRTVAEAIGAASGRQ---RFVIYVKSG  678
             FP WV   D +LL++++  + AN+VVA+DG+GN++T+ +AI AAS R    R+VIYVK+G
Sbjct  186   FPTWVKPGDRKLLQSSSPASTANIVVAQDGSGNYKTIKDAISAASKRSGSGRYVIYVKAG  245

Query  677   VYKEKIR--SSKDGITLIGDGKYSTIITWDDSVGGGSSLTGSATFGITGDGFIAKDIGFQ  504
              YKE +   S    I ++GDG   TIIT   SVGGGS+   SAT  + GDGFIA+ I F+
Sbjct  246   TYKENVEIGSKLKNIMMVGDGIGKTIITGSKSVGGGSTTFNSATVAVVGDGFIARGITFR  305

Query  503   NTAGPGAHQAVALTVASDHSVFYRCSISGYQDTLYALSLRQFYRECDISGTVDFIFGNAA  324
             NTAGP  HQAVAL   SD SVFY+CS  GYQDTLY  S RQFYRECDI GTVD+IFGNAA
Sbjct  306   NTAGPTNHQAVALRSGSDLSVFYKCSFEGYQDTLYVHSERQFYRECDIYGTVDWIFGNAA  365

Query  323   AVFQACNLVLRR-PSSYNVILANGRSDPGQNTGFSVQKCKITPGPDFSPVKNSYNSYLGR  147
              VFQ CN+  R  P+  N + A GR+DP QNTG  +   ++T   D  PV++S  +YLGR
Sbjct  366   VVFQNCNIYARNPPNKTNTVTAQGRTDPNQNTGIIIHNSRVTAASDLKPVQSSVKTYLGR  425

Query  146   PWKPYSRAVVMESDIDGAISARGWIEWPGTSSSSVRELYFGEYANVG  6
             PWK YSR V M++ +D  I+  GW+EW G    +++ LY+ EY N G
Sbjct  426   PWKQYSRTVFMKTYLDSLINPAGWMEWDG--DFALKTLYYAEYMNTG  470



>ref|XP_003622699.1| Pectinesterase [Medicago truncatula]
 gb|ABD33414.1| Pectinesterase; Pectinesterase inhibitor [Medicago truncatula]
 gb|AES78917.1| pectinesterase/pectinesterase inhibitor [Medicago truncatula]
Length=555

 Score =   326 bits (835),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 179/405 (44%), Positives = 246/405 (61%), Gaps = 25/405 (6%)
 Frame = -2

Query  1190  PRLQ-AIGYCEELMGMARQRLNEALVAMKESPGKNRQEDIQTWLSAAVTFQQACKDWAD-  1017
             PR + A+  CE+LM ++  R+ + ++ + ++   + Q+D  TWLS+ +T    C D  + 
Sbjct  117   PREEIALSDCEQLMDLSMNRIWDTMLKLTKN-NIDSQQDAHTWLSSVLTNHATCLDGLEG  175

Query  1016  --QYAFSDELFARISRSMDYQSQLASNALALVNRNTEISAAGRQLSEEdidddddggffp  843
               +    ++L   ISR+   +S LA   +    ++ +      Q  +E +  +       
Sbjct  176   SSRVVMENDLQDLISRA---RSSLAVFLVVFPQKDRD------QFIDETLIGEFPS----  222

Query  842   DWVSGRDLRLLETTTDKTKANVVVAKDGTGNFRTVAEAIGAA--SGRQRFVIYVKSGVYK  669
              WV+ +D RLLET     KANVVVA+DG+G F+TVAEA+ +A  +G+ ++VIYVK G YK
Sbjct  223   -WVTSKDRRLLETAVGDIKANVVVAQDGSGKFKTVAEAVASAPDNGKTKYVIYVKKGTYK  281

Query  668   EKIR--SSKDGITLIGDGKYSTIITWDDSVGGGSSLTGSATFGITGDGFIAKDIGFQNTA  495
             E +   S K  + L+GDG  +TIIT + +   G++   S+T    GDGFIA+DI FQN A
Sbjct  282   ENVEIGSKKTNVMLVGDGMDATIITGNLNFIDGTTTFKSSTVAAVGDGFIAQDIWFQNMA  341

Query  494   GPGAHQAVALTVASDHSVFYRCSISGYQDTLYALSLRQFYRECDISGTVDFIFGNAAAVF  315
             G   HQAVAL V SD SV  RC I  +QDTLYA S RQFYR+  I+GT+DFIFGNAA VF
Sbjct  342   GAAKHQAVALRVGSDQSVINRCRIDAFQDTLYAHSNRQFYRDSVITGTIDFIFGNAAVVF  401

Query  314   QACNLVLRRP--SSYNVILANGRSDPGQNTGFSVQKCKITPGPDFSPVKNSYNSYLGRPW  141
             Q C LV R+P  +  N+  A GR DPGQNTG S+Q+C +TP  D  PV  S  ++LGRPW
Sbjct  402   QKCKLVARKPMANQNNMFTAQGREDPGQNTGTSIQQCDLTPSSDLKPVVGSIKTFLGRPW  461

Query  140   KPYSRAVVMESDIDGAISARGWIEWPGTSSSSVRELYFGEYANVG  6
             K YSR VVM+S +D  I   GW EW   S   ++ LY+GEY N G
Sbjct  462   KKYSRTVVMQSFLDSHIDPTGWAEWDAASKDFLQTLYYGEYLNNG  506



>gb|ACJ85768.1| unknown [Medicago truncatula]
Length=554

 Score =   326 bits (835),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 188/467 (40%), Positives = 265/467 (57%), Gaps = 27/467 (6%)
 Frame = -2

Query  1367  CGYTRFPRLCVQTLSGLVSGERVDFAAALLLNKTIAHADLHIAHFDQL--SSHFVSSQPP  1194
             C +    + C+  +S +V G  +       L+  ++      AH  +   +++ +  +  
Sbjct  55    CEHALDTKSCLTHVSEVVQGSTLSNTKDHKLSTLVSLLTKSTAHIRKAMDTANVIKRRVN  114

Query  1193  QPRLQ-AIGYCEELMGMARQRLNEALVAMKESPGKNRQEDIQTWLSAAVTFQQACKDWAD  1017
              PR + A+  CEELM ++  R+ ++++ + ++   + Q D  TWLS+ +T    C D  +
Sbjct  115   SPREEIALNDCEELMDLSMDRVWDSVLTLTKN-NIDSQHDAHTWLSSVLTNHATCLDGLE  173

Query  1016  ---QYAFSDELFARISRSMDYQSQLASNALALVNRNTEISAAGRQLSEEdidddddggff  846
                +     +L   ISR        A ++LA++       A    + E+   D       
Sbjct  174   GSSRVVMESDLHDLISR--------ARSSLAVLVSVLPPKANDGFIDEKLNGDFPS----  221

Query  845   pDWVSGRDLRLLETTTDKTKANVVVAKDGTGNFRTVAEAIGAA--SGRQRFVIYVKSGVY  672
               WV+ +D RLLE++    KANVVVA+DG+G F+TVA+A+ +A  +G  R+VIYVK G Y
Sbjct  222   --WVTSKDRRLLESSVGDIKANVVVAQDGSGKFKTVAQAVASAPDNGETRYVIYVKKGTY  279

Query  671   KEKIR--SSKDGITLIGDGKYSTIITWDDSVGGGSSLTGSATFGITGDGFIAKDIGFQNT  498
             KE I     K  + L+GDG  +TIIT   +   G++   SAT    GDGFIA+DI FQNT
Sbjct  280   KENIEIGKKKTNVMLVGDGMDATIITGSLNFTDGTTTFKSATVAAVGDGFIAQDIRFQNT  339

Query  497   AGPGAHQAVALTVASDHSVFYRCSISGYQDTLYALSLRQFYRECDISGTVDFIFGNAAAV  318
             AGP  HQAVAL V +D SV  RC I  +QDTLYA S RQFYR+  I+GTVDFIFGNAA V
Sbjct  340   AGPQKHQAVALHVGADQSVINRCKIDAFQDTLYAHSNRQFYRDSYITGTVDFIFGNAAVV  399

Query  317   FQACNLVLRRP--SSYNVILANGRSDPGQNTGFSVQKCKITPGPDFSPVKNSYNSYLGRP  144
             FQ   L  R+P  +  N++ A GR DP QNT  S+Q+C + P  D  PV+ S  +YLGRP
Sbjct  400   FQKSKLAARKPMANQKNMVTAQGREDPNQNTATSIQQCDVIPSSDLKPVQGSIKTYLGRP  459

Query  143   WKPYSRAVVMESDIDGAISARGWIEWPGTSSSSVRELYFGEYANVGA  3
             WK YSR VV++S +DG I   GW EW   S   ++ LY+GEY N GA
Sbjct  460   WKKYSRTVVLQSVVDGHIDPAGWAEWDAASKDFLQTLYYGEYMNSGA  506



>emb|CDO99718.1| unnamed protein product [Coffea canephora]
Length=548

 Score =   325 bits (834),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 194/461 (42%), Positives = 261/461 (57%), Gaps = 26/461 (6%)
 Frame = -2

Query  1367  CGYTRFPRLCVQTLSGLVS-GERVDFAAALLLNKTIAHADLHIAHFDQLSSHFVSSQPPQ  1191
             C +      C+Q +S + S G+  D     LL   +A +   I    +L+ +       Q
Sbjct  58    CSHAHDQSSCLQAVSEVASSGQSSDVD---LLQMILAKSSAQIQETIKLTENINRRINDQ  114

Query  1190  PRLQAIGYCEELMGMARQRLNEALVAMKESPGKNRQEDIQTWLSAAVTFQQACKDWADQY  1011
                 A+  C ELM M+  RL +++VA+     ++ Q D  +WL + +T    C D  +  
Sbjct  115   REQAALADCLELMDMSVDRLMDSMVALGSQTAQS-QSDAHSWLGSVLTNHVTCLDGLNGP  173

Query  1010  AFSDELFARISRSMDYQSQLASNALALVNRNTEISAAGRQLSEEdidddddggffpDWVS  831
             A S      +   M      A  +LA+V     I+    ++ E+ ++ D        WV+
Sbjct  174   ARS-----VVEPMMKDLILKARTSLAMV---VAIAPPKEEMIEQPLNGDLPS-----WVT  220

Query  830   GRDLRLLETTTDKTKANVVVAKDGTGNFRTVAEAIGAA--SGRQRFVIYVKSGVYKEK--  663
              +D RLLE      KAN VVAKDG+GN++TV EA+ AA  + + R+VIYVK+G YKEK  
Sbjct  221   SKDRRLLEALPKDVKANSVVAKDGSGNYKTVQEAVNAAPNNAQSRYVIYVKAGTYKEKVD  280

Query  662   IRSSKDGITLIGDGKYSTIITWDDSVGGGSSLTGSATFGITGDGFIAKDIGFQNTAGPGA  483
             I  +K  + L+GDG   TIIT   +V  GS+   SAT     DGFIA+D+GFQNTAGP  
Sbjct  281   IGKNKKNLMLVGDGMDKTIITGSLNVVDGSTTFNSATVAAVADGFIAQDLGFQNTAGPQK  340

Query  482   HQAVALTVASDHSVFYRCSISGYQDTLYALSLRQFYRECDISGTVDFIFGNAAAVFQACN  303
             HQAVAL V +D SV  RC I  +QDTLY  SLRQF+R+C I+GTVDFIFG+AA VFQ   
Sbjct  341   HQAVALRVGADKSVINRCKIDAFQDTLYTHSLRQFFRDCYITGTVDFIFGDAAVVFQNSK  400

Query  302   LVLRRPSS--YNVILANGRSDPGQNTGFSVQKCKITPGPDFSPVKNSYNSYLGRPWKPYS  129
             L  R+P S   N++ A GR DP  NTG S+Q C + P  D +PVK S  +YLGRPWK YS
Sbjct  401   LAARKPMSNQQNMVTAQGRVDPNSNTGTSIQNCDVIPSSDLAPVKGSIKTYLGRPWKEYS  460

Query  128   RAVVMESDIDGAISARGWIEWPGTSSSSVRELYFGEYANVG  6
             R VVM+S+ID  I   GW  W G    +++ LY+GEY N G
Sbjct  461   RTVVMQSNIDNHIVPEGWSVWSG--DFALKTLYYGEYQNRG  499



>ref|XP_010056336.1| PREDICTED: pectinesterase 2-like [Eucalyptus grandis]
Length=515

 Score =   324 bits (831),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 173/366 (47%), Positives = 229/366 (63%), Gaps = 25/366 (7%)
 Frame = -2

Query  1085  QEDIQTWLSAAVTFQQACKDWADQYAFSDELFARISRSMDYQSQLASNALALVNRNTEIS  906
             Q++ QTWLS A+T  + C+    +   SD +   +S ++   S+L SN LAL        
Sbjct  120   QDEAQTWLSTALTNLETCRAGFVELGISDNVLPLMSNNV---SKLISNTLAL--------  168

Query  905   AAGRQLSEEdidddddggffpDWVSGRDLRLLETTTDKTKANVVVAKDGTGNFRTVAEAI  726
                   +       +    FP WV   D +LL++++  +KAN+VVA+D +GN++T++EAI
Sbjct  169   ------NYAPFTTPNYTKKFPTWVRPSDRKLLQSSSAVSKANIVVARDSSGNYKTISEAI  222

Query  725   GAASGRQ---RFVIYVKSGVYKEKIR--SSKDGITLIGDGKYSTIITWDDSVGGGSSLTG  561
              AAS R    R++IY+K+G Y E I   S  D I  IGDG   TIIT   SVGGGS+   
Sbjct  223   TAASKRTGTARYIIYIKAGTYNENIEVGSKLDNIMFIGDGIGKTIITGSKSVGGGSTTFN  282

Query  560   SATFGITGDGFIAKDIGFQNTAGPGAHQAVALTVASDHSVFYRCSISGYQDTLYALSLRQ  381
             SAT  + GDGFIA+DI F+NTAG   HQAVAL   SD SVFYRC   GYQDTLY  S RQ
Sbjct  283   SATVAVVGDGFIAQDITFRNTAGAANHQAVALRSGSDLSVFYRCGFEGYQDTLYVHSERQ  342

Query  380   FYRECDISGTVDFIFGNAAAVFQACNLVLRR-PSSYNVILANGRSDPGQNTGFSVQKCKI  204
             FYRECDI GTVDFIFGNAA VFQ CN+  R  P+  N + A GR+DP QNTG S+  CK+
Sbjct  343   FYRECDIYGTVDFIFGNAAVVFQNCNIYARNPPNKVNTLTAQGRTDPNQNTGISIHNCKV  402

Query  203   TPGPDFSPVKNSYNSYLGRPWKPYSRAVVMESDIDGAISARGWIEWPGTSSSSVRELYFG  24
             T   D   +++S  +YLGRPWK YSR + M++ +D  +++ GW+EW G  + ++  LY+G
Sbjct  403   TAASDLKSIQSSVKTYLGRPWKQYSRTIFMKTYLDSLVNSAGWMEWDG--NFALDTLYYG  460

Query  23    EYANVG  6
             EY N G
Sbjct  461   EYVNTG  466



>ref|XP_002265599.1| PREDICTED: pectinesterase 2 [Vitis vinifera]
Length=512

 Score =   324 bits (830),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 202/474 (43%), Positives = 274/474 (58%), Gaps = 46/474 (10%)
 Frame = -2

Query  1385  DQIRIQCGYTRFPRLCVQTLS-----GLVSGERVDFAAALLLNKTIAHADLHIAHFDQLS  1221
             D ++  C  T  P+ C   LS      L+  ++ DF   L L+  +A     IAH + LS
Sbjct  22    DDVKSWCSQTPNPQPCDYFLSQKTDQSLIK-QKSDF---LNLSMQLALERAIIAHGNTLS  77

Query  1220  SHFVSSQPPQPRLQAI-GYCEELMGMARQRLNEALVAMKESPGKNRQEDIQTWLSAAVTF  1044
                + S+    R +A    C EL      +LN+ L    +   +  Q D QTWLS A+T 
Sbjct  78    ---LGSKCRNEREKAAWNDCLELYEHTILKLNKTL----DPNTRCTQVDAQTWLSTALTN  130

Query  1043  QQACKDWADQYAFSDELFARISRSMDYQSQLASNALALVNR--NTEISAAGRQLSEEdid  870
              Q C+D   +   SD L   +S ++   S+L SN L+ +N+    E S  G         
Sbjct  131   LQTCQDGFIELGVSDYLLPSMSNNV---SKLISNTLS-INKVPYAEPSYKG---------  177

Query  869   ddddggffpDWVSGRDLRLLETTTDKTKANVVVAKDGTGNFRTVAEAIGAASGRQ---RF  699
                    +P WV   D +LL++++  ++AN+VV+KDG+G++ T+  AI AAS R    R+
Sbjct  178   ------GYPTWVKPGDRKLLQSSSLASQANIVVSKDGSGDYTTIGAAITAASKRSGSGRY  231

Query  698   VIYVKSGVYKEKIR--SSKDGITLIGDGKYSTIITWDDSVGGGSSLTGSATFGITGDGFI  525
             VIYVK+G Y E ++  S    I L+GDG   TI+T   SVGGGS+   SAT  + GDGFI
Sbjct  232   VIYVKAGTYSENVQIGSGLKNIMLLGDGIGKTIVTGSKSVGGGSTTFKSATVAVVGDGFI  291

Query  524   AKDIGFQNTAGPGAHQAVALTVASDHSVFYRCSISGYQDTLYALSLRQFYRECDISGTVD  345
             A+ + F+NTAG   HQAVAL   SD SV+Y+CS  GYQDTLY  S RQFYRECDI GTVD
Sbjct  292   ARGMTFRNTAGASNHQAVALRSGSDLSVYYQCSFEGYQDTLYTYSERQFYRECDIYGTVD  351

Query  344   FIFGNAAAVFQACNLVLRR-PSSYNVILANGRSDPGQNTGFSVQKCKITPGPDFSPVKNS  168
             FIFGNAA VFQ CN+  R  P+  N + A GR+DP QNTG S+  CK+T   D  PV++S
Sbjct  352   FIFGNAAVVFQNCNIYARNPPNKINTVTAQGRTDPNQNTGISIHDCKVTAASDLKPVQSS  411

Query  167   YNSYLGRPWKPYSRAVVMESDIDGAISARGWIEWPGTSSSSVRELYFGEYANVG  6
               +YLGRPWK YSR V +++ +D  I++ GW+EW G    ++  LY+GEY N G
Sbjct  412   VKTYLGRPWKEYSRTVFLKTYLDSLINSAGWLEWSG--DFALNTLYYGEYMNTG  463



>ref|XP_002265740.2| PREDICTED: pectinesterase 2-like [Vitis vinifera]
Length=512

 Score =   324 bits (830),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 200/474 (42%), Positives = 274/474 (58%), Gaps = 46/474 (10%)
 Frame = -2

Query  1385  DQIRIQCGYTRFPRLCVQTLS-----GLVSGERVDFAAALLLNKTIAHADLHIAHFDQLS  1221
             D ++  C  T  P+ C   LS      L+  ++ DF   L ++  +A     IAH D  S
Sbjct  22    DDVKPWCSQTPHPQPCEYFLSQKTDHSLIK-QKSDF---LNISMQLALERAMIAHGDTFS  77

Query  1220  SHFVSSQPPQPRLQAI-GYCEELMGMARQRLNEALVAMKESPGKNRQEDIQTWLSAAVTF  1044
                + S+    R +A    C EL      +LN+ L    +S  +  Q D QTWLS A+T 
Sbjct  78    ---LGSKCRNEREKAAWNDCLELYEHTILKLNKTL----DSNTRCTQADAQTWLSTALTN  130

Query  1043  QQACKDWADQYAFSDELFARISRSMDYQSQLASNALALVNR--NTEISAAGRQLSEEdid  870
              Q C+D       SD +   +S ++   S+L SN L+ +N+    E S  G         
Sbjct  131   LQTCQDGFIDLGVSDYVLPLMSNNV---SKLISNTLS-INKVPYAEPSYKG---------  177

Query  869   ddddggffpDWVSGRDLRLLETTTDKTKANVVVAKDGTGNFRTVAEAIGAASGRQ---RF  699
                    +P WV   D +LL++++  ++AN+VV+KDG+G++ T+  AI AAS R    R+
Sbjct  178   ------GYPTWVKPGDRKLLQSSSLASQANIVVSKDGSGDYTTIGAAITAASKRSGSGRY  231

Query  698   VIYVKSGVYKEKIR--SSKDGITLIGDGKYSTIITWDDSVGGGSSLTGSATFGITGDGFI  525
             VIYVK+G Y E ++  S    I L+GDG   TI+T   SVGGGS+   SAT  + GDGFI
Sbjct  232   VIYVKAGTYSENVQIGSGLKNIMLLGDGIGKTIVTGSKSVGGGSTTFNSATVAVVGDGFI  291

Query  524   AKDIGFQNTAGPGAHQAVALTVASDHSVFYRCSISGYQDTLYALSLRQFYRECDISGTVD  345
             A+ + F+NTAG   HQAVAL   SD SV+Y+CS  GYQDTLY  S RQFYRECDI GTVD
Sbjct  292   ARGMTFRNTAGASNHQAVALRSGSDLSVYYQCSFEGYQDTLYTYSERQFYRECDIYGTVD  351

Query  344   FIFGNAAAVFQACNLVLRR-PSSYNVILANGRSDPGQNTGFSVQKCKITPGPDFSPVKNS  168
             FIFGNAA VFQ CN+ +R  P+  N + A GR+DP QNTG S+  CK+T   D   V++S
Sbjct  352   FIFGNAAVVFQNCNIYVRNPPNKINTVTAQGRTDPNQNTGISIHDCKVTAASDLKAVQSS  411

Query  167   YNSYLGRPWKPYSRAVVMESDIDGAISARGWIEWPGTSSSSVRELYFGEYANVG  6
               +YLGRPWK YSR V +++ +D  I++ GW+EW G    +++ LY+GEY N G
Sbjct  412   VKTYLGRPWKEYSRTVFLKTYLDSLINSAGWMEWSG--DFALKTLYYGEYMNTG  463



>emb|CAN83663.1| hypothetical protein VITISV_017689 [Vitis vinifera]
Length=512

 Score =   323 bits (829),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 202/474 (43%), Positives = 274/474 (58%), Gaps = 46/474 (10%)
 Frame = -2

Query  1385  DQIRIQCGYTRFPRLCVQTLS-----GLVSGERVDFAAALLLNKTIAHADLHIAHFDQLS  1221
             D ++  C  T  P+ C   LS      L+  ++ DF   L L+  +A     IAH + LS
Sbjct  22    DDVKSWCSQTPNPQPCDYFLSQKTDHSLIK-QKSDF---LNLSMQLALERAIIAHGNTLS  77

Query  1220  SHFVSSQPPQPRLQAI-GYCEELMGMARQRLNEALVAMKESPGKNRQEDIQTWLSAAVTF  1044
                + S+    R +A    C EL      +LN+ L    +   +  Q D QTWLS A+T 
Sbjct  78    ---LGSKCRNEREKAAWNDCLELYEHTILKLNKTL----DPNTRCTQVDAQTWLSTALTN  130

Query  1043  QQACKDWADQYAFSDELFARISRSMDYQSQLASNALALVNR--NTEISAAGRQLSEEdid  870
              Q C+D   +   SD L   +S ++   S+L SN L+ +N+    E S  G         
Sbjct  131   LQTCQDGFIELGVSDYLLPSMSNNV---SKLISNTLS-INKVPYAEPSYKG---------  177

Query  869   ddddggffpDWVSGRDLRLLETTTDKTKANVVVAKDGTGNFRTVAEAIGAASGRQ---RF  699
                    +P WV   D +LL++++  ++AN+VV+KDG+G++ T+  AI AAS R    R+
Sbjct  178   ------GYPTWVKPGDRKLLQSSSLASQANIVVSKDGSGDYTTIGAAITAASKRSGSGRY  231

Query  698   VIYVKSGVYKEKIR--SSKDGITLIGDGKYSTIITWDDSVGGGSSLTGSATFGITGDGFI  525
             VIYVK+G Y E ++  S    I L+GDG   TI+T   SVGGGS+   SAT  + GDGFI
Sbjct  232   VIYVKAGTYSENVQIGSGLKNIMLLGDGIGKTIVTGSKSVGGGSTTFKSATVAVVGDGFI  291

Query  524   AKDIGFQNTAGPGAHQAVALTVASDHSVFYRCSISGYQDTLYALSLRQFYRECDISGTVD  345
             A+ + F+NTAG   HQAVAL   SD SV+Y+CS  GYQDTLY  S RQFYRECDI GTVD
Sbjct  292   ARGMTFRNTAGASNHQAVALRSGSDLSVYYQCSFEGYQDTLYTYSERQFYRECDIYGTVD  351

Query  344   FIFGNAAAVFQACNLVLRR-PSSYNVILANGRSDPGQNTGFSVQKCKITPGPDFSPVKNS  168
             FIFGNAA VFQ CN+  R  P+  N + A GR+DP QNTG S+  CK+T   D  PV++S
Sbjct  352   FIFGNAAVVFQNCNIYARNPPNKINTVTAQGRTDPNQNTGISIHDCKVTAASDLKPVQSS  411

Query  167   YNSYLGRPWKPYSRAVVMESDIDGAISARGWIEWPGTSSSSVRELYFGEYANVG  6
               +YLGRPWK YSR V +++ +D  I++ GW+EW G    ++  LY+GEY N G
Sbjct  412   VKTYLGRPWKEYSRTVFLKTYLDSLINSAGWLEWSG--DFALNTLYYGEYMNTG  463



>ref|XP_010654104.1| PREDICTED: pectinesterase [Vitis vinifera]
Length=534

 Score =   324 bits (831),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 176/370 (48%), Positives = 237/370 (64%), Gaps = 15/370 (4%)
 Frame = -2

Query  1079  DIQTWLSAAVTFQQACKD-WADQYAFSDEL--FARISRSMDYQSQLASNALALVNRNTEI  909
             D QTWLSAA+  QQ C D + D    SD+   F  +S S    S+L SN+LA+      +
Sbjct  121   DSQTWLSAAIANQQTCLDGFIDFNPSSDQFQSFPSMSISTSNFSKLLSNSLAI--NKAAV  178

Query  908   SAAGRQLSEEdidddddggffpDWVSGRDLRLLETTTDKTKANVVVAKDGTGNFRTVAEA  729
             SA     + +          FP WVS  D +LL+++   ++A++VVA DG+GN++T++EA
Sbjct  179   SATSILSNNQAGGRRLLSNGFPTWVSAADRKLLQSSGAASRADIVVAHDGSGNYKTISEA  238

Query  728   IGAA----SGRQRFVIYVKSGVYKE--KIRSSKDGITLIGDGKYSTIITWDDSVGGGSSL  567
             + A+    SG +RFVIYVK+GVY+E  +I+     I +IGDGK +TI+T + +V  GS+ 
Sbjct  239   VAASVKLRSGTKRFVIYVKAGVYRENVEIKRKMKNIMIIGDGKDATIVTGNKNVQDGSTT  298

Query  566   TGSATFGITGDGFIAKDIGFQNTAGPGAHQAVALTVASDHSVFYRCSISGYQDTLYALSL  387
               SATF ++G GFIA+D+ F+NTAGP  HQAVAL  +SD SVFY CS  GYQDTLY  + 
Sbjct  299   FRSATFAVSGHGFIARDMTFENTAGPEKHQAVALRSSSDGSVFYGCSFKGYQDTLYVHTQ  358

Query  386   RQFYRECDISGTVDFIFGNAAAVFQACNLVLRRPSSY--NVILANGRSDPGQNTGFSVQK  213
             RQFYR CD+ GTVDFIFG+A AV Q CN+ +RRP S   NVI A GRSD  +NTG S+  
Sbjct  359   RQFYRSCDVYGTVDFIFGDAVAVLQNCNIYVRRPMSNQANVITAQGRSDQNENTGISIHN  418

Query  212   CKITPGPDFSPVKNSYNSYLGRPWKPYSRAVVMESDIDGAISARGWIEWPGTSSSSVREL  33
              ++   PD  PV++ + +YLGRPW+ YSR V M++ +DG I   GW  W G    S   L
Sbjct  419   SRVMAAPDLRPVQSRFKTYLGRPWRKYSRTVFMKTSLDGLIHPEGWSPWKGDFGLST--L  476

Query  32    YFGEYANVGA  3
             Y+GEY N G+
Sbjct  477   YYGEYMNTGS  486



>emb|CAD29733.1| pectin methylesterase [Sesbania rostrata]
Length=554

 Score =   325 bits (832),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 180/400 (45%), Positives = 245/400 (61%), Gaps = 24/400 (6%)
 Frame = -2

Query  1178  AIGYCEELMGMARQRLNEALVAMKESPGKNRQEDIQTWLSAAVTFQQACKDWAD---QYA  1008
             A+  CE+LM ++  R+ +++VA+ ++   + Q+D  +WLS+ +T    C D  +   +  
Sbjct  121   ALHDCEQLMDLSIDRVWDSVVALTKNT-IDSQQDTHSWLSSVLTNHATCLDGLEGTSRAL  179

Query  1007  FSDELFARISRSMDYQSQLASNALALVNRNTEISAAGRQLSEEdidddddggffpDWVSG  828
                EL   +SR+   ++ LA     L  +  E      Q  +E ++ D        WV+ 
Sbjct  180   MEAELEDLMSRA---RTSLAMLVAVLPPKGNE------QFIDESLNGDFPS-----WVTS  225

Query  827   RDLRLLETTTDKTKANVVVAKDGTGNFRTVAEAIGAA--SGRQRFVIYVKSGVYKEKIR-  657
             +D RLLE++    KANVVVAKDG+G F+TVAEAI +A  +G+ R+VIYVK G YKE +  
Sbjct  226   KDRRLLESSIRDIKANVVVAKDGSGKFKTVAEAIASAPDNGKTRYVIYVKKGTYKENVEI  285

Query  656   -SSKDGITLIGDGKYSTIITWDDSVGGGSSLTGSATFGITGDGFIAKDIGFQNTAGPGAH  480
                K  + L+GDG  +T+IT + +V  GS+   SAT    GDGFIA+DI FQNTAGP  H
Sbjct  286   GKKKTNVMLVGDGMDATVITGNLNVIDGSTTFKSATVAAVGDGFIAQDIWFQNTAGPQKH  345

Query  479   QAVALTVASDHSVFYRCSISGYQDTLYALSLRQFYRECDISGTVDFIFGNAAAVFQACNL  300
             QAVAL V +D SV  RC +  +QDTLYA S RQFYR+  I+GTVDFIFGNA  VFQ C L
Sbjct  346   QAVALRVGADQSVINRCRMDAFQDTLYAHSNRQFYRDSFITGTVDFIFGNAPVVFQKCKL  405

Query  299   VLRRP--SSYNVILANGRSDPGQNTGFSVQKCKITPGPDFSPVKNSYNSYLGRPWKPYSR  126
             V R+P  +  N++ A GR DP QNTG S+Q+C +TP  D  PV  S  ++LGRPWK +SR
Sbjct  406   VARKPMNNQKNMVTAQGREDPNQNTGTSIQQCDVTPSSDLKPVVGSIKTFLGRPWKKFSR  465

Query  125   AVVMESDIDGAISARGWIEWPGTSSSSVRELYFGEYANVG  6
              VV++S +D  I   GW EW   S   +  LY+GEY N G
Sbjct  466   TVVLQSFVDNHIDPTGWAEWDAQSKDFLNTLYYGEYMNNG  505



>gb|KHG19575.1| Uncharacterized protein F383_07269 [Gossypium arboreum]
Length=519

 Score =   323 bits (828),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 192/467 (41%), Positives = 263/467 (56%), Gaps = 32/467 (7%)
 Frame = -2

Query  1385  DQIRIQCGYTRFPRLCVQTLSGLVSGERVDFAAALLLNKTIAHADLHIAHFDQLSSHFVS  1206
             + +R  C  T  P+ C   LS     ++          K   H  L  A   + ++H + 
Sbjct  29    NDVRSWCRKTPNPQPCEYFLSH--DPKKTPIKDEFQFFKISTHLALERAARAESNTHSLG  86

Query  1205  SQPPQPRLQAI-GYCEELMGMARQRLNEALVAMKESPGKNRQEDIQTWLSAAVTFQQACK  1029
             ++    R +A    C  L  +   RLN+ +    +S     ++D QTWLS A+T  + C+
Sbjct  87    TKCRNEREKAAWSDCVNLYELTILRLNKTV----DSGTNLNKDDAQTWLSTALTNLETCR  142

Query  1028  DWADQYAFSDELFARISRSMDYQSQLASNALALVNRNTEISAAGRQLSEEdidddddggf  849
                 +    D L   +S ++   SQL SN LAL              ++    +      
Sbjct  143   TGFMELGVPDYLLPMMSNNV---SQLISNTLAL--------------NKAPYKEPTYKDG  185

Query  848   fpDWVSGRDLRLLETTTDKTKANVVVAKDGTGNFRTVAEAIGAASGRQ---RFVIYVKSG  678
             FP WV   D +LL++++  + AN+VVA+DG+GN++T+ +AI AAS R    R+VIYVK+G
Sbjct  186   FPTWVKPGDRKLLQSSSPASTANIVVAQDGSGNYKTIKDAISAASKRSGSGRYVIYVKAG  245

Query  677   VYKEKIR--SSKDGITLIGDGKYSTIITWDDSVGGGSSLTGSATFGITGDGFIAKDIGFQ  504
              YKE +   S    I ++GDG   TIIT   SVGGGS+   SAT  + GDGFIA+ I F+
Sbjct  246   TYKENVEIGSKLKNIMMVGDGIGKTIITGSKSVGGGSTTFNSATVAVVGDGFIARGITFR  305

Query  503   NTAGPGAHQAVALTVASDHSVFYRCSISGYQDTLYALSLRQFYRECDISGTVDFIFGNAA  324
             NTAGP  HQAVAL   SD SVFY+CS  GYQDTLY  S RQFYRECDI GTVD+IFGNAA
Sbjct  306   NTAGPTNHQAVALRSGSDLSVFYKCSFEGYQDTLYVHSERQFYRECDIYGTVDWIFGNAA  365

Query  323   AVFQACNLVLRR-PSSYNVILANGRSDPGQNTGFSVQKCKITPGPDFSPVKNSYNSYLGR  147
              VFQ CN+  R  P+  N + A GR+DP QNTG  +   ++T   D  PV++S  +YLGR
Sbjct  366   VVFQDCNIYARNPPNKTNTVTAQGRTDPNQNTGIIIHNSRVTAASDLKPVQSSVKTYLGR  425

Query  146   PWKPYSRAVVMESDIDGAISARGWIEWPGTSSSSVRELYFGEYANVG  6
             PWK YSR V M++ +D  I+  GW+EW G    +++ LY+ EY N G
Sbjct  426   PWKQYSRTVFMKTYLDSLINPAGWMEWDG--DFALKTLYYAEYMNTG  470



>ref|XP_007157169.1| hypothetical protein PHAVU_002G048400g [Phaseolus vulgaris]
 gb|ESW29163.1| hypothetical protein PHAVU_002G048400g [Phaseolus vulgaris]
Length=549

 Score =   323 bits (829),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 179/406 (44%), Positives = 244/406 (60%), Gaps = 27/406 (7%)
 Frame = -2

Query  1193  QPRLQA-IGYCEELMGMARQRLNEALVAMKESPGKNRQEDIQTWLSAAVTFQQACKDWAD  1017
              PR +A +  C ELM ++ +R+ ++  ++ +    +  ED  TWLS+ +T    C D  +
Sbjct  112   NPREEAALRDCVELMELSMERVRDSKASLAKDTA-DSVEDAHTWLSSVLTNHVTCLDGLE  170

Query  1016  QY---AFSDELFARISRSMDYQSQLASNALALVNRNTEISAAGRQLSEEdidddddggff  846
             +       +E+   ISR+    + L +  L    +  E+S  G+  S             
Sbjct  171   ERGGRVMEEEVQELISRARTSLAMLVA-VLPPNPKVEEVSENGKFPS-------------  216

Query  845   pDWVSGRDLRLLETTTDKTKANVVVAKDGTGNFRTVAEAIGAA--SGRQRFVIYVKSGVY  672
               WV  RD +LLE+   +  ANVVVAKDG+G+F+TVAEA+ +A    ++R+VI+VKSG Y
Sbjct  217   --WVRSRDRKLLESWAGEITANVVVAKDGSGDFKTVAEAVASAPEKSKKRYVIHVKSGTY  274

Query  671   KEKIR--SSKDGITLIGDGKYSTIITWDDSVGGGSSLTGSATFGITGDGFIAKDIGFQNT  498
             KE +     K  + L+GDG  +TIIT   +   G+    +AT    GDGFIA+DI FQNT
Sbjct  275   KENVEIGKRKKNVMLVGDGMNTTIITGSLNFIDGTGTFRTATVAAVGDGFIAQDIWFQNT  334

Query  497   AGPGAHQAVALTVASDHSVFYRCSISGYQDTLYALSLRQFYRECDISGTVDFIFGNAAAV  318
             AGP  HQAVAL V SD SV  RC +  YQDTLYA S RQFYR+  I+GT+DFIFGNAAAV
Sbjct  335   AGPEKHQAVALRVGSDESVINRCRVDAYQDTLYAHSNRQFYRDSFIAGTIDFIFGNAAAV  394

Query  317   FQACNLVLRRP--SSYNVILANGRSDPGQNTGFSVQKCKITPGPDFSPVKNSYNSYLGRP  144
             FQ C L  R+P  S  N++ A GR+DP QNTG S+Q+C+++P  D  PV +S+ +YLGRP
Sbjct  395   FQNCKLEARKPMSSQKNMVTAQGRTDPNQNTGTSIQQCELSPCADLRPVIDSFKTYLGRP  454

Query  143   WKPYSRAVVMESDIDGAISARGWIEWPGTSSSSVRELYFGEYANVG  6
             WK +SR VVM+S +D  I   GW EW     S +  LY+GEY N G
Sbjct  455   WKNFSRTVVMQSFLDKHIDPEGWAEWDAEHKSYLETLYYGEYMNKG  500



>ref|XP_010098938.1| Pectinesterase 2 [Morus notabilis]
 gb|EXB76240.1| Pectinesterase 2 [Morus notabilis]
Length=518

 Score =   322 bits (826),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 203/475 (43%), Positives = 270/475 (57%), Gaps = 54/475 (11%)
 Frame = -2

Query  1382  QIRIQCGYTRFPRLCVQTLSGLVSGERV------DF---AAALLLNKTI-AHADLHIAHF  1233
             +++  CG T  P+ C   LS  +  +R       DF   +A L L++ + AH DL     
Sbjct  34    EVKSWCGQTPNPQPCEYFLSNNLEYDRTPIKQKSDFFKLSAKLALDRAMHAHDDLF----  89

Query  1232  DQLSSHFVSSQPPQPRLQ----AIGYCEELMGMARQRLNEALVAMKESPGKNRQEDIQTW  1065
                      S  P+ R Q    A   C EL      RLN+      +   K  Q+D+QTW
Sbjct  90    ---------SVGPKCRSQQEKAAWADCLELYESTVLRLNKT----SKPTSKCTQDDLQTW  136

Query  1064  LSAAVTFQQACKDWADQYAFSDELFARISRSMDYQSQLASNALALVNRNTEISAAGRQLS  885
             LS A+T  + C+    +   SD L   +S ++   S+L SN+LA +N++           
Sbjct  137   LSTALTNLETCRAGLLELGVSDYLLPLMSNNV---SKLISNSLA-INKS-----------  181

Query  884   EEdidddddggffpDWVSGRDLRLLETTTDK-TKANVVVAKDGTGNFRTVAEAIGAASGR  708
                  D+     FP WV   D RLL++++   ++ANVVVAKDG+G++ TV  A+ A  G 
Sbjct  182   -PYKPDNKYNNGFPTWVKPGDRRLLQSSSSPASRANVVVAKDGSGDYTTVKAAVTAVKGS  240

Query  707   QRFVIYVKSGVYKEKIRSSKDGITLIGDGKYSTIITWDDSVGGGSSLTGSATFGITGDGF  528
              RFVIYVK+G Y E +      + L+GDG   TIIT   SVGGGS+   SAT  + GDGF
Sbjct  241   GRFVIYVKAGTYNENVEIKVKNVMLLGDGIGKTIITGSKSVGGGSTTFQSATVAVVGDGF  300

Query  527   IAKDIGFQNTAGPGAHQAVALTVASDHSVFYRCSISGYQDTLYALSLRQFYRECDISGTV  348
             IA+DI F+NTAG   HQAVAL   SD SVFY+CS  GYQDTLY  S RQFYRECDI GTV
Sbjct  301   IAQDITFRNTAGASNHQAVALRSGSDQSVFYKCSFEGYQDTLYVHSERQFYRECDIYGTV  360

Query  347   DFIFGNAAAVFQACNLVLRR-PSSYNVILANGRSDPGQNTGFSVQKCKITPGPDFSPVKN  171
             DFIFGNAA V Q CN+  R  P+  N I A GR+D  QNTG S+  C++T     S + +
Sbjct  361   DFIFGNAAVVLQNCNIYARDPPNKTNTITAQGRTDSNQNTGISIHNCRVTAA---SSLSS  417

Query  170   SYNSYLGRPWKPYSRAVVMESDIDGAISARGWIEWPGTSSSSVRELYFGEYANVG  6
             S  +YLGRPWK YSR VVM++++   I+  GW+EW G  + +++ LY+ EYAN G
Sbjct  418   SVKTYLGRPWKEYSRTVVMKTNLGSLINPAGWLEWSG--NFALKTLYYAEYANTG  470



>gb|KDP38089.1| hypothetical protein JCGZ_04732 [Jatropha curcas]
Length=543

 Score =   323 bits (828),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 194/481 (40%), Positives = 269/481 (56%), Gaps = 42/481 (9%)
 Frame = -2

Query  1367  CGYTRFPRLCVQTLSGLVSGERVDFAAALLLNKTIAHADLHI--AHFDQLSSHFVSSQPP  1194
             C  T +P +C   ++  +     D       ++++     H   AH   LS     S   
Sbjct  31    CSQTPYPEICNHFMNTNILETEKDQTPFTFRDQSLLVTMNHAIKAHQMILSLEMNDSFDE  90

Query  1193  QPRLQAIGYCEELMGMARQRLNEALVAMKESPGKNRQEDIQTWLSAAVTFQQACKDWADQ  1014
             + +L A   C EL       LN +L     S   N   D QTWLSAA T  Q C++   +
Sbjct  91    KAKL-ARADCVELYEDTIDHLNRSLFV--SSSNNNNPVDSQTWLSAANTNLQTCQNGFTE  147

Query  1013  YAFSDELFARI--SRSMDYQSQLASNALALVNRNTEIS--------------AAGRQLSE  882
             +  +      +     +   S+L SN+LA+   N  IS                GR+L  
Sbjct  148   FNLTSNYLESLLLPDMLSNFSKLLSNSLAINKENYYISPLYNSKTVHPGSSGGGGRKLLH  207

Query  881   EdidddddggffpDWVSGRDLRLLETTTDKTKANVVVAKDGTGNFRTVAEAIGAA----S  714
             +D            WVS  D +LL+++ +   A++VVA+DG+GN++T+ EA+ A+    S
Sbjct  208   DDEFPW--------WVSVTDRKLLQSSPE---ADIVVAQDGSGNYKTIGEAVAASATRRS  256

Query  713   GRQRFVIYVKSGVYKE--KIRSSKDGITLIGDGKYSTIITWDDSVGGGSSLTGSATFGIT  540
             G +RFVIYVK GVYKE  +I++S + + LIGDG  +TI+T + +   GS+   SATF ++
Sbjct  257   GNKRFVIYVKKGVYKEYVEIKNSMNNLMLIGDGIDATIVTGNKNNQDGSTTFRSATFAVS  316

Query  539   GDGFIAKDIGFQNTAGPGAHQAVALTVASDHSVFYRCSISGYQDTLYALSLRQFYRECDI  360
             G+GFIAKDI F+NTAGP  HQAVAL   SD SVFY CS  GYQDTLY  S RQFYR+CDI
Sbjct  317   GEGFIAKDITFENTAGPQKHQAVALRSGSDFSVFYSCSFKGYQDTLYVYSQRQFYRDCDI  376

Query  359   SGTVDFIFGNAAAVFQACNLVLRRPSS--YNVILANGRSDPGQNTGFSVQKCKITPGPDF  186
              GTVDFIFGNA  VFQ CN+ +R+P S   N + A  R+DP +NTG  +   ++T   D 
Sbjct  377   YGTVDFIFGNAVVVFQNCNIYVRKPMSGQKNTVTAQARTDPNENTGIIIHNSRVTAASDL  436

Query  185   SPVKNSYNSYLGRPWKPYSRAVVMESDIDGAISARGWIEWPGTSSSSVRELYFGEYANVG  6
              PV+ S+ SYLGRPW+ YSR V+++S++DG I   GW+ W G  + S   LY+ EY N G
Sbjct  437   RPVQGSFKSYLGRPWQEYSRTVILKSNLDGLIDPAGWLPWSGNFALST--LYYAEYMNSG  494

Query  5     A  3
             +
Sbjct  495   S  495



>ref|XP_006841486.1| hypothetical protein AMTR_s00003p00120050 [Amborella trichopoda]
 gb|ERN03161.1| hypothetical protein AMTR_s00003p00120050 [Amborella trichopoda]
Length=540

 Score =   323 bits (827),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 191/439 (44%), Positives = 259/439 (59%), Gaps = 23/439 (5%)
 Frame = -2

Query  1286  ALLLNKTIAHADLHIAHFDQLSSHFVSSQPPQPRLQAIGYCEELMGMARQRLNEALVAMK  1107
             A  LN T   A   I+    LS    S+  P  R  A+  CEEL+  +   ++  L  + 
Sbjct  63    AATLNLTAKSATEAISSCSNLSHEISSTDLPDQR--ALSDCEELLSTSLGDISSCLADLS  120

Query  1106  ESPGKNRQEDIQTWLSAAVTFQQACKDWADQYAFSDE-LFARISRSMDYQSQLASNALAL  930
              S  ++    +QT+LSAA+T Q  C    D +++++  L +RI  ++   S+  SN+LA+
Sbjct  121   NSSSRSSSIHLQTFLSAAITNQYTC---LDGFSYANHTLRSRIEANIVNISRHISNSLAM  177

Query  929   VN--RNTEI---SAAGRQLSEEdidddddggffpDWVSGRDLRLLETTTDKTKANVVVAK  765
                 R +E+   S +G    E         G FP W+  +D RLL+ + ++T A++VVAK
Sbjct  178   FKKVRASELPENSDSGEVFEE----YGRVDGGFPAWIPPKDRRLLQASANQTNADLVVAK  233

Query  764   DGTGNFRTVAEAIGAA--SGRQRFVIYVKSGVYKEKIR--SSKDGITLIGDGKYSTIITW  597
             DG+G+F T++EAI     +G+ RFVIY+K+G Y E +     K  + LIGDG   T++  
Sbjct  234   DGSGDFTTISEAIAKVPDNGKTRFVIYIKTGEYLENVDVGEKKTNLMLIGDGIEKTVVKA  293

Query  596   DDSVGGGSSLTGSATFGITGDGFIAKDIGFQNTAGPGAHQAVALTVASDHSVFYRCSISG  417
               +V  G +   SATF + G  FIA+D+ F+N+AGP  HQAVAL   +D S FYRCS  G
Sbjct  294   SRNVVDGWTTFRSATFAVVGSNFIARDMSFENSAGPSKHQAVALRSGADLSAFYRCSFVG  353

Query  416   YQDTLYALSLRQFYRECDISGTVDFIFGNAAAVFQACNLVLRR--PSSYNVILANGRSDP  243
             YQDTLY  SLRQFYRECD+ GTVDFIFGNAA V Q CNL  RR  P+  N+  A GR DP
Sbjct  354   YQDTLYVHSLRQFYRECDVYGTVDFIFGNAAVVLQDCNLYARRPNPNQRNLFTAQGRVDP  413

Query  242   GQNTGFSVQKCKITPGPDFSPVKNSYNSYLGRPWKPYSRAVVMESDIDGAISARGWIEWP  63
              QNTG S+Q CK+    D  PV++S+ +YLGRPWK YSR + M+SDI   I   GW EW 
Sbjct  414   NQNTGISIQNCKVAAAADLIPVQSSFKNYLGRPWKQYSRTIFMQSDIGDLIDPAGWFEWS  473

Query  62    GTSSSSVRELYFGEYANVG  6
             G  + S   LY+GEY N G
Sbjct  474   GDFALST--LYYGEYMNRG  490



>ref|XP_008812473.1| PREDICTED: pectinesterase-like [Phoenix dactylifera]
Length=515

 Score =   322 bits (825),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 181/402 (45%), Positives = 246/402 (61%), Gaps = 46/402 (11%)
 Frame = -2

Query  1166  CEELMGMARQRLNEALVAMKESPGKNRQEDIQTWLSAAVTFQQACK----DWADQYAFSD  999
             CE+ +G    +LN ++         +  +D QTWLSAA+  QQ C+    +    + F  
Sbjct  98    CEDTIG----KLNRSM-------SSSSYDDAQTWLSAAMANQQTCRNGFIELGSSFPFGS  146

Query  998   ELFA--RISRSMDYQSQLASNALALVNRNTEISAAG--RQLSEEdidddddggffpDWVS  831
               F    IS S+       SN+LA+    T   + G  R LS          G FP+W+S
Sbjct  147   SPFTSYNISESL-------SNSLAINKATTAAKSGGNRRLLS----------GGFPNWLS  189

Query  830   GRDLRLLETTTDKTKANVVVAKDGTGNFRTVAEAIGAAS----GRQRFVIYVKSGVYKEK  663
               D +LL ++T    A++VVAKDG+GN++T++EAI AA+    GR RFVI+VK+GVY E 
Sbjct  190   AADRKLLHSST--INADLVVAKDGSGNYKTISEAIAAATKQSNGRSRFVIHVKAGVYNEN  247

Query  662   IRSSKDGITLIGDGKYSTIITWDDSVGGGSSLTGSATFGITGDGFIAKDIGFQNTAGPGA  483
             +++    + ++GDG  +T++T   +V  GS+   SATF +TGDGFIA+D+ FQNTAGP  
Sbjct  248   VQTPMKNLMIVGDGMNATVVTGSRNVQDGSTTFRSATFAVTGDGFIARDMTFQNTAGPHK  307

Query  482   HQAVALTVASDHSVFYRCSISGYQDTLYALSLRQFYRECDISGTVDFIFGNAAAVFQACN  303
             HQAVAL   SD SVFYRCS  GYQDTLY  S RQFYR CD+ GTVDFIFG+AA V Q C+
Sbjct  308   HQAVALRSGSDLSVFYRCSFEGYQDTLYIYSQRQFYRNCDVYGTVDFIFGDAAVVLQNCS  367

Query  302   LVLRRPSS--YNVILANGRSDPGQNTGFSVQKCKITPGPDFSPVKNSYNSYLGRPWKPYS  129
             + +R+P S   N + A GR+DP +NTG S+    +T   +  PV+ S+ +YLGRPWK YS
Sbjct  368   MYVRKPMSGQKNTVTAQGRTDPNENTGISIHDSAVTAASELKPVQGSFKTYLGRPWKKYS  427

Query  128   RAVVMESDIDGAISARGWIEWPGTSSSSVRELYFGEYANVGA  3
             R V M++ +D  I   GW+EW G  + S   LY+GEY N GA
Sbjct  428   RTVFMKTSLDCLIDPAGWLEWSGNFALST--LYYGEYMNTGA  467



>gb|KHN35617.1| Pectinesterase 2 [Glycine soja]
Length=511

 Score =   321 bits (823),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 198/470 (42%), Positives = 258/470 (55%), Gaps = 43/470 (9%)
 Frame = -2

Query  1385  DQIRIQCGYTRFPRLCVQTLSGLVS------GERVDFAAALLLNKTIAHADLHIAHFDQL  1224
             + +++ C  T  P  C   LS   +       ++ DF     L+  +A       H + L
Sbjct  26    NDVKLWCSQTPNPEPCEYFLSNNPTHQYKPIKQKSDF---FKLSLQLAQERALNGHANTL  82

Query  1223  SSHFVSSQPPQPR-LQAIGYCEELMGMARQRLNEALVAMKESPGKNRQEDIQTWLSAAVT  1047
             S   + S+   PR   A   C EL     ++LN+ L    +   K  Q D QTWLS A+T
Sbjct  83    S---LGSKCRNPRETAAWADCVELYEQTIRKLNKTL----DPSTKFSQVDTQTWLSTALT  135

Query  1046  FQQACKDWADQYAFSDELFARISRSMDYQSQLASNALALVNRNTEISAAGRQLSEEdidd  867
               + CK    +    D +   +S ++   ++L SN LAL     E  +            
Sbjct  136   NLETCKAGFYELGVQDYVLPLMSNNV---TKLLSNTLALNKVEYEEPSYKDGFP------  186

Query  866   dddggffpDWVSGRDLRLLETTTDKTKANVVVAKDGTGNFRTVAEAIGAA--SGRQRFVI  693
                      WV   D RLL+ ++  +KANVVVAKDG+G + TV+EA+ AA  S   R+VI
Sbjct  187   --------TWVKPGDRRLLQASSPASKANVVVAKDGSGKYTTVSEAVNAAPKSNSGRYVI  238

Query  692   YVKSGVYKEKIRSSKDGITLIGDGKYSTIITWDDSVGGGSSLTGSATFGITGDGFIAKDI  513
             YVK G+Y E++    + I L+GDG   TIIT   SVGGG++   SAT  + GDGFI +DI
Sbjct  239   YVKGGIYDEQVEIKANNIMLVGDGIGKTIITSSKSVGGGTTTFRSATVAVVGDGFITQDI  298

Query  512   GFQNTAGPGAHQAVALTVASDHSVFYRCSISGYQDTLYALSLRQFYRECDISGTVDFIFG  333
              F+NTAG   HQAVAL   SD SVFYRCS  GYQDTLY  S RQFYRECDI GTVDFIFG
Sbjct  299   TFRNTAGATNHQAVALRSGSDLSVFYRCSFEGYQDTLYVYSDRQFYRECDIYGTVDFIFG  358

Query  332   NAAAVFQACNLVLRR-PSSYNVILANGRSDPGQNTGFSVQKCKITPGPDFSPVKNSYNSY  156
             NAA VFQ CN+  R  P+  N I A GR+DP QNTG S+   K+T   D   V+    +Y
Sbjct  359   NAAVVFQNCNIYARNPPNKVNTITAQGRTDPNQNTGISIHNSKVTAASDLMGVR----TY  414

Query  155   LGRPWKPYSRAVVMESDIDGAISARGWIEWPGTSSSSVRELYFGEYANVG  6
             LGRPW+ YSR V M++ +D  I+  GW+EW G  + S   LY+GEY N G
Sbjct  415   LGRPWQQYSRTVFMKTYLDSLINPEGWLEWSGNFALST--LYYGEYMNTG  462



>ref|XP_010264200.1| PREDICTED: pectinesterase 2-like [Nelumbo nucifera]
Length=516

 Score =   321 bits (823),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 183/394 (46%), Positives = 242/394 (61%), Gaps = 31/394 (8%)
 Frame = -2

Query  1166  CEELMGMARQRLNEALVAMKESPGKNRQE-DIQTWLSAAVTFQQACKDWADQYAFSDELF  990
             C EL      RLN  +     +P  +  + D QTWLS A+T  + C++   +   +D + 
Sbjct  98    CLELYENTIIRLNRTV-----NPSASCTDVDFQTWLSTALTNLETCRNGFMELGVTDYVL  152

Query  989   ARISRSMDYQSQLASNALALVNRNTEISAAGRQLSEEdidddddggffpDWVSGRDLRLL  810
               +S ++   S+L SN+LA+              ++           FP WV   D +LL
Sbjct  153   PLMSNNV---SKLISNSLAI--------------NKPPPSPQAYTEGFPSWVKPGDRKLL  195

Query  809   ETTTDKTKANVVVAKDGTGNFRTVAEAIGAASGRQR---FVIYVKSGVYKE--KIRSSKD  645
             +T++  ++AN+VVA+DG+GNF+TV EAI AAS ++R   FVIYVK+G YKE  +I +  +
Sbjct  196   QTSSPTSQANLVVAQDGSGNFKTVNEAISAASKQKRSGRFVIYVKAGTYKENLQIGNKLN  255

Query  644   GITLIGDGKYSTIITWDDSVGGGSSLTGSATFGITGDGFIAKDIGFQNTAGPGAHQAVAL  465
              I LIGDG   T+IT   SVGGGS+   SAT  + GDGFIA+DI F+N+AGP   QAVAL
Sbjct  256   NIMLIGDGIGKTVITGSKSVGGGSTTFNSATVAVLGDGFIARDITFRNSAGPANGQAVAL  315

Query  464   TVASDHSVFYRCSISGYQDTLYALSLRQFYRECDISGTVDFIFGNAAAVFQACNLVLRRP  285
                SD SVFYRC   GYQDTLY  S RQFYRECDI GTVDFIFGNAA VFQ CN+  R+P
Sbjct  316   RSGSDLSVFYRCGFEGYQDTLYVHSNRQFYRECDIYGTVDFIFGNAAVVFQNCNMFARKP  375

Query  284   -SSYNVILANGRSDPGQNTGFSVQKCKITPGPDFSPVKNSYNSYLGRPWKPYSRAVVMES  108
              +S   + A GRSDP QNTG  +   +IT   D  PV++S  +YLGRPW+ YSR VV+++
Sbjct  376   KNSIVTVTAQGRSDPNQNTGIVIHNSRITAASDLKPVQSSVKTYLGRPWRQYSRTVVLKT  435

Query  107   DIDGAISARGWIEWPGTSSSSVRELYFGEYANVG  6
              +D  I   GW+ W G  S ++  LY+GEY N G
Sbjct  436   FLDSLIQPAGWLPWSG--SFALSTLYYGEYQNTG  467



>ref|XP_010273801.1| PREDICTED: pectinesterase [Nelumbo nucifera]
Length=580

 Score =   323 bits (827),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 192/479 (40%), Positives = 268/479 (56%), Gaps = 33/479 (7%)
 Frame = -2

Query  1379  IRIQCGYTRFPRLCVQTLSGLVSGERVDFAA-----ALLLNKTIAHADLHIAHFDQLSSH  1215
             ++  C  T +P LC   ++  V G   + +       + LN T    + +     +L +H
Sbjct  65    LKSSCSSTLYPDLCYSAIA-TVPGAADNLSTQKDVIEISLNITTTAVEHNYFTIKKLLAH  123

Query  1214  FVSSQPPQPRLQAIGYCEELMGMARQRLNEALVAMKESPGKN----RQEDIQTWLSAAVT  1047
                 +  +    A+  C E++      L+E    +K+ P K       ED++  LSAA+T
Sbjct  124   ---EKLTEREKTALHDCLEMVDETLDELHETAEDLKQYPNKKSLDEHAEDLKILLSAAMT  180

Query  1046  FQQACKDWADQYAFSDELFARISRSMDYQSQLASNALALVNRNTEISAA------GRQLS  885
              Q  C D         E+   + +  ++   + SNALA++   T+   A      GR+L 
Sbjct  181   NQDTCIDGFSHEQADKEVRNALLKGQEHVYHMCSNALAMIKNMTDTDMAEEKLKMGRKLG  240

Query  884   EEdidddddggffpDWVSGRDLRLLETTTDKTKANVVVAKDGTGNFRTVAEAIGAA--SG  711
             E   + D   G    W+S  D RLL+ +T     +V VA DG+GN++TV+EA+ AA  + 
Sbjct  241   ESTGEIDGFPG----WLSAGDRRLLQAST--VTPDVTVASDGSGNYKTVSEAVAAAPINS  294

Query  710   RQRFVIYVKSGVYKEKIRSSKD--GITLIGDGKYSTIITWDDSVGGGSSLTGSATFGITG  537
              +R++I +K+GVYKE +  SK    I  +GDG+ +TIIT   +V  GS+   SAT    G
Sbjct  295   NKRYIIRIKAGVYKENVDVSKKKKNIMFVGDGRKNTIITGSRNVVDGSTTFHSATVAAVG  354

Query  536   DGFIAKDIGFQNTAGPGAHQAVALTVASDHSVFYRCSISGYQDTLYALSLRQFYRECDIS  357
             +GF+A+DI FQNTAGP  HQAVAL V SD S FYRC +  YQDTLY  SLRQFY +C I 
Sbjct  355   EGFLARDITFQNTAGPSKHQAVALRVGSDKSAFYRCDMLAYQDTLYVHSLRQFYVDCLIV  414

Query  356   GTVDFIFGNAAAVFQACNLVLRRPSS--YNVILANGRSDPGQNTGFSVQKCKITPGPDFS  183
             GTVDFIFGNAAAVFQ C++  RRP+S   N++ A GR DP QNTG  +Q C+I    D  
Sbjct  415   GTVDFIFGNAAAVFQNCDIHARRPNSGQKNMLTAQGRDDPNQNTGIVIQNCRIAATSDLQ  474

Query  182   PVKNSYNSYLGRPWKPYSRAVVMESDIDGAISARGWIEWPGTSSSSVRELYFGEYANVG  6
              VK+S+ +YLGRPWK YSR V+M+S I   I   GW EW G  + ++  LY+ EY N G
Sbjct  475   AVKSSFPTYLGRPWKEYSRTVIMQSTISDVIHPAGWHEWSG--NFALTTLYYAEYQNTG  531



>ref|XP_003521947.1| PREDICTED: pectinesterase 2-like, partial [Glycine max]
Length=506

 Score =   320 bits (821),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 199/486 (41%), Positives = 263/486 (54%), Gaps = 43/486 (9%)
 Frame = -2

Query  1433  CVTTIaaaavsqvaaQDQIRIQCGYTRFPRLCVQTLSGLVS------GERVDFAAALLLN  1272
             C+     ++     + + +++ C  T  P  C   LS   +       ++ DF     L+
Sbjct  5     CIVPFFLSSFVSSYSWNDVKLWCSQTPNPEPCEYFLSNNPTHQYKPIKQKSDF---FKLS  61

Query  1271  KTIAHADLHIAHFDQLSSHFVSSQPPQPR-LQAIGYCEELMGMARQRLNEALVAMKESPG  1095
               +A       H + LS   + S+   PR   A   C EL     ++LN+ L    +   
Sbjct  62    LQLAQERALNGHANTLS---LGSKCRNPRETAAWADCVELYEQTIRKLNKTL----DPST  114

Query  1094  KNRQEDIQTWLSAAVTFQQACKDWADQYAFSDELFARISRSMDYQSQLASNALALVNRNT  915
             K  Q D QTWLS A+T  + CK    +    D +   +S ++   ++L SN LAL     
Sbjct  115   KFSQVDTQTWLSTALTNLETCKAGFYELGVQDYVLPLMSNNV---TKLLSNTLALNKVEY  171

Query  914   EISAAGRQLSEEdidddddggffpDWVSGRDLRLLETTTDKTKANVVVAKDGTGNFRTVA  735
             E  +                     WV   D RLL+ ++  +KANVVVAKDG+G + TV+
Sbjct  172   EEPSYKDGFP--------------TWVKPGDRRLLQASSPASKANVVVAKDGSGKYTTVS  217

Query  734   EAIGAA--SGRQRFVIYVKSGVYKEKIRSSKDGITLIGDGKYSTIITWDDSVGGGSSLTG  561
             EA+ AA  S   R+VIYVK G+Y E++    + I L+GDG   TIIT   SVGGG++   
Sbjct  218   EAVNAAPKSNSGRYVIYVKGGIYDEQVEIKANNIMLVGDGIGKTIITSSKSVGGGTTTFR  277

Query  560   SATFGITGDGFIAKDIGFQNTAGPGAHQAVALTVASDHSVFYRCSISGYQDTLYALSLRQ  381
             SAT  + GDGFI +DI F+NTAG   HQAVAL   SD SVFYRCS  GYQDTLY  S RQ
Sbjct  278   SATVAVVGDGFITQDITFRNTAGATNHQAVALRSGSDLSVFYRCSFEGYQDTLYVYSDRQ  337

Query  380   FYRECDISGTVDFIFGNAAAVFQACNLVLRR-PSSYNVILANGRSDPGQNTGFSVQKCKI  204
             FYRECDI GTVDFIFGNAA VFQ CN+  R  P+  N I A GR+DP QNTG S+   K+
Sbjct  338   FYRECDIYGTVDFIFGNAAVVFQNCNIYARNPPNKVNTITAQGRTDPNQNTGISIHNSKV  397

Query  203   TPGPDFSPVKNSYNSYLGRPWKPYSRAVVMESDIDGAISARGWIEWPGTSSSSVRELYFG  24
             T   D   V+    +YLGRPW+ YSR V M++ +D  I+  GW+EW G  + S   LY+G
Sbjct  398   TAASDLMGVR----TYLGRPWQQYSRTVFMKTYLDSLINPEGWLEWSGNFALST--LYYG  451

Query  23    EYANVG  6
             EY N G
Sbjct  452   EYMNTG  457



>ref|XP_011000694.1| PREDICTED: pectinesterase [Populus euphratica]
Length=557

 Score =   322 bits (825),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 184/398 (46%), Positives = 238/398 (60%), Gaps = 22/398 (6%)
 Frame = -2

Query  1178  AIGYCEELMGMARQRLNEALVAMKESPGKNRQEDIQTWLSAAVTFQQACKDWADQYAFSD  999
             A+G C ELM +++ R+ + +VA++    ++    + TWLS+ +T    C D  +  A S 
Sbjct  128   ALGDCVELMEISKYRIKDTIVALERVTSESHANAL-TWLSSVLTNHDTCLDGLNGPARS-  185

Query  998   ELFARISRSMDYQSQLASNALALVNRNTEISAAGRQLSEEdidddddggffpDWVSGRDL  819
                           +L  N L L  R +    A    S+E+ D       FP W+   D 
Sbjct  186   ------------TMELDLNDLILRARTSLAILAAISPSKENNDIFPLKEDFPSWLPSMDR  233

Query  818   RLLETTTDKTKANVVVAKDGTGNFRTVAEAIGAA--SGRQRFVIYVKSGVYKEKIR--SS  651
             +LL T      A+V VAKDG+G ++TV EA+ +A  +G+ R+VIYVK G YKE +     
Sbjct  234   KLLITLPKDINADVTVAKDGSGKYKTVKEAVASAPDNGKTRYVIYVKKGTYKENVEVGKK  293

Query  650   KDGITLIGDGKYSTIITWDDSVGGGSSLTGSATFGITGDGFIAKDIGFQNTAGPGAHQAV  471
             K  + L+GDG  STIIT + +V  GS+   SAT    GDGFIA+DI FQNTAGP  HQAV
Sbjct  294   KKNVMLVGDGMDSTIITGNLNVVDGSTTFKSATVAAVGDGFIAQDIWFQNTAGPEKHQAV  353

Query  470   ALTVASDHSVFYRCSISGYQDTLYALSLRQFYRECDISGTVDFIFGNAAAVFQACNLVLR  291
             AL V +D SV  RC I  YQDTLY  SLRQFYR+  I+GTVDFIFGNAA V Q C LV R
Sbjct  354   ALRVGADQSVINRCRIDAYQDTLYTHSLRQFYRDSYITGTVDFIFGNAAVVLQNCKLVPR  413

Query  290   RPSS--YNVILANGRSDPGQNTGFSVQKCKITPGPDFSPVKNSYNSYLGRPWKPYSRAVV  117
             +P S   N++ A GR+DP QNTG S+QKC I    D +PVK+S+ SYLGRPWK YSR VV
Sbjct  414   KPMSGQKNMVTAQGRTDPNQNTGTSIQKCDIIASSDLTPVKSSFKSYLGRPWKEYSRTVV  473

Query  116   MESDIDGAISARGWIEWPGTSSSSVRELYFGEYANVGA  3
             M+S+I   I   GW  W G    +++ LY+GEY N GA
Sbjct  474   MQSNIGDLIDPAGWSAWDG--EFALKTLYYGEYLNQGA  509



>ref|XP_010524372.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 17 
[Tarenaya hassleriana]
Length=513

 Score =   320 bits (821),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 185/391 (47%), Positives = 233/391 (60%), Gaps = 28/391 (7%)
 Frame = -2

Query  1166  CEELMGMARQRLNEALVAMKESPGKNRQEDIQTWLSAAVTFQQACKDWADQYAFSDELFA  987
             C +L      +LNE +    +   K  + D QTWLS+A+T  + C+    +    D L  
Sbjct  98    CLKLYDYTVSKLNETI----DPHVKCSKVDAQTWLSSALTNLETCRTGFIELGVPDFLLP  153

Query  986   RISRSMDYQSQLASNALALVNRNTEISAAGRQLSEEdidddddggffpDWVSGRDLRLLE  807
              +S ++   S+L SN LA+     E+       SE    +         WV   D +LL+
Sbjct  154   LMSNNV---SKLISNTLAI----NEVPFNYTPPSENGFPE---------WVRPGDRKLLQ  197

Query  806   TTTDKTKANVVVAKDGTGNFRTVAEAIGAASGRQ---RFVIYVKSGVYKEKIRSSKDGIT  636
             ++T +  AN VVA+DG+GNFRT+ EA+ +AS R    RFVIYVK GVY E I      I 
Sbjct  198   SSTPQ--ANAVVAQDGSGNFRTIKEAVDSASKRSGSGRFVIYVKQGVYNENIEIKAKNIM  255

Query  635   LIGDGKYSTIITWDDSVGGGSSLTGSATFGITGDGFIAKDIGFQNTAGPGAHQAVALTVA  456
             L GDG   TIIT   SVGGG++   SAT  + GDGFIA+ I F+NTAGP   QAVAL   
Sbjct  256   LRGDGIGKTIITGSKSVGGGATTFNSATVAVVGDGFIARGITFRNTAGPSNGQAVALRSG  315

Query  455   SDHSVFYRCSISGYQDTLYALSLRQFYRECDISGTVDFIFGNAAAVFQACNLVLRRP-SS  279
             SD SVFY+CS  GYQDTLY  S RQFYRECDI GTVDFIFGNAAAVFQ CN+  RRP + 
Sbjct  316   SDLSVFYQCSFEGYQDTLYVHSNRQFYRECDIYGTVDFIFGNAAAVFQNCNIFARRPRNK  375

Query  278   YNVILANGRSDPGQNTGFSVQKCKITPGPDFSPVKNSYNSYLGRPWKPYSRAVVMESDID  99
              N + A GRSDP QNTG  +   ++T G D  PV  S  +YLGRPW+ YSR V M++ +D
Sbjct  376   TNTVTAQGRSDPNQNTGIVIHNSRVTAGSDLQPVLGSVKTYLGRPWRQYSRTVFMKTFLD  435

Query  98    GAISARGWIEWPGTSSSSVRELYFGEYANVG  6
             G I  RGW+EW G  + S   L++ EY N G
Sbjct  436   GLIDPRGWLEWNGNFALST--LFYAEYQNTG  464



>gb|KHG05999.1| putative pectinesterase/pectinesterase inhibitor 40 -like protein 
[Gossypium arboreum]
Length=560

 Score =   322 bits (825),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 194/472 (41%), Positives = 262/472 (56%), Gaps = 35/472 (7%)
 Frame = -2

Query  1367  CGYTRFPRLCVQTLSGL--VSGERVDFAAALLLNKTIAHADLHIAHFDQLSSHFVSSQPP  1194
             C  T +P LCV T+S L  ++ + +       LN+T+    L  A+   +     S    
Sbjct  56    CEGTLYPDLCVSTISVLPDLASKTLPELIQATLNQTMYEVRLSSANCTGIEKRIKSYSKR  115

Query  1193  QPRLQAIGYCEELMGMARQRLNEAL--VAMKESPGKNRQEDIQTWLSAAVTFQQACKDWA  1020
             +    AI  C EL     + L  AL  +A K+        D+QT+LSAA+T Q  C D  
Sbjct  116   EE--AAINDCLELFDDTLEELKVALADLAPKKLAVSRNYHDLQTFLSAAMTNQYTCLDG-  172

Query  1019  DQYAFSDELFAR--------ISRSMDYQSQLASNALALVNRNTEISAAGRQLSEEdiddd  864
                      FAR        I + +   +   SN+L ++ +   +    +  SE      
Sbjct  173   ---------FARSKGNVRNIIKKGLHNITHHVSNSLVMLKK---VPGVNKSKSEYFPQQG  220

Query  863   ddggffpDWVSGRDLRLLETTTDKTKANVVVAKDGTGNFRTVAEAIGAA--SGRQRFVIY  690
                  FP W+S +D  LL+ + ++T+ +++VAKDGTGNF T+ +A+ AA  +   RFVIY
Sbjct  221   RLKNGFPSWLSRQDRILLQASVNETEFDLIVAKDGTGNFTTINDAVAAAPNNSNTRFVIY  280

Query  689   VKSGVYKEKIR--SSKDGITLIGDGKYSTIITWDDSVGGGSSLTGSATFGITGDGFIAKD  516
             +K+G Y E +     K  +  +GDG   T++  + +V  G +   SAT  + G+GFIAK 
Sbjct  281   IKAGSYFENVEVVKKKKMLMFVGDGIGKTVVKANRNVVDGFTTFRSATVAVVGEGFIAKG  340

Query  515   IGFQNTAGPGAHQAVALTVASDHSVFYRCSISGYQDTLYALSLRQFYRECDISGTVDFIF  336
             I F+N+AGP  HQAVAL   SD S FY+CS   YQDTLY  SLRQFYRECDI GTVDFIF
Sbjct  341   ITFENSAGPSKHQAVALRSGSDLSAFYKCSFVAYQDTLYVHSLRQFYRECDIYGTVDFIF  400

Query  335   GNAAAVFQACNLVLRR--PSSYNVILANGRSDPGQNTGFSVQKCKITPGPDFSPVKNSYN  162
             GNAA VFQ CNL  R+  P+  N+  A GR DP QNTG S+  CKI    D  PVK+S+ 
Sbjct  401   GNAAVVFQDCNLYARKPNPNQKNIFTAQGREDPNQNTGISILNCKIAAAADLVPVKSSFK  460

Query  161   SYLGRPWKPYSRAVVMESDIDGAISARGWIEWPGTSSSSVRELYFGEYANVG  6
             +YLGRPWK YSR V+M S ID ++   GW+EW GT + S   LY+GEY N G
Sbjct  461   TYLGRPWKEYSRTVIMRSYIDDSVDPAGWLEWNGTFALST--LYYGEYLNRG  510



>ref|XP_010910186.1| PREDICTED: pectinesterase-like [Elaeis guineensis]
Length=516

 Score =   320 bits (821),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 199/478 (42%), Positives = 277/478 (58%), Gaps = 51/478 (11%)
 Frame = -2

Query  1385  DQIRIQCGYTRFPRLCVQTLSGLVSGERVDFAAALLLNKTIAHADLHIAHFDQLSSHFVS  1206
             + I I C  T +P +C    S +VS   + FA A        H  L  A    + +H ++
Sbjct  23    EPILISCRQTPYPHVC----SSMVSSSPL-FAQAKT-QSGFRHLALQAAIDRAIRAHELA  76

Query  1205  S----QPPQPRLQA-----IGYCEELMGMARQRLNEALVAMKESPGKNRQEDIQTWLSAA  1053
             S         R++A     +  CE+ +G    +LN ++         +  +D QTWLSAA
Sbjct  77    STMDVSSLDERVKAAWADCLELCEDTIG----KLNRSM-------SSSSYDDAQTWLSAA  125

Query  1052  VTFQQACKDWADQYAFSDELFARISRSMDYQ-SQLASNALALVNRNTEISAAG--RQLSE  882
             +  QQ C++   +   S  L +  S  M Y  S+  SN LA+    T   + G  R LS+
Sbjct  126   MANQQTCRNGFLELDSSFPLGS--SPFMSYNISESLSNLLAINMATTPAMSGGNRRLLSD  183

Query  881   EdidddddggffpDWVSGRDLRLLETTTDKTKANVVVAKDGTGNFRTVAEAIGAA----S  714
                        FP+W+S  D +LL ++T    A++VVAKDG+G+++T++EAI AA    S
Sbjct  184   ----------GFPNWLSATDRKLLRSST--INADLVVAKDGSGDYKTISEAIAAAMKQSS  231

Query  713   GRQRFVIYVKSGVYKEKIRSSKDGITLIGDGKYSTIITWDDSVGGGSSLTGSATFGITGD  534
             G+ RFVI+VK+GVY E +++S   + +IGDG  +T++T   +V  GS+   SATF +TGD
Sbjct  232   GKSRFVIHVKTGVYDENVQTSMKNLMIIGDGMDATVVTGSKNVKDGSTTFRSATFAVTGD  291

Query  533   GFIAKDIGFQNTAGPGAHQAVALTVASDHSVFYRCSISGYQDTLYALSLRQFYRECDISG  354
             GFIA+D+ F+NTAGP   QAVAL   SD SVFY+CS  GYQDTLY  S RQFYR CDI G
Sbjct  292   GFIARDMTFENTAGPQKQQAVALRSGSDLSVFYQCSFKGYQDTLYVYSQRQFYRNCDIYG  351

Query  353   TVDFIFGNAAAVFQACNLVLRRPSS--YNVILANGRSDPGQNTGFSVQKCKITPGPDFSP  180
             TVDFIFG+AA V Q CN+ +R+P S   N + A GR+DP +NTG S+    +T   D  P
Sbjct  352   TVDFIFGDAAVVLQNCNMHVRKPMSGQKNTVTAQGRTDPNENTGISIHDSAVTAASDLKP  411

Query  179   VKNSYNSYLGRPWKPYSRAVVMESDIDGAISARGWIEWPGTSSSSVRELYFGEYANVG  6
             V+ S+ +YLGRPW+ YSR V M++ +D  I   GW+EW G  + S   LY+GEY N G
Sbjct  412   VQGSFETYLGRPWQEYSRTVFMKTSLDSLIDPAGWLEWSGNFALST--LYYGEYMNTG  467



>gb|KDP20786.1| hypothetical protein JCGZ_21257 [Jatropha curcas]
Length=544

 Score =   321 bits (823),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 195/436 (45%), Positives = 253/436 (58%), Gaps = 31/436 (7%)
 Frame = -2

Query  1280  LLNKTIAHADLHIAHFDQLSSHFVSSQPPQPRLQA-IGYCEELMGMARQRLNEALVAMKE  1104
             LL   +  +   I +  Q ++H VS Q   P  QA +  C +LM ++  R N+++VA+ +
Sbjct  82    LLQILLKKSKYQIQNSIQEATH-VSRQINDPVNQAALVDCVQLMELSIDRTNDSIVAL-Q  139

Query  1103  SPGKNRQEDIQTWLSAAVTFQQACKDWADQYAFS---DELFARISRSMDYQSQLASNALA  933
             S   N   +   WLS+ +T    C D     A S    EL   IS+S    + L   + A
Sbjct  140   SGTVNSHANAHVWLSSVLTNHFTCLDGLTGPARSIMEPELNDLISKSRTSLALLVGISPA  199

Query  932   LVNRNTEISAAGRQLSEEdidddddggffpDWVSGRDLRLLETTTDKTKANVVVAKDGTG  753
                ++  IS   R                  WV+ +D +LLE +    KANV+VAKDG+G
Sbjct  200   ---KDYLISPLNRDFPS--------------WVTTKDRKLLEASVKDIKANVIVAKDGSG  242

Query  752   NFRTVAEAIGAA--SGRQRFVIYVKSGVYKEKIR--SSKDGITLIGDGKYSTIITWDDSV  585
             N++T+ EA+ AA  +G+ R VIYVK G YKE++    SK  + L+GDG   TIIT   +V
Sbjct  243   NYKTIKEAVAAAPNNGKTRHVIYVKKGTYKEQVEIGKSKKNVMLVGDGMDLTIITGSLNV  302

Query  584   GGGSSLTGSATFGITGDGFIAKDIGFQNTAGPGAHQAVALTVASDHSVFYRCSISGYQDT  405
               GS+   SAT    GDGFIA+DI FQNTAGP  HQAVAL V +D SV  RC +  YQDT
Sbjct  303   VDGSTTFDSATVAAVGDGFIAQDIWFQNTAGPEKHQAVALRVGADQSVINRCRMDAYQDT  362

Query  404   LYALSLRQFYRECDISGTVDFIFGNAAAVFQACNLVLRRPSS--YNVILANGRSDPGQNT  231
             LY  S RQFYR+  I+GTVDFIFGNAA VFQ C LV R+P +   N++ A GR DP QNT
Sbjct  363   LYTHSNRQFYRDSLITGTVDFIFGNAAVVFQNCKLVARKPMNGQKNMVTAQGRIDPNQNT  422

Query  230   GFSVQKCKITPGPDFSPVKNSYNSYLGRPWKPYSRAVVMESDIDGAISARGWIEWPGTSS  51
             G S+QKC+I    D  PVK+S  SYLGRPWK YSR VVM+S+I   I   GW  W G   
Sbjct  423   GTSIQKCEIIASSDLEPVKSSVKSYLGRPWKEYSRTVVMQSNIADHIDPAGWSIWEG--D  480

Query  50    SSVRELYFGEYANVGA  3
              +++ LY+GEY N GA
Sbjct  481   FALKTLYYGEYMNRGA  496



>ref|XP_010259034.1| PREDICTED: pectinesterase 2-like [Nelumbo nucifera]
Length=517

 Score =   320 bits (820),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 182/392 (46%), Positives = 235/392 (60%), Gaps = 27/392 (7%)
 Frame = -2

Query  1166  CEELMGMARQRLNEALVAMKESPG-KNRQEDIQTWLSAAVTFQQACKDWADQYAFSDELF  990
             C EL      RLN     +  +PG K    D+QTWLS A+T  + C+    +   SD + 
Sbjct  99    CIELYKNTIARLN-----LTVNPGAKCTDVDLQTWLSTALTNLETCRTGFVELGVSDYIL  153

Query  989   ARISRSMDYQSQLASNALALVNRNTEISAAGRQLSEEdidddddggffpDWVSGRDLRLL  810
               +S ++   S+L SN LA+   N  ++    Q   E             WVS RD +LL
Sbjct  154   PLMSNNV---SKLISNILAI---NKPVALPNEQTYHEGFPT---------WVSPRDRKLL  198

Query  809   ETTTDKTKANVVVAKDGTGNFRTVAEAIGAASGRQ---RFVIYVKSGVYKEKIRSSKDGI  639
             + T   ++A +VVA+DG+GNF+T+ EAI AA+ +    RFVI VK+G Y E +      +
Sbjct  199   QATALASRAILVVAQDGSGNFKTINEAINAAAKQNTGGRFVIQVKAGTYAEHLHIGSPNL  258

Query  638   TLIGDGKYSTIITWDDSVGGGSSLTGSATFGITGDGFIAKDIGFQNTAGPGAHQAVALTV  459
              L+GDG  +T+IT   SVGGGS+   SAT  + GDGFIA+DI F+NTAGPG  QAVAL  
Sbjct  259   MLVGDGIGNTVITGSMSVGGGSTTFNSATVAVVGDGFIARDITFRNTAGPGKGQAVALRS  318

Query  458   ASDHSVFYRCSISGYQDTLYALSLRQFYRECDISGTVDFIFGNAAAVFQACNLVLRRPSS  279
              SD SVFYRCS  GYQDTLY  S RQFYREC I GTVDFIFGNAA V Q CN+  R+P +
Sbjct  319   GSDLSVFYRCSFEGYQDTLYVHSERQFYRECAIYGTVDFIFGNAAVVLQNCNIFSRKPIN  378

Query  278   YNV-ILANGRSDPGQNTGFSVQKCKITPGPDFSPVKNSYNSYLGRPWKPYSRAVVMESDI  102
               V + A GR DP QNTG  +   +IT   D  PV++S  +YLGRPW+ YSR V+++S +
Sbjct  379   GVVTVTAQGRIDPNQNTGIVIHTSQITAASDLKPVQSSVKAYLGRPWRQYSRTVILKSFL  438

Query  101   DGAISARGWIEWPGTSSSSVRELYFGEYANVG  6
             D  I   GW+EW G  S  +  LY+GEY N G
Sbjct  439   DNLIQPVGWLEWSG--SFGLNTLYYGEYQNTG  468



>ref|XP_004293266.1| PREDICTED: pectinesterase/pectinesterase inhibitor-like [Fragaria 
vesca subsp. vesca]
Length=528

 Score =   320 bits (821),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 183/404 (45%), Positives = 240/404 (59%), Gaps = 20/404 (5%)
 Frame = -2

Query  1196  PQPRLQAIGYCEELMGMARQRLNEALVAMKESPGKNRQEDIQTWLSAAVTFQQACKDWAD  1017
             P+ R  A+  C ELM +   R+ ++ VA+K    +N  ED+ TWLS+ +T    C D   
Sbjct  89    PKDR-AALVDCVELMEVTMDRILDSRVALKNLKVQNTMEDVHTWLSSVLTNHVTCLDGLK  147

Query  1016  QYAFSDELFARISRSMDYQSQLASNALALVNRNTEISAAGRQLSEEdidddddggffpDW  837
               +    +  R++        L S + A + +  EIS +  ++  +   +  D      W
Sbjct  148   GLSARTIMEPRLN-------GLISKSKAFLAKLVEISPSKEKVIGDQPLEIGDFPT---W  197

Query  836   VSGRDLRLLETTTDK-TKANVVVAKDGTGNFRTVAEAIGAASGRQ--RFVIYVKSGVYKE  666
             V  RD RL+     K  +ANVVVA DG+G ++TV EA+ AA  +   R+VIYVK G YKE
Sbjct  198   VKRRDRRLMSRDFQKGVEANVVVANDGSGKYKTVKEAVAAAPDKSTTRYVIYVKKGTYKE  257

Query  665   KIR--SSKDGITLIGDGKYSTIITWDDSVGGGSSLTGSATFGITGDGFIAKDIGFQNTAG  492
              +    +K  + ++GDG   TIIT   +V  GS+   SAT    GDGFIA+DI FQNTAG
Sbjct  258   NVEVVKNKKNLMIVGDGMDKTIITGSLNVVDGSTTFNSATLAAVGDGFIAQDIWFQNTAG  317

Query  491   PGAHQAVALTVASDHSVFYRCSISGYQDTLYALSLRQFYRECDISGTVDFIFGNAAAVFQ  312
             P  HQAVAL V +D SV  RC I  YQDTLYA S RQFYR+C I+GTVDFIFGNAA V Q
Sbjct  318   PDKHQAVALRVGADQSVINRCRIDAYQDTLYAHSNRQFYRDCYITGTVDFIFGNAAVVLQ  377

Query  311   ACNLVLRRPSS--YNVILANGRSDPGQNTGFSVQKCKITPGPDFSPVKNSYNSYLGRPWK  138
              C +V R+P+S   N++ A GR+DP QNTG S+QKC++    D  PVK +  SYLGRPWK
Sbjct  378   NCKIVARKPASGQNNMVTAQGRTDPNQNTGTSIQKCQVIASSDLEPVKGTVRSYLGRPWK  437

Query  137   PYSRAVVMESDIDGAISARGWIEWPGTSSSSVRELYFGEYANVG  6
              YSR VVM+S I   I   GW  W G    +++ LY+GEYAN G
Sbjct  438   EYSRTVVMQSTIGDHIDPTGWSIWSG--DFALKTLYYGEYANSG  479



>ref|XP_006828586.1| hypothetical protein AMTR_s00129p00044320 [Amborella trichopoda]
 gb|ERM96002.1| hypothetical protein AMTR_s00129p00044320 [Amborella trichopoda]
Length=564

 Score =   322 bits (824),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 206/482 (43%), Positives = 280/482 (58%), Gaps = 33/482 (7%)
 Frame = -2

Query  1379  IRIQCGYTRFPRLCVQTLSGL------VSGERVDFAAALLLNKTIAHADLHIAHFDQLSS  1218
             ++  C  T +P LC  +LS         S ++    AAL L+ T   A  H A+F +L  
Sbjct  45    VKSACSSTLYPELCFSSLSAFPAAAEKASSQKDVIEAALNLSIT---AGEH-AYF-KLKK  99

Query  1217  HFVSSQPPQPRLQAIGYCEELMGMARQRLNEALVAMKESPGK----NRQEDIQTWLSAAV  1050
              +      +    A+  C EL+      L +    ++  P K    +   D++T LS A+
Sbjct  100   LYGRKDVLEAEHTALHDCLELVDETLDELRKTDEELELYPSKKSISDHASDLKTLLSGAM  159

Query  1049  TFQQACKDWADQYAFSDELFARISRSMDYQSQLASNALALVNRNT------EISAAGRQL  888
             T Q+ C D    +     +   IS    Y  +L SNALA++   T      E SAAGR+L
Sbjct  160   TNQETCLD-GFSHIKGGGVRKIISGGCVYVEKLISNALAMIKNMTDTDMAAERSAAGRKL  218

Query  887   SEEdidddddggff-pDWVSGRDLRLLETTTDKTKANVVVAKDGTGNFRTVAEAIGAASG  711
              E ++ +   G    P W+S  D RLL++++     NVVVA DG+G+F+TVA A+ AA  
Sbjct  219   EENNLPESFAGEDGFPAWMSAGDRRLLQSSS--VTPNVVVAADGSGDFKTVAAAVAAAPE  276

Query  710   R--QRFVIYVKSGVYKEKIR--SSKDGITLIGDGKYSTIITWDDSVGGGSSLTGSATFGI  543
             +  +R+VI +K+GVY+E +     K  I  +GDG+  TIIT   +V  GS+   SAT   
Sbjct  277   KSSKRYVIRIKAGVYRENVEVPKKKTNIMFLGDGRMKTIITGSKNVKDGSTTFRSATVAA  336

Query  542   TGDGFIAKDIGFQNTAGPGAHQAVALTVASDHSVFYRCSISGYQDTLYALSLRQFYRECD  363
              G+ F+A+DI FQNTAGP  HQAVAL V SD S FYRC +  YQDTLY  SLRQFYREC 
Sbjct  337   VGERFLARDITFQNTAGPSKHQAVALRVGSDFSAFYRCDMIAYQDTLYVHSLRQFYRECF  396

Query  362   ISGTVDFIFGNAAAVFQACNLVLRRPSS--YNVILANGRSDPGQNTGFSVQKCKITPGPD  189
             I GTVDFIFGNAAAV Q C+++ RRP+S   N++ A GR DP QNTG S+ KC+I+   D
Sbjct  397   IYGTVDFIFGNAAAVLQNCDILARRPNSGQKNMVTAQGREDPNQNTGISIHKCRISADSD  456

Query  188   FSPVKNSYNSYLGRPWKPYSRAVVMESDIDGAISARGWIEWPGTSSSSVRELYFGEYANV  9
              +PVK+S+ +YLGRPWK YSR V+M+S I   I+  GW EW G  + ++  LY+GEY N 
Sbjct  457   LAPVKSSFPTYLGRPWKEYSRTVIMQSTISDVINPAGWHEWNG--NFALNTLYYGEYQNT  514

Query  8     GA  3
             GA
Sbjct  515   GA  516



>ref|XP_002523113.1| Pectinesterase-3 precursor, putative [Ricinus communis]
 gb|EEF39298.1| Pectinesterase-3 precursor, putative [Ricinus communis]
Length=557

 Score =   321 bits (823),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 192/464 (41%), Positives = 264/464 (57%), Gaps = 19/464 (4%)
 Frame = -2

Query  1367  CGYTRFPRLCVQTLSGL--VSGERVDFAAALLLNKTIAHADLHIAHFDQLSSHFVSSQPP  1194
             C  T +P LCV TLS L  ++   +    +  +++T+    +  ++   + +     +  
Sbjct  53    CEGTLYPELCVSTLSSLPDLTYRSLQQLISSTISRTMYEVRVSYSNCSGIKNKL--RKLN  110

Query  1193  QPRLQAIGYCEELMGMARQRLNEALVAMKESPG-KNRQEDIQTWLSAAVTFQQACKDWAD  1017
             +    A+  C EL       LN A+  +           D+QT LS A+T Q  C    D
Sbjct  111   KIERVALNDCLELFTETMDELNVAISDLTSRKSVSQHHHDLQTLLSGAMTNQYTC---LD  167

Query  1016  QYAFSD-ELFARISRSMDYQSQLASNALALVNRNTEISAAGRQLSEEdidddddggffpD  840
              +A+S   +   I  S+   S+  SN+LA++ +   ++A+    SE   +  +    FP 
Sbjct  168   GFAYSRGRVRKTIKNSLYNISRHVSNSLAMLKKIPGVNASKE--SEAFPEYGEVKHGFPS  225

Query  839   WVSGRDLRLLETTTDKTKANVVVAKDGTGNFRTVAEAIGAA--SGRQRFVIYVKSGVYKE  666
             W+S +DL LL+   + TK ++VVAKDGTGNF T+++A+ AA  S   RFVIY+K G Y E
Sbjct  226   WLSSKDLELLQAPLNATKFDLVVAKDGTGNFSTISQAVAAAPNSSLTRFVIYIKEGAYFE  285

Query  665   KIR--SSKDGITLIGDGKYSTIITWDDSVGGGSSLTGSATFGITGDGFIAKDIGFQNTAG  492
              +     K  +  IGDG   T++  + SV GG +   SAT  + G+GF+AK I F+N+AG
Sbjct  286   NVDVDKKKTNLMFIGDGIGKTVVKANRSVVGGWTTFRSATVAVVGNGFVAKGITFENSAG  345

Query  491   PGAHQAVALTVASDHSVFYRCSISGYQDTLYALSLRQFYRECDISGTVDFIFGNAAAVFQ  312
             P  HQAVAL   SD S FY+CS  GYQDTLY  SLRQFYRECDI GTVDFIFGNAA VFQ
Sbjct  346   PDMHQAVALRSGSDLSAFYQCSFVGYQDTLYVHSLRQFYRECDIYGTVDFIFGNAAVVFQ  405

Query  311   ACNLVLRRPSS--YNVILANGRSDPGQNTGFSVQKCKITPGPDFSPVKNSYNSYLGRPWK  138
              C++  R+P+S   N+  A GR DP QNTG S+   K+T   D  PVK S+ +YLGRPWK
Sbjct  406   NCSIYARKPNSNQQNIFTAQGREDPNQNTGISIMNSKVTAAADLIPVKKSFKTYLGRPWK  465

Query  137   PYSRAVVMESDIDGAISARGWIEWPGTSSSSVRELYFGEYANVG  6
              YSR V + S ID  +   GW+EW G  + S   LY+GEY N G
Sbjct  466   EYSRTVFLRSYIDDVVDPVGWLEWNGAFALST--LYYGEYMNRG  507



>ref|XP_009628696.1| PREDICTED: pectinesterase 2 [Nicotiana tomentosiformis]
Length=549

 Score =   321 bits (822),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 179/378 (47%), Positives = 232/378 (61%), Gaps = 26/378 (7%)
 Frame = -2

Query  1112  MKESPGKNRQ---EDIQTWLSAAVTFQQACKDWADQYAFSDELFARISRSMDYQSQLASN  942
             +K + G N +    D Q+WLS A+T  + C+   ++   +D +   +S ++   S L SN
Sbjct  140   IKSTVGPNTKCTAADAQSWLSTALTNLETCRAGFEELGVTDYVMPLMSNNV---SSLISN  196

Query  941   ALALVNRNTEISAAGRQLSEEdidddddggffpDWVSGRDLRLLETTTDKTKANVVVAKD  762
              L+L N          Q+             FP WV+  D +LL++++  ++AN+VVAKD
Sbjct  197   TLSL-NHGYYTEPTATQVD-----------GFPTWVALGDRKLLQSSSPASQANIVVAKD  244

Query  761   GTGNFRTVAEAIGAASGRQ---RFVIYVKSGVYKEKIR--SSKDGITLIGDGKYSTIITW  597
             G+GNF+TV EA+ AA  R+   RFVIYVK+G+Y E +   S    I L+GDG   TIIT 
Sbjct  245   GSGNFKTVKEAVAAAGKRKGSARFVIYVKAGIYSENVDLGSKLKNIMLVGDGIGKTIITG  304

Query  596   DDSVGGGSSLTGSATFGITGDGFIAKDIGFQNTAGPGAHQAVALTVASDHSVFYRCSISG  417
               SVGGGS+   SAT  + GDGFI + I  +NTAGP  HQAVAL   SD SVFY+CS  G
Sbjct  305   SKSVGGGSTTFKSATVAVVGDGFICRGITIRNTAGPTNHQAVALRSGSDLSVFYQCSFEG  364

Query  416   YQDTLYALSLRQFYRECDISGTVDFIFGNAAAVFQACNLVLRR-PSSYNVILANGRSDPG  240
             YQDTLY  S RQFYRECDI GTVDFIFGNAA V Q CN+  R  P+  N + A GRSDP 
Sbjct  365   YQDTLYVHSDRQFYRECDIYGTVDFIFGNAAVVLQNCNIFARDPPNKTNTVTAQGRSDPN  424

Query  239   QNTGFSVQKCKITPGPDFSPVKNSYNSYLGRPWKPYSRAVVMESDIDGAISARGWIEWPG  60
             QNTG S+  C++T   D    KNS  +YLGRPWK YSR VVM++ +D  I   GW+ W G
Sbjct  425   QNTGISIHNCRVTAASDLKASKNSVKTYLGRPWKQYSRTVVMKTFLDSLIQPDGWMPWSG  484

Query  59    TSSSSVRELYFGEYANVG  6
             T   +++ LY+GEY N G
Sbjct  485   T--FALKTLYYGEYLNTG  500



>gb|AER38244.1| PME5 [Gossypium barbadense]
Length=519

 Score =   320 bits (820),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 191/467 (41%), Positives = 261/467 (56%), Gaps = 32/467 (7%)
 Frame = -2

Query  1385  DQIRIQCGYTRFPRLCVQTLSGLVSGERVDFAAALLLNKTIAHADLHIAHFDQLSSHFVS  1206
             + +R  C  T  P+ C   LS     ++          K   H  L  A   + ++H + 
Sbjct  29    NDVRSWCRKTPNPQPCEYFLSH--DPKKTPTKDEFQFFKIPTHLALERAARAESNTHSLG  86

Query  1205  SQPPQPRLQAI-GYCEELMGMARQRLNEALVAMKESPGKNRQEDIQTWLSAAVTFQQACK  1029
             ++    R +A    C  L  +   RLN+ +    +S     ++D QTWLS A+T  + C+
Sbjct  87    TKCRSEREKAAWSDCVNLYELTILRLNKTV----DSGTNLNKDDAQTWLSTALTNLETCR  142

Query  1028  DWADQYAFSDELFARISRSMDYQSQLASNALALVNRNTEISAAGRQLSEEdidddddggf  849
                 +    D L   +S ++   SQL SN LAL              ++    +      
Sbjct  143   TGFMELGVPDHLLPMMSNNV---SQLISNTLAL--------------NKAPYKEPTYKDG  185

Query  848   fpDWVSGRDLRLLETTTDKTKANVVVAKDGTGNFRTVAEAIGAASGRQ---RFVIYVKSG  678
             FP WV   D +LL++++  + AN+VVA+DG+GN++T+ +AI AAS R    R+VIYVK+G
Sbjct  186   FPTWVKPGDRKLLQSSSPASTANIVVAQDGSGNYKTIKDAISAASKRSGSGRYVIYVKAG  245

Query  677   VYKEKIR--SSKDGITLIGDGKYSTIITWDDSVGGGSSLTGSATFGITGDGFIAKDIGFQ  504
              YKE +   S    I ++GDG   TIIT   SVGGGS+   SAT  + GDGFIA+ I F+
Sbjct  246   TYKENVEIGSKLKNIMMVGDGIGKTIITGSKSVGGGSTTFNSATVAVVGDGFIARGITFR  305

Query  503   NTAGPGAHQAVALTVASDHSVFYRCSISGYQDTLYALSLRQFYRECDISGTVDFIFGNAA  324
             NTAGP  HQAVAL   SD SVFY+CS  GYQDTLY  S RQFYRECDI GTVD+IFGNAA
Sbjct  306   NTAGPTNHQAVALRSGSDLSVFYKCSFEGYQDTLYVHSERQFYRECDIYGTVDWIFGNAA  365

Query  323   AVFQACNLVLRR-PSSYNVILANGRSDPGQNTGFSVQKCKITPGPDFSPVKNSYNSYLGR  147
              VFQ CN+  R  P+  N + A GR+DP QNTG  +   ++T   D  PV++S  +YLGR
Sbjct  366   VVFQNCNIYARNPPNKTNTVTAQGRTDPNQNTGIIIHNSRVTAASDLKPVQSSVKTYLGR  425

Query  146   PWKPYSRAVVMESDIDGAISARGWIEWPGTSSSSVRELYFGEYANVG  6
             PWK YSR V M++ +D  I+  GW+EW      + + LY+ EY N G
Sbjct  426   PWKQYSRTVFMKTYLDSLINPAGWMEW--DDDFAPKTLYYAEYMNTG  470



>ref|XP_003521940.1| PREDICTED: pectinesterase 2-like [Glycine max]
Length=511

 Score =   320 bits (819),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 196/467 (42%), Positives = 256/467 (55%), Gaps = 37/467 (8%)
 Frame = -2

Query  1385  DQIRIQCGYTRFPRLCVQTLSGLVSGERVDF---AAALLLNKTIAHADLHIAHFDQLSSH  1215
             + +++ C  T  P  C   LS   + +       +    L+  +A       H + LS  
Sbjct  26    NDVKLWCSQTPNPEPCEYFLSNNPTHQYKPIKQKSEFFKLSLQLAQERALNGHANTLS--  83

Query  1214  FVSSQPPQPR-LQAIGYCEELMGMARQRLNEALVAMKESPGKNRQEDIQTWLSAAVTFQQ  1038
              + S+   PR   A   C EL     ++LN+ L    +   K  Q D QTWLS A+T  +
Sbjct  84    -LGSKCRNPRETAAWADCVELYEQTIRKLNKTL----DPSTKFSQVDTQTWLSTALTNLE  138

Query  1037  ACKDWADQYAFSDELFARISRSMDYQSQLASNALALVNRNTEISAAGRQLSEEdiddddd  858
              CK    +    D +   +S ++   ++L SN LAL     E  +               
Sbjct  139   TCKAGFYELGVQDYVLPLMSNNV---TKLLSNTLALNKVEYEEPSYKDGFP---------  186

Query  857   ggffpDWVSGRDLRLLETTTDKTKANVVVAKDGTGNFRTVAEAIGAA--SGRQRFVIYVK  684
                   WV   D RLL+ ++  +KANVVVAKDG+G + TV+EA+ AA  S   R+VIYVK
Sbjct  187   -----TWVKPGDRRLLQASSPASKANVVVAKDGSGKYTTVSEAVNAAPKSNSGRYVIYVK  241

Query  683   SGVYKEKIRSSKDGITLIGDGKYSTIITWDDSVGGGSSLTGSATFGITGDGFIAKDIGFQ  504
              G+Y E++    + I L+GDG   TIIT   SVGGG++   SAT  + GDGFI +DI F+
Sbjct  242   GGIYDEQVEIKANNIMLVGDGIGKTIITSSKSVGGGTTTFRSATVAVVGDGFITQDITFR  301

Query  503   NTAGPGAHQAVALTVASDHSVFYRCSISGYQDTLYALSLRQFYRECDISGTVDFIFGNAA  324
             NTAG   HQAVAL   SD SVFYRCS  GYQDTLY  S RQFYRECDI GTVDFIFGNAA
Sbjct  302   NTAGATNHQAVALRSGSDLSVFYRCSFEGYQDTLYVYSDRQFYRECDIYGTVDFIFGNAA  361

Query  323   AVFQACNLVLRR-PSSYNVILANGRSDPGQNTGFSVQKCKITPGPDFSPVKNSYNSYLGR  147
              VFQ CN+  R  P+  N I A GR+DP QNTG S+   K+T   D   V+    +YLGR
Sbjct  362   VVFQNCNIYARNPPNKVNTITAQGRTDPNQNTGISIHNSKVTAASDLMGVR----TYLGR  417

Query  146   PWKPYSRAVVMESDIDGAISARGWIEWPGTSSSSVRELYFGEYANVG  6
             PW+ YSR V M++ +D  I+  GW+EW G  + S   LY+GEY N G
Sbjct  418   PWQQYSRTVFMKTYLDSLINPEGWLEWSGNFALST--LYYGEYMNTG  462



>ref|XP_011010963.1| PREDICTED: pectinesterase-like [Populus euphratica]
Length=558

 Score =   321 bits (823),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 198/466 (42%), Positives = 269/466 (58%), Gaps = 25/466 (5%)
 Frame = -2

Query  1367  CGYTRFPRLCVQTL---SGLVSGERVDFAAALLLNKTIAHADLHIAHFDQLSSHFVSSQP  1197
             C  T +P LCV TL   S L S    +F +A L NKT+       A+ + + +       
Sbjct  56    CKGTLYPELCVSTLVSLSDLASKSLPEFISATL-NKTMDEVRASSANCNAIRNKI--KLG  112

Query  1196  PQPRLQAIGYCEELMGMARQRLNEAL--VAMKESPGKNRQEDIQTWLSAAVTFQQACKDW  1023
             P  ++ A+  C EL       L  A+  +A ++S  K+   D+QT LS A+T Q  C   
Sbjct  113   PLEKV-ALKDCIELFDDTIAELKSAISDLAPRKSTSKHYH-DLQTLLSGAMTNQYTC---  167

Query  1022  ADQYAFSD-ELFARISRSMDYQSQLASNALALVNRNTEISAAGRQLSEEdidddddggff  846
              D +A S  ++   I + +   S   SN+LA++ +   I       SE   +  +    F
Sbjct  168   LDGFARSKGKVRKAIKKGLYNISHHVSNSLAMLKK---IPGVNTSKSEVFPEYGNVKHGF  224

Query  845   pDWVSGRDLRLLETTTDKTKANVVVAKDGTGNFRTVAEAIGAA--SGRQRFVIYVKSGVY  672
             P W+S +D +LL+ + + TK +++VAKDGTGNF T++EA+ AA  S   RFVIY+K+G Y
Sbjct  225   PSWLSSKDRKLLQASANATKFDLIVAKDGTGNFTTISEAVRAAPNSSDTRFVIYIKAGAY  284

Query  671   KE--KIRSSKDGITLIGDGKYSTIITWDDSVGGGSSLTGSATFGITGDGFIAKDIGFQNT  498
              E  ++   K  +  IGDG   T++    SV  G +   SAT  + GDGFIAK I F+N+
Sbjct  285   FENVEVERKKKMLVFIGDGIGKTVVKAKRSVVDGWTTFRSATVAVVGDGFIAKGITFENS  344

Query  497   AGPGAHQAVALTVASDHSVFYRCSISGYQDTLYALSLRQFYRECDISGTVDFIFGNAAAV  318
             AGP  HQAVAL   SD S FY+CS  GYQDTLY  SLRQFYRECD+ GT+DFIFGNAA V
Sbjct  345   AGPSKHQAVALRSGSDLSAFYQCSFVGYQDTLYVHSLRQFYRECDVYGTIDFIFGNAAVV  404

Query  317   FQACNLVLRRPSS--YNVILANGRSDPGQNTGFSVQKCKITPGPDFSPVKNSYNSYLGRP  144
             FQ  NL  R+P+S   N+  A GR DP QNTG S+  CK+    D  PVK+S+ ++LGRP
Sbjct  405   FQTSNLYARKPNSNQRNIFTAQGREDPNQNTGISILNCKVAAAADLIPVKSSFQTFLGRP  464

Query  143   WKPYSRAVVMESDIDGAISARGWIEWPGTSSSSVRELYFGEYANVG  6
             WK YSR V + S ID  +   GW+EW   +S ++  LY+GEY N G
Sbjct  465   WKEYSRTVFLRSYIDDLVDPAGWLEW--NASFALSTLYYGEYMNRG  508



>ref|XP_011090444.1| PREDICTED: pectinesterase 2 [Sesamum indicum]
Length=531

 Score =   320 bits (820),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 183/392 (47%), Positives = 236/392 (60%), Gaps = 27/392 (7%)
 Frame = -2

Query  1166  CEELMGMARQRLNEALVAMKESPGKNRQEDIQTWLSAAVTFQQACKDWADQYAFSDE-LF  990
             C EL      ++N  +    +   K    D QTWLS A+T  + CK     +  +D+ +F
Sbjct  113   CVELYEHTIHKINTTV----DPNTKCTPADAQTWLSTALTNLETCKSGFVDFGITDDYMF  168

Query  989   ARISRSMDYQSQLASNALALVNRNTEISAAGRQLSEEdidddddggffpDWVSGRDLRLL  810
               +S ++   S L SN LAL N+    +       E           FP WV   D +LL
Sbjct  169   PMMSNNV---SLLLSNTLAL-NKGPYANGPAGSYKE----------GFPSWVKPGDRKLL  214

Query  809   ETTTDKTKANVVVAKDGTGNFRTVAEAIGAA---SGRQRFVIYVKSGVYKEKIRSSKDGI  639
             +++T    ANVVVA+DG+GN++TV+EA+ AA   SG  RFVI+VK G Y+E +  +   I
Sbjct  215   QSSTPT--ANVVVAQDGSGNYKTVSEAVAAAGKRSGSGRFVIHVKQGTYRENVNIAAKNI  272

Query  638   TLIGDGKYSTIITWDDSVGGGSSLTGSATFGITGDGFIAKDIGFQNTAGPGAHQAVALTV  459
              L+GDG   TIIT   SVGGGS+   SAT    GDGFIA+ I F+NTAG   HQAVA   
Sbjct  273   MLLGDGIGKTIITGSRSVGGGSTTFKSATVAAVGDGFIARGITFRNTAGAQNHQAVAFRS  332

Query  458   ASDHSVFYRCSISGYQDTLYALSLRQFYRECDISGTVDFIFGNAAAVFQACNLVLRR-PS  282
              SD SVFY+CS  GYQDTLY  S RQFYRECDI GTVDFIFGNAA VFQ CN+  R  P+
Sbjct  333   GSDLSVFYQCSFEGYQDTLYVHSERQFYRECDIYGTVDFIFGNAAVVFQNCNIYPRNPPN  392

Query  281   SYNVILANGRSDPGQNTGFSVQKCKITPGPDFSPVKNSYNSYLGRPWKPYSRAVVMESDI  102
               N + A GR+DP QNTG S+  C++T  PD  PV+ S  +YLGRPW+ YSR V M++ +
Sbjct  393   KTNTLTAQGRTDPNQNTGISIHNCRVTAAPDLRPVQGSVKTYLGRPWQKYSRTVFMKTFL  452

Query  101   DGAISARGWIEWPGTSSSSVRELYFGEYANVG  6
             D  I+  GW+ W G  + ++  LY+GEYAN G
Sbjct  453   DSLINPAGWMPWSG--NFALDTLYYGEYANTG  482



>ref|XP_010056339.1| PREDICTED: pectinesterase 2-like [Eucalyptus grandis]
 gb|KCW73022.1| hypothetical protein EUGRSUZ_E01463 [Eucalyptus grandis]
Length=515

 Score =   320 bits (819),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 187/465 (40%), Positives = 260/465 (56%), Gaps = 34/465 (7%)
 Frame = -2

Query  1379  IRIQCGYTRFPRLCVQTLSGLVSGERVDFAAALLLNKTIAHADLHIAHFDQLSSHFVSSQ  1200
             ++  C    +P+ C   L+       +   +  L  K      L  A     ++H + S+
Sbjct  29    VKAWCSKMPYPQPCEYFLTHDPKQASIKQKSDFL--KVSMQLALERAQMAHSNTHSLGSK  86

Query  1199  PPQPRLQAI-GYCEELMGMARQRLNEALVAMKESPGKNRQEDIQTWLSAAVTFQQACKDW  1023
                 R +A+   C +L      RLN  +V           ++ QTWLS A+T  + C+  
Sbjct  87    CSNEREKAVWADCLQLYEHTILRLNRTIVH------DCTHDEAQTWLSTALTNLETCRAG  140

Query  1022  ADQYAFSDELFARISRSMDYQSQLASNALALVNRNTEISAAGRQLSEEdidddddggffp  843
               +   S  +   +S ++   S+L SN LAL              +       +    FP
Sbjct  141   FVELGVSGNVLPLMSNNV---SKLISNTLAL--------------NYAPYTTPNYTKKFP  183

Query  842   DWVSGRDLRLLETTTDKTKANVVVAKDGTGNFRTVAEAIGAASGRQ---RFVIYVKSGVY  672
              WV   D +LL++++  +KAN++VA+DG+GN++T++EAI AAS R    R++IY+K+G Y
Sbjct  184   TWVRPGDRKLLQSSSAVSKANIIVAQDGSGNYKTISEAITAASKRSGTARYIIYIKAGTY  243

Query  671   KEKIR--SSKDGITLIGDGKYSTIITWDDSVGGGSSLTGSATFGITGDGFIAKDIGFQNT  498
              E +   S  + I  +GDG   TIIT   SVGGGS+   SAT  + GDGFIA+DI F+NT
Sbjct  244   SENVEVGSKLENIMFVGDGIGKTIITGSKSVGGGSTTFNSATVAVVGDGFIAQDITFRNT  303

Query  497   AGPGAHQAVALTVASDHSVFYRCSISGYQDTLYALSLRQFYRECDISGTVDFIFGNAAAV  318
             AG   HQAVAL   SD SVFYRC   GYQDTLY  S RQFYRECDI GTVDFIFGNAA V
Sbjct  304   AGAANHQAVALRSGSDLSVFYRCGFEGYQDTLYVHSERQFYRECDIYGTVDFIFGNAAVV  363

Query  317   FQACNLVLRR-PSSYNVILANGRSDPGQNTGFSVQKCKITPGPDFSPVKNSYNSYLGRPW  141
              Q CN+  R  P+  N + A GR+DP QNTG S+  CK+T   D   V++S  +YLGRPW
Sbjct  364   LQNCNIYARNPPNKVNTVTAQGRTDPNQNTGISIHNCKVTAASDLKSVQSSVKTYLGRPW  423

Query  140   KPYSRAVVMESDIDGAISARGWIEWPGTSSSSVRELYFGEYANVG  6
             + YSR V M++ +D  I++ GW+EW G  + ++  LY+GEY N G
Sbjct  424   QEYSRTVFMKTYLDSLINSAGWMEWDG--NFALDTLYYGEYLNTG  466



>ref|XP_008795768.1| PREDICTED: pectinesterase-like [Phoenix dactylifera]
Length=557

 Score =   320 bits (821),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 190/463 (41%), Positives = 259/463 (56%), Gaps = 17/463 (4%)
 Frame = -2

Query  1370  QCGYTRFPRLCVQTLSGL--VSGERVDFAAALLLNKTIAHADLHIAHFDQLSSHFVSSQP  1197
              C  T +P LCV TL+ +  +S + +    A ++N+T A      ++      H      
Sbjct  55    HCDGTLYPDLCVSTLADIPNLSSKPLPDVIAAVVNRTAAAVRSSASNCTSYL-HRRGHMD  113

Query  1196  PQPRLQAIGYCEELMGMARQRLNEALVAMKESPGKNRQEDIQTWLSAAVTFQQACKDWAD  1017
              + RL A+  C EL+      L  A+  +          D+QT LSAA+T Q  C D   
Sbjct  114   FRQRL-ALNDCLELLDQTLDDLRTAIADLAGCNSSAHVSDLQTVLSAAITNQYTCLD-GF  171

Query  1016  QYAFSDELFARISRSMDYQSQLASNALALVNRNTEISAAGRQLSEEdidddddggffpDW  837
              Y     +   I   + + S L SN+LA+V +       GR+  EE             W
Sbjct  172   AYVNGGGVRPSIEGRLYHVSHLVSNSLAMVKK-IRRQRRGREAFEEYGRMSGGFPT---W  227

Query  836   VSGRDLRLLETTTDKTKANVVVAKDGTGNFRTVAEAIGAASGRQ--RFVIYVKSGVYKEK  663
             V+ +D RLL+   + T  ++VVAKDG+GNF T+ EA+ AA      RFVIY+K+G Y E 
Sbjct  228   VTRKDRRLLQAAANATSPDLVVAKDGSGNFTTIGEAVAAAPNNSATRFVIYIKAGAYFEN  287

Query  662   IRSSKD--GITLIGDGKYSTIITWDDSVGGGSSLTGSATFGITGDGFIAKDIGFQNTAGP  489
             +  +K+   +  IGDG   T++    +V  G +   SAT  + GDGF+A+DI  +N+AGP
Sbjct  288   VDVAKNKKNLMFIGDGIGKTVVKASRNVVDGWTTFRSATVAVVGDGFLARDITIENSAGP  347

Query  488   GAHQAVALTVASDHSVFYRCSISGYQDTLYALSLRQFYRECDISGTVDFIFGNAAAVFQA  309
               HQAVAL V +D S FYRCS   YQDTLY  SLRQFYR+CD+ GTVDFIFGNAA V Q+
Sbjct  348   SKHQAVALRVGADLSAFYRCSFVAYQDTLYVHSLRQFYRDCDVYGTVDFIFGNAAVVLQS  407

Query  308   CNLVLRR--PSSYNVILANGRSDPGQNTGFSVQKCKITPGPDFSPVKNSYNSYLGRPWKP  135
             CNL  R+  P+  N+  A GR DP QNTG S+QKCK+    D  PV++++++YLGRPWK 
Sbjct  408   CNLYARKPDPNQKNIFTAQGREDPNQNTGISIQKCKVAAASDLIPVQSNFSTYLGRPWKQ  467

Query  134   YSRAVVMESDIDGAISARGWIEWPGTSSSSVRELYFGEYANVG  6
             YSR V M+S +   I   GW+EW G  + S   LY+GEY N G
Sbjct  468   YSRTVFMQSFLGSLIDPAGWLEWDGDFALST--LYYGEYMNQG  508



>gb|KCW73020.1| hypothetical protein EUGRSUZ_E01454 [Eucalyptus grandis]
Length=480

 Score =   318 bits (815),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 176/393 (45%), Positives = 236/393 (60%), Gaps = 31/393 (8%)
 Frame = -2

Query  1166  CEELMGMARQRLNEALVAMKESPGKNRQEDIQTWLSAAVTFQQACKDWADQYAFSDELFA  987
             C +L      RLN  +V          Q++ QTWLS A+T  + C+    +   S  +  
Sbjct  64    CLQLYEYTILRLNRTIVH------DCTQDEAQTWLSTALTNLETCQAGFVELGVSGNVLP  117

Query  986   RISRSMDYQSQLASNALALVNRNTEISAAGRQLSEEdidddddggffpDWVSGRDLRLLE  807
              +S ++   S+L SN LAL              +       +    FP WV   D +LL+
Sbjct  118   LMSNNV---SKLISNTLAL--------------NYAPYTTPNYTKKFPTWVRPGDRKLLQ  160

Query  806   TTTDKTKANVVVAKDGTGNFRTVAEAIGAASGRQ---RFVIYVKSGVYKEKIR--SSKDG  642
             +++  +KAN++VA+DG+GN++T++EAI AAS R    R++IY+K+G Y E +   S  + 
Sbjct  161   SSSAVSKANIIVAQDGSGNYKTISEAITAASKRSGTARYIIYIKAGTYSENVEVGSKLEN  220

Query  641   ITLIGDGKYSTIITWDDSVGGGSSLTGSATFGITGDGFIAKDIGFQNTAGPGAHQAVALT  462
             I  +GDG   TIIT   SVGGGS+   SAT  + GDGFIA+DI F+NTAG   HQAVAL 
Sbjct  221   IMFVGDGIGKTIITGSKSVGGGSTTFNSATVAVVGDGFIAQDITFRNTAGAANHQAVALR  280

Query  461   VASDHSVFYRCSISGYQDTLYALSLRQFYRECDISGTVDFIFGNAAAVFQACNLVLRR-P  285
               SD SVFYRC   GYQDTLY  S RQFYRECDI GTVDFIFGNAA V Q CN+  R  P
Sbjct  281   SGSDLSVFYRCGFEGYQDTLYVHSERQFYRECDIYGTVDFIFGNAAVVLQNCNIYARNPP  340

Query  284   SSYNVILANGRSDPGQNTGFSVQKCKITPGPDFSPVKNSYNSYLGRPWKPYSRAVVMESD  105
             +  N + A GR+DP QNTG S+  CK+T   D   V++S  +YLGRPW+ YSR V M++ 
Sbjct  341   NKVNTVTAQGRTDPNQNTGISIHNCKVTAASDLKSVQSSVKTYLGRPWQEYSRTVFMKTY  400

Query  104   IDGAISARGWIEWPGTSSSSVRELYFGEYANVG  6
             +D  I++ GW+EW G  + ++  LY+GEY N G
Sbjct  401   LDSLINSAGWMEWDG--NFALDTLYYGEYLNTG  431



>emb|CDO97716.1| unnamed protein product [Coffea canephora]
Length=514

 Score =   319 bits (817),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 207/499 (41%), Positives = 271/499 (54%), Gaps = 51/499 (10%)
 Frame = -2

Query  1463  VIMLVLFFGCCVTTIaaaavsqvaaQDQIRIQCGYTRFPRLCVQTLS-----GLVSGERV  1299
             V++L+LFF     +          +   I+  C  T +P+ C   L+     G+    + 
Sbjct  6     VMLLLLFFAFPAIS--------SYSLPTIKSWCAQTPYPQPCEYYLTKNPKYGIPIKGKS  57

Query  1298  DFAAALLLNKTIAHADLHIAHFDQLSSHFVS--SQPPQPRLQAI-GYCEELMGMARQRLN  1128
             DF    L         L + H  Q  ++ +S  S+    R +A    C  L      +LN
Sbjct  58    DFLKLSL--------QLALDHSTQSKTNAISLGSKCRNEREKAAWSDCVTLYEDIPLKLN  109

Query  1127  EALVAMKESPGKNRQEDIQTWLSAAVTFQQACKDWADQYAFSDELFARISRSMDYQSQLA  948
             + +    +  GK   ED+QTWLSAA T  + CK        SD     +   +     L 
Sbjct  110   KTV----DPSGKFTSEDVQTWLSAASTNLETCKQGFVDLGASDNAMPSLYDGV--LGNLI  163

Query  947   SNALALVNRNTEISAAGRQLSEEdidddddggffpDWVSGRDLRLLETTTDKTKANVVVA  768
             SNALA  N+     A  +               FP WVS  D +LL+++    +AN+VVA
Sbjct  164   SNALA-TNKGYYGGAGNKD-------------GFPGWVSPGDRKLLQSSAQAAQANIVVA  209

Query  767   KDGTGNFRTVAEAIGAASGRQ---RFVIYVKSGVYKEKIRSSKDGITLIGDGKYSTIITW  597
             +DG+GN+RTV +A+ AAS R    RFVIYVK+G Y E +      I L+GDG   TIIT 
Sbjct  210   QDGSGNYRTVNDAVAAASKRSGNGRFVIYVKAGTYSETVSIGSKNIMLVGDGIGKTIITG  269

Query  596   DDSVGGGSSLT-GSATFGITGDGFIAKDIGFQNTAGPGAHQAVALTVASDHSVFYRCSIS  420
               SVGGG S T  SAT GITGDGF+A+ I F+NTAG  + QAVA   ASD S +Y+CS  
Sbjct  270   RKSVGGGGSTTYSSATVGITGDGFLARGITFRNTAGAKSQQAVAFRSASDLSAYYQCSFE  329

Query  419   GYQDTLYALSLRQFYRECDISGTVDFIFGNAAAVFQACNLVLRR-PSSYNVILANGRSDP  243
             GYQDTLY  S RQFY ECDI GTVDFIFGNAA VFQ C+L  R  P+  N + A GR+DP
Sbjct  330   GYQDTLYVFSQRQFYSECDIYGTVDFIFGNAAVVFQNCSLFARNTPTHTNTLTAQGRTDP  389

Query  242   GQNTGFSVQKCKITPGPDFSPVKNSYNSYLGRPWKPYSRAVVMESDIDGAISARGWIEWP  63
              QNTG S+  CK+T   D  PV++S  +YLGRPWK YSR V M++ +D  I+  GW+ W 
Sbjct  390   NQNTGISIYNCKVTADSDLKPVQSSVKTYLGRPWKQYSRTVFMKTFLDSLIAPAGWLPWS  449

Query  62    GTSSSSVRELYFGEYANVG  6
             G  S ++  LY+GEY N G
Sbjct  450   G--SFALTTLYYGEYMNTG  466



>emb|CAN76835.1| hypothetical protein VITISV_043176 [Vitis vinifera]
Length=497

 Score =   318 bits (816),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 192/443 (43%), Positives = 261/443 (59%), Gaps = 40/443 (9%)
 Frame = -2

Query  1307  ERVDFAAALLLNKTIAHADLHIAHFDQLSSHFVSSQPPQPRLQAI-GYCEELMGMARQRL  1131
             ++ DF   L ++  +A     IAH D  S   + S+    R +A    C EL      +L
Sbjct  37    QKSDF---LNISMQLALERAMIAHGDTFS---LGSKCRNEREKAAWNDCLELYEHTILKL  90

Query  1130  NEALVAMKESPGKNRQEDIQTWLSAAVTFQQACKDWADQYAFSDELFARISRSMDYQSQL  951
             N+ L    +S  +  Q D QTWLS A+T  Q C+D       SD +   +S ++   S+L
Sbjct  91    NKTL----DSNTRCTQADAQTWLSTALTNLQTCQDGFIDLGVSDYVLPLMSNNV---SKL  143

Query  950   ASNALALVNR--NTEISAAGRQLSEEdidddddggffpDWVSGRDLRLLETTTDKTKANV  777
              SN L+ +N+    E S  G                +P WV   D +LL++++  ++AN+
Sbjct  144   ISNTLS-INKVPYAEPSYKG---------------GYPTWVKPGDRKLLQSSSLASQANI  187

Query  776   VVAKDGTGNFRTVAEAIGAASGRQ---RFVIYVKSGVYKEKIR--SSKDGITLIGDGKYS  612
             VV+KDG+G++ T+  AI AAS R    R+VIYVK+G Y E ++  S    I L+GDG   
Sbjct  188   VVSKDGSGDYTTIGAAITAASKRSGSGRYVIYVKAGTYSENVQIGSGLKNIMLLGDGIGK  247

Query  611   TIITWDDSVGGGSSLTGSATFGITGDGFIAKDIGFQNTAGPGAHQAVALTVASDHSVFYR  432
             TI+T   SVGGGS+   SAT  + GDGFIA+ + F+NTAG   HQAVAL   SD SV+Y+
Sbjct  248   TIVTGSKSVGGGSTTFNSATVAVVGDGFIARGMTFRNTAGASNHQAVALRSGSDLSVYYQ  307

Query  431   CSISGYQDTLYALSLRQFYRECDISGTVDFIFGNAAAVFQACNLVLRR-PSSYNVILANG  255
             CS  GYQDTLY  S RQFYRECDI GTVDFIFGNAA VFQ CN+  R  P+  N + A G
Sbjct  308   CSFEGYQDTLYTYSERQFYRECDIYGTVDFIFGNAAVVFQNCNIYXRNPPNKINTVTAQG  367

Query  254   RSDPGQNTGFSVQKCKITPGPDFSPVKNSYNSYLGRPWKPYSRAVVMESDIDGAISARGW  75
             R+DP QNTG S+  CK+T   D   V++S  +YLGRPWK YSR V +++ +D  I++ GW
Sbjct  368   RTDPNQNTGISIHDCKVTAASDLKAVQSSVKTYLGRPWKEYSRTVFLKTYLDSLINSAGW  427

Query  74    IEWPGTSSSSVRELYFGEYANVG  6
             +EW G    +++ LY+GEY N G
Sbjct  428   MEWSG--DFALKTLYYGEYMNTG  448



>gb|KEH29121.1| pectinesterase/pectinesterase inhibitor [Medicago truncatula]
Length=513

 Score =   319 bits (817),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 197/470 (42%), Positives = 263/470 (56%), Gaps = 41/470 (9%)
 Frame = -2

Query  1385  DQIRIQCGYTRFPRLCVQTLSGLVS------GERVDFAAALLLNKTIAHADLHIAHFDQL  1224
             +++++ C  T  P+ CV  LS   S       ++VDF     L+  +        H   L
Sbjct  26    NEVKLWCNQTPNPQPCVYFLSNNPSYKHKLIKQKVDF---FKLSLELVQERALKGHAKTL  82

Query  1223  SSHFVSSQPPQPRLQ-AIGYCEELMGMARQRLNEALVAMKESPGKNRQEDIQTWLSAAVT  1047
             S   + S+    R + A   C EL      +LN+ L        K  Q D QTWLS A+T
Sbjct  83    S---LGSKCSNSREKSAWADCVELYEQTILKLNKTL----NPKTKCSQVDAQTWLSTALT  135

Query  1046  FQQACKDWADQYAFSDELFARISRSMDYQSQLASNALALVNRNTEISAAGRQLSEEdidd  867
               + CK         D +   +S ++   ++L SN LAL              ++    +
Sbjct  136   NLETCKAGFYDLGVQDYILPLMSNNV---TKLLSNTLAL--------------NKVQYQE  178

Query  866   dddggffpDWVSGRDLRLLETTTDKTKANVVVAKDGTGNFRTVAEAIGA--ASGRQRFVI  693
                   FP WV   D +LL+T++ +   NVVVAKDG+G + TV+ A+ A   + + R+VI
Sbjct  179   PSYKDGFPTWVRPGDRKLLQTSSPR--PNVVVAKDGSGKYTTVSAAVNAIPKNNKGRYVI  236

Query  692   YVKSGVYKEKIRSSKDGITLIGDGKYSTIITWDDSVGGGSSLTGSATFGITGDGFIAKDI  513
             +VK+GVY E++      I L+GDG   TIIT   SVGGG++   SAT  + GDGFIA+DI
Sbjct  237   HVKAGVYNEQVEIKAKNIMLVGDGIGKTIITGSKSVGGGTTTFRSATVAVVGDGFIAQDI  296

Query  512   GFQNTAGPGAHQAVALTVASDHSVFYRCSISGYQDTLYALSLRQFYRECDISGTVDFIFG  333
              F+NTAG   HQAVAL   SD SVFYRCS  G+QDTLY  S RQFY++C+I GTVDFIFG
Sbjct  297   TFRNTAGGKNHQAVALRSGSDLSVFYRCSFEGFQDTLYVHSDRQFYKQCNIYGTVDFIFG  356

Query  332   NAAAVFQACNLVLRR-PSSYNVILANGRSDPGQNTGFSVQKCKITPGPDFSPVKNSYNSY  156
             NAAAVFQ CN+  R  P+  N I A GR+DP QNTG S+   ++T   D  PV+NS  +Y
Sbjct  357   NAAAVFQNCNIFPRNPPNKVNTITAQGRTDPNQNTGISIHNSRVTAASDLKPVQNSVKTY  416

Query  155   LGRPWKPYSRAVVMESDIDGAISARGWIEWPGTSSSSVRELYFGEYANVG  6
             LGRPWK YSRAV M++ +D  I   GW+EW G  + S   LY+GEY N G
Sbjct  417   LGRPWKQYSRAVFMKTSLDSLIHPSGWLEWSGNFALST--LYYGEYMNTG  464



>ref|XP_010316615.1| PREDICTED: pectinesterase-like [Solanum lycopersicum]
Length=548

 Score =   320 bits (820),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 183/452 (40%), Positives = 253/452 (56%), Gaps = 24/452 (5%)
 Frame = -2

Query  1340  CVQTLSGLVSGERVDFAAALLLNKTIAHADLHIAHFDQLSSHFVSSQPPQPRLQAIGYCE  1161
             C+  LS +     +D     LL   +  + L I     L+S+            A+  C 
Sbjct  67    CLAMLSEVAPAGLMDTKTVDLLQMVLHKSSLKIHETIHLASNVNGRINNGQEQVALEDCL  126

Query  1160  ELMGMARQRLNEALVAMKESPGKNRQEDIQTWLSAAVTFQQACKDWADQYAFSDELFARI  981
             ELM ++R RL ++++ +     +    D+ +WLS+ +T    C D       + ++ + +
Sbjct  127   ELMDLSRDRLMDSMMGLGNLTAQ-AHFDVHSWLSSILTNHVTCID-----GLNGQVRSIM  180

Query  980   SRSMDYQSQLASNALALVNRNTEISAAGRQLSEEdidddddggffpDWVSGRDLRLLETT  801
                ++     A  +LAL+            ++ +           P WVS  D RLL+ +
Sbjct  181   EPMLNDLVARARTSLALM----------VAIAPQKNIVPTVSDGLPSWVSANDRRLLQLS  230

Query  800   TDKTKANVVVAKDGTGNFRTVAEAIGAA--SGRQRFVIYVKSGVYKEKIR--SSKDGITL  633
              +   ANVVVAKDG+G ++TV EA+ +A  + + R+VIYVK G+YKE +    +K  + L
Sbjct  231   ANAIAANVVVAKDGSGKYKTVKEAVASAPDNSKTRYVIYVKKGIYKENVEIGKTKKNLML  290

Query  632   IGDGKYSTIITWDDSVGGGSSLTGSATFGITGDGFIAKDIGFQNTAGPGAHQAVALTVAS  453
             +GDG  +TIIT + +V  GS+   SAT    GDGFIA+DI FQNTAGP  HQAVAL V +
Sbjct  291   VGDGMDATIITGNLNVIDGSTTFKSATVAAVGDGFIAQDIQFQNTAGPQKHQAVALRVGA  350

Query  452   DHSVFYRCSISGYQDTLYALSLRQFYRECDISGTVDFIFGNAAAVFQACNLVLRRPSS--  279
             D SV  RC +  +QDTLY  +LRQFYR+C I+GTVDFIFGNAA VFQ   L  R+P S  
Sbjct  351   DQSVINRCKMDAFQDTLYTHTLRQFYRDCYITGTVDFIFGNAAVVFQNSKLAARKPMSGQ  410

Query  278   YNVILANGRSDPGQNTGFSVQKCKITPGPDFSPVKNSYNSYLGRPWKPYSRAVVMESDID  99
              N++ A GR DP QNTG S+Q C I P  D  PVK S  +YLGRPWK YSR V M+S+I 
Sbjct  411   SNMVTAQGREDPNQNTGTSIQNCDIIPSSDLEPVKGSVKTYLGRPWKAYSRTVYMQSNIG  470

Query  98    GAISARGWIEWPGTSSSSVRELYFGEYANVGA  3
               I   GW EW G    +++ LY+GEY N GA
Sbjct  471   DHIDPAGWSEWDG--DFALKTLYYGEYMNKGA  500



>ref|XP_007157170.1| hypothetical protein PHAVU_002G048500g [Phaseolus vulgaris]
 gb|ESW29164.1| hypothetical protein PHAVU_002G048500g [Phaseolus vulgaris]
Length=552

 Score =   320 bits (820),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 180/401 (45%), Positives = 235/401 (59%), Gaps = 26/401 (6%)
 Frame = -2

Query  1178  AIGYCEELMGMARQRLNEALVAMKESPGKNRQEDIQTWLSAAVTFQQACKDWADQYA---  1008
             A+  C ELM ++  R+ ++++ +     ++ Q+D  TWLS+ +T    C D  +  A   
Sbjct  121   ALNDCVELMDLSIDRVLDSMLTLTNQTTES-QQDAHTWLSSVLTNHATCLDGLEGTARAL  179

Query  1007  FSDELFARISRSMDYQSQLASNALALVNRNTEISAAGRQLSEEdidddddggffpDWVSG  828
                EL   ISR+   ++ LA     L  R   +      L+ E             W+S 
Sbjct  180   MEAELEDLISRA---RTALAMFVTVLPPR---VEPIDEPLNGEFPS----------WLSS  223

Query  827   RDLRLLETTTDKTKANVVVAKDGTGNFRTVAEAIGAA--SGRQRFVIYVKSGVYKEKIR-  657
             +D RLLE++     ANVVVAKDG+G F+TVAEA+ +A  + + R+VIYVK G YKE +  
Sbjct  224   KDRRLLESSVGDINANVVVAKDGSGKFKTVAEAVASAPDNSKTRYVIYVKKGTYKENVEI  283

Query  656   -SSKDGITLIGDGKYSTIITWDDSVGGGSSLTGSATFGITGDGFIAKDIGFQNTAGPGAH  480
                K  + L+GDGK  T+IT   +   G+    +AT    GDGFI +DI FQNTAGP  H
Sbjct  284   GKKKKNVMLVGDGKDLTVITGSLNYIDGTGTFQTATVAAVGDGFIGQDIWFQNTAGPQKH  343

Query  479   QAVALTVASDHSVFYRCSISGYQDTLYALSLRQFYRECDISGTVDFIFGNAAAVFQACNL  300
             QAVAL V +D SV  RC +  YQDTLYA + RQFYR+  I+GTVDFIFGNAA VFQ C L
Sbjct  344   QAVALRVGADQSVINRCRVDAYQDTLYAHTNRQFYRDSFITGTVDFIFGNAAVVFQKCYL  403

Query  299   VLRRPSS--YNVILANGRSDPGQNTGFSVQKCKITPGPDFSPVKNSYNSYLGRPWKPYSR  126
             V R+P S   N++ A GR DP QNTG S+Q+C ITP  D  PV  S  +YLGRPWK YSR
Sbjct  404   VARKPMSNQKNMVTAQGREDPNQNTGTSIQQCNITPSSDLKPVAGSIKTYLGRPWKKYSR  463

Query  125   AVVMESDIDGAISARGWIEWPGTSSSSVRELYFGEYANVGA  3
              VVM+S I+  I   GW EW   S   ++ LY+ EY N GA
Sbjct  464   TVVMQSTIENHIDPAGWAEWDDKSKDFLQTLYYAEYMNSGA  504



>ref|XP_008359413.1| PREDICTED: pectinesterase-like [Malus domestica]
Length=579

 Score =   321 bits (822),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 202/526 (38%), Positives = 280/526 (53%), Gaps = 61/526 (12%)
 Frame = -2

Query  1514  VHLHAMGGKSDLVTRTWVIMLVLFFGCCVTTIaaaavsqvaaQDQIRIQCGYTRFPRLCV  1335
             +H      K  L T  W     L+   C++T+A                     FP L  
Sbjct  41    IHFQNHIQKQVLETAHWACQDTLYKSLCLSTLAT--------------------FPNLAS  80

Query  1334  QTLSGLVSGERVDFAAALLLNKTIAHADLHI----AHFDQLSSHFVSSQPPQPRLQAIGY  1167
             +TL  ++S              T++H  L +    ++   +   F S +    +  A+  
Sbjct  81    KTLPQIISS-------------TVSHTVLEVKASSSNCTSIKKQF-SKKLSSLQQWALDD  126

Query  1166  CEELMGMARQRLNEAL--VAMKESPGKNRQEDIQTWLSAAVTFQQACKD------WADQY  1011
             C EL+      L  A+  ++  ++   NR  D++  LSAA+T Q  C D       A + 
Sbjct  127   CLELLDNTIDELKSAISDLSXNKTLNSNRYYDLKALLSAAMTNQDTCLDGFSANGTAPRS  186

Query  1010  AFSDELFARISRSMDYQSQLASNALALVNR-----NTEISAAGRQLSEEdidddddggff  846
             +    + + I   ++  SQ  SNAL ++ +       E S   +  SE   D       F
Sbjct  187   SNXGIVRSEIEGRINTISQHVSNALVMLKKIPGAHKYEYSETMK--SEMFPDFGPAKKKF  244

Query  845   pDWVSGRDLRLLETTTDKTKANVVVAKDGTGNFRTVAEAIGAA--SGRQRFVIYVKSGVY  672
             P WVS +D RLL+++T++TK ++VVAKDGTGNF T++EA+  A  S   RFVIY+K+G Y
Sbjct  245   PTWVSSKDRRLLQSSTNETKYDLVVAKDGTGNFTTISEAVDVAPNSSATRFVIYIKAGAY  304

Query  671   KEKIR--SSKDGITLIGDGKYSTIITWDDSVGGGSSLTGSATFGITGDGFIAKDIGFQNT  498
              E +     K  +  +GDG  +TI+    +V  G +   SAT  + G+GFIAK I F+N 
Sbjct  305   FENVEVVKKKTNLMFLGDGIGNTIVKASRNVVDGWTTFRSATVAVVGBGFIAKGITFENG  364

Query  497   AGPGAHQAVALTVASDHSVFYRCSISGYQDTLYALSLRQFYRECDISGTVDFIFGNAAAV  318
             AGP  HQAVAL   +D S FY+CS  GYQDTLY  SLRQFYRECD+ GTVDFIFGNAA V
Sbjct  365   AGPSKHQAVALRSGADFSAFYKCSFVGYQDTLYVHSLRQFYRECDVYGTVDFIFGNAAVV  424

Query  317   FQACNLVLRRPSS--YNVILANGRSDPGQNTGFSVQKCKITPGPDFSPVKNSYNSYLGRP  144
              Q CNL  R+P+    N+  A GR DP QNTG S+  CK+T G D  PVK+++ +YLGRP
Sbjct  425   LQNCNLYARKPNENQKNIFTAQGREDPNQNTGISILNCKVTAGSDLIPVKSNFTTYLGRP  484

Query  143   WKPYSRAVVMESDIDGAISARGWIEWPGTSSSSVRELYFGEYANVG  6
             WK YSR V ++S ID  +   GW+EW G  S ++  LY+GEY N G
Sbjct  485   WKEYSRTVYLKSYIDDLVDPAGWLEWNG--SFALSTLYYGEYLNRG  528



>gb|AFI23414.1| pectin methylesterase [Coffea arabica]
Length=582

 Score =   321 bits (822),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 191/481 (40%), Positives = 271/481 (56%), Gaps = 41/481 (9%)
 Frame = -2

Query  1379  IRIQCGYTRFPRLCVQTLSGL-VSGERVDFAAALLLNKTIAHADLHIAHFDQLSSHFVSS  1203
             +R  C  T  P  C  ++S L  S    D      L+  + HA L       L  H++S 
Sbjct  74    LRAICSVTVHPDSCYTSISSLEASNSTTDPEKLFQLSLQVVHASLQ--KLSTLPQHWISD  131

Query  1202  QPPQPRLQAIGYCEELMGMARQRLNEALVAMKESPGK-----NRQEDIQTWLSAAVTFQQ  1038
                 P  +A+G C+ ++  A    +E+L ++  S G      +R  D++TWLSA++T  +
Sbjct  132   ARDLPLKKALGVCQAVIDDAVDATDESLSSLNVSEGDRLLTVDRVNDLKTWLSASLTDLE  191

Query  1037  ACKDWADQYAFSDELFARISRSMDYQSQLASNALALVNRNTEISAA-----GRQLSEEdi  873
              C D + Q   +  L  ++  S    ++ ASN+LA+V++   I +       R+L     
Sbjct  192   TCLD-SLQEVNATVLAEQVRASSRNSTEFASNSLAIVSKLLTILSGFNIPIHRKL---LA  247

Query  872   dddddggffpDWVSGRDLRLLETTTDKTKANVVVAKDGTGNFRTVAEAIG--AASGRQRF  699
                D  G FP WV   D RLL+T  + TK ++VVA+DG+G++RT++EA+       + RF
Sbjct  248   AGTDSDGGFPRWVRAADRRLLQTPNENTKPDLVVAQDGSGDYRTISEAVAKIPKKSKTRF  307

Query  698   VIYVKSGVYKEKIRSSKD--GITLIGDGKYSTIITWDDSVGGGSSLTGSATFGITGDGFI  525
             VIYVK+GVYKEK+   K    + + GDGK  TI+T DD+   G+    +ATF + G GFI
Sbjct  308   VIYVKAGVYKEKVSLDKSTWNVMMYGDGKAKTIVTSDDNFVDGTPTFDTATFAVAGKGFI  367

Query  524   AKDIGFQNTAGPGAHQAVALTVASDHSVFYRCSISGYQDTLYALSLRQFYRECDISGTVD  345
             AK + F+NTAG   HQAVA    SD SV Y CS   +QDTLY  S RQFYRECDISGT+D
Sbjct  368   AKSMAFRNTAGAAKHQAVAFRSGSDQSVLYLCSFDAFQDTLYPHSNRQFYRECDISGTID  427

Query  344   FIFGNAAAVFQACNLVLRR--PSSYNVILANGRSDPGQNTGFSVQKCKITPGPDFSPVKN  171
             FIFGNAA VFQ CN+  R+  P+ +  I A G+ DP QNTG ++Q C ++P       K 
Sbjct  428   FIFGNAAVVFQNCNIRPRQPLPNQFVTITAQGKKDPNQNTGITIQNCVMSPLD-----KL  482

Query  170   SYNSYLGRPWKPYSRAVVMESDIDGAISARGWIEW------PGTSSSSVRELYFGEYANV  9
             +  +YLGRPWKPYS  V+M+++I   ++ +GWIEW      P T       +++GEY N 
Sbjct  483   TAPTYLGRPWKPYSTTVIMQTNIGAFLAPKGWIEWVFNVEPPST-------IFYGEYQNT  535

Query  8     G  6
             G
Sbjct  536   G  536



>gb|AFW03484.1| pectin methylesterase 5 [Gossypium hirsutum]
Length=519

 Score =   318 bits (816),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 191/467 (41%), Positives = 262/467 (56%), Gaps = 32/467 (7%)
 Frame = -2

Query  1385  DQIRIQCGYTRFPRLCVQTLSGLVSGERVDFAAALLLNKTIAHADLHIAHFDQLSSHFVS  1206
             + +R  C  T  P+ C   LS       +   +     K   H  L  A   + ++H + 
Sbjct  29    NDVRSWCRKTPNPQPCEYFLSHDPKNTPIKDESQFF--KISMHLALERAARAESNTHSLG  86

Query  1205  SQPPQPR-LQAIGYCEELMGMARQRLNEALVAMKESPGKNRQEDIQTWLSAAVTFQQACK  1029
              +    R + A   C  L  +   RLN+ +    +S     ++D QTWLS A+T  + C+
Sbjct  87    PKCRNGREMAAWSDCVNLYELTILRLNKTV----DSGTNLNKDDAQTWLSTALTNLETCQ  142

Query  1028  DWADQYAFSDELFARISRSMDYQSQLASNALALVNRNTEISAAGRQLSEEdidddddggf  849
                 +    D L   +S ++   SQL SN LAL              ++    +      
Sbjct  143   TGFMELGVPDYLLPMMSNNV---SQLISNTLAL--------------NKAPYQEPTYKDG  185

Query  848   fpDWVSGRDLRLLETTTDKTKANVVVAKDGTGNFRTVAEAIGAASGRQ---RFVIYVKSG  678
             FP WV   D +LL++++  + AN+VVA+DG+GN++T+ +AI AAS R    R+VIYVK+G
Sbjct  186   FPTWVKPGDRKLLQSSSPASTANIVVAQDGSGNYKTIKDAISAASKRSGSGRYVIYVKAG  245

Query  677   VYKEKIR--SSKDGITLIGDGKYSTIITWDDSVGGGSSLTGSATFGITGDGFIAKDIGFQ  504
              YKE +   S    I ++GDG   TIIT   SVGGGS+   SAT  + GDGFIA+ I F+
Sbjct  246   TYKENVEIGSKLKNIMMVGDGIGKTIITGSKSVGGGSTTFNSATVAVVGDGFIARGITFR  305

Query  503   NTAGPGAHQAVALTVASDHSVFYRCSISGYQDTLYALSLRQFYRECDISGTVDFIFGNAA  324
             NTAGP  HQAVAL   SD SVFY+CS  GYQDTLY  S RQFYRECDI GTVD+IFGNAA
Sbjct  306   NTAGPTNHQAVALRSGSDLSVFYKCSFEGYQDTLYVHSERQFYRECDIYGTVDWIFGNAA  365

Query  323   AVFQACNLVLRR-PSSYNVILANGRSDPGQNTGFSVQKCKITPGPDFSPVKNSYNSYLGR  147
              VFQ CN+  R  P+  N + A GR+DP QNTG  +   ++T   D  PV++S  +YLGR
Sbjct  366   VVFQNCNIYARNPPNKTNTVTAQGRTDPNQNTGIIIHNSRVTAASDLKPVQSSVKTYLGR  425

Query  146   PWKPYSRAVVMESDIDGAISARGWIEWPGTSSSSVRELYFGEYANVG  6
             PWK YSR V M++ +D  I+   W+EW G  + +++ LY+ EY N G
Sbjct  426   PWKQYSRTVFMKTYLDSLINPADWMEWDG--NFALKTLYYAEYMNTG  470



>ref|XP_007213952.1| hypothetical protein PRUPE_ppa003697mg [Prunus persica]
 gb|EMJ15151.1| hypothetical protein PRUPE_ppa003697mg [Prunus persica]
Length=555

 Score =   320 bits (819),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 191/466 (41%), Positives = 258/466 (55%), Gaps = 27/466 (6%)
 Frame = -2

Query  1367  CGYTRFPRLCVQTLSGLVSGERVDFAAALLLNKTIAHADLHIAHFDQLSSHFVSSQPPQP  1188
             C +    + C+  ++ +   +    +   LL   +  +  HI    +++    S      
Sbjct  58    CDHAHDQKSCLAMVTEVAGDKTKPVSDVDLLQALLEKSTPHIEKALEIAKDASSGINNPK  117

Query  1187  RLQAIGYCEELMGMARQRLNEALVAMKESPGKNRQEDIQTWLSAAVTFQQACKDWADQYA  1008
              L AI  C ELM ++R R+  +++A++    +N  ED   WLS+ +T    C D     A
Sbjct  118   NLAAIADCVELMDVSRDRVMHSIIALQNFTLQNSLEDAHAWLSSILTNHVTCLDGLQGPA  177

Query  1007  ---FSDELFARISRSMDYQSQLASNALALVNRNTEISAAGRQLSEEdidddddggffpDW  837
                    L   ISRS   ++ LA   +A+ N +   +     L+ E             W
Sbjct  178   RTIMEPRLNDLISRS---RASLAI-MVAISNPSKPKAEIHEPLNGEFPS----------W  223

Query  836   VSGRDLRLLE--TTTDKTKANVVVAKDGTGNFRTVAEAIGAA--SGRQRFVIYVKSGVYK  669
             V+ RD RLL+      + KAN+VVAKDG+GN++T+ EA+ AA  + + R++IYVK G YK
Sbjct  224   VTSRDRRLLQDYNLAKEVKANIVVAKDGSGNYKTLKEAVAAAPNNSKTRYIIYVKKGTYK  283

Query  668   EKIRSSKD--GITLIGDGKYSTIITWDDSVGGGSSLTGSATFGITGDGFIAKDIGFQNTA  495
             E +   KD   + ++GDG   T+IT   +V  GS+   SAT    GDGFIA+D+ FQNTA
Sbjct  284   ENVEVGKDKKNLMIVGDGMDDTVITGSLNVVDGSTTFKSATLAAVGDGFIAQDMWFQNTA  343

Query  494   GPGAHQAVALTVASDHSVFYRCSISGYQDTLYALSLRQFYRECDISGTVDFIFGNAAAVF  315
             G   HQAVAL V +D SV  RC I  YQDTLY  S RQFYR+  I+GTVDFIFGNAA VF
Sbjct  344   GAVKHQAVALRVGADQSVINRCRIDAYQDTLYTHSNRQFYRDSYITGTVDFIFGNAAVVF  403

Query  314   QACNLVLRRPSS--YNVILANGRSDPGQNTGFSVQKCKITPGPDFSPVKNSYNSYLGRPW  141
             Q C LV R+P +   N++ A GR DP QNTG S+QKC I    D  PVK +  SYLGRPW
Sbjct  404   QNCKLVARKPMTGQNNMVTAQGRIDPNQNTGTSIQKCDIIASSDLEPVKGTIRSYLGRPW  463

Query  140   KPYSRAVVMESDIDGAISARGWIEWPGTSSSSVRELYFGEYANVGA  3
             K YSR VVM+S I   I   GW  W G    +++ LY+GEYAN GA
Sbjct  464   KEYSRTVVMQSKIGDHIDPSGWSIWSG--DFALKTLYYGEYANSGA  507



>ref|XP_007024770.1| Pectin methylesterase 3 isoform 1 [Theobroma cacao]
 gb|EOY27392.1| Pectin methylesterase 3 isoform 1 [Theobroma cacao]
Length=582

 Score =   320 bits (821),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 188/477 (39%), Positives = 271/477 (57%), Gaps = 25/477 (5%)
 Frame = -2

Query  1379  IRIQCGYTRFPRLCVQTLSGLVSGERVDFAAA-----LLLNKTIAHADLHIAHFDQLSSH  1215
             ++  C  TR+P LC   ++   +       +      L LN T    + +     +L   
Sbjct  65    VKSACSITRYPDLCFSEVAAAPAATSKKVKSKKDVIELSLNITTTAVEHNYFKIKKL---  121

Query  1214  FVSSQPPQPRLQAIGYCEELMGMARQRLNEALVAMKESPGKN----RQEDIQTWLSAAVT  1047
                    +    A+  C E +      L+EA+  + E P K       +D++T +SAA+T
Sbjct  122   LAKKGLTEREKTALHDCLETIDETLDELHEAVEDLHEYPNKKSLTQHADDLKTLMSAAMT  181

Query  1046  FQQACKDWADQYAFSDELFARISRSMDYQSQLASNALALVNRNTEISAAGRQL---SEEd  876
              Q+ C D     A   ++   +     Y  ++ SNALA++   T+   A   L   S   
Sbjct  182   NQETCLDGFSHDAADKKIRKVLIDGEKYVERMCSNALAMIKNMTDTDIANEMLKTSSNRK  241

Query  875   idddddggffpDWVSGRDLRLLETTTDKTKANVVVAKDGTGNFRTVAEAIGAASGR--QR  702
             + + ++G  +P+W+S  D RLL++++     +VVVA DG+GN++TV+EA+  A  R  +R
Sbjct  242   LKEQENGIAWPEWLSAGDRRLLQSSS--VTPDVVVAADGSGNYKTVSEAVAKAPQRSSKR  299

Query  701   FVIYVKSGVYKEKIR--SSKDGITLIGDGKYSTIITWDDSVGGGSSLTGSATFGITGDGF  528
             +VI +K+GVY+E +     K  I  +GDG+  TIIT   +V  GS+   SAT  + G+ F
Sbjct  300   YVIKIKAGVYRENVEVPKKKTNIMFLGDGRTETIITGSRNVVDGSTTFHSATVAVVGERF  359

Query  527   IAKDIGFQNTAGPGAHQAVALTVASDHSVFYRCSISGYQDTLYALSLRQFYRECDISGTV  348
             +A+DI FQNTAGP  HQAVAL V +D S FY C +  YQDTLYA S RQFY  C I+GTV
Sbjct  360   LARDITFQNTAGPSKHQAVALRVGADLSAFYECDMLAYQDTLYAHSNRQFYVNCIIAGTV  419

Query  347   DFIFGNAAAVFQACNLVLRRPSS--YNVILANGRSDPGQNTGFSVQKCKITPGPDFSPVK  174
             DFIFGNAAAVFQ C++  RRP+S   N++ A GR+DP QNTG  +QKC+I    D   V+
Sbjct  420   DFIFGNAAAVFQNCDIHARRPNSGQKNMVTAQGRTDPNQNTGIVIQKCRIGATSDLQSVR  479

Query  173   NSYNSYLGRPWKPYSRAVVMESDIDGAISARGWIEWPGTSSSSVRELYFGEYANVGA  3
             +++ +YLGRPWK YSR VVM+S I   I   GW EW  + S ++R L++GEY N GA
Sbjct  480   SNFPTYLGRPWKEYSRTVVMQSVISDVIHPAGWHEW--SESFALRTLFYGEYQNTGA  534



>ref|XP_009382521.1| PREDICTED: pectinesterase-like [Musa acuminata subsp. malaccensis]
Length=566

 Score =   320 bits (820),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 185/463 (40%), Positives = 260/463 (56%), Gaps = 13/463 (3%)
 Frame = -2

Query  1370  QCGYTRFPRLCVQTLSGL--VSGERVDFAAALLLNKTIAHADLHIAHFDQLSSHFVSSQP  1197
              C  T +P LC  TLS +  +  + +       +N + A       +  +   H   +  
Sbjct  59    HCDGTLYPDLCASTLSTIPDLHSKSLPEVICATINASEAAVIKSAKNCTKYLHHHNYTLD  118

Query  1196  PQPRLQAIGYCEELMGMARQRLNEALVAMKESPGKNRQEDIQTWLSAAVTFQQACKDWAD  1017
              + R  A+  C +L       L +A   +  +PG +  + +QT LSAA+T Q  C D   
Sbjct  119   TRQRY-ALTDCLDLFSQTLDELLDATSDLTANPGSH-VDHVQTLLSAAITNQYTCLDGFA  176

Query  1016  QYAFSDELFARISRSMDYQSQLASNALALVNRNTEISAAGRQLSEEdidddddggffpDW  837
                      + I + + + S L SN+LA++ +  +         E      +    FP W
Sbjct  177   YVGKDGGYRSVIEQPLYHVSHLVSNSLAMMKK-IQRQKPPHPRREALEGYGEVAEGFPVW  235

Query  836   VSGRDLRLLETTTDKTKANVVVAKDGTGNFRTVAEAIGAASGRQ--RFVIYVKSGVYKEK  663
             VSG+D RLL+   + T  N++VAKDG+GNF T++EA+ AA  +   RFVIY+K+G Y E 
Sbjct  236   VSGKDRRLLQAAANTTTPNLIVAKDGSGNFTTISEAVAAAPSKSETRFVIYIKAGAYLEN  295

Query  662   IR--SSKDGITLIGDGKYSTIITWDDSVGGGSSLTGSATFGITGDGFIAKDIGFQNTAGP  489
             +    S+  +  +GDG   T++    +V  G +   SAT  I G+GF+ +D+  +N+AGP
Sbjct  296   VEVGKSQTNLMFMGDGIGKTVVKASRNVVDGWTTFRSATVAIVGNGFLMRDMTIENSAGP  355

Query  488   GAHQAVALTVASDHSVFYRCSISGYQDTLYALSLRQFYRECDISGTVDFIFGNAAAVFQA  309
               HQAVAL V +D S FYRCS  GYQDTLYA SLRQFYRECD+ GT+DFIFGNA  V Q 
Sbjct  356   SKHQAVALRVGADLSAFYRCSFVGYQDTLYAHSLRQFYRECDVYGTIDFIFGNAGVVLQN  415

Query  308   CNLVLRRPSS--YNVILANGRSDPGQNTGFSVQKCKITPGPDFSPVKNSYNSYLGRPWKP  135
             CNL  R+P S   NV  A GR DP QNTG S+Q CK+    D +PV++++++YLGRPWK 
Sbjct  416   CNLYARKPLSNQKNVFTAQGREDPNQNTGISIQNCKVAAASDLAPVQSNFSTYLGRPWKA  475

Query  134   YSRAVVMESDIDGAISARGWIEWPGTSSSSVRELYFGEYANVG  6
             YSR V M+S +D  I+  GW+EW G  + S   LY+GEY N G
Sbjct  476   YSRTVYMQSLLDSLINPAGWLEWDGDFALST--LYYGEYMNRG  516



>ref|XP_009766156.1| PREDICTED: pectinesterase 2-like [Nicotiana sylvestris]
Length=525

 Score =   318 bits (816),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 174/364 (48%), Positives = 225/364 (62%), Gaps = 23/364 (6%)
 Frame = -2

Query  1079  DIQTWLSAAVTFQQACKDWADQYAFSDELFARISRSMDYQSQLASNALALVNRNTEISAA  900
             D Q+WLS A+T  + C+   ++   +D +   +S ++   S L SN L+L N        
Sbjct  130   DAQSWLSTALTNLETCRAGFEELGVTDYVMPLMSNNV---SSLISNTLSL-NHGYYTEPT  185

Query  899   GRQLSEEdidddddggffpDWVSGRDLRLLETTTDKTKANVVVAKDGTGNFRTVAEAIGA  720
               Q+             FP WV+  D +LL++++  ++AN+VVAKDG+GNF+TV EA+ A
Sbjct  186   ATQVD-----------GFPTWVAPGDRKLLQSSSPASQANIVVAKDGSGNFKTVKEAVAA  234

Query  719   ASGRQ---RFVIYVKSGVYKEKIR--SSKDGITLIGDGKYSTIITWDDSVGGGSSLTGSA  555
             A  R+   RFVIYVK+G+Y E +   S    I  +GDG   TIIT   SVGGGS+   SA
Sbjct  235   AGKRKGSARFVIYVKAGIYSENVELGSKLKNIMFVGDGIGKTIITGSKSVGGGSTTFKSA  294

Query  554   TFGITGDGFIAKDIGFQNTAGPGAHQAVALTVASDHSVFYRCSISGYQDTLYALSLRQFY  375
             T  + GDGFI + I  +NTAGP  HQAVAL   SD SVFY+CS  GYQDTLY  S RQFY
Sbjct  295   TVAVVGDGFICRGITIRNTAGPQNHQAVALRSGSDLSVFYQCSFEGYQDTLYVHSDRQFY  354

Query  374   RECDISGTVDFIFGNAAAVFQACNLVLRR-PSSYNVILANGRSDPGQNTGFSVQKCKITP  198
             RECD+ GTVDFIFGNAA V Q CN+  R  P+  N + A GR+DP QNTG S+  C+IT 
Sbjct  355   RECDVYGTVDFIFGNAAVVLQNCNIFARDPPNKTNTVTAQGRTDPNQNTGISIHNCRITA  414

Query  197   GPDFSPVKNSYNSYLGRPWKPYSRAVVMESDIDGAISARGWIEWPGTSSSSVRELYFGEY  18
               D    KNS  +YLGRPWK YSR VVM++ +D  I   GW+ W GT   +++ LY+GEY
Sbjct  415   ASDLKASKNSVKTYLGRPWKQYSRTVVMKTFLDSLIQPDGWMPWSGT--FALKTLYYGEY  472

Query  17    ANVG  6
              N G
Sbjct  473   LNTG  476



>emb|CAN78759.1| hypothetical protein VITISV_000562 [Vitis vinifera]
Length=513

 Score =   318 bits (815),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 193/468 (41%), Positives = 264/468 (56%), Gaps = 34/468 (7%)
 Frame = -2

Query  1385  DQIRIQCGYTRFPRLCVQTLSGLVSGERVDFAAALL-LNKTIAHADLHIAHFDQLSSHFV  1209
             D ++  C  T +P+ C   LS       +   +  L ++  +A     IAH D  S   +
Sbjct  23    DDVKSWCRQTPYPQPCEYFLSHKPDHSPIKQKSDFLNISMQLALEHAMIAHGDTFS---L  79

Query  1208  SSQPPQPRLQAI-GYCEELMGMARQRLNEALVAMKESPGKNRQEDIQTWLSAAVTFQQAC  1032
              S+    R +A    C EL      +LN+ L    +   +  Q D QTWLS A+T  Q C
Sbjct  80    GSKCRNEREKAAWNDCLELYDHTILKLNKTL----DPNTRCTQADAQTWLSTALTNLQTC  135

Query  1031  KDWADQYAFSDELFARISRSMDYQSQLASNALALVNRNTEISAAGRQLSEEdidddddgg  852
             +D   +   S      +S ++   S+L SN L++              ++         G
Sbjct  136   QDGFIELGVSGHFLPLMSNNV---SKLISNTLSI--------------NKVPYSVPTYKG  178

Query  851   ffpDWVSGRDLRLLETTTDKTKANVVVAKDGTGNFRTVAEAIGAASGRQ---RFVIYVKS  681
              +P WV   D +LL++++  ++AN+VV+KDGT ++ T+  AI AAS R    R+VIYVK+
Sbjct  179   GYPTWVKPGDRKLLQSSSLASQANIVVSKDGTHDYTTIGAAITAASKRSGSGRYVIYVKA  238

Query  680   GVYKEKIR--SSKDGITLIGDGKYSTIITWDDSVGGGSSLTGSATFGITGDGFIAKDIGF  507
             G Y E ++  S    I L+GDG   TI+T   SVGGGS+   SAT  + GDGFIA+ + F
Sbjct  239   GTYSENVQIGSGLKNIMLLGDGIGKTIVTGSKSVGGGSTTYNSATVAVVGDGFIARGMTF  298

Query  506   QNTAGPGAHQAVALTVASDHSVFYRCSISGYQDTLYALSLRQFYRECDISGTVDFIFGNA  327
             +NTAG   HQAVAL   SD SVFY+CS  GYQDTLY  S RQFYRECDI GTVDFIFGNA
Sbjct  299   RNTAGASNHQAVALRSGSDLSVFYQCSFEGYQDTLYTYSERQFYRECDIYGTVDFIFGNA  358

Query  326   AAVFQACNLVLRR-PSSYNVILANGRSDPGQNTGFSVQKCKITPGPDFSPVKNSYNSYLG  150
             A VFQ CN+  R  P+  N + A GR+DP QNTG S+  CK+T   D   V++S   YLG
Sbjct  359   AVVFQNCNIYARNPPNKINTVTAQGRTDPNQNTGISIHDCKVTAASDLKAVQSSVKIYLG  418

Query  149   RPWKPYSRAVVMESDIDGAISARGWIEWPGTSSSSVRELYFGEYANVG  6
             RPWK YSR V +++ +D  I++ GW+EW G    +++ LY+GEY N G
Sbjct  419   RPWKEYSRTVFLKTYLDSLINSAGWMEWSG--DFALKTLYYGEYMNTG  464



>ref|XP_007045218.1| Plant invertase/pectin methylesterase inhibitor superfamily [Theobroma 
cacao]
 gb|EOY01050.1| Plant invertase/pectin methylesterase inhibitor superfamily [Theobroma 
cacao]
Length=520

 Score =   318 bits (816),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 170/390 (44%), Positives = 233/390 (60%), Gaps = 17/390 (4%)
 Frame = -2

Query  1166  CEELMGMARQRLNEALVAMKESPGKNRQEDIQTWLSAAVTFQQACKDWADQYAFSDELFA  987
             C EL       LN        S   N   D QTWLSAA+  QQ C++    +  +  L  
Sbjct  99    CLELYENTVNHLNH-------SKSTNNPMDAQTWLSAAIANQQTCQNGFIDFNLASHLQT  151

Query  986   RISRSMDYQSQLASNALALVNRNTEISAAGRQLSEEdidddddggffpDWVSGRDLRLLE  807
               S   ++ S+L SN+LA+       S+  +Q+    +           W+S  D +LL+
Sbjct  152   FPSMLGNF-SKLLSNSLAINKATVTSSSTAKQVGNRRLLAHGFPA----WLSAADRKLLQ  206

Query  806   TTTDKTKANVVVAKDGTGNFRTVAEAIGAASGRQRFVIYVKSGVYKEKIRSSKDGITLIG  627
              T    KA++VVA+DG+GNF++++EA+ AA G +R VIYVK+GVY+E +   K  I LIG
Sbjct  207   KTGAPPKADIVVAQDGSGNFKSISEAVAAAGGGKRTVIYVKAGVYRENVNIKKSNIMLIG  266

Query  626   DGKYSTIITWDDSVGGGSSLTGSATFGITGDGFIAKDIGFQNTAGPGAHQAVALTVASDH  447
             DG  +T++T   S    ++ + SAT G+ GD F+A+DI F N+AGP  HQAVA    SDH
Sbjct  267   DGMDATVVTGSKSAQTTTTFS-SATVGVAGDRFVARDITFDNSAGPQKHQAVAFRSGSDH  325

Query  446   SVFYRCSISGYQDTLYALSLRQFYRECDISGTVDFIFGNAAAVFQACNLVLRRPSS--YN  273
             SV YRCS  GYQDTLY  S RQFYR+CDI GT+DFIFG+A AV Q CN+ +R+P S   N
Sbjct  326   SVIYRCSFKGYQDTLYVYSQRQFYRDCDIYGTLDFIFGDAVAVLQNCNIYIRKPMSNQRN  385

Query  272   VILANGRSDPGQNTGFSVQKCKITPGPDFSPVKNSYNSYLGRPWKPYSRAVVMESDIDGA  93
              + A GR+D  +NTG  +   ++T   D   V+ S+ SYLGRPW+ YSR V M+S +DG 
Sbjct  386   TVTAQGRTDANENTGIIIHNSRVTASSDLRGVQGSFKSYLGRPWQKYSRTVFMKSVLDGV  445

Query  92    ISARGWIEWPGTSSSSVRELYFGEYANVGA  3
             I+A GW+ W G  S ++  LY+ E+ N GA
Sbjct  446   ITAEGWLPWSG--SFALSTLYYAEHMNTGA  473



>ref|XP_004232737.1| PREDICTED: pectinesterase-like [Solanum lycopersicum]
Length=546

 Score =   319 bits (818),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 185/452 (41%), Positives = 251/452 (56%), Gaps = 24/452 (5%)
 Frame = -2

Query  1340  CVQTLSGLVSGERVDFAAALLLNKTIAHADLHIAHFDQLSSHFVSSQPPQPRLQAIGYCE  1161
             C+  LS +     +D     LL   +  + L I     L+S+            A+  C 
Sbjct  65    CLAMLSEVAPAGLMDIKTVDLLQMVLHKSSLKIHETIHLASNVNGRINNGQEQVALEDCL  124

Query  1160  ELMGMARQRLNEALVAMKESPGKNRQEDIQTWLSAAVTFQQACKDWADQYAFSDELFARI  981
             ELM ++R RL +++V +     +    D+ +WLS+ +T    C D       + ++ + +
Sbjct  125   ELMDLSRDRLMDSMVGLGNLTVQ-AHFDVHSWLSSILTNHVTCID-----GLNGQVRSIM  178

Query  980   SRSMDYQSQLASNALALVNRNTEISAAGRQLSEEdidddddggffpDWVSGRDLRLLETT  801
                ++     A  +LAL+            ++ +           P WVS  D RLL+ +
Sbjct  179   EPMLNDLVARARTSLALM----------VAIAPQKNIVPTVSDGLPSWVSANDRRLLQLS  228

Query  800   TDKTKANVVVAKDGTGNFRTVAEAIGAA--SGRQRFVIYVKSGVYKEKIR--SSKDGITL  633
              +   ANVVVAKDG+G ++TV EA+ +A  + + R+VIYVK G YKE +     K  I L
Sbjct  229   ANAIAANVVVAKDGSGKYKTVKEAVASAPDNSKTRYVIYVKKGTYKENVEIGKKKKNIML  288

Query  632   IGDGKYSTIITWDDSVGGGSSLTGSATFGITGDGFIAKDIGFQNTAGPGAHQAVALTVAS  453
             +GDG  +TIIT + +V  GS+   SAT    GDGFIA+DI FQNTAGP  HQAVAL V +
Sbjct  289   VGDGMDATIITGNLNVIDGSTTFKSATVAAVGDGFIAQDIQFQNTAGPQKHQAVALRVGA  348

Query  452   DHSVFYRCSISGYQDTLYALSLRQFYRECDISGTVDFIFGNAAAVFQACNLVLRRPSS--  279
             D SV  RC +  +QDTLY  +LRQFYR+C I GTVDFIFGNAA VFQ   L  R+P S  
Sbjct  349   DQSVINRCKMDAFQDTLYTHTLRQFYRDCYIIGTVDFIFGNAAVVFQNSKLAARKPMSGQ  408

Query  278   YNVILANGRSDPGQNTGFSVQKCKITPGPDFSPVKNSYNSYLGRPWKPYSRAVVMESDID  99
              N++ A GR DP QNTG S+Q C I P  D +PVK S  +YLGRPWK YSR V M+S+I 
Sbjct  409   KNMVTAQGREDPNQNTGTSIQNCDIIPSSDLAPVKGSVKTYLGRPWKAYSRTVYMQSNIG  468

Query  98    GAISARGWIEWPGTSSSSVRELYFGEYANVGA  3
               I   GW EW G    +++ LY+GEY N GA
Sbjct  469   DHIDPAGWSEWDG--DFALKTLYYGEYMNKGA  498



>ref|XP_004492227.1| PREDICTED: pectinesterase/pectinesterase inhibitor 18-like [Cicer 
arietinum]
Length=557

 Score =   319 bits (818),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 181/406 (45%), Positives = 240/406 (59%), Gaps = 25/406 (6%)
 Frame = -2

Query  1196  PQPRLQAIGYCEELMGMARQRLNEALVAMKESPGKNRQEDIQTWLSAAVTFQQACKDWAD  1017
             P+  L A+  CEELM ++  R+  +++ +  +   + Q++  TWLS  +T    C D  +
Sbjct  119   PKEEL-ALNDCEELMDLSMDRVWNSVLTLTNN-NIDSQQNAHTWLSTVLTNHVTCLDGLE  176

Query  1016  ---QYAFSDELFARISRSMDYQSQLASNALALVNRNTEISAAGRQLSEEdidddddggff  846
                      +L   ISR+   +S LA       +++++         EE ++ D      
Sbjct  177   GSSLVVMESDLHDLISRA---RSSLAVLVAVFPSKDSD------GFIEEKLNGDFPS---  224

Query  845   pDWVSGRDLRLLETTTDKTKANVVVAKDGTGNFRTVAEAIGAA--SGRQRFVIYVKSGVY  672
               WV+ +D +LLE++    KANVVVAKDG+G F+TV EA+ +A  +G  R+VIYVK G+Y
Sbjct  225   --WVTSKDRKLLESSIGDIKANVVVAKDGSGKFKTVVEAVASAPDNGNTRYVIYVKKGIY  282

Query  671   KEKIR--SSKDGITLIGDGKYSTIITWDDSVGGGSSLTGSATFGITGDGFIAKDIGFQNT  498
             KE +     K  + L+GDG   T IT   +V  GS+   SAT    GDGFIA+DIGFQNT
Sbjct  283   KENVEIGKKKKNVMLVGDGMDVTTITGSLNVIDGSTTFKSATVAAVGDGFIAQDIGFQNT  342

Query  497   AGPGAHQAVALTVASDHSVFYRCSISGYQDTLYALSLRQFYRECDISGTVDFIFGNAAAV  318
             AGP  HQAVAL V +D SV  RC I  +QDTLYA S RQFYR+  I+GTVDFIFGNAA V
Sbjct  343   AGPEKHQAVALRVGADQSVINRCRIDAFQDTLYAHSNRQFYRDSYITGTVDFIFGNAAVV  402

Query  317   FQACNLVLRRPSS--YNVILANGRSDPGQNTGFSVQKCKITPGPDFSPVKNSYNSYLGRP  144
             FQ   L  RRP S   N++ A GR DP QNT  S+Q+C + P  D  PV +S  +YLGRP
Sbjct  403   FQKSKLAARRPMSNQKNMVTAQGREDPNQNTATSIQQCDVIPSSDLKPVVSSIKTYLGRP  462

Query  143   WKPYSRAVVMESDIDGAISARGWIEWPGTSSSSVRELYFGEYANVG  6
             WK YSR VV++S ID  I   GW EW   S   ++ LY+GEY N G
Sbjct  463   WKKYSRTVVLQSLIDNHIDPTGWAEWNDASKDFLQTLYYGEYLNNG  508



>ref|XP_007012502.1| Pectin methylesterase 3 [Theobroma cacao]
 gb|EOY30121.1| Pectin methylesterase 3 [Theobroma cacao]
Length=573

 Score =   320 bits (819),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 193/480 (40%), Positives = 269/480 (56%), Gaps = 33/480 (7%)
 Frame = -2

Query  1379  IRIQCGYTRFPRLCVQTLSGLVSGE-RVDFAAALL---LNKTIAHADLHIAHFDQLSSHF  1212
             I+  C  T +P LC+ T+S     E ++     ++   +N TI     +     +L S  
Sbjct  58    IKSSCSSTLYPELCLSTISAAPDAETKIKSPKDVIVTSMNLTITAVQSNYLSIKKLIS--  115

Query  1211  VSSQPPQPRLQAIGYCEELMGMARQRLNEALVAMKESPGKNRQ-----EDIQTWLSAAVT  1047
              +   P+    A+  C EL       L +A   + + P  N+      ++++T LSAA+T
Sbjct  116   TNKNLPKREKTALNDCLELEDETLDELYKAEQDLSDYPTFNKSISQHADELKTLLSAAMT  175

Query  1046  FQQACKDWADQYAFSDELFARISRSMDYQSQLASNALALVNRNTEISAA------GRQLS  885
              Q+ C D     +   ++   +     +   + SNALA++   T+   A      GRQL 
Sbjct  176   NQETCLDGFSHDSADKKVRQALIDGQMHVFHMCSNALAMIKNLTDTDMASQGYPSGRQLE  235

Query  884   EEdidddddggffpDWVSGRDLRLLETTTDKTKANVVVAKDGTGNFRTVAEAIGAASGR-  708
             E+D  +  +      W+S  D RLL+  T     +V VA DG+G+FRTV+EA+ AA  R 
Sbjct  236   EQDETEWPE------WLSAGDRRLLQAPT--VTPDVTVAADGSGDFRTVSEAVAAAPERS  287

Query  707   -QRFVIYVKSGVYKEKIR--SSKDGITLIGDGKYSTIITWDDSVGGGSSLTGSATFGITG  537
              +R++I +K+GVYKE +     K  +  +GDG+ +TIIT   +V  GS+   SAT    G
Sbjct  288   TRRYIIKIKAGVYKENVDVPRGKTNLMFVGDGRVNTIITASRNVVDGSTTFNSATVAAVG  347

Query  536   DGFIAKDIGFQNTAGPGAHQAVALTVASDHSVFYRCSISGYQDTLYALSLRQFYRECDIS  357
             DGF+A+DI FQNTAGP  HQAVAL V SD S FYRC +  YQDTLY  SLRQFY +C ++
Sbjct  348   DGFLARDITFQNTAGPSKHQAVALRVGSDLSAFYRCDMLAYQDTLYVHSLRQFYVQCLVA  407

Query  356   GTVDFIFGNAAAVFQACNLVLRRPS--SYNVILANGRSDPGQNTGFSVQKCKITPGPDFS  183
             GTVDFIFGNAAAVFQ C++  RRP+    N++ A GR DP QNTG  +QKC+I    D  
Sbjct  408   GTVDFIFGNAAAVFQNCDIHARRPNPGQRNMVTAQGRDDPNQNTGIVIQKCRIGATSDLL  467

Query  182   PVKNSYNSYLGRPWKPYSRAVVMESDIDGAISARGWIEWPGTSSSSVRELYFGEYANVGA  3
              VK S+ SYLGRPWK YSR V+M+S+I   I   GW EW G    ++  L + E+ N GA
Sbjct  468   AVKGSFASYLGRPWKQYSRTVIMQSNISDIIHPAGWFEWNG--PFALDTLTYREHQNTGA  525



>ref|XP_004231483.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 46 
[Solanum lycopersicum]
Length=580

 Score =   320 bits (820),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 185/467 (40%), Positives = 276/467 (59%), Gaps = 23/467 (5%)
 Frame = -2

Query  1367  CGYTRFPRLCVQTLSGLVS-GERVDFAAALLLNKTIAHADLHIAHFDQLSSHFVSSQPPQ  1191
             C  T +P  C+ +LS   + G  +       ++  +A  +L  A  + L S    +    
Sbjct  75    CNLTLYPDSCISSLSPFAAKGNALKPQDIYKMSVLVALNELSGASDNFLKSDAFKNINDP  134

Query  1190  PRLQAIGYCEELMGMARQRLNEALVAMKESPGKNRQEDIQTWLSAAVTFQQACKDWADQY  1011
                +AI  C EL+ +A   LN+ L ++ E+   +  +D++TWLS+A T+QQ C D  +  
Sbjct  135   AAAKAIQSCHELLSLAFDHLNDTL-SVAETSLLDAFDDLKTWLSSAGTYQQTCIDSFENV  193

Query  1010  AFSDELFARISRSMDYQSQLASNALALV----NRNTEISAAGRQLSEEdidddddggffp  843
               +  +     +S++  ++  SN+LAL+    N  T ++A G++     +    D   +P
Sbjct  194   TSNSAIRKAAGQSLNNSTRYTSNSLALISSLENSITSLAAIGKR---RRLMGCGDDDEYP  250

Query  842   DWVSG-RDLRLLETTTD-KTKANVVVAKDGTGNFRTVAEAIGAA--SGRQRFVIYVKSGV  675
              W+S   D +LL+ +++ K K NVVVAKDG+G ++++  A+ AA    ++RFVIYVK GV
Sbjct  251   SWLSSSNDRKLLQKSSEEKIKVNVVVAKDGSGKYKSIKAALKAAPEKSKKRFVIYVKKGV  310

Query  674   YKEKIRSSKD--GITLIGDGKYSTIITWDDSVGGGSSLTGSATFGITGDGFIAKDIGFQN  501
             YKE +R  K    I +IGDGK +T+++ + +   G+    SATF + G GF+A+DIGF N
Sbjct  311   YKENVRVEKTKWNIMIIGDGKDATVVSGNRNFIDGTPTFQSATFAVFGKGFVARDIGFVN  370

Query  500   TAGPGAHQAVALTVASDHSVFYRCSISGYQDTLYALSLRQFYRECDISGTVDFIFGNAAA  321
             TAG   HQAVAL   +D SVFYRC +  +QDTLYA S RQFY+ECDI GTVDFIFGN+A 
Sbjct  371   TAGAAKHQAVALMSTADESVFYRCKMDAFQDTLYAHSNRQFYKECDIYGTVDFIFGNSAV  430

Query  320   VFQACNLVLRRPSS--YNVILANGRSDPGQNTGFSVQKCKITPGPDFSPVKNSYNSYLGR  147
             V Q CN++ R+P S   N I A G+ DP QNTG S+Q C + P  + + +    N++LGR
Sbjct  431   VLQNCNILPRKPMSGQQNTITAQGKVDPNQNTGISIQNCSVMPWGNLTGI----NTFLGR  486

Query  146   PWKPYSRAVVMESDIDGAISARGWIEWPGTSSSSVRELYFGEYANVG  6
             PWK YS  V MES++ G I   GW+ W G ++ S   +++ EY N+G
Sbjct  487   PWKNYSTTVFMESNLGGLIHPNGWMPWVGITAPST--IFYAEYKNIG  531



>ref|XP_010056335.1| PREDICTED: pectinesterase 2-like [Eucalyptus grandis]
Length=515

 Score =   318 bits (814),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 176/393 (45%), Positives = 236/393 (60%), Gaps = 31/393 (8%)
 Frame = -2

Query  1166  CEELMGMARQRLNEALVAMKESPGKNRQEDIQTWLSAAVTFQQACKDWADQYAFSDELFA  987
             C +L      RLN  +V          Q++ QTWLS A+T  + C+    +   S  +  
Sbjct  99    CLQLYEYTILRLNRTIVH------DCTQDEAQTWLSTALTNLETCQAGFVELGVSGNVLP  152

Query  986   RISRSMDYQSQLASNALALVNRNTEISAAGRQLSEEdidddddggffpDWVSGRDLRLLE  807
              +S ++   S+L SN LAL              +       +    FP WV   D +LL+
Sbjct  153   LMSNNV---SKLISNTLAL--------------NYAPYTTPNYTKKFPTWVRPGDRKLLQ  195

Query  806   TTTDKTKANVVVAKDGTGNFRTVAEAIGAASGRQ---RFVIYVKSGVYKEKIR--SSKDG  642
             +++  +KAN++VA+DG+GN++T++EAI AAS R    R++IY+K+G Y E +   S  + 
Sbjct  196   SSSAVSKANIIVAQDGSGNYKTISEAITAASKRSGTARYIIYIKAGTYSENVEVGSKLEN  255

Query  641   ITLIGDGKYSTIITWDDSVGGGSSLTGSATFGITGDGFIAKDIGFQNTAGPGAHQAVALT  462
             I  +GDG   TIIT   SVGGGS+   SAT  + GDGFIA+DI F+NTAG   HQAVAL 
Sbjct  256   IMFVGDGIGKTIITGSKSVGGGSTTFNSATVAVVGDGFIAQDITFRNTAGAANHQAVALR  315

Query  461   VASDHSVFYRCSISGYQDTLYALSLRQFYRECDISGTVDFIFGNAAAVFQACNLVLRR-P  285
               SD SVFYRC   GYQDTLY  S RQFYRECDI GTVDFIFGNAA V Q CN+  R  P
Sbjct  316   SGSDLSVFYRCGFEGYQDTLYVHSERQFYRECDIYGTVDFIFGNAAVVLQNCNIYARNPP  375

Query  284   SSYNVILANGRSDPGQNTGFSVQKCKITPGPDFSPVKNSYNSYLGRPWKPYSRAVVMESD  105
             +  N + A GR+DP QNTG S+  CK+T   D   V++S  +YLGRPW+ YSR V M++ 
Sbjct  376   NKVNTVTAQGRTDPNQNTGISIHNCKVTAASDLKSVQSSVKTYLGRPWQEYSRTVFMKTY  435

Query  104   IDGAISARGWIEWPGTSSSSVRELYFGEYANVG  6
             +D  I++ GW+EW G  + ++  LY+GEY N G
Sbjct  436   LDSLINSAGWMEWDG--NFALDTLYYGEYLNTG  466



>ref|XP_010062184.1| PREDICTED: pectinesterase-like [Eucalyptus grandis]
Length=519

 Score =   318 bits (815),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 181/381 (48%), Positives = 228/381 (60%), Gaps = 20/381 (5%)
 Frame = -2

Query  1127  EALVAMKESPGKNRQEDIQTWLSAAVTFQQACKDWADQYAFSDELFARISRSMDYQSQLA  948
             E +  +  + G     D QTWLSAA+T    C+    +   +D +F  +  S    ++L 
Sbjct  103   ETIHRLNRTAGDCTDSDQQTWLSAALTNLDTCRTGFAELGVADYVFQLMYNSN--VTKLI  160

Query  947   SNALALVNRNTEISAAGRQLSEEdidddddggffpDWVSGRDLRLLETTTDKTKANVVVA  768
             SNALAL N N   SA       +             WV+    RLL++ +     +V VA
Sbjct  161   SNALALKNNNASSSATQDTTHNDGQGFPS-------WVTAGVRRLLQSASPT--PDVTVA  211

Query  767   KDGTGNFRTVAEAIGAA---SGRQRFVIYVKSGVYKEK--IRSSKDGITLIGDGKYSTII  603
             +DG+GNFRT+ +A+ AA   SG +RFVIYVK GVY+E   I S  D I ++GDG   T+I
Sbjct  212   QDGSGNFRTIQQALDAAAKRSGSKRFVIYVKRGVYQENLVIGSGLDNIMMVGDGLRFTVI  271

Query  602   TWDDSVGGGSSLTGSATFGITGDGFIAKDIGFQNTAGPGAHQAVALTVASDHSVFYRCSI  423
             T   SVGGGS+   SAT  +TGDGFIA+ I F+NTAGP  HQAVAL   SD SVFYRC  
Sbjct  272   TGSRSVGGGSTTFNSATVAVTGDGFIARGITFRNTAGPQNHQAVALRSGSDLSVFYRCGF  331

Query  422   SGYQDTLYALSLRQFYRECDISGTVDFIFGNAAAVFQACNLVLRRPSS--YNVILANGRS  249
              GYQDTLY  S RQFY+EC I GTVDFIFGNAA V Q C +  RRP S   N I A GR+
Sbjct  332   EGYQDTLYVHSERQFYKECYIYGTVDFIFGNAAVVLQNCMIYARRPMSGQKNTITAQGRT  391

Query  248   DPGQNTGFSVQKCKITPGPDFSPVKNSYNSYLGRPWKPYSRAVVMESDIDGAISARGWIE  69
             DP QNTG S+   ++   PD  PV +S+ SYLGRPWK YSR V +++ +D  I   GW+E
Sbjct  392   DPNQNTGISIHNSRVMAAPDLKPVLSSFKSYLGRPWKQYSRTVYLQTYLDTLIDPAGWLE  451

Query  68    WPGTSSSSVRELYFGEYANVG  6
             W G  + S   LY+GEY N+G
Sbjct  452   WDGNFALST--LYYGEYKNLG  470



>ref|XP_008809854.1| PREDICTED: pectinesterase-like [Phoenix dactylifera]
Length=550

 Score =   319 bits (817),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 194/466 (42%), Positives = 269/466 (58%), Gaps = 34/466 (7%)
 Frame = -2

Query  1367  CGYTRFPRLCVQTLSGLVS--GERVDFAAALLLNKTIAHADLHIAHFDQLSSHFVSSQPP  1194
             C  +  P  C   +S  +S  G R       +L   +  + L I  F  ++ +F      
Sbjct  58    CANSPSPAPCNAVISTALSALGRRSKPDPVQVLQTILHQSLLQIDSFLTVADNFHRPIDG  117

Query  1193  QPRLQ--AIGYCEELMGMARQRLNEALVAMK-ESPGKNRQEDIQTWLSAAVTFQQACKDW  1023
                +Q  A+  C  LM ++R  L ++  A+  E+  K R     TWLSAA+T    C D 
Sbjct  118   TGSIQRSALADCIHLMDLSRDLLRDSASAISAEAYTKAR-----TWLSAALTNHVTCSD-  171

Query  1022  ADQYAFSDELFARISRSMDYQSQLASNALALVNRNTEISAAGRQLSEEdidddddggffp  843
                   +  +   +   ++  + LAS +LA+++           +S  D D  +    FP
Sbjct  172   ----GLTRPIGPLMEAHLESLTALASASLAVLS----------AVSPSDGDAIERVRRFP  217

Query  842   DWVSGRDLRLLETTT-DKTKANVVVAKDGTGNFRTVAEAIGAA--SGRQRFVIYVKSGVY  672
              W++ +D +LLE+++ D   ANV VA +G+G+++TV EA+ +A   G+ R+VIYVK G Y
Sbjct  218   SWLTVKDRKLLESSSSDGIAANVTVAAEGSGDYKTVQEAVDSAPDKGKVRYVIYVKEGTY  277

Query  671   KEKIR--SSKDGITLIGDGKYSTIITWDDSVGGGSSLTGSATFGITGDGFIAKDIGFQNT  498
             KE +     K  +T++GDG  ST+IT   +V  GS+   SATF   G+GFI +DI  +NT
Sbjct  278   KENVVVGKKKTNVTIVGDGMNSTVITGSLNVVDGSTTFNSATFAAVGEGFILQDICIENT  337

Query  497   AGPGAHQAVALTVASDHSVFYRCSISGYQDTLYALSLRQFYRECDISGTVDFIFGNAAAV  318
             AGP  HQAVAL V +D S   RC + GYQDTLYA SLRQFYR+  ISGTVDFIFGNAA V
Sbjct  338   AGPEKHQAVALRVGADRSAINRCRLDGYQDTLYAHSLRQFYRDSVISGTVDFIFGNAAVV  397

Query  317   FQACNLVLRRPSSY--NVILANGRSDPGQNTGFSVQKCKITPGPDFSPVKNSYNSYLGRP  144
             FQ CNL+ R+P S+  N++ A GR DP QNTG S+Q CK+ P  D  PVK S  +YLGRP
Sbjct  398   FQNCNLIARKPMSHQQNLVTAQGRVDPNQNTGTSIQSCKVVPSDDLKPVKGSIPTYLGRP  457

Query  143   WKPYSRAVVMESDIDGAISARGWIEWPGTSSSSVRELYFGEYANVG  6
             WK YSR V M+S ID  +  +GW+EW G    ++  LY+GEYAN+G
Sbjct  458   WKEYSRTVFMQSYIDDHVDPKGWMEWSG--DFALDTLYYGEYANIG  501



>ref|XP_010266280.1| PREDICTED: pectinesterase-like [Nelumbo nucifera]
Length=529

 Score =   318 bits (815),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 178/396 (45%), Positives = 241/396 (61%), Gaps = 19/396 (5%)
 Frame = -2

Query  1166  CEELMGMARQRLNEALVAMKESPGKNRQEDIQTWLSAAVTFQQACKDWADQYAFSDELFA  987
             C EL      +LN ++     S       D QTWLSAA+T +Q C++      F +   +
Sbjct  98    CVELYADTVSQLNRSMA----SKNPLIWSDAQTWLSAAITNEQTCRN-----GFIELSSS  148

Query  986   RISRSMDYQ----SQLASNALALVNRNTEISAAGRQLSEEdidddddggffpDWVSGRDL  819
                 S  +     S++ SN+LA+       S+A     +   +       FP WVS  D 
Sbjct  149   SQLSSFPFMLTNLSKMVSNSLAINKAAASTSSASLFGKQGANNRRLLSDGFPTWVSAADR  208

Query  818   RLLETTTDKTKANVVVAKDGTGNFRTVAEAIGAASGRQ--RFVIYVKSGVYKEKIRSSKD  645
             +LL+++   ++A+VVVA DG+GN++T++EA+ A+S R   RFVIYVK GVYKE +     
Sbjct  209   KLLQSSGAASQADVVVAADGSGNYKTISEAVAASSKRSGSRFVIYVKRGVYKENVEIKAS  268

Query  644   GITLIGDGKYSTIITWDDSVGGGSSLTGSATFGITGDGFIAKDIGFQNTAGPGAHQAVAL  465
              I LIGDG  +TI+T   +V  GS+   SAT  +TG GFIA+D+ F+NTAGP  HQAVAL
Sbjct  269   NIMLIGDGIDATIVTGSRNVQDGSTTFRSATVAVTGGGFIARDMTFENTAGPQKHQAVAL  328

Query  464   TVASDHSVFYRCSISGYQDTLYALSLRQFYRECDISGTVDFIFGNAAAVFQACNLVLRRP  285
                SD SVFYRCS+ GYQDTLY  S RQFYR+CDI GTVDFIFG+A AV Q CN+ +R+P
Sbjct  329   RSGSDLSVFYRCSLKGYQDTLYVYSQRQFYRDCDIYGTVDFIFGDAVAVIQNCNIYVRKP  388

Query  284   SS--YNVILANGRSDPGQNTGFSVQKCKITPGPDFSPVKNSYNSYLGRPWKPYSRAVVME  111
              S   N + A GR+DP +NTG S+   ++T   D   V+ S+ +YLGRPW+ YSR V M+
Sbjct  389   MSGQKNTVTAQGRTDPNENTGISIHNSRVTAASDLRAVQGSFKTYLGRPWQKYSRTVFMK  448

Query  110   SDIDGAISARGWIEWPGTSSSSVRELYFGEYANVGA  3
             + +D  I   GW+EW G  S ++  LY+GEY N GA
Sbjct  449   TSLDSLIDPAGWLEWSG--SFALSTLYYGEYMNTGA  482



>ref|XP_003622696.1| Pectinesterase [Medicago truncatula]
 gb|AES78914.1| pectinesterase/pectinesterase inhibitor [Medicago truncatula]
Length=553

 Score =   319 bits (817),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 185/466 (40%), Positives = 268/466 (58%), Gaps = 27/466 (6%)
 Frame = -2

Query  1367  CGYTRFPRLCVQTLSGLVSGERVDFAAALLLNKTIAHADLHIAHFDQL--SSHFVSSQPP  1194
             C +      C+  ++ +V G  +D      L+  I+       H  +   +++ +  +  
Sbjct  55    CEHAVDTNSCLTHVAEVVQGSTLDNTKDHKLSTLISLLTKSTTHIRKAMDTANVIKRRIN  114

Query  1193  QPRLQ-AIGYCEELMGMARQRLNEALVAMKESPGKNRQEDIQTWLSAAVTFQQACKDWAD  1017
              PR + A+  CE+LM ++ +R+ ++++ + +    + Q+D  TWLS+ +T    C D  +
Sbjct  115   SPREENALNVCEKLMNLSMERVWDSVLTLTKD-NMDSQQDAHTWLSSVLTNHATCLDGLE  173

Query  1016  ---QYAFSDELFARISRSMDYQSQLASNALALVNRNTEISAAGRQLSEEdidddddggff  846
                +    +++   I+R+   +S LA     L  ++ +      +  +E ++ D      
Sbjct  174   GTSRAVMENDIQDLIARA---RSSLAVLVAVLPPKDHD------EFIDESLNGDFPS---  221

Query  845   pDWVSGRDLRLLETTTDKTKANVVVAKDGTGNFRTVAEAIGAA--SGRQRFVIYVKSGVY  672
               WV+ +D RLLE++    KANVVVAKDG+G F+TVAEA+ +A   G  R+VIYVK G+Y
Sbjct  222   --WVTSKDRRLLESSVGDVKANVVVAKDGSGKFKTVAEAVASAPNKGTARYVIYVKKGIY  279

Query  671   KE--KIRSSKDGITLIGDGKYSTIITWDDSVGGGSSLTGSATFGITGDGFIAKDIGFQNT  498
             KE  +I SSK  + L+GDG  +TIIT   +   G+    +AT    GD FIA+DIGFQNT
Sbjct  280   KENVEIASSKTNVMLLGDGMDATIITGSLNYVDGTGTFQTATVAAVGDWFIAQDIGFQNT  339

Query  497   AGPGAHQAVALTVASDHSVFYRCSISGYQDTLYALSLRQFYRECDISGTVDFIFGNAAAV  318
             AGP  HQAVAL V SD SV  RC I  +QDTLYA + RQFYR+  I+GT+DFIFG+AA V
Sbjct  340   AGPQKHQAVALRVGSDRSVINRCKIDAFQDTLYAHTNRQFYRDSFITGTIDFIFGDAAVV  399

Query  317   FQACNLVLRRP--SSYNVILANGRSDPGQNTGFSVQKCKITPGPDFSPVKNSYNSYLGRP  144
              Q C LV R+P  +  N++ A GR DP QNT  S+Q+C + P  D  PV  S  +YLGRP
Sbjct  400   LQKCKLVARKPMANQNNMVTAQGRIDPNQNTATSIQQCDVIPSTDLKPVIGSVKTYLGRP  459

Query  143   WKPYSRAVVMESDIDGAISARGWIEWPGTSSSSVRELYFGEYANVG  6
             WK YSR VVM+S +   I   GW EW   S   ++ LY+GEY N G
Sbjct  460   WKKYSRTVVMQSLLGAHIDPTGWAEWDAASKDFLQTLYYGEYMNSG  505



>ref|XP_009589755.1| PREDICTED: pectinesterase-like [Nicotiana tomentosiformis]
Length=548

 Score =   319 bits (817),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 176/404 (44%), Positives = 237/404 (59%), Gaps = 37/404 (9%)
 Frame = -2

Query  1178  AIGYCEELMGMARQRLNEALVAMKESPGKNRQEDIQTWLSAAVTFQQACKDWADQYAFS-  1002
             A+  C ELM ++R RL ++++++     +    D+ TWLS+ +T    CKD  +  A S 
Sbjct  121   ALADCLELMDLSRDRLMDSMMSLGNLSSQ-AHFDVHTWLSSILTNHVTCKDGLNAQAQSI  179

Query  1001  -----DELFARISRSMDYQSQLA-SNALALVNRNTEISAAGRQLSEEdidddddggffpD  840
                   +L AR   S+    ++A SN + L +    + +                     
Sbjct  180   MKPMLKDLIARAKTSLALMVKMAPSNTMDLPSVTHGLPS---------------------  218

Query  839   WVSGRDLRLLETTTDKTKANVVVAKDGTGNFRTVAEAIGAA--SGRQRFVIYVKSGVYKE  666
             WV+  D RLL+ + +   ANVVVAKDG+G F+TV EA+ +A  +G+ R+VIYVK G+YKE
Sbjct  219   WVTSNDRRLLQLSANAITANVVVAKDGSGKFKTVKEAVASAPDNGKTRYVIYVKKGIYKE  278

Query  665   KIR--SSKDGITLIGDGKYSTIITWDDSVGGGSSLTGSATFGITGDGFIAKDIGFQNTAG  492
              +     K  + L+GDG  +TIIT + +V  G++   SAT    GDGFIA+D+ FQNTAG
Sbjct  279   NVEIGKKKKNVMLVGDGMDTTIITGNLNVVDGATTFNSATVAAVGDGFIAQDLQFQNTAG  338

Query  491   PGAHQAVALTVASDHSVFYRCSISGYQDTLYALSLRQFYRECDISGTVDFIFGNAAAVFQ  312
                HQAVAL V +D SV  RC I  +QDTLY  SLRQFYR+C I+GTVDFIFGNAA VFQ
Sbjct  339   AAKHQAVALRVGADQSVINRCKIDAFQDTLYTHSLRQFYRDCYITGTVDFIFGNAAVVFQ  398

Query  311   ACNLVLRRPSS--YNVILANGRSDPGQNTGFSVQKCKITPGPDFSPVKNSYNSYLGRPWK  138
                +  R+P S   N++ A GR DP QNTG S+Q C I    D +PVK S  +YLGRPWK
Sbjct  399   NSKIAARKPGSGQKNMVTAQGREDPNQNTGTSIQNCDIIASSDLAPVKGSVKTYLGRPWK  458

Query  137   PYSRAVVMESDIDGAISARGWIEWPGTSSSSVRELYFGEYANVG  6
              YSR V M+S+I   I   GW  W G    +++ LY+GEY N G
Sbjct  459   AYSRTVFMQSNIGDHIDPEGWSVWDG--DFALKTLYYGEYMNKG  500



>ref|XP_011076284.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 46 
[Sesamum indicum]
Length=573

 Score =   320 bits (819),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 190/474 (40%), Positives = 271/474 (57%), Gaps = 35/474 (7%)
 Frame = -2

Query  1379  IRIQCGYTRFPRLCVQTLSGLVSGERVDFAAALLLNKTIAHADLHIAHFDQLSSHFVS--  1206
             IR  C  T +P  C  +L+ L             L+  +A  +L +A     S +FV   
Sbjct  70    IRAVCNVTLYPDSCYNSLAPLAKSGNFKPQDLYKLSVQVAIDELSMA-----SKNFVEHG  124

Query  1205  ----SQPPQPRLQAIGYCEELMGMARQRLNEALVAMKESPGKNRQEDIQTWLSAAVTFQQ  1038
                 +   Q  L AI  C+EL  +A   LN +L ++K +      +D+ TWLS+A T+QQ
Sbjct  125   VKKLNITDQKTLAAIDSCQELFSLALDHLNNSL-SIKTTNLFEALDDLTTWLSSAGTYQQ  183

Query  1037  ACKDWADQYAFSDELFARISRSMDYQSQLASNALALVNRNTE----ISAAGRQLSEEdid  870
              C D  +  +     FA  + +    +   SN+LA+++   E    + A GR+       
Sbjct  184   TCIDELESVSGVLTTFA--NENFKNSTAYTSNSLAILSSFEESIGALGAVGRR-----RL  236

Query  869   ddddggffpDWVSGRDLRLLETTTDKTKANVVVAKDGTGNFRTVAEAIGAA--SGRQRFV  696
                 GG  P+WVS +D RLL+T + + KA+ VVAKDG+G ++T+  A+ A     ++RFV
Sbjct  237   MSLGGGDAPEWVSFKDRRLLQTPSSRIKADAVVAKDGSGKYKTIKAALKAVPEKSKKRFV  296

Query  695   IYVKSGVYKEKIRSSKD--GITLIGDGKYSTIITWDDSVGGGSSLTGSATFGITGDGFIA  522
             IYVK GVY E +R  K    + ++GDGK +TI++   +   G+    +ATF + G GFIA
Sbjct  297   IYVKKGVYVENVRVEKTKWNVMMVGDGKDATIVSGSLNFVDGTPTFKTATFAVAGQGFIA  356

Query  521   KDIGFQNTAGPGAHQAVALTVASDHSVFYRCSISGYQDTLYALSLRQFYRECDISGTVDF  342
             +D+GF+NTAGP  HQAVAL   +DHSVFYRC++  YQDTLYA S RQFYREC+I GTVDF
Sbjct  357   RDMGFRNTAGPAKHQAVALMSTADHSVFYRCTMDAYQDTLYAHSNRQFYRECNIYGTVDF  416

Query  341   IFGNAAAVFQACNLVLRRP--SSYNVILANGRSDPGQNTGFSVQKCKITPGPDFSPVKNS  168
             IFGN+A VFQ CN++ ++P     N I A G+ DP QNTG S+Q C I P  + S V+  
Sbjct  417   IFGNSAVVFQNCNILPKKPMLGQQNTITAQGKIDPNQNTGISIQNCTIGPAANLSGVQ--  474

Query  167   YNSYLGRPWKPYSRAVVMESDIDGAISARGWIEWPGTSSSSVRELYFGEYANVG  6
               ++LGRPWK YS  V   S +   I+  GW+ W GTS+ +   +++ E+ N G
Sbjct  475   --TFLGRPWKNYSTTVFFHSQMGSLINPNGWLPWVGTSAPNT--IFYAEFQNSG  524



>ref|XP_007145198.1| hypothetical protein PHAVU_007G218500g [Phaseolus vulgaris]
 gb|ESW17192.1| hypothetical protein PHAVU_007G218500g [Phaseolus vulgaris]
Length=553

 Score =   319 bits (817),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 192/464 (41%), Positives = 259/464 (56%), Gaps = 18/464 (4%)
 Frame = -2

Query  1367  CGYTRFPRLCVQTLSGL--VSGERVDFAAALLLNKTIAHADLHIAHFDQLSSHFVSSQPP  1194
             C  T +P LCV TL+    ++ + V    + ++N T+        +   L     +  P 
Sbjct  48    CQGTLYPDLCVSTLATFPDLTSKSVPQVISSVVNHTMYEVKSSFYNCSSLKKKIRNLNPL  107

Query  1193  QPRLQAIGYCEELMGMARQRLNEALVAM-KESPGKNRQEDIQTWLSAAVTFQQACKDWAD  1017
               R  A+  C +L       L   +  + K S G  R  D+QT LS A+T    C    D
Sbjct  108   DQR--ALDDCLKLFQDTNLELKTTIDDLSKSSIGSKRHHDLQTLLSGAMTNLYTC---LD  162

Query  1016  QYAFSD-ELFARISRSMDYQSQLASNALALVNRNTEISAAGRQLSEEdidddddggffpD  840
              +A+S   +  RI + +   S   SN+LA++ +   +     + SE   +       FP 
Sbjct  163   GFAYSKGRVRDRIEKKLLEISHHMSNSLAMLKKVPGVKTRTSK-SEVFPEYGKMKKGFPL  221

Query  839   WVSGRDLRLLETTTDKTKANVVVAKDGTGNFRTVAEAIGAA--SGRQRFVIYVKSGVYKE  666
             WVS +D +LL+ + +++K ++VVAKDGTGNF T+ EA+  A  S   RFVI++K G Y E
Sbjct  222   WVSPKDRKLLQASVNESKFDLVVAKDGTGNFTTIGEALALAPNSSTTRFVIHIKEGAYFE  281

Query  665   KIR--SSKDGITLIGDGKYSTIITWDDSVGGGSSLTGSATFGITGDGFIAKDIGFQNTAG  492
              +     K  +  +GDG   T++    +V  G +   SAT  + G+GFIAK I F+N+AG
Sbjct  282   NVEVIRKKTNLMFVGDGIGKTVVKGSRNVVDGWTTFQSATVAVLGEGFIAKGITFENSAG  341

Query  491   PGAHQAVALTVASDHSVFYRCSISGYQDTLYALSLRQFYRECDISGTVDFIFGNAAAVFQ  312
             P  HQAVAL   +D S F+RCS  GYQDTLY  SLRQFYRECDI GTVDFIFGNAA VFQ
Sbjct  342   PEKHQAVALRSGADFSAFFRCSFVGYQDTLYVHSLRQFYRECDIYGTVDFIFGNAAVVFQ  401

Query  311   ACNLVLRRPSS--YNVILANGRSDPGQNTGFSVQKCKITPGPDFSPVKNSYNSYLGRPWK  138
              CNL  RRP+    N+  A GR DP QNTG S+  CKI    D  PVK+S+ SYLGRPWK
Sbjct  402   NCNLYARRPNENQKNLFTAQGREDPNQNTGISIFNCKIAAASDLIPVKSSFKSYLGRPWK  461

Query  137   PYSRAVVMESDIDGAISARGWIEWPGTSSSSVRELYFGEYANVG  6
              YSR V ++S I+  I   GW+EW  T   ++  LY+GEY N G
Sbjct  462   TYSRTVYLKSYIEDLIDPAGWLEWNDT--FALDTLYYGEYMNRG  503



>ref|XP_011015915.1| PREDICTED: pectinesterase-like [Populus euphratica]
Length=558

 Score =   318 bits (816),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 197/466 (42%), Positives = 268/466 (58%), Gaps = 25/466 (5%)
 Frame = -2

Query  1367  CGYTRFPRLCVQTL---SGLVSGERVDFAAALLLNKTIAHADLHIAHFDQLSSHFVSSQP  1197
             C  T +P LCV TL     L S    +F +A L NKT+       A+ + + +       
Sbjct  56    CKGTLYPELCVSTLVSLPDLASKSLPEFISATL-NKTMDEVRASSANCNAIRNKI--KLG  112

Query  1196  PQPRLQAIGYCEELMGMARQRLNEAL--VAMKESPGKNRQEDIQTWLSAAVTFQQACKDW  1023
             P  ++ A+  C EL       L  A+  +A ++S  K+   D+QT LS A+T Q  C   
Sbjct  113   PLEKV-ALKDCIELFDDTIAELKSAISDLAPRKSTSKHYH-DLQTLLSGAMTNQYTC---  167

Query  1022  ADQYAFSD-ELFARISRSMDYQSQLASNALALVNRNTEISAAGRQLSEEdidddddggff  846
              D +A S  ++   I + +   S   SN+LA++ +   I       SE   +  +    F
Sbjct  168   LDGFARSKGKVRKAIKKGLYNISHHVSNSLAMLKK---IPGVNTSKSEVFPEYGNVKHGF  224

Query  845   pDWVSGRDLRLLETTTDKTKANVVVAKDGTGNFRTVAEAIGAA--SGRQRFVIYVKSGVY  672
             P W+S +D +LL+ + + TK +++VAKDGTGNF T++EA+ AA  S   RFVIY+K+G Y
Sbjct  225   PSWLSSKDRKLLQASANATKFDLIVAKDGTGNFTTISEAVRAAPNSSDTRFVIYIKAGAY  284

Query  671   KE--KIRSSKDGITLIGDGKYSTIITWDDSVGGGSSLTGSATFGITGDGFIAKDIGFQNT  498
              E  ++   K  +  IGDG   T++    SV  G +   SAT  + GDGFIAK I F+N+
Sbjct  285   FENVEVERKKKMLVFIGDGIGKTVVKAKRSVVDGWTTFRSATVAVVGDGFIAKGITFENS  344

Query  497   AGPGAHQAVALTVASDHSVFYRCSISGYQDTLYALSLRQFYRECDISGTVDFIFGNAAAV  318
             AGP  HQAVAL   SD S FY+CS  GYQDTLY  SLRQFYRECD+ GT+DFIFGNAA V
Sbjct  345   AGPSKHQAVALRSGSDLSAFYQCSFVGYQDTLYVHSLRQFYRECDVYGTIDFIFGNAAVV  404

Query  317   FQACNLVLRRPSS--YNVILANGRSDPGQNTGFSVQKCKITPGPDFSPVKNSYNSYLGRP  144
             FQ  NL  R+P+S   N+  A GR DP QNTG S+  CK+    D  PVK+S+ ++LGRP
Sbjct  405   FQTSNLYARKPNSNQRNIFTAQGREDPNQNTGISILNCKVAAAADLIPVKSSFQTFLGRP  464

Query  143   WKPYSRAVVMESDIDGAISARGWIEWPGTSSSSVRELYFGEYANVG  6
             WK YSR V + S ID  +   GW+EW   +S ++  LY+GEY N G
Sbjct  465   WKEYSRTVFLRSYIDDLVDPAGWLEW--NASFALSTLYYGEYMNRG  508



>ref|XP_004297462.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 6-like 
[Fragaria vesca subsp. vesca]
Length=548

 Score =   318 bits (816),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 186/494 (38%), Positives = 280/494 (57%), Gaps = 53/494 (11%)
 Frame = -2

Query  1379  IRIQCGYTRFPRLCVQTLSG-LVSGERV--------DFAAALLLNKTIAHADLHIAHFDQ  1227
             I   C  T +P++C   ++  L+S   V        D A  + +++ +       AH  +
Sbjct  25    ITASCSQTPYPQVCSHYITNNLLSTLDVRDQRFAFRDLALKVTMDQAVK------AH--R  76

Query  1226  LSSHFVSSQPPQPRLQAIGY--CEELMGMARQRLNEALVAMKESPGKNRQEDIQTWLSAA  1053
             L S  V+S+        + +  C EL      +LN ++         N   D  TWLSA+
Sbjct  77    LVSSAVNSKSLYNERAKLAWNDCLELYEDTIDKLNRSM-------SSNNALDAITWLSAS  129

Query  1052  VTFQQACKD---------------WADQYAFSDELFARISRSMDYQSQLASNALALVNRN  918
             +  QQ C++               + + Y  S +L   +S S+    + ++++ +  + +
Sbjct  130   IANQQTCQNGFNDLNIPNSHLQSSFPNFYKLSTDLPMLLSNSLAIHKESSTSSSSSSSTS  189

Query  917   TEISAAGRQLSEEdidddddggffpDWVSGRDLRLLETTTDKTKANVVVAKDGTGNFRTV  738
             +      +Q+             FP WVS  D +LL+++     A++VVA+DG+GN++T+
Sbjct  190   SSAMHFSKQV-RGRRLLLKSDAIFPAWVSASDRKLLQSSAGPKSADIVVAQDGSGNYKTI  248

Query  737   AEAIGAA-----SGRQRFVIYVKSGVYKE--KIRSSKDGITLIGDGKYSTIITWDDSVGG  579
              EA+ AA     SG +R VIYVK+GVYKE  +++ +   +  +GDG  +TI+T + +   
Sbjct  249   TEAVAAAKKSSGSGTKRVVIYVKAGVYKENVEVKKTMKKLMFVGDGMDATIVTGNKNAQD  308

Query  578   GSSLTGSATFGITGDGFIAKDIGFQNTAGPGAHQAVALTVASDHSVFYRCSISGYQDTLY  399
             GS+   SATFG++G+GFIA+D+ F+NTAGP  HQAVAL   +DHSVFYRCS  GYQDTLY
Sbjct  309   GSTTFRSATFGVSGEGFIAQDMTFENTAGPQKHQAVALRSGADHSVFYRCSFKGYQDTLY  368

Query  398   ALSLRQFYRECDISGTVDFIFGNAAAVFQACNLVLRRPSS--YNVILANGRSDPGQNTGF  225
               S RQFYR+C+I GTVDFIFG+A+A+ Q CN+ +R+PSS   N + A  R DP +NTG 
Sbjct  369   VYSQRQFYRDCNIYGTVDFIFGDASAILQNCNIYVRKPSSNQINTVTAQSRRDPNENTGI  428

Query  224   SVQKCKITPGPDFSPVKNSYNSYLGRPWKPYSRAVVMESDIDGAISARGWIEWPGTSSSS  45
              +  C+IT  PD   V+ S+ +YLGRPW+ YSR V+M+S++DG I  +GW  W G  S  
Sbjct  429   IIHNCRITAAPDLRAVQGSFRTYLGRPWQKYSRVVIMKSNLDGLIEPQGWFPWSG--SFG  486

Query  44    VRELYFGEYANVGA  3
             +  LY+GEY N GA
Sbjct  487   LDTLYYGEYMNTGA  500



>ref|XP_010267745.1| PREDICTED: pectinesterase [Nelumbo nucifera]
Length=553

 Score =   318 bits (816),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 186/396 (47%), Positives = 239/396 (60%), Gaps = 29/396 (7%)
 Frame = -2

Query  1166  CEELMGMARQRLNEALVAMKESPGKNRQEDIQTWLSAAVTFQQACKDWAD---QYAFSDE  996
             C ELM ++  RL + +  +     ++   D  +WLS+ +T    C D  +   + A  D+
Sbjct  129   CVELMDLSIDRLTDTVAVLGTRTSRS-PADAHSWLSSILTNHVTCLDGLNGSARAAMEDK  187

Query  995   LFARISRSMDYQSQLASNALALVNRNTEISAAGRQLSEEdidddddggffpDWVSGRDLR  816
             L   I+R        A  +LA++   T IS      S ++       G FP WV+  D +
Sbjct  188   LQGLIAR--------AKTSLAML---TAIS------SSKEDALRPLDGKFPSWVTKNDRK  230

Query  815   LLETTTDKTKANVVVAKDGTGNFRTVAEAIGAA--SGRQRFVIYVKSGVYKEKIRSSKD-  645
             LL++     KANVVVAKDG+GN++TV EA+ +A   G+ R+VIYVK G YKE +   K  
Sbjct  231   LLQSLPRNIKANVVVAKDGSGNYQTVQEAVNSAPDKGKSRYVIYVKKGTYKENVEVGKKK  290

Query  644   -GITLIGDGKYSTIITWDDSVGGGSSLTGSATFGITGDGFIAKDIGFQNTAGPGAHQAVA  468
               + L+GDG  STIIT   +V  GS+   SAT    GDGFIA+D+ FQNTAGP  HQAVA
Sbjct  291   MNVMLVGDGMDSTIITGSLNVVDGSTTFKSATVAAVGDGFIAQDMWFQNTAGPEKHQAVA  350

Query  467   LTVASDHSVFYRCSISGYQDTLYALSLRQFYRECDISGTVDFIFGNAAAVFQACNLVLRR  288
             L V +D SV  RC I  YQDTLY  SLRQFYR+  I+GTVDFIFG+AA VFQ C LV R+
Sbjct  351   LRVGADQSVINRCRIDAYQDTLYVHSLRQFYRDSYITGTVDFIFGDAAVVFQNCKLVARK  410

Query  287   P--SSYNVILANGRSDPGQNTGFSVQKCKITPGPDFSPVKNSYNSYLGRPWKPYSRAVVM  114
             P  S  N++ A GR DP QNTG S+QKC I    D +PVKNS+ SYLGRPWK YSR VVM
Sbjct  411   PMASQKNMVTAQGRVDPNQNTGISIQKCDIIASSDLAPVKNSFPSYLGRPWKEYSRTVVM  470

Query  113   ESDIDGAISARGWIEWPGTSSSSVRELYFGEYANVG  6
             +S I   I+  GW  W G    +++ LY+GEY N G
Sbjct  471   QSYIGDHIAPAGWSIWSG--EFALKTLYYGEYLNSG  504



>gb|AFB77929.1| pectin methylesterase [Gossypium hirsutum]
Length=582

 Score =   319 bits (818),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 185/478 (39%), Positives = 269/478 (56%), Gaps = 27/478 (6%)
 Frame = -2

Query  1379  IRIQCGYTRFPRLCVQTLSGLVSGERVDFAAALLLNKTIAHADLHIA------HFDQLSS  1218
             ++  C  T +P LC   ++ + +G     A  +   K +    L+I       ++ ++  
Sbjct  65    VKSACSGTFYPDLCFSAVTTVPAGT----AKKVRSQKDVIELSLNITTTAVEHNYFKIKK  120

Query  1217  HFVSSQPPQPRLQAIGYCEELMGMARQRLNEALVAMKESPGKN----RQEDIQTWLSAAV  1050
                          A+  C E +      L+EA+  + E P K       +D++T +SAA+
Sbjct  121   LLARKDLTTREKTALHDCLETIDETLDELHEAVEDLHEYPNKKSLTQHADDLKTLMSAAM  180

Query  1049  TFQQACKDWADQYAFSDELFARISRSMDYQSQLASNALALVNRNTEISAAGRQL---SEE  879
             T Q+ C D         ++   +     Y  ++ SNALA++   T+   A   +   S  
Sbjct  181   TNQETCLDGFSHEGADKKIREVLIDGEKYVEKMCSNALAMIKNMTDTDIANEMMLKSSNR  240

Query  878   didddddggffpDWVSGRDLRLLETTTDKTKANVVVAKDGTGNFRTVAEAIGAASGR--Q  705
              + +D+ G  +P+W+S  D RLL++++     NVVVA DG+GNF+TV+EA+  A  +  +
Sbjct  241   KLKEDESGIAWPEWLSAGDRRLLQSSS--VTPNVVVAADGSGNFKTVSEAVAKAPEKSSK  298

Query  704   RFVIYVKSGVYKEKIR--SSKDGITLIGDGKYSTIITWDDSVGGGSSLTGSATFGITGDG  531
             R++I +K+GVY+E +     K  I  IGDG+  TIIT   +V  GS+   SAT    G+ 
Sbjct  299   RYIIRIKAGVYRENVEVPKKKSNIMFIGDGRTKTIITGSRNVVDGSTTFHSATVAAVGEK  358

Query  530   FIAKDIGFQNTAGPGAHQAVALTVASDHSVFYRCSISGYQDTLYALSLRQFYRECDISGT  351
             F+A+DI FQNTAGP  HQAVAL V SD S FY C +  YQDTLY  S RQFY  C ++GT
Sbjct  359   FLARDITFQNTAGPSKHQAVALRVGSDLSAFYNCDMLAYQDTLYVHSNRQFYVNCLVAGT  418

Query  350   VDFIFGNAAAVFQACNLVLRRPSS--YNVILANGRSDPGQNTGFSVQKCKITPGPDFSPV  177
             VDFIFGNAAAVFQ C++  R+P+S   N++ A GR+DP QNTG  +QKC+I    D  PV
Sbjct  419   VDFIFGNAAAVFQNCDIHARKPNSGQKNMVTAQGRTDPNQNTGIVIQKCRIGATSDLQPV  478

Query  176   KNSYNSYLGRPWKPYSRAVVMESDIDGAISARGWIEWPGTSSSSVRELYFGEYANVGA  3
             + ++ +YLGRPWK YSR VVM+S I   I   GW EW G  S +++ L++ EY N GA
Sbjct  479   RKNFPTYLGRPWKEYSRTVVMQSTISDVIQPAGWHEWSG--SFALKTLFYAEYQNTGA  534



>ref|XP_007052106.1| Pectinesterase 2 [Theobroma cacao]
 gb|EOX96263.1| Pectinesterase 2 [Theobroma cacao]
Length=517

 Score =   317 bits (812),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 192/467 (41%), Positives = 259/467 (55%), Gaps = 32/467 (7%)
 Frame = -2

Query  1385  DQIRIQCGYTRFPRLCVQTLSGLVSGERVDFAAALLLNKTIAHADLHIAHFDQLSSHFVS  1206
             + +R  C  T  P+ C   LS       +      L  K      L  A   Q  ++ + 
Sbjct  27    NAVRSWCSKTPNPQPCEYFLSNDPKNTPIKDEPDFL--KISMQLALERAERAQSHTYLLG  84

Query  1205  SQPPQPRLQAI-GYCEELMGMARQRLNEALVAMKESPGKNRQEDIQTWLSAAVTFQQACK  1029
              +    R +A    C  L  +   RLN+ +    +S  K  ++D QTWLS A+T  + C+
Sbjct  85    PKCRNKREKAAWADCLNLYELTILRLNKTV----DSSIKLNKDDAQTWLSTALTNLETCR  140

Query  1028  DWADQYAFSDELFARISRSMDYQSQLASNALALVNRNTEISAAGRQLSEEdidddddggf  849
                 +    D +   +S ++   S L SN LAL              ++    +      
Sbjct  141   TGFIELGVPDYILPMMSNNV---SNLISNTLAL--------------NKAPYKEPSYKDG  183

Query  848   fpDWVSGRDLRLLETTTDKTKANVVVAKDGTGNFRTVAEAIGAASGRQ---RFVIYVKSG  678
             FP WV   D +LL++++  ++AN+VVA+DG+GN++T+ +AI AAS R    R+VIYVK+G
Sbjct  184   FPTWVKPGDRKLLQSSSPASRANIVVAQDGSGNYKTIKDAISAASKRSGSGRYVIYVKAG  243

Query  677   VYKE--KIRSSKDGITLIGDGKYSTIITWDDSVGGGSSLTGSATFGITGDGFIAKDIGFQ  504
              YKE  +IRS    I L+GDG   TIIT   SVG GS+   SAT    GDGFIA+DI  +
Sbjct  244   TYKENVEIRSKLKNIMLVGDGIGKTIITGSKSVGQGSTTFNSATVAAVGDGFIARDITIR  303

Query  503   NTAGPGAHQAVALTVASDHSVFYRCSISGYQDTLYALSLRQFYRECDISGTVDFIFGNAA  324
             NTAGP  HQAV+L   SD SVFYRCS  GYQDTLY  S RQFYRECDI GTVD IFGNAA
Sbjct  304   NTAGPQNHQAVSLRSGSDLSVFYRCSFEGYQDTLYVHSERQFYRECDIYGTVDVIFGNAA  363

Query  323   AVFQACNLVLRR-PSSYNVILANGRSDPGQNTGFSVQKCKITPGPDFSPVKNSYNSYLGR  147
              V Q CN+  RR P+  N + A  R+DP QNTG  +   ++T   D  PV++S  +YLGR
Sbjct  364   VVLQNCNIYARRPPNKTNTVTAQSRTDPNQNTGIIIHNSRVTAASDLKPVQSSVKTYLGR  423

Query  146   PWKPYSRAVVMESDIDGAISARGWIEWPGTSSSSVRELYFGEYANVG  6
             PWK YSR V M++ +D  I+  GW+EW G  + ++  LY+ EY N G
Sbjct  424   PWKQYSRTVFMKTFLDSLINPAGWMEWDG--NFALNTLYYAEYMNTG  468



>ref|XP_004171768.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 40-like 
[Cucumis sativus]
Length=591

 Score =   319 bits (818),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 199/467 (43%), Positives = 262/467 (56%), Gaps = 16/467 (3%)
 Frame = -2

Query  1376  RIQCGYTRFPRLCVQTLSG--LVSGERVDFAAALLLNKTIAHADLHIAHFDQLSSHFVSS  1203
             R  C  T FP LC   LS   L++    +  A   LN T     L   +   L +H  S 
Sbjct  79    RSLCNGTLFPDLCFSKLSSFPLLASLSPEKLAGSALNFTSREVLLAYTNCTNLKTHLYSG  138

Query  1202  QPPQPRLQAIGYCEELMGMARQRLNEAL--VAMKESPGKNRQEDIQTWLSAAVTFQQACK  1029
               P  R  A+  C EL+  +   L  ++  +A  +SP  +   D+ T +SAA+T  + C 
Sbjct  139   LNPTDR-HALDDCLELLDGSIAELKASIFDLAPSQSPALH-SHDLLTLVSAAMTNHRTCV  196

Query  1028  DWADQYAFSDELFARISRSMDYQSQLASNALALVNRNTEISAAGRQLSEEdidddddggf  849
             D    Y  S  + +R+   +    Q  S  LA++ +   ++ A     E   +     G 
Sbjct  197   D--GFYNSSGTVRSRVELYLGKIGQHLSIDLAMLKKIPGVNRATGVDQEMLPEYGAVKGG  254

Query  848   fpDWVSGRDLRLLETTTDKTKANVVVAKDGTGNFRTVAEAIGAA--SGRQRFVIYVKSGV  675
             FP WVS +D RLL+   ++TK N+VVAKDG+GNF TV+EA+ AA  +   RFVIY+K+G 
Sbjct  255   FPKWVSVKDRRLLQAAVNETKFNMVVAKDGSGNFTTVSEAVAAAPNASTTRFVIYIKAGA  314

Query  674   YKEKIR--SSKDGITLIGDGKYSTIITWDDSVGGGSSLTGSATFGITGDGFIAKDIGFQN  501
             Y E +    +K  +  +GDG   T+I  D +V  G +   SAT  + G GFIAK I F+N
Sbjct  315   YFENVEIGRAKSNLMFVGDGIGKTLIKADRNVVDGWTTFRSATVAVVGTGFIAKGITFEN  374

Query  500   TAGPGAHQAVALTVASDHSVFYRCSISGYQDTLYALSLRQFYRECDISGTVDFIFGNAAA  321
              AGP  HQAVAL   SD S FY+CS  GYQDTLY  SLRQFYRECD+ GT+DFIFGNAA 
Sbjct  375   YAGPSKHQAVALRSNSDFSAFYQCSFIGYQDTLYVHSLRQFYRECDVYGTIDFIFGNAAV  434

Query  320   VFQACNLVLRRPSS--YNVILANGRSDPGQNTGFSVQKCKITPGPDFSPVKNSYNSYLGR  147
             VFQ CNL  R+P+S   N+  A GR DP QNTG S+  CK+    D  PV +S+ +YLGR
Sbjct  435   VFQNCNLYARKPNSNQRNIFTAQGREDPNQNTGISILNCKVEAASDLIPVLSSFRTYLGR  494

Query  146   PWKPYSRAVVMESDIDGAISARGWIEWPGTSSSSVRELYFGEYANVG  6
             PWK YSR V + S I   I   GW+EW GT   ++  LY+GEY N G
Sbjct  495   PWKLYSRTVFLRSFIGQLIEPVGWLEWNGT--FALDTLYYGEYLNRG  539



>emb|CDO97788.1| unnamed protein product [Coffea canephora]
Length=632

 Score =   320 bits (821),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 189/481 (39%), Positives = 271/481 (56%), Gaps = 41/481 (9%)
 Frame = -2

Query  1379  IRIQCGYTRFPRLCVQTLSGL-VSGERVDFAAALLLNKTIAHADLHIAHFDQLSSHFVSS  1203
             +R  C  T  P  C  ++S L  S    D      L+  + HA L       L  H++S 
Sbjct  73    LRAICSVTVHPDSCYTSISSLEASNSTTDPEKLFQLSLQVVHASLQ--KLSTLPQHWISD  130

Query  1202  QPPQPRLQAIGYCEELMGMARQRLNEALVAMKESPGK-----NRQEDIQTWLSAAVTFQQ  1038
                 P  +A+G C+ ++  A    +E+L ++  S G      +R  D++TWLSA++T  +
Sbjct  131   ARDLPLKKALGVCQAVIDDAVDATDESLSSLNVSEGDRLLTVDRVNDLKTWLSASLTDLE  190

Query  1037  ACKDWADQYAFSDELFARISRSMDYQSQLASNALALVNRNTEISAA-----GRQLSEEdi  873
              C D + Q   +  L  ++  S    ++ ASN+LA+V++   I +       R+L     
Sbjct  191   TCLD-SLQEVNATVLAEQVRTSSRNSTEFASNSLAIVSKLLTILSGFNIPIHRKL---LA  246

Query  872   dddddggffpDWVSGRDLRLLETTTDKTKANVVVAKDGTGNFRTVAEAIG--AASGRQRF  699
                D  G FP WV   D RLL+T  + TK ++VVA+DG+G++RT++EA+       + RF
Sbjct  247   AGTDSDGGFPRWVRAADRRLLQTPNENTKPDLVVAQDGSGDYRTISEAVAKIPKKSKTRF  306

Query  698   VIYVKSGVYKEKIRSSKD--GITLIGDGKYSTIITWDDSVGGGSSLTGSATFGITGDGFI  525
             VIYVK+GVYKEK+   K    + + GDGK  T++T DD+   G+    +ATF + G GFI
Sbjct  307   VIYVKAGVYKEKVSLDKSTWNVMMYGDGKAKTVVTSDDNFVDGTPTFDTATFAVAGKGFI  366

Query  524   AKDIGFQNTAGPGAHQAVALTVASDHSVFYRCSISGYQDTLYALSLRQFYRECDISGTVD  345
             AK + F+NTAG   HQAVA    SD SV Y CS   +QDTLY  S RQFYRECDISGT+D
Sbjct  367   AKSMAFRNTAGAAKHQAVAFRSGSDQSVLYLCSFDAFQDTLYTHSNRQFYRECDISGTID  426

Query  344   FIFGNAAAVFQACNLVLRR--PSSYNVILANGRSDPGQNTGFSVQKCKITPGPDFSPVKN  171
             FIFGNAA V Q CN++ R+  P+ +  I A G+ DP QNTG ++Q C ++P       K 
Sbjct  427   FIFGNAAVVLQNCNILPRQPLPNQFVTITAQGKKDPNQNTGITIQNCVMSPLD-----KL  481

Query  170   SYNSYLGRPWKPYSRAVVMESDIDGAISARGWIEW------PGTSSSSVRELYFGEYANV  9
             +  +YLGRPWKPYS  V+M+++I   ++ +GWIEW      P T       +++GEY N 
Sbjct  482   TAPTYLGRPWKPYSTTVIMQTNIGAFLAPKGWIEWVFNVEPPST-------IFYGEYQNT  534

Query  8     G  6
             G
Sbjct  535   G  535



>ref|XP_002317208.1| pectin methylesterase family protein [Populus trichocarpa]
 gb|EEE97820.1| pectin methylesterase family protein [Populus trichocarpa]
Length=549

 Score =   318 bits (814),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 183/398 (46%), Positives = 236/398 (59%), Gaps = 22/398 (6%)
 Frame = -2

Query  1178  AIGYCEELMGMARQRLNEALVAMKESPGKNRQEDIQTWLSAAVTFQQACKDWADQYAFSD  999
             A+G C ELM +++ R+ + +VA++    K+    + TWLS+ +T    C D  +  A   
Sbjct  120   ALGDCVELMEISKYRIKDTIVALERVTSKSHANAL-TWLSSVLTNHDTCLDGLNGPA---  175

Query  998   ELFARISRSMDYQSQLASNALALVNRNTEISAAGRQLSEEdidddddggffpDWVSGRDL  819
                 R +   D       N L L  R +    A    S+E+ D       FP W+   D 
Sbjct  176   ----RSTMEPDL------NDLILRARTSLAILAAISPSKENNDIFSLKEDFPSWLPSMDR  225

Query  818   RLLETTTDKTKANVVVAKDGTGNFRTVAEAIGAA--SGRQRFVIYVKSGVYKEKIR--SS  651
             +LL        A+V VAKDG+G ++TV EA+ +A  +G+ R+VIYVK G YKE +     
Sbjct  226   KLLVALPKDINADVTVAKDGSGKYKTVKEAVASAPDNGKTRYVIYVKKGTYKENVEVGKK  285

Query  650   KDGITLIGDGKYSTIITWDDSVGGGSSLTGSATFGITGDGFIAKDIGFQNTAGPGAHQAV  471
             K  + L+GDG  STIIT   +V  GS+   SAT    GDGFIA+DI FQNTAGP  HQAV
Sbjct  286   KKNVMLVGDGMDSTIITGSLNVVDGSTTFNSATVAAVGDGFIAQDIWFQNTAGPEKHQAV  345

Query  470   ALTVASDHSVFYRCSISGYQDTLYALSLRQFYRECDISGTVDFIFGNAAAVFQACNLVLR  291
             AL V +D SV  RC I  YQDTLY  SLRQFYR+  I+GTVDFIFGNAA V Q C LV R
Sbjct  346   ALRVGADQSVINRCRIDAYQDTLYTHSLRQFYRDSYITGTVDFIFGNAAVVLQNCKLVPR  405

Query  290   RPSS--YNVILANGRSDPGQNTGFSVQKCKITPGPDFSPVKNSYNSYLGRPWKPYSRAVV  117
             +P S   N++ A GR+DP QNTG S+QKC I    D +PVK+S+ S+LGRPWK YSR VV
Sbjct  406   KPMSGQKNMVTAQGRTDPNQNTGTSIQKCDIIASSDLTPVKSSFKSFLGRPWKEYSRTVV  465

Query  116   MESDIDGAISARGWIEWPGTSSSSVRELYFGEYANVGA  3
             M+S+I   I   GW  W G    +++ LY+GEY N GA
Sbjct  466   MQSNIGDLIDPAGWSAWDG--EFALKTLYYGEYLNQGA  501



>gb|AHC69829.1| pectin methylesterase PME2.1 [Nicotiana tabacum]
Length=559

 Score =   318 bits (815),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 177/401 (44%), Positives = 237/401 (59%), Gaps = 29/401 (7%)
 Frame = -2

Query  1178  AIGYCEELMGMARQRLNEALVAMKESPGKNRQEDIQTWLSAAVTFQQACKD----WADQY  1011
             A+  C EL+ ++ + + +++ A+ +S  +    + Q WLS  +T    C D     ++  
Sbjct  127   ALADCLELLDLSIELVTDSIAALGKSRSRLAHANAQIWLSGMLTNHVTCLDGLNSLSNTT  186

Query  1010  AFSDELFARISRSMDYQSQLASNALALVNRNTEISAAGRQLSEEdidddddggffpDWVS  831
             +    L   ISR+    + LAS  +   N       +GR  S               WV+
Sbjct  187   SIGTILEELISRAKTALAILAS--VTTPNEEVFTPLSGRMPS---------------WVN  229

Query  830   GRDLRLLETTTDKTKANVVVAKDGTGNFRTVAEAIGAA--SGRQRFVIYVKSGVYKEKIR  657
              RD +LLE++  + KAN VVA+DG+G+++T+ EA+ AA    + R+VIYVK G+YKE + 
Sbjct  230   SRDRKLLESSAKEIKANAVVAQDGSGDYQTLTEAVAAAPDKSKTRYVIYVKKGIYKENVE  289

Query  656   SSKDGITL--IGDGKYSTIITWDDSVGGGSSLTGSATFGITGDGFIAKDIGFQNTAGPGA  483
              +K  + L  +GDG  STIIT   +V  GS+   SAT    G GFI +DI  QNTAGP  
Sbjct  290   VTKKKMNLMIVGDGMNSTIITGSLNVVDGSTTFRSATLAAVGQGFILQDICIQNTAGPEK  349

Query  482   HQAVALTVASDHSVFYRCSISGYQDTLYALSLRQFYRECDISGTVDFIFGNAAAVFQACN  303
             HQAVAL V +D SV  RC I  YQDTLYA SLRQFYR+C ++GTVDFIFGNAA VFQ C 
Sbjct  350   HQAVALRVGADMSVINRCRIDAYQDTLYAHSLRQFYRDCYVTGTVDFIFGNAAVVFQKCQ  409

Query  302   LVLRRP--SSYNVILANGRSDPGQNTGFSVQKCKITPGPDFSPVKNSYNSYLGRPWKPYS  129
             LV R+P  +  N++ A GR+DP Q TG S+Q C I   PD  PVK+ Y +YLGRPWK YS
Sbjct  410   LVPRKPGKNQKNMVTAQGRTDPNQATGTSIQFCDIIASPDLEPVKSEYKTYLGRPWKEYS  469

Query  128   RAVVMESDIDGAISARGWIEWPGTSSSSVRELYFGEYANVG  6
             R VVMES +   I   GW EW G    +++ LY+GEY N G
Sbjct  470   RTVVMESYLGDLIDPAGWSEWSG--DFALKTLYYGEYMNNG  508



>ref|XP_009768199.1| PREDICTED: pectinesterase 2.1-like [Nicotiana sylvestris]
Length=559

 Score =   318 bits (815),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 177/401 (44%), Positives = 237/401 (59%), Gaps = 29/401 (7%)
 Frame = -2

Query  1178  AIGYCEELMGMARQRLNEALVAMKESPGKNRQEDIQTWLSAAVTFQQACKD----WADQY  1011
             A+  C EL+ ++ + + +++ A+ +S  +    + Q WLS  +T    C D     ++  
Sbjct  127   ALADCLELLDLSIELVTDSIAALGKSRSRLAHANAQIWLSGMLTNHVTCLDGLNSLSNTT  186

Query  1010  AFSDELFARISRSMDYQSQLASNALALVNRNTEISAAGRQLSEEdidddddggffpDWVS  831
             +    L   ISR+    + LAS  +   N       +GR  S               WV+
Sbjct  187   SIGTILEELISRAKTALAILAS--VTTPNEEVFTPLSGRMPS---------------WVN  229

Query  830   GRDLRLLETTTDKTKANVVVAKDGTGNFRTVAEAIGAA--SGRQRFVIYVKSGVYKEKIR  657
              RD +LLE++  + KAN VVA+DG+G+++T+ EA+ AA    + R+VIYVK G+YKE + 
Sbjct  230   SRDRKLLESSAKEIKANAVVAQDGSGDYQTLTEAVAAAPDKSKTRYVIYVKKGIYKENVE  289

Query  656   SSKDGITL--IGDGKYSTIITWDDSVGGGSSLTGSATFGITGDGFIAKDIGFQNTAGPGA  483
              +K  + L  +GDG  STIIT   +V  GS+   SAT    G GFI +DI  QNTAGP  
Sbjct  290   VTKKKMNLMIVGDGMNSTIITGSLNVVDGSTTFRSATLAAVGQGFILQDICIQNTAGPEK  349

Query  482   HQAVALTVASDHSVFYRCSISGYQDTLYALSLRQFYRECDISGTVDFIFGNAAAVFQACN  303
             HQAVAL V +D SV  RC I  YQDTLYA SLRQFYR+C ++GTVDFIFGNAA VFQ C 
Sbjct  350   HQAVALRVGADMSVINRCRIDAYQDTLYAHSLRQFYRDCYVTGTVDFIFGNAAVVFQKCQ  409

Query  302   LVLRRP--SSYNVILANGRSDPGQNTGFSVQKCKITPGPDFSPVKNSYNSYLGRPWKPYS  129
             LV R+P  +  N++ A GR+DP Q TG S+Q C I   PD  PVK+ Y +YLGRPWK YS
Sbjct  410   LVPRKPGKNQKNMVTAQGRTDPNQATGTSIQFCDIIASPDLEPVKSEYKTYLGRPWKEYS  469

Query  128   RAVVMESDIDGAISARGWIEWPGTSSSSVRELYFGEYANVG  6
             R VVMES +   I   GW EW G    +++ LY+GEY N G
Sbjct  470   RTVVMESYLGDLIDPAGWSEWSG--DFALKTLYYGEYMNNG  508



>gb|KDP22414.1| hypothetical protein JCGZ_26245 [Jatropha curcas]
Length=523

 Score =   317 bits (812),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 173/365 (47%), Positives = 226/365 (62%), Gaps = 26/365 (7%)
 Frame = -2

Query  1079  DIQTWLSAAVTFQQACKDWADQYAFSDELFARISRSMDYQSQLASNALALVNRNTEISAA  900
             D+QTWLS A+T  + CK    +   +D +   +S ++   S L  N LA+ N +T +   
Sbjct  129   DVQTWLSTALTNLETCKAGFVELGVTDFMLPLMSNNV---SSLIRNTLAINNSSTSV---  182

Query  899   GRQLSEEdidddddggffpDWVSGRDLRLLETTTDKTKANVVVAKDGTGNFRTVAEAIGA  720
                              FP WV+  D +LL+T++     N+VVA+DG+GNFRT+ +A+ A
Sbjct  183   ---------LPQTYKDGFPHWVTSGDRKLLQTSS--PSPNLVVAQDGSGNFRTIKQALDA  231

Query  719   A---SGRQRFVIYVKSGVYKEKIRSSKD--GITLIGDGKYSTIITWDDSVGGGSSLTGSA  555
             A   SG  RFVI++KSG+Y+E +    D   I L+GDG  +TIIT   SVGGGS+   SA
Sbjct  232   AAKRSGSGRFVIHIKSGIYRENLEIGNDMINIMLVGDGLRNTIITGSRSVGGGSTTFNSA  291

Query  554   TFGITGDGFIAKDIGFQNTAGPGAHQAVALTVASDHSVFYRCSISGYQDTLYALSLRQFY  375
             T  +TGDGFIA+ I F+NTAGP  HQAVAL   SD SVFYRC   GYQDTLY  S RQFY
Sbjct  292   TVAVTGDGFIARGITFRNTAGPQNHQAVALRSGSDLSVFYRCGFEGYQDTLYVHSQRQFY  351

Query  374   RECDISGTVDFIFGNAAAVFQACNLVLRRP--SSYNVILANGRSDPGQNTGFSVQKCKIT  201
             +EC I GTVDFIFGNAA V Q C +  RRP     NV+ A GR+DP QNTG S+   ++ 
Sbjct  352   KECYIYGTVDFIFGNAAVVLQNCMIYARRPMDKQKNVVTAQGRTDPNQNTGISIHNSRVM  411

Query  200   PGPDFSPVKNSYNSYLGRPWKPYSRAVVMESDIDGAISARGWIEWPGTSSSSVRELYFGE  21
               PD  PV +S+ +YLGRPWK YSR V +++ +D  +   GW+EW G    ++  LY+GE
Sbjct  412   ASPDLKPVLSSFKTYLGRPWKQYSRTVYLQTYLDSLVDPAGWLEWDG--DFALNTLYYGE  469

Query  20    YANVG  6
             Y NVG
Sbjct  470   YKNVG  474



>gb|AGG23325.1| pectin methylesterase 1 [Musa acuminata AAA Group]
Length=566

 Score =   318 bits (815),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 183/463 (40%), Positives = 259/463 (56%), Gaps = 13/463 (3%)
 Frame = -2

Query  1370  QCGYTRFPRLCVQTLSGL--VSGERVDFAAALLLNKTIAHADLHIAHFDQLSSHFVSSQP  1197
              C  T +P LC  TLS +  +  + +       +N +         +  +   H   +  
Sbjct  59    HCDGTLYPDLCASTLSTIPDLHSKSLPEVICATINASEXAVIKSAKNCTKYLHHHNYTLD  118

Query  1196  PQPRLQAIGYCEELMGMARQRLNEALVAMKESPGKNRQEDIQTWLSAAVTFQQACKDWAD  1017
              + R  A+  C +L       L +A   +  +PG +  + +QT LSAA+T Q  C D   
Sbjct  119   TRQRY-ALTDCLDLFSQTLDELLDATSDLTANPGSH-VDHVQTLLSAAITNQYTCLDGFA  176

Query  1016  QYAFSDELFARISRSMDYQSQLASNALALVNRNTEISAAGRQLSEEdidddddggffpDW  837
                      + I + + + S L SN+LA++ +  +         E      +    FP W
Sbjct  177   YVGKDGGYRSVIEQPLYHVSHLVSNSLAMMKK-IQRQKPXHPRREALEGYGEVAEGFPVW  235

Query  836   VSGRDLRLLETTTDKTKANVVVAKDGTGNFRTVAEAIGAASGRQ--RFVIYVKSGVYKEK  663
             VSG+D RLL+   + T  N++VAKDG+GNF T+++A+ AA  +   RFVIY+K+G Y E 
Sbjct  236   VSGKDRRLLQAAANTTTPNLIVAKDGSGNFTTISDAVAAAPSKSETRFVIYIKAGAYLEN  295

Query  662   IR--SSKDGITLIGDGKYSTIITWDDSVGGGSSLTGSATFGITGDGFIAKDIGFQNTAGP  489
             +    SK  +  +GDG   T++    +V  G +   SAT  I G+GF+ +D+  +N+AGP
Sbjct  296   VEVGKSKTNLMFMGDGIGKTVVKASRNVVDGWTTFRSATVAIVGNGFLMRDMTIENSAGP  355

Query  488   GAHQAVALTVASDHSVFYRCSISGYQDTLYALSLRQFYRECDISGTVDFIFGNAAAVFQA  309
               HQAVAL V +D S FYRCS  GYQDTLYA SLRQFYRECD+ GT+DFIFGNA  V Q 
Sbjct  356   SKHQAVALRVGADLSAFYRCSFVGYQDTLYAHSLRQFYRECDVYGTIDFIFGNAGVVLQN  415

Query  308   CNLVLRRPSS--YNVILANGRSDPGQNTGFSVQKCKITPGPDFSPVKNSYNSYLGRPWKP  135
             CNL  R+P S   N+  A GR DP QNTG S+Q CK+    D +PV++++++YLGRPWK 
Sbjct  416   CNLYARKPLSNQKNIFTAQGREDPNQNTGISIQNCKVAAASDLAPVQSNFSTYLGRPWKA  475

Query  134   YSRAVVMESDIDGAISARGWIEWPGTSSSSVRELYFGEYANVG  6
             YSR V M+S +D  I+  GW+EW G  + S   LY+GEY N G
Sbjct  476   YSRTVYMQSLLDSLINPAGWLEWDGDFALST--LYYGEYMNRG  516



>ref|XP_010101471.1| Pectinesterase/pectinesterase inhibitor [Morus notabilis]
 gb|EXB88454.1| Pectinesterase/pectinesterase inhibitor [Morus notabilis]
Length=552

 Score =   318 bits (814),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 179/394 (45%), Positives = 233/394 (59%), Gaps = 21/394 (5%)
 Frame = -2

Query  1166  CEELMGMARQRLNEALVAM-KESPGKNRQEDIQTWLSAAVTFQQACKDWADQYAFSDELF  990
             C ELM +++ R+ +++  +  +    +  ED+  WLS+ +T    C D  +  +++  L 
Sbjct  124   CAELMDISKDRVVDSISTLFLQKQTSHSHEDVHAWLSSVLTNHVTCLDALEDGSYAKNL-  182

Query  989   ARISRSMDYQSQLASNALALVNRNTEISAAGRQLSEEdidddddggffpDWVSGRDLRLL  810
                   MD  S L  N L L  R T ++             +      P WV+  D RLL
Sbjct  183   ------MD--SHL--NELILRAR-TSLAILVSVFPSNSEAIETLTDDLPTWVTAGDRRLL  231

Query  809   ETTTDKTKANVVVAKDGTGNFRTVAEAIGAA--SGRQRFVIYVKSGVYKEKIR--SSKDG  642
             + +    KA++VVA+DG+G ++TV EA+ A   + + RF IYVK G YKE +     K  
Sbjct  232   QASVKAIKADIVVAEDGSGKYKTVKEAVAAVPDNSKTRFTIYVKKGTYKENVEIGKKKKN  291

Query  641   ITLIGDGKYSTIITWDDSVGGGSSLTGSATFGITGDGFIAKDIGFQNTAGPGAHQAVALT  462
             + L+GDG  STIIT   +V  GS+   SAT    GDGFIA+DI FQNTAGP  HQAVAL 
Sbjct  292   VMLVGDGMDSTIITGSLNVIDGSTTFNSATVAAVGDGFIAQDIWFQNTAGPQKHQAVALR  351

Query  461   VASDHSVFYRCSISGYQDTLYALSLRQFYRECDISGTVDFIFGNAAAVFQACNLVLRRPS  282
             V +D SV  RC I  YQDTLYA S RQFYR+  ++GTVDFIFGNAA VFQ C LV R+  
Sbjct  352   VGADQSVINRCRIDAYQDTLYAHSNRQFYRDSTVTGTVDFIFGNAAVVFQNCKLVARKGM  411

Query  281   S--YNVILANGRSDPGQNTGFSVQKCKITPGPDFSPVKNSYNSYLGRPWKPYSRAVVMES  108
             S   N++ A GR+DP QNTG S+QKC+I+   D  PVK SY SYLGRPWK YSR VVM+S
Sbjct  412   SGQKNMVTAQGRTDPNQNTGTSIQKCEISASSDLEPVKASYKSYLGRPWKEYSRTVVMQS  471

Query  107   DIDGAISARGWIEWPGTSSSSVRELYFGEYANVG  6
              I   I   GW EW      +++ LY+GEYAN G
Sbjct  472   TIGDLIDPAGWAEWD--KDFALKTLYYGEYANQG  503



>emb|CDX95641.1| BnaC03g25220D [Brassica napus]
Length=445

 Score =   314 bits (805),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 179/388 (46%), Positives = 228/388 (59%), Gaps = 25/388 (6%)
 Frame = -2

Query  1166  CEELMGMARQRLNEALVAMKESPGKNRQEDIQTWLSAAVTFQQACKDWADQYAFSDELFA  987
             C +L      ++NE +    +   K  + D QTWLS A+T    C+    +   +D +  
Sbjct  34    CIKLYDFTVSKINETM----DPNVKCSKTDAQTWLSTALTNLDTCRAGFLELGVTDIVLP  89

Query  986   RISRSMDYQSQLASNALALVNRNTEISAAGRQLSEEdidddddggffpDWVSGRDLRLLE  807
              +S ++   S L  N LA+       +  G+               FP WV   D +LL+
Sbjct  90    LMSNNV---SNLICNTLAINKVPFNYTPPGKD-------------GFPSWVKPGDRKLLQ  133

Query  806   TTTDKTKANVVVAKDGTGNFRTVAEAIGAASGRQRFVIYVKSGVYKEKIRSSKDGITLIG  627
             ++T +   N VVAKDG+GNFRT+ +AI AASG  RFVIYVK GVY E +   K  + L G
Sbjct  134   SSTPRD--NAVVAKDGSGNFRTIKDAINAASGSGRFVIYVKQGVYSENLEIRKKNVMLRG  191

Query  626   DGKYSTIITWDDSVGGGSSLTGSATFGITGDGFIAKDIGFQNTAGPGAHQAVALTVASDH  447
             DGK  TIIT   SVGGGS+   SAT    GDGFIA+ I F+NTAG    QAVAL   SD 
Sbjct  192   DGKGRTIITGSRSVGGGSTTFNSATVAAVGDGFIARGITFRNTAGANNAQAVALRSGSDL  251

Query  446   SVFYRCSISGYQDTLYALSLRQFYRECDISGTVDFIFGNAAAVFQACNLVLRRPSSY-NV  270
             SVFY+CS  GYQDTLY  S RQFYR+CD+ GTVDFIFGNAAAV Q CN+  RRP S  N 
Sbjct  252   SVFYQCSFEGYQDTLYVHSNRQFYRDCDVYGTVDFIFGNAAAVLQNCNIFARRPRSRTNT  311

Query  269   ILANGRSDPGQNTGFSVQKCKITPGPDFSPVKNSYNSYLGRPWKPYSRAVVMESDIDGAI  90
             I A GRSDP QNTG  +   ++T   D  PV  S  +YLGRPW+ YSR V M++ +D  I
Sbjct  312   ITAQGRSDPNQNTGIIIHNSRVTAASDLRPVLGSTKTYLGRPWRQYSRTVFMKTSLDSLI  371

Query  89    SARGWIEWPGTSSSSVRELYFGEYANVG  6
               RGW+EW G  + ++R L++ E+ N G
Sbjct  372   DPRGWLEWDG--NFALRTLFYAEFQNTG  397



>ref|XP_002865971.1| pectinesterase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH42230.1| pectinesterase family protein [Arabidopsis lyrata subsp. lyrata]
Length=587

 Score =   318 bits (816),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 187/470 (40%), Positives = 257/470 (55%), Gaps = 28/470 (6%)
 Frame = -2

Query  1367  CGYTRFPRLCVQTLSGLVSGERVDFAAALLLNKT-IAHADLHIAHFDQLSSHFVSS----  1203
             C  + +P LC+ TL        +DF  +L  ++  + H   + A   + S    +S    
Sbjct  79    CSKSLYPNLCIDTL--------LDFPGSLTADENELIHISFN-ATLQRFSKALYTSSTIT  129

Query  1202  ---QPPQPRLQAIGYCEELMGMARQRLNEALVAMKESPGKNRQEDIQTWLSAAVTFQQAC  1032
                 PP+ R  A   C EL+  +   L  AL ++    G     D+ TWLS+A+T    C
Sbjct  130   YTQMPPRVR-SAYDSCLELLDDSVDALTRALSSVVVVSGDESHSDVMTWLSSAMTNHDTC  188

Query  1031  KDWADQY-AFSDELFARISRSMDYQSQLASNALALVNRNTEISAAGRQLSEEdidddddg  855
              D  D+      E+  ++  ++   S++ SN LA+     +  +    ++   +   ++ 
Sbjct  189   TDGFDEIEGQGGEVKDQVIGAVKDLSEMVSNCLAIFAGKVKDLSGVPVVNNRKLLGTEET  248

Query  854   gffpDWVSGRDLRLLETTTDKTKANVVVAKDGTGNFRTVAEAIGAAS--GRQRFVIYVKS  681
                P+W+   D  LL T T   +A++ V+KDG+G F+T+AEAI  A     +RFVIYVKS
Sbjct  249   EELPNWLKREDRELLGTPTSAVQADITVSKDGSGTFKTIAEAIKKAPEHSSRRFVIYVKS  308

Query  680   GVYKE---KIRSSKDGITLIGDGKYSTIITWDDSVGGGSSLTGSATFGITGDGFIAKDIG  510
             G Y+E   K+   K  +  IGDGK  T+IT   S+    +   +ATF  TG GFI +DI 
Sbjct  309   GRYEEENLKVGRKKTNLMFIGDGKGKTVITGGKSIADDLTTFHTATFAATGAGFIVRDIT  368

Query  509   FQNTAGPGAHQAVALTVASDHSVFYRCSISGYQDTLYALSLRQFYRECDISGTVDFIFGN  330
             F+N AGP  HQAVAL V  DH+V YRCSI GYQD LY  S RQF+REC+I GTVDFIFGN
Sbjct  369   FENYAGPAKHQAVALRVGGDHAVVYRCSIIGYQDALYVHSNRQFFRECEIYGTVDFIFGN  428

Query  329   AAAVFQACNLVLRRPSSYN--VILANGRSDPGQNTGFSVQKCKITPGPDFSPVKNSYNSY  156
             AA + Q+CN+  R+P +     I A  R DP QNTG S+  CK+   PD    K SY +Y
Sbjct  429   AAVILQSCNIYARKPMAQQKITITAQNRKDPNQNTGISIHACKLLATPDLEASKGSYPTY  488

Query  155   LGRPWKPYSRAVVMESDIDGAISARGWIEWPGTSSSSVRELYFGEYANVG  6
             LGRPWK YSR V M SD+   I  RGW+EW G    ++  LY+GEY N G
Sbjct  489   LGRPWKLYSRVVYMMSDMGDHIDPRGWLEWNG--PYALDTLYYGEYMNKG  536



>ref|XP_006841646.1| hypothetical protein AMTR_s00003p00238240 [Amborella trichopoda]
 gb|ERN03321.1| hypothetical protein AMTR_s00003p00238240 [Amborella trichopoda]
Length=566

 Score =   318 bits (815),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 193/478 (40%), Positives = 271/478 (57%), Gaps = 29/478 (6%)
 Frame = -2

Query  1379  IRIQCGYTRFPRLCVQTLSGLVSGERVDFAAALLLNKTIAHADLHIAHFDQLSSHFVSSQ  1200
             I + C  T  P  C +T    +  E ++ +   +L+ T       +    +  S F +  
Sbjct  47    IDLACSKTINPEACFET----IQTECIECSPIAILSSTARLTRNEVKKAMEFLSEFRAQS  102

Query  1199  PPQPRLQAIGYCEELMGMARQRLNEALVAMK-----ESPGKNRQEDIQTWLSAAVTFQQA  1035
               +  + A   C EL+    + L+ +L  M      E    +RQ D++ WLSAA+  Q  
Sbjct  103   VDRREVIATKDCMELLDFTSEELSWSLSIMNNPNFSEETMLHRQGDVRAWLSAALGNQDT  162

Query  1034  CKDWADQYAFSDELFARISRSMDYQSQLASNALALVNRNTEISA------AGRQLSEEdi  873
             C +  +       +   I  S+   SQL SN LA+V R  + S       A  ++S E  
Sbjct  163   CIEGFE--GTKGHVRDYIQGSLQQVSQLVSNMLAMVQRINDFSVVIPLNNATMEVSNESH  220

Query  872   dddddgg-ffpDWVSGRDLR-LLETTTDKTKANVVVAKDGTGNFRTVAEAIGAASG--RQ  705
                ++G   FP W+S  + + +        +ANVVVA DG+GNFR++ EAI AA    +Q
Sbjct  221   GRLEEGNGEFPMWMSSEEQKGIFRKGAGGVRANVVVASDGSGNFRSITEAIRAAPDYRKQ  280

Query  704   RFVIYVKSGVYKE--KIRSSKDGITLIGDGKYSTIITWDDSVGGGSSLTGSATFGITGDG  531
             R+VI+V++GVY+E  +++  K  I L+GDGK  T+I+   S   G +   +ATF ++G G
Sbjct  281   RYVIHVRAGVYRENVEVKKKKTNIMLVGDGKDVTVISGSRSFLQGWTTFHTATFAVSGRG  340

Query  530   FIAKDIGFQNTAGPGAHQAVALTVASDHSVFYRCSISGYQDTLYALSLRQFYRECDISGT  351
             FIA+DI F+NTAGP  HQAVAL V SD S FY C+I GYQDTLYA SLRQFYRECDI GT
Sbjct  341   FIARDITFENTAGPSMHQAVALRVDSDQSAFYHCAIKGYQDTLYAHSLRQFYRECDIYGT  400

Query  350   VDFIFGNAAAVFQACNLVLRRPSSYN---VILANGRSDPGQNTGFSVQKCKITPGPDFSP  180
             +DFIFGN AA FQ C ++ R+P  YN    I A+GR DP Q+TGFS+Q C +    D +P
Sbjct  401   IDFIFGNGAAFFQNCRILARKP-LYNQKISITAHGRKDPHQSTGFSIQNCIVEAASDLAP  459

Query  179   VKNSYNSYLGRPWKPYSRAVVMESDIDGAISARGWIEWPGTSSSSVRELYFGEYANVG  6
             + +S  +YLGRPWKPY+R + MES +   I   GW+ W G  + ++  LY+GEY N G
Sbjct  460   IVSSVPAYLGRPWKPYARTIYMESYLGSLIQPEGWLAWAG--NFALNTLYYGEYRNYG  515



>emb|CBI24285.3| unnamed protein product [Vitis vinifera]
Length=444

 Score =   314 bits (805),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 176/393 (45%), Positives = 238/393 (61%), Gaps = 29/393 (7%)
 Frame = -2

Query  1166  CEELMGMARQRLNEALVAMKESPGKNRQEDIQTWLSAAVTFQQACKDWADQYAFSDELFA  987
             C EL      +LN+ L    +   +  Q D QTWLS A+T  Q C+D   +   SD    
Sbjct  26    CVELYDHTILKLNKTL----DPNTRCTQVDAQTWLSTALTNLQTCQDGFIELGVSDHFLP  81

Query  986   RISRSMDYQSQLASNALALVNRNTEISAAGRQLSEEdidddddggffpDWVSGRDLRLLE  807
              IS ++   S+L SN L++              ++    +    G +P WV   D +LL+
Sbjct  82    LISNNV---SKLISNTLSI--------------NKVPYAEPSYKGGYPTWVKPGDRKLLQ  124

Query  806   TTTDKTKANVVVAKDGTGNFRTVAEAIGAASGRQ---RFVIYVKSGVYKEKIR--SSKDG  642
             +++  ++AN+VV+KDG+G++ T+  AI AAS R    R+VIYVK+G Y E ++  S    
Sbjct  125   SSSLASQANIVVSKDGSGDYTTIGAAITAASKRSGSGRYVIYVKAGTYSENVQIGSGLKN  184

Query  641   ITLIGDGKYSTIITWDDSVGGGSSLTGSATFGITGDGFIAKDIGFQNTAGPGAHQAVALT  462
             ITL+GDG   TI+T   SVGGGS+   SAT  + GDGFIA+ +  +NTAG   HQAVAL 
Sbjct  185   ITLLGDGIGKTIVTGSRSVGGGSTTYNSATVAVVGDGFIARGMTIRNTAGASNHQAVALR  244

Query  461   VASDHSVFYRCSISGYQDTLYALSLRQFYRECDISGTVDFIFGNAAAVFQACNLVLRR-P  285
               SD SV+Y+CS  GYQDTLY  S RQFYRECDI GTVDFIFGNAA VFQ CN+  R  P
Sbjct  245   SGSDLSVYYQCSFEGYQDTLYVYSDRQFYRECDIYGTVDFIFGNAAVVFQKCNIYARNPP  304

Query  284   SSYNVILANGRSDPGQNTGFSVQKCKITPGPDFSPVKNSYNSYLGRPWKPYSRAVVMESD  105
             +  N + A GR+DP QNTG S+  C++T   D   V++S  +YLGRPWK YSR V +++ 
Sbjct  305   NKVNTVTAQGRTDPNQNTGISIHDCEVTAASDLKAVQSSVKTYLGRPWKEYSRTVFLKTY  364

Query  104   IDGAISARGWIEWPGTSSSSVRELYFGEYANVG  6
             +D  I++ GW+EW G    ++  LY+GEY N G
Sbjct  365   LDSLINSAGWLEWSG--DFALNTLYYGEYMNTG  395



>gb|ACQ85264.1| pectin methylesterase [Musa acuminata AAA Group]
Length=565

 Score =   318 bits (814),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 183/463 (40%), Positives = 259/463 (56%), Gaps = 13/463 (3%)
 Frame = -2

Query  1370  QCGYTRFPRLCVQTLSGL--VSGERVDFAAALLLNKTIAHADLHIAHFDQLSSHFVSSQP  1197
              C  T +P LC  TLS +  +  + +       +N +         +  +   H   +  
Sbjct  58    HCDGTLYPDLCASTLSTIPDLHSKSLPEVICATINASEGAVIKSAKNCTKYLHHHNYTLD  117

Query  1196  PQPRLQAIGYCEELMGMARQRLNEALVAMKESPGKNRQEDIQTWLSAAVTFQQACKDWAD  1017
              + R  A+  C +L       L +A   +  +PG +  + +QT LSAA+T Q  C D   
Sbjct  118   TRQRY-ALTDCLDLFSQTLDELLDATSDLTANPG-SHVDHVQTLLSAAITNQYTCLDGFA  175

Query  1016  QYAFSDELFARISRSMDYQSQLASNALALVNRNTEISAAGRQLSEEdidddddggffpDW  837
                      + I + + + S L SN+LA++ +  +         E      +    FP W
Sbjct  176   YVGKDGGYRSVIEQPLYHVSHLVSNSLAMMKK-IQRQKPPHPRREALEGYGEVAEGFPVW  234

Query  836   VSGRDLRLLETTTDKTKANVVVAKDGTGNFRTVAEAIGAASGRQ--RFVIYVKSGVYKEK  663
             VSG+D RLL+   + T  N++VAKDG+GNF T+++A+ AA  +   RFVIY+K+G Y E 
Sbjct  235   VSGKDRRLLQAAANTTTPNLIVAKDGSGNFTTISDAVAAAPSKSETRFVIYIKAGAYLEN  294

Query  662   IR--SSKDGITLIGDGKYSTIITWDDSVGGGSSLTGSATFGITGDGFIAKDIGFQNTAGP  489
             +    SK  +  +GDG   T++    +V  G +   SAT  I G+GF+ +D+  +N+AGP
Sbjct  295   VEVGKSKTNLMFMGDGIGKTVVKASRNVVDGWTTFRSATVAIVGNGFLMRDMTIENSAGP  354

Query  488   GAHQAVALTVASDHSVFYRCSISGYQDTLYALSLRQFYRECDISGTVDFIFGNAAAVFQA  309
               HQAVAL V +D S FYRCS  GYQDTLYA SLRQFYRECD+ GT+DFIFGNA  V Q 
Sbjct  355   SKHQAVALRVGADLSAFYRCSFVGYQDTLYAHSLRQFYRECDVYGTIDFIFGNAGVVLQN  414

Query  308   CNLVLRRPSS--YNVILANGRSDPGQNTGFSVQKCKITPGPDFSPVKNSYNSYLGRPWKP  135
             CNL  R+P S   N+  A GR DP QNTG S+Q CK+    D +PV++++++YLGRPWK 
Sbjct  415   CNLYARKPLSNQKNIFTAQGREDPNQNTGISIQNCKVAAASDLAPVQSNFSTYLGRPWKA  474

Query  134   YSRAVVMESDIDGAISARGWIEWPGTSSSSVRELYFGEYANVG  6
             YSR V M+S +D  I+  GW+EW G  + S   LY+GEY N G
Sbjct  475   YSRTVYMQSLLDSLINPAGWLEWDGDFALST--LYYGEYMNRG  515



>ref|XP_002271665.2| PREDICTED: pectinesterase-like [Vitis vinifera]
Length=561

 Score =   318 bits (814),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 191/466 (41%), Positives = 261/466 (56%), Gaps = 22/466 (5%)
 Frame = -2

Query  1370  QCGYTRFPRLCVQTLSGL--VSGERVDFAAALLLNKTIAHADLHIAHFDQLSSHFVSSQP  1197
              C  T +P LCV TLS    ++ + V    A  ++ T+    L  ++   +     +   
Sbjct  55    HCEGTLYPELCVSTLSTFPDLASKTVPEVIAATVSHTVGEVKLSASNCSGIRRKLKNLNT  114

Query  1196  PQPRLQAIGYCEELMGMARQRLNEAL--VAMKESPGKNRQEDIQTWLSAAVTFQQACKDW  1023
              + R  AI  C EL      +L   +  ++   SP K+   D+QT LS ++T    C   
Sbjct  115   LEGR--AINDCLELHDCTIAQLQSTISDLSHNNSPAKHYH-DLQTLLSGSITNLYTC---  168

Query  1022  ADQYAFSDE-LFARISRSMDYQSQLASNALALVNRNTEISAAGRQLSEEdidddddggff  846
              D +A+S + + + I   +   S   SN+LA++ +   + ++  ++  E     D     
Sbjct  169   LDGFAYSKKHIRSSIEGPLRNISHHVSNSLAMLKKIPGVQSSKSEIFPEYGSTKDGFPA-  227

Query  845   pDWVSGRDLRLLETTTDKTKANVVVAKDGTGNFRTVAEAIGAA--SGRQRFVIYVKSGVY  672
               W+SG+D RLL+ +  +   N+ VAKDG+G+F T+ EAI AA  S   RFVI++K+G Y
Sbjct  228   --WLSGKDRRLLQASASQIHYNLTVAKDGSGDFTTIGEAIAAAPNSSTTRFVIHIKAGAY  285

Query  671   KE--KIRSSKDGITLIGDGKYSTIITWDDSVGGGSSLTGSATFGITGDGFIAKDIGFQNT  498
              E   I  SK  + L+GDG  +T I  + SVGGG +   S T  +  + FIAK I F+N 
Sbjct  286   FEYLDIARSKTMLMLVGDGLENTYIKGNRSVGGGWTTFQSGTVAVVANNFIAKGISFENY  345

Query  497   AGPGAHQAVALTVASDHSVFYRCSISGYQDTLYALSLRQFYRECDISGTVDFIFGNAAAV  318
             AGP  HQAVAL   +D SVFY C   GYQDTLY  SLRQFYRECD+ GT+DFIFGNAA V
Sbjct  346   AGPSNHQAVALRSGADLSVFYLCRFIGYQDTLYVHSLRQFYRECDVYGTIDFIFGNAAVV  405

Query  317   FQACNLVLRRPSS--YNVILANGRSDPGQNTGFSVQKCKITPGPDFSPVKNSYNSYLGRP  144
              Q CNL  RRP++   NV  A GR DP +NTG S+Q CK+    D  PV +S+ SYLGRP
Sbjct  406   LQNCNLYARRPNANQKNVFTAQGRDDPNENTGISIQNCKVAAAADLIPVLSSFKSYLGRP  465

Query  143   WKPYSRAVVMESDIDGAISARGWIEWPGTSSSSVRELYFGEYANVG  6
             WK YSR V M+S+I   I   GW+EW G  + S   LY+GEY N G
Sbjct  466   WKEYSRTVYMQSNIGNLIDPAGWLEWDGDFALST--LYYGEYKNRG  509



>ref|XP_009599511.1| PREDICTED: pectinesterase 2-like [Nicotiana tomentosiformis]
Length=522

 Score =   317 bits (811),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 199/478 (42%), Positives = 270/478 (56%), Gaps = 47/478 (10%)
 Frame = -2

Query  1379  IRIQCGYTRFPRLCVQTLSGLVSGERVDFAAALLLNKTIAHADLHI------------AH  1236
             ++ +C  T FP+ C   L+     +      ALL+NK    +D H             AH
Sbjct  25    LKSRCSQTPFPQPCEYFLA-----DHNRKYGALLINK---KSDFHKMSLKLALDRALRAH  76

Query  1235  FDQLSSHFVSSQPPQPRLQAIGYCEELMGMARQRLNEALVAMKESPGKNRQEDIQTWLSA  1056
              + LS    S    +    A   C EL      ++N+ +    +   K+  +D+QTWLS 
Sbjct  77    ENTLS--LGSKCRNKHEKAAWADCVELYQNIIVKINKTI----DPSIKSTADDVQTWLST  130

Query  1055  AVTFQQACKDWADQYAFSDELFARISRSMDYQSQLASNALALVNRNTEISAAGRQLSEEd  876
             A+T  + C+    +   +D +   +  +++  S L SN L L NR    +       +  
Sbjct  131   ALTNIETCRSGFIELGVTDYVMPILMSNINV-SYLISNTLFL-NRGYYSTEPSTNYED--  186

Query  875   idddddggffpDWVSGRDLRLLETTTD-KTKANVVVAKDGTGNFRTVAEAIGAASGRQ--  705
                      FP+WVS  D  LL+++++  ++AN+VVAKDG+GNF+TV EA+ AA+ R   
Sbjct  187   --------GFPNWVSPNDQTLLQSSSNLGSQANIVVAKDGSGNFKTVTEAVVAAAKRTGS  238

Query  704   -RFVIYVKSGVYKEKIRSSKD--GITLIGDGKYSTIITWDDSVGGGSSLTGSATFGITGD  534
              RFVIYV  G+Y E +    +   I L+GDG   TIIT   SVGGGS+   SAT  + GD
Sbjct  239   GRFVIYVNVGIYNENVEIGINLKNIMLVGDGIGKTIITGSKSVGGGSTTFKSATVAVDGD  298

Query  533   GFIAKDIGFQNTAGPGAHQAVALTVASDHSVFYRCSISGYQDTLYALSLRQFYRECDISG  354
             GFIA+ I F+NTAGP   QAVAL   SD SVFY+CS  GYQDTL A S RQFYR+CDI G
Sbjct  299   GFIAQGITFRNTAGPKNGQAVALRSGSDLSVFYQCSFEGYQDTLCAHSQRQFYRDCDIYG  358

Query  353   TVDFIFGNAAAVFQACNLVLRRPSS-YNVILANGRSDPGQNTGFSVQKCKITPGPDFSPV  177
             TVDFIFGNAA V Q CN+  R P S  N + A GRSDP QNTG S+  C++TP  D  P 
Sbjct  359   TVDFIFGNAAVVLQNCNIFARNPPSRINTVTAQGRSDPNQNTGISIHNCRVTPSSDLKPY  418

Query  176   KNSYNSYLGRPWKPYSRAVVMESDIDGAISARGWIEWPGTSSSSVRELYFGEYANVGA  3
             +NS  +YLGRPW+ YSR V+M++ +D  I   GW+ W GT   +++ LY+GEY N G+
Sbjct  419   QNSVKTYLGRPWQQYSRTVIMKTFLDSLIDPAGWMPWTGT--FALKTLYYGEYLNSGS  474



>ref|XP_002320714.1| putative pectin methylesterase LuPME1 family protein [Populus 
trichocarpa]
 gb|EEE99029.1| putative pectin methylesterase LuPME1 family protein [Populus 
trichocarpa]
Length=514

 Score =   316 bits (810),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 170/374 (45%), Positives = 234/374 (63%), Gaps = 25/374 (7%)
 Frame = -2

Query  1109  KESPGKNRQEDIQTWLSAAVTFQQACKDWADQYAFSDELFARISRSMDYQSQLASNALAL  930
             K +  K  + D QTWLS A+T  + C+    ++  +D +   +S ++   S+L SN LA+
Sbjct  111   KTTGSKCTKYDAQTWLSTALTNLETCRTGFAEFGMTDYILPMMSNNV---SKLISNTLAI  167

Query  929   VNRNTEISAAGRQLSEEdidddddggffpDWVSGRDLRLLETTTDKTKANVVVAKDGTGN  750
                           ++    +    G FP WV   D +LL++++  ++AN+VVA+DG+GN
Sbjct  168   --------------NKAPYSEPSFNGGFPSWVRPGDRKLLQSSSPASQANIVVAQDGSGN  213

Query  749   FRTVAEAIGAASGRQ---RFVIYVKSGVYKEKIRSSKD--GITLIGDGKYSTIITWDDSV  585
              +T+ EAI AAS R    R+VIYVK+G Y E +   +    + ++GDG   TI+T   SV
Sbjct  214   VKTIKEAIVAASKRSGSGRYVIYVKAGTYNENVEVGQKVKNVMVVGDGIGKTIVTGSKSV  273

Query  584   GGGSSLTGSATFGITGDGFIAKDIGFQNTAGPGAHQAVALTVASDHSVFYRCSISGYQDT  405
             GGG++   SATF + GD FIA+D+ F+NTAG   HQAVAL   SD SVFY+CS  GYQDT
Sbjct  274   GGGTTTFKSATFAVVGDNFIARDMTFRNTAGAKNHQAVALRSGSDLSVFYKCSFEGYQDT  333

Query  404   LYALSLRQFYRECDISGTVDFIFGNAAAVFQACNLVLRR-PSSYNVILANGRSDPGQNTG  228
             LY  S RQFYREC+I GTVDFIFGNAA VFQ CN+  R  P+  N I A GR+DP QNTG
Sbjct  334   LYVHSQRQFYRECNIYGTVDFIFGNAAVVFQNCNIYARNPPNKTNTITAQGRTDPNQNTG  393

Query  227   FSVQKCKITPGPDFSPVKNSYNSYLGRPWKPYSRAVVMESDIDGAISARGWIEWPGTSSS  48
              S+  CK+T   D   V++S  +YLGRPW+ YSR V M++D+D  I++ GW+ W G  + 
Sbjct  394   ISIHNCKVTAASDLKSVQSSVKTYLGRPWQKYSRTVFMKTDLDSLINSAGWMPWSG--NF  451

Query  47    SVRELYFGEYANVG  6
             ++  LY+GEY N G
Sbjct  452   ALDTLYYGEYMNTG  465



>ref|XP_008235121.1| PREDICTED: pectinesterase-like [Prunus mume]
Length=562

 Score =   318 bits (814),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 193/466 (41%), Positives = 253/466 (54%), Gaps = 21/466 (5%)
 Frame = -2

Query  1367  CGYTRFPRLCVQTLSGLVSGERVDFAAALLLNKTIAHADLHIAHFDQLSSHFVSSQPPQ-  1191
             C  T +  LCV TLS     +    +   +++ T++H    +       +  +  Q  + 
Sbjct  55    CQDTLYKLLCVSTLSTF--PDLTTKSVPQIISYTVSHTVSEVQASSSNCTGIIKKQFKKL  112

Query  1190  PRLQAIGY--CEELMGMARQRLNEALVAMK-ESPGKNRQEDIQTWLSAAVTFQQACKDWA  1020
               LQ I    C EL       LN  +  +  +    NR  D++T LS A+T Q  C D  
Sbjct  113   DALQQIALDDCLELFDDTIAELNAVISDLSIKKLSSNRYYDLKTLLSGAMTNQYTCLD--  170

Query  1019  DQYAFSDELFAR--ISRSMDYQSQLASNALALVNRNTEISAAGRQLSEEdidddddggff  846
                 F+D    R  I   +   SQ  SNAL ++ +           SE   +       F
Sbjct  171   ---GFNDTGIVRQEIQSRLQTISQHVSNALVMLKKIPGALKYENSKSEMFPEFGPMKNGF  227

Query  845   pDWVSGRDLRLLETTTDKTKANVVVAKDGTGNFRTVAEAIGAA--SGRQRFVIYVKSGVY  672
             P WVS +D +LL++  + TK ++VVAKDGTGNF T++EA+  A  S   RFVIY+KSG Y
Sbjct  228   PTWVSSKDRKLLQSVANGTKYDLVVAKDGTGNFTTISEAVAVAPNSSATRFVIYIKSGAY  287

Query  671   KEKIR--SSKDGITLIGDGKYSTIITWDDSVGGGSSLTGSATFGITGDGFIAKDIGFQNT  498
              E +     K  +  +GDG   T++    +V  G +   SAT  + GDGFIA+ I F+N 
Sbjct  288   FENVEVVRKKTNLMFLGDGIGKTVVKASRNVVDGWTTFRSATVAVVGDGFIAQGITFENA  347

Query  497   AGPGAHQAVALTVASDHSVFYRCSISGYQDTLYALSLRQFYRECDISGTVDFIFGNAAAV  318
             AGP  HQAVA    SD S FY+CS  GYQDTLY  SLRQFYRECDI GTVDFIFGNAA V
Sbjct  348   AGPSKHQAVAFRSGSDFSAFYKCSFVGYQDTLYVHSLRQFYRECDIYGTVDFIFGNAAVV  407

Query  317   FQACNLVLRRPSS--YNVILANGRSDPGQNTGFSVQKCKITPGPDFSPVKNSYNSYLGRP  144
              Q CNL  R+P+    N+  A GR DP QNTG S+  CK+    D  PVK+++ +YLGRP
Sbjct  408   LQNCNLYARKPNENQKNMFTAQGREDPNQNTGISILNCKVAAASDLVPVKSTFKTYLGRP  467

Query  143   WKPYSRAVVMESDIDGAISARGWIEWPGTSSSSVRELYFGEYANVG  6
             WK YSR V M+S ID  +   GW+EW GT + S   LY+GEY N G
Sbjct  468   WKEYSRTVYMKSYIDDLVQPAGWLEWNGTFALST--LYYGEYLNRG  511



>ref|XP_006367330.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 46-like 
[Solanum tuberosum]
Length=582

 Score =   318 bits (815),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 188/467 (40%), Positives = 274/467 (59%), Gaps = 19/467 (4%)
 Frame = -2

Query  1367  CGYTRFPRLCVQTLSGLVS-GERVDFAAALLLNKTIAHADLHIAHFDQLSSHFVSSQPPQ  1191
             C  T +P  C+ +LS   + G  +       ++  +A  +L  A  + L S    +    
Sbjct  75    CNLTLYPDSCISSLSPYAAKGNALKPQDIYKMSVLVALNELSGASDNFLKSDTFKNINDP  134

Query  1190  PRLQAIGYCEELMGMARQRLNEALVAMKESPGKNRQEDIQTWLSAAVTFQQACKDWADQY  1011
                +AI  C EL+ +A   LN+ L ++ E+   +  +D++TWLS+A T+QQ C D  +  
Sbjct  135   AAAKAIQSCHELLSLAFDHLNDTL-SVAETSLLDAFDDLKTWLSSAGTYQQTCIDSFENV  193

Query  1010  AFSDELFARISRSMDYQSQLASNALALV----NRNTEISAAGRQLSEEdidddddggffp  843
               +  +     ++++  ++  SN+LAL+    N  T + A G++       DDDD  +  
Sbjct  194   TSNSAIRKAAGQNLNNSTRYTSNSLALISSLENSITSLGAIGKRRRLMGYGDDDDDEYPS  253

Query  842   DWVSGRDLRLLETTTD-KTKANVVVAKDGTGNFRTVAEAIGAA--SGRQRFVIYVKSGVY  672
                S  D +LL+ +++ K K NVVVAKDG+G ++++  A+ AA    ++RFVIYVK GVY
Sbjct  254   WLSSSNDRKLLQKSSETKIKVNVVVAKDGSGKYKSIKAALKAAPEKSKKRFVIYVKKGVY  313

Query  671   KEKIRSSKD--GITLIGDGKYSTIITWDDSVGGGSSLTGSATFGITGDGFIAKDIGFQNT  498
             KE +R  K    I +IGDGK +TI++ + +   G+    SATF + G GF+A+DIGF NT
Sbjct  314   KENVRVEKTKWNIMIIGDGKDATIVSGNRNFIDGTPTFQSATFAVFGKGFVARDIGFVNT  373

Query  497   AGPGAHQAVALTVASDHSVFYRCSISGYQDTLYALSLRQFYRECDISGTVDFIFGNAAAV  318
             AG   HQAVAL   +D SVFYRC +  +QDTLYA S RQFY+ECDI GTVDFIFGN+A V
Sbjct  374   AGAAKHQAVALMSTADESVFYRCRMDAFQDTLYAHSNRQFYKECDIYGTVDFIFGNSAVV  433

Query  317   FQACNLVLRRPSS--YNVILANGRSDPGQNTGFSVQKCKITPGPDFSPVKNSYNSYLGRP  144
              Q CN++ R P S   N I A G+ DP QNTG S+Q C + P  + + +    N++LGRP
Sbjct  434   LQNCNILPRIPMSGQQNTITAQGKVDPNQNTGISIQNCSVMPWGNLTGI----NTFLGRP  489

Query  143   WKPYSRAVVMESDIDGAISARGWIEWPGTSSSSVRELYFGEYANVGA  3
             WK YS  V MES++ G I   GW+ W GT++ S   +++ EY N GA
Sbjct  490   WKNYSTTVFMESNLGGFIHPNGWMPWVGTTAPST--IFYAEYNNTGA  534



>ref|XP_007160398.1| hypothetical protein PHAVU_002G318500g [Phaseolus vulgaris]
 gb|ESW32392.1| hypothetical protein PHAVU_002G318500g [Phaseolus vulgaris]
Length=517

 Score =   316 bits (810),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 187/473 (40%), Positives = 270/473 (57%), Gaps = 42/473 (9%)
 Frame = -2

Query  1376  RIQCGYTRFPRLC---VQTLSGLVSGERVDFAAALLLNKTIAHADLHIAHFDQLSSHFVS  1206
             ++ C  T +PRLC   V T     S    D    + LN+ +    L +++ D      ++
Sbjct  25    QLSCNETPYPRLCKHYVDTTMDASSSSFHDMTLKVSLNQAMEVYKL-VSNMD------LN  77

Query  1205  SQPPQPRLQAIGYCEELMGMARQRLNEALVAMKESPGKNRQEDIQTWLSAAVTFQQACKD  1026
             +   +    A   C EL         + L  +K S   N   D  TW SA++   Q C++
Sbjct  78    NFKDKRSKSAWEDCLEL-------YEDTLYQLKRSLNSNNLNDRLTWQSASIANHQTCQN  130

Query  1025  WADQYAFSDELFARISRSMDYQSQLASN-----ALALVNRNTEISAAGRQLSEEdidddd  861
                ++     L    S   ++   L+++     A++L + ++     GR+L  +      
Sbjct  131   GFTEFNLPSHLNHFPSMLTNFSKLLSNSLSLSKAMSLASLSSTKQNGGRRLLSDGFPS--  188

Query  860   dggffpDWVSGRDLRLLETTTDKTKANVVVAKDGTGNFRTVAEAIGAAS---GRQRFVIY  690
                    W+S  D +LL+ T   +KA+VVVA+DG+GN++T++E + AAS   G+ R V++
Sbjct  189   -------WMSHSDRKLLQETA--SKADVVVAQDGSGNYKTISEGVAAASKLSGKGRVVVH  239

Query  689   VKSGVYKEKI--RSSKDGITLIGDGKYSTIITWDDSVGGGSSLTGSATFGITGDGFIAKD  516
             VK+GVYKE I  + +   + +IGDG  +TI+T  ++   GS+   SATF ++GD FIA+D
Sbjct  240   VKAGVYKESIDIKRTVKNLMIIGDGMGATIVTGSNNAQDGSTTFRSATFAVSGDNFIARD  299

Query  515   IGFQNTAGPGAHQAVALTVASDHSVFYRCSISGYQDTLYALSLRQFYRECDISGTVDFIF  336
             I F+NTAGP  HQAVAL   +DHSVFYRCS  GYQDTLY  + RQFYR+CDI GTVDFIF
Sbjct  300   ITFENTAGPQKHQAVALRSGADHSVFYRCSFKGYQDTLYVYANRQFYRDCDIYGTVDFIF  359

Query  335   GNAAAVFQACNLVLRRPSS--YNVILANGRSDPGQNTGFSVQKCKITPGPDFSPVKNSYN  162
             G+A +V Q CN+ +R+P S   N + A GR+DP +NTG  +  C IT   D   V+ S+ 
Sbjct  360   GDAVSVLQNCNIYVRKPMSNQQNSVTAQGRTDPNENTGIIIHNCVITAAGDLKAVQGSFR  419

Query  161   SYLGRPWKPYSRAVVMESDIDGAISARGWIEWPGTSSSSVRELYFGEYANVGA  3
             +YLGRPW+ YSR VVM+S +DG I+  GW EW G  + S   LY+GEYAN GA
Sbjct  420   TYLGRPWQKYSRTVVMKSALDGLINPAGWSEWSGNFALST--LYYGEYANTGA  470



>ref|XP_006467993.1| PREDICTED: pectinesterase/pectinesterase inhibitor-like [Citrus 
sinensis]
Length=556

 Score =   317 bits (813),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 184/419 (44%), Positives = 245/419 (58%), Gaps = 33/419 (8%)
 Frame = -2

Query  1220  SHFVSSQPPQPRLQA-IGYCEELMGMARQRLNEALVAMKESPGKNRQEDIQTWLSAAVTF  1044
             ++ V  +   PR QA +  C EL+ ++  R+ +++ A+K+    +  ED   WLS  +T 
Sbjct  108   ANHVKHRINSPRGQAALTDCVELLELSVDRITDSMAALKKRR-TSSNEDAHAWLSGVLTN  166

Query  1043  QQACKDWADQYAFS------DELFARISRSMDYQSQLASNALALVNRNTEISAAGRQLSE  882
                C D  D  A         EL AR           A+N+LA++     IS     + +
Sbjct  167   HVTCLDGLDGSATKLMEPRLVELMAR-----------AANSLAIL---VAISPYNTNVIQ  212

Query  881   EdidddddggffpDWVSGRDLRLLE-TTTDKTKANVVVAKDGTGNFRTVAEAIGAA--SG  711
             +     +       WV+ RD  LL  +  +  KANVVVAKDG+GN++TV EA+ +A  + 
Sbjct  213   QYYLRKEIQFPS--WVTSRDRLLLRPSQAEAAKANVVVAKDGSGNYKTVKEAVASAPDNS  270

Query  710   RQRFVIYVKSGVYKEKIR--SSKDGITLIGDGKYSTIITWDDSVGGGSSLTGSATFGITG  537
             + R+VIYVK G YKE +     K  + ++GDG   TIIT   +V  GS+   SAT  + G
Sbjct  271   KTRYVIYVKKGTYKENVEVGKKKKNLMIVGDGMDLTIITGSLNVVDGSTTFKSATIAVGG  330

Query  536   DGFIAKDIGFQNTAGPGAHQAVALTVASDHSVFYRCSISGYQDTLYALSLRQFYRECDIS  357
             DGFIA+D+  QNTAGP  HQAVAL V++D SV  RC I  YQDTLYA + RQFYR+CDI+
Sbjct  331   DGFIAQDLWIQNTAGPEKHQAVALRVSADQSVINRCRIDAYQDTLYAHTNRQFYRDCDIT  390

Query  356   GTVDFIFGNAAAVFQACNLVLRRPSSY--NVILANGRSDPGQNTGFSVQKCKITPGPDFS  183
             GTVDFIFGNAA V Q C +  R+P S   N++ A GR+DP QNTG S+QKC++    D  
Sbjct  391   GTVDFIFGNAAVVLQNCKIAARKPMSKQSNMVTAQGRTDPNQNTGTSIQKCEVIASSDLE  450

Query  182   PVKNSYNSYLGRPWKPYSRAVVMESDIDGAISARGWIEWPGTSSSSVRELYFGEYANVG  6
             PVK S  SYLGRPWK YSR VVM+S I   I   GW EW G    +++ LY+GEY N G
Sbjct  451   PVKGSIRSYLGRPWKEYSRTVVMQSHIGDHIDPAGWSEWSG--DFALKTLYYGEYLNRG  507



>gb|AFW03475.1| pectin methylesterase 1 [Gossypium barbadense]
Length=582

 Score =   318 bits (815),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 184/478 (38%), Positives = 269/478 (56%), Gaps = 27/478 (6%)
 Frame = -2

Query  1379  IRIQCGYTRFPRLCVQTLSGLVSGERVDFAAALLLNKTIAHADLHIA------HFDQLSS  1218
             ++  C  T +P LC   ++ + +G     A  +   K +    L+I       ++ ++  
Sbjct  65    VKSACSGTFYPDLCFSAVTTVPAGT----AKKVRSQKDVIELSLNITTTAVEHNYFKIKK  120

Query  1217  HFVSSQPPQPRLQAIGYCEELMGMARQRLNEALVAMKESPGKN----RQEDIQTWLSAAV  1050
                          A+  C E +      L+EA+  + E P K       +D++T +SAA+
Sbjct  121   LLARKDLTTREKTALHDCLETIDETLDELHEAVEDLHEYPNKKSLTQHADDLKTLMSAAM  180

Query  1049  TFQQACKDWADQYAFSDELFARISRSMDYQSQLASNALALVNRNTEISAAGRQL---SEE  879
             T Q+ C D         ++   +     Y  ++ SNALA++   T+   A   +   S  
Sbjct  181   TNQETCLDGFSHEGADKKIREVLIDGEKYVEKMCSNALAMIKNMTDTDIANEMMLKSSNR  240

Query  878   didddddggffpDWVSGRDLRLLETTTDKTKANVVVAKDGTGNFRTVAEAIGAASGR--Q  705
              + +D+ G  +P+W+S  D RLL++++     NVVVA DG+GNF+TV+EA+  A  +  +
Sbjct  241   KLKEDESGIAWPEWLSAGDRRLLQSSS--VTPNVVVAADGSGNFKTVSEAVAKAPEKSSK  298

Query  704   RFVIYVKSGVYKEKIR--SSKDGITLIGDGKYSTIITWDDSVGGGSSLTGSATFGITGDG  531
             R++I +K+GVY+E +     K  I  IGDG+  TIIT   +V  GS+   SAT  + G+ 
Sbjct  299   RYIIRIKAGVYRENVEVPKKKSNIMFIGDGRTKTIITGSRNVVDGSTTFHSATVAVVGEK  358

Query  530   FIAKDIGFQNTAGPGAHQAVALTVASDHSVFYRCSISGYQDTLYALSLRQFYRECDISGT  351
             F+A+DI FQNTAGP  HQAVAL V SD S FY C +  YQDTLY  S RQFY  C ++GT
Sbjct  359   FLARDITFQNTAGPSKHQAVALRVGSDLSAFYNCDMLAYQDTLYVHSNRQFYVNCLVAGT  418

Query  350   VDFIFGNAAAVFQACNLVLRRPSS--YNVILANGRSDPGQNTGFSVQKCKITPGPDFSPV  177
             VDFIF NAAAVFQ C++  R+P+S   N++ A GR+DP QNTG  +QKC+I    D  PV
Sbjct  419   VDFIFENAAAVFQNCDIHARKPNSGQKNMVTAQGRTDPNQNTGIVIQKCRIGATSDLQPV  478

Query  176   KNSYNSYLGRPWKPYSRAVVMESDIDGAISARGWIEWPGTSSSSVRELYFGEYANVGA  3
             + ++ +YLGRPWK YSR VVM+S I   I   GW EW G  S +++ L++ EY N GA
Sbjct  479   RKNFPTYLGRPWKEYSRTVVMQSTISDVIQPAGWHEWSG--SFALKTLFYAEYQNTGA  534



>ref|XP_006449081.1| hypothetical protein CICLE_v10014787mg [Citrus clementina]
 gb|ESR62321.1| hypothetical protein CICLE_v10014787mg [Citrus clementina]
Length=556

 Score =   317 bits (812),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 189/440 (43%), Positives = 256/440 (58%), Gaps = 38/440 (9%)
 Frame = -2

Query  1283  LLLNKTIAHADLHIAHFDQLSSHFVSSQPPQPRLQA-IGYCEELMGMARQRLNEALVAMK  1107
             + LNK+ ++    I    ++++H V  +   PR QA +  C EL+ ++  R+ +++ A+K
Sbjct  92    IFLNKSTSY----IQETIEVANH-VKHRINSPRGQAALTDCVELLELSVDRITDSMAALK  146

Query  1106  ESPGKNRQEDIQTWLSAAVTFQQACKDWADQYAFS------DELFARISRSMDYQSQLAS  945
             +    +  ED   WLS  +T    C D  D  A         EL AR           A+
Sbjct  147   KRR-TSSNEDAHAWLSGVLTNHVTCLDGLDGSATKLMEPRLVELMAR-----------AA  194

Query  944   NALALVNRNTEISAAGRQLSEEdidddddggffpDWVSGRDLRLLE-TTTDKTKANVVVA  768
             N+LA++     IS     + ++     +       WV+ RD  LL  +  +  KANVVVA
Sbjct  195   NSLAIL---VAISPYNTNVIQQYYLRKEIQFPS--WVTSRDRLLLRPSQAEAAKANVVVA  249

Query  767   KDGTGNFRTVAEAIGAA--SGRQRFVIYVKSGVYKEKIR--SSKDGITLIGDGKYSTIIT  600
             KDG+GN++TV EA+ +A  + + R+VIYVK G YKE +     K  + ++GDG   TIIT
Sbjct  250   KDGSGNYKTVKEAVASAPDNSKTRYVIYVKKGTYKENVEVGKKKKNLMIVGDGMDLTIIT  309

Query  599   WDDSVGGGSSLTGSATFGITGDGFIAKDIGFQNTAGPGAHQAVALTVASDHSVFYRCSIS  420
                +V  GS+   SAT  + GDGFIA+D+  QNTAGP  HQAVAL V++D SV  RC I 
Sbjct  310   GSLNVVDGSTTFKSATIAVGGDGFIAQDLWIQNTAGPEKHQAVALRVSADQSVINRCRID  369

Query  419   GYQDTLYALSLRQFYRECDISGTVDFIFGNAAAVFQACNLVLRRPSSY--NVILANGRSD  246
              YQDTLYA + RQFYR+C I+GTVDFIFGNAA V Q C +  R+P S   N++ A GR+D
Sbjct  370   AYQDTLYAHTNRQFYRDCYITGTVDFIFGNAAVVLQNCKIAARKPMSKQSNMVTAQGRTD  429

Query  245   PGQNTGFSVQKCKITPGPDFSPVKNSYNSYLGRPWKPYSRAVVMESDIDGAISARGWIEW  66
             P QNTG S+QKC++    D  PVK S  SYLGRPWK YSR VVM+S I G I   GW EW
Sbjct  430   PNQNTGTSIQKCEVIASSDLEPVKGSIRSYLGRPWKEYSRTVVMQSHIGGHIDPAGWSEW  489

Query  65    PGTSSSSVRELYFGEYANVG  6
              G    +++ LY+GEY N G
Sbjct  490   SG--DFALKTLYYGEYLNRG  507



>gb|AFW03480.1| pectin methylesterase 1 [Gossypium hirsutum]
Length=582

 Score =   318 bits (814),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 185/477 (39%), Positives = 267/477 (56%), Gaps = 25/477 (5%)
 Frame = -2

Query  1379  IRIQCGYTRFPRLCVQTLSGLVSGERVDFAA-----ALLLNKTIAHADLHIAHFDQLSSH  1215
             ++  C  T +P LC   ++ + +G      +      L LN T    + +     +L   
Sbjct  65    VKSACSGTFYPDLCFSAVTAVPAGTAKKVRSQKDVIELSLNTTTTAVEHNYFKIKKL---  121

Query  1214  FVSSQPPQPRLQAIGYCEELMGMARQRLNEALVAMKESPGKN----RQEDIQTWLSAAVT  1047
                         A+  C E +      L+EA+  + E P K       +D++T +SAA+T
Sbjct  122   LARKDLTTREKTALHDCLETIDETLDELHEAVEDLHEYPNKKSLTQHADDLKTLMSAAMT  181

Query  1046  FQQACKDWADQYAFSDELFARISRSMDYQSQLASNALALVNRNTEISAAGRQL---SEEd  876
              Q+ C D         ++   +     Y  ++ SNALA++   T+   A   +   S   
Sbjct  182   NQETCLDGFSHEGADKKIREVLIDGEKYVEKMCSNALAMIKNMTDTDIANEMMLKSSNRK  241

Query  875   idddddggffpDWVSGRDLRLLETTTDKTKANVVVAKDGTGNFRTVAEAIGAASGR--QR  702
             + +D+ G  +P+W+S  D RLL++++     NVVVA DG+GNF+TV+EA+  A  +  +R
Sbjct  242   LKEDESGIAWPEWLSAGDRRLLQSSS--VTPNVVVAADGSGNFKTVSEAVAKAPEKSSKR  299

Query  701   FVIYVKSGVYKEKIR--SSKDGITLIGDGKYSTIITWDDSVGGGSSLTGSATFGITGDGF  528
             + I +K+GVY+E +     K  I  IGDG+  TIIT   +V  GS+   SAT  + G+ F
Sbjct  300   YTIRIKAGVYRENVEVPKKKSSIMFIGDGRTKTIITGSRNVVDGSTTFHSATVAVVGEKF  359

Query  527   IAKDIGFQNTAGPGAHQAVALTVASDHSVFYRCSISGYQDTLYALSLRQFYRECDISGTV  348
             +A++I FQNTAGP  HQAVAL V SD S FY C +  YQDTLY  S RQFY  C ++GTV
Sbjct  360   LAREITFQNTAGPSKHQAVALRVGSDLSAFYNCDMLAYQDTLYVHSNRQFYVNCLVAGTV  419

Query  347   DFIFGNAAAVFQACNLVLRRPSS--YNVILANGRSDPGQNTGFSVQKCKITPGPDFSPVK  174
             DFIFGNAAAVFQ C++  R+P+S   N++ A GR+DP QNTG  +QKC+I    D  PV+
Sbjct  420   DFIFGNAAAVFQNCDIHARKPNSGQKNMVTAQGRTDPNQNTGIVIQKCRIGATSDLQPVR  479

Query  173   NSYNSYLGRPWKPYSRAVVMESDIDGAISARGWIEWPGTSSSSVRELYFGEYANVGA  3
              ++ +YLGRPWK YSR VVM+S I   I   GW EW G  S +++ L++ EY N GA
Sbjct  480   KNFPTYLGRPWKEYSRTVVMQSTISDVIQPAGWHEWSG--SFALKTLFYAEYQNTGA  534



>ref|XP_011034009.1| PREDICTED: pectinesterase 2 [Populus euphratica]
Length=514

 Score =   316 bits (809),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 192/468 (41%), Positives = 271/468 (58%), Gaps = 36/468 (8%)
 Frame = -2

Query  1385  DQIRIQCGYTRFPRLCVQTLSGLVSGERVDFAAALLLNKTIAHADLHIAHFDQLSSHFVS  1206
             D+++  C  T  P+ C   LS       +   +  L  K      L  A  D+++++ + 
Sbjct  26    DEVKSWCSKTPNPQPCEYFLSHNPKNTPIQHESDFL--KISIELALDRAMHDKVNTYSLG  83

Query  1205  SQPPQPRLQAIGY--CEELMGMARQRLNEALVAMKESPGKNRQEDIQTWLSAAVTFQQAC  1032
             S+  +  L+   +  C EL       LN      K +  K  + D QTWLS A+T    C
Sbjct  84    SKC-RNGLEKAAWEDCLELYQEIVLWLN------KTTGSKCTKYDAQTWLSTALTNLATC  136

Query  1031  KDWADQYAFSDELFARISRSMDYQSQLASNALALVNRNTEISAAGRQLSEEdidddddgg  852
             +    ++  +D +   +S ++   S+L SN LA +N+     A  R+ S          G
Sbjct  137   RTGFAEFGMTDYILPLMSNNV---SKLISNTLA-INK-----APYREPS--------FNG  179

Query  851   ffpDWVSGRDLRLLETTTDKTKANVVVAKDGTGNFRTVAEAIGAASGRQ---RFVIYVKS  681
              FP WV   D +LL++++  ++AN+VVA+DG+GN +T+ EAI AAS R    R+VIYVK+
Sbjct  180   GFPSWVRPGDRKLLQSSSPASQANIVVAQDGSGNVKTIKEAIDAASKRSGSGRYVIYVKA  239

Query  680   GVYKEKIRSSKD--GITLIGDGKYSTIITWDDSVGGGSSLTGSATFGITGDGFIAKDIGF  507
             G Y E +  ++    + ++GDG   TI+T   SVGGG++   SATF + GD FIA+D+ F
Sbjct  240   GTYNENVEIARKVKNVMVVGDGIGKTIVTGSKSVGGGTTTFKSATFAVVGDNFIARDMTF  299

Query  506   QNTAGPGAHQAVALTVASDHSVFYRCSISGYQDTLYALSLRQFYRECDISGTVDFIFGNA  327
             +NTAG   HQAVAL   SD SVFY+CS  GYQDTLY  S RQFYRECDI GTVDFIFGNA
Sbjct  300   RNTAGAKNHQAVALRSGSDLSVFYKCSFEGYQDTLYVHSQRQFYRECDIYGTVDFIFGNA  359

Query  326   AAVFQACNLVLRR-PSSYNVILANGRSDPGQNTGFSVQKCKITPGPDFSPVKNSYNSYLG  150
             A VFQ CN+  R  P+  N + A GR+DP QNTG S+  CK+T   D   V++S  +YLG
Sbjct  360   AVVFQNCNIYARNPPNKTNTVTAQGRTDPNQNTGISIHNCKVTAASDLKSVQSSVKTYLG  419

Query  149   RPWKPYSRAVVMESDIDGAISARGWIEWPGTSSSSVRELYFGEYANVG  6
             RPW+ YSR V M++ +D  I++ GW+ W G  + ++  LY+GEY N G
Sbjct  420   RPWQKYSRTVFMKTYLDSLINSAGWMPWSG--NFALDTLYYGEYMNTG  465



>ref|XP_006348082.1| PREDICTED: pectinesterase/pectinesterase inhibitor 18-like [Solanum 
tuberosum]
Length=486

 Score =   315 bits (806),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 187/449 (42%), Positives = 252/449 (56%), Gaps = 30/449 (7%)
 Frame = -2

Query  1313  SGERVDFAAALLLNKTIAHADLHIAHFDQLSSHFVSSQPPQPRLQAIGYCEELMGMARQR  1134
             +G  +D     LL   +  + L I     L+S+            A+  C ELM ++R R
Sbjct  8     AGVVMDTKTVDLLQMVLHKSSLKIHETIHLASNVNGRINNGQEQAALADCLELMDLSRDR  67

Query  1133  LNEALVAMKESPGKNRQEDIQTWLSAAVTFQQACKDWADQYAFS------DELFARISRS  972
             L ++++ +     +    D+ +WLS+ +T    C D  +  A S      ++L AR    
Sbjct  68    LMDSMMGLGNLSAQ-AHFDVHSWLSSILTNHVTCIDGLNGQARSIMEPMLNDLIAR----  122

Query  971   MDYQSQLASNALALVNRNTEISAAGRQLSEEdidddddggffpDWVSGRDLRLLETTTDK  792
                    A  +LAL+       A  +  +  +          P WVS  D +LL+ + + 
Sbjct  123   -------ARTSLALM----VAIAPPKSTNNNNNLPPTVSDGLPSWVSANDRKLLQLSANA  171

Query  791   TKANVVVAKDGTGNFRTVAEAIGAA--SGRQRFVIYVKSGVYKEKIR--SSKDGITLIGD  624
               ANVVVAKDG+G ++TV EA+ +A  +G+ RFVIYVK G YKE +     K  I L+GD
Sbjct  172   IAANVVVAKDGSGKYKTVKEAVASAPDNGKTRFVIYVKKGTYKENVEIGKKKKNIMLMGD  231

Query  623   GKYSTIITWDDSVGGGSSLTGSATFGITGDGFIAKDIGFQNTAGPGAHQAVALTVASDHS  444
             G  +TIIT + +V  GS+   SAT    GDGFIA+D+ FQNTAGP  HQAVAL V +D S
Sbjct  232   GMDATIITGNLNVIDGSTTFKSATVAAVGDGFIAQDLQFQNTAGPQKHQAVALRVGADQS  291

Query  443   VFYRCSISGYQDTLYALSLRQFYRECDISGTVDFIFGNAAAVFQACNLVLRRPSS--YNV  270
             V  RC I  ++DTLY  +LRQFYR+C I+GTVDFIFGNAA VFQ   L  R+P S   N+
Sbjct  292   VINRCKIDAFRDTLYTHTLRQFYRDCYITGTVDFIFGNAAVVFQNSKLAARKPMSGQKNM  351

Query  269   ILANGRSDPGQNTGFSVQKCKITPGPDFSPVKNSYNSYLGRPWKPYSRAVVMESDIDGAI  90
             + A GR DP Q TG S+Q C+I P  D +PVK S  +YLGRPWK YSR V M+S+I   I
Sbjct  352   VTAQGREDPNQVTGTSIQNCEIIPSSDLAPVKGSVKTYLGRPWKAYSRTVYMQSNIGDHI  411

Query  89    SARGWIEWPGTSSSSVRELYFGEYANVGA  3
                GW EW G    +++ LY+GEY N GA
Sbjct  412   DPAGWSEWDG--DFALKTLYYGEYMNKGA  438



>ref|XP_004136014.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 40-like 
[Cucumis sativus]
Length=561

 Score =   317 bits (812),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 199/470 (42%), Positives = 263/470 (56%), Gaps = 22/470 (5%)
 Frame = -2

Query  1376  RIQCGYTRFPRLCVQTLSGL-----VSGERVDFAAALLLNKTIAHADLHIAHFDQLSSHF  1212
             R  C  T FP LC   LS       +S E++   A   LN T     L   +   L +H 
Sbjct  49    RSLCNGTLFPDLCFSKLSSFPQLASLSPEKL---AGSALNFTSREVLLAYTNCTNLKTHL  105

Query  1211  VSSQPPQPRLQAIGYCEELMGMARQRLNEAL--VAMKESPGKNRQEDIQTWLSAAVTFQQ  1038
              S   P  R  A+  C EL+  +   L  ++  +A  +SP  +   D+ T +SAA+T  +
Sbjct  106   YSGLNPTDR-HALDDCLELLDGSIAELKASIFDLAPSQSPALH-SHDLLTLVSAAMTNHR  163

Query  1037  ACKDWADQYAFSDELFARISRSMDYQSQLASNALALVNRNTEISAAGRQLSEEdiddddd  858
              C D    Y  S  + +R+   +    Q  S  LA++ +   ++ A     E   +    
Sbjct  164   TCVD--GFYNSSGTVRSRVELYLGKIGQHLSIDLAMLKKIPGVNRATGVDQEMLPEYGAV  221

Query  857   ggffpDWVSGRDLRLLETTTDKTKANVVVAKDGTGNFRTVAEAIGAA--SGRQRFVIYVK  684
              G FP WVS +D RLL+   ++TK N+VVAKDG+GNF TV+EA+ AA  +   RFVIY+K
Sbjct  222   KGGFPKWVSVKDRRLLQAAVNETKFNMVVAKDGSGNFTTVSEAVAAAPNASTTRFVIYIK  281

Query  683   SGVYKEKIR--SSKDGITLIGDGKYSTIITWDDSVGGGSSLTGSATFGITGDGFIAKDIG  510
             +G Y E +    +K  +  +GDG   T+I  D +V  G +   SAT  + G GFIAK I 
Sbjct  282   AGAYFENVEIGRAKSNLMFVGDGIGKTLIKADRNVVDGWTTFRSATVAVVGTGFIAKGIT  341

Query  509   FQNTAGPGAHQAVALTVASDHSVFYRCSISGYQDTLYALSLRQFYRECDISGTVDFIFGN  330
             F+N AGP  HQAVAL   SD S FY+CS  GYQDTLY  SLRQFYR+CD+ GT+DFIFGN
Sbjct  342   FENYAGPSKHQAVALRSNSDFSAFYQCSFIGYQDTLYVHSLRQFYRDCDVYGTIDFIFGN  401

Query  329   AAAVFQACNLVLRRPSS--YNVILANGRSDPGQNTGFSVQKCKITPGPDFSPVKNSYNSY  156
             AA VFQ CNL  R+P+S   N+  A GR DP QNTG S+  CK+    D  PV +S+ +Y
Sbjct  402   AAVVFQNCNLYARKPNSNQRNIFTAQGREDPNQNTGISILNCKVEAASDLIPVLSSFRTY  461

Query  155   LGRPWKPYSRAVVMESDIDGAISARGWIEWPGTSSSSVRELYFGEYANVG  6
             LGRPWK YSR V + S I   I   GW+EW GT   ++  LY+GEY N G
Sbjct  462   LGRPWKLYSRTVFLRSFIGQLIEPVGWLEWNGT--FALDTLYYGEYLNRG  509



>gb|KHN26433.1| Putative pectinesterase/pectinesterase inhibitor 24 [Glycine 
soja]
Length=560

 Score =   317 bits (812),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 183/473 (39%), Positives = 270/473 (57%), Gaps = 30/473 (6%)
 Frame = -2

Query  1379  IRIQCGYTRFPRLCVQTLSGLVSGERVDFAAALLLNKTIAHADLHIAHFDQLSSHFVSSQ  1200
             +R  C  T +   C  +L  +V   +V      +L+  +A +++  A  +  S H +   
Sbjct  55    LRAVCDVTLYKDSCYSSLGSVVDSRQVQPEELFILSMKLALSEVSKA-VEYFSDHHLDGV  113

Query  1199  PPQPRL------QAIGYCEELMGMARQRLNEALVAMKESPGKNRQEDIQTWLSAAVTFQQ  1038
                 +L      + +  C+EL+G+A   LN +L + ++S   +  ED++TWLSAA T+QQ
Sbjct  114   FKGLKLMDGRTKEGLKNCKELLGLAVDHLNSSLTSGEKSSVLDVFEDLKTWLSAAGTYQQ  173

Query  1037  ACKDWADQYAFSDELFARISRSMDY---QSQLASNALALVNRNTEISAAGRQLSEEdidd  867
              C +      F D   A  S  + Y    +Q  SN+LA++   T IS A   L+   +  
Sbjct  174   TCIE-----GFEDAKEAIKSSVVSYLRNSTQFTSNSLAII---TWISKAATTLNLRRLLS  225

Query  866   dddggffpDWVSGRDLRLLETTTDKTKANVVVAKDGTGNFRTVAEAIGAA--SGRQRFVI  693
                    P+W+  +D +LL T   + KA++VVAKDG+G ++ +++A+     +  +R VI
Sbjct  226   LPHQNEAPEWLHSKDRKLLLTEDLREKAHIVVAKDGSGKYKKISDALKHVPNNSNKRTVI  285

Query  692   YVKSGVYKEKIRSSKD--GITLIGDGKYSTIITWDDSVGGGSSLTGSATFGITGDGFIAK  519
             YVK GVY E +R  K    + +IGDG  STI++   +   G+    +ATF + G  FIA+
Sbjct  286   YVKRGVYYENVRVEKTKWNVMIIGDGMTSTIVSGSRNFVDGTPTFSTATFAVFGRNFIAR  345

Query  518   DIGFQNTAGPGAHQAVALTVASDHSVFYRCSISGYQDTLYALSLRQFYRECDISGTVDFI  339
             D+GF+NTAGP  HQAVAL  ++D +V+YRC I  YQDTLYA S RQFYREC+I GTVDFI
Sbjct  346   DMGFRNTAGPQKHQAVALMTSADQAVYYRCHIDAYQDTLYAHSNRQFYRECNIYGTVDFI  405

Query  338   FGNAAAVFQACNLVLRRP--SSYNVILANGRSDPGQNTGFSVQKCKITPGPDFSPVKNSY  165
             FGN+A V Q CN+  + P     N I A G++DP  NTG S+Q C I+P  + S V+   
Sbjct  406   FGNSAVVIQNCNIRPKLPMHGQQNTITAQGKTDPNMNTGISIQHCNISPFGNLSSVQ---  462

Query  164   NSYLGRPWKPYSRAVVMESDIDGAISARGWIEWPGTSSSSVRELYFGEYANVG  6
              +YLGRPWK YS  V M S +DG +S +GW+ W G S+     +++ E+ NVG
Sbjct  463   -TYLGRPWKNYSTTVYMRSRMDGFVSPKGWLPWTGNSAPDT--IFYAEFQNVG  512



>ref|XP_006445298.1| hypothetical protein CICLE_v10019773mg [Citrus clementina]
 gb|ESR58538.1| hypothetical protein CICLE_v10019773mg [Citrus clementina]
Length=510

 Score =   315 bits (808),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 174/390 (45%), Positives = 234/390 (60%), Gaps = 29/390 (7%)
 Frame = -2

Query  1166  CEELMGMARQRLNEALVAMKESPGKNRQEDIQTWLSAAVTFQQACKDWADQYAFSDELFA  987
             C EL  +   +LN+       SPG  +  D QTWLS+A+T  + C+   +     + +  
Sbjct  98    CRELYELTVLKLNQT---SNSSPGCTKV-DKQTWLSSALTNLETCRASLEDLGVPEYVLP  153

Query  986   RISRSMDYQSQLASNALALVNRNTEISAAGRQLSEEdidddddggffpDWVSGRDLRLLE  807
              +S ++   ++L SNAL+L              ++   ++      FP WV   D +LL+
Sbjct  154   LLSNNV---TKLISNALSL--------------NKVPYNEPSYKDGFPTWVKPGDRKLLQ  196

Query  806   TTTDKTKANVVVAKDGTGNFRTVAEAIGAAS--GRQRFVIYVKSGVYKEKIRSSKDGITL  633
             TT    +AN+VVA+DG+GN +T+ EA+ AAS  G  R+VIY+K+G Y E I      I  
Sbjct  197   TTP---RANIVVAQDGSGNVKTIQEAVAAASRAGGSRYVIYIKAGTYNENIEVKLKNIMF  253

Query  632   IGDGKYSTIITWDDSVGGGSSLTGSATFGITGDGFIAKDIGFQNTAGPGAHQAVALTVAS  453
             +GDG   TIIT   SVGGG++   SAT  + GD FIA+DI  +NTAGP  HQAVAL   S
Sbjct  254   VGDGIGKTIITGSKSVGGGATTFKSATVAVVGDNFIARDITIRNTAGPNNHQAVALRSGS  313

Query  452   DHSVFYRCSISGYQDTLYALSLRQFYRECDISGTVDFIFGNAAAVFQACNLVLRRPSS-Y  276
             D SVFYRCS  GYQDTLY  S RQFYRECDI GTVDFIFGNAA V Q CN+  R+P +  
Sbjct  314   DLSVFYRCSFEGYQDTLYVHSQRQFYRECDIYGTVDFIFGNAAVVLQNCNIFARKPPNRT  373

Query  275   NVILANGRSDPGQNTGFSVQKCKITPGPDFSPVKNSYNSYLGRPWKPYSRAVVMESDIDG  96
             N + A GR+DP QNTG  +  C++T   D  PV++S  ++LGRPWK YSR V +++ +D 
Sbjct  374   NTLTAQGRTDPNQNTGIIIHNCRVTAASDLKPVQSSVKTFLGRPWKQYSRTVYIKTFLDS  433

Query  95    AISARGWIEWPGTSSSSVRELYFGEYANVG  6
              I+  GW+EW G    ++  LY+ EY N G
Sbjct  434   LINPAGWMEWSG--DFALNTLYYAEYMNTG  461



>gb|AHB84678.1| pectin methylesterase [Citrus reticulata]
Length=569

 Score =   317 bits (812),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 198/508 (39%), Positives = 277/508 (55%), Gaps = 36/508 (7%)
 Frame = -2

Query  1460  IMLVLFFGCCVTTIaaaavsqvaaQDQIRIQ---------CGYTRFPRLCVQTLSGL--V  1314
             I L+LF    V+        +      +R+          C  T +P LCV TL  +  +
Sbjct  24    IFLLLFVLSAVSVTTLKKNPKTTDAPHLRVHKHFQVAHSACEGTLYPELCVSTLLSVPDL  83

Query  1313  SGERVDFAAALLLNKTIAHADLHIAHFDQLSSHFVSSQPPQPRLQAIGYCEELMGMARQR  1134
             + +RV    ++ +N+T++      ++   +   + +    + R  AI  C EL       
Sbjct  84    ASKRVPELISVTINRTLSELRASSSNCSSIGQSYPNFNTLEKR--AINDCLELFHDTIVE  141

Query  1133  LNEAL--VAMKESPGKNRQEDIQTWLSAAVTFQQACKDWADQYAFSDELFARISRSMDYQ  960
             L  AL  ++ K+SP K+   D+QT  S A+T Q  C    D +A+SD     + +S  Y 
Sbjct  142   LKSALNDLSPKKSPSKHYH-DLQTLFSGAMTNQYTC---LDGFAYSDGNVREVIKSSLYN  197

Query  959   -SQLASNALALVNRNTEISAAGRQLS---EEdidddddggffpDWVSGRDLRLLETTTDK  792
              S+  SN+L ++ +       G  +S   E   +       FP W+S  D +LL+ + + 
Sbjct  198   ISRHVSNSLVMLKK-----IPGDNMSSKYEVFPEYGRIKRGFPTWLSLNDRKLLQKSVNL  252

Query  791   TKANVVVAKDGTGNFRTVAEAIGAASGRQ--RFVIYVKSGVYKEKIRSSKDGITL--IGD  624
             TK +++VAKDG+GNF T+ EA+ AA  +   RFVIY+K+G Y E +   K    L  +GD
Sbjct  253   TKFDLIVAKDGSGNFTTITEAVEAAPNKSNTRFVIYIKAGAYFENVEVDKKKTMLMFVGD  312

Query  623   GKYSTIITWDDSVGGGSSLTGSATFGITGDGFIAKDIGFQNTAGPGAHQAVALTVASDHS  444
             G   T++  + SV  G +   SAT  + G GFIAK I  +N+AGP  HQAVAL   SD S
Sbjct  313   GIGKTLVKANRSVVDGWTTFRSATVAVVGTGFIAKGITVENSAGPSKHQAVALRSGSDLS  372

Query  443   VFYRCSISGYQDTLYALSLRQFYRECDISGTVDFIFGNAAAVFQACNLVLRRPSS--YNV  270
              FY+CS  GYQDTLY  SLRQFYRECD+ GTVDFIFGNAA VFQ CNL  R+P++   N+
Sbjct  373   AFYKCSFVGYQDTLYVHSLRQFYRECDVYGTVDFIFGNAAVVFQICNLYARKPNANQKNI  432

Query  269   ILANGRSDPGQNTGFSVQKCKITPGPDFSPVKNSYNSYLGRPWKPYSRAVVMESDIDGAI  90
             I A GR DP QNTG S+  CK+    D  P +  + +YLGRPWK YSR V M S +   I
Sbjct  433   ITAQGREDPNQNTGISILNCKVAAASDLIPYQTEFKTYLGRPWKEYSRTVFMLSYLGDLI  492

Query  89    SARGWIEWPGTSSSSVRELYFGEYANVG  6
             +  GW+EW GT + S   L++GEY N G
Sbjct  493   APAGWLEWNGTFALST--LFYGEYKNRG  518



>ref|XP_007141001.1| hypothetical protein PHAVU_008G158900g [Phaseolus vulgaris]
 gb|ESW12995.1| hypothetical protein PHAVU_008G158900g [Phaseolus vulgaris]
Length=609

 Score =   318 bits (815),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 195/481 (41%), Positives = 270/481 (56%), Gaps = 36/481 (7%)
 Frame = -2

Query  1367  CGYTRFPRLCVQTL---SGLVSGERVDFAAALLLNKTIAHADLHIAHFDQLSSHFVSSQP  1197
             C  TRFP LCV +L    G  +    D    +  N T+ H     A F      F +++P
Sbjct  87    CSKTRFPTLCVNSLLDFPGSTTASEQDLVH-ISFNMTLRHVSR--AFFASSGLSFAATEP  143

Query  1196  PQPRLQAIGYCEELMGMARQRLNEALVAMK-----------ESPGKNRQEDIQTWLSAAV  1050
                   A   C EL+  +   L+ +L ++             S      ED+ TWLSAA+
Sbjct  144   KV--RAAYEDCLELLEESMDSLSRSLDSILSPSAISNGGGLRSGSDGSTEDVITWLSAAL  201

Query  1049  TFQQACKDWADQYAFSDELFARISRSMDYQSQLASNALALVNRNTEISAAG------RQL  888
             T    C +  ++   S  +  ++  ++   S+L SN LA+ + +     +G      R+L
Sbjct  202   TNHDTCAEGFEES--SGSVKNQMVNNLKDLSELVSNCLAIFSGSGSGDFSGVPIQNKRRL  259

Query  887   SEEdidddddggffpDWVSGRDLRLLETTTDKTKANVVVAKDGTGNFRTVAEAIGAAS--  714
               E+ D+ +  G FP W++ RD RLL   T   +A++VV+K+G G  +T+AEAI  A   
Sbjct  260   MGEEDDEANISGKFPRWLNKRDRRLLNLATSAIQADIVVSKNGEGTVKTIAEAIKKAPEH  319

Query  713   GRQRFVIYVKSGVYKE---KIRSSKDGITLIGDGKYSTIITWDDSVGGGSSLTGSATFGI  543
               +RF+IYV++G Y+E   K+   K  +  IGDGK  T+IT   +V  G +   +A+F  
Sbjct  320   SSRRFIIYVRAGRYEENNLKVGRKKTNVMFIGDGKGKTVITGKRNVIDGMTTFHTASFAA  379

Query  542   TGDGFIAKDIGFQNTAGPGAHQAVALTVASDHSVFYRCSISGYQDTLYALSLRQFYRECD  363
             +G GFIA+DI F+N AGP  HQAVAL V +DH+V YRC+I GYQD+ Y  S RQF+RECD
Sbjct  380   SGAGFIARDITFENYAGPAKHQAVALRVGADHAVVYRCNIVGYQDSCYVHSNRQFFRECD  439

Query  362   ISGTVDFIFGNAAAVFQACNLVLRRPSSY--NVILANGRSDPGQNTGFSVQKCKITPGPD  189
             I GTVDFIFGNAA VFQ CN+  R+P +   N I A  R DP QNTG S+  C+I P PD
Sbjct  440   IYGTVDFIFGNAAVVFQKCNIYARKPMAQQKNTITAQNRKDPNQNTGISMHNCRIQPAPD  499

Query  188   FSPVKNSYNSYLGRPWKPYSRAVVMESDIDGAISARGWIEWPGTSSSSVRELYFGEYANV  9
               PVK S+ +YLGRPWK +SR V M S +   I +RGW+EW G    ++  LY+GEY N 
Sbjct  500   LVPVKGSFPTYLGRPWKQFSRTVFMLSYMGDHIHSRGWLEWNG--DFALDTLYYGEYMNY  557

Query  8     G  6
             G
Sbjct  558   G  558



>ref|XP_006826911.1| hypothetical protein AMTR_s00010p00161740 [Amborella trichopoda]
 gb|ERM94148.1| hypothetical protein AMTR_s00010p00161740 [Amborella trichopoda]
Length=515

 Score =   315 bits (808),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 185/397 (47%), Positives = 236/397 (59%), Gaps = 28/397 (7%)
 Frame = -2

Query  1166  CEELMGMARQRLNEALVAMKESPGKNRQEDIQTWLSAAVTFQQACKDWADQYAFSDELFA  987
             C EL      +LN+ LV+   +       D  TWLSAA+T    C+       FS+  + 
Sbjct  91    CLELTEDTVSKLNKTLVSSNLA-----SSDTLTWLSAAITNDDTCRT-----GFSETPWL  140

Query  986   RISRSMDYQSQLASNALALVNRNTEISAAGRQLSEEdidddddggffpDWVSGRDLRLLE  807
             +   S D  S+L SN+LA V ++      G                FP+WV   D RLL+
Sbjct  141   K---STDL-SKLLSNSLA-VEKSFAARLDGLSGHTNRKLLSVQSRGFPEWVVAGDRRLLQ  195

Query  806   TTTDKTKANVVVAKDGTGNFRTVAEAIGAASGRQ-----RFVIYVKSGVYKE--KIRSSK  648
              +T K  AN+VVAKDG+G F T++ AI A+  ++     RFVIYVK G YKE  +I+ S 
Sbjct  196   ASTGK--ANLVVAKDGSGGFATISAAITASEKQRKTSTSRFVIYVKEGTYKENIEIKKSM  253

Query  647   DGITLIGDGKYSTIITWDDSVGGGSSLTGSATFGITGDGFIAKDIGFQNTAGPGAHQAVA  468
               +  +GDG   TIIT   +V  GS+   SATF +  DGFIAKD+ F+NTAGP  HQAVA
Sbjct  254   KNLMFVGDGIDKTIITGSRNVQDGSTTFRSATFAVAADGFIAKDLTFENTAGPQKHQAVA  313

Query  467   LTVASDHSVFYRCSISGYQDTLYALSLRQFYRECDISGTVDFIFGNAAAVFQACNLVLRR  288
                 SD SV YRCS  GYQDTLY  S RQFYRECDI GTVDFIFGNAAAV Q CN+ +R+
Sbjct  314   FRSGSDLSVLYRCSFKGYQDTLYTYSQRQFYRECDIYGTVDFIFGNAAAVLQNCNIYVRK  373

Query  287   P--SSYNVILANGRSDPGQNTGFSVQKCKITPGPDFSPVKNSYNSYLGRPWKPYSRAVVM  114
             P  S  N I A GR+DP QNTG S+   K++   D   V+NS+ +YLGRPWK YSR V M
Sbjct  374   PMSSQKNTITAQGRTDPNQNTGLSIHDSKVSASSDLKAVQNSFKTYLGRPWKEYSRTVFM  433

Query  113   ESDIDGAISARGWIEWPGTSSSSVRELYFGEYANVGA  3
             ++ +D  I   GW++W G  + ++R LY+GEY N GA
Sbjct  434   KTALDNLIDPSGWLQWSG--NFALRTLYYGEYMNSGA  468



>ref|XP_007134831.1| hypothetical protein PHAVU_010G079900g [Phaseolus vulgaris]
 gb|ESW06825.1| hypothetical protein PHAVU_010G079900g [Phaseolus vulgaris]
Length=520

 Score =   315 bits (808),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 194/465 (42%), Positives = 260/465 (56%), Gaps = 34/465 (7%)
 Frame = -2

Query  1379  IRIQCGYTRFPRLCVQTLSGLVSGERVDFAAALLLNKTIAHADLHIAHFDQLSSHFVSSQ  1200
             I+  C  T +P+ C   L+     + +   +  L  +      L  A   QL++H +   
Sbjct  34    IQSWCNQTPYPQPCEYYLTSHTFNKPIKSKSDFL--QVSLQLALERAERGQLNTHSIG--  89

Query  1199  PPQPR----LQAIGYCEELMGMARQRLNEALVAMKESPGKNRQEDIQTWLSAAVTFQQAC  1032
              P+ R      A   C EL     QRLN+ L    +   K  Q D QTWLS A+T  + C
Sbjct  90    -PKCRNVHEKSAWTDCIELYDYTIQRLNKTL----DPYTKCTQTDTQTWLSTALTNLETC  144

Query  1031  KDWADQYAFSDELFARISRSMDYQSQLASNALALVNRNTEISAAGRQLSEEdidddddgg  852
             +    +    D +   +S ++   ++L SN L+L N+++          E          
Sbjct  145   RAGLYELGVQDYMLPLMSNNV---TKLLSNTLSL-NKDSNYPFKPPSSQE----------  190

Query  851   ffpDWVSGRDLRLLETTTDKTKANVVVAKDGTGNFRTVAEAIGAA--SGRQRFVIYVKSG  678
              +P WV   D +LL++++  ++ANVVVAKDG+G + TV  A+ AA  S   R+VIYVKSG
Sbjct  191   GYPTWVKPGDRKLLQSSSAASQANVVVAKDGSGKYTTVKAAVDAAPSSSSGRYVIYVKSG  250

Query  677   VYKEKIRSSKDGITLIGDGKYSTIITWDDSVGGGSSLTGSATFGITGDGFIAKDIGFQNT  498
             VY E++      I L+GDG   TIIT   SVGGGS+   SAT    GDGFIA+DI F+NT
Sbjct  251   VYNEQVEIKSKNIMLVGDGIGKTIITGSKSVGGGSTTFRSATVAAVGDGFIAQDITFRNT  310

Query  497   AGPGAHQAVALTVASDHSVFYRCSISGYQDTLYALSLRQFYRECDISGTVDFIFGNAAAV  318
             AG   HQAVA    SD SVFYRCS  GYQDTLY  S RQFYRECD+ GTVDFIFGNAA V
Sbjct  311   AGAANHQAVAFRSGSDLSVFYRCSFEGYQDTLYVHSERQFYRECDVYGTVDFIFGNAAVV  370

Query  317   FQACNLVLRRPSSYNV-ILANGRSDPGQNTGFSVQKCKITPGPDFSPVKNSYNSYLGRPW  141
              Q CN+  R P    + + A GR+DP QNTG  +   K+T    F+P  +S  SYLGRPW
Sbjct  371   LQNCNIYARTPPQRTITVTAQGRTDPNQNTGIIIHNSKVTGASGFNP--SSVKSYLGRPW  428

Query  140   KPYSRAVVMESDIDGAISARGWIEWPGTSSSSVRELYFGEYANVG  6
             + YSR V M++++D  I+  GW+EW G  + ++  LY+ EYAN G
Sbjct  429   QKYSRTVFMKTNLDSLINPAGWMEWDG--NFALDTLYYAEYANTG  471



>ref|XP_009769268.1| PREDICTED: pectinesterase-like [Nicotiana sylvestris]
Length=548

 Score =   316 bits (810),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 183/458 (40%), Positives = 250/458 (55%), Gaps = 37/458 (8%)
 Frame = -2

Query  1340  CVQTLSGLVSGERVDFAAALLLNKTIAHADLHIAHFDQLSSHFVSSQPPQPRLQAIGYCE  1161
             C+ T+S +     +D     LL   +  + L I     L S+            A+  C 
Sbjct  67    CLATVSEVAPAGLMDTTTVDLLQMVLHKSSLKIHETIDLVSNVNGRINNDNEQAALADCL  126

Query  1160  ELMGMARQRLNEALVAMKESPGKNRQEDIQTWLSAAVTFQQACKDWADQYAFS------D  999
             ELM ++R RL ++++A+     +    D+ TWLS+ +T    C D  +  A S       
Sbjct  127   ELMNLSRDRLMDSMMALGNLSAQ-AHFDVHTWLSSILTNHVTCMDGLNGQAQSIMKPMLK  185

Query  998   ELFARISRSMDYQSQLA-SNALALVNRNTEISAAGRQLSEEdidddddggffpDWVSGRD  822
             +L  R   S+    ++  SN + L +    + +                     WV+  D
Sbjct  186   DLIVRAKTSLALMVKMTPSNTMDLPSVTDGLPS---------------------WVTSND  224

Query  821   LRLLETTTDKTKANVVVAKDGTGNFRTVAEAIGAA--SGRQRFVIYVKSGVYKEKIR--S  654
              RLL+ + +  KANV+VAKDG+G ++TV EA+ +A  + + R+VIYVK G+YKE +    
Sbjct  225   RRLLQLSANAIKANVIVAKDGSGKYKTVKEAVASAPDNSKTRYVIYVKKGIYKENVEIGK  284

Query  653   SKDGITLIGDGKYSTIITWDDSVGGGSSLTGSATFGITGDGFIAKDIGFQNTAGPGAHQA  474
              K  + L+GDG  +TIIT   +V  GS+   SAT    GDGFIA+D+ FQNTAG   HQA
Sbjct  285   KKKNVMLVGDGMDATIITGSLNVVDGSTTFKSATVAAVGDGFIAQDLRFQNTAGAAKHQA  344

Query  473   VALTVASDHSVFYRCSISGYQDTLYALSLRQFYRECDISGTVDFIFGNAAAVFQACNLVL  294
             VAL V +D SV  RC I  +QDTLYA SLRQFYR+C I+GTVDFIFGNAA VFQ   +  
Sbjct  345   VALRVGADQSVINRCKIDAFQDTLYAHSLRQFYRDCYIAGTVDFIFGNAAVVFQNSKIAA  404

Query  293   RR--PSSYNVILANGRSDPGQNTGFSVQKCKITPGPDFSPVKNSYNSYLGRPWKPYSRAV  120
             R+  P   N++ A GR DP QNTG S+Q C I    D +PVK S  +YLGRPWK YSR V
Sbjct  405   RKPGPGQKNMVTAQGREDPNQNTGTSIQNCDIIATSDLAPVKGSVKTYLGRPWKAYSRTV  464

Query  119   VMESDIDGAISARGWIEWPGTSSSSVRELYFGEYANVG  6
              M+S+I   I   GW  W G    +++ LY+GEY N G
Sbjct  465   FMQSNIGDHIDPEGWSVWQG--DFALKTLYYGEYMNKG  500



>gb|KHG08631.1| Pectinesterase 3 [Gossypium arboreum]
Length=582

 Score =   317 bits (812),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 185/478 (39%), Positives = 268/478 (56%), Gaps = 27/478 (6%)
 Frame = -2

Query  1379  IRIQCGYTRFPRLCVQTLSGLVSGERVDFAAALLLNKTIAHADLHIA------HFDQLSS  1218
             ++  C  T +P LC   ++ + +G     A  +   K +    L+I       ++ ++  
Sbjct  65    VKSACSGTFYPDLCFSAVATVPAGT----AKKVRSQKDVIELSLNITTTAVEHNYFKIKK  120

Query  1217  HFVSSQPPQPRLQAIGYCEELMGMARQRLNEALVAMKESPGKN----RQEDIQTWLSAAV  1050
                          A+  C E +      L+EA+  + E P K       +D++T +SAA+
Sbjct  121   LLARKDLTTREKTALHDCLETIDETLDELHEAVEDLHEYPNKKSLTQHADDLKTLMSAAM  180

Query  1049  TFQQACKDWADQYAFSDELFARISRSMDYQSQLASNALALVNRNTEISAAGRQL---SEE  879
             T Q+ C D         ++   +     Y  ++ SNALA++   T+   A   +   S  
Sbjct  181   TNQETCLDGFSHEGADKKIREVLIDGEKYVEKMCSNALAMIKNMTDTDIANEMMLKSSNR  240

Query  878   didddddggffpDWVSGRDLRLLETTTDKTKANVVVAKDGTGNFRTVAEAIGAASGR--Q  705
              + +D+ G  +P+W+S  D RLL++++     NVVVA DG+GNF+TV+EA+  A  +  +
Sbjct  241   KLKEDESGIAWPEWLSAGDRRLLQSSS--VTPNVVVAADGSGNFKTVSEAVAKAPEKSSK  298

Query  704   RFVIYVKSGVYKEKIR--SSKDGITLIGDGKYSTIITWDDSVGGGSSLTGSATFGITGDG  531
             R++I +K+GVY E +     K  I  IGDG+  TIIT   +V  GS+   SAT    G+ 
Sbjct  299   RYIIRIKAGVYIENVEVPKKKSNIMFIGDGRTKTIITGSRNVVDGSTTFHSATVAAVGEK  358

Query  530   FIAKDIGFQNTAGPGAHQAVALTVASDHSVFYRCSISGYQDTLYALSLRQFYRECDISGT  351
             F+A+DI FQNTAGP  HQAVAL V SD S FY C +  YQDTLY  S RQFY  C ++GT
Sbjct  359   FLARDITFQNTAGPSKHQAVALRVGSDLSAFYNCDMLAYQDTLYVHSNRQFYVNCLVAGT  418

Query  350   VDFIFGNAAAVFQACNLVLRRPSS--YNVILANGRSDPGQNTGFSVQKCKITPGPDFSPV  177
             VDFIFGNAAAVFQ C++  R+P+S   N++ A GR+DP QNTG  +QKC+I    D  PV
Sbjct  419   VDFIFGNAAAVFQNCDIHARKPNSGQKNMVTAQGRTDPNQNTGIVIQKCRIGATSDLQPV  478

Query  176   KNSYNSYLGRPWKPYSRAVVMESDIDGAISARGWIEWPGTSSSSVRELYFGEYANVGA  3
             + ++ +YLGRPWK YSR VVM+S I   I   GW EW G  S +++ L++ EY N GA
Sbjct  479   RKNFPTYLGRPWKEYSRTVVMQSTISDVIQPAGWHEWSG--SFALKTLFYAEYQNTGA  534



>ref|XP_003526361.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 24-like 
[Glycine max]
Length=575

 Score =   317 bits (812),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 183/473 (39%), Positives = 270/473 (57%), Gaps = 30/473 (6%)
 Frame = -2

Query  1379  IRIQCGYTRFPRLCVQTLSGLVSGERVDFAAALLLNKTIAHADLHIAHFDQLSSHFVSSQ  1200
             +R  C  T +   C  +L  +V   +V      +L+  +A +++  A  +  S H +   
Sbjct  70    LRAVCDVTLYKDSCYSSLGSVVDSRQVQPEELFILSMKLALSEVSKA-VEYFSDHHLDGV  128

Query  1199  PPQPRL------QAIGYCEELMGMARQRLNEALVAMKESPGKNRQEDIQTWLSAAVTFQQ  1038
                 +L      + +  C+EL+G+A   LN +L + ++S   +  ED++TWLSAA T+QQ
Sbjct  129   FKGLKLMDGRTKEGLKNCKELLGLAVDHLNSSLTSGEKSSVLDVFEDLKTWLSAAGTYQQ  188

Query  1037  ACKDWADQYAFSDELFARISRSMDY---QSQLASNALALVNRNTEISAAGRQLSEEdidd  867
              C +      F D   A  S  + Y    +Q  SN+LA++   T IS A   L+   +  
Sbjct  189   TCIE-----GFEDAKEAIKSSVVSYLRNSTQFTSNSLAII---TWISKAATTLNLRRLLS  240

Query  866   dddggffpDWVSGRDLRLLETTTDKTKANVVVAKDGTGNFRTVAEAIGAA--SGRQRFVI  693
                    P+W+  +D +LL T   + KA++VVAKDG+G ++ +++A+     +  +R VI
Sbjct  241   LPHQNEAPEWLHSKDRKLLLTEDLREKAHIVVAKDGSGKYKKISDALKHVPNNSNKRTVI  300

Query  692   YVKSGVYKEKIRSSKD--GITLIGDGKYSTIITWDDSVGGGSSLTGSATFGITGDGFIAK  519
             YVK GVY E +R  K    + +IGDG  STI++   +   G+    +ATF + G  FIA+
Sbjct  301   YVKRGVYYENVRVEKTKWNVMIIGDGMTSTIVSGSRNFVDGTPTFSTATFAVFGRNFIAR  360

Query  518   DIGFQNTAGPGAHQAVALTVASDHSVFYRCSISGYQDTLYALSLRQFYRECDISGTVDFI  339
             D+GF+NTAGP  HQAVAL  ++D +V+YRC I  YQDTLYA S RQFYREC+I GTVDFI
Sbjct  361   DMGFRNTAGPQKHQAVALMTSADQAVYYRCHIDAYQDTLYAHSNRQFYRECNIYGTVDFI  420

Query  338   FGNAAAVFQACNLVLRRP--SSYNVILANGRSDPGQNTGFSVQKCKITPGPDFSPVKNSY  165
             FGN+A V Q CN+  + P     N I A G++DP  NTG S+Q C I+P  + S V+   
Sbjct  421   FGNSAVVIQNCNIRPKLPMHGQQNTITAQGKTDPNMNTGISIQHCNISPFGNLSSVQ---  477

Query  164   NSYLGRPWKPYSRAVVMESDIDGAISARGWIEWPGTSSSSVRELYFGEYANVG  6
              +YLGRPWK YS  V M S +DG +S +GW+ W G S+     +++ E+ NVG
Sbjct  478   -TYLGRPWKNYSTTVYMRSRMDGFVSPKGWLPWTGNSAPDT--IFYAEFQNVG  527



>ref|XP_010264199.1| PREDICTED: pectinesterase 2-like [Nelumbo nucifera]
Length=527

 Score =   315 bits (808),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 178/366 (49%), Positives = 227/366 (62%), Gaps = 25/366 (7%)
 Frame = -2

Query  1079  DIQTWLSAAVTFQQACKDWADQYAFSDELFARISRSMDYQSQLASNALALVNRNTEISAA  900
             D+QTWLS A+T  + CK    +   SD +   +S ++   S+L SN LA+ N  T     
Sbjct  130   DVQTWLSTALTNLETCKTGFIELGVSDFMLPLMSNNV---SKLISNTLAINNNATTTQ--  184

Query  899   GRQLSEEdidddddggffpDWVSGRDLRLLETTTDKTKANVVVAKDGTGNFRTVAEAIGA  720
                       +    G +P WVS  D +LL++++  ++AN+VVA+DG+GNFRT+ EA+ A
Sbjct  185   ----------NQSYTGGYPSWVSAGDRKLLQSSSPASQANIVVAQDGSGNFRTIKEALSA  234

Query  719   AS----GRQRFVIYVKSGVYKE--KIRSSKDGITLIGDGKYSTIITWDDSVGGGSSLTGS  558
             AS    G  RFVIYVK G Y E  +I SS   I L+GDG  +TIIT + SVGGGS+   S
Sbjct  235   ASQQRTGSGRFVIYVKKGAYIENLEIGSSLQNIMLVGDGMRNTIITGNRSVGGGSTTFNS  294

Query  557   ATFGITGDGFIAKDIGFQNTAGPGAHQAVALTVASDHSVFYRCSISGYQDTLYALSLRQF  378
             AT  +TG GFIA  I F+NTAGP  HQAVAL   SD SVFYRC   GYQDTLY  S RQ 
Sbjct  295   ATVAVTGQGFIAMGITFRNTAGPENHQAVALRSGSDLSVFYRCGFEGYQDTLYVHSQRQL  354

Query  377   YRECDISGTVDFIFGNAAAVFQACNLVLRRP--SSYNVILANGRSDPGQNTGFSVQKCKI  204
             Y+EC I GTVDFIFGNAA V Q C +  RRP  +  NV+ A GR+DP QNTG S+   +I
Sbjct  355   YKECYIYGTVDFIFGNAAVVLQNCMIFARRPMDNQNNVVTAQGRTDPNQNTGISIHNSRI  414

Query  203   TPGPDFSPVKNSYNSYLGRPWKPYSRAVVMESDIDGAISARGWIEWPGTSSSSVRELYFG  24
                 D  PV +S+ ++LGRPWK YSR V + S ID  +   GW+EW G  + ++  LY+G
Sbjct  415   MASSDLVPVLSSFKTFLGRPWKQYSRTVYLTSYIDTLVDPAGWMEWSG--NFALDTLYYG  472

Query  23    EYANVG  6
             EY N G
Sbjct  473   EYKNYG  478



>ref|XP_004290811.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 40-like 
[Fragaria vesca subsp. vesca]
Length=567

 Score =   317 bits (811),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 189/467 (40%), Positives = 266/467 (57%), Gaps = 21/467 (4%)
 Frame = -2

Query  1367  CGYTRFPRLCVQTLSGL--VSGERVDFAAALLLNKTIAHADLHIAHFDQLSSHFVSSQPP  1194
             C  T +  LCV TL+    +S + V    +  +NKT+       ++   +  H   ++  
Sbjct  59    CQNTLYKDLCVSTLTSFPNLSSKTVPQIISSTVNKTMYEVIASNSNCTGIKKH-NKNKLA  117

Query  1193  QPRLQAIGYCEELMG--MARQRLNEALVAMKESPGKNRQEDIQTWLSAAVTFQQACKDWA  1020
               + QA+  C EL    +A+ ++  + ++ K+SP       ++T LSAA+T Q  C +  
Sbjct  118   AVQQQALDDCLELFDDTVAQLKVTMSELSSKKSPAAKHYNHLRTLLSAAMTNQYTCLEGF  177

Query  1019  DQYAFS--DELFARISRSMDYQSQLASNALALVNRNTEISAAGRQLSEEdidddddggff  846
             D    S    + A +   ++   +  SNAL ++ +       G    E   +       F
Sbjct  178   DSSTSSTVKAVKAELESRLNTTCKHFSNALVMLKK-----IRGVVERESTDEFGAMKNGF  232

Query  845   pDWVSGRDLRLLETTT-DKTKANVVVAKDGTGNFRTVAEAIGAA--SGRQRFVIYVKSGV  675
             P WV  +  +LL+T++ ++TK +++VAKDG+GNF T+ +A+ AA  S   RFVIY+K+G 
Sbjct  233   PTWVGSKARKLLQTSSANQTKYDLLVAKDGSGNFTTITDAVAAAPNSSATRFVIYIKAGA  292

Query  674   YKEKIR--SSKDGITLIGDGKYSTIITWDDSVGGGSSLTGSATFGITGDGFIAKDIGFQN  501
             Y E +   S K  +  +GDG   T++    +V  G +   SAT  + G GFIAK I F+N
Sbjct  293   YFENVEVVSKKTNLMFLGDGIGKTVVKASRNVVDGWTTFRSATVAVVGGGFIAKGITFEN  352

Query  500   TAGPGAHQAVALTVASDHSVFYRCSISGYQDTLYALSLRQFYRECDISGTVDFIFGNAAA  321
             +AGP  HQAVAL   SD S FY+CS  GYQDTLY  SLRQFYRECDI GTVDFIFGNAA 
Sbjct  353   SAGPSKHQAVALRSGSDLSAFYQCSFVGYQDTLYVHSLRQFYRECDIYGTVDFIFGNAAV  412

Query  320   VFQACNLVLRRPS--SYNVILANGRSDPGQNTGFSVQKCKITPGPDFSPVKNSYNSYLGR  147
             VFQ CNL  R+P+    N+  A GR DP QNTG S+  CK+T   D  PVK+++ +YLGR
Sbjct  413   VFQNCNLYARKPNDGQKNIFTAQGREDPNQNTGISILNCKVTAASDLIPVKSTFKTYLGR  472

Query  146   PWKPYSRAVVMESDIDGAISARGWIEWPGTSSSSVRELYFGEYANVG  6
             PWK YSR V + S+ID  +   GW+EW GT + S   LY+GEY N G
Sbjct  473   PWKEYSRTVYLRSNIDDTVDPAGWLEWNGTFALST--LYYGEYLNRG  517



>gb|KDP28190.1| hypothetical protein JCGZ_13961 [Jatropha curcas]
Length=430

 Score =   312 bits (799),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 172/366 (47%), Positives = 229/366 (63%), Gaps = 14/366 (4%)
 Frame = -2

Query  1082  EDIQTWLSAAVTFQQACKDWADQYAFSDELFARISRSMDYQ-SQLASNALALVNRNTEIS  906
              ++QT LSAA+T Q  C    D +A+S+    ++ +S  Y  S   SN+L ++ +   ++
Sbjct  22    HELQTLLSAAMTNQYTC---LDGFAYSEGNVRKVIKSNLYNISHHVSNSLVMLKKIPGVN  78

Query  905   AAGRQLSEEdidddddggffpDWVSGRDLRLLETTTDKTKANVVVAKDGTGNFRTVAEAI  726
              + +  SE      D    FP W+S +D +LL+   + T  N++VAKDG+GNF TV+EA+
Sbjct  79    ISNK--SEVFTGHGDIKHGFPSWLSSKDRKLLQAPLNATTFNLIVAKDGSGNFTTVSEAV  136

Query  725   GAA--SGRQRFVIYVKSGVYKEKI--RSSKDGITLIGDGKYSTIITWDDSVGGGSSLTGS  558
              AA  S   RFVIY+K+G Y E +     K+ +  IGDG   T+I  + SV  G +   S
Sbjct  137   AAAPNSSNARFVIYIKAGAYFENVDVHKKKNMLMFIGDGIGKTVIKANRSVVDGWTTFRS  196

Query  557   ATFGITGDGFIAKDIGFQNTAGPGAHQAVALTVASDHSVFYRCSISGYQDTLYALSLRQF  378
             AT  + G+GFIAK I F+N+AGP  HQAVAL   SD S FY+CS  GYQDTLY  SLRQF
Sbjct  197   ATVAVVGNGFIAKGITFENSAGPSMHQAVALRSGSDLSAFYQCSFVGYQDTLYVHSLRQF  256

Query  377   YRECDISGTVDFIFGNAAAVFQACNLVLRRPSS--YNVILANGRSDPGQNTGFSVQKCKI  204
             YRECD+ GT+DFIFGNAA VFQ CNL  R+P+    N++ A GR DP QNTG S+  CK+
Sbjct  257   YRECDVYGTIDFIFGNAAVVFQNCNLYARQPNENQKNIVTAQGREDPNQNTGISILNCKV  316

Query  203   TPGPDFSPVKNSYNSYLGRPWKPYSRAVVMESDIDGAISARGWIEWPGTSSSSVRELYFG  24
                 D  PVK+S+ +YLGRPWK YSR V + S ID  I   GW+EW G    +++ LY+G
Sbjct  317   AAAADLIPVKSSFKTYLGRPWKEYSRTVYITSYIDDLIDPAGWLEWNG--DFALKTLYYG  374

Query  23    EYANVG  6
             EY N G
Sbjct  375   EYMNRG  380



>ref|XP_002264156.1| PREDICTED: pectinesterase 2 [Vitis vinifera]
Length=513

 Score =   315 bits (806),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 193/468 (41%), Positives = 266/468 (57%), Gaps = 38/468 (8%)
 Frame = -2

Query  1379  IRIQCGYTRFPRLCVQTLSGLVSGERVDFAAALL-LNKTIAHADLHIAHFDQLSSHFVSS  1203
             ++  C  T +P+ C   LS       +   +  L ++  +A      AH +  S   + S
Sbjct  25    VKSWCSQTPYPQPCEYFLSHKPDHSPIKQKSDFLNISMQVALEQAMTAHGNIFS---LGS  81

Query  1202  QPPQPRLQAI-GYCEELMGMARQRLNEALVAMKESPGKNRQEDIQTWLSAAVTFQQACKD  1026
             +    R +A    C EL      +LN+ L    +   +  Q D QTWLS A+T  Q C+D
Sbjct  82    KCRNEREKAAWNDCVELYDHTILKLNKTL----DPNTRCTQVDAQTWLSTALTNLQTCQD  137

Query  1025  WADQYAFSDELFARISRSMDYQSQLASNALALVNR--NTEISAAGRQLSEEdidddddgg  852
                +   SD     IS ++   S+L SN L+ +N+    E S  G               
Sbjct  138   GFIELGVSDHFLPLISNNV---SKLISNTLS-INKVPYAEPSYKG---------------  178

Query  851   ffpDWVSGRDLRLLETTTDKTKANVVVAKDGTGNFRTVAEAIGAASGRQ---RFVIYVKS  681
              +P WV   D +LL++++  ++AN+VV+KDG+G++ T+  AI AAS R    R+VIYVK+
Sbjct  179   GYPTWVKPGDRKLLQSSSLASQANIVVSKDGSGDYTTIGAAITAASKRSGSGRYVIYVKA  238

Query  680   GVYKEKIR--SSKDGITLIGDGKYSTIITWDDSVGGGSSLTGSATFGITGDGFIAKDIGF  507
             G Y E ++  S    ITL+GDG   TI+T   SVGGGS+   SAT  + GDGFIA+ +  
Sbjct  239   GTYSENVQIGSGLKNITLLGDGIGKTIVTGSRSVGGGSTTYNSATVAVVGDGFIARGMTI  298

Query  506   QNTAGPGAHQAVALTVASDHSVFYRCSISGYQDTLYALSLRQFYRECDISGTVDFIFGNA  327
             +NTAG   HQAVAL   SD SV+Y+CS  GYQDTLY  S RQFYRECDI GTVDFIFGNA
Sbjct  299   RNTAGASNHQAVALRSGSDLSVYYQCSFEGYQDTLYVYSDRQFYRECDIYGTVDFIFGNA  358

Query  326   AAVFQACNLVLRR-PSSYNVILANGRSDPGQNTGFSVQKCKITPGPDFSPVKNSYNSYLG  150
             A VFQ CN+  R  P+  N + A GR+DP QNTG S+  C++T   D   V++S  +YLG
Sbjct  359   AVVFQKCNIYARNPPNKVNTVTAQGRTDPNQNTGISIHDCEVTAASDLKAVQSSVKTYLG  418

Query  149   RPWKPYSRAVVMESDIDGAISARGWIEWPGTSSSSVRELYFGEYANVG  6
             RPWK YSR V +++ +D  I++ GW+EW G    ++  LY+GEY N G
Sbjct  419   RPWKEYSRTVFLKTYLDSLINSAGWLEWSG--DFALNTLYYGEYMNTG  464



>gb|AAB67739.1| pectin methylesterase PME2.1 [Solanum lycopersicum]
Length=550

 Score =   316 bits (809),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 193/470 (41%), Positives = 263/470 (56%), Gaps = 40/470 (9%)
 Frame = -2

Query  1367  CGYTRFPRLCVQTLSGLVSGERV--DFAAALLLNKTIAHADLHIAHFDQLSSHFVSSQPP  1194
             C   +  +LC+  +S L+S E V  D     +L K + ++ +H  +        + +Q  
Sbjct  54    CKTAQDSQLCLSYVSDLISNEIVTSDSDGLSILKKFLVYS-VHQMNNAIPVVRKIKNQIN  112

Query  1193  QPRLQ-AIGYCEELMGMARQRLNEALVAMKESPGKNRQEDIQTWLSAAVTFQQACKDWAD  1017
               R Q A+  C EL+ ++   + +++ A+ +   ++   + Q+WLS  +T    C D  D
Sbjct  113   DIREQGALTDCLELLDLSVDLVCDSIAAI-DKRSRSEHANAQSWLSGVLTNHVTCLDELD  171

Query  1016  QYAFS-------DELFARISRSMDYQSQLASNALALVNRNTEISAAGRQLSEEdiddddd  858
              +  +       DEL +R   ++   + LAS    +   N E+   G             
Sbjct  172   SFTKAMINGTNLDELISRAKVAL---AMLAS----VTTPNDEVLRPG-------------  211

Query  857   ggffpDWVSGRDLRLLETTTDKTKANVVVAKDGTGNFRTVAEAIGAA--SGRQRFVIYVK  684
              G  P WVS RD +L+E++     AN VVAKDGTG +RT+AEA+ AA    + R+VIYVK
Sbjct  212   LGKMPSWVSSRDRKLMESSGKDIGANAVVAKDGTGKYRTLAEAVAAAPDKSKTRYVIYVK  271

Query  683   SGVYKEKIR--SSKDGITLIGDGKYSTIITWDDSVGGGSSLTGSATFGITGDGFIAKDIG  510
              G YKE +   S K  + +IGDG Y+TIIT   +V  GS+   SAT    G GFI +DI 
Sbjct  272   RGTYKENVEVSSRKMNLMIIGDGMYATIITGSLNVVDGSTTFHSATLAAVGKGFILQDIC  331

Query  509   FQNTAGPGAHQAVALTVASDHSVFYRCSISGYQDTLYALSLRQFYRECDISGTVDFIFGN  330
              QNTAGP  HQAVAL V +D SV  RC I  YQDTLYA S RQFYR+  ++GT+DFIFGN
Sbjct  332   IQNTAGPAKHQAVALRVGADKSVINRCRIDAYQDTLYAHSQRQFYRDSYVTGTIDFIFGN  391

Query  329   AAAVFQACNLVLRRPSSY--NVILANGRSDPGQNTGFSVQKCKITPGPDFSPVKNSYNSY  156
             AA VFQ C LV R+P  Y  N++ A GR+DP Q TG S+Q C I   PD  PV   + +Y
Sbjct  392   AAVVFQKCQLVARKPGKYQQNMVTAQGRTDPNQATGTSIQFCDIIASPDLKPVVKEFPTY  451

Query  155   LGRPWKPYSRAVVMESDIDGAISARGWIEWPGTSSSSVRELYFGEYANVG  6
             LGRPWK YSR VVMES + G I   GW EW G    +++ LY+GE+ N G
Sbjct  452   LGRPWKKYSRTVVMESYLGGLIDPSGWAEWHG--DFALKTLYYGEFMNNG  499



>gb|KGN44975.1| Pectinesterase [Cucumis sativus]
Length=614

 Score =   318 bits (814),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 199/470 (42%), Positives = 263/470 (56%), Gaps = 22/470 (5%)
 Frame = -2

Query  1376  RIQCGYTRFPRLCVQTLSGL-----VSGERVDFAAALLLNKTIAHADLHIAHFDQLSSHF  1212
             R  C  T FP LC   LS       +S E++   A   LN T     L   +   L +H 
Sbjct  102   RSLCNGTLFPDLCFSKLSSFPQLASLSPEKL---AGSALNFTSREVLLAYTNCTNLKTHL  158

Query  1211  VSSQPPQPRLQAIGYCEELMGMARQRLNEAL--VAMKESPGKNRQEDIQTWLSAAVTFQQ  1038
              S   P  R  A+  C EL+  +   L  ++  +A  +SP  +   D+ T +SAA+T  +
Sbjct  159   YSGLNPTDR-HALDDCLELLDGSIAELKASIFDLAPSQSPALH-SHDLLTLVSAAMTNHR  216

Query  1037  ACKDWADQYAFSDELFARISRSMDYQSQLASNALALVNRNTEISAAGRQLSEEdiddddd  858
              C D    Y  S  + +R+   +    Q  S  LA++ +   ++ A     E   +    
Sbjct  217   TCVD--GFYNSSGTVRSRVELYLGKIGQHLSIDLAMLKKIPGVNRATGVDQEMLPEYGAV  274

Query  857   ggffpDWVSGRDLRLLETTTDKTKANVVVAKDGTGNFRTVAEAIGAA--SGRQRFVIYVK  684
              G FP WVS +D RLL+   ++TK N+VVAKDG+GNF TV+EA+ AA  +   RFVIY+K
Sbjct  275   KGGFPKWVSVKDRRLLQAAVNETKFNMVVAKDGSGNFTTVSEAVAAAPNASTTRFVIYIK  334

Query  683   SGVYKEKIR--SSKDGITLIGDGKYSTIITWDDSVGGGSSLTGSATFGITGDGFIAKDIG  510
             +G Y E +    +K  +  +GDG   T+I  D +V  G +   SAT  + G GFIAK I 
Sbjct  335   AGAYFENVEIGRAKSNLMFVGDGIGKTLIKADRNVVDGWTTFRSATVAVVGTGFIAKGIT  394

Query  509   FQNTAGPGAHQAVALTVASDHSVFYRCSISGYQDTLYALSLRQFYRECDISGTVDFIFGN  330
             F+N AGP  HQAVAL   SD S FY+CS  GYQDTLY  SLRQFYR+CD+ GT+DFIFGN
Sbjct  395   FENYAGPSKHQAVALRSNSDFSAFYQCSFIGYQDTLYVHSLRQFYRDCDVYGTIDFIFGN  454

Query  329   AAAVFQACNLVLRRPSS--YNVILANGRSDPGQNTGFSVQKCKITPGPDFSPVKNSYNSY  156
             AA VFQ CNL  R+P+S   N+  A GR DP QNTG S+  CK+    D  PV +S+ +Y
Sbjct  455   AAVVFQNCNLYARKPNSNQRNIFTAQGREDPNQNTGISILNCKVEAASDLIPVLSSFRTY  514

Query  155   LGRPWKPYSRAVVMESDIDGAISARGWIEWPGTSSSSVRELYFGEYANVG  6
             LGRPWK YSR V + S I   I   GW+EW GT   ++  LY+GEY N G
Sbjct  515   LGRPWKLYSRTVFLRSFIGQLIEPVGWLEWNGT--FALDTLYYGEYLNRG  562



>ref|NP_001233948.1| pectinesterase 2.1 [Solanum lycopersicum]
 sp|P09607.2|PME21_SOLLC RecName: Full=Pectinesterase 2.1; Short=PE 2.1; AltName: Full=Pectin 
methylesterase 2.1; Flags: Precursor [Solanum lycopersicum]
 emb|CAA52704.1| pectin esterase [Solanum lycopersicum]
Length=550

 Score =   316 bits (809),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 195/470 (41%), Positives = 263/470 (56%), Gaps = 40/470 (9%)
 Frame = -2

Query  1367  CGYTRFPRLCVQTLSGLVSGERV--DFAAALLLNKTIAHADLHIAHFDQLSSHFVSSQPP  1194
             C   +  +LC+  +S L+S E V  D     +L K + ++ +H  +        + +Q  
Sbjct  54    CKTAQDSQLCLSYVSDLISNEIVTSDSDGLSILKKFLVYS-VHQMNNAIPVVRKIKNQIN  112

Query  1193  QPRLQ-AIGYCEELMGMARQRLNEALVAMKESPGKNRQEDIQTWLSAAVTFQQACKDWAD  1017
               R Q A+  C EL+ ++   + +++ A+ +   ++   + Q+WLS  +T    C D  D
Sbjct  113   DIREQGALTDCLELLDLSVDLVCDSIAAI-DKRSRSEHANAQSWLSGVLTNHVTCLDELD  171

Query  1016  QYAFS-------DELFARISRSMDYQSQLASNALALVNRNTEISAAGRQLSEEdiddddd  858
              +  +       DEL   ISR+    + LAS    +   N E+   G             
Sbjct  172   SFTKAMINGTNLDEL---ISRAKVALAMLAS----VTTPNDEVLRPG-------------  211

Query  857   ggffpDWVSGRDLRLLETTTDKTKANVVVAKDGTGNFRTVAEAIGAA--SGRQRFVIYVK  684
              G  P WVS RD +L+E++     AN VVAKDGTG +RT+AEA+ AA    + R+VIYVK
Sbjct  212   LGKMPSWVSSRDRKLMESSGKDIGANAVVAKDGTGKYRTLAEAVAAAPDKSKTRYVIYVK  271

Query  683   SGVYKEKIR--SSKDGITLIGDGKYSTIITWDDSVGGGSSLTGSATFGITGDGFIAKDIG  510
              G YKE +   S K  + +IGDG Y+TIIT   +V  GS+   SAT    G GFI +DI 
Sbjct  272   RGTYKENVEVSSRKMNLMIIGDGMYATIITGSLNVVDGSTTFHSATLAAVGKGFILQDIC  331

Query  509   FQNTAGPGAHQAVALTVASDHSVFYRCSISGYQDTLYALSLRQFYRECDISGTVDFIFGN  330
              QNTAGP  HQAVAL V +D SV  RC I  YQDTLYA S RQFYR+  ++GT+DFIFGN
Sbjct  332   IQNTAGPAKHQAVALRVGADKSVINRCRIDAYQDTLYAHSQRQFYRDSYVTGTIDFIFGN  391

Query  329   AAAVFQACNLVLRRPSSY--NVILANGRSDPGQNTGFSVQKCKITPGPDFSPVKNSYNSY  156
             AA VFQ C LV R+P  Y  N++ A GR+DP Q TG S+Q C I   PD  PV   + +Y
Sbjct  392   AAVVFQKCQLVARKPGKYQQNMVTAQGRTDPNQATGTSIQFCDIIASPDLKPVVKEFPTY  451

Query  155   LGRPWKPYSRAVVMESDIDGAISARGWIEWPGTSSSSVRELYFGEYANVG  6
             LGRPWK YSR VVMES + G I   GW EW G    +++ LY+GE+ N G
Sbjct  452   LGRPWKKYSRTVVMESYLGGLIDPSGWAEWHG--DFALKTLYYGEFMNNG  499



>emb|CAB95025.1| pectin methylesterase [Nicotiana tabacum]
Length=579

 Score =   317 bits (811),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 182/479 (38%), Positives = 272/479 (57%), Gaps = 29/479 (6%)
 Frame = -2

Query  1379  IRIQCGYTRFPRLCVQTLSGLVSGERVDFAAALLLNKTIAHADLHIA------HFDQLSS  1218
             ++  C  T  P LC  T++ +      DF+  +   K +    L+I       +F ++  
Sbjct  62    VKSACENTLHPELCYSTIASVS-----DFSKKVTSQKDVIELSLNITCRAVQHNFFKVEK  116

Query  1217  HFVSSQPPQPRLQ-AIGYCEELMGMARQRLNEALVAMKESPGKN----RQEDIQTWLSAA  1053
                + +  +PR + A+  C E +      L+ A+  ++  P K       +D++T +S+A
Sbjct  117   LIKTRKGLKPREKVALHDCLETIDETLDELHTAIKDLELYPNKKSLKAHADDLKTLISSA  176

Query  1052  VTFQQACKDWADQYAFSDELFARISRSMDYQSQLASNALALVNRNTEISAAGRQLSEEdi  873
             +T Q+ C D         ++   + +   +  ++ SNALA++   T+   A  Q  +   
Sbjct  177   ITNQETCLDGFSHDDADKKVRKALLKGQKHVEKMCSNALAMICNMTDTDIANEQKLKGTT  236

Query  872   dddddggffpDW---VSGRDLRLLETTTDKTKANVVVAKDGTGNFRTVAEAIGAASGR--  708
              +        +W   +S  D RLL+++T   + +VVVA DG+GNF+TV+EA+  A  +  
Sbjct  237   TNRKLREDNSEWPEWLSAGDRRLLQSST--VRPDVVVAADGSGNFKTVSEAVAKAPEKSS  294

Query  707   QRFVIYVKSGVYKEKIR--SSKDGITLIGDGKYSTIITWDDSVGGGSSLTGSATFGITGD  534
             +R+VI +K+GVY+E +     K  I  +GDG+ +TIIT   +V  GS+   SAT    G+
Sbjct  295   KRYVIRIKAGVYRENVDVPKKKTNIMFMGDGRSNTIITGSRNVKDGSTTFHSATVAAVGE  354

Query  533   GFIAKDIGFQNTAGPGAHQAVALTVASDHSVFYRCSISGYQDTLYALSLRQFYRECDISG  354
              F+A+DI FQNTAG   HQAVAL V SD S FYRC I  YQD+LY  S RQ++ +C I+G
Sbjct  355   KFLARDITFQNTAGAAKHQAVALRVGSDLSAFYRCDILAYQDSLYVHSNRQYFVQCLIAG  414

Query  353   TVDFIFGNAAAVFQACNLVLRRPSS--YNVILANGRSDPGQNTGFSVQKCKITPGPDFSP  180
             TVDFIFGNAAAV Q C++  RRP S   N++ A GRSDP QNTG  +QKC+I    D  P
Sbjct  415   TVDFIFGNAAAVLQNCDIHARRPGSGQKNMVTAQGRSDPNQNTGIVIQKCRIGATSDLRP  474

Query  179   VKNSYNSYLGRPWKPYSRAVVMESDIDGAISARGWIEWPGTSSSSVRELYFGEYANVGA  3
             V+ S+ +YLGRPWK YSR V+M+S I   I++ GW EW G  + ++  L++GEY N GA
Sbjct  475   VQKSFPTYLGRPWKEYSRTVIMQSSITDVINSAGWHEWNG--NFALNTLFYGEYQNTGA  531



>ref|XP_003519757.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 40-like 
[Glycine max]
Length=562

 Score =   316 bits (809),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 189/464 (41%), Positives = 257/464 (55%), Gaps = 17/464 (4%)
 Frame = -2

Query  1367  CGYTRFPRLCVQTLSGL--VSGERVDFAAALLLNKTIAHADLHIAHFDQLSSHFVSSQPP  1194
             C  T +P LCV TL+    ++ + V    + ++N T+        +   L     +  P 
Sbjct  56    CQGTLYPDLCVSTLATFPDLATKSVPQVISSVVNHTMYEVRSSSYNCSGLKKMLKNLNPL  115

Query  1193  QPRLQAIGYCEELMGMARQRLNEALVAM-KESPGKNRQEDIQTWLSAAVTFQQACKDWAD  1017
               R  A+  C +L       L   +  + K + G  R  D+QT LS A+T    C    D
Sbjct  116   DQR--ALDDCLKLFEDTNVELKATIDDLSKSTIGSKRHHDLQTMLSGAMTNLYTC---LD  170

Query  1016  QYAFSD-ELFARISRSMDYQSQLASNALALVNRNTEISAAGRQLSEEdidddddggffpD  840
              +A+S   +  RI + +   S   SN+LA++N+   +       S    +  +    FP 
Sbjct  171   GFAYSKGRVRDRIEKKLLEISHHVSNSLAMLNKVPGVKKLTTSESVVFPEYGNMKKGFPS  230

Query  839   WVSGRDLRLLETTTDKTKANVVVAKDGTGNFRTVAEAIGAA--SGRQRFVIYVKSGVYKE  666
             WVS +D +LL+    +TK +++VAKDGTGNF T+ EA+  A  S   RFVI++K G Y E
Sbjct  231   WVSSKDRKLLQAKVKETKFDLLVAKDGTGNFTTIGEALAVAPNSSTTRFVIHIKEGAYFE  290

Query  665   KIR--SSKDGITLIGDGKYSTIITWDDSVGGGSSLTGSATFGITGDGFIAKDIGFQNTAG  492
              +     K  +  +GDG   T++    +V  G +   SAT  + G GFIAK I F+N+AG
Sbjct  291   NVEVIRKKTNLMFVGDGIGKTVVKGSRNVVDGWTTFQSATVAVVGAGFIAKGITFENSAG  350

Query  491   PGAHQAVALTVASDHSVFYRCSISGYQDTLYALSLRQFYRECDISGTVDFIFGNAAAVFQ  312
             P  HQAVAL   +D S FY+CS  GYQDTLY  SLRQFYRECDI GTVDFIFGNAA VFQ
Sbjct  351   PDKHQAVALRSGADFSAFYQCSFVGYQDTLYVHSLRQFYRECDIYGTVDFIFGNAAVVFQ  410

Query  311   ACNLVLRRPSS--YNVILANGRSDPGQNTGFSVQKCKITPGPDFSPVKNSYNSYLGRPWK  138
              CNL  R+P+    N+  A GR DP QNTG S+  CKI    D  PVK+S+ SYLGRPWK
Sbjct  411   NCNLYARKPNENQKNLFTAQGREDPNQNTGISILNCKIAAAADLIPVKSSFKSYLGRPWK  470

Query  137   PYSRAVVMESDIDGAISARGWIEWPGTSSSSVRELYFGEYANVG  6
              YSR VV++S ++  I   GW+EW    + ++  LY+GEY N G
Sbjct  471   MYSRTVVLKSFVEDLIDPAGWLEW--NETFALDTLYYGEYMNRG  512



>gb|AFQ23194.1| pectin methylesterase [Theobroma cacao]
Length=582

 Score =   317 bits (811),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 187/477 (39%), Positives = 269/477 (56%), Gaps = 25/477 (5%)
 Frame = -2

Query  1379  IRIQCGYTRFPRLCVQTLSGLVSGERVDFAAA-----LLLNKTIAHADLHIAHFDQLSSH  1215
             ++  C  TR+P LC   ++   +       +      L LN T    + +     +L   
Sbjct  65    VKSACSITRYPDLCFSEVAAAPAATSKKVKSKKDVIELSLNITTTAVEHNYFKIKKL---  121

Query  1214  FVSSQPPQPRLQAIGYCEELMGMARQRLNEALVAMKESPGKN----RQEDIQTWLSAAVT  1047
                    +    A+  C E +      L+EA+  + E P K       +D++T +SAA+T
Sbjct  122   LAKKGLTEREKTALHDCLETIDETLDELHEAVEDLHEYPNKKSLTQHADDLKTLMSAAMT  181

Query  1046  FQQACKDWADQYAFSDELFARISRSMDYQSQLASNALALVNRNTEISAAGRQL---SEEd  876
              Q+ C D     A   ++   +     Y  ++ SNALA++   T+   A   L   S   
Sbjct  182   NQETCLDGFSHDAADKKIRKVLIDGEKYVERMCSNALAMIKNMTDTDIANEMLKTSSNRK  241

Query  875   idddddggffpDWVSGRDLRLLETTTDKTKANVVVAKDGTGNFRTVAEAIGAASGR--QR  702
             + + ++G  +P+W+S  D RLL++++     +VVVA DG+GN++TV+EA+  A  R  +R
Sbjct  242   LKEQENGIAWPEWLSAGDRRLLQSSS--VTPDVVVAADGSGNYKTVSEAVAKAPQRSSKR  299

Query  701   FVIYVKSGVYKEKIR--SSKDGITLIGDGKYSTIITWDDSVGGGSSLTGSATFGITGDGF  528
             +VI +K+GVY+E +     K  I  +GDG+  TIIT   +V  GS+   SAT  + G+ F
Sbjct  300   YVIKIKAGVYRENVEVPKKKTNIMFLGDGRTETIITGSRNVVDGSTTFHSATVAVVGERF  359

Query  527   IAKDIGFQNTAGPGAHQAVALTVASDHSVFYRCSISGYQDTLYALSLRQFYRECDISGTV  348
             +A+ I FQNTAGP  HQAVAL V +D S FY C +  YQDTLYA S RQFY  C I+GTV
Sbjct  360   LARSITFQNTAGPSKHQAVALRVGADLSAFYECDMLAYQDTLYAHSNRQFYVNCIIAGTV  419

Query  347   DFIFGNAAAVFQACNLVLRRPSS--YNVILANGRSDPGQNTGFSVQKCKITPGPDFSPVK  174
             DFIFGNAAAVFQ C++  RRP+S   N++ A GR+DP QNTG  +QKC+I    D   V 
Sbjct  420   DFIFGNAAAVFQNCDIHARRPNSGQKNMVTAQGRTDPNQNTGIVIQKCRIGATSDLQSVT  479

Query  173   NSYNSYLGRPWKPYSRAVVMESDIDGAISARGWIEWPGTSSSSVRELYFGEYANVGA  3
             +++ +YLGRPWK YSR VVM+S I   I   GW EW  + S ++R L++GEY N GA
Sbjct  480   SNFPTYLGRPWKEYSRTVVMQSVISDVIHPAGWHEW--SESFALRTLFYGEYQNTGA  534



>ref|XP_011016647.1| PREDICTED: pectinesterase-like [Populus euphratica]
Length=550

 Score =   315 bits (808),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 183/467 (39%), Positives = 255/467 (55%), Gaps = 35/467 (7%)
 Frame = -2

Query  1367  CGYTRFPRLCVQTLSGLVSGERVDFAAALLLNKTIAHADLHIAHFDQLSSHFVSSQPPQP  1188
             C     P+ C+  LS  VS E V  +  + L KT     L      + +++ V+S+    
Sbjct  57    CNQAHDPQECLSILSEAVSTEGVQESNGVGLLKTFLVKSLSQMRMAKAAANAVNSKINDH  116

Query  1187  RLQA-IGYCEELMGMARQRLNEALVAMKESPGKNRQEDIQTWLSAAVTFQQACKDWAD--  1017
             + QA +  C ELM M+  R+ + L A+     ++   D  TWLS  +T    C D  D  
Sbjct  117   KHQAALADCVELMDMSIDRVTDTLSALGNWGSQSDASDANTWLSGVLTNHVTCLDGVDTI  176

Query  1016  ----QYAFSDELFARISRSMDYQSQLASNALALVNRNTEISAAGRQLSEEdidddddggf  849
                       +L +R+  S+   S L+++   LV                        G 
Sbjct  177   DQPSMKKLLQDLISRMRTSLATVSSLSASDTDLVQ--------------------PLNGG  216

Query  848   fpDWVSGRDLRLLETTTDKTKANVVVAKDGTGNFRTVAEAIGAA--SGRQRFVIYVKSGV  675
             FP W+ GRD +LLE++    +ANV+VA+DG+G++ T+ EA+ +     + R+VI+VKSG+
Sbjct  217   FPSWILGRDRKLLESSVSNVEANVIVAQDGSGDYTTIQEAVNSVPDKSKSRYVIHVKSGI  276

Query  674   YKEKIR--SSKDGITLIGDGKYSTIITWDDSVGGGSSLTGSATFGITGDGFIAKDIGFQN  501
             YKE +     K  + ++GDG   TI+T + +V  GS+   SAT  + GDGFI +DI  QN
Sbjct  277   YKENVEVGKKKKNVMIVGDGMDFTILTGNLNVVDGSTTFRSATLAVAGDGFILQDIWIQN  336

Query  500   TAGPGAHQAVALTVASDHSVFYRCSISGYQDTLYALSLRQFYRECDISGTVDFIFGNAAA  321
             TAGP  HQAVAL V++D SV  RC I  YQDTLY  + RQFYR+C I GT+DFIFGN A 
Sbjct  337   TAGPEKHQAVALRVSADQSVINRCRIDAYQDTLYTHNYRQFYRDCSIIGTIDFIFGNGAV  396

Query  320   VFQACNLVLRRP--SSYNVILANGRSDPGQNTGFSVQKCKITPGPDFSPVKNSYNSYLGR  147
             V Q C ++ R+P  +  N++ A GR DP QNTG S+Q C I    D    +N + +YLGR
Sbjct  397   VLQNCQIISRKPMANQKNMVTAQGRIDPNQNTGISIQNCDIVASSDLESEQNKFPTYLGR  456

Query  146   PWKPYSRAVVMESDIDGAISARGWIEWPGTSSSSVRELYFGEYANVG  6
             PWK YSR VVM+S I G I   GW EW      ++  LY+GEYAN G
Sbjct  457   PWKQYSRTVVMQSKIGGHIDPTGWAEWD--KEFALTTLYYGEYANRG  501



>emb|CDX83392.1| BnaA03g21140D [Brassica napus]
Length=445

 Score =   312 bits (799),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 179/388 (46%), Positives = 226/388 (58%), Gaps = 25/388 (6%)
 Frame = -2

Query  1166  CEELMGMARQRLNEALVAMKESPGKNRQEDIQTWLSAAVTFQQACKDWADQYAFSDELFA  987
             C +L      ++NE +    +   K  + D QTWLS A+T    C+    +   +D +  
Sbjct  34    CIKLYDFTVSKINETM----DPNVKCSKTDAQTWLSTALTNLDTCRAGFLELGVTDIVLP  89

Query  986   RISRSMDYQSQLASNALALVNRNTEISAAGRQLSEEdidddddggffpDWVSGRDLRLLE  807
              +S ++   S L  N LA+       +  G+               FP WV   D +LL+
Sbjct  90    LMSNNV---SNLICNTLAINKVPFNYTPPGKD-------------GFPSWVKPGDRKLLQ  133

Query  806   TTTDKTKANVVVAKDGTGNFRTVAEAIGAASGRQRFVIYVKSGVYKEKIRSSKDGITLIG  627
             ++T +   N VVAKDG+GNFRT+ +AI AASG  RFVIYVK GVY E +   K  + L G
Sbjct  134   SSTPRD--NAVVAKDGSGNFRTIKDAINAASGSGRFVIYVKQGVYSENLEIRKKNVMLRG  191

Query  626   DGKYSTIITWDDSVGGGSSLTGSATFGITGDGFIAKDIGFQNTAGPGAHQAVALTVASDH  447
             DGK  TIIT   SVGGGS+   SAT    GDGFIA+ I F+NTAG    QAVAL   SD 
Sbjct  192   DGKGRTIITGSRSVGGGSTTFNSATVAAVGDGFIARGITFRNTAGANNAQAVALRSGSDL  251

Query  446   SVFYRCSISGYQDTLYALSLRQFYRECDISGTVDFIFGNAAAVFQACNLVLRRP-SSYNV  270
             SVFY+CS  GYQDTLY  S RQFYR+CD+ GTVDFIFGNAAAV Q CN+  RRP S  N 
Sbjct  252   SVFYQCSFEGYQDTLYVHSNRQFYRDCDVYGTVDFIFGNAAAVLQNCNIFARRPRSRTNT  311

Query  269   ILANGRSDPGQNTGFSVQKCKITPGPDFSPVKNSYNSYLGRPWKPYSRAVVMESDIDGAI  90
             I A GRSDP QNTG  +   ++T   D  PV  S  +YLGRPW+ YSR V M++ +D  I
Sbjct  312   ITAQGRSDPNQNTGIIIHNSRVTAASDLRPVLGSTKTYLGRPWRQYSRTVFMKTSLDSLI  371

Query  89    SARGWIEWPGTSSSSVRELYFGEYANVG  6
               RGW+EW G  + S   L++ E+ N G
Sbjct  372   DPRGWLEWDGNFALST--LFYAEFQNTG  397



>ref|XP_009762395.1| PREDICTED: pectinesterase/pectinesterase inhibitor U1 [Nicotiana 
sylvestris]
Length=589

 Score =   316 bits (810),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 182/479 (38%), Positives = 272/479 (57%), Gaps = 29/479 (6%)
 Frame = -2

Query  1379  IRIQCGYTRFPRLCVQTLSGLVSGERVDFAAALLLNKTIAHADLHIA------HFDQLSS  1218
             ++  C  T  P LC  T++ +      DF+  +   K +    L+I       +F ++  
Sbjct  72    VKSACENTLHPELCYSTIASVS-----DFSKKVTSQKDVIELSLNITCRAVQHNFFKVEK  126

Query  1217  HFVSSQPPQPRLQ-AIGYCEELMGMARQRLNEALVAMKESPGKN----RQEDIQTWLSAA  1053
                + +  +PR + A+  C E +      L+ A+  ++  P K       +D++T +S+A
Sbjct  127   LIKTRKGLKPREKVALHDCLETIDETLDELHTAIKDLELYPNKKSLKAHADDLKTLISSA  186

Query  1052  VTFQQACKDWADQYAFSDELFARISRSMDYQSQLASNALALVNRNTEISAAGRQLSEEdi  873
             +T Q+ C D         ++   + +   +  ++ SNALA++   T+   A  Q  +   
Sbjct  187   ITNQETCLDGFSHDDADKKVRKALLKGQKHVEKMCSNALAMICNMTDTDIANEQKLKGTT  246

Query  872   dddddggffpDW---VSGRDLRLLETTTDKTKANVVVAKDGTGNFRTVAEAIGAASGR--  708
              +        +W   +S  D RLL+++T   + +VVVA DG+GNF+TV+EA+  A  +  
Sbjct  247   TNRKLREDNSEWPEWLSAGDRRLLQSST--VRPDVVVAADGSGNFKTVSEAVAKAPEKSS  304

Query  707   QRFVIYVKSGVYKEKIR--SSKDGITLIGDGKYSTIITWDDSVGGGSSLTGSATFGITGD  534
             +R+VI +K+GVY+E +     K  I  +GDG+ +TIIT   +V  GS+   SAT    G+
Sbjct  305   KRYVIRIKAGVYRENVDVPKKKTNIMFMGDGRSNTIITGSRNVKDGSTTFHSATVAAVGE  364

Query  533   GFIAKDIGFQNTAGPGAHQAVALTVASDHSVFYRCSISGYQDTLYALSLRQFYRECDISG  354
              F+A+DI FQNTAG   HQAVAL V SD S FYRC I  YQD+LY  S RQ++ +C I+G
Sbjct  365   KFLARDITFQNTAGAAKHQAVALRVGSDLSAFYRCDILAYQDSLYVHSNRQYFVQCLIAG  424

Query  353   TVDFIFGNAAAVFQACNLVLRRPSS--YNVILANGRSDPGQNTGFSVQKCKITPGPDFSP  180
             TVDFIFGNAAAV Q C++  RRP S   N++ A GRSDP QNTG  +QKC+I    D  P
Sbjct  425   TVDFIFGNAAAVLQDCDIHARRPGSGQKNMVTAQGRSDPNQNTGIVIQKCRIGATSDLRP  484

Query  179   VKNSYNSYLGRPWKPYSRAVVMESDIDGAISARGWIEWPGTSSSSVRELYFGEYANVGA  3
             V+ S+ +YLGRPWK YSR V+M+S I   I++ GW EW G  + ++  L++GEY N GA
Sbjct  485   VQKSFPTYLGRPWKEYSRTVIMQSSITDVINSAGWHEWNG--NFALNTLFYGEYQNTGA  541



>ref|NP_001275775.1| pectinesterase 2 precursor [Citrus sinensis]
 gb|AAB57671.1| pectinesterase [Citrus sinensis]
Length=510

 Score =   314 bits (804),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 174/390 (45%), Positives = 233/390 (60%), Gaps = 29/390 (7%)
 Frame = -2

Query  1166  CEELMGMARQRLNEALVAMKESPGKNRQEDIQTWLSAAVTFQQACKDWADQYAFSDELFA  987
             C EL  +   +LN+       SPG  +  D QTWLS+A+T  + C+   +     + +  
Sbjct  98    CRELYELTVLKLNQT---SNSSPGCTKV-DKQTWLSSALTNLETCRASLEDLGVPEYVLP  153

Query  986   RISRSMDYQSQLASNALALVNRNTEISAAGRQLSEEdidddddggffpDWVSGRDLRLLE  807
              +S ++   ++L SNAL+L              ++   ++      FP WV   D +LL+
Sbjct  154   LLSNNV---TKLISNALSL--------------NKVPYNEPSYKDGFPTWVKPGDRKLLQ  196

Query  806   TTTDKTKANVVVAKDGTGNFRTVAEAIGAAS--GRQRFVIYVKSGVYKEKIRSSKDGITL  633
             TT    +AN+VVA+DG+GN +T+ EA+ AAS  G  R+VIY+K+G Y E I      I  
Sbjct  197   TTP---RANIVVAQDGSGNVKTIQEAVAAASRAGGSRYVIYIKAGTYNENIEVKLKNIMF  253

Query  632   IGDGKYSTIITWDDSVGGGSSLTGSATFGITGDGFIAKDIGFQNTAGPGAHQAVALTVAS  453
             +GDG   TIIT   SVGGG++   SAT  + GD FIA+DI  +NTAGP  HQAVAL   S
Sbjct  254   VGDGIGKTIITGSKSVGGGATTFKSATVAVVGDNFIARDITIRNTAGPNNHQAVALRSGS  313

Query  452   DHSVFYRCSISGYQDTLYALSLRQFYRECDISGTVDFIFGNAAAVFQACNLVLRRPSS-Y  276
             D SVFYRCS  GYQDTLY  S RQFYRECDI GTVDFIFGNAA V Q CN+  R P +  
Sbjct  314   DLSVFYRCSFEGYQDTLYVHSQRQFYRECDIYGTVDFIFGNAAVVLQNCNIFARXPPNRT  373

Query  275   NVILANGRSDPGQNTGFSVQKCKITPGPDFSPVKNSYNSYLGRPWKPYSRAVVMESDIDG  96
             N + A GR+DP QNTG  +  C++T   D  PV++S  ++LGRPWK YSR V +++ +D 
Sbjct  374   NTLTAQGRTDPNQNTGIIIHNCRVTAASDLKPVQSSVKTFLGRPWKQYSRTVXIKTFLDS  433

Query  95    AISARGWIEWPGTSSSSVRELYFGEYANVG  6
              I+  GW+EW G    ++  LY+ EY N G
Sbjct  434   LINPAGWMEWSG--DFALNTLYYAEYMNTG  461



>ref|XP_008389982.1| PREDICTED: pectinesterase [Malus domestica]
 ref|XP_008367067.1| PREDICTED: pectinesterase-like [Malus domestica]
Length=537

 Score =   315 bits (806),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 189/480 (39%), Positives = 270/480 (56%), Gaps = 33/480 (7%)
 Frame = -2

Query  1382  QIRIQCGYTRFPRLC-----VQTLSGLVSGERVDFAAALLLNKTIAHADLHIAHFDQLSS  1218
             +I   C  T  P++C        LS L   +R  F   L+L  T+  A         L+ 
Sbjct  23    RITAPCSQTPHPQVCHHYINTNLLSTLDYQQRFSFRD-LVLKATMEQAIKAHQLVSSLNL  81

Query  1217  HFVSSQPPQPRLQAIGYCEELMGMARQRLNEALVAMKESPGKNRQEDIQTWLSAAVTFQQ  1038
             + +     + +L A   C EL      +LN ++       G +   D  TWLSA++   +
Sbjct  82    NSLDGDDERAKL-ACNDCLELYEDTVDKLNRSI-------GSSNXFDANTWLSASLANLK  133

Query  1037  ACKDWADQYAFSDELFARISRSMDYQSQLA---SNALALVNRNTEISAAGRQLSEEdidd  867
              C++    +  S          +   S L+   SN+L++   +T  SA     S++    
Sbjct  134   TCQNGFVDFNISSSHLQSFPNYVTLSSNLSKMLSNSLSVHKVSTFPSAL--HFSKQVRGR  191

Query  866   dddggffp---DWVSGRDLRLLETTTDKTKANVVVAKDGTGNFRTVAEAIGAAS-----G  711
                        +WVS  D RLL++ +   KA+++VA+DG+GN+++++EA+ +A       
Sbjct  192   RRTLLSDDGFPEWVSAADRRLLQSGSSGPKADMIVAQDGSGNYKSISEAVNSAHKLRSGA  251

Query  710   RQRFVIYVKSGVYKE--KIRSSKDGITLIGDGKYSTIITWDDSVGGGSSLTGSATFGITG  537
              +RFVI+VK+GVY+E  +I+ +   I  IGDG  +TI+T + +   GS+   SATFG+TG
Sbjct  252   TKRFVIHVKAGVYRENVEIKKTMKNIMFIGDGIDATIVTGNKNSQDGSTTYRSATFGVTG  311

Query  536   DGFIAKDIGFQNTAGPGAHQAVALTVASDHSVFYRCSISGYQDTLYALSLRQFYRECDIS  357
             +GFIA+D+ F+NTAGP  HQAVAL  +SDHSVFYRCS  GYQDTLY  S RQFYR+CDI 
Sbjct  312   EGFIAQDMTFENTAGPQKHQAVALRSSSDHSVFYRCSFKGYQDTLYVHSQRQFYRDCDIH  371

Query  356   GTVDFIFGNAAAVFQACNLVLRRPSS--YNVILANGRSDPGQNTGFSVQKCKITPGPDFS  183
             GTVDFI G+A AV Q CN+  R+P S   N I A  R+DP +NTG  +   +IT   D  
Sbjct  372   GTVDFICGDATAVLQNCNIYARKPMSNQINTITAQSRTDPNENTGIVIHNSRITAAQDLR  431

Query  182   PVKNSYNSYLGRPWKPYSRAVVMESDIDGAISARGWIEWPGTSSSSVRELYFGEYANVGA  3
             PV+ S+ +YLGRPWK YSR V+M+S++DG I   GW  W G  S ++  LY+GEY N GA
Sbjct  432   PVQGSFKTYLGRPWKKYSRTVIMKSNLDGLIDPAGWFPWSG--SFALSTLYYGEYMNSGA  489



>ref|XP_011030843.1| PREDICTED: pectinesterase-like [Populus euphratica]
Length=550

 Score =   315 bits (807),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 183/467 (39%), Positives = 255/467 (55%), Gaps = 35/467 (7%)
 Frame = -2

Query  1367  CGYTRFPRLCVQTLSGLVSGERVDFAAALLLNKTIAHADLHIAHFDQLSSHFVSSQPPQP  1188
             C     P+ C+  LS  VS E V  +  + L KT     L      + +++ V+S+    
Sbjct  57    CNQAHDPQECLSILSEAVSTEGVQESNGVGLLKTFLVKSLSQMRMAKAAANAVNSKINDH  116

Query  1187  RLQA-IGYCEELMGMARQRLNEALVAMKESPGKNRQEDIQTWLSAAVTFQQACKDWAD--  1017
             + QA +  C ELM M+  R+ + L A+     ++   D  TWLS  +T    C D  D  
Sbjct  117   KHQAALADCVELMDMSIDRVTDTLSALGNWGSQSDASDANTWLSGVLTNHVTCLDGVDTI  176

Query  1016  ----QYAFSDELFARISRSMDYQSQLASNALALVNRNTEISAAGRQLSEEdidddddggf  849
                       +L +R+  S+   S L+++   LV                        G 
Sbjct  177   DQPSMKKLLQDLISRMRTSLATVSSLSASDTDLVQ--------------------PLNGG  216

Query  848   fpDWVSGRDLRLLETTTDKTKANVVVAKDGTGNFRTVAEAIGAA--SGRQRFVIYVKSGV  675
             FP W+ GRD +LLE++    +ANV+VA+DG+G++ T+ EA+ +     + R+VI+VKSG+
Sbjct  217   FPSWILGRDRKLLESSVSNVEANVIVAQDGSGDYTTIQEAVNSVPDKSKSRYVIHVKSGI  276

Query  674   YKEKIR--SSKDGITLIGDGKYSTIITWDDSVGGGSSLTGSATFGITGDGFIAKDIGFQN  501
             YKE +     K  + ++GDG   TI+T + +V  GS+   SAT  + GDGFI +DI  QN
Sbjct  277   YKENVEVGKKKKNVMIVGDGMDFTILTGNLNVVDGSTTFRSATLAVAGDGFILQDIWIQN  336

Query  500   TAGPGAHQAVALTVASDHSVFYRCSISGYQDTLYALSLRQFYRECDISGTVDFIFGNAAA  321
             TAGP  HQAVAL V++D SV  RC I  YQDTLY  + RQFYR+C I GT+DFIFGN A 
Sbjct  337   TAGPEKHQAVALRVSADQSVINRCRIDAYQDTLYTHNYRQFYRDCSIIGTIDFIFGNGAV  396

Query  320   VFQACNLVLRRP--SSYNVILANGRSDPGQNTGFSVQKCKITPGPDFSPVKNSYNSYLGR  147
             V Q C ++ R+P  +  N++ A GR DP QNTG S+Q C I    D    +N + +YLGR
Sbjct  397   VLQNCQIISRKPMANQKNMVTAQGRIDPNQNTGISIQNCDIVASSDLESDQNKFPTYLGR  456

Query  146   PWKPYSRAVVMESDIDGAISARGWIEWPGTSSSSVRELYFGEYANVG  6
             PWK YSR VVM+S I G I   GW EW      ++  LY+GEYAN G
Sbjct  457   PWKQYSRTVVMQSKIGGHIDPTGWAEWD--KEFALTTLYYGEYANRG  501



>ref|XP_006397702.1| hypothetical protein EUTSA_v10001409mg [Eutrema salsugineum]
 gb|ESQ39155.1| hypothetical protein EUTSA_v10001409mg [Eutrema salsugineum]
Length=511

 Score =   314 bits (804),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 178/388 (46%), Positives = 228/388 (59%), Gaps = 25/388 (6%)
 Frame = -2

Query  1166  CEELMGMARQRLNEALVAMKESPGKNRQEDIQTWLSAAVTFQQACKDWADQYAFSDELFA  987
             C +L  +   ++NE +    +   K  + D QTWLS A+T    C+    +   +D +  
Sbjct  100   CLKLYDLTVSKINETM----DPNVKCSKTDAQTWLSTALTNLDTCRAGFLELGVTDIVLP  155

Query  986   RISRSMDYQSQLASNALALVNRNTEISAAGRQLSEEdidddddggffpDWVSGRDLRLLE  807
              IS ++   S L  N LA+       +   +               FP WV   D +LL+
Sbjct  156   LISNNV---SNLICNTLAINKVPFNYTPPEKD-------------GFPSWVKPGDRKLLQ  199

Query  806   TTTDKTKANVVVAKDGTGNFRTVAEAIGAASGRQRFVIYVKSGVYKEKIRSSKDGITLIG  627
             ++T +   N VVAKDG+GNFRT+ +AI AA G  RFVIYVK GVY E +   K  I L G
Sbjct  200   SSTPRD--NAVVAKDGSGNFRTIKDAINAAKGSGRFVIYVKQGVYSENLEIRKKNIMLRG  257

Query  626   DGKYSTIITWDDSVGGGSSLTGSATFGITGDGFIAKDIGFQNTAGPGAHQAVALTVASDH  447
             DGK  TIIT   SVGGG++   SAT    GDGFIA+ I F+NTAG    QAVAL   SD 
Sbjct  258   DGKGRTIITGSRSVGGGTTTFNSATVAAVGDGFIARGITFRNTAGANNAQAVALRSGSDL  317

Query  446   SVFYRCSISGYQDTLYALSLRQFYRECDISGTVDFIFGNAAAVFQACNLVLRRP-SSYNV  270
             SVFY+CS  GYQDTLY  S RQFYR+CD+ GTVDFIFGNAAAV Q CN+  RRP S  N 
Sbjct  318   SVFYQCSFEGYQDTLYVHSNRQFYRDCDVYGTVDFIFGNAAAVLQNCNIFARRPRSRTNT  377

Query  269   ILANGRSDPGQNTGFSVQKCKITPGPDFSPVKNSYNSYLGRPWKPYSRAVVMESDIDGAI  90
             I A GRSDP QNTG  +   ++T   D  P+  S  +YLGRPW+ YSR V M++ +DG I
Sbjct  378   ITAQGRSDPNQNTGIIIHNSRVTAASDLRPILGSTKTYLGRPWRQYSRTVFMKTFLDGLI  437

Query  89    SARGWIEWPGTSSSSVRELYFGEYANVG  6
               RGW+EW G  + ++R L++ E+ N G
Sbjct  438   DPRGWLEWDG--NFALRTLFYAEFQNTG  463



>ref|XP_011015792.1| PREDICTED: LOW QUALITY PROTEIN: putative pectinesterase/pectinesterase 
inhibitor 45 [Populus euphratica]
Length=593

 Score =   316 bits (810),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 183/477 (38%), Positives = 264/477 (55%), Gaps = 27/477 (6%)
 Frame = -2

Query  1379  IRIQCGYTRFPRLCVQTLSGLVSGERVDFAAALLLNKTIAHADLHIAHFDQLSSHFVSSQ  1200
             I+  C  T +   C +TL   V  +        LL   I  AD  I    + +S F    
Sbjct  79    IKTVCNATTYQETCQKTLEKEVEKDPSSAQPKNLLKIAIKAADEEIKKVLKKASSFKFDD  138

Query  1199  PPQPRLQAIGYCEELMGMARQRLNEALVAMKESPGK--NRQEDIQTWLSAAVTFQQACKD  1026
             P +    A   C EL+  A++ L +++  + +  GK      D+  WLSA +++QQ C D
Sbjct  139   PREK--AAFEDCLELVENAKEELKDSVAHVGDDLGKLVKNAPDLNNWLSAVMSYQQTCID  196

Query  1025  WADQYAFSD-ELFARISRSMDYQSQLASNALALVN------RNTEISAA--GRQLSEEdi  873
                   F + +L + + ++     +  SN+LA+V+      +N     A   R L++ED 
Sbjct  197   -----GFPEGKLKSDMEKTFKASKEFTSNSLAMVSSLTSFMKNFPFPGALNRRLLAKEDN  251

Query  872   dddddggffpDWVSGRDLRLLE-TTTDKTKANVVVAKDGTGNFRTVAEAIGAASGRQ--R  702
                 +    P W+S  D R+L+  + DK K NV VAKDG+G+F+T++EA+ A   +   R
Sbjct  252   SPALNKDDLPGWMSNEDRRILKGASKDKPKPNVTVAKDGSGDFKTISEALAAMPAKYQGR  311

Query  701   FVIYVKSGVYKEKIRSSKD--GITLIGDGKYSTIITWDDSVGGGSSLTGSATFGITGDGF  528
             +VI+VK G+Y E +  +K    IT+ GDG   TI+T + +   G     +ATF + GDGF
Sbjct  312   YVIFVKQGIYDETVTVTKKMANITIYGDGSQKTIVTGNKNFADGVQTFRTATFAVXGDGF  371

Query  527   IAKDIGFQNTAGPGAHQAVALTVASDHSVFYRCSISGYQDTLYALSLRQFYRECDISGTV  348
             + K +GF+NTAGP  HQAVA+ V +D ++F  C   GYQDTLYA + RQFYR C I+GTV
Sbjct  372   LCKTMGFRNTAGPEKHQAVAIRVQADRAIFLNCRFEGYQDTLYAQTHRQFYRSCVITGTV  431

Query  347   DFIFGNAAAVFQACNLVLRRP--SSYNVILANGRSDPGQNTGFSVQKCKITPGPDFSPVK  174
             DFIFG+AAA+FQ C + +R+P  +  N+I A GR D  + TG  +Q C+I P  D  PVK
Sbjct  432   DFIFGDAAAIFQNCLITVRKPLENQQNLITAQGRVDGHETTGIVLQNCRIEPDKDLVPVK  491

Query  173   NSYNSYLGRPWKPYSRAVVMESDIDGAISARGWIEWPGTSSSSVRELYFGEYANVGA  3
                 SYLGRPWK +SR ++MES I   I   GW+ W G     ++ LY+ EY N GA
Sbjct  492   TKIRSYLGRPWKEFSRTIIMESTIGDFIHPDGWLPWQG--EFGLKTLYYAEYNNKGA  546



>ref|XP_002518523.1| Pectinesterase precursor, putative [Ricinus communis]
 gb|EEF43910.1| Pectinesterase precursor, putative [Ricinus communis]
Length=547

 Score =   315 bits (806),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 194/437 (44%), Positives = 254/437 (58%), Gaps = 35/437 (8%)
 Frame = -2

Query  1283  LLLNKTIAHADLHIAHFDQLSSHFVSSQPPQPRLQA-IGYCEELMGMARQRLNEALVAMK  1107
             +LL K+ +H    I     L ++ V      P  QA +  C +LM ++  ++  +++A+ 
Sbjct  88    VLLTKSTSHIQNAI-----LEANHVRIMINDPVNQAALVDCVDLMELSLDKIKNSVLAL-  141

Query  1106  ESPGKNRQEDIQTWLSAAVTFQQACKDWADQYAFSDE---LFARISRSMDYQSQLASNAL  936
             ++   +   D  +WLS  +T    C D     A S     L   I+R        A  +L
Sbjct  142   DNVTTDSHADAHSWLSTVLTNHVTCLDGLKGLARSTMEPGLKDIITR--------ARTSL  193

Query  935   ALVNRNTEISAAGRQLSEEdidddddggffpDWVSGRDLRLLETTTDKTKANVVVAKDGT  756
             A+V     IS A   L           G FP WV+ +D +LLE++     A+V+VAKDG+
Sbjct  194   AMV---VAISPAKNDL------ISPLNGDFPSWVTSKDRKLLESSGKNINADVIVAKDGS  244

Query  755   GNFRTVAEAIGAA--SGRQRFVIYVKSGVYKEKIR--SSKDGITLIGDGKYSTIITWDDS  588
             G ++TV EA+ AA  +G+ R+VIYVK G YKE +   +SK  I L+GD   STIIT   +
Sbjct  245   GKYKTVKEAVAAAPNNGKTRYVIYVKKGTYKENVEIGNSKKNIMLVGDSMDSTIITGSLN  304

Query  587   VGGGSSLTGSATFGITGDGFIAKDIGFQNTAGPGAHQAVALTVASDHSVFYRCSISGYQD  408
             V  GS+   SAT    GDGFIA+DI FQNTAGP  HQAVAL V SD SV  RC I  YQD
Sbjct  305   VVDGSTTFNSATVAAVGDGFIAQDIWFQNTAGPQKHQAVALRVGSDQSVINRCRIDAYQD  364

Query  407   TLYALSLRQFYRECDISGTVDFIFGNAAAVFQACNLVLRRPSS--YNVILANGRSDPGQN  234
             TLYA S R FYR+  I+GTVDFIFGNAAAVFQ C +V R+P +   N++ A GR+DP QN
Sbjct  365   TLYAHSDRHFYRDSFITGTVDFIFGNAAAVFQNCKIVARKPMAGQKNMVTAQGRTDPNQN  424

Query  233   TGFSVQKCKITPGPDFSPVKNSYNSYLGRPWKPYSRAVVMESDIDGAISARGWIEWPGTS  54
             TG S+QKC +    D  PVK S+ SYLGRPWK YSR VVM+S+I   I   GW  W G  
Sbjct  425   TGTSIQKCDVIASSDLQPVKGSFPSYLGRPWKEYSRTVVMQSNIGDHIDPAGWSIWDG--  482

Query  53    SSSVRELYFGEYANVGA  3
               +++ LY+GEY N GA
Sbjct  483   EFALKTLYYGEYMNKGA  499



>gb|KHN21591.1| Putative pectinesterase/pectinesterase inhibitor 6 [Glycine soja]
Length=521

 Score =   313 bits (803),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 186/479 (39%), Positives = 270/479 (56%), Gaps = 47/479 (10%)
 Frame = -2

Query  1376  RIQCGYTRFPRLCVQ------TLSGLVSGE--------RVDFAAALLLNKTIAHADLHIA  1239
             +  C  T +PR+C+       TLS L +          RV    A++ +K ++  DL+  
Sbjct  22    QFSCNETPYPRVCMHYIETTNTLSTLDASSSSFHDLALRVTMEQAIVAHKLVSKMDLN--  79

Query  1238  HFDQLSSHFVSSQPPQPRLQAIGYCEELMGMARQRLNEALVAMKESPGKNRQEDIQTWLS  1059
                    +F   +       A   C EL         + L  +K S   N+  D  TW S
Sbjct  80    -------NFKDKRAKS----AWEDCLEL-------YEDTLYQLKRSMNSNKLNDRLTWQS  121

Query  1058  AAVTFQQACKDWADQYAFSDELFARISRSMDYQSQLASNALALVNRNTEISAAGRQLSEE  879
             A++   Q C++   ++     L    S   ++ S+L SN+L+ +++   ++       + 
Sbjct  122   ASIANHQTCQNGFTEFNLPSHLNYFPSMLSNF-SKLLSNSLS-ISKTMMMTLTTSSTKQS  179

Query  878   didddddggffpDWVSGRDLRLLETTTDKTKANVVVAKDGTGNFRTVAEAIGAA---SGR  708
                       FP W+S  D RLL+ TT   KA+VVVA+DG+GN++T++E + AA   SG+
Sbjct  180   GGRRLLLSDGFPYWLSHSDRRLLQETT--PKADVVVAQDGSGNYKTISEGVAAAAKLSGK  237

Query  707   QRFVIYVKSGVYKEKI--RSSKDGITLIGDGKYSTIITWDDSVGGGSSLTGSATFGITGD  534
              R V++VK+GVYK+ I  + +   + +IGDG  +TI+T + +   GS+   SATF ++GD
Sbjct  238   GRVVVHVKAGVYKDSIDIKRTVKNLMIIGDGMGATIVTGNLNAQDGSTTFRSATFAVSGD  297

Query  533   GFIAKDIGFQNTAGPGAHQAVALTVASDHSVFYRCSISGYQDTLYALSLRQFYRECDISG  354
             GFIA+DI F+NTAGP  HQAVAL   +DHSVFYRCS  GYQDTLY  + RQFYR+CDI G
Sbjct  298   GFIARDITFENTAGPQQHQAVALRSGADHSVFYRCSFMGYQDTLYVYANRQFYRDCDIYG  357

Query  353   TVDFIFGNAAAVFQACNLVLRRPSS--YNVILANGRSDPGQNTGFSVQKCKITPGPDFSP  180
             T+DFIFG+A  V Q CN+ +R+P S   N + A  R+DP +NTG  +  C+IT   D   
Sbjct  358   TIDFIFGDAVTVLQNCNIYVRKPMSNQQNTVTAQARTDPNENTGIIIHNCRITAAGDLIA  417

Query  179   VKNSYNSYLGRPWKPYSRAVVMESDIDGAISARGWIEWPGTSSSSVRELYFGEYANVGA  3
             V+ S+ ++LGRPW+ YSR VVM+S +DG I   GW  W G  +  +  LY+ EYAN GA
Sbjct  418   VQGSFKTFLGRPWQKYSRTVVMKSALDGLIDPAGWSPWSG--NFGLSSLYYAEYANTGA  474



>ref|XP_006580436.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 6-like 
[Glycine max]
Length=521

 Score =   313 bits (803),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 186/479 (39%), Positives = 270/479 (56%), Gaps = 47/479 (10%)
 Frame = -2

Query  1376  RIQCGYTRFPRLCVQ------TLSGLVSGE--------RVDFAAALLLNKTIAHADLHIA  1239
             +  C  T +PR+C+       TLS L +          RV    A++ +K ++  DL+  
Sbjct  22    QFSCNETPYPRVCMHYIETTNTLSTLDASSSSFHDLALRVTMEQAIVAHKLVSKMDLN--  79

Query  1238  HFDQLSSHFVSSQPPQPRLQAIGYCEELMGMARQRLNEALVAMKESPGKNRQEDIQTWLS  1059
                    +F   +       A   C EL         + L  +K S   N+  D  TW S
Sbjct  80    -------NFKDKRAKS----AWEDCLEL-------YEDTLYQLKRSMNSNKLNDRLTWQS  121

Query  1058  AAVTFQQACKDWADQYAFSDELFARISRSMDYQSQLASNALALVNRNTEISAAGRQLSEE  879
             A++   Q C++   ++     L    S   ++ S+L SN+L+ +++   ++       + 
Sbjct  122   ASIANHQTCQNGFTEFNLPSHLNYFPSMLSNF-SKLLSNSLS-ISKTMMMTLTTSSTKQS  179

Query  878   didddddggffpDWVSGRDLRLLETTTDKTKANVVVAKDGTGNFRTVAEAIGAA---SGR  708
                       FP W+S  D RLL+ TT   KA+VVVA+DG+GN++T++E + AA   SG+
Sbjct  180   GGRRLLLSDGFPYWLSHSDRRLLQETT--PKADVVVAQDGSGNYKTISEGVAAAAKLSGK  237

Query  707   QRFVIYVKSGVYKEKI--RSSKDGITLIGDGKYSTIITWDDSVGGGSSLTGSATFGITGD  534
              R V++VK+GVYK+ I  + +   + +IGDG  +TI+T + +   GS+   SATF ++GD
Sbjct  238   GRVVVHVKAGVYKDSIDIKRTVKNLMIIGDGMGATIVTGNLNAQDGSTTFRSATFAVSGD  297

Query  533   GFIAKDIGFQNTAGPGAHQAVALTVASDHSVFYRCSISGYQDTLYALSLRQFYRECDISG  354
             GFIA+DI F+NTAGP  HQAVAL   +DHSVFYRCS  GYQDTLY  + RQFYR+CDI G
Sbjct  298   GFIARDITFENTAGPQQHQAVALRSGADHSVFYRCSFMGYQDTLYVYANRQFYRDCDIYG  357

Query  353   TVDFIFGNAAAVFQACNLVLRRPSS--YNVILANGRSDPGQNTGFSVQKCKITPGPDFSP  180
             T+DFIFG+A  V Q CN+ +R+P S   N + A  R+DP +NTG  +  C+IT   D   
Sbjct  358   TIDFIFGDAVTVLQNCNIYVRKPMSNQQNTVTAQARTDPNENTGIIIHNCRITAAGDLIA  417

Query  179   VKNSYNSYLGRPWKPYSRAVVMESDIDGAISARGWIEWPGTSSSSVRELYFGEYANVGA  3
             V+ S+ ++LGRPW+ YSR VVM+S +DG I   GW  W G  +  +  LY+ EYAN GA
Sbjct  418   VQGSFKTFLGRPWQKYSRTVVMKSALDGLIDPAGWSPWSG--NFGLSSLYYAEYANTGA  474



>ref|XP_002304257.2| pectinesterase family protein [Populus trichocarpa]
 gb|EEE79236.2| pectinesterase family protein [Populus trichocarpa]
Length=584

 Score =   315 bits (808),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 185/482 (38%), Positives = 270/482 (56%), Gaps = 36/482 (7%)
 Frame = -2

Query  1379  IRIQCGYTRFPRLC---VQTLSG----LVSGERVDFAAALLLNKTIAHADLHIAHFDQLS  1221
             ++  C  T +P LC   V T+ G    L S + V   +  L  K + H      +F  + 
Sbjct  68    LKSSCSSTLYPELCYSAVATVPGATSNLASQKDVIELSINLTTKAVQH------NFFTVE  121

Query  1220  SHFVSSQPPQPRLQAIGYCEELMGMARQRLNEALVAMKESPG----KNRQEDIQTWLSAA  1053
                 + +  +    A+  C E++      L+EALV + + P     K   +D++T LS+A
Sbjct  122   KLIATKKLTKREKTALHDCLEIIDETLDELHEALVDLNDYPNNKSLKKHADDLKTLLSSA  181

Query  1052  VTFQQACKDWADQYAFSDELFARISRSMDYQSQLASNALALVNRNT------EISAAGRQ  891
             +T Q+ C D         ++   + +   +  ++ SN LA++   T      E+    R+
Sbjct  182   ITNQETCLDGFSHDEADKKVRKALLKGQIHVEKMCSNVLAMIKNMTDTDVANELKTTNRK  241

Query  890   LSEEdidddddggffpDWVSGRDLRLLETTTDKTKANVVVAKDGTGNFRTVAEAIGAASG  711
             L +E   ++ +      W+S  D RLL++++     +VVVA DG+GN++TV+ A+ AA  
Sbjct  242   LMQEKEGNESEWPE---WMSVADRRLLQSSS--VTPDVVVAADGSGNYKTVSAAVAAAPK  296

Query  710   R--QRFVIYVKSGVYKEKIRSSKD--GITLIGDGKYSTIITWDDSVGGGSSLTGSATFGI  543
             +  +R++I +K+GVY+E +   KD   I  +GDG+ +TIIT   +V  GS+   SAT   
Sbjct  297   KSSKRYIIRIKAGVYRENVDVPKDKTNIMFMGDGRKTTIITASRNVVDGSTTFNSATVAA  356

Query  542   TGDGFIAKDIGFQNTAGPGAHQAVALTVASDHSVFYRCSISGYQDTLYALSLRQFYRECD  363
              G GF+A+ I FQNTAGP  HQAVAL V SD S FY C +  YQDTLY  S RQF+  C 
Sbjct  357   VGQGFLARGITFQNTAGPSKHQAVALRVGSDLSAFYDCDMLAYQDTLYVHSNRQFFINCL  416

Query  362   ISGTVDFIFGNAAAVFQACNLVLRRPSS--YNVILANGRSDPGQNTGFSVQKCKITPGPD  189
             ++GTVDFIFGNAA V Q C++  RRP+S   N++ A GR+DP QNTG  +QK +I    D
Sbjct  417   VAGTVDFIFGNAAVVLQDCDIHARRPNSGQKNMVTAQGRTDPNQNTGIVIQKSRIGATSD  476

Query  188   FSPVKNSYNSYLGRPWKPYSRAVVMESDIDGAISARGWIEWPGTSSSSVRELYFGEYANV  9
               PVK+S+ +YLGRPWK YSR V+M+S I   I   GW EW G  S ++  LY+ EY N 
Sbjct  477   LQPVKSSFPTYLGRPWKEYSRTVIMQSSITDVIQPAGWFEWSG--SFALNTLYYAEYQNS  534

Query  8     GA  3
             GA
Sbjct  535   GA  536



>ref|XP_002301486.2| hypothetical protein POPTR_0002s20370g [Populus trichocarpa]
 gb|EEE80759.2| hypothetical protein POPTR_0002s20370g [Populus trichocarpa]
Length=558

 Score =   315 bits (806),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 191/466 (41%), Positives = 267/466 (57%), Gaps = 25/466 (5%)
 Frame = -2

Query  1367  CGYTRFPRLCVQTL---SGLVSGERVDFAAALLLNKTIAHADLHIAHFDQLSSHFVSSQP  1197
             C  T +P LCV TL     L S    +F +A L NKT+       A  + + +       
Sbjct  56    CKGTLYPELCVSTLVSLPDLASKSLQEFISATL-NKTMDEVRASSADCNAIRNKM--KLG  112

Query  1196  PQPRLQAIGYCEELMGMARQRLNEAL--VAMKESPGKNRQEDIQTWLSAAVTFQQACKDW  1023
             P  ++ A+  C EL       L  A+  +A+++ P      D+QT LS A+T Q  C   
Sbjct  113   PLEKV-ALKDCIELFDDTIAELKSAISNLALRK-PTSKHYHDLQTLLSGAMTNQYTC---  167

Query  1022  ADQYAFSD-ELFARISRSMDYQSQLASNALALVNRNTEISAAGRQLSEEdidddddggff  846
              D +A S  ++   I + +   S   SN+LA++ +   ++A+  ++  E  +        
Sbjct  168   LDGFARSKGKVRKAIKKGLYNISHHVSNSLAMLKKIPGVNASKSEVFPEYGNVKHGFPS-  226

Query  845   pDWVSGRDLRLLETTTDKTKANVVVAKDGTGNFRTVAEAIGAA--SGRQRFVIYVKSGVY  672
               W+S +D +LL+ + + TK +++VAKDGTGNF T++EA+ AA  S   RFVI++K+G Y
Sbjct  227   --WLSTKDRKLLQASANATKFDLIVAKDGTGNFTTISEAVRAAPNSSDTRFVIHIKAGAY  284

Query  671   KE--KIRSSKDGITLIGDGKYSTIITWDDSVGGGSSLTGSATFGITGDGFIAKDIGFQNT  498
              E  ++   K  +  IGDG   T++  + SV  G +   SAT  + GDGFIAK I F+N+
Sbjct  285   FENVEVERKKKMLVFIGDGIGKTVVKANRSVVDGWTTFRSATVAVVGDGFIAKGITFENS  344

Query  497   AGPGAHQAVALTVASDHSVFYRCSISGYQDTLYALSLRQFYRECDISGTVDFIFGNAAAV  318
             AGP  HQAVAL   SD S FY+CS  GYQDTLY  +LRQFYRECDI GT+DFIFGNAA V
Sbjct  345   AGPSKHQAVALRSGSDLSAFYQCSFVGYQDTLYVHTLRQFYRECDIYGTIDFIFGNAAVV  404

Query  317   FQACNLVLRRPSS--YNVILANGRSDPGQNTGFSVQKCKITPGPDFSPVKNSYNSYLGRP  144
             FQ  NL  R+P+S   N+  A GR DP QNTG S+  CK+    D  PVK+S+ ++LGRP
Sbjct  405   FQNSNLYARKPNSNQKNIFTAQGREDPNQNTGISILNCKVAAAADLIPVKSSFQTFLGRP  464

Query  143   WKPYSRAVVMESDIDGAISARGWIEWPGTSSSSVRELYFGEYANVG  6
             WK YSR V + S ID  +   GW+EW   +S ++  LY+ EY N G
Sbjct  465   WKEYSRTVFLRSYIDDLVDPAGWLEW--NASFALSTLYYREYMNRG  508



>ref|XP_006843574.1| hypothetical protein AMTR_s00007p00101250 [Amborella trichopoda]
 gb|ERN05249.1| hypothetical protein AMTR_s00007p00101250 [Amborella trichopoda]
Length=553

 Score =   315 bits (806),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 185/438 (42%), Positives = 259/438 (59%), Gaps = 28/438 (6%)
 Frame = -2

Query  1283  LLLNKTIAHADLHIAHFDQLSSHFVSSQPPQPRLQAIGYCEELMGMARQRLNEALVAMKE  1104
             LLL+  I  + LHI +   LS        PQ + Q    C EL+  AR RL E   A++ 
Sbjct  83    LLLHHLIHSSLLHINNALSLSK-------PQ-KHQPFADCTELLDQARDRLLETRAALR-  133

Query  1103  SPGKNRQEDIQTWLSAAVTFQQACKDWADQYAFSDELFARISRSMDYQ----SQLASNAL  936
             +P      +  TWLSA +T    C+D  ++     +L A+ +++M         +AS +L
Sbjct  134   TPSPLSLAEAHTWLSATLTNYITCEDGLNE--GKTKLEAKATKAMVVALGECKAMASTSL  191

Query  935   ALVN--RNTEISAAGRQLSEEdidddddggffpDWVSGRDLRLLETTTDKTKANVVVAKD  762
             A ++  RN   +    + S  +   +      P WV   + RLLE+   + KA+VVVAKD
Sbjct  192   ATISAMRN---ALGSTEASGYEPMIEVGSTRLPAWVRDIETRLLESKVSEIKADVVVAKD  248

Query  761   GTGNFRTVAEAIGAA--SGRQRFVIYVKSGVYKEKIR--SSKDGITLIGDGKYSTIITWD  594
             G+GN++TV+EA+ AA    ++R+VIYVK G Y+EK+    +K  + L+GDG   T+IT  
Sbjct  249   GSGNYKTVSEAVAAAPDKSKKRYVIYVKKGTYEEKVEIGKNKKNLMLVGDGMDFTVITGS  308

Query  593   DSVGGGSSLTGSATFGITGDGFIAKDIGFQNTAGPGAHQAVALTVASDHSVFYRCSISGY  414
              +   G++   SAT  + G+GFIA+D+ FQNTAGP  HQAVAL V +D S+  RC I GY
Sbjct  309   LNFIDGTTTFNSATLAVVGEGFIAQDMCFQNTAGPKKHQAVALRVGADKSIINRCRIEGY  368

Query  413   QDTLYALSLRQFYRECDISGTVDFIFGNAAAVFQACNLVLRRPSS--YNVILANGRSDPG  240
             QDTLYA S RQFYR+  ISGT+DFIFGNAA V Q C ++ R+P S   N++ A GR+DP 
Sbjct  369   QDTLYAHSQRQFYRDSVISGTIDFIFGNAAVVLQNCTIIARKPMSNQQNLVTAQGRTDPN  428

Query  239   QNTGFSVQKCKITPGPDFSPVKNSYNSYLGRPWKPYSRAVVMESDIDGAISARGWIEWPG  60
             QNTG ++Q  +I    D  PVKN   +YLGRPWK YSR V M+++I   I+A GW+ W G
Sbjct  429   QNTGTTIQFSRIQASTDLEPVKNILPTYLGRPWKEYSRTVYMQNNIGDHIAAEGWLPWSG  488

Query  59    TSSSSVRELYFGEYANVG  6
                 +++ LY+ EY N G
Sbjct  489   --GFALKTLYYAEYMNGG  504



>gb|KEH24404.1| pectinesterase/pectinesterase inhibitor [Medicago truncatula]
Length=557

 Score =   315 bits (806),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 198/499 (40%), Positives = 274/499 (55%), Gaps = 24/499 (5%)
 Frame = -2

Query  1457  MLVLFFGCCVTTIaaaavsqvaaQDQIRIQ---CGYTRFPRLCVQTLSGL--VSGERVDF  1293
             +LVL F   VT  +  A +     + I++    C  T +  LCV TLS L  ++ + V  
Sbjct  18    ILVLLFS--VTNFSKLATAATLQTNHIQVAQSACEGTLYQDLCVSTLSTLPDLTSKTVPQ  75

Query  1292  AAALLLNKTIAHADLHIAHFDQLSSHFVSSQPPQPRLQAIGYCEELMGMARQRLNEALVA  1113
                 +LN TI       ++   L     S+Q    + +A+  C  L       L   +  
Sbjct  76    IICSVLNNTIKEVKQSSSNCTGLRIRGRSAQSILDQ-RALEDCVNLFDTTIDELKTTISD  134

Query  1112  MKESP---GKNRQEDIQTWLSAAVTFQQACKDWADQYAFS-DELFARISRSMDYQSQLAS  945
             + ++      + + D QT LS A+T    C    D +A+S  +L  +I   ++  S   S
Sbjct  135   LSQTQTTVASSSKRDCQTLLSGAMTNVYTC---LDGFAYSKSKLRKKIEAKLNDISSHVS  191

Query  944   NALALVNRNTEISAAGRQLSEEdidddddggffpDWVSGRDLRLLETTTDKTKANVVVAK  765
             N+LA++ +   +     + SE   +       FP WVS +D +LL+   ++TK ++VVAK
Sbjct  192   NSLAMLKKVPGVKTKASE-SETFPEYGKVKDGFPSWVSPKDRKLLQAAVNQTKFDLVVAK  250

Query  764   DGTGNFRTVAEAIGAA--SGRQRFVIYVKSGVYKEKIR--SSKDGITLIGDGKYSTIITW  597
             DGTGNF T+ EAI AA  S   RFVI++K+G Y E +     K  + L+GDG   T++  
Sbjct  251   DGTGNFATIGEAIAAAPNSSATRFVIHIKAGAYFENVEVIKKKTNLMLVGDGIGQTVVKA  310

Query  596   DDSVGGGSSLTGSATFGITGDGFIAKDIGFQNTAGPGAHQAVALTVASDHSVFYRCSISG  417
               +V  G +   S+TF + GD FIAK I F+N+AGP  HQAVA+   +D S FY+CS   
Sbjct  311   SRNVVDGWTTFQSSTFAVVGDKFIAKGITFENSAGPSKHQAVAVRNGADFSAFYQCSFVA  370

Query  416   YQDTLYALSLRQFYRECDISGTVDFIFGNAAAVFQACNLVLRR--PSSYNVILANGRSDP  243
             YQDTLY  SLRQFYRECD+ GTVDFIFGNAA VFQ CNL  R+  P   N+  A GR DP
Sbjct  371   YQDTLYVHSLRQFYRECDVYGTVDFIFGNAAVVFQNCNLYARKPDPKQKNLFTAQGREDP  430

Query  242   GQNTGFSVQKCKITPGPDFSPVKNSYNSYLGRPWKPYSRAVVMESDIDGAISARGWIEWP  63
              QNTG S+  CKI    D  PV++++ SYLGRPWK YSR V + S ID  I   GW+EW 
Sbjct  431   NQNTGISILNCKIAAAADLIPVQSTFKSYLGRPWKKYSRTVYLNSFIDNLIDPAGWLEWN  490

Query  62    GTSSSSVRELYFGEYANVG  6
             GT   ++  L++GEY N G
Sbjct  491   GT--FALDTLFYGEYKNRG  507



>ref|XP_006444399.1| hypothetical protein CICLE_v100237231mg, partial [Citrus clementina]
 gb|ESR57639.1| hypothetical protein CICLE_v100237231mg, partial [Citrus clementina]
Length=548

 Score =   314 bits (805),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 197/508 (39%), Positives = 276/508 (54%), Gaps = 36/508 (7%)
 Frame = -2

Query  1460  IMLVLFFGCCVTTIaaaavsqvaaQDQIRIQ---------CGYTRFPRLCVQTLSGL--V  1314
             I L+LF    V+        +      +R+          C  T +P LCV TL  +  +
Sbjct  3     IFLLLFVLSAVSVTTLKKNPKTTDAPHLRVHKHFQVAHSACEGTLYPELCVSTLLSVPDL  62

Query  1313  SGERVDFAAALLLNKTIAHADLHIAHFDQLSSHFVSSQPPQPRLQAIGYCEELMGMARQR  1134
             + +RV    ++ +N+T++      ++   +   + +    + R  AI  C EL       
Sbjct  63    ASKRVPELISVTINRTLSELRASSSNCSSIGQSYPNFNTLEKR--AINDCLELFHDTIVE  120

Query  1133  LNEAL--VAMKESPGKNRQEDIQTWLSAAVTFQQACKDWADQYAFSDELFARISRSMDYQ  960
             L  AL  ++ K+ P K+   D+QT  S A+T Q  C    D +A+SD     + +S  Y 
Sbjct  121   LKSALNDLSPKKLPSKHYH-DLQTLFSGAMTNQYTC---LDGFAYSDGNVRDVIKSSLYN  176

Query  959   -SQLASNALALVNRNTEISAAGRQLS---EEdidddddggffpDWVSGRDLRLLETTTDK  792
              S+  SN+L ++ +       G  +S   E   +       FP W+S  D +LL+ + + 
Sbjct  177   ISRHVSNSLVMLKK-----IPGDNMSSKYEVFPEYGRIKRGFPTWLSLNDRKLLQKSVNL  231

Query  791   TKANVVVAKDGTGNFRTVAEAIGAASGRQ--RFVIYVKSGVYKEKIRSSKDGITL--IGD  624
             TK +++VAKDG+GNF T+ EA+ AA  +   RFVIY+K+G Y E +   K    L  +GD
Sbjct  232   TKFDLIVAKDGSGNFTTITEAVEAAPNKSNTRFVIYIKAGAYFENVEVDKKKTMLMFVGD  291

Query  623   GKYSTIITWDDSVGGGSSLTGSATFGITGDGFIAKDIGFQNTAGPGAHQAVALTVASDHS  444
             G   T++  + SV  G +   SAT  + G GFIAK I  +N+AGP  HQAVAL   SD S
Sbjct  292   GIGKTVVKANRSVVDGWTTFRSATVAVVGTGFIAKGITVENSAGPSKHQAVALRSGSDLS  351

Query  443   VFYRCSISGYQDTLYALSLRQFYRECDISGTVDFIFGNAAAVFQACNLVLRRPSS--YNV  270
              FY+CS  GYQDTLY  SLRQFYRECD+ GTVDFIFGNAA VFQ CNL  R+P++   N+
Sbjct  352   AFYKCSFVGYQDTLYVHSLRQFYRECDVYGTVDFIFGNAAVVFQICNLYARKPNANQKNI  411

Query  269   ILANGRSDPGQNTGFSVQKCKITPGPDFSPVKNSYNSYLGRPWKPYSRAVVMESDIDGAI  90
             I A GR DP QNTG S+  CK+    D  P +  + +YLGRPWK YSR V M S +   I
Sbjct  412   ITAQGREDPNQNTGISILNCKVAAASDLIPYQTEFKTYLGRPWKEYSRTVFMLSYLGDLI  471

Query  89    SARGWIEWPGTSSSSVRELYFGEYANVG  6
             +  GW+EW GT + S   L++GEY N G
Sbjct  472   APAGWLEWNGTFALST--LFYGEYKNRG  497



>ref|XP_010101977.1| putative pectinesterase/pectinesterase inhibitor 6 [Morus notabilis]
 gb|EXB90901.1| putative pectinesterase/pectinesterase inhibitor 6 [Morus notabilis]
Length=514

 Score =   313 bits (802),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 185/468 (40%), Positives = 267/468 (57%), Gaps = 28/468 (6%)
 Frame = -2

Query  1367  CGYTRFPRLC-----VQTLSGLVSGERVDFAAALLLNKTIAHADLHIAHFDQLSSHFVSS  1203
             C  T +P++C        LS L     V F   L L  T+  A        +L S   S 
Sbjct  14    CNQTPYPQVCHHFLNTNHLSTLDDKTTVSFHD-LALKATMKQA----VEAHRLVSTMDSD  68

Query  1202  QPPQPRLQAIGYCEELMGMARQRLNEALVAMKESPGKNRQEDIQTWLSAAVTFQQACKDW  1023
                +    A   C EL       LN ++ +  ++P      D  TWLSA++  Q  C++ 
Sbjct  69    SFGERGKSAWQDCLELYKDTVDLLNRSVNSNNKNP-----LDTHTWLSASLANQHTCRNG  123

Query  1022  ADQYAFSDELFARISRSMDYQSQLASNALALVNRNTEISAAGRQLSEEdidddddggffp  843
                +       +  S   ++ S+L SN+LA +N+ T I +     S++          FP
Sbjct  124   FTDFQIPSHYDSFPSMLSNF-SKLLSNSLA-INKAT-IPSTATSFSKQVRSRRLLSDGFP  180

Query  842   DWVSGRDLRLLETTTDKTKANVVVAKDGTGNFRTVAEAIGAAS----GRQRFVIYVKSGV  675
             +WVS  D +LL++     KA++VVA+DG+G F+T++EA+ AA     G +R V+YVK+GV
Sbjct  181   EWVSAADRKLLQSGGAAAKADIVVAQDGSGGFKTISEAVEAAKNLGGGSKRIVVYVKAGV  240

Query  674   YKEKIRSSKD--GITLIGDGKYSTIITWDDSVGGGSSLTGSATFGITGDGFIAKDIGFQN  501
             YKE +    D   +  +GDG  +TI+T + +   GS+   SATFG++GDGFIA+D+ F+N
Sbjct  241   YKENVEIKNDIKNLMFVGDGIDATIVTGNRNNVDGSTTFQSATFGVSGDGFIAQDMTFEN  300

Query  500   TAGPGAHQAVALTVASDHSVFYRCSISGYQDTLYALSLRQFYRECDISGTVDFIFGNAAA  321
             TAGP  HQAVAL   SDHSVF+RCS  GYQDTLY  S RQFYR+C++ GTVDFI G+A A
Sbjct  301   TAGPAKHQAVALRSGSDHSVFHRCSFKGYQDTLYVYSQRQFYRDCNVYGTVDFICGDAVA  360

Query  320   VFQACNLVLRRPSS--YNVILANGRSDPGQNTGFSVQKCKITPGPDFSPVKNSYNSYLGR  147
             + Q CN+++R+P S   N + +  R+DP +NTG  +   +IT   D  PV+ S+ +YLGR
Sbjct  361   ILQNCNILVRKPMSDQRNTVTSQARTDPNENTGIIIHNSRITASSDLRPVQGSFETYLGR  420

Query  146   PWKPYSRAVVMESDIDGAISARGWIEWPGTSSSSVRELYFGEYANVGA  3
             PW+ YSR V+M+S +DG I  +GW+ W G  + S   LY+ E+ N GA
Sbjct  421   PWQKYSRTVIMKSSLDGLIDPKGWLPWSGNFALST--LYYAEFMNSGA  466



>gb|KEH21379.1| pectinesterase/pectinesterase inhibitor [Medicago truncatula]
Length=541

 Score =   314 bits (804),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 165/387 (43%), Positives = 242/387 (63%), Gaps = 15/387 (4%)
 Frame = -2

Query  1127  EALVAMKESPGKNRQEDIQTWLSAAVTFQQACKDWADQYAFSDELFARISRSMDYQSQLA  948
             + +  +K S   N   D  TW SA++T  Q C++    +     L    S   ++ ++L 
Sbjct  110   DTIYQLKRSINSNNLNDKLTWQSASITNHQTCQNGFIDFNLPSHLNYFPSMLSNF-TKLL  168

Query  947   SNALALVNRNTEISAAGRQL--SEEdidddddggffpDWVSGRDLRLLETTTDK---TKA  783
             SN+L++ N  T   ++      ++++         FP W+SG D +LL+ T       +A
Sbjct  169   SNSLSISNTLTSSQSSSSSSSSTKQNGGRRLLSDGFPYWLSGSDRKLLQATPGSGIGPRA  228

Query  782   NVVVAKDGTGNFRTVAEAIGAA---SGRQRFVIYVKSGVYKEK--IRSSKDGITLIGDGK  618
             ++VVA+DG+GN++T++E + AA   SG+ R VI++K+G+YKE   I+ +   + + GDG 
Sbjct  229   DIVVAQDGSGNYKTISEGVAAAAKLSGKGRVVIHLKAGIYKENVDIKKTVKNLMIFGDGM  288

Query  617   YSTIITWDDSVGGGSSLTGSATFGITGDGFIAKDIGFQNTAGPGAHQAVALTVASDHSVF  438
              STI+T + +   GS+   SATFG+ GDGFIAKD+ F+NTAGP  HQAVAL   +DHSVF
Sbjct  289   DSTIVTGNHNAIDGSTTFRSATFGVMGDGFIAKDMTFENTAGPQKHQAVALRSGADHSVF  348

Query  437   YRCSISGYQDTLYALSLRQFYRECDISGTVDFIFGNAAAVFQACNLVLRRPSS--YNVIL  264
             YRC+  G+QDTLY  + RQFYR+C+I GT+DFIFGNA  V Q CN+ +R+P S   N + 
Sbjct  349   YRCAFKGFQDTLYVYANRQFYRDCNIYGTIDFIFGNAVTVLQNCNIFVRKPMSNQKNTVT  408

Query  263   ANGRSDPGQNTGFSVQKCKITPGPDFSPVKNSYNSYLGRPWKPYSRAVVMESDIDGAISA  84
             A GR+DP +NTG  +  C+IT   D   ++NS  +YLGRPW+ YSR VVM+S++DG I++
Sbjct  409   AQGRTDPNENTGIVIHNCRITASSDLKAIQNSVKTYLGRPWQKYSRTVVMKSNLDGLINS  468

Query  83    RGWIEWPGTSSSSVRELYFGEYANVGA  3
              GW  W G    ++  LY+GEY NVG 
Sbjct  469   EGWAPWMG--GFALSTLYYGEYMNVGG  493



>ref|XP_011031815.1| PREDICTED: pectinesterase-like [Populus euphratica]
Length=580

 Score =   315 bits (807),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 186/482 (39%), Positives = 271/482 (56%), Gaps = 35/482 (7%)
 Frame = -2

Query  1379  IRIQCGYTRFPRLC---VQTLSG----LVSGERVDFAAALLLNKTIAHADLHIAHFDQLS  1221
             ++  C  T +P LC   V T+ G    L S + V   +  L  K + H      +F  + 
Sbjct  63    LKSSCSSTLYPELCYSAVATVPGATSNLASQKDVIELSINLTTKAVQH------NFFTVE  116

Query  1220  SHFVSSQPPQPRLQAIGYCEELMGMARQRLNEALVAMKESPG----KNRQEDIQTWLSAA  1053
                 + +  +    A+  C E++      L+EALV + E P     K   +D++T LS+A
Sbjct  117   KLIATKKLSKREKTALHDCLEIIDETLDELHEALVDLNEYPNNKSLKKHADDLKTLLSSA  176

Query  1052  VTFQQACKDWADQYAFSDELFARISRSMDYQSQLASNALALVNRNT------EISAAGRQ  891
             +T Q+ C D         ++   + +   +  ++ SN LA++   T      E+    R+
Sbjct  177   ITNQETCLDGFSHDEADKKVRKALLKGQIHVEKMCSNVLAMIKNMTDTDVANELKITNRK  236

Query  890   LSEEdidddddggffpDWVSGRDLRLLETTTDKTKANVVVAKDGTGNFRTVAEAIGAASG  711
             L +++ + ++       W+S  D RLL++++     +VVVA DG+GN++TV+ A+ AA  
Sbjct  237   LMQQEKEGNESEWPE--WMSVADRRLLQSSS--VTPDVVVAADGSGNYKTVSAAVAAAPK  292

Query  710   R--QRFVIYVKSGVYKEKIRSSKD--GITLIGDGKYSTIITWDDSVGGGSSLTGSATFGI  543
             +  +R++I +K+GVY+E +   KD   I  +GDG+ +TIIT   +V  GS+   SAT   
Sbjct  293   KSSKRYIIRIKAGVYRENVDVPKDKTNIMFMGDGRKTTIITASRNVVDGSTTFNSATVAA  352

Query  542   TGDGFIAKDIGFQNTAGPGAHQAVALTVASDHSVFYRCSISGYQDTLYALSLRQFYRECD  363
              G GF+A+ I FQNTAGP  HQAVAL V SD S FY C +  YQDTLY  S RQF+  C 
Sbjct  353   VGQGFLARGITFQNTAGPSKHQAVALRVGSDLSAFYDCDMLAYQDTLYVHSNRQFFINCF  412

Query  362   ISGTVDFIFGNAAAVFQACNLVLRRPSS--YNVILANGRSDPGQNTGFSVQKCKITPGPD  189
             I+GTVDFIFGNAA V Q C++  RRP+S   N++ A GR+DP QNTG  +QK +I    D
Sbjct  413   IAGTVDFIFGNAAVVLQDCDIHARRPNSGQKNMVTAQGRTDPNQNTGIVIQKSRIGATSD  472

Query  188   FSPVKNSYNSYLGRPWKPYSRAVVMESDIDGAISARGWIEWPGTSSSSVRELYFGEYANV  9
               PVK+S+ +YLGRPWK YSR V+M+S I   I   GW EW G  S ++  LY+ EY N 
Sbjct  473   LQPVKSSFPTYLGRPWKEYSRTVIMQSSITDVIQPAGWFEWSG--SFALNTLYYAEYQNS  530

Query  8     GA  3
             GA
Sbjct  531   GA  532



>ref|XP_006279604.1| hypothetical protein CARUB_v10026136mg [Capsella rubella]
 gb|EOA12502.1| hypothetical protein CARUB_v10026136mg [Capsella rubella]
Length=587

 Score =   315 bits (807),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 188/475 (40%), Positives = 258/475 (54%), Gaps = 38/475 (8%)
 Frame = -2

Query  1367  CGYTRFPRLCVQTLSGLVSGERVDFAAALLLNKT-IAHADLHIAHFDQLSSHFVSS----  1203
             C  + +P LC+ TL        +DF  +L  +++ + H   + A   + S    +S    
Sbjct  79    CSKSLYPNLCIDTL--------LDFPGSLTADESELIHISFN-ATLQRFSKALYASSTIT  129

Query  1202  ---QPPQPRLQAIGYCEELMGMARQRLNEALVAMKESPGKNRQEDIQTWLSAAVTFQQAC  1032
                 PP+ R  A   C EL+  + + L  AL ++    G     D+ TWLS+A+T    C
Sbjct  130   YTQMPPRVR-SAYDSCLELLDDSVEALTRALSSVVVVSGDESHSDVMTWLSSAMTNHDTC  188

Query  1031  KDWADQY-----AFSDELFARISRSMDYQSQLASNALAL-VNRNTEISAAGRQLSEEdid  870
              D  D+         D++   +       S++ SN LA+   + T++S     ++   + 
Sbjct  189   TDGFDETDGEGGGVKDQVIGAVKD----LSEMVSNCLAIFAGKVTDLSGV-PVVNNRKLL  243

Query  869   ddddggffpDWVSGRDLRLLETTTDKTKANVVVAKDGTGNFRTVAEAIGAAS--GRQRFV  696
               ++    P+W++  D  LL T     +A++ V+KDGTG F+T+ EAI  A     ++FV
Sbjct  244   GTEETEELPNWLNREDRELLGTPAPAIQADITVSKDGTGTFKTITEAIKKAPEHSSRKFV  303

Query  695   IYVKSGVYKE---KIRSSKDGITLIGDGKYSTIITWDDSVGGGSSLTGSATFGITGDGFI  525
             IYVK+G Y+E   K+   K  I  IGDGK  T+IT   S+    +   +ATF  TG GFI
Sbjct  304   IYVKAGRYEEENLKVGRKKTNIVFIGDGKGKTVITGGKSIADDLTTFHTATFAATGAGFI  363

Query  524   AKDIGFQNTAGPGAHQAVALTVASDHSVFYRCSISGYQDTLYALSLRQFYRECDISGTVD  345
              +DI F+N AGPG HQAVAL +  DH+V Y CSI GYQD LY  S RQF+RECDI GTVD
Sbjct  364   VRDITFENYAGPGKHQAVALRIGGDHAVVYHCSIIGYQDALYVHSNRQFFRECDIYGTVD  423

Query  344   FIFGNAAAVFQACNLVLRRPSSYN--VILANGRSDPGQNTGFSVQKCKITPGPDFSPVKN  171
             FIFGNAA + Q+CN+  R+P       I A  R DP QNTG S+  CKI   PD    K 
Sbjct  424   FIFGNAAVILQSCNIYARKPMPQQKITITAQNRKDPNQNTGISIHACKILATPDLEASKG  483

Query  170   SYNSYLGRPWKPYSRAVVMESDIDGAISARGWIEWPGTSSSSVRELYFGEYANVG  6
             SY +YLGRPWK YSR V M SD+   I  RGW+EW G    ++  LY+GEY N G
Sbjct  484   SYPTYLGRPWKLYSRVVYMMSDMGDHIDPRGWLEWNG--PFALDTLYYGEYMNKG  536



>ref|XP_009133718.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 17 
[Brassica rapa]
Length=510

 Score =   313 bits (801),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 180/389 (46%), Positives = 227/389 (58%), Gaps = 27/389 (7%)
 Frame = -2

Query  1166  CEELMGMARQRLNEALVAMKESPG-KNRQEDIQTWLSAAVTFQQACKDWADQYAFSDELF  990
             C +L      ++NE +     +P  K  + D QTWLS A+T    C+    +   +D + 
Sbjct  99    CIKLYDFTVSKINETM-----NPNVKCSKTDAQTWLSTALTNLDTCRAGFLELGVTDIVL  153

Query  989   ARISRSMDYQSQLASNALALVNRNTEISAAGRQLSEEdidddddggffpDWVSGRDLRLL  810
               +S ++   S L  N LA+       +  G+               FP WV   D +LL
Sbjct  154   PLMSNNV---SNLICNTLAINKVPFNYTPPGKD-------------GFPSWVKPGDRKLL  197

Query  809   ETTTDKTKANVVVAKDGTGNFRTVAEAIGAASGRQRFVIYVKSGVYKEKIRSSKDGITLI  630
             +++T +   N VVAKDG+GNFRT+ +AI AASG  RFVIYVK GVY E +   K  + L 
Sbjct  198   QSSTPRD--NAVVAKDGSGNFRTIKDAINAASGSGRFVIYVKQGVYSENLEIRKKNVMLR  255

Query  629   GDGKYSTIITWDDSVGGGSSLTGSATFGITGDGFIAKDIGFQNTAGPGAHQAVALTVASD  450
             GDGK  TIIT   SVGGGS+   SAT    GDGFIA+ I F+NTAG    QAVAL   SD
Sbjct  256   GDGKGRTIITGSRSVGGGSTTFNSATVAAVGDGFIARGITFRNTAGANNAQAVALRSGSD  315

Query  449   HSVFYRCSISGYQDTLYALSLRQFYRECDISGTVDFIFGNAAAVFQACNLVLRRP-SSYN  273
              SVFY+CS  GYQDTLY  S RQFYR+CD+ GTVDFIFGNAAAV Q CN+  RRP S  N
Sbjct  316   LSVFYQCSFEGYQDTLYVHSNRQFYRDCDVYGTVDFIFGNAAAVLQNCNIFARRPRSRTN  375

Query  272   VILANGRSDPGQNTGFSVQKCKITPGPDFSPVKNSYNSYLGRPWKPYSRAVVMESDIDGA  93
              I A GRSDP QNTG  +   ++T   D  PV  S  +YLGRPW+ YSR V M++ +D  
Sbjct  376   TITAQGRSDPNQNTGIIIHNSRVTAASDLRPVLGSTKTYLGRPWRQYSRTVFMKTSLDSL  435

Query  92    ISARGWIEWPGTSSSSVRELYFGEYANVG  6
             I  RGW+EW G  + S   L++ E+ N G
Sbjct  436   IDPRGWLEWDGNFALST--LFYAEFQNTG  462



>ref|NP_200149.1| pectin methylesterase PCR fragment F [Arabidopsis thaliana]
 sp|Q9FK05.1|PME61_ARATH RecName: Full=Probable pectinesterase/pectinesterase inhibitor 
61; Includes: RecName: Full=Pectinesterase inhibitor 61; AltName: 
Full=Pectin methylesterase inhibitor 61; Includes: RecName: 
Full=Pectinesterase 61; Short=PE 61; AltName: Full=AtPMEpcrF; 
AltName: Full=Pectin methylesterase 61; Short=AtPME61 
[Arabidopsis thaliana]
 gb|AAK28637.1|AF360340_1 putative pectinesterase [Arabidopsis thaliana]
 dbj|BAB09799.1| pectinesterase [Arabidopsis thaliana]
 gb|AAK93754.1| putative pectinesterase [Arabidopsis thaliana]
 gb|AED96345.1| putative pectinesterase/pectinesterase inhibitor 61 [Arabidopsis 
thaliana]
Length=587

 Score =   315 bits (807),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 184/470 (39%), Positives = 257/470 (55%), Gaps = 28/470 (6%)
 Frame = -2

Query  1367  CGYTRFPRLCVQTLSGLVSGERVDFAAALLLNKT-IAHADLHIAHFDQLSSHFVSS----  1203
             C  + +P LC+ TL        +DF  +L  ++  + H   + A   + S    +S    
Sbjct  79    CSKSLYPNLCIDTL--------LDFPGSLTADENELIHISFN-ATLQKFSKALYTSSTIT  129

Query  1202  ---QPPQPRLQAIGYCEELMGMARQRLNEALVAMKESPGKNRQEDIQTWLSAAVTFQQAC  1032
                 PP+ R  A   C EL+  +   L  AL ++    G     D+ TWLS+A+T    C
Sbjct  130   YTQMPPRVR-SAYDSCLELLDDSVDALTRALSSVVVVSGDESHSDVMTWLSSAMTNHDTC  188

Query  1031  KDWADQY-AFSDELFARISRSMDYQSQLASNALALVNRNTEISAAGRQLSEEdidddddg  855
              D  D+      E+  ++  ++   S++ SN LA+     +  +    ++   +   ++ 
Sbjct  189   TDGFDEIEGQGGEVKDQVIGAVKDLSEMVSNCLAIFAGKVKDLSGVPVVNNRKLLGTEET  248

Query  854   gffpDWVSGRDLRLLETTTDKTKANVVVAKDGTGNFRTVAEAIGAAS--GRQRFVIYVKS  681
                P+W+   D  LL T T   +A++ V+KDG+G F+T+AEAI  A     +RFVIYVK+
Sbjct  249   EELPNWLKREDRELLGTPTSAIQADITVSKDGSGTFKTIAEAIKKAPEHSSRRFVIYVKA  308

Query  680   GVYKE---KIRSSKDGITLIGDGKYSTIITWDDSVGGGSSLTGSATFGITGDGFIAKDIG  510
             G Y+E   K+   K  +  IGDGK  T+IT   S+    +   +ATF  TG GFI +D+ 
Sbjct  309   GRYEEENLKVGRKKTNLMFIGDGKGKTVITGGKSIADDLTTFHTATFAATGAGFIVRDMT  368

Query  509   FQNTAGPGAHQAVALTVASDHSVFYRCSISGYQDTLYALSLRQFYRECDISGTVDFIFGN  330
             F+N AGP  HQAVAL V  DH+V YRC+I GYQD LY  S RQF+REC+I GTVDFIFGN
Sbjct  369   FENYAGPAKHQAVALRVGGDHAVVYRCNIIGYQDALYVHSNRQFFRECEIYGTVDFIFGN  428

Query  329   AAAVFQACNLVLRRPSSYN--VILANGRSDPGQNTGFSVQKCKITPGPDFSPVKNSYNSY  156
             AA + Q+CN+  R+P +     I A  R DP QNTG S+  CK+   PD    K SY +Y
Sbjct  429   AAVILQSCNIYARKPMAQQKITITAQNRKDPNQNTGISIHACKLLATPDLEASKGSYPTY  488

Query  155   LGRPWKPYSRAVVMESDIDGAISARGWIEWPGTSSSSVRELYFGEYANVG  6
             LGRPWK YSR V M SD+   I  RGW+EW G    ++  LY+GEY N G
Sbjct  489   LGRPWKLYSRVVYMMSDMGDHIDPRGWLEWNG--PFALDSLYYGEYMNKG  536



>ref|XP_006377839.1| hypothetical protein POPTR_0011s13830g [Populus trichocarpa]
 gb|ERP55636.1| hypothetical protein POPTR_0011s13830g [Populus trichocarpa]
Length=550

 Score =   314 bits (804),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 184/467 (39%), Positives = 257/467 (55%), Gaps = 35/467 (7%)
 Frame = -2

Query  1367  CGYTRFPRLCVQTLSGLVSGERVDFAAALLLNKTIAHADLHIAHFDQLSSHFVSSQPPQP  1188
             C   R P+ C+  LS  VS E V  +  + L KT     L      + +++ V+S+    
Sbjct  57    CNQARDPQECLSILSEAVSTEGVQESNGVGLLKTFLVKSLSQMRMAKAAANAVNSKINGH  116

Query  1187  RLQA-IGYCEELMGMARQRLNEALVAMKESPGKNRQEDIQTWLSAAVTFQQACKDWAD--  1017
             + QA +  C ELM M+  R+ + L A+     ++   D  TWLS  +T    C D  D  
Sbjct  117   KHQAALADCVELMDMSIDRVTDTLSALANWGSQSDASDANTWLSGVLTNHVTCLDGIDTI  176

Query  1016  ----QYAFSDELFARISRSMDYQSQLASNALALVNRNTEISAAGRQLSEEdidddddggf  849
                       +L +R+  S+   S L+++   LV                        G 
Sbjct  177   DQPSMKKLLQDLISRMRTSLAAVSSLSASDTDLVQ--------------------PLNGG  216

Query  848   fpDWVSGRDLRLLETTTDKTKANVVVAKDGTGNFRTVAEAIGAA--SGRQRFVIYVKSGV  675
             FP W+ GRD +LLE++    +ANVVVA+DG+G+  T+ E++ +     + R+VI VKSG+
Sbjct  217   FPSWILGRDRKLLESSVSTVEANVVVAQDGSGDNTTIQESVNSVPDKSKSRYVICVKSGI  276

Query  674   YKEKIR--SSKDGITLIGDGKYSTIITWDDSVGGGSSLTGSATFGITGDGFIAKDIGFQN  501
             YKE +     K  + ++GDG  STI+T + +V  GS+   SAT  + GDGF+ +DI  QN
Sbjct  277   YKENVEVGKKKKNVMIVGDGMDSTILTGNLNVVDGSTTFRSATLAVAGDGFVLQDIWIQN  336

Query  500   TAGPGAHQAVALTVASDHSVFYRCSISGYQDTLYALSLRQFYRECDISGTVDFIFGNAAA  321
             TAGP  HQAVAL V++D SV  RC I  YQDTLY  + RQFYR+C I GT+DFIFGN A 
Sbjct  337   TAGPEKHQAVALRVSADQSVINRCRIDAYQDTLYTHNYRQFYRDCFIIGTIDFIFGNGAV  396

Query  320   VFQACNLVLRRP--SSYNVILANGRSDPGQNTGFSVQKCKITPGPDFSPVKNSYNSYLGR  147
             V Q C+++ R+P  +  N++ A GR DP QNTG S+Q C I    D    +N + +YLGR
Sbjct  397   VLQNCHIISRKPMANQKNMVTAQGRIDPNQNTGISIQNCDIVASSDLESEQNKFPTYLGR  456

Query  146   PWKPYSRAVVMESDIDGAISARGWIEWPGTSSSSVRELYFGEYANVG  6
             PWK YSR VVM+S+I G I   GW EW      ++  LY+GEYAN G
Sbjct  457   PWKEYSRTVVMQSNIGGHIDPTGWAEWD--KEFALTTLYYGEYANRG  501



>ref|XP_010044212.1| PREDICTED: pectinesterase [Eucalyptus grandis]
Length=552

 Score =   314 bits (804),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 195/475 (41%), Positives = 273/475 (57%), Gaps = 46/475 (10%)
 Frame = -2

Query  1367  CGYTRFPRLC-----VQTLSGLVSGERVDFAAALLLNKTIAHADLHIAHFDQLSSH-FVS  1206
             C  T +P  C      + LS L   +R +F        +     L +A  + L +H  VS
Sbjct  50    CAQTPYPETCHYFIGTEVLSEL---DRTEF--------SFRDVALKVAMSEALRAHELVS  98

Query  1205  SQPP-----QPRLQAIGYCEELMGMARQRLNEALVAMKESPGKNRQEDIQTWLSAAVTFQ  1041
             S  P     + RL A   C EL   + + LN ++ + K S       D QTWLSAA+T  
Sbjct  99    SMDPSSFDERTRL-AWSDCIELYEDSVRLLNRSVSSKKPS-------DSQTWLSAAITNH  150

Query  1040  QACKDWADQYAFSDELFARISRSMDYQSQLASNALALVNR--NTEISAAGRQLSEEdidd  867
             + C++  +++  +  L       +   S+L SN+LA +N+  ++  S A    S++    
Sbjct  151   RTCQNGFNEFNLASHL-ESFPLMLSNFSKLLSNSLA-INKVSSSSYSPARVSFSKQVRGR  208

Query  866   ddd--ggffpDWVSGRDLRLLETTTDKTKANVVVAKDGTGNFRTVAEAIGAASGRQR---  702
                     FP WVS  D +LL+T     KA++VVAKDG+GN++T++EA+ A+S ++    
Sbjct  209   RLLGDHEKFPSWVSASDRKLLQTARAPAKADLVVAKDGSGNYKTISEAVAASSSKRSGSS  268

Query  701   -FVIYVKSGVYKE--KIRSSKDGITLIGDGKYSTIITWDDSVGGGSSLTGSATFGITGDG  531
              FVIYVK+GVY E  +++ S   + ++GDG  +TI+T D +   GS+   SATF + GDG
Sbjct  269   RFVIYVKAGVYSENVEVKRSMKNLMIVGDGIDATIVTGDKNAQDGSTTFRSATFAVMGDG  328

Query  530   FIAKDIGFQNTAGPGAHQAVALTVASDHSVFYRCSISGYQDTLYALSLRQFYRECDISGT  351
             FIA+DI FQNTAGP  HQAVAL   SD SVFY CS  GYQDTLY  + RQFYR+CDI GT
Sbjct  329   FIARDITFQNTAGPQKHQAVALRSGSDFSVFYSCSFKGYQDTLYVYAQRQFYRDCDIYGT  388

Query  350   VDFIFGNAAAVFQACNLVLRRPSS--YNVILANGRSDPGQNTGFSVQKCKITPGPDFSPV  177
              DFIFG+A  V Q CN+ +R+P S   N + A GRSDP +NTG  V   ++T   D  PV
Sbjct  389   QDFIFGDAVTVLQNCNIYIRKPISGQINTVTAQGRSDPNENTGIIVHNSRVTASSDMKPV  448

Query  176   KNSYNSYLGRPWKPYSRAVVMESDIDGAISARGWIEWPGTSSSSVRELYFGEYAN  12
             + S+ +YLGRPW+ YSR V M + +D  I+ +GW  W G  S ++  LY+GEY N
Sbjct  449   QGSFKNYLGRPWQKYSRTVFMRTFLDSLIAPQGWYPWSG--SFALSTLYYGEYMN  501



>ref|XP_009383893.1| PREDICTED: pectinesterase-like [Musa acuminata subsp. malaccensis]
Length=567

 Score =   314 bits (805),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 195/462 (42%), Positives = 254/462 (55%), Gaps = 12/462 (3%)
 Frame = -2

Query  1370  QCGYTRFPRLCVQTLSGLVSGERVDFAAALLLN-KTIAHADLHIAHFDQLSSHFVSSQPP  1194
              C  T +P LCV TLS +           +  +  T A A  + A       H      P
Sbjct  61    HCDGTLYPDLCVSTLSTIPDLHAKSLPEVICASVNTTAAAVRNAAKNCTNFLHRRGYLDP  120

Query  1193  QPRLQAIGYCEELMGMARQRLNEALVAMKESPGKNRQEDIQTWLSAAVTFQQACKDWADQ  1014
             + RL A+  C +L       L  A  A+         +D+QT LSAA+T Q  C D    
Sbjct  121   RQRL-AVTDCLDLFSQTLDELGAASAALAAD-PAAHVDDVQTVLSAAITNQYTCLDGFAY  178

Query  1013  YAFSDELFARISRSMDYQSQLASNALALVNRNTEISAAGRQLSEEdidddddggffpDWV  834
                       I R + + S L SN+LA+V +      A R          +    FP WV
Sbjct  179   VGRGGGYRPAIERRLYHVSHLVSNSLAMV-KRIRRRRASRPRRGALEGYGEVSEGFPAWV  237

Query  833   SGRDLRLLETTTDKTKANVVVAKDGTGNFRTVAEAIGAASGRQ--RFVIYVKSGVYKEKI  660
             S +D +LL+  T+ T  ++ VAKDG+GNF T+++A+ AA      RFVIYVK+G Y E +
Sbjct  238   SAKDRKLLQAPTNATIPDLEVAKDGSGNFTTISDAVAAAPNNTDTRFVIYVKAGAYFENV  297

Query  659   R--SSKDGITLIGDGKYSTIITWDDSVGGGSSLTGSATFGITGDGFIAKDIGFQNTAGPG  486
                 SK  + LIGDG   T++    SV  G +   SAT  + GDGF+ +DI  +N AGP 
Sbjct  298   EVGKSKTNLLLIGDGIGKTVVKASRSVVDGWTTFRSATVAVVGDGFLMRDITIENAAGPS  357

Query  485   AHQAVALTVASDHSVFYRCSISGYQDTLYALSLRQFYRECDISGTVDFIFGNAAAVFQAC  306
              HQAVAL V +D S FYRCS  GYQDTLY  SLRQFYREC++ GTVDFIFGNAA V Q C
Sbjct  358   KHQAVALRVGADLSAFYRCSFVGYQDTLYVHSLRQFYRECNVYGTVDFIFGNAAVVLQNC  417

Query  305   NLVLRR--PSSYNVILANGRSDPGQNTGFSVQKCKITPGPDFSPVKNSYNSYLGRPWKPY  132
             NL  R+  P+  N+  A GR DP QNTG S+Q+CK+    D  PV+ ++++YLGRPWK Y
Sbjct  418   NLYARKPLPNQQNIFTAQGREDPNQNTGISIQRCKVAAAADLIPVQANFSTYLGRPWKEY  477

Query  131   SRAVVMESDIDGAISARGWIEWPGTSSSSVRELYFGEYANVG  6
             SR V M+S +D  IS  GW+EW G  S ++  LY+GEY N G
Sbjct  478   SRTVFMQSYLDSLISPAGWLEWNG--SFALSTLYYGEYMNRG  517



>ref|XP_007157171.1| hypothetical protein PHAVU_002G048600g [Phaseolus vulgaris]
 gb|ESW29165.1| hypothetical protein PHAVU_002G048600g [Phaseolus vulgaris]
Length=553

 Score =   313 bits (803),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 179/401 (45%), Positives = 234/401 (58%), Gaps = 25/401 (6%)
 Frame = -2

Query  1178  AIGYCEELMGMARQRLNEALVAMKESPGKNRQEDIQTWLSAAVTFQQACKDWADQYA---  1008
             A+  C ELM ++  R+ ++++ +     ++ Q+D  TWLS+ +T    C D  +  A   
Sbjct  121   ALNDCVELMDLSIDRVLDSMLTLTNQTTES-QQDAHTWLSSVLTNHATCLDGLEGTARAL  179

Query  1007  FSDELFARISRSMDYQSQLASNALALVNRNTEISAAGRQLSEEdidddddggffpDWVSG  828
                EL   ISR+   ++ LA     L  R   I      L+ E             W+  
Sbjct  180   MEAELEDLISRA---RTTLAMFVTVLPPRVEPI--VDEPLNGEFPS----------WLRS  224

Query  827   RDLRLLETTTDKTKANVVVAKDGTGNFRTVAEAIGAA--SGRQRFVIYVKSGVYKEKIR-  657
             +D RLLE++     ANVVVAKDG+  F+TVAEA+ +A  + + R+VIYVK G YKE +  
Sbjct  225   KDRRLLESSVGDINANVVVAKDGSDKFKTVAEAVKSAPVNSKTRYVIYVKKGTYKENVEI  284

Query  656   -SSKDGITLIGDGKYSTIITWDDSVGGGSSLTGSATFGITGDGFIAKDIGFQNTAGPGAH  480
               +K  + L+GDGK  T+IT   +   G+    +AT    GDGFI +DI FQNTAGP   
Sbjct  285   CQTKKNVMLVGDGKDLTVITGSLNYVDGTGTFQTATVAAVGDGFIGQDIWFQNTAGPQKQ  344

Query  479   QAVALTVASDHSVFYRCSISGYQDTLYALSLRQFYRECDISGTVDFIFGNAAAVFQACNL  300
             QAVAL V +D SV  RC I  +QDTLYA S RQFYR+  I+GTVDFIFGNAA VFQ CNL
Sbjct  345   QAVALRVGADKSVINRCRIDAFQDTLYAHSNRQFYRDSFITGTVDFIFGNAAVVFQKCNL  404

Query  299   VLRRPSS--YNVILANGRSDPGQNTGFSVQKCKITPGPDFSPVKNSYNSYLGRPWKPYSR  126
             V R+P S   N++ A GR DP QNTG S+Q+C +TP  D  PV  S  +YLGRPWK YSR
Sbjct  405   VARKPMSNQKNMVTAQGREDPNQNTGTSIQQCNLTPSSDLKPVVGSIKTYLGRPWKKYSR  464

Query  125   AVVMESDIDGAISARGWIEWPGTSSSSVRELYFGEYANVGA  3
              VVM+S I+  I   GW EW   S   ++ LY+ EY N GA
Sbjct  465   TVVMQSTIENHIYPTGWAEWDEKSKDFLQTLYYAEYNNSGA  505



>ref|XP_002324181.2| pectinesterase family protein [Populus trichocarpa]
 gb|EEF02746.2| pectinesterase family protein [Populus trichocarpa]
Length=593

 Score =   315 bits (806),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 182/477 (38%), Positives = 263/477 (55%), Gaps = 27/477 (6%)
 Frame = -2

Query  1379  IRIQCGYTRFPRLCVQTLSGLVSGERVDFAAALLLNKTIAHADLHIAHFDQLSSHFVSSQ  1200
             I+  C  T +   C +TL   V  +        LL   I  AD  I    + +S F    
Sbjct  79    IKTVCNATTYQETCQKTLEKEVEKDPSLAQPKNLLKIAIKAADEEIKKVLKKASSFKFDD  138

Query  1199  PPQPRLQAIGYCEELMGMARQRLNEALVAMKESPGK--NRQEDIQTWLSAAVTFQQACKD  1026
             P +    A   C EL+  A++ L +++  + +  GK      D+  WLSA +++QQ C D
Sbjct  139   PREK--AAFEDCLELVENAKEELKDSVAHVGDDLGKLAKNAPDLNNWLSAVMSYQQTCID  196

Query  1025  WADQYAFSD-ELFARISRSMDYQSQLASNALALVNRNTEISAA--------GRQLSEEdi  873
                   F + +L + + ++     +L SN+LA+V+  T    +         R L++ED 
Sbjct  197   -----GFPEGKLKSDMEKTFKASKELTSNSLAMVSSLTSFMKSFPFPAALNRRLLAKEDN  251

Query  872   dddddggffpDWVSGRDLRLLE-TTTDKTKANVVVAKDGTGNFRTVAEAIGAASGRQ--R  702
                 +    P W+S  D R+L+  + DK K NV VAKDG+G+F+T++EA+ A   +   R
Sbjct  252   SPALNKDDLPGWMSNEDRRILKGASKDKPKPNVTVAKDGSGDFKTISEALAAMPAKYEGR  311

Query  701   FVIYVKSGVYKEKIRSSKD--GITLIGDGKYSTIITWDDSVGGGSSLTGSATFGITGDGF  528
             +VI+VK G+Y E +  +K    IT+ GDG   TI+T + +   G     +ATF + GDGF
Sbjct  312   YVIFVKQGIYDETVTVTKKMSNITIYGDGSQKTIVTGNKNFADGVQTFRTATFAVLGDGF  371

Query  527   IAKDIGFQNTAGPGAHQAVALTVASDHSVFYRCSISGYQDTLYALSLRQFYRECDISGTV  348
             + K +GF+NTAGP  HQAVA+ V +D ++F  C   GYQDTLYA + RQFYR C I+GTV
Sbjct  372   LCKAMGFRNTAGPEKHQAVAIRVQADRAIFLNCRFEGYQDTLYAQTHRQFYRSCVITGTV  431

Query  347   DFIFGNAAAVFQACNLVLRRP--SSYNVILANGRSDPGQNTGFSVQKCKITPGPDFSPVK  174
             DFIFG+A A+FQ C + +R+P  +  N+I A GR D  + TG  +Q C+I P  D  PVK
Sbjct  432   DFIFGDATAIFQNCLITVRKPLENQQNLITAQGRVDGHETTGIVLQNCRIEPDKDLVPVK  491

Query  173   NSYNSYLGRPWKPYSRAVVMESDIDGAISARGWIEWPGTSSSSVRELYFGEYANVGA  3
                 SYLGRPWK +SR ++MES I   I   GW+ W G     ++ LY+ EY N GA
Sbjct  492   TKIRSYLGRPWKEFSRTIIMESTIGDFIHPDGWLPWQG--EFGLKTLYYAEYNNKGA  546



>ref|XP_009592542.1| PREDICTED: pectinesterase-like [Nicotiana tomentosiformis]
Length=568

 Score =   314 bits (804),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 192/467 (41%), Positives = 261/467 (56%), Gaps = 22/467 (5%)
 Frame = -2

Query  1370  QCGYTRFPRLCVQTLSGLVSGERVDFAAALLLNKTIAHADLHIAHFD--QLSSHFVSSQP  1197
              C  T  P LCV TLS   +  R   A  +     IA  ++  +  +   L  H    +P
Sbjct  60    HCEGTLHPELCVSTLSSFPNLHRKSIAEIISSTVKIAVGEVRASAHNCSDLRRHVPKLEP  119

Query  1196  PQPRLQAIGYCEELMGMARQRLNEAL--VAMKESPGKNRQEDIQTWLSAAVTFQQACKDW  1023
              + R  A+  C EL+G     L  AL  ++ K+S  K+   DIQT LSAA+T +  C D 
Sbjct  120   IEKR--ALQDCVELLGETIAELRTALSDLSPKKSASKHYN-DIQTLLSAAMTNEDTCLD-  175

Query  1022  ADQYAFSDELFARISRSMDYQSQLASNALALVNR--NTEISAAGRQLSEEdidddddggf  849
                Y+  + L   +  ++   +   SN+LA++N+   T +S++     E           
Sbjct  176   GLFYSTKNNLTRYVEDNLHTIAHHVSNSLAMLNKIKRTSVSSSDEVFPE----YGAMKNG  231

Query  848   fpDWVSGRDLRLLETTTDKTKANVVVAKDGTGNFRTVAEAIGAA--SGRQRFVIYVKSGV  675
             FP W+  R+  LL+   ++TK ++ VAKDG+GNF T+ EA+ AA  S   RFVIY+K G 
Sbjct  232   FPKWLKRRERALLQVPVNETKFDLAVAKDGSGNFTTINEALSAAPNSTNTRFVIYIKEGS  291

Query  674   YKE--KIRSSKDGITLIGDGKYSTIITWDDSVGGGSSLTGSATFGITGDGFIAKDIGFQN  501
             Y E  ++   K+ I  +GDG   T I  + +   G +   SAT  + G GF+AK I F+N
Sbjct  292   YFEYVEVDKKKNMIMFVGDGVGKTKIKGNRNHVDGWTTFRSATVAVVGKGFLAKGITFEN  351

Query  500   TAGPGAHQAVALTVASDHSVFYRCSISGYQDTLYALSLRQFYRECDISGTVDFIFGNAAA  321
              AGP  HQAV L  +SD S FY+CS   YQDTLY  SLRQFYRECDI GTVDFIFGNAA 
Sbjct  352   YAGPSKHQAVTLRSSSDLSAFYQCSFVAYQDTLYVHSLRQFYRECDIYGTVDFIFGNAAV  411

Query  320   VFQACNLVLRR--PSSYNVILANGRSDPGQNTGFSVQKCKITPGPDFSPVKNSYNSYLGR  147
             V Q CNL  R+  P+  N+  A GR DP QNTG S+  CK+    D  PV++S+ +YLGR
Sbjct  412   VLQNCNLYARKPDPNQRNLFTAQGREDPNQNTGISILNCKVEAAADLVPVQSSFKNYLGR  471

Query  146   PWKPYSRAVVMESDIDGAISARGWIEWPGTSSSSVRELYFGEYANVG  6
             PWK YSR V ++S I   I   GW+EW G  + +++ LY+GEY N G
Sbjct  472   PWKEYSRTVFLQSYIGSLIEPAGWLEWNG--NFALKTLYYGEYMNRG  516



>ref|XP_004502642.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 34-like 
[Cicer arietinum]
Length=595

 Score =   315 bits (807),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 190/484 (39%), Positives = 270/484 (56%), Gaps = 41/484 (8%)
 Frame = -2

Query  1379  IRIQCGYTRFPRLCVQTLSGLVSGERVDFAAALLLN-KTIAHADL-----HIAHFDQLSS  1218
             I + C  TRF  LCV +         +DF  + + + K + H  L     H++     S+
Sbjct  76    ISLTCSKTRFXTLCVNSF--------LDFPGSTIASEKDLVHISLNMTLQHLSKALYSSA  127

Query  1217  HFVSSQPPQPRLQ-AIGYCEELMGMARQRLNEALVAMKESP--------GKNRQEDIQTW  1065
                S+    PR++ A   C EL+  +   + ++L ++K S           +  +D+ TW
Sbjct  128   SISSAVGMNPRIRTAYQDCLELLDDSIDAVAKSLTSVKPSTSSGSIKPLAASSTDDVLTW  187

Query  1064  LSAAVTFQQACKDWADQYAFSD---ELFARISRSMDYQSQLASNALALVNRN-TEISAAG  897
             LSAA+T Q  C +      FSD   E+  +++ ++   S+L SN LA+ + +      +G
Sbjct  188   LSAALTNQDTCAE-----GFSDTSGEVKNQMTNNLKDLSELVSNCLAIFSASGVGDDFSG  242

Query  896   RQLSEEdidddddggffpDWVSGRDLRLLETTTDKTKANVVVAKDGTGNFRTVAEAIGAA  717
               +  +          FP W+S R+ RLL     + +A+V+V+KDG G  +T+AEAI   
Sbjct  243   VPIQNKRRLLTMREDNFPKWLSRRERRLLNLAVSEIQADVIVSKDGNGTVKTIAEAIKKI  302

Query  716   S--GRQRFVIYVKSGVYKE---KIRSSKDGITLIGDGKYSTIITWDDSVGGGSSLTGSAT  552
                G +RF+IY++ G Y+E   KI   K  + +IGDGK  T+IT   +V    +   +A+
Sbjct  303   PEYGNRRFIIYIRQGRYEEDNLKIGRKKTNVMIIGDGKGKTVITGGKNVMQNLTTFHTAS  362

Query  551   FGITGDGFIAKDIGFQNTAGPGAHQAVALTVASDHSVFYRCSISGYQDTLYALSLRQFYR  372
             F  +G GFIA+D+ F+N AGP  HQAVAL V +DH+V YRC+I GYQDT+Y  S RQFYR
Sbjct  363   FAASGPGFIARDVTFENYAGPAKHQAVALRVGADHAVVYRCNIIGYQDTMYVHSNRQFYR  422

Query  371   ECDISGTVDFIFGNAAAVFQACNLVLRRPSSY--NVILANGRSDPGQNTGFSVQKCKITP  198
             ECDI GTVDFIFGNAA VFQ C+L  R+P +   N I A  R DP QNTG S+  C+I  
Sbjct  423   ECDIYGTVDFIFGNAAVVFQNCSLYARKPMAQQKNTITAQNRKDPNQNTGISIHNCRILA  482

Query  197   GPDFSPVKNSYNSYLGRPWKPYSRAVVMESDIDGAISARGWIEWPGTSSSSVRELYFGEY  18
              PD    K S+ +YLGRPWK YS+ V M S +   I  RGW+EW  T   ++  LY+GEY
Sbjct  483   TPDLEASKGSFQTYLGRPWKLYSKTVYMLSYMGDHIHPRGWLEWNAT--FALDTLYYGEY  540

Query  17    ANVG  6
              N G
Sbjct  541   MNYG  544



>gb|KFK26958.1| hypothetical protein AALP_AA8G315400 [Arabis alpina]
Length=584

 Score =   315 bits (806),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 188/477 (39%), Positives = 262/477 (55%), Gaps = 30/477 (6%)
 Frame = -2

Query  1382  QIRIQCGYTRFPRLCVQTLSGLVSGERVDFAAALLLN-KTIAHADLHI-------AHFDQ  1227
             +I   C  +++  LC+ TL        +DF  AL  N + + H   +        A +  
Sbjct  71    EISRTCSKSQYQNLCIDTL--------LDFPGALTANEQELIHISFNATLQGFSKALYSS  122

Query  1226  LSSHFVSSQPPQPRLQAIGYCEELMGMARQRLNEAL--VAMKESPGKNRQEDIQTWLSAA  1053
              S  + +  PP+ R  A   C EL+  +   L+ AL  VA+          D+ TWLS+A
Sbjct  123   SSISYTNKMPPRVR-SAYDSCLELLDDSVDALSRALSLVAIASEDNGEHHSDVVTWLSSA  181

Query  1052  VTFQQACKDWADQYAFSDELFARISRSMDYQSQLASNALALVNRNTEISAAGRQLSEEdi  873
             +T    C D  ++   S  +  +I  ++   S++ SN LA+ + N +  +    ++   +
Sbjct  182   MTNHDTCTDGFEE--ISSGVKDQIIEAVKDLSEMVSNCLAIFSGNVKDLSGVPVVNNRKL  239

Query  872   dddddggffpDWVSGRDLRLLETTTDKTKANVVVAKDGTGNFRTVAEAIGAA--SGRQRF  699
              + ++   FP W++  D  LL T     +A++ V+KDG G F+T+AEAI  A     +RF
Sbjct  240   LNTEETEEFPKWLNRGDRELLGTPATTIQADITVSKDGNGTFKTIAEAIKKAPEHSSRRF  299

Query  698   VIYVKSGVYKE---KIRSSKDGITLIGDGKYSTIITWDDSVGGGSSLTGSATFGITGDGF  528
             VIYVKSG Y+E   K+   K  I  IGDGK  T+IT   S+    +   +ATF  TG GF
Sbjct  300   VIYVKSGRYEEENLKVGRKKTNIMFIGDGKGKTVITGGKSIANDLTTFHTATFAATGAGF  359

Query  527   IAKDIGFQNTAGPGAHQAVALTVASDHSVFYRCSISGYQDTLYALSLRQFYRECDISGTV  348
             I +D+ F+N AGP  HQAVAL V  DH+V YRC++ GYQD LY  S RQF+RECDI GTV
Sbjct  360   IVRDMTFENYAGPAKHQAVALRVGGDHAVVYRCNVIGYQDALYVHSNRQFFRECDIYGTV  419

Query  347   DFIFGNAAAVFQACNLVLRRPSSYN--VILANGRSDPGQNTGFSVQKCKITPGPDFSPVK  174
             DFIFGNAA + Q+CN+  R+P       I A  R DP QNTG S+  CK+    D    K
Sbjct  420   DFIFGNAAVILQSCNIYARKPMPQQKITITAQNRKDPNQNTGISIHACKLLATADLEASK  479

Query  173   NSYNSYLGRPWKPYSRAVVMESDIDGAISARGWIEWPGTSSSSVRELYFGEYANVGA  3
              SY +YLGRPWK YSR V M SD+   I+ +GW+EW G    ++  LY+GEY N GA
Sbjct  480   GSYPTYLGRPWKLYSRVVYMMSDMGDHINPQGWLEWNG--PFALDTLYYGEYMNRGA  534



>ref|XP_008228106.1| PREDICTED: pectinesterase 3 [Prunus mume]
Length=587

 Score =   315 bits (806),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 192/481 (40%), Positives = 260/481 (54%), Gaps = 42/481 (9%)
 Frame = -2

Query  1379  IRIQCGYTRFPRLCVQTLSGLVSGERVDFAAALLLNKTIAHADLHIA-----HFDQLSSH  1215
             ++  C  T++P  C  ++S L +    D        + I    LH+A         L S 
Sbjct  77    LKAVCDVTQYPNSCFSSISSLETSNTTD-------PEVIFKLSLHVAINAASKLAGLPSK  129

Query  1214  FVSSQPPQPRLQ-AIGYCEELMGMARQRLNEALVAMKESPGKN-----RQEDIQTWLSAA  1053
             F        RL   +  CE L      RLN++L +M  + G+      + +D++TWLS  
Sbjct  130   FRRQAANDTRLNGTLSVCESLFEDVVDRLNDSLSSMDVNQGEKLLSAAKIDDLKTWLSTT  189

Query  1052  VTFQQACKDWADQYAFSDELFARISRSMDYQSQLASNALALVNR------NTEISAAGRQ  891
             +T Q+ C D       +  L      +M   ++ +SN+LA+V +      N  I    R 
Sbjct  190   LTDQETCLDSLQD--LNSTLVQEFKVAMQNSTEFSSNSLAIVAKILGLLTNLNIPVHRRL  247

Query  890   LSEEdidddddggffpDWVSGRDLRLLETTTDKTKANVVVAKDGTGNFRTVAEAIGAASG  711
             L             FP WV   D RLLE   + T A V+VAKDGTG F+T+ EA+ A   
Sbjct  248   LG-----VGGSEMGFPGWVGPGDRRLLEDN-NVTAAQVIVAKDGTGLFKTIKEAVEAVPK  301

Query  710   RQ--RFVIYVKSGVYKEKI--RSSKDGITLIGDGKYSTIITWDDSVGGGSSLTGSATFGI  543
             +   RFVI+VK GVY E +    SK  + ++GDGK  TI+    +   G+    +ATF +
Sbjct  302   KSTTRFVIHVKEGVYNENVLMDKSKWNVMMVGDGKDKTIVNGSLNFVDGTPTFSTATFAV  361

Query  542   TGDGFIAKDIGFQNTAGPGAHQAVALTVASDHSVFYRCSISGYQDTLYALSLRQFYRECD  363
              G GFIAKD+GF N+AGP  HQAVA    SD SV+Y+CS SGYQDTLYA S RQFYRECD
Sbjct  362   AGKGFIAKDMGFINSAGPAKHQAVAFRSGSDLSVYYKCSFSGYQDTLYAHSNRQFYRECD  421

Query  362   ISGTVDFIFGNAAAVFQACNLVLRRPSS--YNVILANGRSDPGQNTGFSVQKCKITPGPD  189
             I GT+DFIFGNAA VFQ CN++ R+P S  +N I A G+ DP QNTG S+QKCKI+    
Sbjct  422   IIGTIDFIFGNAAVVFQNCNIMPRQPMSNQFNTITAQGKKDPNQNTGMSIQKCKISA---  478

Query  188   FSPVKNSYNSYLGRPWKPYSRAVVMESDIDGAISARGWIEWPGTSSSSVRELYFGEYANV  9
                   +  +YLGRPWK +S  V M+SDI   ++ +GWIEW  ++      +Y+ EY N 
Sbjct  479   LDAANLTAPTYLGRPWKEFSTTVFMQSDIGSFLNPKGWIEWV-SNVEPPNTIYYAEYQNS  537

Query  8     G  6
             G
Sbjct  538   G  538



>ref|XP_010259035.1| PREDICTED: pectinesterase 2-like [Nelumbo nucifera]
Length=528

 Score =   313 bits (801),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 175/366 (48%), Positives = 231/366 (63%), Gaps = 26/366 (7%)
 Frame = -2

Query  1079  DIQTWLSAAVTFQQACKDWADQYAFSDELFARISRSMDYQSQLASNALALVNRNTEISAA  900
             D QTWLS A+T  Q C+    +   SD +   +S ++   S+L SN LA+   N  IS  
Sbjct  132   DAQTWLSTALTNLQTCRAGFIELGVSDFMLPLMSNNV---SKLISNTLAI---NKAIS--  183

Query  899   GRQLSEEdidddddggffpDWVSGRDLRLLETTTDKTKANVVVAKDGTGNFRTVAEAIGA  720
                      + +   G FP WVS  D +LL++++  ++AN+VVA+DG+GNFRT+  A+ A
Sbjct  184   --------QNQNYTDGRFPSWVSPGDRKLLQSSSPASRANMVVAQDGSGNFRTIKAALDA  235

Query  719   AS----GRQRFVIYVKSGVYKE--KIRSSKDGITLIGDGKYSTIITWDDSVGGGSSLTGS  558
              S    G  RF+I+VK+GVY+E  +I +    I L+GDG  STIIT   SVGGG +   S
Sbjct  236   VSKQRKGSGRFIIHVKAGVYRENLEIGNGMKNIMLVGDGMRSTIITGSRSVGGGFTTFNS  295

Query  557   ATFGITGDGFIAKDIGFQNTAGPGAHQAVALTVASDHSVFYRCSISGYQDTLYALSLRQF  378
             AT  +TG+GFIA  I F+NTAGP  HQAVAL   SD SVFYRC   GYQDTLY  S RQF
Sbjct  296   ATVAVTGEGFIAMGITFRNTAGPQNHQAVALRSGSDLSVFYRCGFEGYQDTLYVHSQRQF  355

Query  377   YRECDISGTVDFIFGNAAAVFQACNLVLRRP--SSYNVILANGRSDPGQNTGFSVQKCKI  204
             YREC I GTVDFIFGNAA V Q C ++ RRP     NV+ A GR+DP QNTG S+  C++
Sbjct  356   YRECYIYGTVDFIFGNAAVVLQNCMILPRRPMDGQSNVVTAQGRTDPNQNTGISIHNCRV  415

Query  203   TPGPDFSPVKNSYNSYLGRPWKPYSRAVVMESDIDGAISARGWIEWPGTSSSSVRELYFG  24
                 D  PV++S+ ++LGRPWK YSR V +++ +D  +   GW+EW G  + ++  LY+G
Sbjct  416   MASSDLKPVQSSFKTFLGRPWKEYSRTVYLQTYLDTLVDPAGWMEWSG--NFALNTLYYG  473

Query  23    EYANVG  6
             EY N G
Sbjct  474   EYRNFG  479



>ref|XP_006480001.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 40-like 
[Citrus sinensis]
Length=569

 Score =   314 bits (804),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 197/508 (39%), Positives = 276/508 (54%), Gaps = 36/508 (7%)
 Frame = -2

Query  1460  IMLVLFFGCCVTTIaaaavsqvaaQDQIRIQ---------CGYTRFPRLCVQTLSGL--V  1314
             I L+LF    V+        +      +R+          C  T +P LCV TL  +  +
Sbjct  24    IFLLLFVLSAVSVTTLKKNPKTTDAPHLRVHKHFQVAHSACEGTLYPELCVSTLLSVPDL  83

Query  1313  SGERVDFAAALLLNKTIAHADLHIAHFDQLSSHFVSSQPPQPRLQAIGYCEELMGMARQR  1134
             + +RV    ++ +N+T++      ++   +   + +    + R  AI  C EL       
Sbjct  84    ASKRVPELISVTINRTLSELRASSSNCSSIGQSYPNFNTLEKR--AINDCLELFHDTIVE  141

Query  1133  LNEAL--VAMKESPGKNRQEDIQTWLSAAVTFQQACKDWADQYAFSDELFARISRSMDYQ  960
             L  AL  ++ K+ P K+   D+QT  S A+T Q  C    D +A+SD     + +S  Y 
Sbjct  142   LKSALNDLSPKKLPSKHYH-DLQTLFSGAMTNQYTC---LDGFAYSDGNVRDVIKSSLYN  197

Query  959   -SQLASNALALVNRNTEISAAGRQLS---EEdidddddggffpDWVSGRDLRLLETTTDK  792
              S+  SN+L ++ +       G  +S   E   +       FP W+S  D +LL+ + + 
Sbjct  198   ISRHVSNSLVMLKK-----IPGDNMSSKYEVFPEYGRIKRGFPTWLSLNDRKLLQKSVNL  252

Query  791   TKANVVVAKDGTGNFRTVAEAIGAASGRQ--RFVIYVKSGVYKEKIRSSKDGITL--IGD  624
             TK +++VAKDG+GNF T+ EA+ AA  +   RFVIY+K+G Y E +   K    L  +GD
Sbjct  253   TKFDLIVAKDGSGNFTTITEAVEAAPNKSNTRFVIYIKAGAYFENVEVDKKKTMLMFVGD  312

Query  623   GKYSTIITWDDSVGGGSSLTGSATFGITGDGFIAKDIGFQNTAGPGAHQAVALTVASDHS  444
             G   T++  + SV  G +   SAT  + G GFIAK I  +N+AGP  HQAVAL   SD S
Sbjct  313   GIGKTVVKANRSVVDGWTTFRSATVAVVGTGFIAKGITVENSAGPSKHQAVALRSGSDLS  372

Query  443   VFYRCSISGYQDTLYALSLRQFYRECDISGTVDFIFGNAAAVFQACNLVLRRPSS--YNV  270
              FY+CS  GYQDTLY  SLRQFYRECD+ GTVDFIFGNAA VFQ CNL  R+P++   N+
Sbjct  373   AFYKCSFVGYQDTLYVHSLRQFYRECDVYGTVDFIFGNAAVVFQICNLYARKPNANQKNI  432

Query  269   ILANGRSDPGQNTGFSVQKCKITPGPDFSPVKNSYNSYLGRPWKPYSRAVVMESDIDGAI  90
             I A GR DP QNTG S+  CK+    D  P +  + +YLGRPWK YSR V M S +   I
Sbjct  433   ITAQGREDPNQNTGISILNCKVAAASDLIPYQTEFKTYLGRPWKEYSRTVFMLSYLGDLI  492

Query  89    SARGWIEWPGTSSSSVRELYFGEYANVG  6
             +  GW+EW GT + S   L++GEY N G
Sbjct  493   APAGWLEWNGTFALST--LFYGEYKNRG  518



>ref|XP_008224789.1| PREDICTED: pectinesterase [Prunus mume]
Length=555

 Score =   313 bits (803),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 184/414 (44%), Positives = 241/414 (58%), Gaps = 28/414 (7%)
 Frame = -2

Query  1208  SSQPPQPRLQA-IGYCEELMGMARQRLNEALVAMKESPGKNRQEDIQTWLSAAVTFQQAC  1032
             SS+   P+ QA I  C ELM ++  R+  + +A++    +N  ED   WLS+ +T    C
Sbjct  110   SSRINNPKDQAAIADCVELMDVSIDRVMHSTIALQNFTLQNSLEDAHAWLSSILTNHVTC  169

Query  1031  KDWADQYA---FSDELFARISRSMDYQSQLASNALALVNRNTEISAAGRQLSEEdidddd  861
              D     A       L   ISRS          +LA++   + +S    ++ E    +  
Sbjct  170   LDGLQGPARTIMEPRLNDLISRS--------RASLAIMVAISNLSKLKAEIHEPLNGEFP  221

Query  860   dggffpDWVSGRDLRLLE--TTTDKTKANVVVAKDGTGNFRTVAEAIGAA--SGRQRFVI  693
                    WV+ RD RLL+      + KAN+VVAKDG+GN++TV EA+ AA  + + R++I
Sbjct  222   S------WVTSRDRRLLQDYNLAKEVKANIVVAKDGSGNYKTVKEAVAAAPNNSKTRYII  275

Query  692   YVKSGVYKEKIR--SSKDGITLIGDGKYSTIITWDDSVGGGSSLTGSATFGITGDGFIAK  519
             YVK G YKE +    +K  + ++GDG  +T+IT   +V  GS+   SAT    GDGFIA+
Sbjct  276   YVKKGTYKENVEVGKNKKNLMIVGDGMDNTVITGSLNVVDGSTTFKSATLAAVGDGFIAQ  335

Query  518   DIGFQNTAGPGAHQAVALTVASDHSVFYRCSISGYQDTLYALSLRQFYRECDISGTVDFI  339
             D+ FQNTAG   HQAVAL V +D SV  RC I  YQDTLY  S RQFYR+  I+GTVDFI
Sbjct  336   DMWFQNTAGAVKHQAVALRVGADQSVINRCRIDAYQDTLYTHSNRQFYRDSYITGTVDFI  395

Query  338   FGNAAAVFQACNLVLRRPSS--YNVILANGRSDPGQNTGFSVQKCKITPGPDFSPVKNSY  165
             FGNAA VFQ C LV R+P +   N++ A GR DP QNTG S+QKC I    D  PVK + 
Sbjct  396   FGNAAVVFQNCQLVARKPMTGQNNMVTAQGRIDPNQNTGTSIQKCDIIASSDLEPVKGTI  455

Query  164   NSYLGRPWKPYSRAVVMESDIDGAISARGWIEWPGTSSSSVRELYFGEYANVGA  3
              SYLGRPWK YSR VVM+S I   I   GW  W G    +++ LY+GEYAN GA
Sbjct  456   RSYLGRPWKEYSRTVVMQSKIGDHIDPTGWSIWSG--DFALKTLYYGEYANSGA  507



>ref|XP_009589961.1| PREDICTED: LOW QUALITY PROTEIN: pectinesterase-like [Nicotiana 
tomentosiformis]
Length=548

 Score =   313 bits (803),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 184/454 (41%), Positives = 250/454 (55%), Gaps = 29/454 (6%)
 Frame = -2

Query  1340  CVQTLSGLVSGERVDFAAALLLNKTIAHADLHIAHFDQLSSHFVSSQPPQPRLQAIGYCE  1161
             C+  +S +     +D     LL   +  + L I     L  +  S         A+  C 
Sbjct  67    CLAMVSEVAPTGVMDTKTVDLLQMVLHKSSLKIHEAIDLVRNVNSRINNDKEQAALADCL  126

Query  1160  ELMGMARQRLNEALVAMKESPGKNRQEDIQTWLSAAVTFQQACKDWAD---QYAFSDELF  990
             ELM ++R RL ++++++  +       D+ TWLS+ +T    CKD  +   Q      L 
Sbjct  127   ELMDLSRDRLMDSMMSLG-NLSTQVHFDVHTWLSSILTNHVTCKDGLNGLVQSIMEPMLK  185

Query  989   ARISRSMDYQSQLASNALALVNRNTEISAAGRQLSEEdidddddggffpDWVSGRDLRLL  810
               I+R        A  +LAL+ +   +         + +D        P WV+  D RLL
Sbjct  186   DLITR--------AKTSLALMVKMAPV---------KTMDLPSVTHGLPSWVTSNDRRLL  228

Query  809   ETTTDKTKANVVVAKDGTGNFRTVAEAIGAA--SGRQRFVIYVKSGVYKEKIR--SSKDG  642
             + + +   ANVVVAKDG+G F+TV EA+ +A  +G+ R+VIYVK G+YKE +     K  
Sbjct  229   QLSANAITANVVVAKDGSGKFKTVKEAVASAPDNGKTRYVIYVKKGIYKENVEIGKKKKN  288

Query  641   ITLIGDGKYSTIITWDDSVGGGSSLTGSATFGITGDGFIAKDIGFQNTAGPGAHQAVALT  462
             + L+GDG  +TIIT   +   GS+   SAT    GDGFIA+D+ FQNTAGP  HQAVAL 
Sbjct  289   VMLVGDGMDATIITGSLNFVDGSTTFKSATVAAVGDGFIAQDLQFQNTAGPSKHQAVALR  348

Query  461   VASDHSVFYRCSISGYQDTLYALSLRQFYRECDISGTVDFIFGNAAAVFQACNLVLRRPS  282
             + +D SV  RC I  +QDTLY  SLRQFYR+C I+GTVDFIFGNAA VFQ   +  R+P 
Sbjct  349   IGADQSVINRCKIDAFQDTLYTHSLRQFYRDCYITGTVDFIFGNAAVVFQNSKIAARKPG  408

Query  281   S--YNVILANGRSDPGQNTGFSVQKCKITPGPDFSPVKNSYNSYLGRPWKPYSRAVVMES  108
             S   N++ A GR DP QNTG S+Q C I    D + VK S  +YLGRPWK YSR V M+S
Sbjct  409   SGQKNMVTAQGREDPNQNTGTSIQNCDIIATSDLASVKGSVKTYLGRPWKAYSRTVFMQS  468

Query  107   DIDGAISARGWIEWPGTSSSSVRELYFGEYANVG  6
             +I   I   GW  W G    +++ LY+GEY N G
Sbjct  469   NIGDHIDPEGWSVWDG--DFALKTLYYGEYMNKG  500



>emb|CDY27388.1| BnaC04g50170D [Brassica napus]
Length=510

 Score =   312 bits (799),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 179/388 (46%), Positives = 227/388 (59%), Gaps = 25/388 (6%)
 Frame = -2

Query  1166  CEELMGMARQRLNEALVAMKESPGKNRQEDIQTWLSAAVTFQQACKDWADQYAFSDELFA  987
             C +L      ++N+ +    +   K  + D QTWLS A+T    CK    +   +D +  
Sbjct  99    CLKLYDFTVSKINKTM----DPDTKCSKTDSQTWLSTALTNLDTCKAGFLELGVTDFILP  154

Query  986   RISRSMDYQSQLASNALALVNRNTEISAAGRQLSEEdidddddggffpDWVSGRDLRLLE  807
              +S ++   S L  N LA+       +   +               FP WV   D +LL+
Sbjct  155   LMSNNV---SDLICNTLAINKVPFNYTPPEKD-------------GFPSWVKPGDRKLLQ  198

Query  806   TTTDKTKANVVVAKDGTGNFRTVAEAIGAASGRQRFVIYVKSGVYKEKIRSSKDGITLIG  627
              +T +   NVVVAKDG+GNFRT+ EAI AASG  RFVIYVK GVY E +   KD + L G
Sbjct  199   NSTPRD--NVVVAKDGSGNFRTIKEAINAASGSGRFVIYVKQGVYSENLEIQKDNVMLRG  256

Query  626   DGKYSTIITWDDSVGGGSSLTGSATFGITGDGFIAKDIGFQNTAGPGAHQAVALTVASDH  447
             DGK  TIIT   SVGGGS+   SAT    GDGFIA+ I F+NTAG    QAVAL   SD 
Sbjct  257   DGKGRTIITGSRSVGGGSTTFKSATVAAVGDGFIARGITFRNTAGANNGQAVALRSGSDL  316

Query  446   SVFYRCSISGYQDTLYALSLRQFYRECDISGTVDFIFGNAAAVFQACNLVLRRPSS-YNV  270
             SVFY+CS  GYQDTLY  S RQFY +CD+ GTVDFIFGNAAA+FQ CN+  RRP    N 
Sbjct  317   SVFYQCSFEGYQDTLYVHSNRQFYSDCDVYGTVDFIFGNAAAIFQNCNIFARRPPGRTNT  376

Query  269   ILANGRSDPGQNTGFSVQKCKITPGPDFSPVKNSYNSYLGRPWKPYSRAVVMESDIDGAI  90
             I A GRS P QNTG  +   ++T   D  PV  S  +YLGRPW+ YSRAV M++ +D  I
Sbjct  377   ITAQGRSYPDQNTGIIIHNSRVTAASDLRPVLGSTKTYLGRPWRQYSRAVFMKTSLDSLI  436

Query  89    SARGWIEWPGTSSSSVRELYFGEYANVG  6
               RGW+EW G  + ++  L++GE+ N G
Sbjct  437   DPRGWLEWNG--NFALTTLFYGEFQNTG  462



>gb|AFC98398.1| pectin methylesterase [Lepidium sativum]
Length=556

 Score =   313 bits (802),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 180/399 (45%), Positives = 235/399 (59%), Gaps = 28/399 (7%)
 Frame = -2

Query  1166  CEELMGMARQRLNEALVAMKESPGKNRQ----EDIQTWLSAAVTFQQACKDWADQYAFSD  999
             C+E+M +++ R+   + ++KE  G N +     ++ TWLS+ +T    C     Q + +D
Sbjct  125   CDEMMDVSKDRM---VSSIKELRGGNLELESYSNVHTWLSSVLTNYMTC-----QESITD  176

Query  998   ELFARISRSMDYQSQLASNALALVNRNTEISAAGRQLSEEdidddddggffpDWVSGRDL  819
                   SR M     L S A   +     ++     L             FP W++  D 
Sbjct  177   VSVDSNSRVMPQLEDLVSRARVALAIFVSVTPVKDDLQ------MIVSNHFPSWLTTFDR  230

Query  818   RLLETTTD--KTKANVVVAKDGTGNFRTVAEAIGAA--SGRQRFVIYVKSGVYKEKIR--  657
             +LLE+     +  ANVVVAKDGTG F+TV EA+ AA  +   R+V+YVK GVYKE I   
Sbjct  231   KLLESAPKSLEVNANVVVAKDGTGKFKTVNEAVTAAPENSNSRYVVYVKKGVYKETIDIG  290

Query  656   SSKDGITLIGDGKYSTIITWDDSVGGGSSLTGSATFGITGDGFIAKDIGFQNTAGPGAHQ  477
               K  + L+GDGK  TIIT   +V  GS+   SAT    GDGF+A+DI  QNTAGP  HQ
Sbjct  291   KKKKNLMLVGDGKDLTIITGSLNVVDGSTTFRSATVAANGDGFMAQDIWIQNTAGPAKHQ  350

Query  476   AVALTVASDHSVFYRCSISGYQDTLYALSLRQFYRECDISGTVDFIFGNAAAVFQACNLV  297
             AVAL V++D SV  RC I  YQDTLY  +LRQFYR+C I+GTVDFIFGN+A VFQ C++V
Sbjct  351   AVALRVSADQSVINRCRIDAYQDTLYTHTLRQFYRDCFITGTVDFIFGNSAVVFQNCDIV  410

Query  296   LRRPSS--YNVILANGRSDPGQNTGFSVQKCKITPGPDFSPVKNSYNSYLGRPWKPYSRA  123
              R+P +   N++ A GR DP QNT  S+QKC I P  + +PVK S  +YLGRPWK YSR 
Sbjct  411   ARKPDAGQKNMLTAQGREDPNQNTAISIQKCNIKPSSELAPVKESVKTYLGRPWKLYSRT  470

Query  122   VVMESDIDGAISARGWIEWPGTSSSSVRELYFGEYANVG  6
             V+M+S ID  I   GW  W G  + S   LY+GEYAN G
Sbjct  471   VIMQSFIDNHIDPAGWFPWDGEFALST--LYYGEYANNG  507



>ref|XP_004307817.1| PREDICTED: pectinesterase 2-like [Fragaria vesca subsp. vesca]
Length=459

 Score =   310 bits (795),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 178/363 (49%), Positives = 225/363 (62%), Gaps = 24/363 (7%)
 Frame = -2

Query  1079  DIQTWLSAAVTFQQACKDWADQYAFSDELFARISRSMDYQSQLASNALALVNRNTEISAA  900
             D QTWLS A+T  + C+    +   SD +   +S ++   S+L SN L+ +N  +   A 
Sbjct  67    DSQTWLSTALTNLETCRAGFVELGVSDFVLPLMSNNV---SKLISNTLS-INNGSSAPAV  122

Query  899   GRQLSEEdidddddggffpDWVSGRDLRLLETTTDKTKANVVVAKDGTGNFRTVAEAIGA  720
               Q +E           FP WV     RLL++T     ANVVVA+DG+GN++T+ EA+ A
Sbjct  123   TNQYTE----------GFPSWVKPGVRRLLQSTP---AANVVVAQDGSGNYKTIKEALDA  169

Query  719   A---SGRQRFVIYVKSGVYKEKIRSSKDGITLIGDGKYSTIITWDDSVGGGSSLTGSATF  549
             A   SG QRFVI VKSGVYKE +      I L+GDG  STIIT   SV GGS+   SAT 
Sbjct  170   AAKRSGSQRFVIRVKSGVYKENLEIKLKNIYLLGDGLRSTIITGSRSVVGGSTTFNSATV  229

Query  548   GITGDGFIAKDIGFQNTAGPGAHQAVALTVASDHSVFYRCSISGYQDTLYALSLRQFYRE  369
              +TGDGFIA+ I F+NTAGP  HQAVAL   +D SVFYRCS  GYQDTLY  S RQFY+E
Sbjct  230   AVTGDGFIARGITFRNTAGPQNHQAVALRSGADLSVFYRCSFEGYQDTLYTHSQRQFYKE  289

Query  368   CDISGTVDFIFGNAAAVFQACNLVLRRPSS--YNVILANGRSDPGQNTGFSVQKCKITPG  195
             C I GTVDFIFGNAA V Q C +  R+P S   N I A GR+DP QNTG S+   +I   
Sbjct  290   CYIYGTVDFIFGNAAVVLQNCMIYARKPMSGQKNTITAQGRTDPNQNTGISIHDSRIMAA  349

Query  194   PDFSPVKNSYNSYLGRPWKPYSRAVVMESDIDGAISARGWIEWPGTSSSSVRELYFGEYA  15
              D +PV  S  ++LGRPWK YSR V ++S +D  +   GW+EW G  + +++ LY+GEY 
Sbjct  350   ADLAPVIKSVKTFLGRPWKTYSRTVFLQSYLDSLVDPAGWLEWDG--NFALKTLYYGEYK  407

Query  14    NVG  6
             N G
Sbjct  408   NKG  410



>ref|XP_006360083.1| PREDICTED: pectinesterase 2.1-like [Solanum tuberosum]
Length=550

 Score =   313 bits (802),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 171/404 (42%), Positives = 240/404 (59%), Gaps = 36/404 (9%)
 Frame = -2

Query  1178  AIGYCEELMGMARQRLNEALVAMKESPGKNRQEDIQTWLSAAVTFQQACKDWADQYAFS-  1002
             A+  C EL+ ++   +++++ A+ ++ G     + Q+WLS  +T    C D  D +  + 
Sbjct  119   ALTDCLELLDLSVDLVSDSIEAIDKTSGSG-HANAQSWLSGVLTNHVTCLDELDSFTKTM  177

Query  1001  ------DELFARISRSMDYQSQLASNALALVNRNTEISAAGRQLSEEdidddddggffpD  840
                   DEL +R   ++   + + ++     N +   +  GR  S               
Sbjct  178   INGTNLDELISRAKVALAMLASVTTH-----NEDVFRTVLGRMPS---------------  217

Query  839   WVSGRDLRLLETTTDKTKANVVVAKDGTGNFRTVAEAIGAA--SGRQRFVIYVKSGVYKE  666
             WVS RD +L+E+     K N VVA+DGTG+++T+AEA+ AA  + ++R+VIYVK G+YKE
Sbjct  218   WVSSRDRKLMESLGKDIKTNAVVAQDGTGDYQTLAEAVAAAPDNSKKRYVIYVKMGIYKE  277

Query  665   KIR--SSKDGITLIGDGKYSTIITWDDSVGGGSSLTGSATFGITGDGFIAKDIGFQNTAG  492
              +   ++K  + ++GDG  +TIIT   +V  GS+   SAT    G GFI +DI  QNTAG
Sbjct  278   NVEVTNNKMNLMIVGDGMNATIITGSLNVVDGSTTFRSATLAAVGQGFILQDICIQNTAG  337

Query  491   PGAHQAVALTVASDHSVFYRCSISGYQDTLYALSLRQFYRECDISGTVDFIFGNAAAVFQ  312
             P  HQAVAL V +D SV  RC I  YQDTLYA SLRQFYR+  ++GTVDFIFGNAA VFQ
Sbjct  338   PDKHQAVALRVGADMSVINRCHIDAYQDTLYAFSLRQFYRDSYVTGTVDFIFGNAAVVFQ  397

Query  311   ACNLVLRRPSS--YNVILANGRSDPGQNTGFSVQKCKITPGPDFSPVKNSYNSYLGRPWK  138
              C LV R+P+    N++ A GR+DP Q TG S+Q C I   PD  PV N + +YLGRPWK
Sbjct  398   KCQLVARKPNKNQQNMVTAQGRTDPNQATGTSIQFCDIIASPDLEPVVNEFKTYLGRPWK  457

Query  137   PYSRAVVMESDIDGAISARGWIEWPGTSSSSVRELYFGEYANVG  6
              YSR VVM+S + G I   GW EW G    +++ LY+GE+ N G
Sbjct  458   EYSRTVVMQSYLGGLIDPAGWAEWDG--DFALKTLYYGEFMNNG  499



>ref|XP_006360163.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 34-like 
[Solanum tuberosum]
Length=595

 Score =   314 bits (805),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 200/483 (41%), Positives = 268/483 (55%), Gaps = 48/483 (10%)
 Frame = -2

Query  1367  CGYTRFPRLCVQTLSGLVSGERVDFAAALLLNKTIAHADL-HI---AHFDQLSSHF----  1212
             C  TRFP LC+ +L         +F  AL    T + A+L HI   A   +    F    
Sbjct  81    CSRTRFPTLCLNSLH--------EFPGAL----TASDAELVHISVNATLQRFGRAFYMAS  128

Query  1211  -VSSQPPQPRLQ-AIGYCEELMGMARQRLNEALVAM-----KESPGKNRQEDIQTWLSAA  1053
              ++S     R + A   C EL+  +   L+ +L ++     K  PG N   D+QTWLSAA
Sbjct  129   DINSLVMDKRTRSAYESCLELLEDSVYLLSRSLTSVAPGAGKSPPGNN--NDVQTWLSAA  186

Query  1052  VTFQQACKD-WADQYAFSDELFARISRSMDYQSQLASNALAL---VNRNTEISAA---GR  894
             +T Q  C + +AD    S  +  +++ ++   SQL SN LA+   VN N + +      R
Sbjct  187   LTNQDTCTEGFAD---VSGNVKDQMATNLKDLSQLVSNCLAIFAAVNGNDDFAGVPIHNR  243

Query  893   QLSEEdidddddggffpDWVSGRDLRLLETTTDKTKANVVVAKDGTGNFRTVAEAIGAAS  714
             +              FP W+S +D +LL+      +A+++V+KDG G F+T+AEAI    
Sbjct  244   RRRLMSTVASAKNENFPKWLSRKDRKLLDAPVSTIQADMIVSKDGNGTFKTIAEAIKKLP  303

Query  713   --GRQRFVIYVKSGVYKE---KIRSSKDGITLIGDGKYSTIITWDDSVGGGSSLTGSATF  549
                 +R +IYVK+G Y+E   K+   K  +  IGDGK  T+I+   SV    +   +A+F
Sbjct  304   DYSSRRIIIYVKAGRYEEDILKVGRKKTNVMFIGDGKGQTMISGGKSVSQNLTTFHTASF  363

Query  548   GITGDGFIAKDIGFQNTAGPGAHQAVALTVASDHSVFYRCSISGYQDTLYALSLRQFYRE  369
               TG GFIA+DI FQN AGPG HQAVAL + +DH+V YRC+I GYQDTLY  S RQFYRE
Sbjct  364   AATGAGFIARDITFQNWAGPGKHQAVALRIGADHAVIYRCNIIGYQDTLYVHSQRQFYRE  423

Query  368   CDISGTVDFIFGNAAAVFQACNLVLRRPSSY--NVILANGRSDPGQNTGFSVQKCKITPG  195
             CDI GTVDFIFGNAA V Q C++  R+P  +  N I A  R DP QNTG S+  CKI   
Sbjct  424   CDIYGTVDFIFGNAAVVIQNCSIYARKPMDFQKNTITAQNRKDPNQNTGISIHACKIIAT  483

Query  194   PDFSPVKNSYNSYLGRPWKPYSRAVVMESDIDGAISARGWIEWPGTSSSSVRELYFGEYA  15
              D    K S+ +YLGRPWK YSR VVM S +   I   GW+EW  T   ++  LY+GEY 
Sbjct  484   SDLQASKGSFPTYLGRPWKLYSRTVVMLSYLGDHIHPHGWLEWNAT--FALDTLYYGEYM  541

Query  14    NVG  6
             N G
Sbjct  542   NYG  544



>emb|CDP00815.1| unnamed protein product [Coffea canephora]
Length=531

 Score =   312 bits (800),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 188/464 (41%), Positives = 257/464 (55%), Gaps = 22/464 (5%)
 Frame = -2

Query  1367  CGYTRFPRLC----VQTLSGLVSGERVDFA---AALLLNKTIAHADLHIAHFDQLSSHFV  1209
             C  T +P LC    + T+S     ++  F    AAL    T++ A     +  +L S   
Sbjct  31    CSQTPYPDLCNSLSINTMSPQTKLDQTSFNVRDAALKF--TLSQAQ----YVQKLLSTMD  84

Query  1208  SSQPPQPRLQAIGYCEELMGMARQRLNEALVAMKESPGKNRQEDIQTWLSAAVTFQQACK  1029
              S   Q    A   C EL   +   LN A+     S    + +D QTWLSAA+   Q C+
Sbjct  85    LSSLNQLGKSAWADCVELYEDSIDNLNRAIT----SANPTKLDDAQTWLSAAIANHQTCQ  140

Query  1028  DWADQYAFSDELFARISRSMDYQSQLASNALALVNRNTEISAAGRQLSEEdidddddggf  849
             +    +  S  L +         S+  SN+LA+       ++A     +           
Sbjct  141   NGFLDFQLSSNLQSFPFLVNSTFSKHLSNSLAINKAALSAASAHSSTQQIKGRRLLSSNG  200

Query  848   fpDWVSGRDLRLLETTTDKTKANVVVAKDGTGNFRTVAEAIGAASGRQ-RFVIYVKSGVY  672
             FP+W+S  D +LL+++   TKA++ VA+DG+GN++T+AEA+ AA G+  R VIYVK G+Y
Sbjct  201   FPEWLSVGDRKLLQSSGGPTKADITVAQDGSGNYKTIAEALAAAKGKGGRVVIYVKKGIY  260

Query  671   KEKIRSSKDGITLIGDGKYSTIITWDDSVGGGSSLTGSATFGITGDGFIAKDIGFQNTAG  492
             KE +  +   I  IGDG  +T++T + +V  GS+   SATF ITG GFIA+D+ F+NTAG
Sbjct  261   KENVVVTMKNIMFIGDGIDATVVTGNKNVQDGSTTFRSATFAITGSGFIARDMTFENTAG  320

Query  491   PGAHQAVALTVASDHSVFYRCSISGYQDTLYALSLRQFYRECDISGTVDFIFGNAAAVFQ  312
             P  HQAVAL   SD SVFYRCS  GYQDTLY  + RQFYR+CD+ GT DF+FG+A  VFQ
Sbjct  321   PQKHQAVALRSGSDFSVFYRCSFKGYQDTLYVYAQRQFYRDCDVYGTQDFVFGDAIVVFQ  380

Query  311   ACNLVLRRP--SSYNVILANGRSDPGQNTGFSVQKCKITPGPDFSPVKNSYNSYLGRPWK  138
              CN  LRRP  +  N + A  R+DP +NTG  +   +IT   D   V+ S  SYLGRPW+
Sbjct  381   NCNFNLRRPLGNQMNTLTAQARTDPNENTGIIIHNSRITAASDLKSVQGSIKSYLGRPWQ  440

Query  137   PYSRAVVMESDIDGAISARGWIEWPGTSSSSVRELYFGEYANVG  6
              YSR V+M + ID  I   GW+ W G  + S   LY+ EY N G
Sbjct  441   KYSRTVIMTTSIDNVIDPAGWLPWSGNFALST--LYYAEYMNSG  482



>ref|XP_009378667.1| PREDICTED: pectinesterase 2-like [Pyrus x bretschneideri]
 ref|XP_009339421.1| PREDICTED: pectinesterase 2-like [Pyrus x bretschneideri]
Length=510

 Score =   311 bits (798),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 195/472 (41%), Positives = 267/472 (57%), Gaps = 48/472 (10%)
 Frame = -2

Query  1385  DQIRIQCGYTRFPRLCVQTLSG-----LVSGERVDF--AAALLLNKTI-AHADLHIAHFD  1230
             + +R  C  T  P+ C   LS       + G+   F  +  L L++ I AH +L+     
Sbjct  26    NDVRTWCSQTPHPQPCESFLSHNPNNIPIKGKSQFFKISTQLALDRAILAHTNLYSLGSK  85

Query  1229  QLSSHFVSSQPPQPRLQAIGYCEELMGMARQRLNEALVAMKESPGKNRQEDIQTWLSAAV  1050
               ++H            A   C EL     Q+LN+++    +      Q D Q+WLS A+
Sbjct  86    CQNAH---------EKAAWADCLELYDYTIQKLNKSI----DPTNGATQNDAQSWLSTAL  132

Query  1049  TFQQACK-DWADQYAFSDELFARISRSMDYQSQLASNALALVNRNTEISAAGRQLSEEdi  873
             T  + C+  + D    +++L        +  S L SN L+ VN+    S    +      
Sbjct  133   TNLETCRAGFVDLAVSNNQLMPS-----NNVSNLISNTLS-VNKVPYTSQPEYK------  180

Query  872   dddddggffpDWVSGRDLRLLETTTDKTKANVVVAKDGTGNFRTVAEAIGAASGRQ---R  702
                     FP WV   D +LL++++ K  A++VVAKDG+GN++T+ EAI AAS R+   R
Sbjct  181   ------QGFPTWVKPGDRKLLKSSSPK--ADIVVAKDGSGNYKTINEAISAASKRKGSGR  232

Query  701   FVIYVKSGVYKEKIRSSKDGITLIGDGKYSTIITWDDSVGGGSSLTGSATFGITGDGFIA  522
             +VIYVK+G YKE ++   + I L+GDG   TIIT   SVGGG++   SAT  + GDGFIA
Sbjct  233   YVIYVKAGSYKENVQIKLNNIMLLGDGIGKTIITGSKSVGGGTTTFNSATVAVVGDGFIA  292

Query  521   KDIGFQNTAGPGAHQAVALTVASDHSVFYRCSISGYQDTLYALSLRQFYRECDISGTVDF  342
             + I F+NTAGP + QAVAL   SD SVFY+CS  G QDTLY  S RQFYRECDI GTVDF
Sbjct  293   QGITFENTAGPTSGQAVALRSGSDLSVFYKCSFEGNQDTLYVHSERQFYRECDIYGTVDF  352

Query  341   IFGNAAAVFQACNLVLRRPSSYNVILANGRSDPGQNTGFSVQKCKITPGPDFSPVKNSYN  162
             IFGNAA V Q  N+ +    + N I A GR+DP QNTG S+  CK+T   D  PV++S  
Sbjct  353   IFGNAAVVIQNSNIYVHNHKT-NTITAQGRTDPNQNTGISIHNCKVTAASDLKPVQSSVK  411

Query  161   SYLGRPWKPYSRAVVMESDIDGAISARGWIEWPGTSSSSVRELYFGEYANVG  6
             +YLGRPWK YSR V M++ +D  I+  GW+EW G    +++ LY+GEY N G
Sbjct  412   TYLGRPWKQYSRTVFMKTYLDSLINPAGWMEWSG--DFALKTLYYGEYMNTG  461



>ref|XP_010537086.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 61 
[Tarenaya hassleriana]
Length=586

 Score =   314 bits (804),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 197/470 (42%), Positives = 266/470 (57%), Gaps = 31/470 (7%)
 Frame = -2

Query  1367  CGYTRFPRLCVQTL----SGLVSGERVDFAAALLLNKTIAHADLHIAHFDQLSSHFVSSQ  1200
             CG T +P LCV +L      L +GE  D    + +N T+       A +D  SS   S Q
Sbjct  81    CGKTLYPSLCVSSLLDFPGSLAAGE--DELVHISVNMTLQR--FSKALYD--SSAISSVQ  134

Query  1199  PPQPRLQ-AIGYCEELMGMARQRLNEALVAMKESPGKNRQEDIQTWLSAAVTFQQACKDW  1023
              P PR++ A   C EL+  +   L+ AL       G     D+ TWLS+A+T    C + 
Sbjct  135   MP-PRVRSAYDACLELLDDSVDDLSRAL------SGGGSHSDVLTWLSSAMTNHDTCTEG  187

Query  1022  ADQ-YAFSDE--LFARISRSMDYQSQLASNALALVN-RNTEISAAGRQLSEEdidddddg  855
              D+   FSD   +  R+  ++   S+L SN LA+ + +  ++SA   +     + + ++ 
Sbjct  188   FDENEGFSDSGGVKGRVGGAVKDLSELVSNCLAIFSGKVGDLSAVPVENRRRRLLETEEE  247

Query  854   gffpDWVSGRDLRLLETTTDKTKANVVVAKDGTGNFRTVAEAIGAAS--GRQRFVIYVKS  681
                P W+  RD  LL     K +A++VV+KDGTG  +T+AEAI  A     +R VIYVK+
Sbjct  248   LELPIWLGKRDRELLSIPAAKIQADIVVSKDGTGTCKTIAEAIKKAPEHSSRRIVIYVKA  307

Query  680   GVYKE---KIRSSKDGITLIGDGKYSTIITWDDSVGGGSSLTGSATFGITGDGFIAKDIG  510
             G Y+E   K+   K  +  IGDGK  T+IT   S+    +   +A+F  TG GFIA+D+ 
Sbjct  308   GRYEEENLKVGRKKTNVMFIGDGKGKTVITGGKSISDDLTTFHTASFAATGAGFIARDMT  367

Query  509   FQNTAGPGAHQAVALTVASDHSVFYRCSISGYQDTLYALSLRQFYRECDISGTVDFIFGN  330
             F+N AGPG HQAVAL V +DH+V YRCS+ GYQD LY  S RQF+RECDI GTVDFIFGN
Sbjct  368   FENYAGPGKHQAVALRVGADHAVVYRCSVIGYQDALYIHSNRQFFRECDIYGTVDFIFGN  427

Query  329   AAAVFQACNLVLRR--PSSYNVILANGRSDPGQNTGFSVQKCKITPGPDFSPVKNSYNSY  156
             AA V Q C++  R+  P   N I A  R DP QNTG S+  C+I P  D    K S+ +Y
Sbjct  428   AAVVLQNCSIYARKPMPGQKNTITAQNRKDPNQNTGISIHACRILPTSDLEASKGSFPTY  487

Query  155   LGRPWKPYSRAVVMESDIDGAISARGWIEWPGTSSSSVRELYFGEYANVG  6
             LGRPWK YSR+V M S +   I  RGW+EW G    ++  LY+GEY N G
Sbjct  488   LGRPWKLYSRSVYMMSYMGDHIHPRGWLEWSG--GFALDTLYYGEYMNRG  535



>ref|XP_010925933.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 34 
[Elaeis guineensis]
Length=587

 Score =   313 bits (803),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 189/476 (40%), Positives = 271/476 (57%), Gaps = 38/476 (8%)
 Frame = -2

Query  1367  CGYTRFPRLCVQTLSGLVSGERVDFAAAL-LLNKTIAHADLHIAHFDQLSSHFVSSQPPQ  1191
             CG T +P LC+ +L        +DF  A    ++ + H  L++       + + +S    
Sbjct  77    CGLTLYPALCISSL--------LDFPGAFDARDRDLVHISLNMTMQRVSKALYGASAIAG  128

Query  1190  PRLQAIGY-----CEELMGMARQRLNEALVAMKES---PGKNRQEDIQTWLSAAVTFQQA  1035
               + A+       C EL+  +  +L+E+L  +  S   P     ED+ TWLSAA+T Q  
Sbjct  129   VSMDALARAAYEDCMELLEDSLDQLSESLAVVSPSASGPAGASNEDVLTWLSAALTNQDT  188

Query  1034  CK----DWADQYAFSDELFARISRSMDYQSQLASNALAL---VNRNTEISAAGRQLSEEd  876
             C     D AD Y     + A++   +   ++L SN LA+   V+RN + S    + +++ 
Sbjct  189   CTEGLTDVADGY-----VRAQMQSKLKDLAELVSNCLAIFSAVSRNKDFSGIPIK-NKKR  242

Query  875   idddddggffpDWVSGRDLRLLETTTDKTKANVVVAKDGTGNFRTVAEAIGAASGR--QR  702
                    G FP+W+  RD +LL+    + +A++VV+KDG G ++++A+A+ AA  R  +R
Sbjct  243   RLLSSGDGDFPEWLGRRDRKLLQVPVAQIQADMVVSKDGNGTYKSIADAVKAAPERSTRR  302

Query  701   FVIYVKSGVYKEKIRSS--KDGITLIGDGKYSTIITWDDSVGGGSSLTGSATFGITGDGF  528
              +IYVK+G Y E I+ S  K  +  IGDGK  TI+    SV    +   +ATF  TG+GF
Sbjct  303   IIIYVKAGRYDENIKVSRKKTNLMFIGDGKGKTIVAASRSVAENYTTFHTATFASTGNGF  362

Query  527   IAKDIGFQNTAGPGAHQAVALTVASDHSVFYRCSISGYQDTLYALSLRQFYRECDISGTV  348
             I +D+  +N AGP  HQAVAL V +DH+V YRC+I GYQDTLY  S RQF+RECD+ GTV
Sbjct  363   IMRDMTIENWAGPAKHQAVALRVGADHAVVYRCNIIGYQDTLYVHSQRQFFRECDVYGTV  422

Query  347   DFIFGNAAAVFQACNLVLRRPSSY--NVILANGRSDPGQNTGFSVQKCKITPGPDFSPVK  174
             DFIFGNAA V Q C+L  R+P     N I A  R DP QNTG S+  C++   PD  PV+
Sbjct  423   DFIFGNAAVVLQNCSLWARKPMPMQKNTITAQNRKDPNQNTGISIHACRVAATPDLVPVR  482

Query  173   NSYNSYLGRPWKPYSRAVVMESDIDGAISARGWIEWPGTSSSSVRELYFGEYANVG  6
              +Y++YLGRPWK YSR V M S +   I+  GW+EW  T   ++  LY+GEY N G
Sbjct  483   WNYSTYLGRPWKLYSRTVYMLSYMGDHINPAGWLEWNAT--FALDTLYYGEYMNYG  536



>ref|XP_010915944.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 34 
[Elaeis guineensis]
Length=587

 Score =   313 bits (803),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 187/472 (40%), Positives = 270/472 (57%), Gaps = 29/472 (6%)
 Frame = -2

Query  1367  CGYTRFPRLCVQTLSGLVSGERVDFAAALLL-NKTIAHADLHIAHFDQLSSHFVSSQPPQ  1191
             C  TR+P LCV +L        +DF  AL   ++ + H  L++       + + +S    
Sbjct  76    CALTRYPELCVSSL--------LDFPGALDAGDRDLVHISLNMTTQRVGKALYGASAIAG  127

Query  1190  PRLQAIGY-----CEELMGMARQRLNEALVAMKES---PGKNRQEDIQTWLSAAVTFQQA  1035
               + ++       C EL+  +  +L+++L  +  +   P     ED+ TWLSAA++ Q  
Sbjct  128   VSMDSLARSAYDDCMELLDDSLDQLSQSLAVIAPTELRPASASDEDVLTWLSAALSNQDT  187

Query  1034  CKDWADQYAFSDELFARISRSMDYQSQLASNALAL---VNRNTEISAAGRQLSEEdiddd  864
             C D     A +  + A++  ++   ++L SN LA+    +RN + S    Q  +  +   
Sbjct  188   CTDGLADVA-NGYVRAQMESNLKDLAELVSNCLAIFSAASRNKDFSGIPIQNKKRRLLSS  246

Query  863   ddggffpDWVSGRDLRLLETTTDKTKANVVVAKDGTGNFRTVAEAIGAA--SGRQRFVIY  690
                G FP+W+  RD RLL+    K +A++VVAKDGTG  +++A+A+ AA  +  +R +IY
Sbjct  247   AGDGEFPEWLGWRDRRLLQVPAAKIQADMVVAKDGTGTHKSIADAVKAAPENSARRIIIY  306

Query  689   VKSGVYKEKIRSS--KDGITLIGDGKYSTIITWDDSVGGGSSLTGSATFGITGDGFIAKD  516
             VK+G Y E I+ +  K  +  IGDGK  T +    SV    +   +ATF  TG+GFI +D
Sbjct  307   VKAGRYNENIKVTRKKTNLMFIGDGKGITTVAGSRSVADKYTTFHTATFASTGNGFIMRD  366

Query  515   IGFQNTAGPGAHQAVALTVASDHSVFYRCSISGYQDTLYALSLRQFYRECDISGTVDFIF  336
             +  +N AGP  HQAVAL V +DH+V YRC+I GYQDTLY  S RQF+RECDI GTVDF+F
Sbjct  367   MTIENWAGPEKHQAVALRVGADHAVVYRCNIVGYQDTLYVHSQRQFFRECDIYGTVDFVF  426

Query  335   GNAAAVFQACNLVLRRPSSY--NVILANGRSDPGQNTGFSVQKCKITPGPDFSPVKNSYN  162
             GNAA V Q C+L  R+P +   N I A  R DP QNTG S+  C++   P+  PVK +Y 
Sbjct  427   GNAAVVLQNCSLWARKPMAMQKNTITAQNRRDPNQNTGISIHACRVLATPELEPVKWTYP  486

Query  161   SYLGRPWKPYSRAVVMESDIDGAISARGWIEWPGTSSSSVRELYFGEYANVG  6
             +YLGRPWK YSR V M S +   I + GW+EW G  S ++  LY+GEY N G
Sbjct  487   TYLGRPWKLYSRTVYMLSYLGDHIHSVGWLEWNG--SFALDTLYYGEYMNYG  536



>gb|KDO85751.1| hypothetical protein CISIN_1g010441mg [Citrus sinensis]
Length=510

 Score =   311 bits (797),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 172/390 (44%), Positives = 233/390 (60%), Gaps = 29/390 (7%)
 Frame = -2

Query  1166  CEELMGMARQRLNEALVAMKESPGKNRQEDIQTWLSAAVTFQQACKDWADQYAFSDELFA  987
             C EL  +   +LN+       SPG  +  D QTWLS+A+T  + C+   +     + +  
Sbjct  98    CRELYELTVLKLNQT---SNSSPGCTKV-DKQTWLSSALTNLETCRASLEDLGVPEYVLP  153

Query  986   RISRSMDYQSQLASNALALVNRNTEISAAGRQLSEEdidddddggffpDWVSGRDLRLLE  807
              +S ++   ++L SN L+L              ++   ++      FP WV   D +LL+
Sbjct  154   LLSNNV---TKLISNTLSL--------------NKVPYNEPSYKDGFPTWVKPGDRKLLQ  196

Query  806   TTTDKTKANVVVAKDGTGNFRTVAEAIGAAS--GRQRFVIYVKSGVYKEKIRSSKDGITL  633
             TT    +AN+VVA+DG+GN +T+ EA+ AAS  G  R+VIY+K+G Y E I      I  
Sbjct  197   TTP---RANIVVAQDGSGNVKTIQEAVAAASRAGGSRYVIYIKAGTYNENIEVKLKNIMF  253

Query  632   IGDGKYSTIITWDDSVGGGSSLTGSATFGITGDGFIAKDIGFQNTAGPGAHQAVALTVAS  453
             +GDG   TIIT   SVGGG++   SAT  + GD FIA+DI  +NTAGP  HQAVAL   S
Sbjct  254   VGDGIGKTIITGSKSVGGGATTFKSATVAVVGDNFIARDITIRNTAGPNNHQAVALRSGS  313

Query  452   DHSVFYRCSISGYQDTLYALSLRQFYRECDISGTVDFIFGNAAAVFQACNLVLRRPSS-Y  276
             D SVFYRCS  GYQDTLY  S RQFYRECDI GTVDFIFGNAA V Q CN+  R+P +  
Sbjct  314   DLSVFYRCSFEGYQDTLYVHSQRQFYRECDIYGTVDFIFGNAAVVLQNCNIFARKPPNRT  373

Query  275   NVILANGRSDPGQNTGFSVQKCKITPGPDFSPVKNSYNSYLGRPWKPYSRAVVMESDIDG  96
             N + A GR+DP Q+TG  +  C++T   D  PV++S  ++LGRPWK YSR V +++ +D 
Sbjct  374   NTLTAQGRTDPNQSTGIIIHNCRVTAASDLKPVQSSVKTFLGRPWKQYSRTVYIKTFLDS  433

Query  95    AISARGWIEWPGTSSSSVRELYFGEYANVG  6
              I+  GW+EW G    ++  LY+ EY N G
Sbjct  434   LINPAGWMEWSG--DFALNTLYYAEYMNTG  461



>ref|XP_002516186.1| Pectinesterase-3 precursor, putative [Ricinus communis]
 gb|EEF46188.1| Pectinesterase-3 precursor, putative [Ricinus communis]
Length=589

 Score =   313 bits (803),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 192/486 (40%), Positives = 272/486 (56%), Gaps = 41/486 (8%)
 Frame = -2

Query  1379  IRIQCGYTRFPRLCVQTLSGLVSGERVDFAAALLLNKTIAHADLHIAH------FDQLSS  1218
             ++  C  T +P LC  T+S L +    D  + +   K +    L++        + ++  
Sbjct  68    VKSSCSSTLYPDLCFSTISALPA----DATSTIKTTKDVIILSLNVTESSVYQTYLKIQG  123

Query  1217  HFVSSQPPQPR-LQAIGYCEELMGMARQRLNEALVAMKESPG-KN----RQEDIQTWLSA  1056
               ++ +   PR + A+  C + +      + + +  +KE P  KN      ++++  +SA
Sbjct  124   LTLARRSYTPREVTALKDCLQTLSETVDEIRKVVQLLKEYPSLKNSISEHADELKILISA  183

Query  1055  AVTFQQAC-----KDWADQYAFSDELFARISRSMDYQSQLASNALALVNRNTEISAAGRQ  891
             A+T Q+ C      D AD+     E F    R   +  +L  NALA++   T+   A  Q
Sbjct  184   AMTNQETCLDGFSHDRADEKV--REFFLGDER---HVHRLCGNALAMIKTMTDTDMANEQ  238

Query  890   L-----SEEdidddddggffpDWVSGRDLRLLETTTDKTKANVVVAKDGTGNFRTVAEAI  726
                   S E    +++G  +P+W+   D RLL+ TT     NVVVA DG+GN+RTV+EA+
Sbjct  239   ALSSSPSSERRLKEENGIEWPEWLPAGDRRLLQATT--LTPNVVVAADGSGNYRTVSEAV  296

Query  725   GAASGRQ--RFVIYVKSGVYKEK--IRSSKDGITLIGDGKYSTIITWDDSVGGGSSLTGS  558
              AA  R   R++I +K+GVY+E   I SSK  +  +GDG+ +TIIT   SV GGS+   S
Sbjct  297   AAAPSRSSTRYIIRIKAGVYRENVDIPSSKTNLMFVGDGRTTTIITGSRSVVGGSTTFNS  356

Query  557   ATFGITGDGFIAKDIGFQNTAGPGAHQAVALTVASDHSVFYRCSISGYQDTLYALSLRQF  378
             AT  +  DGF+A+D+ FQNTAGP  HQAVAL V++D S FYRC +  +QDTLY   LRQF
Sbjct  357   ATVAVNADGFLARDVTFQNTAGPSGHQAVALRVSADLSAFYRCDMIAFQDTLYVHRLRQF  416

Query  377   YRECDISGTVDFIFGNAAAVFQACNLVLRRPS--SYNVILANGRSDPGQNTGFSVQKCKI  204
             Y  C + GTVDFIFGNAA VFQ C++  RRP+    N++ A GR DP QNTG  +QKC+I
Sbjct  417   YVSCIVIGTVDFIFGNAAVVFQNCDIHARRPNPGQRNMVTAQGREDPNQNTGIVIQKCRI  476

Query  203   TPGPDFSPVKNSYNSYLGRPWKPYSRAVVMESDIDGAISARGWIEWPGTSSSSVRELYFG  24
                 D    KNS+ SYLGRPWK YSR V+M+S I   I   GW  W GT   ++  L + 
Sbjct  477   GATQDLEAAKNSFQSYLGRPWKLYSRTVIMQSQISDIIHPAGWFMWDGT--FALDTLTYR  534

Query  23    EYANVG  6
             EY N G
Sbjct  535   EYQNTG  540



>ref|XP_011078159.1| PREDICTED: pectinesterase-like isoform X1 [Sesamum indicum]
Length=567

 Score =   313 bits (802),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 190/481 (40%), Positives = 273/481 (57%), Gaps = 33/481 (7%)
 Frame = -2

Query  1379  IRIQCGYTRFPRLCVQTLSGLVSGERVDFAAA-----LLLNKTIAHADLHIAHFDQLSSH  1215
             ++  C  T +P+LCV T++   +   V   ++       LN TI+  + +     +L   
Sbjct  50    VKTTCAATLYPKLCVSTINAAATAASVAIKSSKDVLITALNYTISTVERNYFTVKKLGRS  109

Query  1214  FVSSQPPQPRLQAIGYCEELMGMARQRLNEALVAMKESPGKN-----RQEDIQTWLSAAV  1050
               S    +    A+  C E++      L  +   +K+   KN      +E++   LSAA 
Sbjct  110   RKSLTTREK--GALHDCLEMIDDTLDELRRSAAELKDFGFKNYSLADHKENLMILLSAAQ  167

Query  1049  TFQQACKDWADQYAFSDELFARISRSMDYQSQ-----LASNALALVNRNTEISAAGRQLS  885
             T Q++C D      FS +   ++ R      Q     L SN +A++   T+   A    S
Sbjct  168   TNQESCLD-----GFSHDKADKVVRRALVVGQMHVFRLVSNVMAIIKNLTDTEMAKNSYS  222

Query  884   E-EdidddddggffpDWVSGRDLRLLETTTDKTKANVVVAKDGTGNFRTVAEAIGAASG-  711
               E    ++    +P+W+S  D RLL+ +T     +V VA DG+GNFRTV+ A+ AA G 
Sbjct  223   SPERRLGENTNSEWPEWLSAGDRRLLQAST--VTPDVTVAADGSGNFRTVSAAVAAAPGG  280

Query  710   -RQRFVIYVKSGVYKE--KIRSSKDGITLIGDGKYSTIITWDDSVGGGSSLTGSATFGIT  540
               +R+VI +K+GVY+E  +I  SK  +  +GDG+ +TIIT + +V  GS+   SAT  + 
Sbjct  281   SSRRYVIRIKAGVYRENVEIPRSKTNLMFVGDGRTTTIITGNRNVVDGSTTFNSATVAVV  340

Query  539   GDGFIAKDIGFQNTAGPGAHQAVALTVASDHSVFYRCSISGYQDTLYALSLRQFYRECDI  360
             GD F+A+DI FQNTAGP  HQAVAL V +D   FYRC +  YQDTLY  SLRQFY  C I
Sbjct  341   GDRFLARDITFQNTAGPSKHQAVALRVNADLCAFYRCDMLAYQDTLYVHSLRQFYTGCII  400

Query  359   SGTVDFIFGNAAAVFQACNLVLRRPSS--YNVILANGRSDPGQNTGFSVQKCKITPGPDF  186
             +GTVDFIFGNAAAV Q C++  RRP++   N++ A GR DP QNTG  +QKC+I    D 
Sbjct  401   AGTVDFIFGNAAAVLQNCDIHARRPNAGQRNMVTAQGRDDPNQNTGIVIQKCRIGATSDL  460

Query  185   SPVKNSYNSYLGRPWKPYSRAVVMESDIDGAISARGWIEWPGTSSSSVRELYFGEYANVG  6
              PV++S+ +YLGRPWK YSR +VM++DI   I+  GW EW G  + ++  L++ EY N G
Sbjct  461   RPVQSSFPTYLGRPWKEYSRTIVMQTDISNVINPAGWYEWNG--NFALNTLFYAEYQNTG  518

Query  5     A  3
             A
Sbjct  519   A  519



>gb|KDO75533.1| hypothetical protein CISIN_1g008722mg [Citrus sinensis]
Length=556

 Score =   312 bits (800),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 183/419 (44%), Positives = 243/419 (58%), Gaps = 33/419 (8%)
 Frame = -2

Query  1220  SHFVSSQPPQPRLQA-IGYCEELMGMARQRLNEALVAMKESPGKNRQEDIQTWLSAAVTF  1044
             ++ V  +   PR QA +  C EL+ ++  R+ +++ A+K+    +  ED   WLS  +T 
Sbjct  108   ANHVKHRINSPRGQAALTDCVELLELSVDRITDSMAALKKRR-TSSNEDAHAWLSGVLTN  166

Query  1043  QQACKDWADQYAFS------DELFARISRSMDYQSQLASNALALVNRNTEISAAGRQLSE  882
                C D  D  A         EL AR           A+N+LA++     IS     + +
Sbjct  167   HVTCLDGLDGSATKLMEPRLVELMAR-----------AANSLAIL---VAISPYNTNVIQ  212

Query  881   EdidddddggffpDWVSGRDLRLLE-TTTDKTKANVVVAKDGTGNFRTVAEAIGAA--SG  711
             +     +       WV+ RD  LL  +  +  KANVVVAKDG+GN++TV EA+ +A  + 
Sbjct  213   QYYLRKEIQFPS--WVTSRDRLLLRPSQAEAAKANVVVAKDGSGNYKTVKEAVASAPDNS  270

Query  710   RQRFVIYVKSGVYKEKIR--SSKDGITLIGDGKYSTIITWDDSVGGGSSLTGSATFGITG  537
             + R+VIYVK G YKE +     K  + ++GDG   TIIT   +V  GS+   SAT  + G
Sbjct  271   KTRYVIYVKKGTYKENVEVGKKKKNLMIVGDGMDLTIITGSLNVVDGSTTFKSATIAVGG  330

Query  536   DGFIAKDIGFQNTAGPGAHQAVALTVASDHSVFYRCSISGYQDTLYALSLRQFYRECDIS  357
             DGFIA+D+  QNTAGP  HQAVAL V++D SV  RC I  YQDTLYA + RQFYR+C I+
Sbjct  331   DGFIAQDLWIQNTAGPEKHQAVALRVSADQSVINRCRIDAYQDTLYAHTNRQFYRDCYIT  390

Query  356   GTVDFIFGNAAAVFQACNLVLRRPSSY--NVILANGRSDPGQNTGFSVQKCKITPGPDFS  183
             GTVDFIFGNAA V Q C +  R+P S   N++ A GR+DP QNTG S+QKC +    D  
Sbjct  391   GTVDFIFGNAAVVLQNCKIAARKPMSKQSNMVTAQGRTDPNQNTGTSIQKCDVIASSDLE  450

Query  182   PVKNSYNSYLGRPWKPYSRAVVMESDIDGAISARGWIEWPGTSSSSVRELYFGEYANVG  6
             PVK S  SYLGRPWK YSR VVM+S I   I   GW EW G    +++ LY+GEY N G
Sbjct  451   PVKGSIRSYLGRPWKEYSRTVVMQSHIGDHIDPAGWSEWSG--DFALKTLYYGEYLNRG  507



>ref|XP_002302526.1| putative pectin methylesterase LuPME1 family protein [Populus 
trichocarpa]
 gb|EEE81799.1| putative pectin methylesterase LuPME1 family protein [Populus 
trichocarpa]
Length=514

 Score =   311 bits (797),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 170/374 (45%), Positives = 227/374 (61%), Gaps = 25/374 (7%)
 Frame = -2

Query  1109  KESPGKNRQEDIQTWLSAAVTFQQACKDWADQYAFSDELFARISRSMDYQSQLASNALAL  930
             K +  K    D QTWLS A+T  + C+    ++  +D +   +S ++   S+L SN LA+
Sbjct  111   KTTSSKCTDYDAQTWLSTALTNLETCRTGFTEFGMTDFILPLMSNNV---SKLISNTLAI  167

Query  929   VNRNTEISAAGRQLSEEdidddddggffpDWVSGRDLRLLETTTDKTKANVVVAKDGTGN  750
                  ++  +     E           FP WV   D +LL++++  ++AN+VVA DG+GN
Sbjct  168   ----NKVPYSEPSYKE----------GFPSWVRPGDRKLLQSSSPASQANIVVATDGSGN  213

Query  749   FRTVAEAIGAASGRQ---RFVIYVKSGVYKEKIRSSKD--GITLIGDGKYSTIITWDDSV  585
              +T+ EAI AAS R    R+VIYVK+G Y E +   K    +  +GDG   TI+T   S 
Sbjct  214   VKTIKEAIDAASKRSGSGRYVIYVKAGTYNENVEVGKKVKNVMFVGDGIGKTIVTGSKSA  273

Query  584   GGGSSLTGSATFGITGDGFIAKDIGFQNTAGPGAHQAVALTVASDHSVFYRCSISGYQDT  405
             GGG++   SATF + GD FIA+D+ F+NTAG   HQAVAL   SD SVFY+CS  GYQDT
Sbjct  274   GGGTTTFKSATFAVVGDNFIARDMTFRNTAGAKNHQAVALRSGSDFSVFYKCSFEGYQDT  333

Query  404   LYALSLRQFYRECDISGTVDFIFGNAAAVFQACNLVLRRPSSYNV-ILANGRSDPGQNTG  228
             LY  S RQFYRECDI GTVDFIFGNAA VFQ CN+  R P +  + I A GR+DP QNTG
Sbjct  334   LYVYSQRQFYRECDIYGTVDFIFGNAAVVFQNCNIYARSPPNKIITITAQGRTDPNQNTG  393

Query  227   FSVQKCKITPGPDFSPVKNSYNSYLGRPWKPYSRAVVMESDIDGAISARGWIEWPGTSSS  48
              S+  C++T   D  PV+ S  +YLGRPWK YSR V M++ +D  I+  GW  W G  + 
Sbjct  394   ISIHNCRVTAASDLKPVQGSVKTYLGRPWKQYSRTVFMKTFLDSLINPAGWSPWNG--NF  451

Query  47    SVRELYFGEYANVG  6
             ++  LY+GEY N G
Sbjct  452   ALDTLYYGEYMNTG  465



>ref|XP_009118185.1| PREDICTED: pectinesterase/pectinesterase inhibitor 18 [Brassica 
rapa]
Length=556

 Score =   312 bits (800),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 184/400 (46%), Positives = 242/400 (61%), Gaps = 30/400 (8%)
 Frame = -2

Query  1166  CEELMGMARQRLNEALVAMKESPGKNRQ----EDIQTWLSAAVTFQQACKDWADQYAFSD  999
             C+E+M +++ R+   + +M+E  G N       ++ TWLS+ +T    C D     + SD
Sbjct  125   CKEMMDVSKDRM---VSSMEELRGGNLNLESYSNVHTWLSSVLTNYMTCLD-----SISD  176

Query  998   ELFARISRSMDYQSQLASNALALVNR-NTEISAAGRQLSEEdidddddggffpDWVSGRD  822
                     S+D + ++      LV+R    +S     L  +D  +      FP W++  D
Sbjct  177   V-------SIDSKHRVQPKLEDLVSRARVALSIFVSVLPSKDYLEMILPIHFPSWLNSLD  229

Query  821   LRLLETT--TDKTKANVVVAKDGTGNFRTVAEAIGAA--SGRQRFVIYVKSGVYKEKIR-  657
              +LLE+   T + KANVVVAKDGTG ++TV EA+ AA  +   R+VIYVK GVYKE I  
Sbjct  230   RKLLESAPKTFEVKANVVVAKDGTGKYKTVNEAVAAAPENSNSRYVIYVKKGVYKETIDI  289

Query  656   -SSKDGITLIGDGKYSTIITWDDSVGGGSSLTGSATFGITGDGFIAKDIGFQNTAGPGAH  480
                K  + L+GDGK  TIIT   +V  GS+   SAT    GDGF+A+DI FQNTAGP  H
Sbjct  290   GKKKKNLMLVGDGKDVTIITGSLNVVDGSTTFRSATVAANGDGFMAQDIWFQNTAGPAKH  349

Query  479   QAVALTVASDHSVFYRCSISGYQDTLYALSLRQFYRECDISGTVDFIFGNAAAVFQACNL  300
             QAVAL V++D SV  RC I  YQDTLY  +LRQFYR+  I+GTVDFIFGN+A VFQ C++
Sbjct  350   QAVALRVSADQSVINRCRIDAYQDTLYTHTLRQFYRDSFITGTVDFIFGNSAVVFQNCDI  409

Query  299   VLRRPSS--YNVILANGRSDPGQNTGFSVQKCKITPGPDFSPVKNSYNSYLGRPWKPYSR  126
             V R+P +   N++ A GR DP QNT  S QKC++T   D +PVK S  +YLGRPWK YSR
Sbjct  410   VARKPGAGQKNMLTAQGREDPNQNTAISFQKCRLTASSDLAPVKGSVKTYLGRPWKLYSR  469

Query  125   AVVMESDIDGAISARGWIEWPGTSSSSVRELYFGEYANVG  6
              V+M+S ID  I   GW  W G  + S   LY+GEYAN G
Sbjct  470   TVIMQSFIDNHIDPAGWFPWDGDFALST--LYYGEYANNG  507



>ref|XP_002280446.1| PREDICTED: pectinesterase 2 [Vitis vinifera]
Length=513

 Score =   311 bits (797),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 178/393 (45%), Positives = 235/393 (60%), Gaps = 29/393 (7%)
 Frame = -2

Query  1166  CEELMGMARQRLNEALVAMKESPGKNRQEDIQTWLSAAVTFQQACKDWADQYAFSDELFA  987
             C +L      RLN+ +    +   K  Q D QTWLS A+T  + C+    +   SD L  
Sbjct  95    CLKLYEYTILRLNKTV----DPNTKCSQVDSQTWLSTALTNLETCRAGFVELGVSDYLLP  150

Query  986   RISRSMDYQSQLASNALALVNRNTEISAAGRQLSEEdidddddggffpDWVSGRDLRLLE  807
              +S ++   S+L SN L+L N+      + ++              FP WV   D +LL+
Sbjct  151   LMSNNV---SKLISNTLSL-NKVPYTEPSYKE-------------GFPTWVKPGDRKLLQ  193

Query  806   TTTDKTKANVVVAKDGTGNFRTVAEAIGAASGRQ---RFVIYVKSGVYKEKIR--SSKDG  642
             +++  ++AN+VVAKDG+G++ T+  A+ AAS R    R+VIYVK+G Y E I   +    
Sbjct  194   SSSPASQANIVVAKDGSGDYTTITAAVSAASKRSGTGRYVIYVKAGTYNENIEIGAKLKN  253

Query  641   ITLIGDGKYSTIITWDDSVGGGSSLTGSATFGITGDGFIAKDIGFQNTAGPGAHQAVALT  462
             I L+GDG   TIIT   SVGGGS+   SAT    GDGFI + +  +NTAG   HQAVAL 
Sbjct  254   IMLLGDGIGKTIITGSKSVGGGSTTFNSATVAAVGDGFIGRGLTIRNTAGAANHQAVALR  313

Query  461   VASDHSVFYRCSISGYQDTLYALSLRQFYRECDISGTVDFIFGNAAAVFQACNLVLRR-P  285
               SD SVFY+CS  GYQDTLY  S RQFYRECDI GTVDFIFGNAA V Q CN+  R  P
Sbjct  314   SGSDLSVFYQCSFEGYQDTLYVHSERQFYRECDIYGTVDFIFGNAAVVLQNCNIYPRNPP  373

Query  284   SSYNVILANGRSDPGQNTGFSVQKCKITPGPDFSPVKNSYNSYLGRPWKPYSRAVVMESD  105
             +  N I A GR+DP QNTG S+  CK+T   D   V++S  +YLGRPWK YSR V M++ 
Sbjct  374   NKTNTITAQGRTDPNQNTGISIHNCKVTAASDLKSVQSSVKTYLGRPWKEYSRTVFMKTY  433

Query  104   IDGAISARGWIEWPGTSSSSVRELYFGEYANVG  6
             +D  I+  GW+EW G  + +++ LY+GEY N G
Sbjct  434   LDSLINPAGWMEWSG--NFALKTLYYGEYMNTG  464



>ref|XP_002318284.2| pectinesterase family protein [Populus trichocarpa]
 gb|EEE96504.2| pectinesterase family protein [Populus trichocarpa]
Length=533

 Score =   311 bits (798),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 182/394 (46%), Positives = 233/394 (59%), Gaps = 22/394 (6%)
 Frame = -2

Query  1166  CEELMGMARQRLNEALVAMKESPGKNRQEDIQTWLSAAVTFQQACKDWADQYAFSDELFA  987
             C +L      +LN  L+ +++        D QTWLS A+T  Q C+  +     +D    
Sbjct  106   CLKLHSNTILQLNRTLIGLEKKRLPCTDLDAQTWLSTALTNIQTCRTGSLDLNVTDFTMP  165

Query  986   RISRSMDYQSQLASNALALVNRNTEISAAGRQLSEEdidddddggffpDWVSGRDLRLLE  807
               S+++   S+L SN LA+          G  L+ ED +          W SG++ RLL+
Sbjct  166   AASKNL---SELISNTLAI---------NGVSLATEDNNTQGYFPS---WFSGQNRRLLQ  210

Query  806   TTTDKTKANVVVAKDGTGNFRTVAEAIGAASGR---QRFVIYVKSGVYKEKI--RSSKDG  642
             +T+   KAN+VV+K G GNFRT+  AI AAS R    RF+IYVK GVY+E I  R + + 
Sbjct  211   STSIAAKANLVVSKSGLGNFRTIQAAIDAASKRIFRTRFIIYVKRGVYRENIVVRVNSNN  270

Query  641   ITLIGDGKYSTIITWDDSVGGGSSLTGSATFGITGDGFIAKDIGFQNTAGPGAHQAVALT  462
             I L+GDG   TIIT   SVG G +   SAT GI G  F+A+ I F NTAGP   QAVAL 
Sbjct  271   IWLVGDGLRDTIITSSRSVGAGYTTYSSATAGIDGLRFVARGITFINTAGPLKGQAVALR  330

Query  461   VASDHSVFYRCSISGYQDTLYALSLRQFYRECDISGTVDFIFGNAAAVFQACNLVLRRP-  285
              ASD SVFYRCSI GYQDTL+  S RQFYREC I GT+DFIFGNAA VFQ   + +RRP 
Sbjct  331   SASDLSVFYRCSIQGYQDTLFVHSQRQFYRECYIFGTIDFIFGNAAVVFQNSIIYVRRPL  390

Query  284   -SSYNVILANGRSDPGQNTGFSVQKCKITPGPDFSPVKNSYNSYLGRPWKPYSRAVVMES  108
                 N+I A GR+DP QNTG S+   +I P PD  PV  ++ +YLGRPW  YSR V++ +
Sbjct  391   KGQANMITAQGRNDPFQNTGISIHNSRILPAPDLKPVVGAFETYLGRPWMQYSRTVILRT  450

Query  107   DIDGAISARGWIEWPGTSSSSVRELYFGEYANVG  6
              ID  I+  GW  W  TS+ +   LY+GEY N G
Sbjct  451   YIDSFINPSGWSPWLRTSNFAQDTLYYGEYKNFG  484



>ref|XP_010269596.1| PREDICTED: pectinesterase-like [Nelumbo nucifera]
Length=561

 Score =   312 bits (800),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 195/466 (42%), Positives = 265/466 (57%), Gaps = 23/466 (5%)
 Frame = -2

Query  1367  CGYTRFPRLCVQTLSG---LVSGERVDFAAALLLNKTIAHADLHIAHFDQLSSHFVSSQP  1197
             C  T +P LCV T+S    L S    D  +A +   T+       ++         +  P
Sbjct  57    CEGTLYPELCVSTVSSFPDLASKTIPDIISATV-QHTVNEVRTSASNCTGJRMKRRTLDP  115

Query  1196  PQPRLQAIGYCEELMGMARQRLNEAL--VAMKESPGKNRQEDIQTWLSAAVTFQQACKDW  1023
              Q    A+  C EL+      L  AL  ++ K SP ++   D+ T LSAA+T +  C   
Sbjct  116   LQQ--MALDDCLELLDETVAELKSALSDLSPKNSPSRH-YNDLGTLLSAAMTNEYTC---  169

Query  1022  ADQYAFSD-ELFARISRSMDYQSQLASNALALVNRNTEISAAGRQLSEEdidddddggff  846
              D +  S   +   I + +   S   SN+LA++ +  + + + +  +E   +     G F
Sbjct  170   LDGFVHSKGNVREEIKQGLYNISHSVSNSLAMLKKIPKSNRSSK--AEVFPEYGRMVGGF  227

Query  845   pDWVSGRDLRLLETTTDKTKANVVVAKDGTGNFRTVAEAIGAA--SGRQRFVIYVKSGVY  672
             P WVS RD +LL+ +T+ TK ++VVAKDG+GNF T+++A+ AA  S   RFVIY+K+G Y
Sbjct  228   PRWVSPRDRKLLQASTNTTKFDLVVAKDGSGNFTTISDAVAAAPNSTTTRFVIYIKAGAY  287

Query  671   KEKIRSSKDGITL--IGDGKYSTIITWDDSVGGGSSLTGSATFGITGDGFIAKDIGFQNT  498
              E +   K    L  +GDG   T++  + SV  G +   SAT  + G+GFIA+D+ F+N+
Sbjct  288   FENVDVDKKKTMLMFVGDGIGKTVVKANRSVVDGWTTFRSATVAVVGNGFIARDMTFENS  347

Query  497   AGPGAHQAVALTVASDHSVFYRCSISGYQDTLYALSLRQFYRECDISGTVDFIFGNAAAV  318
             AGP  HQAVAL   SD S FYRCS  GYQDTLY  SLRQFYR+CDI GTVDFIFGNAA V
Sbjct  348   AGPNKHQAVALRSGSDLSAFYRCSFVGYQDTLYVHSLRQFYRDCDIYGTVDFIFGNAAVV  407

Query  317   FQACNLVLRRPSS--YNVILANGRSDPGQNTGFSVQKCKITPGPDFSPVKNSYNSYLGRP  144
             FQ CNL  RRP+    N+  A GR DP QNT  S+   K+T   D  PVK+S+ +YLGRP
Sbjct  408   FQNCNLYARRPNDNQKNIFTAQGRQDPNQNTXISILDSKVTAASDLIPVKSSFKTYLGRP  467

Query  143   WKPYSRAVVMESDIDGAISARGWIEWPGTSSSSVRELYFGEYANVG  6
             WK YSR V + S +D  I   GW+EW G    ++  LY+GEY N G
Sbjct  468   WKEYSRTVFLRSFLDDLIDPAGWLEWSG--DFALTTLYYGEYMNRG  511



>sp|O04887.1|PME2_CITSI RecName: Full=Pectinesterase 2; Short=PE 2; AltName: Full=Pectin 
methylesterase; Flags: Precursor [Citrus sinensis]
 gb|AAB57669.1| pectinesterase [Citrus sinensis]
Length=510

 Score =   311 bits (796),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 172/390 (44%), Positives = 232/390 (59%), Gaps = 29/390 (7%)
 Frame = -2

Query  1166  CEELMGMARQRLNEALVAMKESPGKNRQEDIQTWLSAAVTFQQACKDWADQYAFSDELFA  987
             C EL  +   +LN+       SPG  +  D QTWLS A+T  + C+   +     + +  
Sbjct  98    CRELYELTVLKLNQT---SNSSPGCTKV-DKQTWLSTALTNLETCRASLEDLGVPEYVLP  153

Query  986   RISRSMDYQSQLASNALALVNRNTEISAAGRQLSEEdidddddggffpDWVSGRDLRLLE  807
              +S ++   ++L SN L+L              ++   ++      FP WV   D +LL+
Sbjct  154   LLSNNV---TKLISNTLSL--------------NKVPYNEPSYKDGFPTWVKPGDRKLLQ  196

Query  806   TTTDKTKANVVVAKDGTGNFRTVAEAIGAAS--GRQRFVIYVKSGVYKEKIRSSKDGITL  633
             TT    +AN+VVA+DG+GN +T+ EA+ AAS  G  R+VIY+K+G Y E I      I  
Sbjct  197   TTP---RANIVVAQDGSGNVKTIQEAVAAASRAGGSRYVIYIKAGTYNENIEVKLKNIMF  253

Query  632   IGDGKYSTIITWDDSVGGGSSLTGSATFGITGDGFIAKDIGFQNTAGPGAHQAVALTVAS  453
             +GDG   TIIT   SVGGG++   SAT  + GD FIA+DI  +NTAGP  HQAVAL   S
Sbjct  254   VGDGIGKTIITGSKSVGGGATTFKSATVAVVGDNFIARDITIRNTAGPNNHQAVALRSGS  313

Query  452   DHSVFYRCSISGYQDTLYALSLRQFYRECDISGTVDFIFGNAAAVFQACNLVLRRPSS-Y  276
             D SVFYRCS  GYQDTLY  S RQFYRECDI GTVDFIFGNAA V Q CN+  R+P +  
Sbjct  314   DLSVFYRCSFEGYQDTLYVHSQRQFYRECDIYGTVDFIFGNAAVVLQNCNIFARKPPNRT  373

Query  275   NVILANGRSDPGQNTGFSVQKCKITPGPDFSPVKNSYNSYLGRPWKPYSRAVVMESDIDG  96
             N + A GR+DP Q+TG  +  C++T   D  PV++S  ++LGRPWK YSR V +++ +D 
Sbjct  374   NTLTAQGRTDPNQSTGIIIHNCRVTAASDLKPVQSSVKTFLGRPWKQYSRTVYIKTFLDS  433

Query  95    AISARGWIEWPGTSSSSVRELYFGEYANVG  6
              I+  GW+EW G    ++  LY+ EY N G
Sbjct  434   LINPAGWMEWSG--DFALNTLYYAEYMNTG  461



>ref|XP_008438193.1| PREDICTED: pectinesterase 2 [Cucumis melo]
Length=511

 Score =   311 bits (796),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 177/376 (47%), Positives = 230/376 (61%), Gaps = 21/376 (6%)
 Frame = -2

Query  1130  NEALVAMKESPGKNRQEDIQTWLSAAVTFQQACKDWADQYAFSDELFARISRSMDYQSQL  951
             +E +  +  +  +    D QTWLSAA+T  + C+   D+   S   +   + ++   S+L
Sbjct  107   DEIITRLNRTSDRCTPADAQTWLSAALTALETCRTGFDELGLSAFGYPLTANNV---SKL  163

Query  950   ASNALALVNRNTEISAAGRQLSEEdidddddggffpDWVSGRDLRLLETTTDKTKANVVV  771
              S+ L++   N   S  G + +            FP WV   D +LL++ + K  ANVVV
Sbjct  164   ISDGLSV---NKPASPEGYEPT------TIMDDGFPTWVRPGDRKLLQSGSPK--ANVVV  212

Query  770   AKDGTGNFRTVAEAIGAASGRQRFVIYVKSGVYKEKIRSSKDGITLIGDGKYSTIITWDD  591
             A+DG+GNF+TV EA+ AA G  RFVIYVKSGVY E +      + ++GDG   TIIT   
Sbjct  213   AQDGSGNFKTVKEAVAAAKGGGRFVIYVKSGVYNENLDIKAKNVMMVGDGIGKTIITGSR  272

Query  590   SVGGGSSLTGSATFGITGDGFIAKDIGFQNTAGPGAHQAVALTVASDHSVFYRCSISGYQ  411
             SVGGGS+   SAT  + GDGFIA+DI F+NTAG   HQAVAL   SD SVFYRC   GYQ
Sbjct  273   SVGGGSTTFRSATVAVDGDGFIARDITFRNTAGAKNHQAVALRSGSDLSVFYRCGFEGYQ  332

Query  410   DTLYALSLRQFYRECDISGTVDFIFGNAAAVFQACNLVLRRPSSYNV-ILANGRSDPGQN  234
             DTLY  + RQFY++CDI GTVDFIFGNAA V Q CN++ R P +  + + A GRSDP QN
Sbjct  333   DTLYVYAERQFYKQCDIYGTVDFIFGNAAVVLQDCNIIARDPPNKTITVTAQGRSDPNQN  392

Query  233   TGFSVQKCKITPGPDFSPVKNSYNSYLGRPWKPYSRAVVMESDIDGAISARGWIEWPGTS  54
             TG S+  C+IT     S VK    +YLGRPW+ YSR VVM+S I G IS  GW+ W G  
Sbjct  393   TGISIHNCRITSAGGLSGVK----AYLGRPWRQYSRTVVMKSSIGGFISPAGWMPWSG--  446

Query  53    SSSVRELYFGEYANVG  6
             + ++  LY+GEY N G
Sbjct  447   NFALNTLYYGEYMNTG  462



>ref|XP_011016743.1| PREDICTED: pectinesterase-like [Populus euphratica]
Length=550

 Score =   312 bits (799),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 184/464 (40%), Positives = 252/464 (54%), Gaps = 29/464 (6%)
 Frame = -2

Query  1367  CGYTRFPRLCVQTLSGLVSGERVDFAAALLLNKTIAHADLHIAHFDQLSSHFVSSQPPQP  1188
             C     P+ C+  LS  VS E V  +  + L K      L      +  ++ V+S+    
Sbjct  57    CNQAHDPQECLSILSEAVSTEGVQESNGVGLLKIFLVKSLSQMRMAKAVANAVNSKINDH  116

Query  1187  RLQA-IGYCEELMGMARQRLNEALVAMKESPGKNRQEDIQTWLSAAVTFQQACKDWAD--  1017
             + QA +  C ELM M+  R+ + L A+     ++   D  TWLS  +T    C D  D  
Sbjct  117   KHQAALADCVELMDMSIDRVTDTLSALGNWGSQSDASDANTWLSGVLTNHVTCLDGVDTI  176

Query  1016  -QYAFSDELFARISRSMDYQSQLASNALALVNRNTEISAAGRQLSEEdidddddggffpD  840
              Q +    L   ISR           +LA V   + +SA    L +              
Sbjct  177   DQPSMKKLLQDLISR--------MRTSLATV---SSLSAPDTDLVQPLNGGVPS------  219

Query  839   WVSGRDLRLLETTTDKTKANVVVAKDGTGNFRTVAEAIGAA--SGRQRFVIYVKSGVYKE  666
             W+ GRD +LLE++    +ANVVVA+DG+G++ T+ EA+ +     + R+VI+VKSG+YKE
Sbjct  220   WILGRDRKLLESSVSNVEANVVVAQDGSGDYTTIQEAVNSVPDKSKSRYVIHVKSGIYKE  279

Query  665   KIR--SSKDGITLIGDGKYSTIITWDDSVGGGSSLTGSATFGITGDGFIAKDIGFQNTAG  492
              +     K  + ++GDG   TI+T + +V  GS+   SAT  + GDGFI +DI  QNTAG
Sbjct  280   NVEVGKKKKNVMIVGDGMDFTILTGNLNVVDGSTTFRSATLAVAGDGFILQDIWIQNTAG  339

Query  491   PGAHQAVALTVASDHSVFYRCSISGYQDTLYALSLRQFYRECDISGTVDFIFGNAAAVFQ  312
             P  HQAVAL V++D SV  RC I  YQDTLY  + RQFYR+C I GT+DFIFGN A V Q
Sbjct  340   PEKHQAVALRVSADQSVINRCRIDAYQDTLYTHNYRQFYRDCSIIGTIDFIFGNGAVVLQ  399

Query  311   ACNLVLRRP--SSYNVILANGRSDPGQNTGFSVQKCKITPGPDFSPVKNSYNSYLGRPWK  138
              C ++ R+P  +  N++ A GR DP QNTG S+Q C I    D    +N + +YLGRPWK
Sbjct  400   NCQIISRKPMANQKNMVTAQGRIDPNQNTGISIQNCDIVASSDLESDQNKFPTYLGRPWK  459

Query  137   PYSRAVVMESDIDGAISARGWIEWPGTSSSSVRELYFGEYANVG  6
              YSR VVM+S I G I   GW EW      ++  LY+GEYAN G
Sbjct  460   QYSRTVVMQSKIGGHIDPTGWAEWD--KEFALTTLYYGEYANRG  501



>ref|XP_010684346.1| PREDICTED: pectinesterase-like [Beta vulgaris subsp. vulgaris]
Length=576

 Score =   313 bits (801),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 193/484 (40%), Positives = 259/484 (54%), Gaps = 38/484 (8%)
 Frame = -2

Query  1370  QCGYTRFPRLCVQTLSGLVSGERVDFAAALLLNKTIAHADL-----HIAHFDQLSSHFVS  1206
              C  T +  LC+ TLS +    +      L    ++  A++     +I+  + ++ H +S
Sbjct  52    HCDGTLYTDLCISTLSNIPHLHKKSLTEILRYVISVTEAEVRASATNISGLESVNRHTLS  111

Query  1205  SQPPQPRLQ--AIGYCEELMGMARQRLNEALVAMKESPG-KNRQEDIQTWLSAAVTFQQA  1035
                   RLQ  A+  C EL+      L+  L  M    G  N   +I+T+LSAA+T+Q  
Sbjct  112   ------RLQHFAVRDCLELLADTTDELDTVLDEMTGQCGPSNNVSNIRTYLSAAMTYQYT  165

Query  1034  CKDWADQYAFSDELFARISRSMDYQSQLASNALALVNR--------NTEISAAGRQLSEE  879
             C D  D    S  L   I   +   +   SN+LA++N+        +  +S+      + 
Sbjct  166   CLDGFD-VGSSKTLRRLIETGLLNITHHVSNSLAMLNKIRGPRHCKDKTMSSPPYHDDDL  224

Query  878   didddddggffpDWVSGRDLRLLETTT-------DKTKANVVVAKDGTGNFRTVAEAIGA  720
                +  D    P W+  +D RLL+T           T+ ++VVAKDG+GNF T+ EA+ A
Sbjct  225   HDRNGLDRAGLPRWMEKKDRRLLQTAKPASPGSGTTTQVDIVVAKDGSGNFTTIREAVAA  284

Query  719   ASG--RQRFVIYVKSGVYKE--KIRSSKDGITLIGDGKYSTIITWDDSVGGGSSLTGSAT  552
             A      RFVIY+K+G Y E  +++  K  I  +GDG   T+I    +V  G +   SAT
Sbjct  285   ARNWSTTRFVIYIKTGAYFENVEVKKKKTNIMFLGDGIGKTVIKAKRNVADGYTTFRSAT  344

Query  551   FGITGDGFIAKDIGFQNTAGPGAHQAVALTVASDHSVFYRCSISGYQDTLYALSLRQFYR  372
               + G GFIAKD+  +N AGP  HQAVAL   SD S FYRCS  GYQDTLY  SLRQFYR
Sbjct  345   LAVVGAGFIAKDLTVENYAGPAKHQAVALRSGSDFSAFYRCSFIGYQDTLYTHSLRQFYR  404

Query  371   ECDISGTVDFIFGNAAAVFQACNLVLRR--PSSYNVILANGRSDPGQNTGFSVQKCKITP  198
             ECDI GTVDFIFGNAA VFQ CNL  R   P+  NV  A  R DP QNTG S+  CK+ P
Sbjct  405   ECDIYGTVDFIFGNAAVVFQLCNLYARTPLPNQKNVYTAQSRKDPNQNTGISILNCKVAP  464

Query  197   GPDFSPVKNSYNSYLGRPWKPYSRAVVMESDIDGAISARGWIEWPGTSSSSVRELYFGEY  18
               D +  K +Y ++LGRPWK YSR + M S ID  +   GW+EW G  + S   LY+GEY
Sbjct  465   AADLAANKTAYKTFLGRPWKDYSRTIFMLSYIDDVVDPAGWLEWSGDFALST--LYYGEY  522

Query  17    ANVG  6
              N G
Sbjct  523   KNRG  526



>ref|XP_010656074.1| PREDICTED: pectinesterase-like [Vitis vinifera]
Length=578

 Score =   313 bits (801),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 198/487 (41%), Positives = 279/487 (57%), Gaps = 42/487 (9%)
 Frame = -2

Query  1379  IRIQCGYTRFPRLCVQTLSGLVSGERVDFAAALLLNKTIAHADLHIAHFDQLSSHFVSSQ  1200
             ++  C  T +P LC   +S     E     A +   K +  A L+        ++F    
Sbjct  58    VKSSCSATLYPELCFSAVSSREGEE-----AKITKPKDVIEAVLNFTITTVQHNYFTLQH  112

Query  1199  PPQPRL-------QAIGYCEELMGMARQRLNEALVAMKE-SPGKN---RQEDIQTWLSAA  1053
               + RL        A+  C E++      L+++ + +++ S  K+   + +D+ T LSAA
Sbjct  113   IIKTRLGLSPREKAALHDCLEMVDDTLDELHKSALDLQDYSLNKSISQQADDLITLLSAA  172

Query  1052  VTFQQACKDWADQYAFSDELFARISRS--MDYQSQ---LASNALALVNRNTEIS------  906
             +T Q+ C D      FS +   +  R   MD Q Q   L SN LA++   T+        
Sbjct  173   MTNQETCID-----GFSHDGADKKIRKGLMDGQMQAFRLCSNVLAMIKNLTDTDMAAAAS  227

Query  905   AAGRQLSEEdidddddggffpDWVSGRDLRLLETTTDKTKANVVVAKDGTGNFRTVAEAI  726
             AAGRQL EE+ +       +P+W+S  D RLL+ +T    A+V VA DG+GN++TV EA+
Sbjct  228   AAGRQLREEEEEATATAIEWPEWLSAGDRRLLQAST--VTADVTVAADGSGNYKTVGEAV  285

Query  725   GAASGR--QRFVIYVKSGVYKEKIR--SSKDGITLIGDGKYSTIITWDDSVGGGSSLTGS  558
              +A  R  +R++I +K+GVYKE +     K  I  +GDG+ +TIIT   +V  GS+   S
Sbjct  286   ASAPERSSKRYIIRIKAGVYKENVEVPKKKTNIMFVGDGRTNTIITASRNVVDGSTTFHS  345

Query  557   ATFGITGDGFIAKDIGFQNTAGPGAHQAVALTVASDHSVFYRCSISGYQDTLYALSLRQF  378
             AT  + GDGF+A+DI FQNTAGP  HQAVAL V SD S FYRC +  YQDTLY  SLRQF
Sbjct  346   ATVAVVGDGFLARDITFQNTAGPSKHQAVALRVGSDLSAFYRCDVLAYQDTLYVHSLRQF  405

Query  377   YRECDISGTVDFIFGNAAAVFQACNLVLRRPSS--YNVILANGRSDPGQNTGFSVQKCKI  204
             +  C ++GTVDFIFGNAAAV Q C++  RRP+S   N++ A GR DP QNTG  +QKC+I
Sbjct  406   FVGCLVAGTVDFIFGNAAAVLQDCDIHARRPNSGQRNMVTAQGRDDPNQNTGIVIQKCRI  465

Query  203   TPGPDFSPVKNSYNSYLGRPWKPYSRAVVMESDIDGAISARGWIEWPGTSSSSVRELYFG  24
                 D  PV++S+ +YLGRPWK YSR VVM++ I   I+  GW  W G  + ++  L++ 
Sbjct  466   GATSDLKPVQSSFPTYLGRPWKEYSRTVVMQTSISDVINPAGWYPWNG--NFALDTLFYA  523

Query  23    EYANVGA  3
             EY N GA
Sbjct  524   EYQNTGA  530



>ref|XP_002265171.1| PREDICTED: pectinesterase [Vitis vinifera]
Length=611

 Score =   313 bits (803),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 189/484 (39%), Positives = 274/484 (57%), Gaps = 42/484 (9%)
 Frame = -2

Query  1379  IRIQCGYTRFPRLCVQTLSGLVSGERV----DFAAALLLNKTIAHADLHIAHFDQLSSHF  1212
             ++  C  TR+P LC   ++ +    +         A+ LN T+   + +    ++L    
Sbjct  97    LKSACSSTRYPDLCYSAIATVPGASKKVTSQKDVIAVSLNITVTAVEHNYFTIEKLLDFK  156

Query  1211  VSSQPPQPRLQAIGYCEELMGMARQRLNEALVAMKESPGKN----RQEDIQTWLSAAVTF  1044
               ++  +  L     C E +      L+ A+  + E P K       +D++T +SAA+T 
Sbjct  157   NLTKREKAALHD---CLETIDETLDELHVAMDDLDEYPDKKSLTQHADDLKTLMSAAMTN  213

Query  1043  QQAC-----KDWADQYAFSDELFARISRSMDYQSQLASNALALVNRNT------EISAAG  897
             Q+ C      D AD++    E+  +  R +++   + SNALA++   T      E  A  
Sbjct  214   QETCLDGFSHDDADKHV--REVLLKGQRHVEH---MCSNALAMIKNMTDTDIAREREAMN  268

Query  896   RQLSEEdidddddggffpDWVSGRDLRLLETTTDKTKANVVVAKDGTGNFRTVAEAIGAA  717
             R+L EE  +          W+S  D RLL++++     +VVVA DG+G+++TV+ A+ AA
Sbjct  269   RKLMEERDESGWPK-----WLSAGDRRLLQSSS--VTPDVVVAADGSGDYKTVSAAVAAA  321

Query  716   SGR--QRFVIYVKSGVYKEKIR--SSKDGITLIGDGKYSTIITWDDSVGGGSSLTGSATF  549
               +  +R++I +K+GVYKE +     K  I  +GDG+ +TIIT   +V  GS+   SAT 
Sbjct  322   PEKSSKRYIIGIKAGVYKENVEVGKKKTNIMFLGDGRSNTIITGSKNVVDGSTTFNSATV  381

Query  548   GITGDGFIAKDIGFQNTAGPGAHQAVALTVASDHSVFYRCSISGYQDTLYALSLRQFYRE  369
              + G+ FIA+DI FQNTAGP  HQAVAL V SD S FY+C +  YQDTLY  S RQFY  
Sbjct  382   AVVGEKFIARDITFQNTAGPSKHQAVALRVGSDLSAFYKCDMLAYQDTLYVHSNRQFYIN  441

Query  368   CDISGTVDFIFGNAAAVFQACNLVLRRPSS--YNVILANGRSDPGQNTGFSVQKCKITPG  195
             C ++GTVDFIFGNAAAVFQ C++  RRP+S   N++ A GR+DP QNTG  +QKC+I   
Sbjct  442   CLVAGTVDFIFGNAAAVFQDCDIHARRPNSGQKNMLTAQGRTDPNQNTGIVIQKCRIGAT  501

Query  194   PDFSPVKNSYNSYLGRPWKPYSRAVVMESDIDGAISARGWIEWPGTSSSSVRELYFGEYA  15
              D   V +S+ +YLGRPWK YSR VVM++ I   I   GW EW G  S ++  LY+GEY 
Sbjct  502   SDLQAVISSFKTYLGRPWKEYSRTVVMQTSITNVIDPAGWHEWSG--SFALSTLYYGEYQ  559

Query  14    NVGA  3
             N GA
Sbjct  560   NTGA  563



>ref|XP_009783075.1| PREDICTED: pectinesterase-like [Nicotiana sylvestris]
Length=567

 Score =   312 bits (799),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 191/466 (41%), Positives = 260/466 (56%), Gaps = 20/466 (4%)
 Frame = -2

Query  1370  QCGYTRFPRLCVQTLSGLVSGERVDFAAALLLNKTIAHADLHIAHFD--QLSSHFVSSQP  1197
              C  T  P LCV TLS   +  R   A  +     +A  ++  +  +   L  +    +P
Sbjct  59    HCEGTLHPELCVSTLSSFPNLHRKSIAEIISSTVKVAVGEVRDSAHNCSDLRRNVPKLEP  118

Query  1196  PQPRLQAIGYCEELMGMARQRLNEALVAMKESPGKNRQE---DIQTWLSAAVTFQQACKD  1026
              + R  A+  C EL+G     L  AL  +  SP K+  +   DIQT LSAA+T +  C D
Sbjct  119   IEKR--ALQDCVELLGETIAELRTALTDL--SPKKSASKHYNDIQTLLSAAMTNEDTCLD  174

Query  1025  WADQYAFSDELFARISRSMDYQSQLASNALALVNRNTEISAAGRQLSEEdidddddggff  846
                 Y   + L   +  ++   +   SN+LA++N+    S +  +  E   +       F
Sbjct  175   -GLFYCTKNNLTRYVEDNLHTIAHHVSNSLAMLNKIKRTSVSSSE--EVFPEYGAVKNGF  231

Query  845   pDWVSGRDLRLLETTTDKTKANVVVAKDGTGNFRTVAEAIGAA--SGRQRFVIYVKSGVY  672
             P+W+  R+  LL+T   +TK ++VVAKDG+GNF T+ EA+ AA  S   RFVIY+K G Y
Sbjct  232   PNWLKRRERALLQTPVSQTKLDLVVAKDGSGNFTTINEALSAAPNSSSTRFVIYIKEGSY  291

Query  671   KE--KIRSSKDGITLIGDGKYSTIITWDDSVGGGSSLTGSATFGITGDGFIAKDIGFQNT  498
              E  ++   K  I  +GDG   T I  + +   G +   SAT  + G GF+AK I F+N 
Sbjct  292   FEYVEVDKKKTMIMFVGDGIGKTKIKGNRNHVDGWTTFRSATVAVVGKGFLAKGITFENY  351

Query  497   AGPGAHQAVALTVASDHSVFYRCSISGYQDTLYALSLRQFYRECDISGTVDFIFGNAAAV  318
             AGP  HQAVAL  +SD S FY+CS   YQDTLY  SLRQFYR+CD+ GTVDFIFGNAA V
Sbjct  352   AGPSKHQAVALRSSSDLSAFYQCSFVAYQDTLYVHSLRQFYRDCDVYGTVDFIFGNAAVV  411

Query  317   FQACNLVLRR--PSSYNVILANGRSDPGQNTGFSVQKCKITPGPDFSPVKNSYNSYLGRP  144
              Q CNL  R+  P+  N+  A GR DP QNTG S+  CK+    D  PV++S+ +YLGRP
Sbjct  412   LQNCNLYARKPDPNQKNLFTAQGREDPNQNTGISILNCKVEAAADLIPVQSSFKNYLGRP  471

Query  143   WKPYSRAVVMESDIDGAISARGWIEWPGTSSSSVRELYFGEYANVG  6
             WK YSR VV++S I   I   GW+EW G    +++ LY+GEY N G
Sbjct  472   WKEYSRTVVLQSYIGSLIEPAGWLEWNG--DFALKTLYYGEYMNRG  515



>ref|XP_010271372.1| PREDICTED: pectinesterase-like [Nelumbo nucifera]
Length=526

 Score =   311 bits (796),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 195/471 (41%), Positives = 273/471 (58%), Gaps = 25/471 (5%)
 Frame = -2

Query  1385  DQIRIQCGYTRFPRLCVQTLSG---LVS-GERVDFA---AALLLNKTIAHADLHIAHFDQ  1227
             D   I C  T +P +C   +S    LV+  E+  F+   AAL    ++       AH   
Sbjct  24    DANTISCSQTPYPEICEYFMSSKHDLVTLDEKTQFSFRDAAL----SVTMDQAQRAH-GL  78

Query  1226  LSSHFVSSQPPQPRLQAIGYCEELMGMARQRLNEALVAMKESPGKNRQEDIQTWLSAAVT  1047
             +S+  +SS   + ++ A   C EL      +LN +L     S       D QTWLSAA+T
Sbjct  79    ISAMDLSSFDEKVKM-AWADCVELYADTVSQLNRSL----GSKNPLSWSDSQTWLSAALT  133

Query  1046  FQQACKDWADQYAFSDELFARISRSMDYQSQLASNALALVNRNTEISAAGRQLSEEdidd  867
              +Q C++       S  L +  S   ++ S++ SN+LA+       S++   L  +  + 
Sbjct  134   NEQTCRNGFMDLNLSHRLSSLPSMLSNF-SKMVSNSLAI--NKAAASSSASLLGRQGGNR  190

Query  866   dddggffpDWVSGRDLRLLETTTDKTKANVVVAKDGTGNFRTVAEAIGAASGR-QRFVIY  690
                   FP WVS  D +LL+++   ++A+VVVA DG+GN++T++EA+ AASG   RF+IY
Sbjct  191   RLLSDGFPAWVSAADRKLLQSSGAASQADVVVAADGSGNYKTISEAVAAASGGGSRFIIY  250

Query  689   VKSGVYKEKIRSSKDGITLIGDGKYSTIITWDDSVGGGSSLTGSATFGITGDGFIAKDIG  510
             VK GVYKE +      I LIGDG  +TI++   +V  GS+   SAT  ++G GFIA+D+ 
Sbjct  251   VKRGVYKENVEIRASNIMLIGDGIDATIVSSSRNVQQGSTTFRSATVAVSGGGFIARDMT  310

Query  509   FQNTAGPGAHQAVALTVASDHSVFYRCSISGYQDTLYALSLRQFYRECDISGTVDFIFGN  330
             F+N+AGP  HQAVAL   SD SV Y CS  GYQDTLY  S RQFYR+CDI GT DFI GN
Sbjct  311   FENSAGPQNHQAVALRSGSDLSVLYGCSFKGYQDTLYVHSQRQFYRDCDIYGTQDFICGN  370

Query  329   AAAVFQACNLVLRRPSS--YNVILANGRSDPGQNTGFSVQKCKITPGPDFSPVKNSYNSY  156
             AAAVFQ CN+ +R+P S   N + A  R+DP QNTG S+   ++T   D   V+ S+ +Y
Sbjct  371   AAAVFQNCNIYVRKPLSGQKNTVTAQARTDPNQNTGISIHNSRVTAASDLRAVQGSFKTY  430

Query  155   LGRPWKPYSRAVVMESDIDGAISARGWIEWPGTSSSSVRELYFGEYANVGA  3
             LGRPW+ YSR V M++ +D  I   GW+EW G  S ++  LY+GE+ N GA
Sbjct  431   LGRPWQKYSRTVFMKTSLDSLIDPAGWLEWSG--SFALSTLYYGEFMNSGA  479



>ref|XP_006578909.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 34-like 
[Glycine max]
Length=581

 Score =   312 bits (800),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 190/469 (41%), Positives = 260/469 (55%), Gaps = 27/469 (6%)
 Frame = -2

Query  1367  CGYTRFPRLCVQTLSGLVSGERVDFAAAL-LLNKTIAHADLHIA--HFDQ--LSSHFVSS  1203
             C  TRF  LC+++L        +DF  +     K + H   ++   HF +   SS  +S 
Sbjct  74    CSKTRFKMLCMKSL--------LDFPGSQGASEKDLVHISFNVTLQHFSKALYSSATISY  125

Query  1202  QPPQPRLQAIGY-CEELMGMARQRLNEALVAMKESPGKNRQEDIQTWLSAAVTFQQACKD  1026
                 PR++A  + C EL+  +   L  +L  +      +  +D+ TWLSAA+T Q  C +
Sbjct  126   TAMDPRVRAAYHDCLELLDDSVDALARSLNTVSVGAVGSANDDVLTWLSAALTNQDTCAE  185

Query  1025  -WADQYAFSDELFARISRSMDYQSQLASNALALVN-RNTEISAAGRQLSEEdidddddgg  852
              +AD      +  A   + +   S+L SN LA+ +        AG  +            
Sbjct  186   GFADAAGTVKDQMANNLKDL---SELVSNCLAIFSGAGAGDDFAGVPIQNRRRLMAMRED  242

Query  851   ffpDWVSGRDLRLLETTTDKTKANVVVAKDGTGNFRTVAEAIGAAS--GRQRFVIYVKSG  678
              FP W++GRD RLL     + +A++VV+KDG G  +T+AEAI        +R +IY+++G
Sbjct  243   NFPTWLNGRDRRLLSLPLSQIQADIVVSKDGNGTVKTIAEAIKKVPEYSSRRIIIYIRAG  302

Query  677   VYKE---KIRSSKDGITLIGDGKYSTIITWDDSVGGGSSLTGSATFGITGDGFIAKDIGF  507
              Y+E   K+   K  +  IGDGK  T+IT   +     +   +A+F  +G GFIAKD+ F
Sbjct  303   RYEEDNLKLGRKKTNVMFIGDGKGKTVITGGRNYYQNLTTFHTASFAASGSGFIAKDMTF  362

Query  506   QNTAGPGAHQAVALTVASDHSVFYRCSISGYQDTLYALSLRQFYRECDISGTVDFIFGNA  327
             +N AGPG HQAVAL V +DH+V YRC+I GYQDT+Y  S RQFYRECDI GTVDFIFGNA
Sbjct  363   ENYAGPGRHQAVALRVGADHAVVYRCNIIGYQDTMYVHSNRQFYRECDIYGTVDFIFGNA  422

Query  326   AAVFQACNLVLRRPSSY--NVILANGRSDPGQNTGFSVQKCKITPGPDFSPVKNSYNSYL  153
             A VFQ C L  R+P +   N I A  R DP QNTG S+  C+I   PD    K SY +YL
Sbjct  423   AVVFQNCTLWARKPMAQQKNTITAQNRKDPNQNTGISIHNCRIMATPDLEASKGSYPTYL  482

Query  152   GRPWKPYSRAVVMESDIDGAISARGWIEWPGTSSSSVRELYFGEYANVG  6
             GRPWK Y+R V M S I   +  RGW+EW  TSS ++   Y+GEY N G
Sbjct  483   GRPWKLYARTVFMLSYIGDHVHPRGWLEW-NTSSFALDTCYYGEYMNYG  530



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4353788048512