BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c9790_g1_i1 len=1362 path=[1:0-1361]

Length=1362
                                                                      Score     E

gb|EYU36422.1|  hypothetical protein MIMGU_mgv1a025661mg                200   4e-57   
ref|XP_011074300.1|  PREDICTED: transcription factor TGA1               193   4e-54   
ref|XP_010104546.1|  hypothetical protein L484_025521                   177   2e-48   
ref|XP_008444975.1|  PREDICTED: transcription factor TGA4               176   4e-48   
ref|XP_008366197.1|  PREDICTED: transcription factor TGA5-like          176   6e-48   
ref|XP_004148432.1|  PREDICTED: transcription factor TGA4-like          175   9e-48   
gb|KGN62783.1|  Transcription factor HBP-1b                             175   1e-47   
ref|XP_009339278.1|  PREDICTED: transcription factor TGA5               172   1e-46   
ref|XP_009768149.1|  PREDICTED: transcription factor TGA7-like          172   2e-46   
ref|XP_008219160.1|  PREDICTED: transcription factor HBP-1b(c38)        170   6e-46   
ref|XP_009606302.1|  PREDICTED: transcription factor TGA7-like          170   8e-46   
ref|XP_004238547.1|  PREDICTED: transcription factor HBP-1b(c38)        169   2e-45   
ref|XP_010667750.1|  PREDICTED: transcription factor HBP-1b(c38)-...    167   3e-44   
ref|XP_006356862.1|  PREDICTED: TGACG-sequence-specific DNA-bindi...    166   3e-44   
ref|XP_008349608.1|  PREDICTED: transcription factor TGA5-like          160   9e-43   
ref|XP_006472990.1|  PREDICTED: transcription factor TGA5-like          160   2e-41   
ref|XP_002510006.1|  Transcription factor HBP-1b, putative              148   4e-38   Ricinus communis
ref|XP_008345524.1|  PREDICTED: transcription factor TGA4-like          149   6e-38   
ref|XP_006429421.1|  hypothetical protein CICLE_v10012620mg             147   3e-37   
ref|XP_009377744.1|  PREDICTED: transcription factor TGA4-like          147   4e-37   
gb|KDO56688.1|  hypothetical protein CISIN_1g047612mg                   145   9e-37   
gb|KDP41541.1|  hypothetical protein JCGZ_15948                         144   2e-36   
ref|XP_002263705.1|  PREDICTED: transcription factor TGA2-like          142   9e-36   Vitis vinifera
ref|XP_010104255.1|  hypothetical protein L484_016398                   141   2e-35   
ref|XP_007137287.1|  hypothetical protein PHAVU_009G114600g             139   4e-35   
ref|XP_002532112.1|  Transcription factor HBP-1b, putative              139   2e-34   Ricinus communis
ref|XP_010277360.1|  PREDICTED: transcription factor HBP-1b(c38)-...    139   3e-34   
ref|XP_004246934.1|  PREDICTED: transcription factor TGA2-like          137   7e-34   
ref|XP_007206845.1|  hypothetical protein PRUPE_ppa027068mg             137   8e-34   
ref|XP_010064245.1|  PREDICTED: transcription factor TGA1-like          137   1e-33   
ref|XP_008243515.1|  PREDICTED: transcription factor TGA4-like          134   1e-32   
ref|XP_007026666.1|  Response to aba and salt 1, putative               133   2e-32   
ref|XP_003530288.1|  PREDICTED: transcription factor HBP-1b(c38)-...    133   3e-32   
ref|XP_006366944.1|  PREDICTED: transcription factor HBP-1b(c38)-...    132   5e-32   
ref|XP_006338981.1|  PREDICTED: transcription factor TGA6-like          131   1e-31   
ref|XP_010037696.1|  PREDICTED: transcription factor HBP-1b(c38)-...    131   2e-31   
ref|XP_004249821.1|  PREDICTED: transcription factor HBP-1b(c38)-...    130   2e-31   
ref|XP_010277361.1|  PREDICTED: transcription factor HBP-1b(c38)-...    131   3e-31   
ref|XP_004305124.1|  PREDICTED: transcription factor TGA4-like          129   6e-31   
ref|XP_008351209.1|  PREDICTED: transcription factor TGA7-like          130   1e-30   
ref|XP_010695448.1|  PREDICTED: transcription factor HBP-1b(c38)        125   3e-30   
ref|XP_007140269.1|  hypothetical protein PHAVU_008G097900g             125   8e-30   
ref|XP_009623095.1|  PREDICTED: transcription factor HBP-1b(c38)-...    126   1e-29   
ref|XP_009802153.1|  PREDICTED: transcription factor HBP-1b(c38)-...    125   1e-29   
ref|XP_006602670.1|  PREDICTED: transcription factor HBP-1b(c38)-...    124   3e-29   
ref|XP_011079057.1|  PREDICTED: transcription factor TGA5-like          124   4e-29   
ref|XP_006433711.1|  hypothetical protein CICLE_v10003662mg             123   5e-29   
gb|KEH23189.1|  transcription factor TGA5-like protein                  123   7e-29   
ref|XP_009769468.1|  PREDICTED: transcription factor TGA6-like          124   7e-29   
gb|KDP24433.1|  hypothetical protein JCGZ_24997                         123   1e-28   
ref|XP_008344751.1|  PREDICTED: transcription factor TGA5-like          120   2e-28   
ref|XP_009148314.1|  PREDICTED: transcription factor TGA1-like          122   2e-28   
ref|XP_010490486.1|  PREDICTED: transcription factor TGA4-like          121   3e-28   
ref|XP_010458320.1|  PREDICTED: transcription factor TGA4-like          121   4e-28   
emb|CDX93460.1|  BnaA06g05880D                                          120   5e-28   
ref|XP_004514219.1|  PREDICTED: uncharacterized protein LOC101514340    120   6e-28   
ref|XP_004137901.1|  PREDICTED: transcription factor TGA7-like          120   8e-28   
ref|XP_006303181.1|  hypothetical protein CARUB_v10010176mg             120   9e-28   
ref|XP_009338174.1|  PREDICTED: transcription factor TGA2-like          119   1e-27   
ref|XP_008351887.1|  PREDICTED: transcription factor TGA4-like          118   2e-27   
ref|XP_010511109.1|  PREDICTED: transcription factor TGA4-like          119   2e-27   
ref|XP_010414743.1|  PREDICTED: transcription factor TGA4-like          119   3e-27   
ref|XP_008442399.1|  PREDICTED: transcription factor HBP-1b(c38)        119   3e-27   
ref|XP_002272259.1|  PREDICTED: transcription factor TGA3-like          119   3e-27   Vitis vinifera
emb|CDP06468.1|  unnamed protein product                                118   5e-27   
ref|XP_009118288.1|  PREDICTED: TGACG-sequence-specific DNA-bindi...    118   5e-27   
emb|CDX94928.1|  BnaC05g07430D                                          116   2e-26   
ref|XP_004301438.1|  PREDICTED: uncharacterized protein LOC101313994    112   2e-26   
ref|XP_006417512.1|  hypothetical protein EUTSA_v10008665mg             115   6e-26   
emb|CDY22613.1|  BnaC08g42470D                                          114   1e-25   
ref|XP_006301016.1|  hypothetical protein CARUB_v10021407mg             113   2e-25   
ref|XP_007226122.1|  hypothetical protein PRUPE_ppa013318mg             109   4e-25   
ref|XP_008807787.1|  PREDICTED: transcription factor HBP-1b(c38)-...    110   2e-24   
ref|NP_172466.1|  response to ABA and salt 1                            109   4e-24   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002272336.1|  PREDICTED: transcription factor TGA5-like          109   6e-24   Vitis vinifera
ref|XP_002892539.1|  hypothetical protein ARALYDRAFT_471106             108   9e-24   
ref|XP_009350620.1|  PREDICTED: transcription factor TGA4-like          108   2e-23   
ref|XP_002888220.1|  hypothetical protein ARALYDRAFT_893661             107   2e-23   
dbj|BAH30346.1|  hypothetical protein                                   107   2e-23   Arabidopsis thaliana [mouse-ear cress]
ref|NP_564730.1|  protein ZW2                                           107   3e-23   Arabidopsis thaliana [mouse-ear cress]
gb|ACD56655.1|  predicted protein                                       105   3e-22   Gossypioides kirkii
ref|XP_009617985.1|  PREDICTED: transcription factor TGA5-like          104   3e-22   
ref|XP_007025357.1|  Transcription factor-related, putative             103   7e-22   
ref|NP_001042845.2|  Os01g0306400                                       103   9e-22   Oryza sativa Japonica Group [Japonica rice]
dbj|BAB64034.1|  hypothetical protein                                   103   2e-21   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010676762.1|  PREDICTED: transcription factor TGA4-like          102   3e-21   
ref|XP_011085128.1|  PREDICTED: transcription factor TGA5-like          102   3e-21   
gb|AAT64037.1|  predicted protein                                       100   8e-21   Gossypium hirsutum [American cotton]
ref|XP_002272378.1|  PREDICTED: transcription factor TGA5-like        99.0    4e-20   Vitis vinifera
ref|XP_008463763.1|  PREDICTED: transcription factor TGA5             97.4    1e-19   
ref|XP_010674364.1|  PREDICTED: transcription factor TGA6-like        98.2    2e-19   
ref|XP_003567594.2|  PREDICTED: uncharacterized protein LOC100833996  97.1    2e-19   
ref|XP_002273632.1|  PREDICTED: transcription factor TGA2             96.3    4e-19   Vitis vinifera
emb|CAB37450.1|  putative protein                                     95.9    4e-19   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003630355.1|  Transcription factor HBP-1b(c1)                  96.7    4e-19   
ref|NP_193600.2|  transcription factor-related protein                95.9    4e-19   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010253822.1|  PREDICTED: uncharacterized protein LOC104594963  97.8    5e-19   
ref|XP_004146086.1|  PREDICTED: transcription factor TGA5-like        95.5    5e-19   
ref|XP_010695960.1|  PREDICTED: LOW QUALITY PROTEIN: transcriptio...  95.5    7e-19   
ref|XP_004244373.1|  PREDICTED: transcription factor TGA5             94.7    9e-19   
ref|XP_006394098.1|  hypothetical protein EUTSA_v10005017mg           93.6    9e-19   
ref|XP_004503896.1|  PREDICTED: transcription factor HBP-1b(c38)-...  95.5    1e-18   
gb|KDP21107.1|  hypothetical protein JCGZ_21578                       94.4    2e-18   
ref|XP_007021794.1|  Uncharacterized protein TCM_031867               94.7    2e-18   
ref|XP_006348396.1|  PREDICTED: TGACG-sequence-specific DNA-bindi...  94.0    2e-18   
ref|XP_008386261.1|  PREDICTED: transcription factor TGA5-like        93.6    2e-18   
ref|XP_009618663.1|  PREDICTED: transcription factor TGA1-like        93.6    2e-18   
ref|XP_007212919.1|  hypothetical protein PRUPE_ppa022280mg           93.2    3e-18   
ref|XP_004289493.1|  PREDICTED: TGACG-sequence-specific DNA-bindi...  93.6    4e-18   
ref|XP_006380400.1|  hypothetical protein POPTR_0007s04840g           93.6    4e-18   
ref|XP_010052186.1|  PREDICTED: transcription factor HBP-1b(c38)      93.2    5e-18   
ref|XP_003547173.2|  PREDICTED: transcription factor TGA5-like        94.0    5e-18   
ref|XP_011022856.1|  PREDICTED: transcription factor TGA2-like        93.6    5e-18   
ref|XP_006830264.1|  hypothetical protein AMTR_s00130p00113960        92.8    6e-18   
ref|XP_010086637.1|  hypothetical protein L484_004349                 92.4    7e-18   
ref|XP_004288481.1|  PREDICTED: TGACG-sequence-specific DNA-bindi...  92.4    1e-17   
ref|XP_008655844.1|  PREDICTED: transcription factor TGA5-like        91.3    2e-17   
ref|XP_006414073.1|  hypothetical protein EUTSA_v10027388mg           91.3    2e-17   
ref|XP_002310543.2|  hypothetical protein POPTR_0007s04840g           91.7    2e-17   Populus trichocarpa [western balsam poplar]
ref|XP_003541699.1|  PREDICTED: transcription factor HBP-1b(c38)-...  91.3    2e-17   
ref|XP_010277052.1|  PREDICTED: transcription factor HBP-1b(c38)-...  90.9    3e-17   
ref|XP_009798761.1|  PREDICTED: transcription factor TGA5             90.5    3e-17   
ref|NP_001145406.1|  uncharacterized protein LOC100278763             90.1    4e-17   Zea mays [maize]
ref|XP_009132069.1|  PREDICTED: uncharacterized protein LOC103856700  90.1    4e-17   
ref|XP_002283108.1|  PREDICTED: transcription factor HBP-1b(c1)-like  90.1    5e-17   Vitis vinifera
emb|CAN72574.1|  hypothetical protein VITISV_036367                   89.4    8e-17   Vitis vinifera
gb|EYU26796.1|  hypothetical protein MIMGU_mgv1a026861mg              89.0    1e-16   
ref|XP_010439827.1|  PREDICTED: transcription factor TGA6-like        89.0    1e-16   
ref|XP_004967541.1|  PREDICTED: transcription factor PERIANTHIA-like  88.2    2e-16   
ref|XP_002266016.2|  PREDICTED: transcription factor TGA2             88.6    2e-16   Vitis vinifera
ref|XP_010276977.1|  PREDICTED: transcription factor TGA2             88.2    2e-16   
ref|XP_011101398.1|  PREDICTED: transcription factor TGA5-like        88.2    2e-16   
ref|XP_004486274.1|  PREDICTED: TGACG-sequence-specific DNA-bindi...  87.4    4e-16   
ref|XP_003524316.1|  PREDICTED: transcription factor TGA4-like        88.2    4e-16   
emb|CDX99446.1|  BnaC01g11060D                                        87.4    4e-16   
gb|KHN17404.1|  Transcription factor TGA4                             89.4    6e-16   
gb|KHG25856.1|  Transcription factor TGA1 -like protein               86.7    7e-16   
ref|XP_010543213.1|  PREDICTED: transcription factor TGA2-like        86.3    9e-16   
ref|XP_007159878.1|  hypothetical protein PHAVU_002G275400g           86.7    1e-15   
ref|XP_011100139.1|  PREDICTED: transcription factor TGA1-like        86.7    1e-15   
ref|XP_009395216.1|  PREDICTED: transcription factor TGA2-like        86.3    1e-15   
ref|XP_009594445.1|  PREDICTED: transcription factor TGA6-like        86.3    2e-15   
ref|XP_010274492.1|  PREDICTED: transcription factor TGA5-like        85.5    2e-15   
ref|XP_002537773.1|  conserved hypothetical protein                   85.5    2e-15   Ricinus communis
ref|XP_007214751.1|  hypothetical protein PRUPE_ppa024940mg           85.5    3e-15   
ref|XP_006345765.1|  PREDICTED: transcription factor TGA1-like        85.5    3e-15   
ref|XP_002867982.1|  hypothetical protein ARALYDRAFT_354881           84.7    3e-15   
ref|XP_006477767.1|  PREDICTED: transcription factor TGA1-like        84.7    4e-15   
gb|EYU20609.1|  hypothetical protein MIMGU_mgv1a010868mg              85.5    4e-15   
ref|XP_007213175.1|  hypothetical protein PRUPE_ppa027008mg           84.3    4e-15   
ref|XP_006442481.1|  hypothetical protein CICLE_v10022056mg           84.3    4e-15   
ref|XP_004293959.1|  PREDICTED: uncharacterized protein LOC101299272  84.3    5e-15   
gb|EYU23355.1|  hypothetical protein MIMGU_mgv1a023684mg              84.3    5e-15   
ref|XP_011085982.1|  PREDICTED: transcription factor HBP-1b(c38)-...  84.3    6e-15   
gb|EYU35712.1|  hypothetical protein MIMGU_mgv1a011847mg              84.3    6e-15   
ref|XP_008793320.1|  PREDICTED: transcription factor HBP-1b(c38)-...  84.3    7e-15   
ref|XP_010434503.1|  PREDICTED: transcription factor TGA6-like is...  83.6    8e-15   
ref|XP_006362387.1|  PREDICTED: transcription factor TGA4-like        83.2    8e-15   
ref|XP_008673985.1|  PREDICTED: transcription factor PERIANTHIA-like  83.2    9e-15   
ref|XP_009379553.1|  PREDICTED: transcription factor TGA6-like        84.0    9e-15   
ref|XP_008337157.1|  PREDICTED: transcription factor HBP-1b(c38)-...  84.0    1e-14   
ref|XP_003636790.1|  Transcription factor TGA5                        83.2    1e-14   
ref|XP_009757325.1|  PREDICTED: transcription factor TGA5-like        83.6    1e-14   
ref|XP_006285198.1|  hypothetical protein CARUB_v10006552mg           82.4    2e-14   
ref|XP_006384064.1|  hypothetical protein POPTR_0004s05690g           82.4    2e-14   
ref|XP_006414070.1|  hypothetical protein EUTSA_v10027258mg           82.8    2e-14   
emb|CDO96810.1|  unnamed protein product                              82.4    2e-14   
ref|XP_006370140.1|  DNA-binding family protein                       82.0    3e-14   
ref|XP_003596341.1|  Transcription factor TGA5                        81.6    3e-14   
gb|EYU23876.1|  hypothetical protein MIMGU_mgv11b017687mg             82.4    3e-14   
ref|XP_006582492.1|  PREDICTED: transcription factor HBP-1b(c38)-...  79.7    4e-14   
gb|EYU23360.1|  hypothetical protein MIMGU_mgv1a019261mg              82.4    4e-14   
ref|XP_004489078.1|  PREDICTED: transcription factor HBP-1b(c38)-...  81.3    4e-14   
ref|XP_009799260.1|  PREDICTED: transcription factor TGA6-like        82.0    4e-14   
emb|CBI30697.3|  unnamed protein product                              80.9    5e-14   
ref|XP_010062825.1|  PREDICTED: transcription factor HBP-1b(c38)-...  81.3    5e-14   
gb|KFK43297.1|  hypothetical protein AALP_AA1G105800                  79.3    5e-14   
ref|XP_008227573.1|  PREDICTED: transcription factor TGA2-like        81.6    6e-14   
ref|XP_009402767.1|  PREDICTED: TGACG-sequence-specific DNA-bindi...  81.3    6e-14   
ref|XP_011085984.1|  PREDICTED: transcription factor TGA5-like        82.0    7e-14   
ref|XP_009764515.1|  PREDICTED: transcription factor TGA6             80.5    8e-14   
ref|XP_010999748.1|  PREDICTED: transcription factor TGA6             80.9    8e-14   
ref|XP_010316825.1|  PREDICTED: transcription factor TGA6             80.1    9e-14   
ref|XP_004239641.1|  PREDICTED: transcription factor TGA6-like        80.9    9e-14   
ref|XP_010686461.1|  PREDICTED: transcription factor HBP-1b(c38)      80.5    1e-13   
ref|XP_002870027.1|  hypothetical protein ARALYDRAFT_492990           80.5    1e-13   
emb|CDO96811.1|  unnamed protein product                              80.1    1e-13   
ref|XP_008806140.1|  PREDICTED: transcription factor TGA7-like        80.5    2e-13   
dbj|BAA05470.1|  tumor-related protein                                80.5    2e-13   Nicotiana glauca x Nicotiana langsdorffii
ref|XP_011082768.1|  PREDICTED: transcription factor TGA1             79.7    2e-13   
gb|EEC71515.1|  hypothetical protein OsI_03809                        80.5    2e-13   Oryza sativa Indica Group [Indian rice]
gb|EYU43340.1|  hypothetical protein MIMGU_mgv1a020768mg              79.7    2e-13   
ref|XP_006467638.1|  PREDICTED: TGACG-sequence-specific DNA-bindi...  79.7    2e-13   
ref|XP_010920869.1|  PREDICTED: transcription factor TGA3-like        79.7    2e-13   
ref|XP_011007917.1|  PREDICTED: transcription factor HBP-1b(c38)      79.3    2e-13   
ref|XP_006285421.1|  hypothetical protein CARUB_v10006838mg           79.7    3e-13   
gb|AHA62826.1|  delay of germination 1 B                              79.3    3e-13   
ref|XP_003634633.1|  PREDICTED: transcription factor TGA4-like        79.0    4e-13   
emb|CDY66844.1|  BnaC07g50150D                                        79.0    5e-13   
ref|XP_008371485.1|  PREDICTED: TGACG-sequence-specific DNA-bindi...  78.2    5e-13   
ref|NP_193604.2|  uncharacterized protein                             78.6    6e-13   Arabidopsis thaliana [mouse-ear cress]
emb|CAB37454.1|  putative protein                                     80.1    6e-13   Arabidopsis thaliana [mouse-ear cress]
gb|KDO77874.1|  hypothetical protein CISIN_1g046619mg                 78.2    6e-13   
ref|XP_010920258.1|  PREDICTED: transcription factor TGA2             78.2    7e-13   
ref|XP_002985809.1|  hypothetical protein SELMODRAFT_123200           77.8    9e-13   
ref|XP_007148035.1|  hypothetical protein PHAVU_006G175000g           78.6    9e-13   
ref|XP_004156023.1|  PREDICTED: transcription factor TGA6-like        77.8    1e-12   
ref|XP_002984747.1|  hypothetical protein SELMODRAFT_181239           77.4    1e-12   
gb|KFK28539.1|  hypothetical protein AALP_AA7G009900                  77.8    1e-12   
ref|XP_010317335.1|  PREDICTED: transcription factor HBP-1b(c38)-...  77.4    1e-12   
ref|XP_010025725.1|  PREDICTED: transcription factor TGA2-like        77.8    1e-12   
ref|XP_007025355.1|  Delay of germination 1, putative                 79.3    1e-12   
gb|EYU45430.1|  hypothetical protein MIMGU_mgv1a012463mg              77.4    1e-12   
ref|XP_008442175.1|  PREDICTED: transcription factor TGA2-like is...  77.8    1e-12   
ref|XP_008443347.1|  PREDICTED: uncharacterized protein LOC103486954  77.8    1e-12   
gb|EPS63781.1|  hypothetical protein M569_11002                       78.6    2e-12   
ref|XP_008439732.1|  PREDICTED: transcription factor TGA5             77.0    2e-12   
ref|XP_002528014.1|  conserved hypothetical protein                   77.0    2e-12   Ricinus communis
emb|CDX97614.1|  BnaA05g24650D                                        76.6    2e-12   
ref|XP_003634664.1|  PREDICTED: transcription factor HBP-1b(c38)      76.3    2e-12   
ref|XP_008442174.1|  PREDICTED: transcription factor TGA2-like is...  77.0    2e-12   
ref|NP_001237999.1|  bZIP transcription factor bZIP132                76.3    2e-12   
ref|XP_010089698.1|  hypothetical protein L484_006320                 76.3    3e-12   
ref|XP_010449481.1|  PREDICTED: uncharacterized protein LOC104731707  76.6    3e-12   
ref|XP_009350852.1|  PREDICTED: transcription factor TGA6             76.3    3e-12   
ref|XP_002534284.1|  conserved hypothetical protein                   76.3    3e-12   Ricinus communis
ref|XP_006449514.1|  hypothetical protein CICLE_v10017869mg           75.9    3e-12   
gb|EYU23363.1|  hypothetical protein MIMGU_mgv1a023034mg              76.6    3e-12   
ref|XP_009789761.1|  PREDICTED: transcription factor TGA2-like        75.9    3e-12   
gb|ACV41800.1|  delay of germination 1                                75.9    5e-12   Lepidium sativum
gb|AGG09198.1|  delay of germination 1a                               75.9    5e-12   
ref|XP_009607760.1|  PREDICTED: transcription factor TGA6-like        75.5    6e-12   
gb|EPS72055.1|  hypothetical protein M569_02704                       73.9    6e-12   
ref|XP_006432080.1|  hypothetical protein CICLE_v10002078mg           75.9    6e-12   
ref|XP_007048544.1|  TGACG-sequence-specific DNA-binding protein ...  75.1    6e-12   
gb|EPS65159.1|  hypothetical protein M569_09619                       76.6    7e-12   
ref|XP_009629955.1|  PREDICTED: transcription factor TGA1-like        74.7    7e-12   
ref|XP_006414069.1|  hypothetical protein EUTSA_v10025925mg           75.5    7e-12   
ref|XP_010439824.1|  PREDICTED: uncharacterized protein LOC104723191  75.1    8e-12   
emb|CDY70293.1|  BnaCnng67640D                                        74.7    8e-12   
ref|XP_010313918.1|  PREDICTED: transcription factor TGA5-like        74.7    9e-12   
ref|XP_009136952.1|  PREDICTED: uncharacterized protein LOC103861007  75.1    9e-12   
gb|KFK28541.1|  hypothetical protein AALP_AA7G010100                  74.7    9e-12   
gb|EYU45030.1|  hypothetical protein MIMGU_mgv1a018123mg              77.0    1e-11   
ref|XP_006643777.1|  PREDICTED: transcription factor TGA6-like        74.7    1e-11   
gb|KFK28536.1|  hypothetical protein AALP_AA7G009500                  73.9    1e-11   
emb|CDY70896.1|  BnaCnng70220D                                        74.3    1e-11   
ref|XP_009613589.1|  PREDICTED: transcription factor TGA6             73.9    1e-11   
ref|XP_010093103.1|  hypothetical protein L484_007912                 74.7    1e-11   
ref|XP_009792613.1|  PREDICTED: transcription factor TGA6-like        74.3    1e-11   
ref|XP_009589153.1|  PREDICTED: TGACG-sequence-specific DNA-bindi...  74.3    1e-11   
gb|KFK31508.1|  hypothetical protein AALP_AA6G121700                  74.3    1e-11   
gb|AAD34570.1|AF143442_1  NPR1-interactor protein 1                   73.9    2e-11   Solanum lycopersicum
gb|KFK28540.1|  hypothetical protein AALP_AA7G010000                  74.3    2e-11   
ref|XP_010089699.1|  hypothetical protein L484_006321                 73.6    2e-11   
emb|CDX76507.1|  BnaA08g08930D                                        73.6    2e-11   
ref|NP_001118628.1|  uncharacterized protein                          73.6    2e-11   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011101404.1|  PREDICTED: transcription factor TGA6-like        73.6    2e-11   
ref|XP_004161213.1|  PREDICTED: uncharacterized LOC101207776          73.9    3e-11   
ref|XP_004293958.1|  PREDICTED: TGACG-sequence-specific DNA-bindi...  73.2    3e-11   
dbj|BAJ05339.1|  hypothetical protein                                 73.2    3e-11   
emb|CDM81542.1|  unnamed protein product                              73.2    3e-11   
ref|XP_010497839.1|  PREDICTED: uncharacterized protein LOC104775530  70.5    3e-11   
gb|KHN08426.1|  TGACG-sequence-specific DNA-binding protein TGA-2.1   72.4    4e-11   
ref|XP_010552125.1|  PREDICTED: transcription factor TGA7             72.8    4e-11   
ref|XP_004134926.1|  PREDICTED: transcription factor TGA1-like        73.2    4e-11   
ref|XP_004150221.1|  PREDICTED: uncharacterized protein LOC101207776  73.6    4e-11   
ref|XP_009405272.1|  PREDICTED: transcription factor HBP-1b(c1)-like  72.4    4e-11   
ref|XP_011098215.1|  PREDICTED: transcription factor TGA6-like        72.8    4e-11   
ref|XP_010434499.1|  PREDICTED: uncharacterized protein LOC104718445  72.8    6e-11   
emb|CDY61468.1|  BnaCnng37860D                                        72.4    7e-11   
gb|KHN36891.1|  Transcription factor TGA1                             71.2    7e-11   
emb|CDM84316.1|  unnamed protein product                              72.8    8e-11   
dbj|BAO79416.1|  wheat delay of dormancy 1                            72.4    8e-11   
ref|XP_009146508.1|  PREDICTED: uncharacterized protein LOC103870151  71.6    8e-11   
ref|XP_011081582.1|  PREDICTED: transcription factor HBP-1b(c38)-...  71.6    9e-11   
ref|XP_004249310.1|  PREDICTED: TGACG-sequence-specific DNA-bindi...  73.6    1e-10   
ref|XP_010316820.1|  PREDICTED: transcription factor HBP-1b(c38)-...  71.6    1e-10   
ref|XP_006351371.1|  PREDICTED: TGACG-sequence-specific DNA-bindi...  73.6    1e-10   
ref|XP_009114387.1|  PREDICTED: TGACG-sequence-specific DNA-bindi...  72.0    1e-10   
ref|XP_009383925.1|  PREDICTED: transcription factor HBP-1b(c38)-...  70.9    1e-10   
gb|EPS59924.1|  hypothetical protein M569_14883                       70.1    1e-10   
gb|ACG36725.1|  tumor-related protein                                 72.0    1e-10   
ref|XP_011101452.1|  PREDICTED: transcription factor TGA5-like        71.2    1e-10   
emb|CDY52216.1|  BnaAnng11390D                                        71.6    1e-10   
ref|XP_006398268.1|  hypothetical protein EUTSA_v10001138mg           71.6    1e-10   
ref|XP_004234088.1|  PREDICTED: transcription factor TGA6-like        71.2    1e-10   
ref|XP_007159877.1|  hypothetical protein PHAVU_002G275400g           70.1    2e-10   
gb|EPS71747.1|  hypothetical protein M569_03008                       71.2    2e-10   
ref|XP_006593493.1|  PREDICTED: bZIP transcription factor bZIP132...  70.9    2e-10   
ref|XP_002863451.1|  hypothetical protein ARALYDRAFT_330831           71.2    2e-10   
ref|XP_010922993.1|  PREDICTED: uncharacterized protein LOC105046169  72.8    2e-10   
ref|XP_008651323.1|  PREDICTED: uncharacterized protein LOC100279...  71.6    2e-10   
ref|XP_011075022.1|  PREDICTED: transcription factor TGA5-like        70.5    2e-10   
gb|KFK22875.1|  hypothetical protein AALP_AAs39777U000200             70.9    3e-10   
gb|AJE25535.1|  DOG1-like protein                                     70.9    3e-10   
ref|XP_008651325.1|  PREDICTED: uncharacterized protein LOC100279...  71.2    3e-10   
ref|XP_011082770.1|  PREDICTED: transcription factor HBP-1b(c38)-...  71.6    3e-10   
ref|XP_008651314.1|  PREDICTED: uncharacterized protein LOC100279...  71.6    3e-10   
ref|XP_008651321.1|  PREDICTED: uncharacterized protein LOC100279...  71.2    3e-10   
ref|XP_008651318.1|  PREDICTED: uncharacterized protein LOC100279...  71.2    3e-10   
gb|ABP88233.1|  transcription factor bZIP98                           70.9    3e-10   
ref|XP_010487302.1|  PREDICTED: transcription factor HBP-1b(c38)-...  69.7    4e-10   
gb|ACV53508.1|  leucine zipper transcription factor TGA               72.0    4e-10   
ref|XP_006659885.1|  PREDICTED: transcription factor TGA4-like        71.2    4e-10   
ref|XP_006594375.1|  PREDICTED: transcription factor HBP-1b(c1) i...  72.0    4e-10   
ref|XP_008651324.1|  PREDICTED: uncharacterized protein LOC100279...  70.9    4e-10   
gb|KHN37699.1|  Transcription factor HBP-1b(c1)                       71.6    4e-10   
ref|XP_006288172.1|  hypothetical protein CARUB_v10001409mg           70.9    4e-10   
gb|ACV41802.1|  delay of germination 1                                69.7    4e-10   
emb|CDY58051.1|  BnaA06g40200D                                        70.1    4e-10   
ref|NP_188106.2|  uncharacterized protein                             69.7    4e-10   
emb|CDY23102.1|  BnaC09g18560D                                        70.1    5e-10   
ref|NP_001237963.1|  bZIP transcription factor bZIP99                 71.6    5e-10   
ref|XP_010465409.1|  PREDICTED: transcription factor HBP-1b(c38)-...  69.3    5e-10   
ref|XP_008788486.1|  PREDICTED: transcription factor HBP-1b(c38)-...  71.6    5e-10   
ref|XP_006281774.1|  hypothetical protein CARUB_v10027949mg           70.1    5e-10   
gb|KDP21106.1|  hypothetical protein JCGZ_21577                       68.9    5e-10   
ref|XP_008788487.1|  PREDICTED: transcription factor HBP-1b(c38)-...  71.2    5e-10   
ref|XP_006598094.1|  PREDICTED: transcription factor HBP-1b(c1) i...  71.6    5e-10   
ref|XP_002975942.1|  hypothetical protein SELMODRAFT_232668           70.1    5e-10   
ref|XP_009101563.1|  PREDICTED: transcription factor HBP-1b(c38)      69.7    6e-10   
ref|XP_009599896.1|  PREDICTED: transcription factor TGA3-like        69.3    6e-10   
ref|XP_002968543.1|  hypothetical protein SELMODRAFT_231160           69.7    6e-10   
ref|XP_002970901.1|  hypothetical protein SELMODRAFT_231689           70.1    7e-10   
gb|KHN29100.1|  Transcription factor TGA4                             68.6    7e-10   
ref|XP_003546706.1|  PREDICTED: transcription factor HBP-1b(c1) i...  70.9    7e-10   
ref|XP_010502264.1|  PREDICTED: transcription factor HBP-1b(c38)-...  68.6    8e-10   
dbj|BAB17733.1|  putative transcription factor HBP-1b - wheat         68.9    9e-10   
ref|XP_010316826.1|  PREDICTED: transcription factor TGA5-like        69.3    9e-10   
ref|XP_002871243.1|  ocs-element binding factor 5                     69.7    9e-10   
ref|XP_011097086.1|  PREDICTED: transcription factor TGA2-like        69.3    9e-10   
ref|XP_010494735.1|  PREDICTED: TGACG-sequence-specific DNA-bindi...  69.3    9e-10   
ref|XP_008651313.1|  PREDICTED: uncharacterized protein LOC100279...  70.5    9e-10   
ref|XP_009762839.1|  PREDICTED: transcription factor HBP-1b(c38)-...  68.6    1e-09   
ref|XP_002969636.1|  hypothetical protein SELMODRAFT_231344           69.3    1e-09   
ref|XP_006407035.1|  hypothetical protein EUTSA_v10022387mg           68.2    1e-09   
ref|XP_009759888.1|  PREDICTED: TGACG-sequence-specific DNA-bindi...  70.1    1e-09   
emb|CDP10926.1|  unnamed protein product                              69.3    1e-09   
ref|XP_010557921.1|  PREDICTED: transcription factor TGA6             69.3    1e-09   
gb|KDP35207.1|  hypothetical protein JCGZ_09366                       69.7    1e-09   
ref|XP_007133721.1|  hypothetical protein PHAVU_011G203400g           70.1    2e-09   
ref|XP_006358130.1|  PREDICTED: transcription factor TGA1-like        68.6    2e-09   
ref|XP_008786824.1|  PREDICTED: transcription factor TGA2-like is...  69.7    2e-09   
ref|XP_009792490.1|  PREDICTED: uncharacterized protein LOC104239538  67.8    2e-09   
tpg|DAA57189.1|  TPA: LOW QUALITY PROTEIN: putative bZIP transcri...  68.9    2e-09   
dbj|BAB09311.1|  tumor-related protein-like                           68.2    2e-09   
ref|XP_001770560.1|  predicted protein                                68.9    2e-09   
ref|XP_008786823.1|  PREDICTED: transcription factor TGA2-like is...  69.7    2e-09   
ref|XP_009789465.1|  PREDICTED: uncharacterized protein LOC104237085  68.2    2e-09   
gb|AGI17587.1|  transcription factor TGA2                             69.7    2e-09   
ref|NP_001105735.1|  LOC542756                                        68.9    2e-09   
gb|ABK81207.1|  DOG1 alpha splice variant                             68.2    2e-09   
ref|XP_010904691.1|  PREDICTED: transcription factor HBP-1b(c38)-...  69.3    2e-09   
gb|AGG09199.1|  delay of germination 1c                               68.2    2e-09   
gb|EEC70410.1|  hypothetical protein OsI_01405                        68.9    2e-09   
ref|XP_009594430.1|  PREDICTED: transcription factor TGA1-like        68.9    2e-09   
gb|KDP34795.1|  hypothetical protein JCGZ_10575                       67.0    2e-09   
gb|EEE54337.1|  hypothetical protein OsJ_01313                        68.9    2e-09   
ref|XP_011097899.1|  PREDICTED: transcription factor TGA4 isoform X2  68.9    2e-09   
gb|ACF80806.1|  unknown                                               68.9    2e-09   
ref|XP_011097907.1|  PREDICTED: transcription factor TGA1 isoform X3  68.9    3e-09   
ref|XP_011097893.1|  PREDICTED: transcription factor TGA4 isoform X1  68.9    3e-09   
gb|EYU43338.1|  hypothetical protein MIMGU_mgv1a023322mg              67.4    3e-09   
ref|XP_010904690.1|  PREDICTED: transcription factor HBP-1b(c38)-...  69.3    3e-09   
ref|XP_003531372.1|  PREDICTED: transcription factor TGA1-like is...  68.6    3e-09   
ref|XP_006585296.1|  PREDICTED: transcription factor TGA1-like is...  68.6    3e-09   
ref|XP_006585301.1|  PREDICTED: transcription factor TGA1-like is...  68.6    3e-09   
ref|XP_006827054.1|  hypothetical protein AMTR_s00010p00231750        68.6    3e-09   
ref|NP_001042751.1|  Os01g0279900                                     68.2    3e-09   
ref|XP_007149576.1|  hypothetical protein PHAVU_005G081900g           66.6    3e-09   
gb|ABK81208.1|  DOG1 alpha splice variant                             67.4    4e-09   
ref|XP_010922090.1|  PREDICTED: transcription factor HBP-1b(c38)-...  68.9    4e-09   
gb|KDO58848.1|  hypothetical protein CISIN_1g0457862mg                66.2    4e-09   
gb|ABK81209.1|  DOG1 alpha splice variant                             67.4    4e-09   
ref|NP_193603.1|  uncharacterized protein                             66.6    4e-09   
ref|XP_010520066.1|  PREDICTED: transcription factor TGA6-like is...  67.8    4e-09   
ref|XP_010067716.1|  PREDICTED: transcription factor TGA2             67.8    4e-09   
gb|ACF79461.1|  unknown                                               68.6    4e-09   
gb|ABK81211.1|  DOG1 alpha splice variant                             67.4    5e-09   
ref|XP_008225304.1|  PREDICTED: TGACG-sequence-specific DNA-bindi...  66.6    5e-09   
ref|XP_010487301.1|  PREDICTED: transcription factor HBP-1b(c38)-...  66.6    5e-09   
ref|XP_009125669.1|  PREDICTED: transcription factor TGA5             67.8    5e-09   
gb|AJE25537.1|  DOG1-like protein                                     67.0    5e-09   
ref|XP_010230791.1|  PREDICTED: transcription factor HBP-1b(c38)      67.8    5e-09   
ref|XP_009146628.1|  PREDICTED: transcription factor TGA6 isoform X2  67.4    5e-09   
ref|XP_006299748.1|  hypothetical protein CARUB_v10015943mg           67.0    5e-09   
ref|XP_006354049.1|  PREDICTED: transcription factor TGA1-like is...  67.8    6e-09   
ref|XP_010269124.1|  PREDICTED: transcription factor TGA1-like is...  68.2    6e-09   
ref|XP_009776929.1|  PREDICTED: transcription factor TGA1-like        67.8    6e-09   
dbj|BAF00554.1|  tumor-related protein-like                           66.6    6e-09   
ref|XP_008801024.1|  PREDICTED: transcription factor TGA4-like is...  67.4    6e-09   
emb|CDY05010.1|  BnaAnng01920D                                        67.4    6e-09   
ref|XP_004970302.1|  PREDICTED: transcription factor HBP-1b(c1)-l...  68.2    6e-09   
ref|XP_008801019.1|  PREDICTED: transcription factor HBP-1b(c38)-...  67.8    6e-09   
ref|XP_006354048.1|  PREDICTED: transcription factor TGA1-like is...  67.8    6e-09   
ref|XP_008801023.1|  PREDICTED: transcription factor HBP-1b(c38)-...  67.8    6e-09   
ref|XP_010465408.1|  PREDICTED: transcription factor HBP-1b(c38)-...  66.2    6e-09   
ref|XP_010534328.1|  PREDICTED: transcription factor TGA6-like is...  67.4    6e-09   
ref|XP_008801022.1|  PREDICTED: transcription factor TGA1-like is...  67.8    6e-09   
ref|XP_010534337.1|  PREDICTED: transcription factor TGA6-like is...  67.4    6e-09   
ref|XP_008801018.1|  PREDICTED: transcription factor TGA4-like is...  67.8    6e-09   
ref|XP_007159742.1|  hypothetical protein PHAVU_002G263400g           67.8    6e-09   
ref|XP_011090575.1|  PREDICTED: transcription factor TGA1-like        67.8    6e-09   
ref|XP_008801021.1|  PREDICTED: transcription factor TGA4-like is...  67.8    6e-09   
ref|XP_003562427.1|  PREDICTED: transcription factor HBP-1b(c38)      67.4    6e-09   
ref|XP_002870028.1|  hypothetical protein ARALYDRAFT_492991           65.9    6e-09   
gb|EAY72627.1|  hypothetical protein OsI_00493                        66.6    6e-09   
ref|NP_196313.1|  OCS-element binding factor 5                        67.4    7e-09   
ref|XP_006644874.1|  PREDICTED: transcription factor HBP-1b(c1)-like  67.4    7e-09   
emb|CDY14061.1|  BnaC02g01780D                                        67.0    7e-09   
ref|XP_010269125.1|  PREDICTED: transcription factor TGA1-like is...  67.4    7e-09   
ref|XP_010519876.1|  PREDICTED: transcription factor TGA1-like is...  67.4    7e-09   
ref|XP_009619619.1|  PREDICTED: transcription factor TGA2-like        65.9    7e-09   
emb|CAA49525.1|  ocs-element binding factor 5                         67.0    7e-09   
ref|XP_003560850.1|  PREDICTED: transcription factor HBP-1b(c38)-...  66.6    8e-09   
ref|XP_006580295.1|  PREDICTED: transcription factor TGA1-like is...  67.4    8e-09   
ref|XP_004237865.1|  PREDICTED: transcription factor TGA1-like is...  67.4    8e-09   
gb|ABK81206.1|  DOG1 alpha splice variant                             66.6    8e-09   
ref|NP_001042081.1|  Os01g0159000                                     66.2    8e-09   
ref|XP_010519867.1|  PREDICTED: transcription factor TGA1-like is...  67.4    8e-09   
ref|NP_199395.2|  protein DELAY OF GERMINATION 1                      66.6    8e-09   
ref|XP_002980439.1|  hypothetical protein SELMODRAFT_112221           65.5    9e-09   
ref|XP_010320138.1|  PREDICTED: transcription factor TGA4-like is...  67.0    9e-09   
ref|XP_009401076.1|  PREDICTED: transcription factor TGA1-like is...  67.0    9e-09   
ref|XP_009588814.1|  PREDICTED: transcription factor TGA1             67.0    9e-09   
ref|XP_009401075.1|  PREDICTED: transcription factor TGA4-like is...  67.0    9e-09   
ref|XP_010519853.1|  PREDICTED: transcription factor TGA1-like is...  67.4    9e-09   
gb|ADW40546.1|  bZIP transcription factor                             66.6    1e-08   
ref|XP_010519860.1|  PREDICTED: transcription factor TGA1-like is...  67.0    1e-08   
ref|XP_009146627.1|  PREDICTED: transcription factor TGA6 isoform X1  66.6    1e-08   
gb|AHF20186.1|  transcription factor tga1                             67.0    1e-08   
ref|XP_004511049.1|  PREDICTED: TGACG-sequence-specific DNA-bindi...  67.4    1e-08   
ref|XP_010502256.1|  PREDICTED: transcription factor HBP-1b(c38)-...  65.5    1e-08   
ref|XP_006300241.1|  hypothetical protein CARUB_v10016481mg           65.5    1e-08   
ref|XP_010546397.1|  PREDICTED: transcription factor TGA1             67.0    1e-08   
gb|EYU28097.1|  hypothetical protein MIMGU_mgv1a017794mg              65.1    1e-08   
ref|XP_002456383.1|  hypothetical protein SORBIDRAFT_03g035150        66.2    1e-08   
dbj|BAJ95134.1|  predicted protein                                    66.2    1e-08   
ref|XP_008347016.1|  PREDICTED: transcription factor TGA2-like        65.1    2e-08   
ref|XP_002882899.1|  hypothetical protein ARALYDRAFT_341612           65.1    2e-08   
ref|XP_010905948.1|  PREDICTED: transcription factor TGA4-like is...  66.6    2e-08   
ref|XP_004976975.1|  PREDICTED: transcription factor TGA4-like is...  66.2    2e-08   
ref|XP_010423270.1|  PREDICTED: transcription factor TGA2             65.9    2e-08   
ref|XP_002306337.1|  TGA-type basic leucine zipper protein TGA1.1     66.2    2e-08   
ref|XP_010498795.1|  PREDICTED: transcription factor TGA6-like is...  65.5    2e-08   
emb|CDP09298.1|  unnamed protein product                              65.9    2e-08   
gb|EMT22752.1|  hypothetical protein F775_12222                       65.5    2e-08   
ref|XP_006644064.1|  PREDICTED: transcription factor HBP-1b(c38)-...  65.9    2e-08   
dbj|BAO45899.1|  basic leucine zipper protein                         66.6    2e-08   
ref|XP_010498804.1|  PREDICTED: transcription factor TGA6-like is...  65.9    2e-08   
ref|XP_004976974.1|  PREDICTED: transcription factor TGA4-like is...  66.2    2e-08   
ref|XP_010491292.1|  PREDICTED: transcription factor TGA5             65.9    2e-08   
dbj|BAB72064.1|  bZIP transcription factor                            65.9    2e-08   
ref|XP_010905949.1|  PREDICTED: transcription factor TGA4-like is...  66.2    2e-08   
gb|AFK48734.1|  unknown                                               64.3    2e-08   
ref|XP_010464986.1|  PREDICTED: transcription factor TGA6 isoform X4  65.5    2e-08   
ref|XP_010274491.1|  PREDICTED: uncharacterized protein LOC104609805  66.6    2e-08   
gb|AEF30410.1|  putative TGA2-like protein 2                          65.9    2e-08   
gb|EEC71673.1|  hypothetical protein OsI_04142                        66.2    2e-08   
ref|XP_002458658.1|  hypothetical protein SORBIDRAFT_03g037560        66.2    2e-08   
ref|XP_008661337.1|  PREDICTED: uncharacterized protein LOC100192...  66.2    2e-08   
gb|AAT28675.1|  bZIP transcription factor                             66.2    2e-08   
ref|XP_010502248.1|  PREDICTED: transcription factor HBP-1b(c38)-...  64.3    2e-08   
gb|AFK49199.1|  unknown                                               63.9    2e-08   
ref|XP_002882771.1|  hypothetical protein ARALYDRAFT_478587           65.9    2e-08   
ref|XP_008661340.1|  PREDICTED: uncharacterized protein LOC100192...  65.9    2e-08   
ref|XP_006465763.1|  PREDICTED: transcription factor TGA6-like is...  65.5    2e-08   
ref|XP_010486922.1|  PREDICTED: transcription factor TGA6 isoform X3  65.9    3e-08   
ref|XP_006432426.1|  hypothetical protein CICLE_v100010812mg          65.5    3e-08   
ref|XP_003564436.1|  PREDICTED: transcription factor HBP-1b(c1)       66.2    3e-08   
ref|XP_010464987.1|  PREDICTED: transcription factor TGA6 isoform X5  65.5    3e-08   
ref|NP_974293.1|  transcription factor TGA6                           65.5    3e-08   
ref|NP_001030678.1|  transcription factor TGA6                        65.5    3e-08   
ref|XP_006288178.1|  hypothetical protein CARUB_v10001413mg           65.5    3e-08   
ref|XP_002513852.1|  Transcription factor TGA7, putative              65.5    3e-08   
dbj|BAB03134.1|  leucine zipper transcription factor HBP-1b           65.1    3e-08   
tpg|DAA57191.1|  TPA: putative bZIP transcription factor superfam...  63.5    3e-08   
ref|XP_010498764.1|  PREDICTED: transcription factor TGA6-like is...  65.5    3e-08   
ref|XP_002263159.2|  PREDICTED: transcription factor TGA2 isoform X2  65.9    3e-08   
ref|XP_011020430.1|  PREDICTED: transcription factor TGA2-like is...  65.9    3e-08   
ref|XP_010659087.1|  PREDICTED: transcription factor TGA2 isoform X1  65.9    3e-08   
gb|EYU43565.1|  hypothetical protein MIMGU_mgv1a019798mg              65.1    3e-08   
sp|P23923.1|HBP1B_WHEAT  RecName: Full=Transcription factor HBP-1...  65.1    3e-08   
gb|ABR46126.1|  bZIP transcription factor TGA2                        65.1    3e-08   
ref|NP_001078141.1|  transcription factor TGA6                        64.7    3e-08   
gb|KDP32726.1|  hypothetical protein JCGZ_12018                       65.1    3e-08   
gb|EEC82717.1|  hypothetical protein OsI_27401                        65.1    3e-08   
ref|XP_011097615.1|  PREDICTED: TGACG-sequence-specific DNA-bindi...  65.5    3e-08   
ref|NP_001130903.1|  putative bZIP transcription factor superfami...  65.5    3e-08   
ref|XP_001779430.1|  predicted protein                                65.1    3e-08   
ref|XP_011097617.1|  PREDICTED: TGACG-sequence-specific DNA-bindi...  65.1    4e-08   
ref|XP_006399172.1|  hypothetical protein EUTSA_v10014082mg           65.1    4e-08   
ref|XP_007218367.1|  hypothetical protein PRUPE_ppa011185mg           63.5    4e-08   
ref|XP_002310607.2|  hypothetical protein POPTR_0007s06710g           63.5    4e-08   
ref|XP_011097616.1|  PREDICTED: TGACG-sequence-specific DNA-bindi...  65.1    4e-08   
ref|XP_010464983.1|  PREDICTED: transcription factor TGA6 isoform X2  65.1    4e-08   
gb|EAZ11603.1|  hypothetical protein OsJ_01467                        63.2    4e-08   
ref|XP_009386887.1|  PREDICTED: transcription factor TGA4-like is...  65.5    4e-08   
gb|AFW84811.1|  putative bZIP transcription factor superfamily pr...  64.3    4e-08   



>gb|EYU36422.1| hypothetical protein MIMGU_mgv1a025661mg [Erythranthe guttata]
Length=236

 Score =   200 bits (508),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 106/221 (48%), Positives = 153/221 (69%), Gaps = 1/221 (0%)
 Frame = -1

Query  942  DFTAFYHGWLMNQDAIFEQLESFLaaaaaaddDREQCGGLVGRVLAHYQeyyaektkaae  763
            +FT+F+  WL  Q+A   QLE+ L+ A   D +RE C  ++ RV +HYQE Y EK   A 
Sbjct  6    NFTSFFDSWLTRQEAFLRQLEALLSPADGFDRNRE-CAAIIPRVFSHYQEMYMEKAALAG  64

Query  762  EDVFVFFASPWMSRLEQSFLWLSGFKPSMLFWVVESSMEGALSEEQRCKVGMLRAETARV  583
            EDVF+  ++PW+S  E++ +W+SGF+PSMLF ++E+++   LS+EQ+ ++  ++AE  R 
Sbjct  65   EDVFLLMSAPWLSSFERTLVWISGFRPSMLFPMIETAVAEDLSDEQKREIEGVKAEIRRK  124

Query  582  ENAISKAMASAQETVAAPPILGLLKRAEELVDGEVSELDAVMGDLKQSMGRLMGNADALR  403
            E  I++ MA  QETVA PP+ GL+K+   LVDGE +EL+A M +LK +M  ++GNAD LR
Sbjct  125  EREINQKMARVQETVAEPPLCGLVKKFGRLVDGETTELEAAMVELKAAMLVVVGNADELR  184

Query  402  GSTASKILEILNPKQAVKFLTAVMRFQREARRWGLYNDSQR  280
            G TA+ ++ ILNP Q VKF  AV RFQ +AR+WG+  D QR
Sbjct  185  GWTAAAVVGILNPVQGVKFFAAVARFQLQARKWGVEKDRQR  225



>ref|XP_011074300.1| PREDICTED: transcription factor TGA1 [Sesamum indicum]
Length=274

 Score =   193 bits (491),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 102/221 (46%), Positives = 150/221 (68%), Gaps = 8/221 (4%)
 Frame = -1

Query  939  FTAFYHGWLMNQDAIFEQLESFLaaaaaaddDREQCGGLVGRVLAHYQeyyaektkaaeE  760
            FT+F+  WL  Q+A   QLE+             +C  ++ +V +HYQE Y EK++AA  
Sbjct  50   FTSFFERWLSRQEAFLRQLETL--------HRHRECSEIIPQVFSHYQELYREKSRAAHA  101

Query  759  DVFVFFASPWMSRLEQSFLWLSGFKPSMLFWVVESSMEGALSEEQRCKVGMLRAETARVE  580
            DVF+  ++PW++  E+S LW+SGF+PS+LF ++ +S+ G LS EQR ++  ++AET R E
Sbjct  102  DVFLLLSAPWLTSFERSMLWISGFRPSILFPILVNSVGGELSAEQRQRIEAVKAETRRKE  161

Query  579  NAISKAMASAQETVAAPPILGLLKRAEELVDGEVSELDAVMGDLKQSMGRLMGNADALRG  400
              I++AMA  QETVA  P+  L+++  +LVDGEV+E D  M  LK +M  ++ NADAL+G
Sbjct  162  REITQAMARVQETVAEQPLYSLMRKFGKLVDGEVTEFDTSMDRLKAAMLVVVENADALQG  221

Query  399  STASKILEILNPKQAVKFLTAVMRFQREARRWGLYNDSQRE  277
             TA +++EIL+P Q VKFL AV RFQ ++RRWG+  DS+RE
Sbjct  222  WTAVEVVEILSPVQGVKFLAAVARFQLQSRRWGVEKDSERE  262



>ref|XP_010104546.1| hypothetical protein L484_025521 [Morus notabilis]
 gb|EXC01147.1| hypothetical protein L484_025521 [Morus notabilis]
Length=235

 Score =   177 bits (449),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 101/221 (46%), Positives = 143/221 (65%), Gaps = 1/221 (0%)
 Frame = -1

Query  939  FTAFYHGWLMNQDAIFEQLESFLaaaaaaddDREQCGGLVGRVLAHYQeyyaektkaaeE  760
            F AFY  WL  Q AI  QL    A  A  D+D E+   L+ + L+HYQ Y+ E+   A +
Sbjct  13   FEAFYEEWLAGQQAILNQLLLVAAETAEKDNDCERRRSLIEQSLSHYQRYFEERNDIASD  72

Query  759  DVFVFFASPWMSRLEQSFLWLSGFKPSMLFWVVESSMEGALSEEQRCKVGMLRAETARVE  580
            DVFV F+SPW+S LE+++LW++G++P+++  +VES +   LS EQ  ++  L+AE  R+E
Sbjct  73   DVFVVFSSPWLSSLERAYLWIAGYRPTLILRLVESGV-ADLSPEQARRMDRLKAEAVRLE  131

Query  579  NAISKAMASAQETVAAPPILGLLKRAEELVDGEVSELDAVMGDLKQSMGRLMGNADALRG  400
              +S+AMA+ QE+VAA P++ L+ R    VDGEVS +D  M  L+  M  ++ +ADALRG
Sbjct  132  QEVSEAMAAVQESVAARPLVALVSRMGRAVDGEVSAIDVAMDRLRAEMVGVLESADALRG  191

Query  399  STASKILEILNPKQAVKFLTAVMRFQREARRWGLYNDSQRE  277
            ST  + +E+L+P QAVKFL A   FQ   RRWG   DS RE
Sbjct  192  STMRRAIEVLSPAQAVKFLVAAAEFQLRIRRWGQQRDSNRE  232



>ref|XP_008444975.1| PREDICTED: transcription factor TGA4 [Cucumis melo]
Length=237

 Score =   176 bits (446),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 99/224 (44%), Positives = 145/224 (65%), Gaps = 4/224 (2%)
 Frame = -1

Query  951  VGEDFTAFYHGWLMNQDAIFEQLESFLaaaaaaddDREQCGGLVGRVLAHYQeyyaektk  772
            V E+F  FY  WL  Q ++ EQL   L  +   D   E+  GL+ +VLAHYQ Y+ E +K
Sbjct  14   VIENFADFYESWLTTQRSLLEQL---LHVSQITDYKEERQLGLIKQVLAHYQLYHEEISK  70

Query  771  aaeEDVFVFFASPWMSRLEQSFLWLSGFKPSMLFWVVESSMEGALSEEQRCKVGMLRAET  592
            A  EDVF  F++PW++  E++ LW+SGFKPS++F +V+S+++  L+  Q   +  L+A+ 
Sbjct  71   AVSEDVFRTFSAPWLTSYERTLLWISGFKPSIVFRLVDSAVKD-LTPAQAASLEELKADV  129

Query  591  ARVENAISKAMASAQETVAAPPILGLLKRAEELVDGEVSELDAVMGDLKQSMGRLMGNAD  412
             R E  +++AMAS QETVAAPP++GL +RA  LVDGE+ E+   + +LK  M  +  +AD
Sbjct  130  KRKERDLTEAMASLQETVAAPPLVGLARRAGRLVDGEICEMKNAIEELKIGMLGVFYSAD  189

Query  411  ALRGSTASKILEILNPKQAVKFLTAVMRFQREARRWGLYNDSQR  280
             LRGST  +++EIL   Q ++ L A   FQ+  RRWG+  DSQR
Sbjct  190  LLRGSTMKRVMEILKTDQTLRPLAAATEFQQRIRRWGIQRDSQR  233



>ref|XP_008366197.1| PREDICTED: transcription factor TGA5-like [Malus domestica]
Length=229

 Score =   176 bits (445),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 106/222 (48%), Positives = 145/222 (65%), Gaps = 4/222 (2%)
 Frame = -1

Query  945  EDFTAFYHGWLMNQDAIFEQLESFLaaaa-aaddDREQCGGLVGRVLAHYQeyyaektka  769
            E F  F  GWL  Q    +QL   + +      D RE+   L+ +VL+HYQ+Y+AEK + 
Sbjct  9    ERFVKFLGGWLDRQQTFLDQLLKLVESPDYENKDARER--NLIEQVLSHYQQYFAEKART  66

Query  768  aeEDVFVFFASPWMSRLEQSFLWLSGFKPSMLFWVVESSMEGALSEEQRCKVGMLRAETA  589
            AEEDVFV F+ PW+S  E+S LWL+GFKPSM+  +V+SS+E  L+ EQ  ++  ++ ET 
Sbjct  67   AEEDVFVLFSPPWLSSFERSLLWLAGFKPSMVLRMVDSSVED-LTAEQAREMDAVKGETR  125

Query  588  RVENAISKAMASAQETVAAPPILGLLKRAEELVDGEVSELDAVMGDLKQSMGRLMGNADA  409
            R E  +S+ MA  QE+VAAPPIL L++R    +DGE+S LD  M  LK +M  +  +AD 
Sbjct  126  RGERDLSETMARIQESVAAPPILALVRRVGRQMDGEISSLDMAMEMLKTAMLGVFESADG  185

Query  408  LRGSTASKILEILNPKQAVKFLTAVMRFQREARRWGLYNDSQ  283
            LRGST  K++E+L+P+Q VK L AV +FQ   RRWGL  DSQ
Sbjct  186  LRGSTVRKVVEVLSPEQTVKVLAAVAQFQLRIRRWGLQRDSQ  227



>ref|XP_004148432.1| PREDICTED: transcription factor TGA4-like [Cucumis sativus]
 ref|XP_004166651.1| PREDICTED: transcription factor TGA4-like [Cucumis sativus]
Length=230

 Score =   175 bits (443),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 100/224 (45%), Positives = 145/224 (65%), Gaps = 4/224 (2%)
 Frame = -1

Query  951  VGEDFTAFYHGWLMNQDAIFEQLESFLaaaaaaddDREQCGGLVGRVLAHYQeyyaektk  772
            V E+F  FY  WL  Q    EQL   L  +  AD   E+  GL+ +VLAHYQ Y+ E +K
Sbjct  7    VIENFADFYESWLTTQRGFLEQL---LHVSQIADYKEERQLGLIKQVLAHYQLYHEEISK  63

Query  771  aaeEDVFVFFASPWMSRLEQSFLWLSGFKPSMLFWVVESSMEGALSEEQRCKVGMLRAET  592
            AA EDVF  F++PW++  E++ LW+SGFKPS++F +V+ +++  L+  Q   V  L+ + 
Sbjct  64   AAGEDVFRVFSAPWLTSYERTLLWISGFKPSIVFRLVDGAVKD-LTPVQAASVEELKTDV  122

Query  591  ARVENAISKAMASAQETVAAPPILGLLKRAEELVDGEVSELDAVMGDLKQSMGRLMGNAD  412
             R E  +++AMAS QETVAAPPI+GL +RA  LVDGE+ E++  + +LK  M  +   AD
Sbjct  123  KRKERDLAEAMASLQETVAAPPIVGLARRAGRLVDGEICEMENAIEELKIGMLGVFDGAD  182

Query  411  ALRGSTASKILEILNPKQAVKFLTAVMRFQREARRWGLYNDSQR  280
            +LRG+T  +++EIL   Q ++ LTA   FQ+  R+WG+  DSQR
Sbjct  183  SLRGTTMKRVMEILRTDQTLRLLTAATEFQQRIRQWGIQRDSQR  226



>gb|KGN62783.1| Transcription factor HBP-1b [Cucumis sativus]
Length=237

 Score =   175 bits (443),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 100/224 (45%), Positives = 145/224 (65%), Gaps = 4/224 (2%)
 Frame = -1

Query  951  VGEDFTAFYHGWLMNQDAIFEQLESFLaaaaaaddDREQCGGLVGRVLAHYQeyyaektk  772
            V E+F  FY  WL  Q    EQL   L  +  AD   E+  GL+ +VLAHYQ Y+ E +K
Sbjct  14   VIENFADFYESWLTTQRGFLEQL---LHVSQIADYKEERQLGLIKQVLAHYQLYHEEISK  70

Query  771  aaeEDVFVFFASPWMSRLEQSFLWLSGFKPSMLFWVVESSMEGALSEEQRCKVGMLRAET  592
            AA EDVF  F++PW++  E++ LW+SGFKPS++F +V+ +++  L+  Q   V  L+ + 
Sbjct  71   AAGEDVFRVFSAPWLTSYERTLLWISGFKPSIVFRLVDGAVKD-LTPVQAASVEELKTDV  129

Query  591  ARVENAISKAMASAQETVAAPPILGLLKRAEELVDGEVSELDAVMGDLKQSMGRLMGNAD  412
             R E  +++AMAS QETVAAPPI+GL +RA  LVDGE+ E++  + +LK  M  +   AD
Sbjct  130  KRKERDLAEAMASLQETVAAPPIVGLARRAGRLVDGEICEMENAIEELKIGMLGVFDGAD  189

Query  411  ALRGSTASKILEILNPKQAVKFLTAVMRFQREARRWGLYNDSQR  280
            +LRG+T  +++EIL   Q ++ LTA   FQ+  R+WG+  DSQR
Sbjct  190  SLRGTTMKRVMEILRTDQTLRLLTAATEFQQRIRQWGIQRDSQR  233



>ref|XP_009339278.1| PREDICTED: transcription factor TGA5 [Pyrus x bretschneideri]
Length=229

 Score =   172 bits (435),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 104/222 (47%), Positives = 143/222 (64%), Gaps = 4/222 (2%)
 Frame = -1

Query  945  EDFTAFYHGWLMNQDAIFEQLESFLaaaa-aaddDREQCGGLVGRVLAHYQeyyaektka  769
            E F  F  GWL  Q    +QL + + +      D RE+   L+ +VL+HYQ+Y+AEK + 
Sbjct  9    ERFVTFLGGWLDRQQTFLDQLLNLVESPDYENKDARERI--LIEQVLSHYQQYFAEKART  66

Query  768  aeEDVFVFFASPWMSRLEQSFLWLSGFKPSMLFWVVESSMEGALSEEQRCKVGMLRAETA  589
            AEED FV F+ PW+S  E+S LWL GFKPSM+  +V+SS+E  L+ EQ  ++  ++ ET 
Sbjct  67   AEEDAFVLFSPPWLSSFERSLLWLGGFKPSMVLRMVDSSVED-LTAEQVREMDAVKGETR  125

Query  588  RVENAISKAMASAQETVAAPPILGLLKRAEELVDGEVSELDAVMGDLKQSMGRLMGNADA  409
            R E  +S+ MA  QE+VAAPPIL L +R    ++GE+S LD  M  LK +M  +  +AD 
Sbjct  126  RAERDLSETMARIQESVAAPPILALARRVGRPMEGEISSLDMAMEMLKTAMLGVFESADG  185

Query  408  LRGSTASKILEILNPKQAVKFLTAVMRFQREARRWGLYNDSQ  283
            LRGST  K++E+L+P+Q VK L AV +FQ   RRWGL  DSQ
Sbjct  186  LRGSTVRKVVEVLSPEQTVKVLAAVAQFQLRIRRWGLQRDSQ  227



>ref|XP_009768149.1| PREDICTED: transcription factor TGA7-like [Nicotiana sylvestris]
Length=249

 Score =   172 bits (435),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 102/224 (46%), Positives = 138/224 (62%), Gaps = 4/224 (2%)
 Frame = -1

Query  942  DFTAFYHGWLMNQDAIFEQLE----SFLaaaaaaddDREQCGGLVGRVLAHYQeyyaekt  775
            +   +Y  WL+  +   E+L     S+      A+++R     LV +VL HYQEYY EK 
Sbjct  15   NIDTYYENWLIQLENFLEKLNEVSASYDVFNEEAEENRSSSSKLVTQVLDHYQEYYQEKF  74

Query  774  kaaeEDVFVFFASPWMSRLEQSFLWLSGFKPSMLFWVVESSMEGALSEEQRCKVGMLRAE  595
            KA   D F   + PW + LE++FLW++GFKPSMLF  +  S+   L+ +Q  K+  L++E
Sbjct  75   KATNGDTFFLNSPPWYTSLERTFLWMAGFKPSMLFPTINYSIGQELTPDQGEKLKKLKSE  134

Query  594  TARVENAISKAMASAQETVAAPPILGLLKRAEELVDGEVSELDAVMGDLKQSMGRLMGNA  415
              R E AI K MA  QE+VAAPPI  L+KR   LVDGE SEL+ V+  LKQSM  ++  A
Sbjct  135  IKRDEKAIEKGMAKVQESVAAPPIFELMKRGGLLVDGEASELETVIDGLKQSMMAMIEAA  194

Query  414  DALRGSTASKILEILNPKQAVKFLTAVMRFQREARRWGLYNDSQ  283
            + LRGS   K+L+IL PKQAVK L AV +F  +AR+ GL  D+Q
Sbjct  195  EHLRGSAVRKVLDILPPKQAVKLLAAVAQFHLQARKCGLRMDNQ  238



>ref|XP_008219160.1| PREDICTED: transcription factor HBP-1b(c38) [Prunus mume]
Length=232

 Score =   170 bits (431),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 100/222 (45%), Positives = 144/222 (65%), Gaps = 2/222 (1%)
 Frame = -1

Query  939  FTAFYHGWLMNQDAIFEQLESFLaaaaaaddDREQCGGLVGRVLAHYQeyyaektkaaeE  760
            F AF  GWL  Q    +QL   +   ++ +   +Q   L+ +VL HYQ+Y++EK   AEE
Sbjct  13   FIAFLGGWLERQQTFLDQLLRLVDLPSSENKAHQQ-RHLIEQVLCHYQQYFSEKDLTAEE  71

Query  759  DVFVFFASPWMSRLEQSFLWLSGFKPSMLFWVVESSMEGALSEEQRCKVGMLRAETARVE  580
            DVFV F+ PW+S  E++ LWL+GFKPS++  +V+SS+E  L+EEQ  K+  ++ ET   E
Sbjct  72   DVFVLFSPPWLSSFERTMLWLAGFKPSLVLRMVDSSVED-LTEEQARKMEAVKGETRWAE  130

Query  579  NAISKAMASAQETVAAPPILGLLKRAEELVDGEVSELDAVMGDLKQSMGRLMGNADALRG  400
              +S+ MA  QE+VAAPPIL L +R   L+DGE+S LD  M  LK +M  +  +AD LRG
Sbjct  131  RELSEKMARIQESVAAPPILALARRVGRLMDGEISSLDLAMETLKTAMLGVFESADGLRG  190

Query  399  STASKILEILNPKQAVKFLTAVMRFQREARRWGLYNDSQREA  274
            S+  K++E+L P+Q VK L AV +FQ   RR GL  DS++++
Sbjct  191  SSVRKVVEVLRPEQTVKVLAAVAQFQLGIRRLGLQRDSEQQS  232



>ref|XP_009606302.1| PREDICTED: transcription factor TGA7-like [Nicotiana tomentosiformis]
Length=246

 Score =   170 bits (431),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 101/221 (46%), Positives = 138/221 (62%), Gaps = 1/221 (0%)
 Frame = -1

Query  942  DFTAFYHGWLMNQDAIFEQLESFLaaaaa-addDREQCGGLVGRVLAHYQeyyaektkaa  766
            +  A+Y  WL+  + + E+L    A+     ++  E    LV +VL HYQEYY EK KA 
Sbjct  15   NIDAYYENWLIQLENLLEKLNKVSASYDVFNEEAEENRSKLVTQVLDHYQEYYQEKFKAT  74

Query  765  eEDVFVFFASPWMSRLEQSFLWLSGFKPSMLFWVVESSMEGALSEEQRCKVGMLRAETAR  586
              D F+  + PW + LE++FLW++GFKPSMLF  +  S+   L+ EQ  K+  L++E  R
Sbjct  75   NGDTFLLNSPPWYTSLERTFLWIAGFKPSMLFPTINYSIGQELTPEQGEKLKRLKSEIKR  134

Query  585  VENAISKAMASAQETVAAPPILGLLKRAEELVDGEVSELDAVMGDLKQSMGRLMGNADAL  406
             E AI K MA  QE VAAPPI  L+KR   LVDGE SEL+ V+  LKQS+  ++  A+ L
Sbjct  135  EEKAIEKGMAKVQEKVAAPPIFELMKRGGLLVDGEASELETVIDGLKQSIMAVIEAAEHL  194

Query  405  RGSTASKILEILNPKQAVKFLTAVMRFQREARRWGLYNDSQ  283
            RG+   K+L+IL PKQAVK L AV +F  +AR+ GL  D+Q
Sbjct  195  RGAAVKKVLDILPPKQAVKLLAAVAQFHLQARKCGLRMDNQ  235



>ref|XP_004238547.1| PREDICTED: transcription factor HBP-1b(c38) [Solanum lycopersicum]
Length=243

 Score =   169 bits (429),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 95/219 (43%), Positives = 133/219 (61%), Gaps = 0/219 (0%)
 Frame = -1

Query  939  FTAFYHGWLMNQDAIFEQLESFLaaaaaaddDREQCGGLVGRVLAHYQeyyaektkaaeE  760
             + +Y  WL+      E+L +  ++    D++  +   LV +VL HYQ+YY EK  +   
Sbjct  14   ISPYYENWLIQLQYFLEKLNAISSSYGGDDEEENRSNELVTQVLDHYQDYYREKFNSTNR  73

Query  759  DVFVFFASPWMSRLEQSFLWLSGFKPSMLFWVVESSMEGALSEEQRCKVGMLRAETARVE  580
            DVF+  + PW + LE++FLW++GFKPS LF  +  S+   L+ EQ   +  L+AET R E
Sbjct  74   DVFLLVSPPWYTSLEKTFLWIAGFKPSTLFPTINYSIGSELTTEQCENLKRLKAETKREE  133

Query  579  NAISKAMASAQETVAAPPILGLLKRAEELVDGEVSELDAVMGDLKQSMGRLMGNADALRG  400
              I K MA  QE VAAPPI  L+KR   +VDGE SEL++V+  +K SM  ++  A+ LRG
Sbjct  134  KVIEKGMAKVQEKVAAPPIFELMKRGGTVVDGEASELESVIDGMKHSMMSMVETAEHLRG  193

Query  399  STASKILEILNPKQAVKFLTAVMRFQREARRWGLYNDSQ  283
            ST   IL+IL  KQAVK L AV +F  +AR+ GL  D Q
Sbjct  194  STVKNILDILRQKQAVKLLAAVAQFHLQARKLGLQMDIQ  232



>ref|XP_010667750.1| PREDICTED: transcription factor HBP-1b(c38)-like [Beta vulgaris 
subsp. vulgaris]
Length=257

 Score =   167 bits (422),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 92/225 (41%), Positives = 139/225 (62%), Gaps = 6/225 (3%)
 Frame = -1

Query  951  VGEDFTAFYHGWLMNQDAIFEQLESFLaaaaaaddDREQCGGLVGRVLAHYQeyyaektk  772
            + + F AF+ GWL +Q A  +QL         A+ + +    L+ +VL+HY EYY  K +
Sbjct  38   ISDTFAAFFKGWLEHQQAFLDQL------VDTAEHEDKNSSQLIEQVLSHYAEYYEMKAQ  91

Query  771  aaeEDVFVFFASPWMSRLEQSFLWLSGFKPSMLFWVVESSMEGALSEEQRCKVGMLRAET  592
               +DVFV F+ PW++ +E++FLW+ GFKPS+ F + E S    +  EQ  K+  L+AET
Sbjct  92   VIWQDVFVAFSPPWLTPIEKTFLWVGGFKPSLTFCLAEVSNNSDMILEQVEKLASLKAET  151

Query  591  ARVENAISKAMASAQETVAAPPILGLLKRAEELVDGEVSELDAVMGDLKQSMGRLMGNAD  412
               E  +  A+AS QE++ +PP++ L+K+   LVDGEVSE   V+   K+SM R++ +AD
Sbjct  152  IWAEKNLVDALASVQESMGSPPLISLVKQYGRLVDGEVSEFADVIDKWKESMSRVLESAD  211

Query  411  ALRGSTASKILEILNPKQAVKFLTAVMRFQREARRWGLYNDSQRE  277
             LR +T  K++EILN KQ +KFL  V ++    R WGL ND Q++
Sbjct  212  NLRRNTVIKVIEILNVKQGLKFLAVVAKYYLGIRAWGLQNDVQKD  256



>ref|XP_006356862.1| PREDICTED: TGACG-sequence-specific DNA-binding protein TGA-2.1-like 
[Solanum tuberosum]
Length=236

 Score =   166 bits (419),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 92/220 (42%), Positives = 136/220 (62%), Gaps = 1/220 (0%)
 Frame = -1

Query  942  DFTAFYHGWLMNQDAIFEQLESFLaaaaaaddDREQCGGLVGRVLAHYQeyyaektkaae  763
            +   +Y  WL+      E+L + ++++   D++  +   LV +VL HYQ+YY EK  +  
Sbjct  12   NINPYYENWLIQLQNFLEKLNA-ISSSYGEDEEENKSSELVTKVLDHYQDYYREKFNSTN  70

Query  762  EDVFVFFASPWMSRLEQSFLWLSGFKPSMLFWVVESSMEGALSEEQRCKVGMLRAETARV  583
             DVF+  + PW + LE++FLW++GFKPS LF  +  S+   L+ EQ  K+  L+AET R 
Sbjct  71   RDVFLLVSPPWYTSLEKTFLWIAGFKPSTLFPTINYSIGSELTTEQEEKLKRLKAETKRE  130

Query  582  ENAISKAMASAQETVAAPPILGLLKRAEELVDGEVSELDAVMGDLKQSMGRLMGNADALR  403
            E  I K MA  QE  AAPPI  L+KR   +VDGE ++L++++  +K SM  ++  A+ LR
Sbjct  131  EKVIEKGMAKVQERGAAPPIFELMKRGGTVVDGEATDLESIIDGMKNSMMSMVETAEHLR  190

Query  402  GSTASKILEILNPKQAVKFLTAVMRFQREARRWGLYNDSQ  283
            GST  KIL+IL  KQ+VK L AV +F  +AR+ GL  D Q
Sbjct  191  GSTVRKILDILQQKQSVKLLAAVAQFHLQARKLGLQMDIQ  230



>ref|XP_008349608.1| PREDICTED: transcription factor TGA5-like [Malus domestica]
Length=175

 Score =   160 bits (404),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 81/159 (51%), Positives = 110/159 (69%), Gaps = 1/159 (1%)
 Frame = -1

Query  759  DVFVFFASPWMSRLEQSFLWLSGFKPSMLFWVVESSMEGALSEEQRCKVGMLRAETARVE  580
            DVFV F+ PW+S  E+S LWL+GFKPSM+  +V+SS+E  L+ EQ  ++  ++ ET R E
Sbjct  16   DVFVLFSPPWLSSFERSLLWLAGFKPSMVLRMVDSSVED-LTAEQAREMDAVKGETRRXE  74

Query  579  NAISKAMASAQETVAAPPILGLLKRAEELVDGEVSELDAVMGDLKQSMGRLMGNADALRG  400
              +S+ MA  QE+VAAPPIL L++R    +DGE+S LD  M  LK +M  +  +AD LRG
Sbjct  75   RDLSETMARIQESVAAPPILALVRRVGRXMDGEISSLDMAMEMLKTAMLGVFESADGLRG  134

Query  399  STASKILEILNPKQAVKFLTAVMRFQREARRWGLYNDSQ  283
            ST  K++E+L+P+Q VK L AV +FQ   RRWGL  DSQ
Sbjct  135  STVRKVVEVLSPEQTVKVLAAVAQFQLRIRRWGLQRDSQ  173



>ref|XP_006472990.1| PREDICTED: transcription factor TGA5-like [Citrus sinensis]
Length=313

 Score =   160 bits (406),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 93/220 (42%), Positives = 142/220 (65%), Gaps = 3/220 (1%)
 Frame = -1

Query  948  GEDFTAFYHGWLMNQDAIFEQLESFLaaaaaaddDREQCGGLVGRVLAHYQeyyaektka  769
            G +F AF+  WL+ Q+ +  QL   +A     +++  QC  L+ +VL+HYQ+YY EK+ A
Sbjct  81   GMNFEAFFKDWLIRQENLSYQLLDAIAPENIHNNELHQC--LIDQVLSHYQQYYLEKSLA  138

Query  768  aeEDVFVFFASPWMSRLEQSFLWLSGFKPSMLFWVVESSMEGALSEEQRCKVGMLRAETA  589
            A EDVF   + PW++  E++FLW+ GF+PS++F ++ +S++  L+ EQ  +V  ++AET 
Sbjct  139  ATEDVFQIISPPWLTFPERTFLWIGGFRPSLIFKLIANSVQD-LTAEQESEVQQVKAETR  197

Query  588  RVENAISKAMASAQETVAAPPILGLLKRAEELVDGEVSELDAVMGDLKQSMGRLMGNADA  409
            R E  + + MA  QE+VA+ P + L +R+  LVDGEV E +A M +L++ M  ++  ADA
Sbjct  198  REERELGQTMARVQESVASAPFMNLARRSANLVDGEVPEAEAAMKELQKGMVAVLEAADA  257

Query  408  LRGSTASKILEILNPKQAVKFLTAVMRFQREARRWGLYND  289
            LR + A K+L+IL P Q VKFL AV +F    RRW L  D
Sbjct  258  LRSTAAWKVLQILLPIQTVKFLAAVAQFHLTTRRWCLDRD  297



>ref|XP_002510006.1| Transcription factor HBP-1b, putative [Ricinus communis]
 gb|EEF52193.1| Transcription factor HBP-1b, putative [Ricinus communis]
Length=199

 Score =   148 bits (373),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 82/180 (46%), Positives = 123/180 (68%), Gaps = 1/180 (1%)
 Frame = -1

Query  840  EQCGGLVGRVLAHYQeyyaektkaaeEDVFVFFASPWMSRLEQSFLWLSGFKPSMLFWVV  661
            EQ   L+ ++L+HY+ YY EK+ AA EDVF+F   PW+S  E++ LWL GFKP ++F ++
Sbjct  21   EQHKHLIAQLLSHYKCYYEEKSNAAREDVFLFMNPPWLSSFERTLLWLGGFKPLVMFRLI  80

Query  660  ESSMEGALSEEQRCKVGMLRAETARVENAISKAMASAQETVAAPPILGLLKRAEELVDGE  481
             +S+   L+ EQ  ++  +R ET   E A+++ MAS QE++A+P IL L +R  +++DGE
Sbjct  81   NNSVTD-LTPEQSERIEQVRFETRIEERALTETMASVQESLASPLILNLSRRFRQMIDGE  139

Query  480  VSELDAVMGDLKQSMGRLMGNADALRGSTASKILEILNPKQAVKFLTAVMRFQREARRWG  301
            VSE++A +  LK +M  L  NADALR STA  +LE+L+P QAV+FL   ++FQ +  R G
Sbjct  140  VSEMEAALEGLKTAMFALSENADALRRSTAVNLLEVLSPAQAVRFLATALKFQLQVMRQG  199



>ref|XP_008345524.1| PREDICTED: transcription factor TGA4-like [Malus domestica]
Length=251

 Score =   149 bits (376),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 86/220 (39%), Positives = 137/220 (62%), Gaps = 3/220 (1%)
 Frame = -1

Query  939  FTAFYHGWLMNQDAIFEQLESFLaaaaaaddDREQCGGLVGRVLAHYQeyyaektkaaeE  760
            F AF+ GWL+ Q+   ++L S  A     +   E    L+ RVL HYQ+YY EK++ A+ 
Sbjct  14   FVAFFEGWLVRQEHFLDELLS--AQRTVDEARDEDLQDLISRVLLHYQQYYDEKSRLAQR  71

Query  759  DVFVFFASPWMSRLEQSFLWLSGFKPSMLFWVVESSMEGALSEEQRCKVGMLRAETARVE  580
            DVF+ F+  W S  E++ LW++G+KP ++F +V  S+    S+ QR  +  LR ET   E
Sbjct  72   DVFLVFSPTWFSSYERTLLWIAGYKPGLVFRIVTESVPD-FSDRQRINIARLRVETRIEE  130

Query  579  NAISKAMASAQETVAAPPILGLLKRAEELVDGEVSELDAVMGDLKQSMGRLMGNADALRG  400
             A++  +A+  E+VAAPP + +L+R     DGE+ E  AV+  LK ++  ++ NA+ LR 
Sbjct  131  RALNDKLANIHESVAAPPFVDVLRRYGRARDGEIVEDIAVIESLKPALESVLVNANLLRT  190

Query  399  STASKILEILNPKQAVKFLTAVMRFQREARRWGLYNDSQR  280
            +  +K++EIL+ +QAV+FLTAV +FQ + R  GL  D+++
Sbjct  191  TMVTKLVEILSSRQAVRFLTAVAQFQLKIRSLGLERDAEK  230



>ref|XP_006429421.1| hypothetical protein CICLE_v10012620mg [Citrus clementina]
 ref|XP_006481058.1| PREDICTED: uncharacterized protein LOC102613676 [Citrus sinensis]
 gb|ESR42661.1| hypothetical protein CICLE_v10012620mg [Citrus clementina]
Length=238

 Score =   147 bits (370),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 89/222 (40%), Positives = 136/222 (61%), Gaps = 4/222 (2%)
 Frame = -1

Query  939  FTAFYHGWLMNQDAIFEQLESFLaaaaaaddDREQCGGLVGRVLAHYQeyyaektkaaeE  760
            F  F+  WL+ Q+ + ++L S  A         E    LV RVLAHYQ+YY EK+K A+ 
Sbjct  18   FETFFRAWLVRQEHLLDELIS--AQENHHQSRDEDLKELVKRVLAHYQQYYQEKSKVAQH  75

Query  759  DVFVFFASPWMSRLEQSFLWLSGFKPSMLFWVVESSMEGALSEEQRCKVGMLRAETARVE  580
            +VF+ FA  W +  EQ+F W++GF P++ F VV  S++  L++EQR ++  L  ET   E
Sbjct  76   NVFLLFAPTWFTPFEQTFFWIAGFNPTLAFRVVNESVKD-LADEQRQRMDSLSVETRVEE  134

Query  579  NAISKAMASAQETVAAPPILGLLKRAEELVDGEVSELDAVM-GDLKQSMGRLMGNADALR  403
              ++  +A  QE+VA P I+ L +R   L + E++E + V   +L+ S+  L+ NAD LR
Sbjct  135  KLLNDELARIQESVAGPTIMELARRRGRLGEWEMTEGEEVTESNLRASLESLVANADMLR  194

Query  402  GSTASKILEILNPKQAVKFLTAVMRFQREARRWGLYNDSQRE  277
             +TA+K++EIL+P Q VKF TAV R Q   RRW  + +S+++
Sbjct  195  TTTAAKVVEILDPLQNVKFFTAVARLQLRIRRWASHGESEKD  236



>ref|XP_009377744.1| PREDICTED: transcription factor TGA4-like [Pyrus x bretschneideri]
Length=251

 Score =   147 bits (371),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 85/220 (39%), Positives = 134/220 (61%), Gaps = 3/220 (1%)
 Frame = -1

Query  939  FTAFYHGWLMNQDAIFEQLESFLaaaaaaddDREQCGGLVGRVLAHYQeyyaektkaaeE  760
            F AF+ GWL+ Q+   ++L S        +   E    L+ RVL HYQ+YY EK++ A  
Sbjct  14   FVAFFEGWLVRQEHFLDELLS--TQQTIDEARDEDLRDLISRVLLHYQQYYDEKSRLAHR  71

Query  759  DVFVFFASPWMSRLEQSFLWLSGFKPSMLFWVVESSMEGALSEEQRCKVGMLRAETARVE  580
            DVF+ F+  W S  E++ LW++G+KP ++F +V  S+   LS+ QR  +  LR ET   E
Sbjct  72   DVFLVFSPKWFSSYERTLLWIAGYKPGLVFRIVTESVPD-LSDRQRVNIARLREETRVEE  130

Query  579  NAISKAMASAQETVAAPPILGLLKRAEELVDGEVSELDAVMGDLKQSMGRLMGNADALRG  400
             A++  +A   E+VAAPP + +L+R     DG + E  AV+  LK ++  ++ NA+ LR 
Sbjct  131  RALNDKLAKIHESVAAPPFVDVLRRYGRARDGGIVEDIAVIESLKPALESVLVNANLLRT  190

Query  399  STASKILEILNPKQAVKFLTAVMRFQREARRWGLYNDSQR  280
            +  +K++EIL+ +QAV+FLTAV +FQ + R  GL  D+++
Sbjct  191  TMVTKLVEILSSRQAVRFLTAVAQFQLKIRSLGLERDAEK  230



>gb|KDO56688.1| hypothetical protein CISIN_1g047612mg [Citrus sinensis]
Length=238

 Score =   145 bits (367),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 87/222 (39%), Positives = 135/222 (61%), Gaps = 4/222 (2%)
 Frame = -1

Query  939  FTAFYHGWLMNQDAIFEQLESFLaaaaaaddDREQCGGLVGRVLAHYQeyyaektkaaeE  760
            F  F+  WL+ Q+ + ++L S  A         E    LV RVLAHYQ+YY EK+K A+ 
Sbjct  18   FETFFRAWLVRQEHLLDELIS--AQENHHQSRDEDLKELVKRVLAHYQQYYQEKSKVAQH  75

Query  759  DVFVFFASPWMSRLEQSFLWLSGFKPSMLFWVVESSMEGALSEEQRCKVGMLRAETARVE  580
            +VF+ FA  W +  EQ+F W++GF P++ F VV  S++  L++EQR ++  L  ET   E
Sbjct  76   NVFLLFAPTWFTPFEQTFFWIAGFNPTLAFRVVNESVKD-LADEQRQRMDSLSVETRVEE  134

Query  579  NAISKAMASAQETVAAPPILGLLKRAEELVDGEVSE-LDAVMGDLKQSMGRLMGNADALR  403
              ++  +A  QE+VA P I+ L +R   L + E++E ++    +L+ S+  L+ NAD LR
Sbjct  135  KLLNDELARIQESVAGPTIMELARRRGRLGEWEMTEGVEVTESNLRASLESLVANADMLR  194

Query  402  GSTASKILEILNPKQAVKFLTAVMRFQREARRWGLYNDSQRE  277
             +T +K++EIL+P Q VKF TAV R Q   RRW  + +S+++
Sbjct  195  TTTTAKVVEILDPLQNVKFFTAVARLQLRIRRWASHGESEKD  236



>gb|KDP41541.1| hypothetical protein JCGZ_15948 [Jatropha curcas]
Length=232

 Score =   144 bits (364),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 91/228 (40%), Positives = 134/228 (59%), Gaps = 6/228 (3%)
 Frame = -1

Query  948  GEDFTAFYHGWLMNQDAIFEQLESFLaaaaaaddDREQCGGLVGRVLAHYQeyyaektka  769
             E+F  F++GWL    A+ EQL   +A  A      E    L+ +VL+HY+ YY  K  A
Sbjct  5    SENFETFFNGWLDRLQALSEQLR--IAIEAENAQRTEYRKYLIDQVLSHYKLYYQVKVNA  62

Query  768  aeEDVFVFFASPWMSRLEQSFLWLSGFKPSMLFWVVESSMEGALSEEQRCKVGMLRAETA  589
            A ED F+F   PW+S  E++ LWL  F PS++F +++ S+   L+ EQ  ++  ++    
Sbjct  63   AREDPFLFLNPPWLSSFERTLLWLGDFNPSVIFKLIDRSVTD-LTPEQIERIKEVKLAIR  121

Query  588  RVENAISKAMASAQETVAAPPILGLLKR---AEELVDGEVSELDAVMGDLKQSMGRLMGN  418
            R E  +S  MAS QE++A+PPIL L +R   +  L+DGEVSE++     LK  +  ++ +
Sbjct  122  REERVLSDTMASIQESLASPPILNLARRFGRSGRLIDGEVSEIEVAEDMLKTQVHNVLES  181

Query  417  ADALRGSTASKILEILNPKQAVKFLTAVMRFQREARRWGLYNDSQREA  274
            ADALRG T +K+LEIL+P Q+V F+ A   FQ   RR G   D+ R A
Sbjct  182  ADALRGLTVAKVLEILSPVQSVTFMIAAADFQLRMRRLGQQTDALRVA  229



>ref|XP_002263705.1| PREDICTED: transcription factor TGA2-like [Vitis vinifera]
Length=231

 Score =   142 bits (359),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 85/219 (39%), Positives = 130/219 (59%), Gaps = 3/219 (1%)
 Frame = -1

Query  939  FTAFYHGWLMNQDAIFEQLESFLaaaaaaddDREQCGGLVGRVLAHYQeyyaektkaaeE  760
            F  F   W+++Q+   ++L          +   ++   LV RVL HYQ YY +K++  E 
Sbjct  11   FERFLQRWMVSQEHYLDEL--LTTERNCGEYGEKEMTDLVSRVLTHYQLYYEQKSRVIER  68

Query  759  DVFVFFASPWMSRLEQSFLWLSGFKPSMLFWVVESSMEGALSEEQRCKVGMLRAETARVE  580
            +VFV F+ PW + LE++ LW+ GFKP + F +V  ++ G LSE+QR ++  L+ ET   E
Sbjct  69   NVFVVFSPPWFTPLERTLLWIGGFKPGLAFRIVAEAV-GELSEDQRRRMNELQEETRTEE  127

Query  579  NAISKAMASAQETVAAPPILGLLKRAEELVDGEVSELDAVMGDLKQSMGRLMGNADALRG  400
              +S  +A  QETVAAPP++ L ++A    DGE+   D+V   L  ++  ++ +A+ LR 
Sbjct  128  RLLSDELARIQETVAAPPLMELARQAGRRRDGEILGSDSVTELLSSALETVVRDAELLRM  187

Query  399  STASKILEILNPKQAVKFLTAVMRFQREARRWGLYNDSQ  283
            STA K++EIL P Q VKFL AV RF  + R WGL  + +
Sbjct  188  STAVKVVEILTPIQNVKFLGAVGRFHMKIRTWGLQRNRE  226



>ref|XP_010104255.1| hypothetical protein L484_016398 [Morus notabilis]
 gb|EXB99422.1| hypothetical protein L484_016398 [Morus notabilis]
Length=226

 Score =   141 bits (356),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 83/214 (39%), Positives = 127/214 (59%), Gaps = 7/214 (3%)
 Frame = -1

Query  939  FTAFYHGWLMNQDAIFEQLESFLaaaaaaddDREQCGGLVGRVLAHYQeyyaektkaaeE  760
            F  F  GWL+ Q+   ++L S        D   +    LV R+LAHYQ+YY EK+K AE 
Sbjct  17   FERFLEGWLVRQEHYLDELLSC------RDSPDDDLRDLVYRILAHYQQYYDEKSKIAER  70

Query  759  DVFVFFASPWMSRLEQSFLWLSGFKPSMLFWVVESSMEGALSEEQRCKVGMLRAETARVE  580
            ++F+  +  W + LE +FLW+ GFKP + F +V  S++  L+++QR  +G L  ET   E
Sbjct  71   NIFLVLSPTWFTSLEHAFLWIGGFKPGLAFRLVNDSIDD-LTDDQRRSIGRLVQETKSEE  129

Query  579  NAISKAMASAQETVAAPPILGLLKRAEELVDGEVSELDAVMGDLKQSMGRLMGNADALRG  400
             A++  +A  QE+VAAPP+L + +R    VDGE++  D  +  L+ ++  ++  AD+LR 
Sbjct  130  RALNDELAKIQESVAAPPLLDISRRCTRQVDGEIAGADVAIATLRTALETVVTAADSLRM  189

Query  399  STASKILEILNPKQAVKFLTAVMRFQREARRWGL  298
            STA K++E+L P Q V+FL    + Q   R WGL
Sbjct  190  STALKVMEVLRPAQNVRFLATAAQLQLRLRTWGL  223



>ref|XP_007137287.1| hypothetical protein PHAVU_009G114600g [Phaseolus vulgaris]
 gb|ESW09281.1| hypothetical protein PHAVU_009G114600g [Phaseolus vulgaris]
Length=181

 Score =   139 bits (351),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 73/179 (41%), Positives = 117/179 (65%), Gaps = 5/179 (3%)
 Frame = -1

Query  825  LVGRVLAHYQeyyaektkaaeEDVFVFFASPWMSRLEQSFLWLSGFKPSMLFWVVESSME  646
            ++ +VL HYQ++  EK+  A  DVF+ F+ PW+S  E S LW+  +KPS++  + + +++
Sbjct  2    VIEQVLCHYQQFLEEKSNVANGDVFLLFSPPWLSAYESSLLWIGDYKPSLILRLADCAVK  61

Query  645  GALSEEQRCKVGMLRAETARVENAISKAMASAQETVAAPPILGLLKRAEELVDGEVSELD  466
             + + EQR K+  +R ET R E  IS+AMAS QE++A+P +L L++     VDGE++E +
Sbjct  62   -SFTPEQRDKMERVRDETKRAEREISEAMASVQESMASPRMLALVRE----VDGEITEQE  116

Query  465  AVMGDLKQSMGRLMGNADALRGSTASKILEILNPKQAVKFLTAVMRFQREARRWGLYND  289
              +  LK+++ ++    DALR ST  K++EIL+P Q V+ L A MRFQ   R+ GL+ D
Sbjct  117  LALRGLKEALKKVSERGDALRASTMRKVVEILSPPQTVQLLAATMRFQMRVRKHGLHRD  175



>ref|XP_002532112.1| Transcription factor HBP-1b, putative [Ricinus communis]
 gb|EEF30274.1| Transcription factor HBP-1b, putative [Ricinus communis]
Length=232

 Score =   139 bits (349),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 88/217 (41%), Positives = 129/217 (59%), Gaps = 9/217 (4%)
 Frame = -1

Query  951  VGEDFTAFYHGWLMNQDAIFEQLESFLaaaaaaddDREQCGGLVGRVLAHYQeyyaektk  772
            + + F +F+ GWL+ Q+   ++L S        +   E    LV R+L+HY++YY EK++
Sbjct  18   IAQSFVSFFEGWLVRQEHYLDELLSV--QQHCHESTEEDLKELVSRILSHYEQYYEEKSR  75

Query  771  aaeEDVFVFFASPWMSRLEQSFLWLSGFKPSMLFWVVESSMEGALSEEQRCKVGMLRAET  592
              + +VF+ F+ PW S LEQSF W++GFKPS+ F V+ +S+   LSE+Q  +VG L  ET
Sbjct  76   LVQGNVFLVFSPPWFSSLEQSFFWIAGFKPSLAFRVLSNSV-NDLSEDQNSEVGRLEKET  134

Query  591  ARVENAISKAMASAQETVAAPPILG---LLKRAEELVDGEVSELDAVMGDLKQSMGRLMG  421
               E  ++   A  QE++A+PP+L    L  RA E  DG VS+  AV G L+  +  ++ 
Sbjct  135  KVNERLLADEFAKIQESLASPPLLQEARLQGRAGE--DGRVSDRLAV-GSLRSRLEAVVA  191

Query  420  NADALRGSTASKILEILNPKQAVKFLTAVMRFQREAR  310
             AD LR +T  K++EILN  Q V FLTAV R Q   R
Sbjct  192  KADLLRTNTVVKVMEILNSVQKVNFLTAVTRLQLRIR  228



>ref|XP_010277360.1| PREDICTED: transcription factor HBP-1b(c38)-like isoform X1 [Nelumbo 
nucifera]
Length=275

 Score =   139 bits (351),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 88/222 (40%), Positives = 133/222 (60%), Gaps = 4/222 (2%)
 Frame = -1

Query  939  FTAFYHGWLMNQDAIFEQLESFLaaaaaaddDREQ-CGGLVGRVLAHYQeyyaektkaae  763
            F AF  GWL+ Q    +++    A     DD REQ    L+ RVL+HYQ+Y  EK++AA 
Sbjct  54   FHAFLEGWLVRQQQFLDEI--VYAKRFCHDDSREQDLRDLIARVLSHYQQYLGEKSRAAH  111

Query  762  EDVFVFFASPWMSRLEQSFLWLSGFKPSMLFWVVESSMEGALSEEQRCKVGMLRAETARV  583
             DVF+  + PW S LE++  W+ GF+P ++F +V +S+ G LS++Q   +  LRAET+  
Sbjct  112  RDVFLVLSPPWFSSLERALFWIGGFRPGLVFRLVANSV-GDLSQDQVQWMETLRAETSAE  170

Query  582  ENAISKAMASAQETVAAPPILGLLKRAEELVDGEVSELDAVMGDLKQSMGRLMGNADALR  403
            E  + + +A  QE+V APP+  LL+R    V+GE    + V+  +      L+G+AD LR
Sbjct  171  ERQLEEELARLQESVVAPPLSELLRRRGRAVNGEEGNANPVLESMITEFEILLGSADMLR  230

Query  402  GSTASKILEILNPKQAVKFLTAVMRFQREARRWGLYNDSQRE  277
             +TA+K+++IL+P Q V FL A  + Q   RR G   D++RE
Sbjct  231  ANTATKMIQILSPVQTVSFLAAAAQLQLRIRRLGFQRDAERE  272



>ref|XP_004246934.1| PREDICTED: transcription factor TGA2-like [Solanum lycopersicum]
Length=240

 Score =   137 bits (346),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 85/222 (38%), Positives = 131/222 (59%), Gaps = 8/222 (4%)
 Frame = -1

Query  939  FTAFYHGWLMNQDAIFEQLESFLaaaaaaddDREQCGGLVGRVLAHYQeyyaektkaaeE  760
            F AF  GWL+ Q+ +  +L +          D      L+ R+LAHYQEYY EK++ +  
Sbjct  15   FEAFLQGWLIRQEELLNELTT-----TQNTLDESIIRNLISRILAHYQEYYEEKSRMSHI  69

Query  759  DVFVFFASPWMSRLEQSFLWLSGFKPSMLFWVVESSMEGALSEEQRCKVGMLRAETARVE  580
            +VF  F+  W S LE+SFLW++GFKP + F +V +S+   L+E Q   +  L+ ET   E
Sbjct  70   NVFYMFSPSWFSPLEKSFLWIAGFKPGLAFPLVMNSV-NDLTENQIEMINGLKIETRIQE  128

Query  579  NAISKAMASAQETVAAPPILGLLK--RAEELVDGEVSELDAVMGDLKQSMGRLMGNADAL  406
              +   +A  QE+VAAPP++GL +  R E L DGE+SE+D  +  ++ +M  ++ +AD L
Sbjct  129  RDLMDKLAKIQESVAAPPLMGLAQQYRMEMLQDGEISEVDEEIEIIRTAMENVVTDADRL  188

Query  405  RGSTASKILEILNPKQAVKFLTAVMRFQREARRWGLYNDSQR  280
            R  TA  ++ ILNP Q++KFL A  + Q   R  G+  +++R
Sbjct  189  RTKTADSVVGILNPLQSLKFLAAAAQLQLRIRMIGMQREAER  230



>ref|XP_007206845.1| hypothetical protein PRUPE_ppa027068mg [Prunus persica]
 gb|EMJ08044.1| hypothetical protein PRUPE_ppa027068mg [Prunus persica]
Length=245

 Score =   137 bits (346),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 80/221 (36%), Positives = 136/221 (62%), Gaps = 3/221 (1%)
 Frame = -1

Query  939  FTAFYHGWLMNQDAIFEQLESFLaaaaaaddDREQCGGLVGRVLAHYQeyyaektkaaeE  760
            F AF+  WL+ Q+   ++L S  A     +   E    LV RVL HYQ+YY EK++ A+ 
Sbjct  12   FGAFFEAWLVRQEHFLDELLS--AQQRINEARDEDQRDLVYRVLLHYQQYYDEKSRIAQR  69

Query  759  DVFVFFASPWMSRLEQSFLWLSGFKPSMLFWVVESSMEGALSEEQRCKVGMLRAETARVE  580
            DVF+ F+ PW +  E+S LW++G+KP + F ++  S+   LS+ QR ++  L  ET   E
Sbjct  70   DVFLVFSPPWFTSFERSLLWIAGYKPGLAFRLLTESVPD-LSDGQRVRMARLMEETRVEE  128

Query  579  NAISKAMASAQETVAAPPILGLLKRAEELVDGEVSELDAVMGDLKQSMGRLMGNADALRG  400
             A++  +A   E+VAAPP++ + +R     +GE+ E D  + +LK ++  ++ N++ LR 
Sbjct  129  RALNDKLAKIHESVAAPPLVDVARRYGRFANGEIVEEDVAIDELKSALESVLENSNLLRT  188

Query  399  STASKILEILNPKQAVKFLTAVMRFQREARRWGLYNDSQRE  277
            + A+K++++L+  QAV+FL AV++FQ + R  GL  D+ ++
Sbjct  189  TMATKLVDMLSSAQAVRFLAAVVQFQLKIRSLGLERDADKQ  229



>ref|XP_010064245.1| PREDICTED: transcription factor TGA1-like [Eucalyptus grandis]
 gb|KCW66703.1| hypothetical protein EUGRSUZ_F00466 [Eucalyptus grandis]
Length=265

 Score =   137 bits (346),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 88/228 (39%), Positives = 135/228 (59%), Gaps = 14/228 (6%)
 Frame = -1

Query  945  EDFTAFYHGWLMNQDAIFEQL-----------ESFLaaaaaaddDREQCGGLVGRVLAHY  799
            E F AF+  WL  Q+A  +QL                     D D E    L+ +VL HY
Sbjct  29   ETFEAFFEDWLAQQEAFLDQLLLRASAPQGQSCPSHDHRGDGDGDGEADRALIEQVLGHY  88

Query  798  QeyyaektkaaeEDVFVFFASPWMSRLEQSFLWLSGFKPSMLFWVVESSMEGALSEEQRC  619
            Q +Y EKT+ A ED F+FF++PW++  E++FLW+  FKP++LF  + S+++G L+  Q  
Sbjct  89   QRFYEEKTRVAREDAFLFFSAPWLTSFERTFLWIGDFKPTLLFRFLGSAVDG-LTAAQSE  147

Query  618  KVGMLRAETARVENAISKAMASAQETVAAPPILGLLKRA--EELVDGEVSELDAVMGDLK  445
            +V  + AET   E  +++AMA  QE+V APP+L LL+ +  +   DGE+  L+  M  LK
Sbjct  148  EVERIGAETRWRERELTEAMARVQESVGAPPLLCLLRASAGQPPRDGELCALEVAMAQLK  207

Query  444  QSMGRLMGNADALRGSTASKILEILNPKQAVKFLTAVMRFQREARRWG  301
            ++M  ++ +A+ALR +TA +++E+L+P Q VK L A  +FQ   R WG
Sbjct  208  EAMVAVLEDANALRAATARRLMEVLSPAQTVKLLAAAAQFQVRIRWWG  255



>ref|XP_008243515.1| PREDICTED: transcription factor TGA4-like [Prunus mume]
Length=246

 Score =   134 bits (338),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 78/221 (35%), Positives = 134/221 (61%), Gaps = 3/221 (1%)
 Frame = -1

Query  939  FTAFYHGWLMNQDAIFEQLESFLaaaaaaddDREQCGGLVGRVLAHYQeyyaektkaaeE  760
            F AF+  WL+ Q+   ++L S  A     +   E    LV RVL HYQ+YY EK++ A+ 
Sbjct  14   FGAFFEAWLVRQEHFLDELLS--AQQRINEARDEDLRDLVYRVLLHYQQYYDEKSRIAQR  71

Query  759  DVFVFFASPWMSRLEQSFLWLSGFKPSMLFWVVESSMEGALSEEQRCKVGMLRAETARVE  580
            DVF+ F+ PW +  E+S LW++G+KP + F ++  S+   L + QR ++  L  ET   E
Sbjct  72   DVFLVFSPPWFTSFERSLLWIAGYKPGLAFRLLTESVPD-LCDGQRVRMARLMEETRVEE  130

Query  579  NAISKAMASAQETVAAPPILGLLKRAEELVDGEVSELDAVMGDLKQSMGRLMGNADALRG  400
             A++  +A   E+VAAPP++ + +R     +GE+ E D  + +L+ ++  ++ N++ LR 
Sbjct  131  RALNDKLAKIHESVAAPPLVDVARRYGRFANGEIVEEDVAIDELQSALESVLANSNLLRT  190

Query  399  STASKILEILNPKQAVKFLTAVMRFQREARRWGLYNDSQRE  277
            + A+K++++L+  QAV+FL AV +FQ + R  GL  D+ ++
Sbjct  191  TMATKLVDMLSSAQAVRFLGAVAQFQLKIRSLGLERDANKQ  231



>ref|XP_007026666.1| Response to aba and salt 1, putative [Theobroma cacao]
 gb|EOY07168.1| Response to aba and salt 1, putative [Theobroma cacao]
Length=235

 Score =   133 bits (335),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 78/222 (35%), Positives = 135/222 (61%), Gaps = 5/222 (2%)
 Frame = -1

Query  939  FTAFYHGWLMNQDAIFEQLESFLaaaaaaddDREQ-CGGLVGRVLAHYQeyyaektkaae  763
            F AF+  WL  Q+   ++L   L+    + + RE     L+ RVL+H+Q+YY EK++ A 
Sbjct  17   FDAFFQVWLERQEQYLDEL---LSVQQRSHEAREDDLKDLITRVLSHHQQYYEEKSRVAH  73

Query  762  EDVFVFFASPWMSRLEQSFLWLSGFKPSMLFWVVESSMEGALSEEQRCKVGMLRAETARV  583
             ++F+ F+  W+S  E++ LW++GFKP     +V +S++  LS+EQ  ++  L AET   
Sbjct  74   RNIFLVFSPTWLSSFERASLWIAGFKPGFALKLVSNSVQD-LSQEQSERIKRLMAETRVE  132

Query  582  ENAISKAMASAQETVAAPPILGLLKRAEELVDGEVSELDAVMGDLKQSMGRLMGNADALR  403
            E  ++  +A  QE++AAPP+L + ++   L++ E++   A +  L++++  ++  AD LR
Sbjct  133  ERVLNDELARVQESIAAPPLLEIARKRARLMNAEIAGEQAALASLRKAVEEVVAAADLLR  192

Query  402  GSTASKILEILNPKQAVKFLTAVMRFQREARRWGLYNDSQRE  277
             +TA +++EILNP Q V FLTA  +   + R WGL  D +R+
Sbjct  193  MTTAMRVVEILNPVQNVNFLTAATQLLVKLRNWGLQKDGERK  234



>ref|XP_003530288.1| PREDICTED: transcription factor HBP-1b(c38)-like [Glycine max]
 gb|KHN44703.1| Transcription factor HBP-1b(c1) [Glycine soja]
Length=233

 Score =   133 bits (334),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 82/222 (37%), Positives = 126/222 (57%), Gaps = 5/222 (2%)
 Frame = -1

Query  939  FTAFYHGWLMNQDAIFEQLESFLaaaaaaddDREQCGGLVGRVLAHYQeyyaektkaaeE  760
            F AF  GW++ Q    ++L S          D +    L+ RV+ HY +Y+ EK+K A +
Sbjct  9    FEAFLQGWMVRQRGYLDELLS-AQQHYQEMQDDDDVRQLINRVICHYGQYFEEKSKIAHQ  67

Query  759  DVFVFFASPWMSRLEQSFLWLSGFKPSMLFWVVESSMEGALSEEQRCKVGMLRAETARVE  580
            +V + F+ PW S LE++FLW+ GFKP + F VV +++E  LSEEQ+ ++ +L  ET   E
Sbjct  68   NVLLVFSPPWFSSLERTFLWVGGFKPGVSFQVVNTALED-LSEEQKERLSLLNQETKVKE  126

Query  579  NAISKAMASAQETVAAPPILGLLKRAEELVDGE---VSELDAVMGDLKQSMGRLMGNADA  409
             A++  +A   E+VAAPP++ + +    +         E  +V    ++++  L+ NADA
Sbjct  127  RALNDELAKLHESVAAPPLVDMARSHGRVCFSRSFMAEEGSSVPSTFRETLENLVANADA  186

Query  408  LRGSTASKILEILNPKQAVKFLTAVMRFQREARRWGLYNDSQ  283
            LR +T+ KI ++L P Q V FL AV   Q   R WGL  DSQ
Sbjct  187  LRTNTSLKIFQVLRPAQIVSFLVAVAELQIRIRSWGLDKDSQ  228



>ref|XP_006366944.1| PREDICTED: transcription factor HBP-1b(c38)-like [Solanum tuberosum]
Length=240

 Score =   132 bits (332),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 82/222 (37%), Positives = 130/222 (59%), Gaps = 8/222 (4%)
 Frame = -1

Query  939  FTAFYHGWLMNQDAIFEQLESFLaaaaaaddDREQCGGLVGRVLAHYQeyyaektkaaeE  760
            F AF  GW + Q+    +L +           R     L+ R+L+HYQEYY EK++ +  
Sbjct  15   FEAFLQGWFLRQEQFLNEL-TITQTTLDESIMR----NLISRILSHYQEYYEEKSRMSHI  69

Query  759  DVFVFFASPWMSRLEQSFLWLSGFKPSMLFWVVESSMEGALSEEQRCKVGMLRAETARVE  580
            +VF  F+  W + LE+SFLW++GFKP + F +V +S+   LSE Q  ++  LR ET   E
Sbjct  70   NVFYMFSPSWFTPLEKSFLWIAGFKPGLAFPLVMNSV-NDLSENQIERINRLRIETRIEE  128

Query  579  NAISKAMASAQETVAAPPILGLLKR--AEELVDGEVSELDAVMGDLKQSMGRLMGNADAL  406
              +   +A  QE+VAAPP++GL ++   E L DGE++E+D  +  L+ ++  ++ +AD L
Sbjct  129  RNLMDKLAKLQESVAAPPLMGLAQQYGMEMLRDGEITEVDEEIEILRTAVENVVTDADRL  188

Query  405  RGSTASKILEILNPKQAVKFLTAVMRFQREARRWGLYNDSQR  280
            R  TA  ++ ILNP Q++KFL A  + Q   R  G+  +++R
Sbjct  189  RTRTADSVVGILNPLQSLKFLAAAAQLQLRIRMVGMQREAER  230



>ref|XP_006338981.1| PREDICTED: transcription factor TGA6-like [Solanum tuberosum]
Length=248

 Score =   131 bits (330),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 81/227 (36%), Positives = 132/227 (58%), Gaps = 10/227 (4%)
 Frame = -1

Query  939  FTAFYHGWLMNQDAIFEQLESFLaaaaaaddDREQCGGLVGRVLAHYQeyyaektkaaeE  760
            F  F  GWL+ Q+    +L   + A    DD       L+ RVLAHYQEYY EK++    
Sbjct  16   FEVFLEGWLIRQEQFLNEL---VVAQDTFDDQENDMRDLISRVLAHYQEYYEEKSRMTHR  72

Query  759  DVFVFFASPWMSRLEQSFLWLSGFKPSMLFWVVESSMEGALSEEQRCKVGMLRAETARVE  580
            +VF  F+  W S LE+SFLW++GF P ++F +V  S+   LSE Q  ++  L+ ET   E
Sbjct  73   NVFRAFSPTWFSPLERSFLWITGFNPGLIFNLVTDSVNN-LSEHQVQRLNWLKHETKAEE  131

Query  579  NAISKAMASAQETVAAPPILGLLKRA------EELVDGEVSELDAVMGDLKQSMGRLMGN  418
             ++++ M   QE+VA+PP+  L +R        + ++ E+ E+D  +  LK ++  ++ +
Sbjct  132  RSLTEEMTQIQESVASPPLADLARRVGMQLIYTDNINTEIEEIDGNIDQLKTALENVVTD  191

Query  417  ADALRGSTASKILEILNPKQAVKFLTAVMRFQREARRWGLYNDSQRE  277
            AD LR  TA +++ +LNP Q++KFL+AV + Q   R  G+  +++R+
Sbjct  192  ADRLRTRTAERVVGLLNPLQSLKFLSAVGQLQLRVRMMGMEREAERQ  238



>ref|XP_010037696.1| PREDICTED: transcription factor HBP-1b(c38)-like [Eucalyptus 
grandis]
 gb|KCW49450.1| hypothetical protein EUGRSUZ_K02977 [Eucalyptus grandis]
Length=246

 Score =   131 bits (329),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 81/224 (36%), Positives = 136/224 (61%), Gaps = 7/224 (3%)
 Frame = -1

Query  939  FTAFYHGWLMNQDAIFEQLESFLaaaaaaddDREQCGGLVGRVLAHYQeyyaektkaaeE  760
            F +F   WL+ Q    E+L S  A  ++ +  ++    L+ RVL HYQ+YY EK++ A  
Sbjct  20   FESFLEAWLVRQKRYLEELLS--AQHSSCEVRQDDHLELIHRVLYHYQQYYEEKSRVANW  77

Query  759  DVFVFFASPWMSRLEQSFLWLSGFKPSMLFWVVESSMEGALSEEQRCKVGMLRAETARVE  580
            DVF+ F+ PW++ LE++ LW++GF+P++LF +V SS+   ++E+Q  ++  L AET   E
Sbjct  78   DVFLVFSPPWLTNLERALLWIAGFRPNLLFRLVSSSVND-MTEDQSRRMDRLVAETRMEE  136

Query  579  NAISKAMASAQETVAAPPILGLLKR-AEELVDGEVSE---LDAVMGDLKQSMGRLMGNAD  412
             A++  +A  QE V APP+   ++R      DGE ++    D+ +G L++++ +++ NAD
Sbjct  137  KALNDELAKIQERVGAPPLANAIRRYGRTAQDGETADGSGDDSALGGLRKALEKVVANAD  196

Query  411  ALRGSTASKILEILNPKQAVKFLTAVMRFQREARRWGLYNDSQR  280
             LR +T  K+  +L P Q VK L AV + Q + R  GL  D+++
Sbjct  197  MLRATTGEKVALVLTPPQMVKVLAAVAQLQLKVRGLGLQRDAEK  240



>ref|XP_004249821.1| PREDICTED: transcription factor HBP-1b(c38)-like [Solanum lycopersicum]
Length=246

 Score =   130 bits (328),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 83/228 (36%), Positives = 138/228 (61%), Gaps = 12/228 (5%)
 Frame = -1

Query  939  FTAFYHGWLMNQDAIFEQLESFLaaaaaaddDREQ-CGGLVGRVLAHYQeyyaektkaae  763
            F  F  GW + Q    EQ ++ L  A    DD+E    GL+ RVLAHYQ+YY EK++   
Sbjct  14   FEVFLVGWFIRQ----EQFQNELVVAQDTFDDQENDMRGLIHRVLAHYQQYYEEKSRMTH  69

Query  762  EDVFVFFASPWMSRLEQSFLWLSGFKPSMLFWVVESSMEGALSEEQRCKVGMLRAETARV  583
             +VF  F+  W S LE+SFLW++GF P ++F +V +S+   LSE Q  ++  L+ ET   
Sbjct  70   RNVFRVFSPTWFSPLERSFLWITGFNPGLVFNLVTNSI-NDLSEHQVERLNRLKQETKAQ  128

Query  582  ENAISKAMASAQETVAAPPILGLLKRA------EELVDGEVSELDAVMGDLKQSMGRLMG  421
            E +++K +A  QE+VA+PP++ L +R        + ++ ++ E+D  +  LK ++  ++ 
Sbjct  129  ERSLTKELAQIQESVASPPLVDLARRLGTQLLYTDNINTDIEEVDGDIDQLKTALENVVT  188

Query  420  NADALRGSTASKILEILNPKQAVKFLTAVMRFQREARRWGLYNDSQRE  277
            +AD LR  TA +++ +L+P Q++KFL+AV + Q  AR  G+  + +R+
Sbjct  189  DADRLRTRTAERVVGLLSPLQSLKFLSAVGQLQLRARMMGMEREVERQ  236



>ref|XP_010277361.1| PREDICTED: transcription factor HBP-1b(c38)-like isoform X2 [Nelumbo 
nucifera]
Length=269

 Score =   131 bits (329),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 84/212 (40%), Positives = 127/212 (60%), Gaps = 4/212 (2%)
 Frame = -1

Query  939  FTAFYHGWLMNQDAIFEQLESFLaaaaaaddDREQ-CGGLVGRVLAHYQeyyaektkaae  763
            F AF  GWL+ Q    +++    A     DD REQ    L+ RVL+HYQ+Y  EK++AA 
Sbjct  54   FHAFLEGWLVRQQQFLDEI--VYAKRFCHDDSREQDLRDLIARVLSHYQQYLGEKSRAAH  111

Query  762  EDVFVFFASPWMSRLEQSFLWLSGFKPSMLFWVVESSMEGALSEEQRCKVGMLRAETARV  583
             DVF+  + PW S LE++  W+ GF+P ++F +V +S+ G LS++Q   +  LRAET+  
Sbjct  112  RDVFLVLSPPWFSSLERALFWIGGFRPGLVFRLVANSV-GDLSQDQVQWMETLRAETSAE  170

Query  582  ENAISKAMASAQETVAAPPILGLLKRAEELVDGEVSELDAVMGDLKQSMGRLMGNADALR  403
            E  + + +A  QE+V APP+  LL+R    V+GE    + V+  +      L+G+AD LR
Sbjct  171  ERQLEEELARLQESVVAPPLSELLRRRGRAVNGEEGNANPVLESMITEFEILLGSADMLR  230

Query  402  GSTASKILEILNPKQAVKFLTAVMRFQREARR  307
             +TA+K+++IL+P Q V FL A  + Q   RR
Sbjct  231  ANTATKMIQILSPVQTVSFLAAAAQLQLRIRR  262



>ref|XP_004305124.1| PREDICTED: transcription factor TGA4-like [Fragaria vesca subsp. 
vesca]
Length=229

 Score =   129 bits (324),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 85/223 (38%), Positives = 137/223 (61%), Gaps = 7/223 (3%)
 Frame = -1

Query  939  FTAFYHGWLMNQDAIFEQLESFLaaaaaaddDRE-QCGGLVGRVLAHYQeyyaektkaae  763
            F  F+ GWL+ Q+   ++L+S   A   A + RE     LV RVL HYQ+YY EK++ A+
Sbjct  4    FETFFEGWLVRQEHYLDELQS---AQQRAHEAREVDLRDLVSRVLLHYQQYYEEKSRIAQ  60

Query  762  EDVFVFFASPWMSRLEQSFLWLSGFKPSMLFWVVESSMEGALSEEQRCKVGMLRAETARV  583
             DVF+ F+  W + LE++ LW++GFKP + F +V  S+   LS++QR +V  L  ET   
Sbjct  61   RDVFMVFSPTWFTSLERALLWIAGFKPGLAFRLVSDSVPD-LSDDQRVRVTRLVEETRVE  119

Query  582  ENAISKAMASAQETVAAPPILGLLKRAEELV--DGEVSELDAVMGDLKQSMGRLMGNADA  409
            E A++  +A   E+VAAPP++ + +R    V  +G   E +     LK ++  ++ +A+ 
Sbjct  120  ERALNDKLAKIHESVAAPPLVDVARRHARYVESEGAEGEEEEAATRLKSALEDVLADANL  179

Query  408  LRGSTASKILEILNPKQAVKFLTAVMRFQREARRWGLYNDSQR  280
            LR + A+K++E+++  QAV+FL AV +FQ + R WGL  D++R
Sbjct  180  LRTTVATKLVEMMSGAQAVRFLVAVGQFQLKIRSWGLERDARR  222



>ref|XP_008351209.1| PREDICTED: transcription factor TGA7-like [Malus domestica]
Length=309

 Score =   130 bits (327),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 80/221 (36%), Positives = 128/221 (58%), Gaps = 3/221 (1%)
 Frame = -1

Query  939  FTAFYHGWLMNQDAIFEQLESFLaaaaaaddDREQCGGLVGRVLAHYQeyyaektkaaeE  760
            F AFY GWL+ Q+   ++L S  A     +   E    LV  VL HYQ+YY EK++  + 
Sbjct  75   FEAFYEGWLVXQEHFLDELLS--AQQTIDEARDEDLRDLVSXVLFHYQQYYDEKSRLGQR  132

Query  759  DVFVFFASPWMSRLEQSFLWLSGFKPSMLFWVVESSMEGALSEEQRCKVGMLRAETARVE  580
            DV + F+  W +  E+S LW++G+KP ++F +V  S+   LS++QR ++   R  T   E
Sbjct  133  DVLLXFSPTWYTSYERSLLWIAGYKPGIVFRLVTESVPD-LSDQQRVRMAXXREATRVEE  191

Query  579  NAISKAMASAQETVAAPPILGLLKRAEELVDGEVSELDAVMGDLKQSMGRLMGNADALRG  400
             A+   +A     VAAPP +  ++R      G   E DAV   LK ++  ++ NA+  R 
Sbjct  192  RALXDKLAKIHXXVAAPPFMDAVRRYGRAXHGXXVEDDAVXKSLKSALETVVENANLXRT  251

Query  399  STASKILEILNPKQAVKFLTAVMRFQREARRWGLYNDSQRE  277
            + A+K++++L+  QAV+FLTAVM+FQ + R  GL  D++++
Sbjct  252  TMATKLVDLLSSGQAVRFLTAVMQFQLKIRSLGLERDAEQQ  292



>ref|XP_010695448.1| PREDICTED: transcription factor HBP-1b(c38) [Beta vulgaris subsp. 
vulgaris]
Length=176

 Score =   125 bits (314),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 65/157 (41%), Positives = 101/157 (64%), Gaps = 1/157 (1%)
 Frame = -1

Query  747  FFASPWMSRLEQSFLWLSGFKPSMLFWVVESSMEGALSEEQRCKVGMLRAETARVENAIS  568
             F+ PW+S LE+S LW+ GFKPS+ F +VE S+   + E Q  K+  L+ ET   E  + 
Sbjct  11   MFSPPWLSSLEKSLLWMGGFKPSITFSLVEFSVSDMVPE-QVEKLIRLKKETKIEERTLM  69

Query  567  KAMASAQETVAAPPILGLLKRAEELVDGEVSELDAVMGDLKQSMGRLMGNADALRGSTAS  388
             A+A+ QE + +PP++ L+K+   LV+GEVS+    + + K S+  L+ +AD LR +T  
Sbjct  70   DALAAVQEAMGSPPLINLVKQYGRLVNGEVSDFAEAIDETKHSLSSLVHSADNLRRNTVM  129

Query  387  KILEILNPKQAVKFLTAVMRFQREARRWGLYNDSQRE  277
            K+++ILN  Q++KFL+AV ++Q  +R  GL ND Q E
Sbjct  130  KVIQILNENQSLKFLSAVAKYQLSSRAKGLQNDVQNE  166



>ref|XP_007140269.1| hypothetical protein PHAVU_008G097900g [Phaseolus vulgaris]
 gb|ESW12263.1| hypothetical protein PHAVU_008G097900g [Phaseolus vulgaris]
Length=231

 Score =   125 bits (315),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 79/221 (36%), Positives = 123/221 (56%), Gaps = 5/221 (2%)
 Frame = -1

Query  939  FTAFYHGWLMNQDAIFEQLESFLaaaaaaddDREQCGGLVGRVLAHYQeyyaektkaaeE  760
            F AF  GW++ Q     +L S  A     +  R     L+ RV+ HY +Y+ EK+K A  
Sbjct  9    FEAFLQGWMVRQKEFLGELLS--AQQQYQEGRRADVRPLIDRVICHYGQYFEEKSKLAHH  66

Query  759  DVFVFFASPWMSRLEQSFLWLSGFKPSMLFWVVESSMEGALSEEQRCKVGMLRAETARVE  580
            ++F+ F+ PW S LE+SFLW+ GFKP + F VV +++   L+E+Q+ K+  L+ E+   E
Sbjct  67   NIFLVFSPPWFSSLEKSFLWVGGFKPGVAFQVVNTALRD-LTEDQKEKMSKLKKESKVKE  125

Query  579  NAISKAMASAQETVAAPPILGLLKRAEELVDGEVSELDA--VMGDLKQSMGRLMGNADAL  406
              ++  +A  QE+VA PP++ + +    L       +D   V    K+ +  L+ +ADAL
Sbjct  126  RTLNDDLAKLQESVADPPLVDMARSQGRLCFSRSFMVDQGLVPSAFKEKLENLVADADAL  185

Query  405  RGSTASKILEILNPKQAVKFLTAVMRFQREARRWGLYNDSQ  283
            R  TA KI++IL P Q V F+ +    Q + R WGL  D+Q
Sbjct  186  RTDTALKIMKILRPAQIVSFMVSAAELQIKIRSWGLDKDAQ  226



>ref|XP_009623095.1| PREDICTED: transcription factor HBP-1b(c38)-like [Nicotiana tomentosiformis]
Length=247

 Score =   126 bits (316),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 81/229 (35%), Positives = 137/229 (60%), Gaps = 12/229 (5%)
 Frame = -1

Query  939  FTAFYHGWLMNQDAIFEQLESFLaaaaaaddDREQ--CGGLVGRVLAHYQeyyaektkaa  766
            F  F  GWL+ Q+   E+L   L A    D++ E+     L+ RVLAHYQEYY EK++ +
Sbjct  15   FGVFLEGWLIRQEQYLEEL---LVAQDTFDEETEEGVIRDLISRVLAHYQEYYEEKSRMS  71

Query  765  eEDVFVFFASPWMSRLEQSFLWLSGFKPSMLFWVVESSMEGALSEEQRCKVGMLRAETAR  586
              +VF+ F+  W + LE++FLW++GFKP + F +V  S+   LS  Q  ++  LR ET  
Sbjct  72   HRNVFLVFSPTWFTPLERTFLWITGFKPGLAFTLVTDSV-NDLSGNQVQRINRLRYETKI  130

Query  585  VENAISKAMASAQETVAAPPILGLLKRA------EELVDGEVSELDAVMGDLKQSMGRLM  424
             E +++  +A  QE+VAAPP++ L +R        + ++ E+++ D  +  LK +M  ++
Sbjct  131  EEKSLTDELAKIQESVAAPPLMELARRIGMQLLYTDGINIEITDGDENIETLKSAMENVV  190

Query  423  GNADALRGSTASKILEILNPKQAVKFLTAVMRFQREARRWGLYNDSQRE  277
             +AD LR  TA +++ +L+P Q+++FLTA  + Q   R  G+  +++R+
Sbjct  191  TDADRLRTRTAERVVGVLSPLQSLRFLTAAAQLQLRLRMMGMQREAERQ  239



>ref|XP_009802153.1| PREDICTED: transcription factor HBP-1b(c38)-like [Nicotiana sylvestris]
Length=247

 Score =   125 bits (315),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 80/230 (35%), Positives = 135/230 (59%), Gaps = 14/230 (6%)
 Frame = -1

Query  939  FTAFYHGWLMNQDAIFEQLESFLaaaaaaddDREQCGG---LVGRVLAHYQeyyaektka  769
            F  F  GWL+ Q+   ++L      A    D+  Q G    L+ RVLAHYQEYY EK++ 
Sbjct  15   FGGFLEGWLIRQEQFLDEL----LVAQDTFDEETQEGAIRDLISRVLAHYQEYYEEKSRM  70

Query  768  aeEDVFVFFASPWMSRLEQSFLWLSGFKPSMLFWVVESSMEGALSEEQRCKVGMLRAETA  589
            +  +VF  F+  W + LE++FLW++GFKP + F +V  S+   LSE Q  ++  LR ET 
Sbjct  71   SHRNVFHVFSPTWFTPLERTFLWITGFKPGLAFTLVTDSV-NDLSENQVQRINRLRYETK  129

Query  588  RVENAISKAMASAQETVAAPPILGLLKRA------EELVDGEVSELDAVMGDLKQSMGRL  427
              E +++  +A  QE+VAAPP++ + +R        + ++ E+++ D  +  LK +M  +
Sbjct  130  VEEKSLTDELAKIQESVAAPPLIEMARRVGMQLLHTDGINIEITDGDENIETLKSAMENV  189

Query  426  MGNADALRGSTASKILEILNPKQAVKFLTAVMRFQREARRWGLYNDSQRE  277
            + +AD LR  TA +++ +L+P Q+++FLTA  + Q   R  G+  +++R+
Sbjct  190  VTDADRLRTRTAERVVGLLSPLQSLRFLTAAAQLQLRLRMMGMQREAERQ  239



>ref|XP_006602670.1| PREDICTED: transcription factor HBP-1b(c38)-like [Glycine max]
Length=232

 Score =   124 bits (312),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 81/228 (36%), Positives = 126/228 (55%), Gaps = 14/228 (6%)
 Frame = -1

Query  948  GEDFTAFYHGWLMNQDAIFEQLESFLaaaaaaddDREQCGGLVGRVLAHYQeyyaektka  769
             + F AF  GW + Q    ++L S  A     +   +    L+ RV+ HY +Y+ EK+K 
Sbjct  6    ADSFEAFLQGWRVRQRGYLDELLS--AQQHYHELQDDDVKQLINRVVCHYGQYFEEKSKI  63

Query  768  aeEDVFVFFASPWMSRLEQSFLWLSGFKPSMLFWVVESSMEGALSEEQRCKVGMLRAETA  589
            A ++V + F+ PW S LE++FLW+ GFKP + F VV +++E  LSEEQ+ ++ +L  ET 
Sbjct  64   AHQNVLLVFSPPWFSSLERTFLWVGGFKPGVAFQVVNAALE-VLSEEQKERLSLLNQETK  122

Query  588  RVENAISKAMASAQETVAAPPILGLLKRAEE-------LVDGEVSELDAVMGDLKQSMGR  430
              E A++  +A   E+VAAPP++ + +           + +G  S    V    ++++  
Sbjct  123  VKERALNDELAKLHESVAAPPLVDMARSHGRVCFSRSFMAEGGSS----VPSTFRETLEN  178

Query  429  LMGNADALRGSTASKILEILNPKQAVKFLTAVMRFQREARRWGLYNDS  286
            L+ NADALR +T+ KI +IL P Q V FL AV   Q     WGL  D+
Sbjct  179  LVANADALRTNTSLKIFQILRPSQLVSFLVAVAELQIRIGSWGLDKDA  226



>ref|XP_011079057.1| PREDICTED: transcription factor TGA5-like [Sesamum indicum]
 ref|XP_011079058.1| PREDICTED: transcription factor TGA5-like [Sesamum indicum]
Length=245

 Score =   124 bits (311),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 74/220 (34%), Positives = 124/220 (56%), Gaps = 2/220 (1%)
 Frame = -1

Query  939  FTAFYHGWLMNQDAIFEQLESFLaaaaaaddDRE-QCGGLVGRVLAHYQeyyaektkaae  763
            F AF   WL++Q+     L   +    + +++ E +C  L+ +V+ HY+ Y+  K +  E
Sbjct  11   FEAFLGRWLIDQERYLRDLLGLMERNRSEEEEYEVRCKDLIQQVMGHYKHYFEAKARVVE  70

Query  762  EDVFVFFASPWMSRLEQSFLWLSGFKPSMLFWVVESSMEGALSEEQRCKVGMLRAETARV  583
            E+VF+     W S  E+++LW+ GF+P +LF +V++++   L+EEQ  ++  L AE    
Sbjct  71   ENVFLVLMPTWFSSFERAYLWIGGFRPGLLFRLVKNNVLD-LTEEQSQRINRLMAEIKEE  129

Query  582  ENAISKAMASAQETVAAPPILGLLKRAEELVDGEVSELDAVMGDLKQSMGRLMGNADALR  403
            E  ++      QE VA+PP++ L++R   L +G    +++ +  LK S+  L+  AD LR
Sbjct  130  EKELTDEFDRVQEVVASPPMVELVRRLGRLRNGAQHNMESAVDRLKLSLETLVECADFLR  189

Query  402  GSTASKILEILNPKQAVKFLTAVMRFQREARRWGLYNDSQ  283
              T   ++EIL P QAV+ L AV + Q   RRWG+  D Q
Sbjct  190  MKTGIILVEILKPAQAVRLLAAVAQLQLRVRRWGMQRDGQ  229



>ref|XP_006433711.1| hypothetical protein CICLE_v10003662mg, partial [Citrus clementina]
 gb|ESR46951.1| hypothetical protein CICLE_v10003662mg, partial [Citrus clementina]
Length=206

 Score =   123 bits (308),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 73/182 (40%), Positives = 118/182 (65%), Gaps = 3/182 (2%)
 Frame = -1

Query  948  GEDFTAFYHGWLMNQDAIFEQLESFLaaaaaaddDREQCGGLVGRVLAHYQeyyaektka  769
            G +F AF+  WL+ Q+ +  QL   +A     +++  QC  L+ +VL+HYQ+YY EK+ A
Sbjct  28   GMNFEAFFKDWLIRQENLSYQLLDAIAPENIHNNELHQC--LIDQVLSHYQQYYLEKSLA  85

Query  768  aeEDVFVFFASPWMSRLEQSFLWLSGFKPSMLFWVVESSMEGALSEEQRCKVGMLRAETA  589
            A EDVF   + PW++  E++FLW+ GF+PS++F ++ +S++  L+ EQ  +V  ++AET 
Sbjct  86   ATEDVFQIISPPWLTFPERTFLWIGGFRPSLIFKLIANSVQD-LTAEQESEVQQVKAETR  144

Query  588  RVENAISKAMASAQETVAAPPILGLLKRAEELVDGEVSELDAVMGDLKQSMGRLMGNADA  409
            R E  + + MA  QE+VA+ P + L +R+  LVD EV E +A M +L++ M  ++  ADA
Sbjct  145  REERELGQTMARVQESVASAPFMNLARRSANLVDREVPEAEAAMKELQKGMLAVLEAADA  204

Query  408  LR  403
            LR
Sbjct  205  LR  206



>gb|KEH23189.1| transcription factor TGA5-like protein [Medicago truncatula]
Length=231

 Score =   123 bits (309),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 79/223 (35%), Positives = 122/223 (55%), Gaps = 5/223 (2%)
 Frame = -1

Query  939  FTAFYHGWLMNQDAIFEQLESFLaaaaaaddDREQCGGLVGRVLAHYQeyyaektkaaeE  760
            F  F  GW++ Q      L S  A     +        L+ RVL HY +YY EK+K A +
Sbjct  9    FDEFLQGWMIRQRNYLNDLLS--AQQQPQELADSDRLNLLNRVLCHYGQYYEEKSKIAHQ  66

Query  759  DVFVFFASPWMSRLEQSFLWLSGFKPSMLFWVVESSMEGALSEEQRCKVGMLRAETARVE  580
            ++ + F+ PW S LE+SFLW++GFKP + F +V  ++E  LSE+QR ++  L+ E    E
Sbjct  67   NILLLFSPPWFSSLEKSFLWVAGFKPGLTFHLVNKTLED-LSEDQRQRLSELKQEIKMKE  125

Query  579  NAISKAMASAQETVAAPPILGLLKRAEE--LVDGEVSELDAVMGDLKQSMGRLMGNADAL  406
              ++  +A   E++AAPP+L  ++      L    ++E   V    K+++  L+ NADAL
Sbjct  126  RELNDELAKVHESMAAPPVLDNVRSHGRVCLSRSFMAEEGTVSSSFKETLENLVTNADAL  185

Query  405  RGSTASKILEILNPKQAVKFLTAVMRFQREARRWGLYNDSQRE  277
            R  TA ++++IL P Q + F  AV   Q + R  G   D+QRE
Sbjct  186  RTETALRVVQILKPAQVLNFFVAVAELQLKVRSLGFDKDAQRE  228



>ref|XP_009769468.1| PREDICTED: transcription factor TGA6-like [Nicotiana sylvestris]
Length=262

 Score =   124 bits (311),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 77/224 (34%), Positives = 132/224 (59%), Gaps = 7/224 (3%)
 Frame = -1

Query  939  FTAFYHGWLMNQDAIFEQLESFLaaaaaaddDREQCGGLVGRVLAHYQeyyaektkaaeE  760
            F AF+ GWL+ Q+    +L   +A     +        L+  VLAHYQEY+ EK++ +  
Sbjct  16   FEAFFQGWLLRQEQFLNEL--IIAQNTFDESQEGVIKNLISGVLAHYQEYFEEKSRMSHR  73

Query  759  DVFVFFASPWMSRLEQSFLWLSGFKPSMLFWVVESSMEGALSEEQRCKVGMLRAETARVE  580
            +VF  F+  W + LE+S+LW++GFKP + F +V +S++  LS+ Q  ++  L+ ET   E
Sbjct  74   NVFNVFSPAWFTPLEKSYLWIAGFKPGLAFSLVMNSVDD-LSQNQVERINRLKFETRVQE  132

Query  579  NAISKAMASAQETVAAPPILGLLKR-AEELVDGE---VSELDAVMGDLKQSMGRLMGNAD  412
              +   +A  QE+VAAPP +GL ++    L+ G+   + E+D  +  L+ ++  ++ +AD
Sbjct  133  KNLMDELAKIQESVAAPPFMGLAQQFGVHLLRGDGGKIREVDENIETLRSALENVITDAD  192

Query  411  ALRGSTASKILEILNPKQAVKFLTAVMRFQREARRWGLYNDSQR  280
             LR  TA +++ ILNP Q+++FLTA  + Q   R  G+  +++R
Sbjct  193  KLRTRTAERVVGILNPLQSLRFLTAAAQLQLRIRMLGMQTEAER  236



>gb|KDP24433.1| hypothetical protein JCGZ_24997 [Jatropha curcas]
Length=232

 Score =   123 bits (308),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 78/222 (35%), Positives = 125/222 (56%), Gaps = 9/222 (4%)
 Frame = -1

Query  939  FTAFYHGWLMNQDAIFEQLESFLaaaaaaddDREQCGGLVGRVLAHYQeyyaektkaaeE  760
            F  F+ GWL+ Q+   ++L S        +   E    L+ RVL+HY++YY EK++ A+ 
Sbjct  17   FEEFFEGWLVRQEHYLDELLSV--EQHYHESRDEDLKDLIARVLSHYEQYYEEKSRMAQR  74

Query  759  DVFVFFASPWMSRLEQSFLWLSGFKPSMLFWVVESSMEGALSEEQRCKVGMLRAETARVE  580
            +VF+ F+ PW +  +++ LW++GFKP++ F +V  S+   LSE+Q  ++  L  ET   E
Sbjct  75   NVFLVFSPPWFTPFQRTLLWIAGFKPALTFQIVNGSV-NDLSEDQSQRMSRLNEETTASE  133

Query  579  NAISKAMASAQETVAAPPILGLLKRA--EELVDGEVSELDAVMGDLKQSMGRLMGNADAL  406
              ++  +A   E+VA+PP+L L +R       + EVS   + +G    +M  L+  AD L
Sbjct  134  RILTDELARIHESVASPPLLDLARRQGRGRWEEDEVS-YKSTIGS---AMESLVATADLL  189

Query  405  RGSTASKILEILNPKQAVKFLTAVMRFQREARRWGLYNDSQR  280
            R +T +K++EILNP Q VKFL+A  +     R  GL     R
Sbjct  190  RTNTVTKVVEILNPVQNVKFLSAATQLHLRIRNLGLQRQRHR  231



>ref|XP_008344751.1| PREDICTED: transcription factor TGA5-like [Malus domestica]
Length=177

 Score =   120 bits (302),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 73/159 (46%), Positives = 106/159 (67%), Gaps = 10/159 (6%)
 Frame = -1

Query  810  LAHYQeyyaektkaaeEDVFVFFASPWMSRLEQSFLWLSGFKPSMLFWVVESSMEGALSE  631
            ++HYQ+Y+AEK + AEEDVFV F+ PW+S  E+S LWL GFKPSM+  +V+SS+E  L+ 
Sbjct  1    MSHYQQYFAEKARTAEEDVFVLFSPPWLSSFERSLLWLGGFKPSMVLRMVDSSIED-LTA  59

Query  630  EQRCKVGMLRAETARVENAISKAMASAQETVAAPPILGLLKRAEELVDGEVSELDAVMGD  451
            EQ  ++  ++ ET R E  + + MA  QE+VAAPPIL L +R   L+D E          
Sbjct  60   EQATEMDAVKGETRRAERELLETMARIQESVAAPPILPLARRVGRLMDEET---------  110

Query  450  LKQSMGRLMGNADALRGSTASKILEILNPKQAVKFLTAV  334
            LK +M  ++ +AD LRGST  K++++L+P+Q  + LT V
Sbjct  111  LKTAMMGVIKSADGLRGSTVRKVVKLLSPEQVEERLTYV  149



>ref|XP_009148314.1| PREDICTED: transcription factor TGA1-like [Brassica rapa]
Length=230

 Score =   122 bits (305),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 75/202 (37%), Positives = 115/202 (57%), Gaps = 9/202 (4%)
 Frame = -1

Query  924  HGWLMNQDAIFEQLESFLaaaaaaddDREQCGGLVGRVLAH---YQeyyaektkaaeEDV  754
            +GWL+      EQL     A++  + + EQ   LV + L+H   Y +  +     A ++V
Sbjct  15   NGWLIRHRYFVEQLTC---ASSFDETNEEQQQSLVTQFLSHCLQYYQEKSSAVSLAGDNV  71

Query  753  FVFFASPWMSRLEQSFLWLSGFKPSMLFWVVESSMEGALSEEQRCKVGMLRAETARVENA  574
            F FF  PW +   +  LW+  FKPS++F + +S+++  L+  QR ++  LR+ET R E  
Sbjct  72   FTFFCPPWFTSYARLILWVGDFKPSLVFKLTDSTVDD-LTRHQRDRISSLRSETRRRERD  130

Query  573  ISKAMASAQETVAAPPILGLLKR--AEELVDGEVSELDAVMGDLKQSMGRLMGNADALRG  400
            + +  A  Q++VA PP++   +R  A  LVDGE S+L+  M  LK+ M R M +AD LR 
Sbjct  131  VMRDFALVQQSVADPPVMLAARRVGARGLVDGEESDLEEAMEVLKRGMARAMNSADELRC  190

Query  399  STASKILEILNPKQAVKFLTAV  334
            ST  K++EIL P QAVK L  +
Sbjct  191  STVGKVVEILTPSQAVKVLRTI  212



>ref|XP_010490486.1| PREDICTED: transcription factor TGA4-like [Camelina sativa]
Length=236

 Score =   121 bits (304),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 73/210 (35%), Positives = 114/210 (54%), Gaps = 7/210 (3%)
 Frame = -1

Query  945  EDFTAFYHGWLMNQDAIFEQLE-SFLaaaaaaddDREQCGGLVGRVLAH---YQeyyaek  778
            + FT+F +GWL+      EQL  +  +    +    E+   LV + L+H   Y +     
Sbjct  10   QSFTSFANGWLIRHRYFVEQLMCASSSDETNSITLEEEQQSLVTQFLSHCLQYYQEKYAA  69

Query  777  tkaaeEDVFVFFASPWMSRLEQSFLWLSGFKPSMLFWVVESSMEGALSEEQRCKVGMLRA  598
               A ++VF FF  PW S   +  LW+  FKPS++F + ++S++  L+  QR ++  LR+
Sbjct  70   VSIAGDNVFTFFCPPWFSSYAKLILWVGDFKPSLIFRLTDASVDD-LTSHQRDRISCLRS  128

Query  597  ETARVENAISKAMASAQETVAAPPILGLLKRAE--ELVDGEVSELDAVMGDLKQSMGRLM  424
            ET R E  + +  A  Q++VA PP++   +R     +VDGE ++L+  M  LK  M   M
Sbjct  129  ETRRKEREVMRDFALVQQSVADPPVMLAARRVGVVGMVDGEETDLEEAMEVLKSGMAAAM  188

Query  423  GNADALRGSTASKILEILNPKQAVKFLTAV  334
             NAD LR ST  K++EIL P QA+K L  +
Sbjct  189  NNADQLRCSTVGKVVEILTPSQAIKVLRTI  218



>ref|XP_010458320.1| PREDICTED: transcription factor TGA4-like [Camelina sativa]
Length=238

 Score =   121 bits (303),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 75/212 (35%), Positives = 113/212 (53%), Gaps = 9/212 (4%)
 Frame = -1

Query  945  EDFTAFYHGWLMNQDAIFEQL---ESFLaaaaaaddDREQCGGLVGRVLAH---YQeyya  784
            + FT+F +GWL       EQL    S  +    +    E+   LV + L+H   Y +   
Sbjct  10   QSFTSFANGWLNRHRYFVEQLMCASSSSSDETNSITLEEEQQSLVTQFLSHCLQYYQEKY  69

Query  783  ektkaaeEDVFVFFASPWMSRLEQSFLWLSGFKPSMLFWVVESSMEGALSEEQRCKVGML  604
                 A ++VF FF  PW S   +  LW+  FKPS++F + ++S++  L+  QR ++  L
Sbjct  70   AAVSIAGDNVFTFFCPPWFSSYAKLILWVGDFKPSLIFKLTDASVDD-LTSHQRDRISCL  128

Query  603  RAETARVENAISKAMASAQETVAAPPILGLLKRAE--ELVDGEVSELDAVMGDLKQSMGR  430
            R+ET R E  + +  A  Q++VA PP++   +R     +VDGE S+L+  M  LK  M  
Sbjct  129  RSETRRKEREVMRDFALVQQSVADPPVMLAARRVGVVGMVDGEESDLEEAMEVLKSGMAA  188

Query  429  LMGNADALRGSTASKILEILNPKQAVKFLTAV  334
             M NAD LR ST  K++EIL P QA+K L  +
Sbjct  189  AMNNADQLRCSTVGKVVEILTPSQAIKVLRTI  220



>emb|CDX93460.1| BnaA06g05880D [Brassica napus]
Length=230

 Score =   120 bits (302),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 74/202 (37%), Positives = 115/202 (57%), Gaps = 9/202 (4%)
 Frame = -1

Query  924  HGWLMNQDAIFEQLESFLaaaaaaddDREQCGGLVGRVLAH---YQeyyaektkaaeEDV  754
            +GWL+      EQL     A++  + + EQ   LV + L+H   Y +  +     A ++V
Sbjct  15   NGWLIRHRYFVEQLTC---ASSLDETNEEQQQSLVTQFLSHCLQYYQEKSSAVSLAGDNV  71

Query  753  FVFFASPWMSRLEQSFLWLSGFKPSMLFWVVESSMEGALSEEQRCKVGMLRAETARVENA  574
            F FF  PW +   +  LW+  FKPS++F + +S+++  L+  QR ++  LR+ET R E  
Sbjct  72   FTFFCPPWFTSYARLILWVGDFKPSLVFKLTDSTVDD-LTRHQRDRISSLRSETRRRERD  130

Query  573  ISKAMASAQETVAAPPILGLLKR--AEELVDGEVSELDAVMGDLKQSMGRLMGNADALRG  400
            + +  A  Q++VA PP++   +R  A  +VDGE S+L+  M  LK+ M R M +AD LR 
Sbjct  131  VMRDFALVQQSVADPPVMLAARRVGARGMVDGEESDLEEAMEVLKRGMARAMNSADELRC  190

Query  399  STASKILEILNPKQAVKFLTAV  334
            ST  K++EIL P QAVK L  +
Sbjct  191  STVGKVVEILTPSQAVKVLRTI  212



>ref|XP_004514219.1| PREDICTED: uncharacterized protein LOC101514340 [Cicer arietinum]
Length=231

 Score =   120 bits (301),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 78/221 (35%), Positives = 126/221 (57%), Gaps = 5/221 (2%)
 Frame = -1

Query  939  FTAFYHGWLMNQDAIFEQLESFLaaaaaaddDREQCGGLVGRVLAHYQeyyaektkaaeE  760
            F  F  GW++ Q    E+L S  A     + D      L+ RVL HY +YY EK+K A++
Sbjct  9    FEEFIQGWMVRQRNYLEELLS--AQQQRQELDDSDRMSLLNRVLCHYGQYYEEKSKIAQQ  66

Query  759  DVFVFFASPWMSRLEQSFLWLSGFKPSMLFWVVESSMEGALSEEQRCKVGMLRAETARVE  580
            ++ + F+ PW+S LE+SFLW++GFKP M F VV   +E  LS++Q+ ++  +  ET   E
Sbjct  67   NILLVFSPPWLSSLEKSFLWVAGFKPGMAFHVVNRVLED-LSQDQKQRLSQINQETKMKE  125

Query  579  NAISKAMASAQETVAAPPILGLLKRAEE--LVDGEVSELDAVMGDLKQSMGRLMGNADAL  406
              ++  +A   E++AAPP++ +++      L    ++E   V    K+++  L+ NADAL
Sbjct  126  RELNDELAKVHESMAAPPLVDMIRSHGRVCLSRSFMAEEGTVPMTFKETLENLVTNADAL  185

Query  405  RGSTASKILEILNPKQAVKFLTAVMRFQREARRWGLYNDSQ  283
            R  TA +++++L P Q + F  AV   Q + R  GL  D+Q
Sbjct  186  RTETALRVVQVLKPAQVLNFFVAVAELQIKIRSLGLDKDAQ  226



>ref|XP_004137901.1| PREDICTED: transcription factor TGA7-like [Cucumis sativus]
 ref|XP_004156668.1| PREDICTED: transcription factor TGA7-like [Cucumis sativus]
 gb|KGN58743.1| hypothetical protein Csa_3G731050 [Cucumis sativus]
Length=235

 Score =   120 bits (301),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 75/227 (33%), Positives = 127/227 (56%), Gaps = 14/227 (6%)
 Frame = -1

Query  948  GEDFTAFYHGWLMNQDAIFEQLESFLaaaaaaddDRE-QCGGLVGRVLAHYQeyyaektk  772
             + F AF+  WL+ Q      L+  L+ A     +R+ Q    + R+L+HY++YY +K++
Sbjct  8    ADSFKAFFEAWLLRQR---NYLDDLLSTAHGTPQNRDLQVS--ISRILSHYEDYYEKKSR  62

Query  771  aaeEDVFVFFASPWMSRLEQSFLWLSGFKPSMLFWVVESSMEGALSEEQRCKVGMLRAET  592
             A+ D+F+ F  PW +  E++ LW+ GF+P ++  +V  S++  LS+EQ  ++  L+ +T
Sbjct  63   IAQTDIFLVFTPPWFTTYEKTLLWIGGFRPGLIVRLVNQSIDD-LSDEQVVRIRRLKDDT  121

Query  591  ARVENAISKAMASAQETVAAPPILGLLKRA--EELVDGEVSELDAVMGDLKQSMGRLMGN  418
               E  ++  +A  QE VAAPP+L   +    + ++ GE     A M  LK +   ++ +
Sbjct  122  KVEERLLNNDLAKIQEKVAAPPLLEFFRHGGHDGVIGGE-----AAMESLKAAFQSVLAS  176

Query  417  ADALRGSTASKILEILNPKQAVKFLTAVMRFQREARRWGLYNDSQRE  277
            AD LR  TA K+ +IL P Q V+FL AV +     R  GL  D++R+
Sbjct  177  ADLLRRDTALKVTQILTPAQTVRFLAAVAQLHLRVRALGLQEDAKRD  223



>ref|XP_006303181.1| hypothetical protein CARUB_v10010176mg [Capsella rubella]
 gb|EOA36079.1| hypothetical protein CARUB_v10010176mg [Capsella rubella]
Length=234

 Score =   120 bits (300),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 75/219 (34%), Positives = 116/219 (53%), Gaps = 7/219 (3%)
 Frame = -1

Query  921  GWLMNQDAIFEQLESFLaaaaaaddDREQCGGLVGRVLAH---YQeyyaektkaaeEDVF  751
            GWL       EQL    +++++     EQ   LV + L+H   Y +        A ++VF
Sbjct  17   GWLTRHRYFVEQLTCASSSSSSDVTLEEQ-QSLVTQFLSHCLQYYQEKYAAVSIAGDNVF  75

Query  750  VFFASPWMSRLEQSFLWLSGFKPSMLFWVVESSMEGALSEEQRCKVGMLRAETARVENAI  571
             FF  PW S   +  LW+  FKPS++F + ++S++  L+  Q+ ++  LR++T R E  +
Sbjct  76   TFFCPPWFSSYAKLILWVGDFKPSLIFKLTDASVDD-LTSHQQDRISSLRSDTRRKEREV  134

Query  570  SKAMASAQETVAAPPILGLLKR--AEELVDGEVSELDAVMGDLKQSMGRLMGNADALRGS  397
             +  A  Q++VA PP++   +R  A  +VDGE S+L+  M  LK  M   M NAD LR S
Sbjct  135  MRDFALVQQSVADPPVMLAARRVGAVGMVDGEESDLEEAMEVLKSGMAAAMNNADQLRCS  194

Query  396  TASKILEILNPKQAVKFLTAVMRFQREARRWGLYNDSQR  280
            T  K++EIL P QA+K L  +       R   L +D +R
Sbjct  195  TVGKVVEILTPSQAIKVLRTIGELHLRLRELNLESDHER  233



>ref|XP_009338174.1| PREDICTED: transcription factor TGA2-like [Pyrus x bretschneideri]
Length=217

 Score =   119 bits (298),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 74/199 (37%), Positives = 117/199 (59%), Gaps = 3/199 (2%)
 Frame = -1

Query  939  FTAFYHGWLMNQDAIFEQLESFLaaaaaaddDREQCGGLVGRVLAHYQeyyaektkaaeE  760
            F AFY GWL+ Q    ++L S  A     +   E    LV RVL HYQ+YY EK++  + 
Sbjct  14   FEAFYEGWLVRQGHFLDELLS--AQQTIDEARDEDLRDLVSRVLFHYQQYYDEKSRLGQR  71

Query  759  DVFVFFASPWMSRLEQSFLWLSGFKPSMLFWVVESSMEGALSEEQRCKVGMLRAETARVE  580
            DV + F+  W +  E+S LW++G+K S++F +V  S+   LS++ R ++  LR  T   E
Sbjct  72   DVLLVFSPTWYTSYERSLLWIAGYKQSIVFQLVTESVSD-LSDQLRVRMARLREATRVEE  130

Query  579  NAISKAMASAQETVAAPPILGLLKRAEELVDGEVSELDAVMGDLKQSMGRLMGNADALRG  400
             A++   A   E+VAAPP +  ++R      GE+ E DAV+  LK ++  ++ NA+ LR 
Sbjct  131  RALNDKRAKIHESVAAPPFMDAVRRYRRAGHGEIVEDDAVIKSLKSALETVVENANLLRT  190

Query  399  STASKILEILNPKQAVKFL  343
            + A+K++++L+  QAVK L
Sbjct  191  TMATKLVDLLSSGQAVKIL  209



>ref|XP_008351887.1| PREDICTED: transcription factor TGA4-like, partial [Malus domestica]
Length=191

 Score =   118 bits (296),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 60/161 (37%), Positives = 104/161 (65%), Gaps = 1/161 (1%)
 Frame = -1

Query  759  DVFVFFASPWMSRLEQSFLWLSGFKPSMLFWVVESSMEGALSEEQRCKVGMLRAETARVE  580
            DV + F+  W +  E+S LW++G+KP ++F +V  S+   LS++QR ++  LR  T   E
Sbjct  15   DVLLVFSPTWYTSYERSLLWIAGYKPGIVFRLVTESVPD-LSDQQRVRIARLREATRVEE  73

Query  579  NAISKAMASAQETVAAPPILGLLKRAEELVDGEVSELDAVMGDLKQSMGRLMGNADALRG  400
             A++  +A   E+VAAP  + +++R      GE+ E DAV+  LK ++  ++ NA+ LR 
Sbjct  74   RALNDKLAKIHESVAAPQFMDVVRRYGRAGHGEIVEDDAVIKSLKSALETVVENANLLRT  133

Query  399  STASKILEILNPKQAVKFLTAVMRFQREARRWGLYNDSQRE  277
            + A+K++++L+  QAV+FLTAVM+FQ + R  GL  D++++
Sbjct  134  TMATKLVDLLSSGQAVRFLTAVMQFQLKIRSLGLERDAEKQ  174



>ref|XP_010511109.1| PREDICTED: transcription factor TGA4-like [Camelina sativa]
Length=231

 Score =   119 bits (297),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 75/222 (34%), Positives = 120/222 (54%), Gaps = 8/222 (4%)
 Frame = -1

Query  948  GEDFTAFYHGWLMNQDAIFEQLESFLaaaaaaddDREQCGGLVGRVLAH---YQeyyaek  778
             E FT+F++ WL+    + +QL  F     +   + E+   LV + L+H   Y +  +  
Sbjct  7    SETFTSFFNDWLLRHRQLIQQLAHFDDETISVTPEEEE--SLVTQFLSHCLQYYQEKSAA  64

Query  777  tkaaeEDVFVFFASPWMSRLEQSFLWLSGFKPSMLFWVVESSMEGALSEEQRCKVGMLRA  598
               A +D++ FF+ PW+S  E+  LW+ GFKP M+F ++ +S+   L+  Q+ ++  +R 
Sbjct  65   VSVAGDDIYDFFSPPWLSSCEKLILWIGGFKPGMVFKLITTSV-NDLTSHQKDQLESIRL  123

Query  597  ETARVENAISKAMASAQETVAAPPILGLLKR--AEELVDGEVSELDAVMGDLKQSMGRLM  424
            ET R E A+    A  Q++V  P ++   KR  A  L + E SE++  M  LK+ M   M
Sbjct  124  ETKRRERALMGRFAHLQQSVGDPLLMVPFKRIGALRLGEREQSEMEEAMEVLKREMKEAM  183

Query  423  GNADALRGSTASKILEILNPKQAVKFLTAVMRFQREARRWGL  298
             NAD LR  T  K++E+LNP QA+K L A   F  + R  G+
Sbjct  184  KNADQLRCVTVRKVVEVLNPGQAIKLLRAAGEFYLKLRDLGV  225



>ref|XP_010414743.1| PREDICTED: transcription factor TGA4-like [Camelina sativa]
Length=231

 Score =   119 bits (297),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 75/222 (34%), Positives = 120/222 (54%), Gaps = 8/222 (4%)
 Frame = -1

Query  948  GEDFTAFYHGWLMNQDAIFEQLESFLaaaaaaddDREQCGGLVGRVLAH---YQeyyaek  778
             E FT+F++ WL+    + +QL  F     +     E+   LV + L+H   Y +  +  
Sbjct  7    SETFTSFFNDWLLRHRQLIQQLAHFDDETTSVTPVEEE--SLVTQFLSHCLQYYQEKSAA  64

Query  777  tkaaeEDVFVFFASPWMSRLEQSFLWLSGFKPSMLFWVVESSMEGALSEEQRCKVGMLRA  598
               A +D++ FF+ PW+S  E+  LW+ GFKP M+F ++ +S+   L+ +Q+ ++  +R 
Sbjct  65   VSVAGDDIYDFFSPPWLSSCEKLILWIGGFKPGMVFKLITTSV-NDLTCQQKDQLESIRL  123

Query  597  ETARVENAISKAMASAQETVAAPPILGLLKR--AEELVDGEVSELDAVMGDLKQSMGRLM  424
            ET R E A+    A  Q++V  P +L   KR  A  L + E S+++  M  LK+ M   M
Sbjct  124  ETKRRERALMGRFAHLQQSVGDPLLLVPFKRIGASRLGEREQSKMEEAMEVLKREMKEAM  183

Query  423  GNADALRGSTASKILEILNPKQAVKFLTAVMRFQREARRWGL  298
             NAD LR  T  K++E+LNP QA+K L A   F  + R  G+
Sbjct  184  KNADQLRCVTVRKVVEVLNPGQAIKLLRAAGEFYFKLRDLGV  225



>ref|XP_008442399.1| PREDICTED: transcription factor HBP-1b(c38) [Cucumis melo]
Length=235

 Score =   119 bits (297),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 77/224 (34%), Positives = 127/224 (57%), Gaps = 10/224 (4%)
 Frame = -1

Query  948  GEDFTAFYHGWLMNQDAIFEQLESFLaaaaaaddDRE-QCGGLVGRVLAHYQeyyaektk  772
             + F AF+  WL+ Q      L+  L+AA  +  +R+ Q    + R+L+HY++YY +K++
Sbjct  8    ADSFKAFFEAWLLRQR---NYLDDLLSAAHGSPHNRDLQVS--ISRILSHYEDYYEKKSR  62

Query  771  aaeEDVFVFFASPWMSRLEQSFLWLSGFKPSMLFWVVESSMEGALSEEQRCKVGMLRAET  592
             A+ D+F+ F  PW +  E++ LW+ GF+P ++  +V  S++  LS+EQ  ++  L+ +T
Sbjct  63   IAQTDIFLVFTPPWFTTYERTLLWIGGFRPGLIIRLVNQSIDD-LSDEQVVRIRRLKDDT  121

Query  591  ARVENAISKAMASAQETVAAPPILGLLKRAEELVDGEVSELDAVMGDLKQSMGRLMGNAD  412
               E  ++  +A  QE VAAPP+L   +      DG V   +A M  LK +   ++ +AD
Sbjct  122  KIEERLLNNDLAKIQEKVAAPPLLEFFRHGGH--DGAVGGEEA-METLKAAFQSVLASAD  178

Query  411  ALRGSTASKILEILNPKQAVKFLTAVMRFQREARRWGLYNDSQR  280
             LR  TA K+ +IL P Q V+FL AV +     R  GL  D++R
Sbjct  179  LLRRDTALKVTQILTPAQTVRFLAAVAQLHLRVRALGLQEDARR  222



>ref|XP_002272259.1| PREDICTED: transcription factor TGA3-like [Vitis vinifera]
Length=237

 Score =   119 bits (297),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 82/221 (37%), Positives = 121/221 (55%), Gaps = 8/221 (4%)
 Frame = -1

Query  939  FTAFYHGWLMNQDAIFEQLESFLaaaaaaddDREQCG--GLVGRVLAHYQeyyaektkaa  766
            F  F+ GWL+ Q    E+L   L  A   D D E+ G   L+GR +AHY EYY  K +  
Sbjct  15   FERFFRGWLVRQ----EELRQLLLQATERDCD-EEAGLQELIGRAVAHYAEYYKAKQRVV  69

Query  765  eEDVFVFFASPWMSRLEQSFLWLSGFKPSMLFWVVESSMEGALSEEQRCKVGMLRAETAR  586
             EDV +    PW++  E+S LW+ GFKP   F +V + +   L+EEQ+ ++  LRAETA 
Sbjct  70   REDVLILLGPPWLTPFERSLLWIGGFKPGFAFRLVTNYVTN-LTEEQKQRMEQLRAETAE  128

Query  585  VENAISKAMASAQETVAAPPILGLLKRAEELVDGEVSELDAVMGDLKQSMGRLMGNADAL  406
             E  ++  ++  +    A  ++ +   A E V+GE   +D  +  +K +   L+  AD L
Sbjct  129  DERKLTAELSRVRTRPTAISLVEMATMARERVNGERDTVDERIEMMKLAAEILVECADYL  188

Query  405  RGSTASKILEILNPKQAVKFLTAVMRFQREARRWGLYNDSQ  283
            R  TA KI+ ILNP Q VKFL AV + QR  R W +  +++
Sbjct  189  RCKTALKIMGILNPSQNVKFLLAVTQLQRRVRNWRMEREAE  229



>emb|CDP06468.1| unnamed protein product [Coffea canephora]
Length=249

 Score =   118 bits (296),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 76/227 (33%), Positives = 129/227 (57%), Gaps = 7/227 (3%)
 Frame = -1

Query  939  FTAFYHGWLMNQDAIFEQLESFLaaaaaaddDREQ--CGGLVGRVLAHYQeyyaektkaa  766
            F AF+  WL+ Q    ++L S   +++      +    G L+ RVLAHYQEYY EK++ A
Sbjct  16   FQAFFEDWLVRQQRFLDELLSAQESSSTTSRIDDTDVVGDLIARVLAHYQEYYDEKSRMA  75

Query  765  eEDVFVFFASPWMSRLEQSFLWLSGFKPSMLFWVVESSMEGALSEEQRCKVGMLRAETAR  586
              +VF+ F+  W + LE++FLW++GFKP ++  +   S++  L+E+Q  ++  L  ET  
Sbjct  76   HRNVFLAFSPTWFTPLERTFLWIAGFKPGLVCRLALGSLDD-LTEDQIHRINGLSRETNW  134

Query  585  VENAISKAMASAQETVAAPPILGLLK----RAEELVDGEVSELDAVMGDLKQSMGRLMGN  418
             E  + + MA  QE+VA+PP++ L +    + +     ++ ++D  +  LK +M  ++ +
Sbjct  135  QEKLLDQKMAKIQESVASPPLVDLARSEGMQIQSATGSDIDDVDNQIEPLKSAMQNILRD  194

Query  417  ADALRGSTASKILEILNPKQAVKFLTAVMRFQREARRWGLYNDSQRE  277
            AD LR  TA  +  IL+P Q V+FL+A  R Q   R  G   ++ R+
Sbjct  195  ADGLRTRTAETMAGILSPLQNVRFLSAAARLQFRIRMLGFQREADRQ  241



>ref|XP_009118288.1| PREDICTED: TGACG-sequence-specific DNA-binding protein TGA-2.1-like 
[Brassica rapa]
Length=231

 Score =   118 bits (295),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 71/209 (34%), Positives = 113/209 (54%), Gaps = 6/209 (3%)
 Frame = -1

Query  945  EDFTAFYHGWLMNQDAIFEQLESFLaaaaaaddDREQCGGLVGRVLAH---YQeyyaekt  775
            + FT+F +GWL+      EQL    ++        +    LV + L+H   Y +  +   
Sbjct  8    QSFTSFANGWLIRHRHFVEQLACASSSDETNRITLQDQQFLVTQFLSHCLQYYQAKSSAV  67

Query  774  kaaeEDVFVFFASPWMSRLEQSFLWLSGFKPSMLFWVVESSMEGALSEEQRCKVGMLRAE  595
              A ++VF FF+ PW +   +  LW+  FKPS++F + +SS++  L+  Q+ ++  LRAE
Sbjct  68   SVAGDNVFTFFSPPWFTSYARLILWVGDFKPSLVFKLTDSSVDD-LTRRQKDRILSLRAE  126

Query  594  TARVENAISKAMASAQETVAAPPILGLLKR--AEELVDGEVSELDAVMGDLKQSMGRLMG  421
            T R E  + +  A  Q++VA PP++   +   A  +VDGE S+L+  M  LK  M   M 
Sbjct  127  TRRKERDVMRDFALVQQSVADPPVMAAARGVGARGMVDGEESDLEEAMEVLKNGMAAAMN  186

Query  420  NADALRGSTASKILEILNPKQAVKFLTAV  334
             AD LR +T  +++EIL P QAVK L  +
Sbjct  187  EADELRCATVGRVVEILTPSQAVKVLRTI  215



>emb|CDX94928.1| BnaC05g07430D [Brassica napus]
Length=230

 Score =   116 bits (290),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 76/220 (35%), Positives = 120/220 (55%), Gaps = 10/220 (5%)
 Frame = -1

Query  924  HGWLMNQDAIFEQLESFLaaaaaaddDREQCGGLVGRVLAH---YQeyyaektkaaeEDV  754
            +GWL+      EQL     A++  + ++EQ   LV + L+H   Y +  +     A +++
Sbjct  15   NGWLIRHRYFVEQLTC---ASSFDETNQEQQQSLVTQFLSHCLQYYQEKSSAVSLAGDNI  71

Query  753  FVFFASPWMSRLEQSFLWLSGFKPSMLFWVVESSMEGALSEEQRCKVGMLRAETARVENA  574
            F FF  PW +   +  LW+  FKPS++F + +S+++  L+  QR ++  LR+ET R E  
Sbjct  72   FTFFCPPWFTPYARLILWVGDFKPSLVFKLTDSTVDD-LTRHQRDRLSSLRSETRRRERD  130

Query  573  ISKAMASAQETVAAPPILGLLKR--AEELVDGEVSELDAVMGDLKQSMGRLMGNADALRG  400
            + +  A  Q++VA PP++   +R  A  +VDGE S+L+  M  L++ M R M +AD LR 
Sbjct  131  VMRDFALVQQSVADPPVMLAARRVGARGMVDGEESDLEEAMDVLRRGMARAMNSADELRC  190

Query  399  STASKILEILNPKQAVKFLTAVMRFQREARRW-GLYNDSQ  283
            ST  K++EIL   QAVK L  +       R   GL  D Q
Sbjct  191  STVGKVVEILTSSQAVKVLRTIGELHFRLRELVGLERDHQ  230



>ref|XP_004301438.1| PREDICTED: uncharacterized protein LOC101313994 [Fragaria vesca 
subsp. vesca]
Length=124

 Score =   112 bits (281),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 58/119 (49%), Positives = 77/119 (65%), Gaps = 0/119 (0%)
 Frame = -1

Query  639  LSEEQRCKVGMLRAETARVENAISKAMASAQETVAAPPILGLLKRAEELVDGEVSELDAV  460
            L  EQ  ++  L+ ET R E  +S+ MA  QE+VAAPPIL  ++R   L+DG++S LD  
Sbjct  5    LRPEQVTELDRLKLETRRSERELSETMARIQESVAAPPILATVRRVGRLMDGQISTLDEA  64

Query  459  MGDLKQSMGRLMGNADALRGSTASKILEILNPKQAVKFLTAVMRFQREARRWGLYNDSQ  283
            M +LK +M RL+ +AD LRGST  K++E+L+P Q VK L AV  FQ   R WGL  D Q
Sbjct  65   MEELKAAMLRLIESADGLRGSTVRKVVEVLSPSQTVKVLAAVAEFQLRIRSWGLQRDQQ  123



>ref|XP_006417512.1| hypothetical protein EUTSA_v10008665mg [Eutrema salsugineum]
 gb|ESQ35865.1| hypothetical protein EUTSA_v10008665mg [Eutrema salsugineum]
Length=231

 Score =   115 bits (287),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 77/220 (35%), Positives = 115/220 (52%), Gaps = 10/220 (5%)
 Frame = -1

Query  924  HGWLMNQDAIFEQLESFLaaaaaaddDREQCGGLVGRVLAH---YQeyyaektkaaeEDV  754
            +GWL       EQL     A++  +   E+   LV + L+H   Y +  +     A ++V
Sbjct  16   NGWLTRHRYFVEQLTC---ASSLDEITVEEQQSLVTQFLSHCLQYYQEKSAVVSLAGDNV  72

Query  753  FVFFASPWMSRLEQSFLWLSGFKPSMLFWVVESSMEGALSEEQRCKVGMLRAETARVENA  574
            F FF  PW S   +  LW+  FKPS++F + E+S++  L+  Q+  +  LR+ET R E  
Sbjct  73   FTFFCPPWFSSYAKLILWVGDFKPSLVFKLTEASVDD-LTRHQQDLISSLRSETRRKERD  131

Query  573  ISKAMASAQETVAAPPILGLLKRA--EELVDGEVSELDAVMGDLKQSMGRLMGNADALRG  400
            + +  A  Q++VA PP++   +R    E+VDGE S+L+  M  LK  M   M NAD LR 
Sbjct  132  VIRDYALVQQSVADPPVMLAARRVGVSEMVDGEESDLEEAMEVLKSGMAAAMNNADQLRC  191

Query  399  STASKILEILNPKQAVKFLTAVMRFQREARRW-GLYNDSQ  283
            ST  K++EIL P QA+K L  +       R   GL  D +
Sbjct  192  STVGKVVEILTPSQAIKVLRTIGELHLRLRELVGLEGDHE  231



>emb|CDY22613.1| BnaC08g42470D [Brassica napus]
Length=232

 Score =   114 bits (284),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 74/212 (35%), Positives = 113/212 (53%), Gaps = 9/212 (4%)
 Frame = -1

Query  948  GEDFTAFYHGWLMNQDAIFEQLESFLaaaaaaddDREQCGGLVGRVLAH---YQeyyaek  778
             + FT+F +GWL+      EQL    +         +    LV + L+H   Y +  +  
Sbjct  7    SQSFTSFANGWLIRHRHFVEQLACASSLDETNRITLQDQQFLVTQFLSHCLQYYQEKSSA  66

Query  777  tkaaeEDVFVFFASPW-MSRLEQSFLWLSGFKPSMLFWVVESSMEGALSEEQRCKVGMLR  601
               A ++VF FF+ PW  S   +  LW+  FKPS++F + +SS++  L+  QR ++  LR
Sbjct  67   VSVAGDNVFTFFSPPWFTSSYARLILWVGDFKPSLVFKLTDSSVDD-LTRHQRDRISTLR  125

Query  600  AETARVENAISKAMASAQETVAAPPILGLLKR---AEELVDGEVSELDAVMGDLKQSMGR  430
            AET R E  + +  A  Q++VA PP++ L  R   A  +VDGE S+L+  M  LK  M  
Sbjct  126  AETRRKERDVMRDFALVQQSVADPPVM-LAARGVGARGMVDGEESDLEEAMEVLKNGMAA  184

Query  429  LMGNADALRGSTASKILEILNPKQAVKFLTAV  334
             M +AD LR +T  +++EIL   QAVK L  +
Sbjct  185  AMNDADELRCATVGRVVEILTTSQAVKVLRTI  216



>ref|XP_006301016.1| hypothetical protein CARUB_v10021407mg [Capsella rubella]
 gb|EOA33914.1| hypothetical protein CARUB_v10021407mg [Capsella rubella]
Length=234

 Score =   113 bits (283),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 75/224 (33%), Positives = 118/224 (53%), Gaps = 9/224 (4%)
 Frame = -1

Query  948  GEDFTAFYHGWLMNQDAIFEQLESFLaaaaaaddDREQCGGLVGRVLAH---YQeyyaek  778
             E F  F+  WL +   + EQL  F   A+ +    E+   LV + L+H   Y +  +  
Sbjct  7    SETFATFFDDWLNHHRQLIEQLAHFADEASTSVTQVEE-ESLVTKFLSHCLQYYQEKSSA  65

Query  777  tkaaeEDVFVFFASPWMSRLEQSFLWLSGFKPSMLFWVVESSMEGALSEEQRCKVGMLRA  598
               A ED++ FF+ PW++  E+  LW+ GFKP M+F ++ +S+   L+  Q+ ++  +R 
Sbjct  66   MSVAGEDLYDFFSPPWLNSYEKLILWIGGFKPGMVFKLITTSV-NDLTSHQKDQLESIRL  124

Query  597  ETARVENAISKAMASAQETVAAPPILGLLKRAEELVDGEVSEL----DAVMGDLKQSMGR  430
            ET R E A+++  A  Q++V  P ++   K    L  GE  +     +  M  LK+ M  
Sbjct  125  ETQRRERALTRGFALLQQSVGDPLLMVRFKNIGALRLGEREQPGMKEEEAMEVLKKEMTE  184

Query  429  LMGNADALRGSTASKILEILNPKQAVKFLTAVMRFQREARRWGL  298
            +M NAD LR  T  K++E+LNP+QAVK L AV  F    R  G+
Sbjct  185  VMKNADQLRCVTVEKVVEVLNPRQAVKLLRAVGEFYLRLRDLGV  228



>ref|XP_007226122.1| hypothetical protein PRUPE_ppa013318mg [Prunus persica]
 gb|EMJ27321.1| hypothetical protein PRUPE_ppa013318mg [Prunus persica]
Length=129

 Score =   109 bits (273),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 57/121 (47%), Positives = 83/121 (69%), Gaps = 1/121 (1%)
 Frame = -1

Query  708  FLWLSGFKPSMLFWVVESSMEGALSEEQRCKVGMLRAETARVENAISKAMASAQETVAAP  529
             LWL+GFKPS++  +V+SS+E  L+ EQ  ++  ++ ET R E  +S+ MA  QE+VAAP
Sbjct  1    MLWLAGFKPSLVLRMVDSSVED-LTAEQAREMEAVKGETRRAERELSETMARIQESVAAP  59

Query  528  PILGLLKRAEELVDGEVSELDAVMGDLKQSMGRLMGNADALRGSTASKILEILNPKQAVK  349
            PIL L +R   L+DGE+S LD  M  LK +M  +  +A+ LRGST  K++E+L+P+Q VK
Sbjct  60   PILALARRVGRLMDGEISSLDLAMETLKTAMLGVFESANGLRGSTVRKVVEVLSPEQTVK  119

Query  348  F  346
             
Sbjct  120  I  120



>ref|XP_008807787.1| PREDICTED: transcription factor HBP-1b(c38)-like [Phoenix dactylifera]
Length=216

 Score =   110 bits (275),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 71/186 (38%), Positives = 109/186 (59%), Gaps = 10/186 (5%)
 Frame = -1

Query  825  LVGRVLAHYQeyyaektkaaeEDVFVFFASPWMSRLEQSFLWLSGFKPSMLFWVVES---  655
            LV R LAH+Q+YY +K + A  DV   F+  W++  E+SFLW++G+KPS+ F ++ S   
Sbjct  33   LVARALAHHQDYYHQKARLAARDVLRVFSPRWLTPFERSFLWIAGWKPSIAFRLLRSLDD  92

Query  654  --SMEGALSEEQRCKVGMLRAETARVENAISKAMASAQETVAAPPILGLLKRAEELVDGE  481
                + + S EQR  V +L+ ETA  E A+S+ MA AQE +A P +L     A  + +GE
Sbjct  93   DDDGDASHSPEQRRAVAVLQRETASAERALSEDMARAQEAMALPQVLAA---ARGVRNGE  149

Query  480  VSELDAVMGDLKQSMGRLMGNADALRGSTASKILEILNPKQAVKFLTAVMRFQREARRWG  301
                 A M  + +S+  L+ +ADALR  T +++++IL P Q V FL A  + +    RWG
Sbjct  150  ARAEAAEM--VVRSLELLLASADALRARTVTRLVDILTPAQTVDFLLAAAQLRLRVHRWG  207

Query  300  LYNDSQ  283
            +  D +
Sbjct  208  MRRDGR  213



>ref|NP_172466.1| response to ABA and salt 1 [Arabidopsis thaliana]
 gb|AAB60750.1| Similar to Nicotiana tumor-related protein (gb|26453) [Arabidopsis 
thaliana]
 gb|AAS76699.1| At1g09950 [Arabidopsis thaliana]
 gb|AAS92316.1| At1g09950 [Arabidopsis thaliana]
 dbj|BAF00861.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE28520.1| response to ABA and salt 1 [Arabidopsis thaliana]
Length=230

 Score =   109 bits (273),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 72/210 (34%), Positives = 109/210 (52%), Gaps = 6/210 (3%)
 Frame = -1

Query  948  GEDFTAFYHGWLMNQDAIFEQLESFLaaaaaaddDREQCGGLVGRVLAH---YQeyyaek  778
             + FT F  GWL+      EQL    +         E+   LV + L+H   Y +     
Sbjct  7    SQSFTIFVDGWLIRHRYFVEQLMCASSLDETNRISLEEQQSLVAQFLSHCLQYYQEKFAS  66

Query  777  tkaaeEDVFVFFASPWMSRLEQSFLWLSGFKPSMLFWVVESSMEGALSEEQRCKVGMLRA  598
               A ++VF FF  PW +   +  LW+  FKPS++F + E S+   L+  Q+ ++  L++
Sbjct  67   VSLAGDNVFTFFCPPWFNSYAKLILWVGDFKPSLVFKLTEVSV-ADLTRHQKDRISSLKS  125

Query  597  ETARVENAISKAMASAQETVAAPPILGLLKR--AEELVDGEVSELDAVMGDLKQSMGRLM  424
            ET R E  + +  A  Q++VA PP++   +R  A  +VDGE ++L+  M  LK  M   M
Sbjct  126  ETRRKEREVMRDFALVQQSVADPPVMLAARRVGAVGMVDGEETDLEEAMEVLKAGMAAAM  185

Query  423  GNADALRGSTASKILEILNPKQAVKFLTAV  334
             NAD LR ST  K++EIL P QA+K L  +
Sbjct  186  NNADQLRCSTVGKVVEILTPPQAIKVLRTI  215



>ref|XP_002272336.1| PREDICTED: transcription factor TGA5-like [Vitis vinifera]
Length=240

 Score =   109 bits (272),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 78/227 (34%), Positives = 115/227 (51%), Gaps = 7/227 (3%)
 Frame = -1

Query  948  GEDFTAFYHGWLMNQDAIFEQLESFLaaaaaaddDREQC--GGLVGRVLAHYQeyyaekt  775
             E F  F+ GWL+  + +   L+           + E+     L+GRV+AHY EYY  K 
Sbjct  10   SEPFEIFFRGWLVRHEEVRLLLQQADERDCDETREDEEARVQELIGRVVAHYAEYYKAKQ  69

Query  774  kaaeEDVFVFFASPWMSRLEQSFLWLSGFKPSMLFWVVESSMEGALSEEQRCKVGMLRAE  595
            +   EDV   F  PW++  E+S LW++GF P   F +V + ++  L+ EQ   +  L+ E
Sbjct  70   RVVREDVMTLFEPPWLTPFERSLLWIAGFMPGFAFRLVMNYVKD-LNGEQTRMMEQLKTE  128

Query  594  TARVENAISKAMASAQETVAAPPILGLLKRAEELVDGEVSELDAVMGDLKQSMGRLMGNA  415
            TA  E  ++  +   + +     ++ +  R  E  DGE   +   +  +K +M  L+  A
Sbjct  129  TAAEEIDLTAELVKVKRSPTMISLVEMAARGREWADGERDAVKEKIDMVKLAMEMLVECA  188

Query  414  DALRGSTASKILEILNPKQAVKFLTAVMRFQREARRWGLYNDSQREA  274
            D LR  TA KI+EILNP Q VKFL A+   Q   R WGL    QREA
Sbjct  189  DCLRYKTALKIMEILNPSQNVKFLLAITGLQLRVRNWGL----QREA  231



>ref|XP_002892539.1| hypothetical protein ARALYDRAFT_471106 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68798.1| hypothetical protein ARALYDRAFT_471106 [Arabidopsis lyrata subsp. 
lyrata]
Length=234

 Score =   108 bits (271),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 74/219 (34%), Positives = 110/219 (50%), Gaps = 6/219 (3%)
 Frame = -1

Query  921  GWLMNQDAIFEQLESFLaaaaaaddDREQCGGLVGRVLAH---YQeyyaektkaaeEDVF  751
            GWL+      EQL    +         E+   LV + L+H   Y +        A ++VF
Sbjct  16   GWLIRHRYFVEQLTCASSLDETNRISLEEQQSLVTQFLSHCLQYYQEKFAAVSVAGDNVF  75

Query  750  VFFASPWMSRLEQSFLWLSGFKPSMLFWVVESSMEGALSEEQRCKVGMLRAETARVENAI  571
             FF  PW +   +  LW+  FKPS++F + E S++  L+  Q+ ++  L++ET R E  +
Sbjct  76   TFFCPPWFNSYAKLILWVGDFKPSLVFKLTEVSVDN-LTRHQKDRISSLKSETMRKEREV  134

Query  570  SKAMASAQETVAAPPILGLLKR--AEELVDGEVSELDAVMGDLKQSMGRLMGNADALRGS  397
             +  A  Q++VA PP++   +R  A  +VDGE S+L+  M  LK  M   M NAD LR S
Sbjct  135  MRDFALVQQSVADPPVMLAARRVGAVGMVDGEESDLEEAMEVLKAGMAAAMNNADQLRCS  194

Query  396  TASKILEILNPKQAVKFLTAVMRFQREARRWGLYNDSQR  280
            T  K++EIL P QA+K L  +       R      D QR
Sbjct  195  TVGKVVEILTPPQAIKVLKTIGELHLRLREVNSERDHQR  233



>ref|XP_009350620.1| PREDICTED: transcription factor TGA4-like [Pyrus x bretschneideri]
Length=236

 Score =   108 bits (269),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 56/147 (38%), Positives = 97/147 (66%), Gaps = 1/147 (1%)
 Frame = -1

Query  717  EQSFLWLSGFKPSMLFWVVESSMEGALSEEQRCKVGMLRAETARVENAISKAMASAQETV  538
            E+S LW++G+KP ++FW+V  S+   L+++QR ++  LR  T   E A++  +A   E+V
Sbjct  78   ERSLLWIAGYKPGIVFWLVTESVPD-LNDQQRVRMARLRKATRVEERALNDKLAKIHESV  136

Query  537  AAPPILGLLKRAEELVDGEVSELDAVMGDLKQSMGRLMGNADALRGSTASKILEILNPKQ  358
            AAPP +  ++R      GE+ E +AV+  LK ++  ++ NA+ LR + A+K++++L+  Q
Sbjct  137  AAPPFMDAVRRYGSAGHGEIVEDNAVIKSLKSALETVVENANLLRTTMATKLVDLLSSGQ  196

Query  357  AVKFLTAVMRFQREARRWGLYNDSQRE  277
            AVKFLTAVM+FQ +    GL  D++++
Sbjct  197  AVKFLTAVMQFQLKIWSLGLERDAEKQ  223



>ref|XP_002888220.1| hypothetical protein ARALYDRAFT_893661 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH64479.1| hypothetical protein ARALYDRAFT_893661 [Arabidopsis lyrata subsp. 
lyrata]
Length=230

 Score =   107 bits (268),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 74/228 (32%), Positives = 119/228 (52%), Gaps = 9/228 (4%)
 Frame = -1

Query  948  GEDFTAFYHGWLMNQDAIFEQLESFLaaaaaaddDREQCGGLVGRVLAH---YQeyyaek  778
             E F +F++ WL+      ++L S LA         E+   L+   L+H   Y E  +  
Sbjct  7    SETFASFFNDWLLRHRQFVQEL-SHLADETTRTPVEEE--SLLSNFLSHCLQYYEEKSVA  63

Query  777  tkaaeEDVFVFFASPWMSRLEQSFLWLSGFKPSMLFWVVESSMEGALSEEQRCKVGMLRA  598
               A +DV+ FF+ PW+S  E+  LW+ GFKP M+F ++ +S+   L+  Q  ++  +R 
Sbjct  64   MSVAGDDVYDFFSPPWLSSYEKLILWIGGFKPGMVFKLITTSV-NDLTSHQIDQLENIRL  122

Query  597  ETARVENAISKAMASAQETVAAPPILGLLKR--AEELVDGEVSELDAVMGDLKQSMGRLM  424
            ET R E  + +  A  Q++V  P ++   +R     L +GE SE++  M  +K+ M   M
Sbjct  123  ETKRRERDLMRRFALLQQSVGDPLLMVPFRRIGVLSLGEGEQSEMEEAMDVMKEEMITAM  182

Query  423  GNADALRGSTASKILEILNPKQAVKFLTAVMRFQREARRWGLYNDSQR  280
             NAD LR  T  K++E+LNP+QA+K L A   F    R  G+  ++ R
Sbjct  183  KNADQLRCVTVGKVVEVLNPRQAIKLLRAAGEFYLLLRDLGVQIETVR  230



>dbj|BAH30346.1| hypothetical protein [Arabidopsis thaliana]
Length=225

 Score =   107 bits (267),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 70/222 (32%), Positives = 111/222 (50%), Gaps = 8/222 (4%)
 Frame = -1

Query  948  GEDFTAFYHGWLMNQDAIFEQLESFLaaaaaaddDREQCGGLVGRVLAHY---Qeyyaek  778
             E F +F++ WL       +QL              E+   LV   L+HY    E  +  
Sbjct  7    SETFASFFNDWLCRHRQFVQQLAHLADKTTIVTPIEEE--SLVSNFLSHYLQYYEEKSVA  64

Query  777  tkaaeEDVFVFFASPWMSRLEQSFLWLSGFKPSMLFWVVESSMEGALSEEQRCKVGMLRA  598
               A +D++ FF+ PW+S  E+  LW+ GFKP M+F ++ +S+   L+  Q  ++  +R 
Sbjct  65   MSVAGDDIYDFFSPPWLSSYEKLILWIGGFKPGMVFKLITTSVND-LTSHQIDQLESIRL  123

Query  597  ETARVENAISKAMASAQETVAAPPILGLLKR--AEELVDGEVSELDAVMGDLKQSMGRLM  424
            ET R E  + +  A  Q++V  P ++   +R     L +GE  E++  M  LK  M + M
Sbjct  124  ETKRRERDLMRRFALLQQSVGDPLLMVPFRRIGVLRLGEGEQPEMEDAMEVLKVEMIKAM  183

Query  423  GNADALRGSTASKILEILNPKQAVKFLTAVMRFQREARRWGL  298
             NAD LR  T  K++E+LNP+Q++K L A   F    R  G+
Sbjct  184  KNADQLRCVTVGKVVEVLNPRQSIKLLRAAGEFYLRLRDLGV  225



>ref|NP_564730.1| protein ZW2 [Arabidopsis thaliana]
 gb|AAF82255.1|AC008051_6 Identical to gene ZW2 from Arabidopsis thaliana gb|AB028196 [Arabidopsis 
thaliana]
 dbj|BAA87938.1| ZW2 [Arabidopsis thaliana]
 gb|ABF19046.1| At1g58330 [Arabidopsis thaliana]
 gb|AEE33536.1| transcription factor-like protein [Arabidopsis thaliana]
Length=225

 Score =   107 bits (267),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 70/222 (32%), Positives = 111/222 (50%), Gaps = 8/222 (4%)
 Frame = -1

Query  948  GEDFTAFYHGWLMNQDAIFEQLESFLaaaaaaddDREQCGGLVGRVLAHY---Qeyyaek  778
             E F +F++ WL       +QL              E+   LV   L+HY    E  +  
Sbjct  7    SETFASFFNDWLCRHRQFVQQLAHLADETTIVTPIEEE--SLVSNFLSHYLQYYEEKSVA  64

Query  777  tkaaeEDVFVFFASPWMSRLEQSFLWLSGFKPSMLFWVVESSMEGALSEEQRCKVGMLRA  598
               A +D++ FF+ PW+S  E+  LW+ GFKP M+F ++ +S+   L+  Q  ++  +R 
Sbjct  65   MSVAGDDIYDFFSPPWLSSYEKLILWIGGFKPGMVFKLITTSVND-LTSHQIDQLESIRL  123

Query  597  ETARVENAISKAMASAQETVAAPPILGLLKR--AEELVDGEVSELDAVMGDLKQSMGRLM  424
            ET R E  + +  A  Q++V  P ++   +R     L +GE  E++  M  LK  M + M
Sbjct  124  ETKRRERDLMRRFALLQQSVGDPLLMVPFRRIGVLRLGEGEQPEMEDAMEVLKVEMIKAM  183

Query  423  GNADALRGSTASKILEILNPKQAVKFLTAVMRFQREARRWGL  298
             NAD LR  T  K++E+LNP+Q++K L A   F    R  G+
Sbjct  184  KNADQLRCVTVGKVVEVLNPRQSIKLLRAAGEFYLRLRDLGV  225



>gb|ACD56655.1| predicted protein [Gossypioides kirkii]
Length=253

 Score =   105 bits (261),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 81/237 (34%), Positives = 127/237 (54%), Gaps = 17/237 (7%)
 Frame = -1

Query  951  VGEDFTAFYHGWLMNQDAIFEQLESFLaaaaaaddDREQCGGLVGRVLAHYQeyyaektk  772
            VGE F+ F+  W+   D   +QL   +   +    + EQ   LV ++ AHY+EYY  K  
Sbjct  5    VGERFSEFFDKWICQLDGYLQQL---VRVPSEGLSESEQ-QALVSKLTAHYKEYYTVKWA  60

Query  771  aaeEDVFVFFASPWMSRLEQSFLWLSGFKPSMLFWVVESSMEGA---LSEEQRCKVGMLR  601
            AA EDV VF+   W+S+LE ++ WL+G+KPSM+F VVES+   +   L+EEQ  K+  LR
Sbjct  61   AAHEDVLVFYCPVWLSKLENAYSWLTGWKPSMIFGVVESTRRKSVAELTEEQVRKIEQLR  120

Query  600  AETARVENAISKAMASAQETVAAPPILGLLK-----RAEELV----DGEVSEL-DAVMGD  451
             +    E  + + M   Q  +A   ++ L++     R EELV    + +V  L +  +  
Sbjct  121  VKIKLEEEKVEREMERQQVAMADRKVVELVRTARRIRNEELVVVVGNHQVEGLVEVALKG  180

Query  450  LKQSMGRLMGNADALRGSTASKILEILNPKQAVKFLTAVMRFQREARRWGLYNDSQR  280
            +   + R+M  AD +R      +L+ILNP Q++ FL      Q + R+WG   D+Q+
Sbjct  181  VLAGLERVMKAADCVRLKALKGVLDILNPSQSLDFLAGTCMLQIQIRKWGQNRDNQK  237



>ref|XP_009617985.1| PREDICTED: transcription factor TGA5-like [Nicotiana tomentosiformis]
Length=234

 Score =   104 bits (259),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 71/228 (31%), Positives = 121/228 (53%), Gaps = 14/228 (6%)
 Frame = -1

Query  945  EDFTAFYHGWLMNQDAIFEQLESFLaaaaaaddDREQCGG----LVGRVLAHYQeyyaek  778
            E F  F+  WL+ Q+   +QL        +++   E C      ++ +VLAHY+ YY  K
Sbjct  16   ESFETFFQSWLIEQERYLQQL-----LRLSSESCNENCISEKRLIIDQVLAHYRAYYIAK  70

Query  777  tkaaeEDVFVFFASPWMSRLEQSFLWLSGFKPSMLFWVVESSMEGALSEEQRCKVGMLRA  598
            +K  +E+VF+  +  W +  E+++LW++GF+P + F +V  ++   LS  Q   +  L  
Sbjct  71   SKVTQENVFLVLSPTWFTAFERTYLWIAGFRPGLAFTLVNKNVSD-LSRNQSLMLKELLD  129

Query  597  ETARVENAISKAMASAQETVAAPPILGLLKRAEELVDGEVSELDAVMGDLKQSMGRLMGN  418
            E    E  ++      Q+T+ +  ++ L +    L +G ++EL+  +  L+ +M  L+  
Sbjct  130  EIKAEEKQLTDEFTRVQQTMVSQTMILLARDEGPLENGRLTELNRAIDRLRLAMETLVEC  189

Query  417  ADALRGSTASKILEILNPKQAVKFLTAVMRFQREARRWGLYNDSQREA  274
            AD LRG T  +I+EIL+  Q+V+FL A  +FQ   R  GL    QREA
Sbjct  190  ADYLRGKTVLRIVEILSAAQSVRFLVAATQFQLRIRSLGL----QREA  233



>ref|XP_007025357.1| Transcription factor-related, putative [Theobroma cacao]
 gb|EOY27979.1| Transcription factor-related, putative [Theobroma cacao]
Length=251

 Score =   103 bits (258),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 80/237 (34%), Positives = 125/237 (53%), Gaps = 17/237 (7%)
 Frame = -1

Query  951  VGEDFTAFYHGWLMNQDAIFEQLESFLaaaaaaddDREQCGGLVGRVLAHYQeyyaektk  772
            VGE F+ F+  W+   D   +QL      + +++ D +Q   LV ++ AHY+E+Y  K  
Sbjct  5    VGERFSQFFEKWICQLDDYLQQLLRVSKESLSSEADEQQ--ALVSKLTAHYKEFYTVKWT  62

Query  771  aaeEDVFVFFASPWMSRLEQSFLWLSGFKPSMLFWVVESSME--------GALSEEQRCK  616
            AA EDV  F+   W+S+LE ++ WL+G+KPSM+F +VES             L+EEQ  K
Sbjct  63   AAHEDVLAFYCPVWLSKLENAYSWLTGWKPSMIFRLVESMRRTRVPGPGLAELTEEQLRK  122

Query  615  VGMLRAETARVENAISKAMASAQETVAAPPILGLLKRAEELVDGE-VSELD-----AVMG  454
            +  LR +    E  + + M   Q  +A   ++ L++ A  +  GE V ++D     A+ G
Sbjct  123  IEQLRMKIKLEEEKVEREMERQQVALADRKMVELVRMASRIRKGELVGQVDGLVEVAIKG  182

Query  453  DLKQSMGRLMGNADALRGSTASKILEILNPKQAVKFLTAVMRFQREARRWGLYNDSQ  283
             L   + R+M  AD +R  T   +L++LNP Q+V FL      Q + R+WG   D Q
Sbjct  183  ILA-GLERVMKAADCVRLKTLKGVLDVLNPSQSVDFLAGTCMLQIQLRQWGQRRDGQ  238



>ref|NP_001042845.2| Os01g0306400 [Oryza sativa Japonica Group]
 gb|EAY73690.1| hypothetical protein OsI_01574 [Oryza sativa Indica Group]
 dbj|BAF04759.2| Os01g0306400 [Oryza sativa Japonica Group]
Length=245

 Score =   103 bits (257),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 76/229 (33%), Positives = 117/229 (51%), Gaps = 12/229 (5%)
 Frame = -1

Query  951  VGEDFTAFYHGWLMNQDAIFEQLESFLaaaaaaddDREQCGGLVGRVLAHYQeyyaektk  772
             GE+  AFY  W+  ++ I   L   L  A      R+    LV   + H  EYY  K +
Sbjct  22   AGEEMVAFYEAWVGREERIVADLTDALLPARRR---RDVLAPLVDAAVGHVSEYYERKAR  78

Query  771  aaeEDVFVFFASPWMSRLEQSFLWLSGFKPSMLFWVVESSMEGALS-EEQRCKVGMLRAE  595
             A+ DV       W++ LE++FLW  G+KP+++F   + ++ G  S ++QR  +  +RA 
Sbjct  79   LADRDVVAALDPRWLNPLERTFLWAWGWKPALVFRFADGAVAGGSSHQQQRRALERVRAA  138

Query  594  TARVENAISKAMASAQETVAAPPILGLLKRAEELVDGEVSELDAVMGDLKQSMGRLMGNA  415
            TA  E  + + +A  QE++A P +L  L+R +   +GE  E  A +G   +S+  L+  A
Sbjct  139  TAEAEREVDREVAVVQESLAGPRVLAALRR-QHPRNGEADEAVAAVG---RSLRVLLAAA  194

Query  414  DALRGSTASKILEILNPKQAVKFLTAVMRF----QREARRWGLYNDSQR  280
            DALR  T   ++  L P QA  FL A++RF     R  R WG  N  +R
Sbjct  195  DALRERTVRDVVGTLAPDQAGAFLAAMLRFHLGVHRAGRNWGSGNGGRR  243



>dbj|BAB64034.1| hypothetical protein [Oryza sativa Japonica Group]
 dbj|BAB93383.1| hypothetical protein [Oryza sativa Japonica Group]
Length=277

 Score =   103 bits (256),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 76/229 (33%), Positives = 117/229 (51%), Gaps = 12/229 (5%)
 Frame = -1

Query  951  VGEDFTAFYHGWLMNQDAIFEQLESFLaaaaaaddDREQCGGLVGRVLAHYQeyyaektk  772
             GE+  AFY  W+  ++ I   L   L  A      R+    LV   + H  EYY  K +
Sbjct  54   AGEEMVAFYEAWVGREERIVADLTDALLPARRR---RDVLAPLVDAAVGHVSEYYERKAR  110

Query  771  aaeEDVFVFFASPWMSRLEQSFLWLSGFKPSMLFWVVESSMEGALS-EEQRCKVGMLRAE  595
             A+ DV       W++ LE++FLW  G+KP+++F   + ++ G  S ++QR  +  +RA 
Sbjct  111  LADRDVVAALDPRWLNPLERTFLWAWGWKPALVFRFADGAVAGGSSHQQQRRALERVRAA  170

Query  594  TARVENAISKAMASAQETVAAPPILGLLKRAEELVDGEVSELDAVMGDLKQSMGRLMGNA  415
            TA  E  + + +A  QE++A P +L  L+R +   +GE  E  A +G   +S+  L+  A
Sbjct  171  TAEAEREVDREVAVVQESLAGPRVLAALRR-QHPRNGEADEAVAAVG---RSLRVLLAAA  226

Query  414  DALRGSTASKILEILNPKQAVKFLTAVMRF----QREARRWGLYNDSQR  280
            DALR  T   ++  L P QA  FL A++RF     R  R WG  N  +R
Sbjct  227  DALRERTVRDVVGTLAPDQAGAFLAAMLRFHLGVHRAGRNWGSGNGGRR  275



>ref|XP_010676762.1| PREDICTED: transcription factor TGA4-like [Beta vulgaris subsp. 
vulgaris]
Length=251

 Score =   102 bits (254),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 61/181 (34%), Positives = 105/181 (58%), Gaps = 2/181 (1%)
 Frame = -1

Query  825  LVGRVLAHYQeyyaektkaaeEDVFVFFASPWMSRLEQSFLWLSGFKPSMLFWVVESSME  646
            L+ R L H++EYY  K++A   D +  F+  W S LE SFLW++GF+P +L  +V  S+ 
Sbjct  62   LIARALGHFEEYYEHKSRAVYLDGYSLFSPTWCSSLEFSFLWVAGFRPRVLLHLVADSVR  121

Query  645  GALSEEQRCKVGMLRAETARVENAISKAMASAQETVAAPPILGLLKRAEELVDGEVSELD  466
              L+ +Q   +  L+ ET + E  +   +A  QET+ APP++  ++ A  L D +  E  
Sbjct  122  D-LTPDQTRALDRLKRETRKNEKMVEDELARIQETIGAPPLMDAIREAAWLTDRQSFEAT  180

Query  465  A-VMGDLKQSMGRLMGNADALRGSTASKILEILNPKQAVKFLTAVMRFQREARRWGLYND  289
            +  +  L++++  ++ NAD LR +T +K+ EILNP Q ++FL A  +  +  +  G+  D
Sbjct  181  SEPILQLREALKAVIANADTLRVTTGAKVAEILNPIQCLRFLVAAFKLLQGMKSCGIERD  240

Query  288  S  286
            +
Sbjct  241  N  241



>ref|XP_011085128.1| PREDICTED: transcription factor TGA5-like [Sesamum indicum]
Length=240

 Score =   102 bits (253),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 64/223 (29%), Positives = 117/223 (52%), Gaps = 2/223 (1%)
 Frame = -1

Query  948  GEDFTAFYHGWLMNQDAIFEQLESFLaaaaaaddDRE-QCGGLVGRVLAHYQeyyaektk  772
             + F AF   W ++++     L   ++     ++  E QC  L+ RV+ H+++Y+  K +
Sbjct  14   AQTFEAFVDQWFIDKEHYLRDLLGLISRNGCDNEVNEAQCKDLIDRVIRHFRQYFEAKAR  73

Query  771  aaeEDVFVFFASPWMSRLEQSFLWLSGFKPSMLFWVVESSMEGALSEEQRCKVGMLRAET  592
               ++VF+     W S  E+++LW+ GF+P + + +V +++   L+EEQ  ++  L  E 
Sbjct  74   MIGDNVFLVLMPTWFSSFERAYLWMGGFRPGLAYRLVINNVLD-LTEEQSWRINTLMTEI  132

Query  591  ARVENAISKAMASAQETVAAPPILGLLKRAEELVDGEVSELDAVMGDLKQSMGRLMGNAD  412
               E  I+      QE + +PP+L LL+   +L +G    +  ++  LK  +  L+  AD
Sbjct  133  KEEEKEITDEFDKVQEVMTSPPMLELLRHGGQLRNGLGHSMALLVDQLKSVLEALVECAD  192

Query  411  ALRGSTASKILEILNPKQAVKFLTAVMRFQREARRWGLYNDSQ  283
             LR  T   ++EIL   Q ++FL A M+ Q   RRWG+  D++
Sbjct  193  FLRMKTGIMLIEILKSGQTIRFLAAAMQLQLILRRWGMMRDAE  235



>gb|AAT64037.1| predicted protein [Gossypium hirsutum]
Length=253

 Score =   100 bits (250),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 78/237 (33%), Positives = 123/237 (52%), Gaps = 17/237 (7%)
 Frame = -1

Query  951  VGEDFTAFYHGWLMNQDAIFEQLESFLaaaaaaddDREQCGGLVGRVLAHYQeyyaektk  772
            VGE F+ F+  W+   D   +QL       +       +   LV ++ AHY+EYY  K  
Sbjct  5    VGERFSEFFDKWICQLDGYLQQL----VRVSREGLSESEHQTLVSKLTAHYKEYYTVKWA  60

Query  771  aaeEDVFVFFASPWMSRLEQSFLWLSGFKPSMLFWVVESSMEGA---LSEEQRCKVGMLR  601
            AA EDV VF+   W+S+LE +  WL+G+KPSM+F VVES    +   L+EEQ  K+  LR
Sbjct  61   AAHEDVLVFYCPVWLSKLENACSWLTGWKPSMIFGVVESMRRKSVAELTEEQVRKIEQLR  120

Query  600  AETARVENAISKAMASAQETVAAPPILGLLK-----RAEELV----DGEVSEL-DAVMGD  451
             +    E  + + M   Q  +A   ++ L++     R EELV    + +V  L +  +  
Sbjct  121  VKIKLEEEKVEREMERQQVAMADRKMVELVRTARRIRNEELVVVVGNHQVEGLVEVALKG  180

Query  450  LKQSMGRLMGNADALRGSTASKILEILNPKQAVKFLTAVMRFQREARRWGLYNDSQR  280
            +   + R+M  AD +R      +L++LNP Q++ FL  +   Q + R+WG   D+Q+
Sbjct  181  VLAGLERVMKAADCVRLKALKGVLDVLNPSQSLDFLAGICMLQIQIRKWGQNRDNQK  237



>ref|XP_002272378.1| PREDICTED: transcription factor TGA5-like [Vitis vinifera]
Length=243

 Score = 99.0 bits (245),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 76/227 (33%), Positives = 118/227 (52%), Gaps = 8/227 (4%)
 Frame = -1

Query  945  EDFTAFYHGWLMNQDAIFE---QLESFLaaaaaaddDREQCGGLVGRVLAHYQeyyaekt  775
            E F  F+ GWL+ Q+ + +   Q  +      A +D+  +  GL+GRV+AHY EYY  K 
Sbjct  13   EPFETFFRGWLVRQEEVRQLLLQATTERDCDKAREDEEARLQGLIGRVVAHYAEYYKAKL  72

Query  774  kaaeEDVFVFFASPWMSRLEQSFLWLSGFKPSMLFWVVESSMEGALSEEQRCKVGMLRAE  595
            +   ED    F  PW +  E++ LW+ GFKP +   +V + +   L+EEQ   +  +R E
Sbjct  73   RVVREDALNMFEPPWFTLFERNLLWIGGFKPGLALRLVRNYVTN-LTEEQTRMMEDVRTE  131

Query  594  TARVENAISKAMASAQETVAAPPILGLLKRAEELVDGEVSELDAVMGDLKQSMGRLMGNA  415
             A  E  ++  +   +       ++ +  R  E  +GE  E+D  +  +K ++  L+  A
Sbjct  132  MAEEERELAAELEKVKTGPTMISLVEMATRGRERSNGERDEVDEQIEIVKLAVETLVECA  191

Query  414  DALRGSTASKILEILNPKQAVKFLTAVMRFQREARRWGLYNDSQREA  274
            D LR  TA KI++ILNP Q +KFL A+ + Q     WGL    QREA
Sbjct  192  DYLRCKTALKIMDILNPSQNLKFLLAITQLQLRVCNWGL----QREA  234



>ref|XP_008463763.1| PREDICTED: transcription factor TGA5 [Cucumis melo]
Length=235

 Score = 97.4 bits (241),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 79/248 (32%), Positives = 116/248 (47%), Gaps = 48/248 (19%)
 Frame = -1

Query  948  GEDFTAFYHGWLMNQDAIFEQLESFLaaaaaaddDREQCGGLVGRVLAHYQeyyaektka  769
            G +FT+FY  W      + +QL S       +    +    LV  V++HY +YY  K+ A
Sbjct  5    GFNFTSFYATWFDQLHRLVDQLSSTAKDNHNSSSAADHLARLVQTVMSHYCDYYRVKSMA  64

Query  768  aeEDVFVFFASPWMSRLEQSFLWLSGFKPSMLFWVV--ESSM-----------------E  646
            AE D    F++PW + LE+S  W++G++P+  F ++  ESS+                  
Sbjct  65   AERDPLSVFSAPWATSLERSLHWIAGWRPTTTFHLIYSESSILFESRIVDILRGLHTGDL  124

Query  645  GALSEEQRCKVGMLRAETARVENAISKAMASAQETVAAPPILGLLKRAEELVDGEVSELD  466
            G LS  Q  +V  L+ ET   ENAI++ ++  Q+                    +VSEL 
Sbjct  125  GDLSPSQIRRVSELQCETVEEENAITEELSEWQD--------------------DVSEL-  163

Query  465  AVMGDLKQSMGR------LMGNADALRGSTASKILEILNPKQAVKFLTAVMRFQREARRW  304
              MG   +  GR      ++  ADALR  T  K++E+L PKQAV+F  A    Q   R W
Sbjct  164  --MGTRTEVTGRFEDLVNIIKKADALRLRTVQKVVELLTPKQAVEFFIAAAELQFGVRGW  221

Query  303  GLYNDSQR  280
            GL  D QR
Sbjct  222  GLDQDRQR  229



>ref|XP_010674364.1| PREDICTED: transcription factor TGA6-like [Beta vulgaris subsp. 
vulgaris]
Length=288

 Score = 98.2 bits (243),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 72/255 (28%), Positives = 121/255 (47%), Gaps = 36/255 (14%)
 Frame = -1

Query  945  EDFTAFYHGWLMNQDAIFEQLES----FLaaaaaaddDREQCGGLVGRVLAHYQeyyaek  778
            E F  F+  WL+ Q+   E+L++    +  +  +  +  +Q   LV RV+ HY+ YY  K
Sbjct  24   ESFAQFFETWLLEQEHDLEELKAAATCYTESTQSDTEWNQQLTSLVNRVMCHYENYYRVK  83

Query  777  tkaaeEDVFVFFASPWMSRLEQSFLWLSGFKPS----MLFWVVESSMEGA----------  640
            +++A+ DV    +  W S LE++FLW+ G++PS    +L+ V    +E            
Sbjct  84   SESADHDVLTMLSPSWRSNLEEAFLWVGGWRPSTAFHLLYSVTGLQLEAGFHELLRGLGS  143

Query  639  -----LSEEQRCKVGMLRAETARVENAISKAMASAQETVAAPPILGLLKRAEELVDGEVS  475
                 LS +Q  +V  L+ +T   E  +++  A+ QETVA   ++ L   A EL+    S
Sbjct  144  GNLADLSPDQLVRVDELQRQTVWEERELTENFAAIQETVADSTMVELSHVATELIRDPNS  203

Query  474  -------------ELDAVMGDLKQSMGRLMGNADALRGSTASKILEILNPKQAVKFLTAV  334
                          +++ +G  +  +  ++G AD LR  T   +L+IL P QAV FL A 
Sbjct  204  VTTGPVGPESVNERVESTIGTKENKLKEILGRADDLRLRTLKNVLDILTPIQAVDFLIAA  263

Query  333  MRFQREARRWGLYND  289
                    +WG+  D
Sbjct  264  AELHLRVHQWGVKKD  278



>ref|XP_003567594.2| PREDICTED: uncharacterized protein LOC100833996 [Brachypodium 
distachyon]
Length=255

 Score = 97.1 bits (240),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 70/214 (33%), Positives = 113/214 (53%), Gaps = 5/214 (2%)
 Frame = -1

Query  942  DFTAFYHGWLMNQDAIFEQLESFLaaaaaaddDREQCGGLVGRVLAHYQeyyaektkaae  763
            D  AFY  W+  ++ I   L + L+ + +A   RE    LV   + H   YY  K + A+
Sbjct  34   DMAAFYDAWVGREEEIVADLTAALSLSLSARR-REALAPLVDAAMDHVATYYEHKARLAD  92

Query  762  EDVFVFFASPWMSRLEQSFLWLSGFKPSMLFWVVESSMEGALSEEQRCKVGMLRAETARV  583
             DV       W++ LE++FLW  G+KP+++F  V+ +  G  S +QR  +  LRA TA  
Sbjct  93   RDVVAALDPRWLNPLERTFLWAWGWKPALVFRFVDEAAVG--SAQQRRGLEDLRASTAAA  150

Query  582  ENAISKAMASAQETVAAPPILGLLKRAEELVDGEVSELDAVMGDLKQSMGRLMGNADALR  403
            E  + + +A+ QE++A P +L  L+R  +L      E D  +  + +S+  L+   DALR
Sbjct  151  EREVEREVAAMQESLAGPRVLAALRR--QLHSPRNGEADEAVAAVGRSLRVLLAAGDALR  208

Query  402  GSTASKILEILNPKQAVKFLTAVMRFQREARRWG  301
              T   ++ +L P+QA  F+ A++RF    RR G
Sbjct  209  ERTVRGVVGLLGPEQAGAFVAALLRFHLGVRRAG  242



>ref|XP_002273632.1| PREDICTED: transcription factor TGA2 [Vitis vinifera]
 emb|CBI21619.3| unnamed protein product [Vitis vinifera]
Length=255

 Score = 96.3 bits (238),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 75/244 (31%), Positives = 114/244 (47%), Gaps = 22/244 (9%)
 Frame = -1

Query  945  EDFTAFYHGWLMNQDAIFEQLESFLaaaaaaddDREQCGGLVGRVLAHYQeyyaektkaa  766
            E F  F+  WL  Q+   ++L S        DD  +    LV RV++HY  YY  K+ + 
Sbjct  9    EGFHKFFESWLTEQNQHLQELISASRNNQHTDDSDQILCPLVERVVSHYHNYYHAKSLST  68

Query  765  eEDVFVFFASPWMSRLEQSFLWLSGFKPSMLFWVV--------ESSME-----------G  643
             +++      PW S LE +FLW+ G++PS+ F ++        ES +            G
Sbjct  69   RDNILSMLTPPWRSLLEDAFLWVGGWRPSVAFHLLYSKSGLQFESGLADLIRGLSTGDLG  128

Query  642  ALSEEQRCKVGMLRAETARVENAISKAMASAQETVAAPPILGLLKRAEELVDGEVSELDA  463
             +S EQ C+V  L+ +T R E  +++ MA  QETVA   ++ L + A E   G     + 
Sbjct  129  DMSHEQLCRVDELQRKTIREEREMTENMARIQETVADSKMVELSEAATEEGGGGDDLGER  188

Query  462  VMGDLK---QSMGRLMGNADALRGSTASKILEILNPKQAVKFLTAVMRFQREARRWGLYN  292
            V   LK   + +  ++  AD LR  T   +L+IL P Q V FL A         +WG   
Sbjct  189  VESALKHKEEGLAEMLLKADDLRLRTLKGVLDILTPMQCVHFLIAAAELHLRLHKWGKNK  248

Query  291  DSQR  280
            D Q+
Sbjct  249  DEQQ  252



>emb|CAB37450.1| putative protein [Arabidopsis thaliana]
 emb|CAB78867.1| putative protein [Arabidopsis thaliana]
Length=229

 Score = 95.9 bits (237),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 70/220 (32%), Positives = 108/220 (49%), Gaps = 5/220 (2%)
 Frame = -1

Query  954  IVGEDFTAFYHGWLMNQDAIFEQLESFLaaaaaaddDREQCGGLVGRVLAHYQeyyaekt  775
            +V E F  FY  W++  +    QL   L A         +   L+ ++  H++ YY  K 
Sbjct  4    LVEEKFLEFYESWVIQLELYLHQL---LIAHNNNTMSETELRHLISKLTTHHKAYYTAKW  60

Query  774  kaaeEDVFVFFASPWMSRLEQSFLWLSGFKPSMLFWVVESSMEG--ALSEEQRCKVGMLR  601
             A  EDV  FF S W++ LE +  WL+G+KPSM+F +V+   +    L E Q  K+  LR
Sbjct  61   AAIREDVLAFFGSVWLNPLENACSWLTGWKPSMVFRMVDRLRKSRVVLVEAQVKKLEELR  120

Query  600  AETARVENAISKAMASAQETVAAPPILGLLKRAEELVDGEVSELDAVMGDLKQSMGRLMG  421
             +T   E  I + M   Q  +A   ++ L +    +    V  ++A +  L   + +++ 
Sbjct  121  VKTKFDEQKIEREMERYQVAMADRKMVELARLGCHVGGESVMVVEAAVRGLSMGLEKMVK  180

Query  420  NADALRGSTASKILEILNPKQAVKFLTAVMRFQREARRWG  301
             AD +R  T   IL+IL P Q V+FL A   FQ + RRWG
Sbjct  181  AADCVRLKTLKGILDILTPPQCVEFLAAAATFQVQLRRWG  220



>ref|XP_003630355.1| Transcription factor HBP-1b(c1) [Medicago truncatula]
 gb|AET04831.1| transcription factor TGA5-like protein [Medicago truncatula]
Length=272

 Score = 96.7 bits (239),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 70/241 (29%), Positives = 117/241 (49%), Gaps = 28/241 (12%)
 Frame = -1

Query  948  GEDFTAFYHGWLMNQDAIFEQLESFLaaaaaaddDREQCGGLVGRVLAHYQeyyaektka  769
             E F  F+  W++ Q+    +L    A +A      ++   L+ +V+ HY+ YY  K+  
Sbjct  12   AESFNKFFECWMVEQNKYLNEL--VAAKSAQPQLTNDRMHTLIDKVVEHYECYYKTKSSF  69

Query  768  aeEDVFVFFASPWMSRLEQSFLWLSGFKPSMLFWVVES--SME-----------------  646
            A++DV   F+ PW+S LE++FLW+ G++PSM F ++ S  SM+                 
Sbjct  70   AKKDVLSMFSPPWLSTLEEAFLWIGGWRPSMAFHLLYSKCSMQFQARLNDLIQGQKTCDL  129

Query  645  GALSEEQRCKVGMLRAETARVENAISKAMASAQETVAAPPILGLLKRAEELVDGEVSE--  472
            G L+  Q  +   L+ +T R E  I+  +A  QETVA  P++ L     E++ G  +E  
Sbjct  130  GDLTASQLAEFDDLQKKTIREEREITDMLAEHQETVADAPMVELSHVVSEMIRGGENEKK  189

Query  471  -----LDAVMGDLKQSMGRLMGNADALRGSTASKILEILNPKQAVKFLTAVMRFQREARR  307
                 +++V+    + + +++  AD LR      I+ IL PKQA+ FL A          
Sbjct  190  ELEERIESVLEPKVEGLEKILYRADDLRLRALQGIVNILTPKQAIHFLIAAAELHLRLHE  249

Query  306  W  304
            W
Sbjct  250  W  250



>ref|NP_193600.2| transcription factor-related protein [Arabidopsis thaliana]
 gb|AAO41945.1| unknown protein [Arabidopsis thaliana]
 gb|AAO50710.1| unknown protein [Arabidopsis thaliana]
 gb|AEE84072.1| transcription factor-related protein [Arabidopsis thaliana]
Length=232

 Score = 95.9 bits (237),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 70/220 (32%), Positives = 108/220 (49%), Gaps = 5/220 (2%)
 Frame = -1

Query  954  IVGEDFTAFYHGWLMNQDAIFEQLESFLaaaaaaddDREQCGGLVGRVLAHYQeyyaekt  775
            +V E F  FY  W++  +    QL   L A         +   L+ ++  H++ YY  K 
Sbjct  7    LVEEKFLEFYESWVIQLELYLHQL---LIAHNNNTMSETELRHLISKLTTHHKAYYTAKW  63

Query  774  kaaeEDVFVFFASPWMSRLEQSFLWLSGFKPSMLFWVVESSMEG--ALSEEQRCKVGMLR  601
             A  EDV  FF S W++ LE +  WL+G+KPSM+F +V+   +    L E Q  K+  LR
Sbjct  64   AAIREDVLAFFGSVWLNPLENACSWLTGWKPSMVFRMVDRLRKSRVVLVEAQVKKLEELR  123

Query  600  AETARVENAISKAMASAQETVAAPPILGLLKRAEELVDGEVSELDAVMGDLKQSMGRLMG  421
             +T   E  I + M   Q  +A   ++ L +    +    V  ++A +  L   + +++ 
Sbjct  124  VKTKFDEQKIEREMERYQVAMADRKMVELARLGCHVGGESVMVVEAAVRGLSMGLEKMVK  183

Query  420  NADALRGSTASKILEILNPKQAVKFLTAVMRFQREARRWG  301
             AD +R  T   IL+IL P Q V+FL A   FQ + RRWG
Sbjct  184  AADCVRLKTLKGILDILTPPQCVEFLAAAATFQVQLRRWG  223



>ref|XP_010253822.1| PREDICTED: uncharacterized protein LOC104594963 [Nelumbo nucifera]
Length=378

 Score = 97.8 bits (242),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 54/155 (35%), Positives = 88/155 (57%), Gaps = 11/155 (7%)
 Frame = -1

Query  738  SPWMSRLEQSFLWLSGFKPSMLFWVVESSMEGALSEEQRCKVGMLRAETARVENAISKAM  559
            +PW S LE++  W+ GF+P ++F +V +S+ G LS++Q     M R ET R + +  + +
Sbjct  108  APWFSSLERALFWIGGFRPGLVFRLVANSV-GDLSQDQ-----MQRMETLRAKTSAEEEL  161

Query  558  ASAQETVAAPPILGLLKRAEELVDGEVSELDAVMGDLKQSMGRLMGNADALRGSTASKIL  379
               QE+V APP+  LL+R      G    +++V+         L+G+A  LR +TA+K++
Sbjct  162  VRLQESVVAPPLSELLRRG-----GRTVNVNSVLESKLTKFEILLGSAGMLRANTATKVI  216

Query  378  EILNPKQAVKFLTAVMRFQREARRWGLYNDSQREA  274
            +IL+P Q V FL    + Q   RR G   D++RE 
Sbjct  217  QILSPIQTVSFLATAAQLQFRIRRLGFQRDAEREG  251



>ref|XP_004146086.1| PREDICTED: transcription factor TGA5-like [Cucumis sativus]
 ref|XP_004173947.1| PREDICTED: transcription factor TGA5-like [Cucumis sativus]
 gb|KGN55047.1| hypothetical protein Csa_4G625020 [Cucumis sativus]
Length=232

 Score = 95.5 bits (236),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 77/242 (32%), Positives = 117/242 (48%), Gaps = 39/242 (16%)
 Frame = -1

Query  948  GEDFTAFYHGWLMNQDAIFEQLESFLaaaaaaddDREQCGGLVGRVLAHYQeyyaektka  769
            G +FT+FY  W  +   + +QL S       +    +    LV  V++HY +YY  K+ A
Sbjct  5    GFNFTSFYATWFDHLHRLVDQLSSTAKDNHNSSSAPDH---LVQTVMSHYSDYYRVKSMA  61

Query  768  aeEDVFVFFASPWMSRLEQSFLWLSGFKPSMLFWVV--ESSME-----------------  646
            AE D    F++PW + LE+S  W++G++P+  F ++  ESS+                  
Sbjct  62   AERDPLSVFSAPWATSLERSLHWIAGWRPTTTFHLIYTESSILFESRIFDILRGLHTGDL  121

Query  645  GALSEEQRCKVGMLRAETARVENAISKAMASAQETVAAPPILGLLKRAEELVDGEVSELD  466
            G LS  Q  +V  L+ ET   ENAI++ ++  Q+ V+   +LG        V+G V+   
Sbjct  122  GDLSPSQIRRVSELQCETVEEENAITEELSEWQDDVS--ELLGTRTEVTGRVEGLVN---  176

Query  465  AVMGDLKQSMGRLMGNADALRGSTASKILEILNPKQAVKFLTAVMRFQREARRWGLYNDS  286
                        ++  ADALR  T  K++E+L PKQAV+F  A    Q   R WGL  D 
Sbjct  177  ------------IIKKADALRLRTVQKVVELLTPKQAVEFFIAAAELQFGVRGWGLDQDR  224

Query  285  QR  280
            QR
Sbjct  225  QR  226



>ref|XP_010695960.1| PREDICTED: LOW QUALITY PROTEIN: transcription factor TGA5 [Beta 
vulgaris subsp. vulgaris]
Length=242

 Score = 95.5 bits (236),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 71/234 (30%), Positives = 108/234 (46%), Gaps = 28/234 (12%)
 Frame = -1

Query  939  FTAFYHGWLMNQDAIFEQLESFLaaaaaaddDREQCGGLVGRVLAHYQeyyaektkaaeE  760
            F  F+  W    + +  +L S       +  D +    LV +V+ HY +YY +K   A  
Sbjct  4    FHRFHESWTDKLNKLITELASTPTPRPTSSSDHQHIRHLVDKVVTHYAQYYEKKAATAXT  63

Query  759  DVFVFFASPWMSRLEQSFLWLSGFKPSMLFWVV--ESSME-----------------GAL  637
            DV   FA+PW S LE+S  W++GF+P+ LF ++  ESS+                  G L
Sbjct  64   DVLSLFAAPWASALERSLNWVAGFRPTTLFHLIYTESSIRFESHVADILRGCRTGDLGEL  123

Query  636  SEEQRCKVGMLRAETARVENAISKAMASAQETVAAPPILGLLKRAEELVDGEVSELDAVM  457
            +  Q  +V  L+  T + EN I   + + QE VA         R+E    G        +
Sbjct  124  TPGQLARVSELQCLTVQDENQIGDELGTWQEEVA---------RSEPEWSGLCGNGPDGL  174

Query  456  GDLKQSMGRLMGNADALRGSTASKILEILNPKQAVKFLTAVMRFQREARRWGLY  295
              L   +G ++  AD LR  T  +++E+L P+QA +FL A    Q   RRWGL+
Sbjct  175  NRLLAKLGTVVAKADDLRMKTIRQVVELLTPQQAAEFLIAAAELQLGIRRWGLH  228



>ref|XP_004244373.1| PREDICTED: transcription factor TGA5 [Solanum lycopersicum]
Length=226

 Score = 94.7 bits (234),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 77/243 (32%), Positives = 118/243 (49%), Gaps = 43/243 (18%)
 Frame = -1

Query  939  FTAFYHGWLMNQDAIFEQLESFLaaaaaaddDREQCGGLVGRVLAHYQeyyaektkaaeE  760
            F  FY  W      I  QL   +   A +D  RE    LV +V++H  EYY  K+ AA+ 
Sbjct  3    FQRFYETWFDQLKEIVRQLNQ-VPRPATSDHHRELHQLLVQKVVSHIYEYYRVKSLAAKN  61

Query  759  DVFVFFASPWMSRLEQSFLWLSGFKPSMLFWVV--ESSME-----------------GAL  637
            D+   F++PW + LE+S  W++G++P+  F ++  ESS+                  G L
Sbjct  62   DILSVFSAPWSTSLERSLHWIAGWRPTTAFHLIYTESSILFESHIIDILRGLRYGDLGDL  121

Query  636  SEEQRCKVGMLRAETARVENAISKAMASAQETVAAPPILGLLKRAEELVDGEVSELDAVM  457
            S EQ  +V   + ET   EN+I+  +   Q+   A  I+GL                  M
Sbjct  122  SPEQLARVSEFQCETVHEENSITDELNDWQD--GASEIIGL------------------M  161

Query  456  GDLKQSMGRL---MGNADALRGSTASKILEILNPKQAVKFLTAVMRFQREARRWGLYNDS  286
            GD+++ M +L   +  AD LR  T   ++++L P+QAV+FL A    Q   R+WG+ +D 
Sbjct  162  GDIEEKMEKLVEILEKADKLRMKTIENLVQLLTPQQAVEFLIASAHLQFGIRKWGINHDR  221

Query  285  QRE  277
            QRE
Sbjct  222  QRE  224



>ref|XP_006394098.1| hypothetical protein EUTSA_v10005017mg [Eutrema salsugineum]
 gb|ESQ31384.1| hypothetical protein EUTSA_v10005017mg [Eutrema salsugineum]
Length=172

 Score = 93.6 bits (231),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 52/138 (38%), Positives = 79/138 (57%), Gaps = 5/138 (4%)
 Frame = -1

Query  732  WMSRLEQSF--LWLSGFKPSMLFWVVESSMEGALSEEQRCKVGMLRAETARVENAISKAM  559
            W++     F   W+  F PS++F + E+S++  L+  Q+  +  LR+ET R E  + +  
Sbjct  34   WITNGSNHFDVFWVDDFNPSLVFKLTEASVDD-LTRHQQDLISSLRSETRRKERDVMRDY  92

Query  558  ASAQETVAAPPILGLLKRA--EELVDGEVSELDAVMGDLKQSMGRLMGNADALRGSTASK  385
            A  Q++VA PP++   +R    E+VDGE S+L+  M  LK  M   M NAD LR ST  K
Sbjct  93   ALVQQSVADPPVMLAARRVGVREMVDGEESDLEEAMEVLKSGMAAAMNNADQLRCSTVGK  152

Query  384  ILEILNPKQAVKFLTAVM  331
            ++EIL P QA+K +   M
Sbjct  153  VVEILTPSQAIKVIIYCM  170



>ref|XP_004503896.1| PREDICTED: transcription factor HBP-1b(c38)-like [Cicer arietinum]
Length=277

 Score = 95.5 bits (236),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 75/253 (30%), Positives = 121/253 (48%), Gaps = 32/253 (13%)
 Frame = -1

Query  948  GEDFTAFYHGWLMNQDAIFEQLESFLaaaaaaddDREQCGGLVGRVLAHYQeyyaektka  769
            GE F  F+  WL+ Q+    +L +  ++      DR     L+ +V+ HYQ YY EK++ 
Sbjct  16   GESFHNFFECWLVEQNQHLNELVAAKSSQPQLAIDRMHT--LIDKVVEHYQFYYKEKSRY  73

Query  768  aeEDVFVFFASPWMSRLEQSFLWLSGFKPSMLFWVVES--SME-----------------  646
            A++DV   F+  W+S LE++FLW+ G++PSM F +V S  SM+                 
Sbjct  74   AKKDVLSMFSPSWISSLEEAFLWIGGWRPSMAFHLVYSKCSMQFQARLNDLIQGLKTCDL  133

Query  645  GALSEEQRCKVGMLRAETARVENAISKAMASAQETVAAPPILGLLKRAEELV--DGEVSE  472
            G LS  Q  +   L+  T + E  I+  MA  QETVA  P++ L     E++  D ++ E
Sbjct  134  GDLSSSQLAEFDDLQKRTIKEEREITGLMAEHQETVADAPMVELSHVVSEIIRDDNQIGE  193

Query  471  ---------LDAVMGDLKQSMGRLMGNADALRGSTASKILEILNPKQAVKFLTAVMRFQR  319
                     +++ +    + + +++  AD LR  T   I+ IL P+Q + FL A      
Sbjct  194  ENEKKLEERIESTLEPKVEGLEKILHRADDLRLRTLQGIVSILTPQQGIHFLIAAAELHL  253

Query  318  EARRWGLYNDSQR  280
                WG   D  +
Sbjct  254  RLHEWGKKMDDAK  266



>gb|KDP21107.1| hypothetical protein JCGZ_21578 [Jatropha curcas]
Length=250

 Score = 94.4 bits (233),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 64/198 (32%), Positives = 95/198 (48%), Gaps = 19/198 (10%)
 Frame = -1

Query  825  LVGRVLAHYQeyyaektkaaeEDVFVFFASPWMSRLEQSFLWLSGFKPSMLFWVV-----  661
            L  + + H+Q+Y  +++   + +V  +FA  W S LE SFLWL+G +PS+   +V     
Sbjct  46   LAEKSIQHFQDYIQKRSHLYQNNVSHYFAPGWNSALENSFLWLAGCRPSIFIRLVYALCG  105

Query  660  ---ESSME-----------GALSEEQRCKVGMLRAETARVENAISKAMASAQETVAAPPI  523
               ES++            G LS  Q   V  L + T + E  +S  +AS QE +A  PI
Sbjct  106  SEVESNLAEYLQGARIGNLGELSARQLNMVNNLHSRTIKQEEKLSSQLASLQEEIADEPI  165

Query  522  LGLLKRAEELVDGEVSELDAVMGDLKQSMGRLMGNADALRGSTASKILEILNPKQAVKFL  343
              L K   +  D    E+D  + DL  +M R++  AD  R ST  ++  ILNP QA+ FL
Sbjct  166  SILAKSQSQASDEPSDEVDRALQDLDVAMARILQEADNFRLSTVKELNSILNPIQAIDFL  225

Query  342  TAVMRFQREARRWGLYND  289
             A  +       WG   D
Sbjct  226  AAAKKLHLCMHDWGKRRD  243



>ref|XP_007021794.1| Uncharacterized protein TCM_031867 [Theobroma cacao]
 gb|EOY13319.1| Uncharacterized protein TCM_031867 [Theobroma cacao]
Length=261

 Score = 94.7 bits (234),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 79/239 (33%), Positives = 113/239 (47%), Gaps = 43/239 (18%)
 Frame = -1

Query  933  AFYHGWLMNQDAIFEQLESFLaaaaaaddDREQCGGLVGRVLAHYQeyyaektkaaeEDV  754
            AFY+ W      +  QL S        D        LV ++L+HY EYY  K  AAE DV
Sbjct  43   AFYNTWSDQLHHLLRQLCSAPKPPTMQDHL-HHLNHLVTKLLSHYSEYYRVKAAAAERDV  101

Query  753  FVFFASPWMSRLEQSFLWLSGFKPSMLFWVV--ESSM-----------------EGALSE  631
            F  FA+PW S LE+S  W++G++P+ +F +V  ESS+                  G LS 
Sbjct  102  FDIFAAPWASSLEKSLHWIAGWRPTTVFHLVYTESSILFESHIVDILRGVRTGDLGDLSP  161

Query  630  EQRCKVGMLRAETARVENAISKAMASAQETVAAPPILGLLKRAEELVDGEVSELDAVMGD  451
             Q  +V  L+ ET + ENAI+  ++  Q +                    V++L     D
Sbjct  162  SQFRRVSELQCETVKEENAITDELSEWQHS--------------------VTDLVGSFTD  201

Query  450  LKQSMGRLMG---NADALRGSTASKILEILNPKQAVKFLTAVMRFQREARRWGLYNDSQ  283
             +Q +GRL+     AD LR  T  +++++L P+QAV+FL A    Q   R WGL  D Q
Sbjct  202  AEQMIGRLVSIVQKADDLRLRTLKRVVDLLTPQQAVEFLIAAAELQFGIREWGLNQDRQ  260



>ref|XP_006348396.1| PREDICTED: TGACG-sequence-specific DNA-binding protein TGA-2.1-like 
[Solanum tuberosum]
Length=226

 Score = 94.0 bits (232),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 77/243 (32%), Positives = 119/243 (49%), Gaps = 43/243 (18%)
 Frame = -1

Query  939  FTAFYHGWLMNQDAIFEQLESFLaaaaaaddDREQCGGLVGRVLAHYQeyyaektkaaeE  760
            F  FY  W      I  QL S +   A ++  RE    LV +V++H  EYY  K+ AA+ 
Sbjct  3    FQRFYDTWFDQLKEIVRQL-SQVPRPATSEQHRELHQQLVQKVVSHIYEYYRVKSLAAKN  61

Query  759  DVFVFFASPWMSRLEQSFLWLSGFKPSMLFWVV--ESSME-----------------GAL  637
            D+   +++PW + LE+S  W++G++P+  F ++  ESS+                  G L
Sbjct  62   DILSVYSAPWSTSLERSLHWIAGWRPTTAFHLIYTESSILFESHIIDILRGLRYGDLGDL  121

Query  636  SEEQRCKVGMLRAETARVENAISKAMASAQETVAAPPILGLLKRAEELVDGEVSELDAVM  457
            S +Q  +V  L+ E  + EN+I+      Q++  A  ILGL                  M
Sbjct  122  SPDQLARVSELQCEAVQEENSITDEFNDWQDS--ASEILGL------------------M  161

Query  456  GDLKQSMGRL---MGNADALRGSTASKILEILNPKQAVKFLTAVMRFQREARRWGLYNDS  286
            GD++  M +L   +  AD LR  T   ++E+L P+QA++FL A    Q   RRWG+ +D 
Sbjct  162  GDIEGKMEKLVEILEKADKLRLKTIENLVELLTPQQAIEFLIASAHLQFGIRRWGINHDR  221

Query  285  QRE  277
            QRE
Sbjct  222  QRE  224



>ref|XP_008386261.1| PREDICTED: transcription factor TGA5-like [Malus domestica]
Length=227

 Score = 93.6 bits (231),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 81/239 (34%), Positives = 114/239 (48%), Gaps = 37/239 (15%)
 Frame = -1

Query  939  FTAFYHGWLMNQDAIFEQLESFLaaaaaaddDREQCGGLVGRVLAHYQeyyaektkaaeE  760
            FT+FY  W      +  QL S         D   Q   +V +V+AHY EYY  K+ AAE 
Sbjct  4    FTSFYETWFEQLHHLVHQL-STCPRPPTTPDHHHQLLHVVQKVMAHYAEYYRVKSLAAER  62

Query  759  DVFVFFASPWMSRLEQSFLWLSGFKPSMLFWVV--ESSME-----------------GAL  637
            D    F +PW + LE+S  W+ G++P+  F +V  ESS+                  G L
Sbjct  63   DALSVFVAPWATTLERSLHWIGGWRPTTAFHLVYSESSIHFEAHIVDILRGYRTGDLGDL  122

Query  636  SEEQRCKVGMLRAETARVENAISKAMASAQETVAAPPILGLLKRAEELVDGEVSELDAVM  457
            +  Q  +V  L+ ET + ENAIS  ++  Q+             A EL+ GE + L+  M
Sbjct  123  TPSQFRRVSDLQCETVKEENAISDELSEWQDG------------ACELM-GEYTNLETNM  169

Query  456  GDLKQSMGRLMGNADALRGSTASKILEILNPKQAVKFLTAVMRFQREARRWGLYNDSQR  280
            G L      ++  AD LR  T  K++E+L P+QAV+FL A    Q   R WGL  D +R
Sbjct  170  GLLVS----VLKKADELRLKTLRKVVELLTPQQAVEFLIAAAELQFGVRGWGLNQDRRR  224



>ref|XP_009618663.1| PREDICTED: transcription factor TGA1-like [Nicotiana tomentosiformis]
Length=228

 Score = 93.6 bits (231),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 74/239 (31%), Positives = 119/239 (50%), Gaps = 37/239 (15%)
 Frame = -1

Query  939  FTAFYHGWLMNQDAIFEQLESFLaaaaaaddDREQCGGLVGRVLAHYQeyyaektkaaeE  760
            F  FY  W      +  QL   +   A +D   E    LV +V++HY EYY  K+ AA+ 
Sbjct  3    FQRFYDAWFEQLKGMVHQLNQ-VPRPATSDQHHELHKQLVQKVMSHYYEYYRVKSLAAKN  61

Query  759  DVFVFFASPWMSRLEQSFLWLSGFKPSMLFWVV--ESSME-----------------GAL  637
            D+F  F++PW + LE+S  W++G++P+  F ++  ESS+                  G L
Sbjct  62   DIFSVFSAPWSTSLERSLHWIAGWRPTTAFHLIYTESSILFESHIIDILRGLRYGDLGDL  121

Query  636  SEEQRCKVGMLRAETARVENAISKAMASAQETVAAPPILGLLKRAEELVDGEVSELDAVM  457
            S +Q  +V  L+ E  + ENAI+  ++  Q+   A  ++GL    +  ++G VS      
Sbjct  122  SPDQLHRVSELQCEAVQEENAIADELSDWQD--GASEVIGLTGDIDVKMEGLVS------  173

Query  456  GDLKQSMGRLMGNADALRGSTASKILEILNPKQAVKFLTAVMRFQREARRWGLYNDSQR  280
                     ++  AD LR  T   ++++L+P+QAV+FL A    Q   RRWG+ +D QR
Sbjct  174  ---------ILERADKLRMKTIENLVQLLSPQQAVEFLIAAAHLQFGIRRWGINHDRQR  223



>ref|XP_007212919.1| hypothetical protein PRUPE_ppa022280mg [Prunus persica]
 gb|EMJ14118.1| hypothetical protein PRUPE_ppa022280mg [Prunus persica]
Length=229

 Score = 93.2 bits (230),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 81/239 (34%), Positives = 113/239 (47%), Gaps = 37/239 (15%)
 Frame = -1

Query  939  FTAFYHGWLMNQDAIFEQLESFLaaaaaaddDREQCGGLVGRVLAHYQeyyaektkaaeE  760
            FT+FY  W      +  QL S         D       +V +V++HY EYY  K  AAE 
Sbjct  6    FTSFYETWFEQLHNLVHQL-STCPRPPTTPDHHHHLLHVVQKVMSHYDEYYRVKALAAER  64

Query  759  DVFVFFASPWMSRLEQSFLWLSGFKPSMLFWVV--ESSME-----------------GAL  637
            D    F +PW + LE+S  W++G++P+  F +V  ESS+                  G L
Sbjct  65   DALAVFVAPWATTLERSLHWIAGWRPTTAFHLVYSESSIHFEAHIVDILRGFSTGDLGDL  124

Query  636  SEEQRCKVGMLRAETARVENAISKAMASAQETVAAPPILGLLKRAEELVDGEVSELDAVM  457
            S  Q  +V  L+ ET + ENAIS+ ++  QE             A EL+ G  + LD  M
Sbjct  125  SPSQFRRVSELQCETVKEENAISEELSEWQEG------------ASELM-GACTNLDMKM  171

Query  456  GDLKQSMGRLMGNADALRGSTASKILEILNPKQAVKFLTAVMRFQREARRWGLYNDSQR  280
            G L      ++  AD LR  T  K++E+L P+QAV+FL A    Q   R WG+  D QR
Sbjct  172  GRLVT----VLKKADNLRLRTVRKVVELLTPQQAVEFLIAAAELQFGVRGWGMNQDRQR  226



>ref|XP_004289493.1| PREDICTED: TGACG-sequence-specific DNA-binding protein TGA-2.1-like 
[Fragaria vesca subsp. vesca]
Length=267

 Score = 93.6 bits (231),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 77/252 (31%), Positives = 121/252 (48%), Gaps = 34/252 (13%)
 Frame = -1

Query  939  FTAFYHGWLMNQDAIFEQL---ESFLaaaaaaddDREQCGGLVGRVLAHYQeyyaektka  769
            F AF+  WL  QD   + L          AA DDDR     LV RV+ HY++YY +K++ 
Sbjct  13   FQAFFESWLSEQDQHLQDLIIASKQHQKRAADDDDRVLLSSLVERVVKHYEQYYNKKSQW  72

Query  768  aeEDVFVFFASPWMSRLEQSFLWLSGFKPSMLFWVVESS----MEGALSEEQR-------  622
            A++DV    + PW S LE +FLW+ G++PSM F ++ S     +E + +E  R       
Sbjct  73   AKQDVLRMLSPPWRSSLEDAFLWIGGWRPSMAFHLLYSKSGLQLEASFAELMRGLRLSTG  132

Query  621  -------CKVGM---LRAETARVENAISKAMASAQETVAAPPILGLLKRAEELV------  490
                   C++ M   ++  T   E  +S+ MA  QETVA   ++ L   A E++      
Sbjct  133  DLGDLSHCQLTMVDKVQRRTIEDEKHLSEKMAKLQETVADATLVELAHEATEMMRNNEVH  192

Query  489  ----DGEVSELDAVMGDLKQSMGRLMGNADALRGSTASKILEILNPKQAVKFLTAVMRFQ  322
                D  +  +++ +   ++ + +++  AD LR  T   I +IL+P QAV FL A     
Sbjct  193  EGGADDHMERVESTLASKEEGLEKILHKADDLRMKTLRNITQILSPLQAVHFLIAAAELH  252

Query  321  REARRWGLYNDS  286
                 WG   D+
Sbjct  253  LRVHDWGKKKDA  264



>ref|XP_006380400.1| hypothetical protein POPTR_0007s04840g [Populus trichocarpa]
 gb|ERP58197.1| hypothetical protein POPTR_0007s04840g [Populus trichocarpa]
Length=277

 Score = 93.6 bits (231),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 73/248 (29%), Positives = 108/248 (44%), Gaps = 29/248 (12%)
 Frame = -1

Query  945  EDFTAFYHGWLMNQDAIFEQLESFLaaaaaaddDREQCGG-----LVGRVLAHYQeyyae  781
            E F  F+  WL  Q+   EQL S          +  Q        L+ RVL HY+ YY  
Sbjct  23   ETFRKFFECWLAEQNNYLEQLISSCKDYDHNKKNSPQSSQATLQPLINRVLEHYEYYYRA  82

Query  780  ktkaaeEDVFVFFASPWMSRLEQSFLWLSGFKPSMLFWVVESSME---------------  646
            K++ A++DV    +  W S LE +FLW+ G++PS+ F ++ S                  
Sbjct  83   KSRWAKDDVLSMLSPSWTSTLEHAFLWIGGWRPSVAFHLLYSKSGHQLEAQLHELICGLG  142

Query  645  ----GALSEEQRCKVGMLRAETARVENAISKAMASAQETVAAPPILGLLKRAEELVDGEV  478
                G LS  Q  +V  L+ +T R EN +++     QETVA   ++ L     EL+  E 
Sbjct  143  TGDLGDLSGSQLTRVDQLQRKTIREENELTEKHVKHQETVADSSMVELAHEVTELLRSEN  202

Query  477  SELD-----AVMGDLKQSMGRLMGNADALRGSTASKILEILNPKQAVKFLTAVMRFQREA  313
            +  D     + +   K  +  ++  AD LR  T   +++IL P QAV FL A        
Sbjct  203  TGTDEERVESTLAPRKDGLQEILQMADDLRVRTIKGVIDILTPIQAVHFLIAAAELHLRL  262

Query  312  RRWGLYND  289
              WG   D
Sbjct  263  HDWGKKGD  270



>ref|XP_010052186.1| PREDICTED: transcription factor HBP-1b(c38) [Eucalyptus grandis]
Length=242

 Score = 93.2 bits (230),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 75/232 (32%), Positives = 118/232 (51%), Gaps = 12/232 (5%)
 Frame = -1

Query  945  EDFTAFYHGWLMNQDAIFEQLESFLaaaaaaddDREQCGGLVGRVLAHYQeyyaektkaa  766
            E F+ ++  W+   +    QL S   A+       E+   LV ++ AH++EYY  K  AA
Sbjct  7    EKFSDYFEKWVSRLEEYSHQLHS---ASRETSTTEEELRALVSKLTAHHKEYYTAKWAAA  63

Query  765  eEDVFVFFASPWMSRLEQSFLWLSGFKPSMLFWVVES-SMEGA-LSEEQRCKVGMLRAET  592
              DVF FF+ PW S LE ++ WL+G+KPS  F V+E+    GA ++E+Q  ++  LRA+ 
Sbjct  64   GGDVFAFFSPPWSSPLENAYSWLTGWKPSTAFRVIEALRARGAVVAEDQLTRIEQLRAKI  123

Query  591  ARVENAISKAMASAQETVAAPPILGLLKRAEELVDGEVSE-------LDAVMGDLKQSMG  433
               E  + + M   Q  +A   ++ L + A   V+   +        +DA +  L   + 
Sbjct  124  RLEEERVEREMERQQVGLADRRMVELARLAGRRVEAATAAGPQVDGLVDAALKGLASGLE  183

Query  432  RLMGNADALRGSTASKILEILNPKQAVKFLTAVMRFQREARRWGLYNDSQRE  277
             +M  AD +R  T   +L+ L+P Q V+FL A+   Q + RRWG    SQ E
Sbjct  184  WIMKAADCVRLKTLKGVLDELSPSQCVEFLAALSALQVQLRRWGKKRQSQAE  235



>ref|XP_003547173.2| PREDICTED: transcription factor TGA5-like [Glycine max]
Length=290

 Score = 94.0 bits (232),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 70/228 (31%), Positives = 113/228 (50%), Gaps = 11/228 (5%)
 Frame = -1

Query  951  VGEDFTAFYHGWLMNQDAIFEQLESFLaaaaaaddDREQCGGLVGRVLAHYQeyyaektk  772
            V + FT FY  W+   + I  QL              ++   L+ +V +H +EYY  K  
Sbjct  44   VAQSFTEFYDKWVWKLEEILHQLLEVSKQRTQVVKTEQELQVLISKVTSHLKEYYTVKWA  103

Query  771  aaeEDVFVFFASPWMSRLEQSFLWLSGFKPSMLFWVVESSMEGA-------LSEEQRCKV  613
            +A EDV VFF+  W+S LE ++LW++G+KPSM+  ++E+  + A       ++EEQ  K+
Sbjct  104  SAHEDVLVFFSPTWLSPLENAYLWMTGWKPSMVLKLLETLKKQAASGGDFVMTEEQARKI  163

Query  612  GMLRAETARVENAISKAMASAQETVAAPPILGLLKRAEELVDGEVSELDAV----MGDLK  445
              LR  T   E  + + M   Q  +A   ++ L+K      +G     DAV    +  + 
Sbjct  164  EELRKRTRMEEEKVEREMERQQVAMADRKMVELVKLTTRARNGGGGGGDAVAEVALKGVL  223

Query  444  QSMGRLMGNADALRGSTASKILEILNPKQAVKFLTAVMRFQREARRWG  301
              + R+M  +D +R  T   +L++L+P Q V FL A    Q   R+WG
Sbjct  224  AGLERVMKASDCVRLKTLKGVLDVLSPMQCVDFLAANTAMQLRLRQWG  271



>ref|XP_011022856.1| PREDICTED: transcription factor TGA2-like [Populus euphratica]
Length=280

 Score = 93.6 bits (231),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 73/251 (29%), Positives = 110/251 (44%), Gaps = 32/251 (13%)
 Frame = -1

Query  945  EDFTAFYHGWLMNQDAIFEQLESFLaaaaaaddDREQCGG------LVGRVLAHYQeyya  784
            E F  F+  WL  Q    EQL S          +  Q         L+ RVL HY+ YY 
Sbjct  23   ESFRKFFECWLAEQSNYLEQLISTCKDYDHNKKNSPQSSSQAILQPLINRVLEHYEHYYR  82

Query  783  ektkaaeEDVFVFFASPWMSRLEQSFLWLSGFKPSMLFWV--------VESSME------  646
             K++ A++DV    +  W S LE +FLW+ G++PS+ F +        +E+ +       
Sbjct  83   AKSRWAKDDVLSMLSPSWTSTLEHAFLWIGGWRPSVAFHLLYSKSGHQLEAQLHELICGL  142

Query  645  -----GALSEEQRCKVGMLRAETARVENAISKAMASAQETVAAPPILGLLKRAEELVDGE  481
                 G LS  Q  +V  L+ +T R EN +++  A  QE VA   ++ L     EL+  E
Sbjct  143  GTGDLGDLSASQLTRVDQLQRKTIREENELTEKHAKHQEAVADSSMVELSHEVTELLRSE  202

Query  480  VS-------ELDAVMGDLKQSMGRLMGNADALRGSTASKILEILNPKQAVKFLTAVMRFQ  322
             +        +++ +   K  +  ++  AD LR  T   ++EIL P QAV FL A     
Sbjct  203  STGDEVDEERVESTLAPKKDGLQEILQMADDLRLRTIKGVIEILTPMQAVHFLIAAAELH  262

Query  321  REARRWGLYND  289
                 WG   D
Sbjct  263  LRLHDWGKKGD  273



>ref|XP_006830264.1| hypothetical protein AMTR_s00130p00113960 [Amborella trichopoda]
 gb|ERM97680.1| hypothetical protein AMTR_s00130p00113960 [Amborella trichopoda]
Length=255

 Score = 92.8 bits (229),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 70/236 (30%), Positives = 121/236 (51%), Gaps = 27/236 (11%)
 Frame = -1

Query  939  FTAFYHGWLMNQDAIFEQLESFLaaaaaaddDREQCGGLVGRVLAHYQeyyaektkaaeE  760
            F  F+  W+  Q+    +L +   A       R     L+ RV+AHY+ YY  K+KAA+E
Sbjct  11   FKRFFEEWIAEQERQLHELMAASHAHINEKTLR----SLIERVMAHYEAYYDAKSKAAKE  66

Query  759  DVFVFFASPWMSRLEQSFLWLSGFKPSMLFWVVESS------------MEG-------AL  637
            ++   F+  W S+LE +FLW++G++P+M+F ++ +             ++G        L
Sbjct  67   NIVGMFSPTWTSKLENAFLWIAGWRPAMVFRLLYAKAGLQLDSDLADLLQGLSRRNLADL  126

Query  636  SEEQRCKVGMLRAETARVENAISKAMASAQETVAAPPILGLLKRAEELVDGEVSELDAVM  457
            S  Q   V  L+ +T + E  IS+ MA  QE VA  P++GL+    ++V+ E   ++A +
Sbjct  127  SPSQLMAVNELQMKTIKEEEEISRKMAKLQEGVADQPLVGLV----QMVNAEEDGVEAAL  182

Query  456  GDLKQSMGRLMGNADALRGSTASKILEILNPKQAVKFLTAVMRFQREARRWGLYND  289
             + ++ + R++  AD LR  T   ++ +LN  QAV  L A  +   +   WG+  D
Sbjct  183  EEQEEGLERVLECADRLRLETLKSVVGVLNLIQAVDLLVAAAQLHLKIHEWGMKRD  238



>ref|XP_010086637.1| hypothetical protein L484_004349 [Morus notabilis]
 gb|EXB22356.1| hypothetical protein L484_004349 [Morus notabilis]
Length=232

 Score = 92.4 bits (228),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 80/245 (33%), Positives = 116/245 (47%), Gaps = 43/245 (18%)
 Frame = -1

Query  948  GEDFTAFYHGWLMNQDAIFEQLESFLaaaaaaddDREQCGGLVGRVLAHYQeyyaektka  769
            G  F  FY  WL     +  QL +         D       LVG+V++HY EYY  K+ A
Sbjct  6    GGGFCNFYETWLEQLHHLVRQLTA-APRPPTTPDHHYDLDVLVGKVMSHYAEYYRVKSVA  64

Query  768  aeEDVFVFFASPWMSRLEQSFLWLSGFKPSMLFWVV--ESSM-----------------E  646
            AE D    FA+PW S LE+S  W++G++P+ +F +V  ESS+                  
Sbjct  65   AERDTLSVFAAPWASALERSLHWIAGWRPTTVFHLVYSESSILFESHIIDILRGLRTGDL  124

Query  645  GALSEEQRCKVGMLRAETARVENAISKAMASAQETVAAPPILGLLKRAEELVDGEVSELD  466
            G LS  Q  +V  L+ +T R ENAI++  +  Q++            A ELV+       
Sbjct  125  GDLSPSQFRRVSELQCDTVREENAITEEFSEWQDS------------ASELVNAR-----  167

Query  465  AVMGDLKQSMGRLMG---NADALRGSTASKILEILNPKQAVKFLTAVMRFQREARRWGLY  295
                DLK+ +GRL+     AD LR  T   ++++L P+QA +FL A    Q   R WG+ 
Sbjct  168  ---ADLKEKIGRLVSVLRKADDLRLRTFQSVVDLLTPQQAAEFLIAAAELQFGVRGWGVN  224

Query  294  NDSQR  280
            +D  R
Sbjct  225  HDRLR  229



>ref|XP_004288481.1| PREDICTED: TGACG-sequence-specific DNA-binding protein TGA-2.1-like 
[Fragaria vesca subsp. vesca]
Length=280

 Score = 92.4 bits (228),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 77/253 (30%), Positives = 120/253 (47%), Gaps = 36/253 (14%)
 Frame = -1

Query  939  FTAFYHGWLMNQDAIFEQLESFLaaaaaaddDREQC--GGLVGRVLAHYQeyyaektkaa  766
            F AF+  W+  Q+   + L    + AA  + D +Q     LV RVL HY++YY  K + A
Sbjct  26   FQAFFKCWIAEQNQHLDDL-VVASKAADYNGDHDQVLLSSLVERVLKHYEQYYNAKFQWA  84

Query  765  eEDVFVFFASPWMSRLEQSFLWLSGFKPSMLFWVV---------ESSME-----------  646
            +++V    + PW S LE +FLW+ G++PSM F ++         + S E           
Sbjct  85   KQEVLSMLSPPWRSSLEDAFLWIGGWRPSMAFHLLYSKSGLHPEDCSAELMRGLRFSNTG  144

Query  645  --GALSEEQRCKVGMLRAETARVENAISKAMASAQETVAAPPILGLLKRA----------  502
              G LS+ Q   V  L+  T + E  IS+ MA  QET+A  P++ L   A          
Sbjct  145  DLGDLSQWQLTMVDELQRRTIQEEKHISEKMAKLQETLADNPLVELSHLATDKMRKNNNV  204

Query  501  -EELVDGEVSELDAVMGDLKQSMGRLMGNADALRGSTASKILEILNPKQAVKFLTAVMRF  325
             EE  D  +  +++ +   ++ + +++  AD LR +T   I +IL+P QAV FL A    
Sbjct  205  HEEGGDDHMERVESTLASKEEGLEKILHKADDLRITTLKNITQILSPLQAVHFLIAAAEL  264

Query  324  QREARRWGLYNDS  286
                  WG+  D 
Sbjct  265  NLRVHDWGIKKDD  277



>ref|XP_008655844.1| PREDICTED: transcription factor TGA5-like [Zea mays]
 gb|AFW80595.1| hypothetical protein ZEAMMB73_105834 [Zea mays]
Length=225

 Score = 91.3 bits (225),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 74/226 (33%), Positives = 118/226 (52%), Gaps = 11/226 (5%)
 Frame = -1

Query  945  EDFTAFYHGWLMNQDAIFEQLESFLaaaaaaddDREQCGGLVGRVLAHYQeyyaektkaa  766
            +D  AFY  W+  ++ I  +L + LA         +    LV   +AH   YY  K++ A
Sbjct  5    DDMAAFYDAWVGREEQIVAELTAALALQPRRRG--DALALLVDGAVAHVAAYYEHKSRLA  62

Query  765  eEDVFVFFASPWMSRLEQSFLWLSGFKPSMLFWVVESSMEGALSEEQRCKVGMLRAETAR  586
            + DV       W++ +E++FLW  G+KP+++F  VES   G L  EQR  +  LR  TA 
Sbjct  63   DRDVVAALDPRWLNPIERTFLWAWGWKPALMFRFVESVGVG-LRLEQRRALEELRGATAA  121

Query  585  VENAISKAMASAQETVAAPPILGLLKRAEELVDGEVSELDAVMGDLKQSMGRLMGNADAL  406
             E  +   +A+ QE++A P +L  L+R + L +GE  +  AV+G   +S+  L+  ADAL
Sbjct  122  AEREVDLQVAAVQESLAGPRVLAALRR-QPLRNGEAEDAVAVVG---RSLRVLLVAADAL  177

Query  405  RGSTASKILEILNPKQAVKFLTAVMRF----QREARRWGLYNDSQR  280
            R  T   ++ +L   QA   + A++RF    +R  R W   + +QR
Sbjct  178  RDRTLRGVVGLLATDQAGAVVVAMLRFHLGVRRAGRDWSSGHGAQR  223



>ref|XP_006414073.1| hypothetical protein EUTSA_v10027388mg [Eutrema salsugineum]
 gb|ESQ55526.1| hypothetical protein EUTSA_v10027388mg [Eutrema salsugineum]
Length=238

 Score = 91.3 bits (225),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 67/222 (30%), Positives = 104/222 (47%), Gaps = 5/222 (2%)
 Frame = -1

Query  951  VGEDFTAFYHGWLMNQDAIFEQLESFLaaaaaaddDREQCGGLVGRVLAHYQeyyaektk  772
            + E F  FY GW+   +    QL               +  G++ ++  H++ YY  K  
Sbjct  5    IEEKFLEFYEGWIFQLEQYLHQLIVAHNNYTNNTMSEMELRGMISKLTTHHKAYYTAKWA  64

Query  771  aaeEDVFVFFASPWMSRLEQSFLWLSGFKPSMLFWVVESSMEG-----ALSEEQRCKVGM  607
            A  EDV  FF   W++ LE+S  WL+G+KPSM F +V+   +       L E Q  K+  
Sbjct  65   AIGEDVLAFFGPVWLNPLERSCFWLTGWKPSMAFRIVDRLRKSWRPTVVLEEAQVKKLEE  124

Query  606  LRAETARVENAISKAMASAQETVAAPPILGLLKRAEELVDGEVSELDAVMGDLKQSMGRL  427
            LR +T   E  I + M   Q  +A   ++ L K    +       ++A +  L  ++ ++
Sbjct  125  LRVKTRFDEEKIEREMERYQVAMADRKMVELAKLGCHIGGESAVVVEAAVKGLAMALEKM  184

Query  426  MGNADALRGSTASKILEILNPKQAVKFLTAVMRFQREARRWG  301
            +  AD  R  T   IL+IL+P Q V+FL A   FQ + RR G
Sbjct  185  VKVADCARLKTLKGILDILSPPQCVEFLAAAAAFQVQLRRLG  226



>ref|XP_002310543.2| hypothetical protein POPTR_0007s04840g [Populus trichocarpa]
 gb|EEE90993.2| hypothetical protein POPTR_0007s04840g [Populus trichocarpa]
Length=269

 Score = 91.7 bits (226),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 72/246 (29%), Positives = 108/246 (44%), Gaps = 27/246 (11%)
 Frame = -1

Query  945  EDFTAFYHGWLMNQDAIFEQLESFLaaaaaaddDREQCGG-----LVGRVLAHYQeyyae  781
            E F  F+  WL  Q+   EQL S          +  Q        L+ RVL HY+ YY  
Sbjct  23   ETFRKFFECWLAEQNNYLEQLISSCKDYDHNKKNSPQSSQATLQPLINRVLEHYEYYYRA  82

Query  780  ktkaaeEDVFVFFASPWMSRLEQSFLWLSGFKPSMLFWVVESSME---------------  646
            K++ A++DV    +  W S LE +FLW+ G++PS+ F ++ S                  
Sbjct  83   KSRWAKDDVLSMLSPSWTSTLEHAFLWIGGWRPSVAFHLLYSKSGHQLEAQLHELICGLG  142

Query  645  ----GALSEEQRCKVGMLRAETARVENAISKAMASAQETVAAPPILGLLKRAEELVDGEV  478
                G LS  Q  +V  L+ +T R EN +++     QETVA   ++ L   A E    + 
Sbjct  143  TGDLGDLSGSQLTRVDQLQRKTIREENELTEKHVKHQETVADSSMVEL---AHENTGTDE  199

Query  477  SELDAVMGDLKQSMGRLMGNADALRGSTASKILEILNPKQAVKFLTAVMRFQREARRWGL  298
              +++ +   K  +  ++  AD LR  T   +++IL P QAV FL A          WG 
Sbjct  200  ERVESTLAPRKDGLQEILQMADDLRVRTIKGVIDILTPIQAVHFLIAAAELHLRLHDWGK  259

Query  297  YNDSQR  280
              D  R
Sbjct  260  KGDWAR  265



>ref|XP_003541699.1| PREDICTED: transcription factor HBP-1b(c38)-like [Glycine max]
Length=254

 Score = 91.3 bits (225),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 74/231 (32%), Positives = 118/231 (51%), Gaps = 14/231 (6%)
 Frame = -1

Query  951  VGEDFTAFYHGWLMNQDAIFEQLESFLaaaaaaddDREQCGGLVGRVLAHYQeyyaektk  772
            V E FT FY  W+   + I  QL              ++   LV +V +H +EYY  K  
Sbjct  5    VAESFTDFYDKWVWKLEEILHQLLEVSKQRTEVVKTEQELQVLVSKVTSHLKEYYTIKWA  64

Query  771  aaeEDVFVFFASPWMSRLEQSFLWLSGFKPSMLFWVVESSMEGA------LSEEQRCKVG  610
            +A E+V VFF+  W+S LE ++LW++G+KPSM+F ++E+  + A      ++EEQ  K+ 
Sbjct  65   SAHEEVLVFFSPAWLSPLENAYLWITGWKPSMVFKLLETLKKQASGGDFVMTEEQVRKIE  124

Query  609  MLRAETARVENAISKAMASAQETVAAPPILGLLK---RAEELVDGEVSE-LDAV----MG  454
             LR  T   E  + + M   Q  +A   ++ L+K   RA     G   + +DAV    + 
Sbjct  125  ELRKRTRMEEEKVEREMERQQVAMADRKMVELVKLTGRARNNGSGGGGDAVDAVVEVALK  184

Query  453  DLKQSMGRLMGNADALRGSTASKILEILNPKQAVKFLTAVMRFQREARRWG  301
             +   + R+M  +D +R  T   +L++L+P Q V FL A +  Q   R+WG
Sbjct  185  GVLAGLERVMKASDCVRLKTLKGVLDVLSPMQCVDFLAANIAMQLRLRQWG  235



>ref|XP_010277052.1| PREDICTED: transcription factor HBP-1b(c38)-like [Nelumbo nucifera]
Length=243

 Score = 90.9 bits (224),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 70/227 (31%), Positives = 113/227 (50%), Gaps = 19/227 (8%)
 Frame = -1

Query  939  FTAFYHGWLMNQDAIFEQLESFLaaaaaaddDREQCGGLVGRVLAHYQeyyaektkaaeE  760
            F+ FY  WL   +   ++L S     +     R     LV + + HY+EYY  K  AA E
Sbjct  9    FSEFYEKWLHQLETNLQELLSVPRDQSHEAKHR----ALVIKAVTHYKEYYTAKWAAAHE  64

Query  759  DVFVFFASPWMSRLEQSFLWLSGFKPSMLFWVVES---------SMEGALSEEQRCKVGM  607
            D+  FF  PW++ LE +++W++ ++PS+ F +V S         S+E  +SEEQ  ++  
Sbjct  65   DILGFFCPPWLTPLENAYIWMTDWRPSVAFRLVHSLRHTHVPGPSLEH-MSEEQLKRMVE  123

Query  606  LRAETARVENAISKAMASAQETVAAPPILGLLKRAEELVDGE-VSEL----DAVMGDLKQ  442
            LR      E  +   M   Q  +A   ++ L + A  + +GE V EL    DA +  + +
Sbjct  124  LRTRIRSEEQKVEMEMERQQVGLADRRMVELARLATRVRNGEVVGELDGFVDAALKTVLE  183

Query  441  SMGRLMGNADALRGSTASKILEILNPKQAVKFLTAVMRFQREARRWG  301
             + R+M  AD LR      +L++L P Q V F+ A +  + + RRWG
Sbjct  184  GLERVMKTADCLRLKALKGVLDVLTPLQCVDFMAATLMLKIQMRRWG  230



>ref|XP_009798761.1| PREDICTED: transcription factor TGA5 [Nicotiana sylvestris]
Length=226

 Score = 90.5 bits (223),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 75/245 (31%), Positives = 120/245 (49%), Gaps = 49/245 (20%)
 Frame = -1

Query  939  FTAFYHGWLMNQDAIFEQLESFLaaa------aaaddDREQCGGLVGRVLAHYQeyyaek  778
            F  FY  W       FEQL+  +         A  D   E    LV +V++HY EYY  K
Sbjct  3    FQLFYETW-------FEQLKGMVHQLGQAPRPATNDQHHELHQQLVQKVMSHYSEYYRVK  55

Query  777  tkaaeEDVFVFFASPWMSRLEQSFLWLSGFKPSMLFWVV--ESSME--------------  646
            + AA+ D+   F++PW + LE+S  W+SG++P+  F ++  ESS+               
Sbjct  56   SLAAKNDILSVFSAPWCTSLERSLHWISGWRPTTAFHLIYTESSVLFESHIIDILRGLRY  115

Query  645  ---GALSEEQRCKVGMLRAETARVENAISKAMASAQETVAAPPILGLLKRAEELVDGEVS  475
               G LS +Q  +V  L+ +  + ENAI+  ++  Q+   A  ++GL+   +  ++G VS
Sbjct  116  GDLGDLSPDQLRRVSELQCQAVQEENAIADELSDWQD--GASEVIGLMGDIDAKMEGLVS  173

Query  474  ELDAVMGDLKQSMGRLMGNADALRGSTASKILEILNPKQAVKFLTAVMRFQREARRWGLY  295
                           ++  AD LR  T   ++++L+P+QAV+FL A    Q   RRWG+ 
Sbjct  174  ---------------ILERADKLRMKTIENLVQLLSPQQAVEFLIAAAHLQFGIRRWGIN  218

Query  294  NDSQR  280
            +D QR
Sbjct  219  HDRQR  223



>ref|NP_001145406.1| uncharacterized protein LOC100278763 [Zea mays]
 gb|ACG47325.1| hypothetical protein [Zea mays]
Length=219

 Score = 90.1 bits (222),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 74/226 (33%), Positives = 117/226 (52%), Gaps = 11/226 (5%)
 Frame = -1

Query  939  FTAFYHGWLMNQDAIFEQLESFLaaaaaaddDREQCGGLVGRVLAHYQeyyaektkaaeE  760
              AFY  W+  ++ I  +L + LA         +    LV   +AH   YY  K++ A+ 
Sbjct  1    MAAFYDAWVGREEQIVAELTAALALQPRRRG--DALALLVDGAVAHVAAYYEHKSRLADR  58

Query  759  DVFVFFASPWMSRLEQSFLWLSGFKPSMLFWVVESSMEGALSEEQRCKVGMLRAETARVE  580
            DV       W++ +E++FLW  G+KP+++F  VES   G L  EQR  +  LR  TA  E
Sbjct  59   DVVAALDPRWLNPIERTFLWAWGWKPALMFRFVESVGVG-LRLEQRRALEELRGATAVAE  117

Query  579  NAISKAMASAQETVAAPPILGLLKRAEELVDGEVSELDAVMGDLKQSMGRLMGNADALRG  400
              +   +A+ QE++A P +L  L+R + L +GE  +  AV+G   +S+  L+  ADALR 
Sbjct  118  REVDLQVAAVQESLAGPRVLAALRR-QPLRNGEAEDAVAVVG---RSLRVLLAAADALRD  173

Query  399  STASKILEILNPKQAVKFLTAVMRF----QREARRWGLYNDSQREA  274
             T   ++ +L   QA   + A++RF    +R  R W   + +QR A
Sbjct  174  RTLRGVVGLLATDQAGAVVAAMLRFHLGVRRAGRDWSSGHGAQRRA  219



>ref|XP_009132069.1| PREDICTED: uncharacterized protein LOC103856700 [Brassica rapa]
 emb|CDX78882.1| BnaA01g09490D [Brassica napus]
Length=239

 Score = 90.1 bits (222),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 71/225 (32%), Positives = 110/225 (49%), Gaps = 10/225 (4%)
 Frame = -1

Query  951  VGEDFTAFYHGWLMNQDAIFEQLESFLaaaaaaddDREQCGGLVGRVLAHYQeyyaektk  772
            V E F  FY GW+   +    QL   +A          +  GL+ ++ AH++ YY  K  
Sbjct  5    VEEKFLEFYEGWIFQLEQYLHQL--LIAHNNINTMSEIELRGLISKLTAHHKAYYTAKWA  62

Query  771  aaeEDVFVFFASPWMSRLEQSFLWLSGFKPSMLFWVVESSMEG-----ALSEEQRCKVGM  607
            A  EDV  FF   W++ LE+S  WL+G+KPS  F +++   +       L E Q  ++  
Sbjct  63   AIGEDVLAFFGPVWLNPLEKSCFWLTGWKPSTAFRMLDRLRKSWRPTVVLVEAQVRRLEE  122

Query  606  LRAETARVENAISKAMASAQETVAAPPILGLLKRAEEL--VDGEVSEL-DAVMGDLKQSM  436
            LR +T   E  I   M   Q  +A   ++ L +    +  V+GE + L +A +  L   +
Sbjct  123  LRVKTRFDEERIETEMERYQVAMADRKMVELARLGCRVGGVEGESTVLVEAAVKGLATRL  182

Query  435  GRLMGNADALRGSTASKILEILNPKQAVKFLTAVMRFQREARRWG  301
             +++  AD +R  T   IL++L P Q V+FL A   FQ + RRWG
Sbjct  183  EKMVKAADCVRLKTLKGILDVLAPPQCVEFLAAAAAFQVQLRRWG  227



>ref|XP_002283108.1| PREDICTED: transcription factor HBP-1b(c1)-like [Vitis vinifera]
Length=227

 Score = 90.1 bits (222),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 80/243 (33%), Positives = 116/243 (48%), Gaps = 42/243 (17%)
 Frame = -1

Query  939  FTAFYHGWLMNQDAIFEQLESFLaaaaaaddDREQCGGLVGRVLAHYQeyyaektkaaeE  760
            F  FY  W  + + +  QL   LA       D      LV +V++HY +YY  K+ AA+ 
Sbjct  3    FHRFYASWFDHLNHLVHQLT--LAPKPTTPQDNPALLQLVQKVISHYSQYYRAKSVAAQN  60

Query  759  DVFVFFASPWMSRLEQSFLWLSGFKPSMLFWVV--ESSME-----------------GAL  637
            D    FA+PW S LE+S  W++G++P+++F ++  E+S                   G L
Sbjct  61   DAVSLFAAPWSSSLERSLHWVAGWRPTIVFHLIYTETSARFESHIADILHGVRTGDLGDL  120

Query  636  SEEQRCKVGMLRAETARVENAISKAMASAQETVAAPPILGLLKRAEELVDGEVSELDAVM  457
            S  Q  +V  L+ ET R EN I++ +A  QE        G ++  E   DG V E     
Sbjct  121  STAQLHRVSELQCETVREENEITRELAKWQE--------GAVELVEAGGDGNVEE-----  167

Query  456  GDLKQSMGRLMG---NADALRGSTASKILEILNPKQAVKFLTAVMRFQREARRWGLYNDS  286
                  +G LM     AD LR  T  ++ E+L P+QAV+FL A    Q   R  GL +D+
Sbjct  168  -----KIGGLMSVLVKADELRMRTIWRVAEMLTPQQAVEFLIAAAELQFGVRVLGLNHDN  222

Query  285  QRE  277
            QRE
Sbjct  223  QRE  225



>emb|CAN72574.1| hypothetical protein VITISV_036367 [Vitis vinifera]
Length=227

 Score = 89.4 bits (220),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 80/243 (33%), Positives = 115/243 (47%), Gaps = 42/243 (17%)
 Frame = -1

Query  939  FTAFYHGWLMNQDAIFEQLESFLaaaaaaddDREQCGGLVGRVLAHYQeyyaektkaaeE  760
            F  FY  W  + + +  QL   LA       D      LV +V++HY +YY  K+ AA+ 
Sbjct  3    FHRFYASWFDHLNXLVHQLT--LAPKPTTPQDNPALLQLVQKVISHYSQYYRAKSVAAQN  60

Query  759  DVFVFFASPWMSRLEQSFLWLSGFKPSMLFWVV--ESSME-----------------GAL  637
            D    FA+PW S LE+S  W++G++P+++F ++  E+S                   G L
Sbjct  61   DAVSLFAAPWSSSLERSLHWVAGWRPTIVFHLIYTETSARFESHIADILHGVRTGDLGDL  120

Query  636  SEEQRCKVGMLRAETARVENAISKAMASAQETVAAPPILGLLKRAEELVDGEVSELDAVM  457
            S  Q  +V  L+ ET R EN I+  +A  QE        G ++  E   DG V E     
Sbjct  121  STAQLHRVSELQCETVREENEITSELAKWQE--------GAVELVEAGGDGNVEE-----  167

Query  456  GDLKQSMGRLMG---NADALRGSTASKILEILNPKQAVKFLTAVMRFQREARRWGLYNDS  286
                  +G LM     AD LR  T  ++ E+L P+QAV+FL A    Q   R  GL +D+
Sbjct  168  -----KIGGLMSVLVKADELRMRTIWRVAEMLTPQQAVEFLIAAAELQFGVRVLGLNHDN  222

Query  285  QRE  277
            QRE
Sbjct  223  QRE  225



>gb|EYU26796.1| hypothetical protein MIMGU_mgv1a026861mg [Erythranthe guttata]
Length=232

 Score = 89.0 bits (219),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 67/227 (30%), Positives = 118/227 (52%), Gaps = 6/227 (3%)
 Frame = -1

Query  954  IVGEDFTAFYHGWLMNQDAIFEQLESFLaaaaaaddDREQ-CGGLVGRVLAHYQeyyaek  778
            I  + F AF   WL+ Q+     L   L    + D++ EQ C  L+   ++HY++Y+  K
Sbjct  4    ITDQSFEAFQSRWLIGQE---HHLHDLLQVIESGDEENEQRCKNLIDDNISHYKQYFEAK  60

Query  777  tkaaeEDVFVFFASPWMSRLEQSFLWLSGFKPSMLFWVVESSMEGALSEEQRCKVGMLRA  598
            T+   +DVF+  A  W+S LE++ LW+ GF+P + F +V +++   L+E+Q  ++     
Sbjct  61   TRLVRQDVFLVLAPTWISSLERAHLWIGGFRPRLAFLIVINNVLD-LTEDQTQRINQGLE  119

Query  597  ETARVENAISKAMASAQETVAAPPILGLLKRAEELVDGEVSE-LDAVMGDLKQSMGRLMG  421
            E    EN ++      QE + +  ++ L ++     +G     ++  +  L+ S+  ++ 
Sbjct  120  EIKEEENELTNEFDKVQERMISSSVVQLARQMGRPRNGVWDHSMETAVDMLRVSIEDVVE  179

Query  420  NADALRGSTASKILEILNPKQAVKFLTAVMRFQREARRWGLYNDSQR  280
             AD LR  +   ILEILNP Q ++FL A  + Q   RR G+  D +R
Sbjct  180  CADFLRRKSGIIILEILNPTQCLRFLAAAAKLQINLRRLGMQRDERR  226



>ref|XP_010439827.1| PREDICTED: transcription factor TGA6-like [Camelina sativa]
 ref|XP_010449485.1| PREDICTED: transcription factor TGA6-like [Camelina sativa]
Length=231

 Score = 89.0 bits (219),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 66/219 (30%), Positives = 106/219 (48%), Gaps = 6/219 (3%)
 Frame = -1

Query  951  VGEDFTAFYHGWLMNQDAIFEQLESFLaaaaaaddDREQCGGLVGRVLAHYQeyyaektk  772
            V E F  FY  W++  +    QL        +  + R     L+ ++  H++ YY  K  
Sbjct  5    VEEKFLEFYENWVIQLEQYLHQLLIAHNTTMSEIELR----ALISKLTTHHKAYYTAKWA  60

Query  771  aaeEDVFVFFASPWMSRLEQSFLWLSGFKPSMLFWVVESSMEG--ALSEEQRCKVGMLRA  598
            A  EDV  FF   W++ LE++  WL+G+KPS +F +V+   +    L E Q  K+  LRA
Sbjct  61   AIGEDVLAFFGPVWLTPLEKACFWLTGWKPSTVFRMVDRLRKSRLVLVEAQVRKLEELRA  120

Query  597  ETARVENAISKAMASAQETVAAPPILGLLKRAEELVDGEVSELDAVMGDLKQSMGRLMGN  418
            +T   E  I + +   Q  +    ++ L +    +    V  ++A +  L   + +++  
Sbjct  121  KTKFEEQKIEREVERYQVAMGDRKMVELARLGCHVGGESVVVIEAAVKGLATGLEKMVKA  180

Query  417  ADALRGSTASKILEILNPKQAVKFLTAVMRFQREARRWG  301
            AD +R  T   IL+IL P Q V+FL A   FQ + RRWG
Sbjct  181  ADCVRLKTLKGILDILAPPQCVEFLAAAAAFQVQLRRWG  219



>ref|XP_004967541.1| PREDICTED: transcription factor PERIANTHIA-like [Setaria italica]
Length=223

 Score = 88.2 bits (217),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 72/223 (32%), Positives = 112/223 (50%), Gaps = 11/223 (5%)
 Frame = -1

Query  930  FYHGWLMNQDAIFEQLESFLaaaaaaddDREQCGGLVGRVLAHYQeyyaektkaaeEDVF  751
            FY  W+  ++ I   L + LA        R+    LV   + H   YY  K + A+ DV 
Sbjct  4    FYDTWVGREEQIVADLTAALALPPRRR--RDALPPLVDVAVGHVAAYYEHKARLADRDVV  61

Query  750  VFFASPWMSRLEQSFLWLSGFKPSMLFWVVESSMEGALS--EEQRCKVGMLRAETARVEN  577
                  W++ LE++FLW  G+KP+++F  VE+   G       QR  +  LRA TA  E 
Sbjct  62   AALDPRWLNPLERTFLWAWGWKPALVFRFVETGGVGVGGMGSTQRRALEDLRAATAAAER  121

Query  576  AISKAMASAQETVAAPPILGLLKRAEELVDGEVSELDAVMGDLKQSMGRLMGNADALRGS  397
             + + +A+ QE++A P +L  L+R     +GE  +  A +G   +S+  L+G ADALR  
Sbjct  122  EVGREVAAVQESLAGPRVLAALRRQHAPGNGEADDAVAAVG---RSLRVLLGAADALRER  178

Query  396  TASKILEILNPKQAVKFLTAVMRF----QREARRWGLYNDSQR  280
            T   ++ +L P QA  F+ A++RF    +   R WG  +  QR
Sbjct  179  TLRGVVGLLAPDQAAAFVAAMLRFHLAVRHAGRDWGSGHGGQR  221



>ref|XP_002266016.2| PREDICTED: transcription factor TGA2 [Vitis vinifera]
Length=245

 Score = 88.6 bits (218),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 75/231 (32%), Positives = 112/231 (48%), Gaps = 17/231 (7%)
 Frame = -1

Query  951  VGEDFTAFYHGWLMNQDAIFEQLESFLaaaaaaddDREQCGGLVGRVLAHYQeyyaektk  772
            V E F  FY  W+   +   E L+  L  +       E+   LV RV  H +EYY  K  
Sbjct  11   VEERFIEFYEKWMCQLE---ENLQRLLKVSREIPHRTER-EALVSRVTTHLKEYYNAKWA  66

Query  771  aaeEDVFVFFASPWMSRLEQSFLWLSGFKPSMLFWVVESSME--------GALSEEQRCK  616
            AA EDV  FF+  W+S LE ++LW++G+KPS  F ++ES  +          +SEEQ  K
Sbjct  67   AAHEDVLAFFSPVWLSPLENAYLWVTGWKPSTAFRLIESLRQTGVPGESLAEMSEEQMKK  126

Query  615  VGMLRAETARVENAISKAMASAQETVAAPPILGLLKRAEELVDGEVSE-----LDAVMGD  451
            V  LR      E  + + M   Q  +A   ++ L + A  + +G ++      ++  +  
Sbjct  127  VEELRVRIRLEEEKVEREMERQQVALADRKMVELARAASRVSNGGLASEENGLVEVALKG  186

Query  450  LKQSMGRLMGNADALRGSTASKILEILNPKQAVKFLTAVMRFQREARRWGL  298
            L   + R+M  AD  R  T   ILE+L+P Q V FL A + F    R+WG+
Sbjct  187  LLSGLERVMKAADCARLKTLKGILEVLSPLQCVDFLAATLMFHVNLRKWGI  237



>ref|XP_010276977.1| PREDICTED: transcription factor TGA2 [Nelumbo nucifera]
Length=232

 Score = 88.2 bits (217),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 64/205 (31%), Positives = 99/205 (48%), Gaps = 40/205 (20%)
 Frame = -1

Query  825  LVGRVLAHYQeyyaektkaaeEDVFVFFASPWMSRLEQSFLWLSGFKPSMLFWVV--ESS  652
            L  RV+ HY++YY  K+ AA+ DV   F++PW + LE S  W++G++P+ +F +V  ESS
Sbjct  46   LADRVMTHYEDYYRIKSHAAKHDVLAMFSAPWTTSLESSLHWIAGWRPTTVFHIVYTESS  105

Query  651  ME-----------------GALSEEQRCKVGMLRAETARVENAISKAMASAQETVA--AP  529
            +                  G L+  Q  +V  L+ +T R EN I++ ++  Q        
Sbjct  106  VRFEAQIVDLLRGHRTGDLGDLTPRQLTRVSELQCQTVREENEITEELSQWQNNSCDLVS  165

Query  528  PILGLLKRAEELVDGEVSELDAVMGDLKQSMGRLMGNADALRGSTASKILEILNPKQAVK  349
            P   +    E LV+                   ++  AD LR  T  +++EIL P+QAV+
Sbjct  166  PSANMEANIERLVE-------------------VLEKADDLRLKTLRRVVEILTPQQAVE  206

Query  348  FLTAVMRFQREARRWGLYNDSQREA  274
            FL A    Q   R WGL  D +RE+
Sbjct  207  FLIATAEVQLGIRGWGLEKDRKRES  231



>ref|XP_011101398.1| PREDICTED: transcription factor TGA5-like [Sesamum indicum]
Length=238

 Score = 88.2 bits (217),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 80/232 (34%), Positives = 117/232 (50%), Gaps = 22/232 (9%)
 Frame = -1

Query  951  VGEDFTAFYHGWLMNQDAIFEQLESFLaaaaaaddDREQCGG---LVGRVLAHYQeyyae  781
            V E F+ FY  W+        QLE FL        +         +V ++ AH+++YY  
Sbjct  14   VEEKFSDFYRKWM-------GQLEDFLQLLLVVSREHSHSQAAEDMVNKLTAHHKQYYTF  66

Query  780  ktkaaeEDVFVFFASPWMSRLEQSFLWLSGFKPSMLFWVVESSMEGALSEEQRCKVGMLR  601
            K  AA EDV  FF   W+SRLE + LW++G+KPS++F +VES+   A++EEQ  K+  LR
Sbjct  67   KWAAAHEDVLAFFTPVWLSRLENAHLWVTGWKPSLVFRLVESA---AMTEEQVKKIEALR  123

Query  600  AETARVENAISKAMASAQETVAAPPILGLLKRAEELVD-----GEVSEL--DAVMGDLKQ  442
             +    E  + + M   Q  VA   ++ L+ R E+L +      EVS L   AV G L  
Sbjct  124  VKIKMEEERVEREMERQQVAVADRKMVELV-RQEQLAEKNGGAAEVSGLVEVAVRGML-A  181

Query  441  SMGRLMGNADALRGSTASKILEILNPKQAVKFLTAVMRFQREARRWGLYNDS  286
             + R+M  AD +R  T   +L++L P Q V  L A    Q + R+ G   D 
Sbjct  182  GLERVMKMADCVRLKTLKGMLDVLTPIQCVDLLAAKSMLQIQMRKMGEKRDK  233



>ref|XP_004486274.1| PREDICTED: TGACG-sequence-specific DNA-binding protein TGA-2.1-like 
[Cicer arietinum]
Length=234

 Score = 87.4 bits (215),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 72/229 (31%), Positives = 116/229 (51%), Gaps = 18/229 (8%)
 Frame = -1

Query  951  VGEDFTAFYHGWLMNQDAIFEQLESFLaaaaaaddDREQCGGLVGRVLAHYQeyyaektk  772
            V E F+ FY  W+   + I  QL         +  + ++   LV +V  H +EYY  K  
Sbjct  5    VVEKFSEFYQKWIFKLEEILHQL------LQVSKTEEQEIQSLVSKVTTHLKEYYTVKWG  58

Query  771  aaeEDVFVFFASPWMSRLEQSFLWLSGFKPSMLFWVVES-SMEGALSEEQRCKVGMLRAE  595
            AA EDV +FF   W+S LE + LW++G+KPS +F +++  +    ++EEQ+ K+  LR  
Sbjct  59   AAHEDVVIFFTPTWLSPLENAHLWVTGWKPSTVFRILDGLNAAFDMTEEQKKKIDELRVR  118

Query  594  TARVENAISKAMASAQETVAAPPILGLLK------RAEELVDGEVS-ELDAVMGDLKQSM  436
                E  + + M   Q  +A   ++ L K      + +  VDG V   L AV G L+   
Sbjct  119  VRIEEEKVEREMERQQVAMADLKMVELAKLSCRARKGDARVDGLVGVALKAVFGGLE---  175

Query  435  GRLMGNADALRGSTASKILEILNPKQAVKFLTAVMRFQREARRWGLYND  289
             ++M  +D +R  T   +L++L P Q V+FL A +  Q   R++G+  D
Sbjct  176  -KVMKTSDCVRLKTLKGVLDVLTPIQCVEFLAANIGIQLRLRKFGMKRD  223



>ref|XP_003524316.1| PREDICTED: transcription factor TGA4-like [Glycine max]
Length=285

 Score = 88.2 bits (217),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 69/253 (27%), Positives = 119/253 (47%), Gaps = 33/253 (13%)
 Frame = -1

Query  948  GEDFTAFYHGWLMNQDAIFEQLESFLaaaaaaddDREQCGGLVGRVLAHYQeyyaektka  769
             E F  F+  W+  Q    + L+  LAA +      E+   L  +V+ HY+ YY  K++ 
Sbjct  21   SESFHKFFECWISEQK---QHLKDLLAAESTQLISDEELQALNDKVVEHYEYYYKAKSRC  77

Query  768  aeEDVFVFFASPWMSRLEQSFLWLSGFKPSMLFWVV--------ESSME-----------  646
            A++DV    +  WMS LE++FLW+ G++PSM F ++        E+ ++           
Sbjct  78   AKQDVLAMLSPTWMSSLEEAFLWIGGWRPSMAFHLIYSKSGLQFEARLDEVLQGLRTHDL  137

Query  645  GALSEEQRCKVGMLRAETARVENAISKAMASAQETVAAPPILGLLKRAEELV----DGEV  478
            G LS  Q  ++  ++  T   E  I+  MA  QETVA   ++ L     E++     GEV
Sbjct  138  GDLSASQLAQLDEMQRRTILEEREITDLMARHQETVADASMVELSHVVSEMIRANQRGEV  197

Query  477  SELDAVMGDLKQS-------MGRLMGNADALRGSTASKILEILNPKQAVKFLTAVMRFQR  319
             +   +   ++ +       + +++  AD LR  T   ++++L PKQA+ FL A      
Sbjct  198  DQSKEIENKVESTLVLKEEGLEKILLKADELRFITLKDVVDVLTPKQAIHFLIAAAELHL  257

Query  318  EARRWGLYNDSQR  280
                WG   D+++
Sbjct  258  RLHEWGKKMDARK  270



>emb|CDX99446.1| BnaC01g11060D [Brassica napus]
Length=239

 Score = 87.4 bits (215),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 69/225 (31%), Positives = 109/225 (48%), Gaps = 10/225 (4%)
 Frame = -1

Query  951  VGEDFTAFYHGWLMNQDAIFEQLESFLaaaaaaddDREQCGGLVGRVLAHYQeyyaektk  772
            V E F  FY  W+   +    QL   +A          +  GL+ ++ AH++ YY  K  
Sbjct  5    VEEKFLEFYESWIFQLEQYLHQL--LIAHNNINTMSEIELRGLISKLTAHHKAYYTAKWA  62

Query  771  aaeEDVFVFFASPWMSRLEQSFLWLSGFKPSMLFWVVESSMEG-----ALSEEQRCKVGM  607
            A  ED+  FF   W++ LE+S  WL+G+KPS  F +++   +       L E Q  ++  
Sbjct  63   AIGEDILAFFGPVWLNPLEKSCFWLTGWKPSTAFRMLDRLRKSWRPTVVLVEAQVRRLEE  122

Query  606  LRAETARVENAISKAMASAQETVAAPPILGLLKRAEEL--VDGEVSEL-DAVMGDLKQSM  436
            LR +T   E  I   M   Q  +A   ++ L +    +  V+GE + L +A +  L   +
Sbjct  123  LRVKTRFDEERIETEMERYQVAMADRKMVELARLGCRVGGVEGESTVLVEAAVKGLATRL  182

Query  435  GRLMGNADALRGSTASKILEILNPKQAVKFLTAVMRFQREARRWG  301
             +++  AD +R  T   IL++L P Q V+FL A   FQ + RRWG
Sbjct  183  EKMVKAADCVRLKTLKGILDVLAPPQCVEFLAAAAAFQVQLRRWG  227



>gb|KHN17404.1| Transcription factor TGA4 [Glycine soja]
Length=402

 Score = 89.4 bits (220),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 69/253 (27%), Positives = 119/253 (47%), Gaps = 33/253 (13%)
 Frame = -1

Query  948  GEDFTAFYHGWLMNQDAIFEQLESFLaaaaaaddDREQCGGLVGRVLAHYQeyyaektka  769
             E F  F+  W+  Q    + L+  LAA +      E+   L  +V+ HY+ YY  K++ 
Sbjct  21   SESFHKFFECWISEQK---QHLKDLLAAESTQLISDEELQALNDKVVEHYEYYYKAKSRC  77

Query  768  aeEDVFVFFASPWMSRLEQSFLWLSGFKPSMLFWVV--------ESSME-----------  646
            A++DV    +  WMS LE++FLW+ G++PSM F ++        E+ ++           
Sbjct  78   AKQDVLAMLSPTWMSSLEEAFLWIGGWRPSMAFHLIYSKSGLQFEARLDEVLQGLRTHDL  137

Query  645  GALSEEQRCKVGMLRAETARVENAISKAMASAQETVAAPPILGLLKRAEELV----DGEV  478
            G LS  Q  ++  ++  T   E  I+  MA  QETVA   ++ L     E++     GEV
Sbjct  138  GDLSASQLAQLDEMQRRTILEEREITDLMARHQETVADASMVELSHVVSEMIRANQRGEV  197

Query  477  SELDAVMGDLKQS-------MGRLMGNADALRGSTASKILEILNPKQAVKFLTAVMRFQR  319
             +   +   ++ +       + +++  AD LR  T   ++++L PKQA+ FL A      
Sbjct  198  DQSKEIENKVESTLVLKEEGLEKILLKADELRFITLKDVVDVLTPKQAIHFLIAAAELHL  257

Query  318  EARRWGLYNDSQR  280
                WG   D+++
Sbjct  258  RLHEWGKKMDARK  270



>gb|KHG25856.1| Transcription factor TGA1 -like protein [Gossypium arboreum]
Length=226

 Score = 86.7 bits (213),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 74/241 (31%), Positives = 112/241 (46%), Gaps = 43/241 (18%)
 Frame = -1

Query  939  FTAFYHGWLMNQDAIFEQLESFLaaaaaaddDREQCGGLVGRVLAHYQeyyaektkaaeE  760
            FTAFY  W  +Q     +            D       LV +VL+HY EYY  K  AAE 
Sbjct  4    FTAFYTAW-SDQLQQLLRQLCSAPKPPTTQDHLHHLNHLVNKVLSHYAEYYRVKAAAAER  62

Query  759  DVFVFFASPWMSRLEQSFLWLSGFKPSMLFWVV--ESSM-----------------EGAL  637
            DV   FA+PW S  E+S  W++G++P+ +F +V  ESS+                  G L
Sbjct  63   DVLDIFAAPWASAFEKSLHWIAGWRPTTVFHLVYTESSILFESHIVDILRGVRTGDLGDL  122

Query  636  SEEQRCKVGMLRAETARVENAISKAMASAQETVAAPPILGLLKRAEELVDGEVSELDAVM  457
            S  Q  +V  L+ ET + ENAI+  ++  Q +                    VS+L    
Sbjct  123  SPTQFRRVSELQCETVKEENAITDELSEWQHS--------------------VSDLMGAT  162

Query  456  GDLKQSMGRLMG---NADALRGSTASKILEILNPKQAVKFLTAVMRFQREARRWGLYNDS  286
             D+ + + RL+     AD LR  T  +++++L P+QA++FL A +  Q+  R WG+  D 
Sbjct  163  PDVDKMIERLVTVVRKADDLRLRTLKRVVDLLTPQQALEFLIAAVELQQGIREWGMNQDR  222

Query  285  Q  283
            +
Sbjct  223  E  223



>ref|XP_010543213.1| PREDICTED: transcription factor TGA2-like [Tarenaya hassleriana]
Length=222

 Score = 86.3 bits (212),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 71/229 (31%), Positives = 108/229 (47%), Gaps = 29/229 (13%)
 Frame = -1

Query  942  DFTAFYHGWLMNQDAIFEQLESFLaaaaaaddDREQCG--------GLVGRVLAHYQeyy  787
            +F  F   W++ Q+   ++L             +E  G         L+ RV+ HY+EY+
Sbjct  5    EFAEFVGEWILRQEGFHDEL----------LAAKEHAGEEGFCDRDDLIARVIRHYKEYF  54

Query  786  aektkaaeEDVFVFFASPWMSRLEQSFLWLSGFKPSMLFWVVESSMEGALSEEQRCKVGM  607
              K    E D F   +  W SRLE  FLW++GFKP +   +V+ ++ G L+ EQ  K+ M
Sbjct  55   ERKAVVRENDCFALLSPTWFSRLEICFLWVAGFKPGLGIGIVKDAV-GGLTNEQMDKMDM  113

Query  606  LRAETARVENAISKAMASAQETVAAPPILGLLKRAEELVDGEVSELDAVMGDLKQSMGRL  427
            L  ET   E  I   +A  Q + AA   +    R +   D   ++ D  +  +  +M  +
Sbjct  114  LELETIVAETTIEHRLAEIQRSAAALRAI----RRQSREDNMAAQAD--VDWIATAMKGV  167

Query  426  MGNADALRGSTASKILEILNPKQAVKFLTAVMRFQREARRWGLYNDSQR  280
            +  ADALR  TA KI+ IL   Q ++FLTA     ++ R  G    SQR
Sbjct  168  VAAADALRMRTAIKIVGILQTAQKIEFLTAAATLYKKIRVRG----SQR  212



>ref|XP_007159878.1| hypothetical protein PHAVU_002G275400g [Phaseolus vulgaris]
 gb|ESW31872.1| hypothetical protein PHAVU_002G275400g [Phaseolus vulgaris]
Length=278

 Score = 86.7 bits (213),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 69/253 (27%), Positives = 118/253 (47%), Gaps = 40/253 (16%)
 Frame = -1

Query  945  EDFTAFYHGWLMNQDAIFEQLESFLaaaaaaddDREQCGGLVGRVLAHYQeyyaektkaa  766
            E F  F+ GW+  Q+   + L+  L          E+   +  +V+ HY+ YY  K++ A
Sbjct  22   ESFHHFFEGWISEQN---QHLKDLLVVG-------EELQSVKDKVVEHYESYYKTKSRCA  71

Query  765  eEDVFVFFASPWMSRLEQSFLWLSGFKPSMLFWVV--------ESSME-----------G  643
            ++DV    +  W S LE +FLW+ G++PSM F ++        E+ ++           G
Sbjct  72   KQDVLAMLSPTWTSSLEDAFLWIGGWRPSMAFHLLYSKSGLQFEARLQELVQGLRTHDLG  131

Query  642  ALSEEQRCKVGMLRAETARVENAISKAMASAQETVAAPPILGLLKRAEELV----DGEVS  475
             LS  Q  ++  ++      E  I+  MA  QETVA   ++ L   A E++     GEV 
Sbjct  132  DLSASQISQLDEMQKRVILEERQITDLMAGHQETVADASMVELSHVASEMIRANERGEVE  191

Query  474  E-------LDAVMGDLKQSMGRLMGNADALRGSTASKILEILNPKQAVKFLTAVMRFQRE  316
            E       +++ +   ++ + +++  AD LR  T   I+ +L PKQA+ FL A       
Sbjct  192  ESKEFEDKVESTLVQKEEGLEKILQKADELRLGTLKAIVNVLTPKQAIHFLIAAAELHLR  251

Query  315  ARRWGLYNDSQRE  277
               WG   D+++E
Sbjct  252  LHEWGKKIDARKE  264



>ref|XP_011100139.1| PREDICTED: transcription factor TGA1-like, partial [Sesamum indicum]
Length=276

 Score = 86.7 bits (213),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 63/208 (30%), Positives = 104/208 (50%), Gaps = 26/208 (13%)
 Frame = -1

Query  825  LVGRVLAHYQeyyaektkaaeEDVFVFFASPWMSRLEQSFLWLSGFKPSMLFWVV--ESS  652
            L+ RV+ HY+ YY  K++ A+ DV   F   W S LE +F+W+ G++PSM F ++  +S 
Sbjct  57   LLERVIQHYEHYYRAKSRWAKSDVLSMFNPSWRSSLEDAFMWIGGWRPSMTFHLLYSKSG  116

Query  651  ME-----------------GALSEEQRCKVGMLRAETARVENAISKAMASAQETVAAPPI  523
            ++                 G LS  Q  +V  L+ +T R E  I++ +A  QETVA   +
Sbjct  117  LQLEARLTELLQGLSTGDLGDLSPSQLDQVNELQKQTIREEKDITEKLAKQQETVADSSM  176

Query  522  LGLLKRAEELV-DGEVSE------LDAVMGDLKQSMGRLMGNADALRGSTASKILEILNP  364
            + L     E++ +G+V +      +D  +   ++ +  ++  AD LR  T  ++L IL+P
Sbjct  177  VELTHVVTEMMREGQVDQAMDTERVDETLAPKEEGLVEVLQRADGLRLKTLKEVLNILSP  236

Query  363  KQAVKFLTAVMRFQREARRWGLYNDSQR  280
             Q V FL A          WG   D++R
Sbjct  237  IQGVYFLIAAAELHLRVHEWGKKRDARR  264



>ref|XP_009395216.1| PREDICTED: transcription factor TGA2-like [Musa acuminata subsp. 
malaccensis]
Length=261

 Score = 86.3 bits (212),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 78/255 (31%), Positives = 115/255 (45%), Gaps = 39/255 (15%)
 Frame = -1

Query  939  FTAFYHGWLMNQDAIFEQLESFLaaaaaaddDREQCGG----LVGRVLAHYQeyyaektk  772
            F A Y  WL  Q+A  ++L   L A +    +RE+       LV R + HY+EY+  +  
Sbjct  5    FLACYEEWLGIQEADLDEL---LQAISTQHGNRERSDAELRELVERCMRHYEEYHERRRG  61

Query  771  aaeEDVFVFFASPWMSRLEQSFLWLSGFKPSMLFWV--------------------VESS  652
               +D   F   PW +  E S +W  G +PSM   +                    V S 
Sbjct  62   LVRDDSPTFLCPPWCNSFENSMIWAGGCRPSMFIRLIYSLSSSGLEAHLDAPAGRAVSSH  121

Query  651  MEG--ALSEEQRCKVGMLRAETARVENAISKAMASAQETVAAPPILGLLKRAE-------  499
             EG   LS  Q  +V  +   T + E+ I+  MA+ QE VA  P+L ++K+ +       
Sbjct  122  GEGLMGLSSSQLARVNEIHRSTLQEEDKITSQMATLQENVADGPLLPIVKKRQMWQWSGT  181

Query  498  ELVD--GEVSELDAVMGDLKQSMGRLMGNADALRGSTASK-ILEILNPKQAVKFLTAVMR  328
              V+  G  +E++A M +  +SM RL+  AD LR  TA   +LEIL  KQAV+ L A  +
Sbjct  182  SRVENGGGDAEVEAAMEEYTESMERLVQEADRLRVETARTLVLEILTSKQAVELLVAAKQ  241

Query  327  FQREARRWGLYNDSQ  283
             Q      G   D +
Sbjct  242  LQLSVHECGHQRDQR  256



>ref|XP_009594445.1| PREDICTED: transcription factor TGA6-like [Nicotiana tomentosiformis]
Length=286

 Score = 86.3 bits (212),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 74/248 (30%), Positives = 118/248 (48%), Gaps = 28/248 (11%)
 Frame = -1

Query  945  EDFTAFYHGWLMNQDAIFEQL-ESFLaaaaaaddDREQCGGLVGRVLAHYQeyyaektka  769
            E F  F+  WL+ Q+   EQL  +        +++R     L+ RV+ HY+ YY EK+++
Sbjct  18   ETFHKFFESWLVEQNQDLEQLVRASKEVNGVEENNRRMLSPLIQRVIHHYENYYKEKSRS  77

Query  768  aeEDVFVFFASPWMSRLEQSFLWLSGFKPSMLFWVV--ESSME-----------------  646
            A+EDV       W S LE +FLW+ G++PSM F ++  +S ++                 
Sbjct  78   AKEDVLGMLNPTWRSNLEDAFLWIGGWRPSMAFHLLYSKSGLQLEAGFHDLFRGISRGDL  137

Query  645  GALSEEQRCKVGMLRAETARVENAISKAMASAQETVAAPPILGLLKRAEELVDGEVSELD  466
            G LS  Q  K+  L+ +T R E  +++ +A  QETVA   ++ L     EL+  E  +++
Sbjct  138  GDLSGIQLGKIDELQNKTLREEKKLTERLAKVQETVADTSMVELSHIVSELMREEGRQVE  197

Query  465  AV--------MGDLKQSMGRLMGNADALRGSTASKILEILNPKQAVKFLTAVMRFQREAR  310
                      +   ++ +   +  AD LR  T  +IL IL P QAV FL A         
Sbjct  198  ETEEEKVKTNIAKKEEGLLEALKKADDLRLRTLKEILGILKPIQAVHFLIAAAELHLRIH  257

Query  309  RWGLYNDS  286
             WG+  D+
Sbjct  258  DWGMKKDT  265



>ref|XP_010274492.1| PREDICTED: transcription factor TGA5-like [Nelumbo nucifera]
Length=248

 Score = 85.5 bits (210),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 69/234 (29%), Positives = 105/234 (45%), Gaps = 27/234 (12%)
 Frame = -1

Query  927  YHGWLMNQDAIFEQLESFLaaaaaaddDREQCGGLVGRVLAHYQeyyaektkaaeEDVFV  748
            +  W+  Q A    LE  L A      D      +V + + H+QEY  +++  A E+   
Sbjct  15   FQSWIAQQQA---DLEELLQALTIYKGDDTHLNLIVEKNIQHFQEYTEKRSILARENATS  71

Query  747  FFASPWMSRLEQSFLWLSGFKPS----MLFWVVESSME---------------GALSEEQ  625
            FFA  W + LE SFLW++G +PS    +++ +  S +E               G LS  Q
Sbjct  72   FFAPSWCTSLENSFLWIAGCRPSLAIRLVYSLCGSELEAQLNEFLQGVRKGNLGELSARQ  131

Query  624  RCKVGMLRAETARVENAISKAMASAQETVAAPPILGLLKRAEE--LVDGEVSELDAVMGD  451
               V  L+  T R E  +S  MAS QE +A  P   LL +A E  L+   +  +D  + +
Sbjct  132  LSLVNDLQCRTIREEEKLSTQMASLQEDIADQP---LLTKANEYGLIGASIEHVDTTLDE  188

Query  450  LKQSMGRLMGNADALRGSTASKILEILNPKQAVKFLTAVMRFQREARRWGLYND  289
               ++  ++  AD LR ST  +++ IL P QA   L A  +       WG   D
Sbjct  189  HALALAGILEEADKLRLSTLKELINILTPLQAADLLVAAKKLHLSIHEWGKRRD  242



>ref|XP_002537773.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF24610.1| conserved hypothetical protein [Ricinus communis]
Length=255

 Score = 85.5 bits (210),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 70/235 (30%), Positives = 111/235 (47%), Gaps = 24/235 (10%)
 Frame = -1

Query  927  YHGWLMNQDAIFEQLESFLaaaaaaddDREQC--GGLVGRVLAHYQeyyaektkaaeEDV  754
            +H W+  Q+    +L   L          +Q     L  + + H+QEY  ++ + A  DV
Sbjct  16   FHDWMNVQELDLAELLRALTLTDDDKPPDDQSLFAQLAEKNIEHFQEYVDKRNRLAHNDV  75

Query  753  FVFFASPWMSRLEQSFLWLSGFKPSMLFWV--------VESSME-----------GALSE  631
             V+FA  W S LE S LWL+G +PS+   +        VES +            G LS 
Sbjct  76   SVYFAPTWNSALENSLLWLAGCRPSIFIRLVYALCGSQVESQIAEHLQGTRTGNLGDLSL  135

Query  630  EQRCKVGMLRAETARVENAISKAMASAQETVAAPPILGLLKRAEELVDGEVSE-LDAVMG  454
            +Q   V +L  +T + E  ++  +AS QE +A  PI  + K  E+   G+ +E +D  + 
Sbjct  136  QQLNMVNVLHCKTIKHEEKLTTQLASLQEDIADEPISMVAK--EQSHAGDSNEVVDRALQ  193

Query  453  DLKQSMGRLMGNADALRGSTASKILEILNPKQAVKFLTAVMRFQREARRWGLYND  289
            +  ++M RL+  AD LR +T  +++ IL P QAV +L A  +       WG   D
Sbjct  194  NHDEAMVRLLQEADNLRLTTLKELISILTPVQAVDYLAAGRKLHLCMHEWGKKRD  248



>ref|XP_007214751.1| hypothetical protein PRUPE_ppa024940mg [Prunus persica]
 gb|EMJ15950.1| hypothetical protein PRUPE_ppa024940mg [Prunus persica]
Length=277

 Score = 85.5 bits (210),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 62/208 (30%), Positives = 99/208 (48%), Gaps = 27/208 (13%)
 Frame = -1

Query  825  LVGRVLAHYQeyyaektkaaeEDVFVFFASPWMSRLEQSFLWLSGFKPSMLFWVVESS--  652
            LV RV+ HY++YY  K++  ++DV    +  W + LE +FLW+ G++PSM F +  S   
Sbjct  64   LVERVVKHYEQYYEAKSRWVKQDVLRMLSPSWTTSLEDAFLWIGGWRPSMAFHLFYSKSG  123

Query  651  ----------MEG-------ALSEEQRCKVGMLRAETARVENAISKAMASAQETVAAPPI  523
                      +EG        +S+ Q  +V  L+  T + E  I++ MA  QE+VA   +
Sbjct  124  LQLEARLTELIEGLGTGDLADISQHQLMQVDHLQRRTVKEERDITEKMAKQQESVADTSM  183

Query  522  LGLLKRAEELV--------DGEVSELDAVMGDLKQSMGRLMGNADALRGSTASKILEILN  367
            + L     EL+        + E   ++ V+   +Q +  ++  AD+LR  T   I  IL 
Sbjct  184  VELAHMTTELMSTNGGHEHEAEEDRVECVVASKEQCLEEILQRADSLRLKTLKAITHILT  243

Query  366  PKQAVKFLTAVMRFQREARRWGLYNDSQ  283
            P QAV FL A          WG   D++
Sbjct  244  PIQAVHFLIAAAELHLRLHDWGKKEDAR  271



>ref|XP_006345765.1| PREDICTED: transcription factor TGA1-like [Solanum tuberosum]
Length=285

 Score = 85.5 bits (210),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 72/249 (29%), Positives = 117/249 (47%), Gaps = 28/249 (11%)
 Frame = -1

Query  948  GEDFTAFYHGWLMNQDAIFEQL--ESFLaaaaaaddDREQCGGLVGRVLAHYQeyyaekt  775
            G+ F  F+  WL+ Q+   +QL   S        +++      L+  V+ HY+EYY EK+
Sbjct  12   GKSFHKFFESWLVKQNQDLDQLVRASKDDDNNNKNNNDMMLSSLIHSVVKHYEEYYREKS  71

Query  774  kaaeEDVFVFFASPWMSRLEQSFLWLSGFKPSMLFWV--------VESSME---------  646
            + A  D+       W+S LE +FLW+ G++PSM F +        +E+++          
Sbjct  72   RYAISDILGMLHPSWLSNLEDAFLWIGGWRPSMAFHLLYSKSGIQLEANLHELIRGFNTK  131

Query  645  --GALSEEQRCKVGMLRAETARVENAISKAMASAQETVAAPPILGL------LKRAEEL-  493
              G LS  Q   +  L+ +T   E  +S+ +A  QET+A   ++ L      L R ++L 
Sbjct  132  DLGNLSGNQLVLIDELQHKTISEERKLSENLAKVQETLADASMVELSHVVSELMRDDQLV  191

Query  492  VDGEVSELDAVMGDLKQSMGRLMGNADALRGSTASKILEILNPKQAVKFLTAVMRFQREA  313
            V+ E  ++   +   ++S+  L+  AD LR ST  +IL IL   Q V FL A        
Sbjct  192  VNDEEEKIKKNISKKEESLLDLLKKADDLRLSTIKEILRILTSTQGVHFLIAAAELHLRI  251

Query  312  RRWGLYNDS  286
              WG   D+
Sbjct  252  HEWGKKKDA  260



>ref|XP_002867982.1| hypothetical protein ARALYDRAFT_354881 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH44241.1| hypothetical protein ARALYDRAFT_354881 [Arabidopsis lyrata subsp. 
lyrata]
Length=228

 Score = 84.7 bits (208),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 67/221 (30%), Positives = 107/221 (48%), Gaps = 8/221 (4%)
 Frame = -1

Query  954  IVGEDFTAFYHGWLMNQDAIFEQLESFLaaaaaaddDREQCGGLVGRVLAHYQeyyaekt  775
            +V E F  FY  W++  +    QL       A       +   L+ ++  H++ YY  K 
Sbjct  4    LVEEKFLEFYESWVIQLELYLHQL-----LIAHNTMSETELRALISKLTTHHKAYYTAKW  58

Query  774  kaaeEDVFVFFASPWMSRLEQSFLWLSGFKPSMLFWVVESSMEGA---LSEEQRCKVGML  604
             A  EDV  FF   W++ LE++  WL+G+KPS +F +V+   + +   L E Q  K+  L
Sbjct  59   AAIGEDVLAFFGPIWLNPLEKACFWLTGWKPSTVFRMVDRLRKYSRVVLVEAQVRKLEEL  118

Query  603  RAETARVENAISKAMASAQETVAAPPILGLLKRAEELVDGEVSELDAVMGDLKQSMGRLM  424
            R +T   E  I + M   Q  +A   ++ L +    +    V  ++A +  L   + +++
Sbjct  119  RVKTKFDEQKIEREMERYQVAMADRKMVELARLGCHVGGESVVVVEAAVRGLATGLEKMV  178

Query  423  GNADALRGSTASKILEILNPKQAVKFLTAVMRFQREARRWG  301
              AD +R  T   IL+IL P Q V+FL A   FQ + RRWG
Sbjct  179  KAADCVRLKTLKGILDILAPPQCVEFLAAAATFQVQLRRWG  219



>ref|XP_006477767.1| PREDICTED: transcription factor TGA1-like [Citrus sinensis]
 gb|KDO35852.1| hypothetical protein CISIN_1g040790mg [Citrus sinensis]
Length=231

 Score = 84.7 bits (208),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 68/201 (34%), Positives = 103/201 (51%), Gaps = 35/201 (17%)
 Frame = -1

Query  825  LVGRVLAHYQeyyaektkaaeEDVFVFFASPWMSRLEQSFLWLSGFKPSMLFWVV--ESS  652
            LV + L HY EYY  K+  A+ DVF  FA+PW S LE+S  W++G++P+ +F +V  ESS
Sbjct  43   LVAKTLTHYTEYYKVKSAEAQRDVFNVFAAPWASSLERSLHWIAGWRPTTVFHLVYTESS  102

Query  651  M-----------------EGALSEEQRCKVGMLRAETARVENAISKAMASAQETVAAPPI  523
                               G LS  Q  +V  L+ ET + ENAI+  ++  Q+       
Sbjct  103  TLFESHIVDILRGLRTGDLGDLSPSQFRRVSELQCETVKEENAITDELSEWQDG------  156

Query  522  LGLLKRAEELVDGEVSELDAVMGDLKQSMGRLMGNADALRGSTASKILEILNPKQAVKFL  343
                  A ELV G+ S   A + +  + +  ++  AD LR  T  +++++L  +QAV+FL
Sbjct  157  ------ASELV-GDCS---ASVDEKIRLLVSIVQKADDLRLRTVRRVVDLLTTQQAVEFL  206

Query  342  TAVMRFQREARRWGLYNDSQR  280
             A    Q   R+WGL  D +R
Sbjct  207  IAAAELQFGVRKWGLDQDRRR  227



>gb|EYU20609.1| hypothetical protein MIMGU_mgv1a010868mg [Erythranthe guttata]
Length=299

 Score = 85.5 bits (210),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 73/262 (28%), Positives = 117/262 (45%), Gaps = 43/262 (16%)
 Frame = -1

Query  945  EDFTAFYHGWLMNQDAIFEQLESFLaaaaaaddDREQCGG------------LVGRVLAH  802
            E F  F+  W++ QD     L   ++A+   +D  +  GG            L+ RV+ H
Sbjct  23   ESFHKFFECWIVEQD---HHLHELVSASKDIEDRHQHHGGATAELNGRVLRPLLERVVQH  79

Query  801  YQeyyaektkaaeEDVFVFFASPWMSRLEQSFLWLSGFKPSMLFWVVESS----------  652
            Y+ YY  K++ A+ DV   F   W S LE +FLW+ G++PSM F ++ S           
Sbjct  80   YEHYYRAKSRWAKNDVLSMFNPSWRSSLEDAFLWIGGWRPSMAFHLLYSKSGLQLEARAI  139

Query  651  -------MEGALSE---EQRCKVGMLRAETARVENAISKAMASAQETVAAPPILGLLKRA  502
                     G LS+    Q  +V  L+  T R E  I++ +A  QETVA   ++ L    
Sbjct  140  DDLILGLTNGDLSDLSTGQLGRVDALQKVTLREEKEITEKLAKLQETVADSSMVELSHAV  199

Query  501  EELVDGEVSE--------LDAVMGDLKQSMGRLMGNADALRGSTASKILEILNPKQAVKF  346
             EL+  E  +        ++A +   ++ +  ++  AD LR  T   +++IL+P Q V F
Sbjct  200  SELIQEEAGDRVAEQEGRVEAALAPKEEGLVGVLEKADELRMKTLKGVIDILSPTQGVHF  259

Query  345  LTAVMRFQREARRWGLYNDSQR  280
            L A          WG   D++ 
Sbjct  260  LIAAAELHLRVHDWGKKRDARH  281



>ref|XP_007213175.1| hypothetical protein PRUPE_ppa027008mg, partial [Prunus persica]
 gb|EMJ14374.1| hypothetical protein PRUPE_ppa027008mg, partial [Prunus persica]
Length=230

 Score = 84.3 bits (207),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 60/195 (31%), Positives = 102/195 (52%), Gaps = 23/195 (12%)
 Frame = -1

Query  843  REQCGGLVGRVLAHYQeyyaektkaaeEDVFVFFASPWMSRLEQSFLWLSGFKPSMLFWV  664
            ++Q   L  + + H+Q+Y  ++T+ A  DV  FFA  W +  E S LW++G +PS+ F +
Sbjct  38   KDQLKHLAEKGICHFQDYINKRTQLARRDVSAFFAPTWCTSWENSLLWIAGCRPSLFFRL  97

Query  663  V----------------ESSMEGALSEEQRCK----VGMLRAETARVENAISKAMASAQE  544
            V                + + EG+L E   C     V  L+++T R E  ++  +A+ QE
Sbjct  98   VYVLGGSKMESKLSEFLQDTREGSLGEVLTCSQLVVVNSLQSKTIREEERLTGELAALQE  157

Query  543  TVAAPPILGLLKRAEELVDGEVS-ELDAVMGDLKQSMGRLMGNADALRGSTASKILEILN  367
             +A  PI  + K   +L  GE++ E++  + +  Q+M R++  AD LR +T  +++ IL 
Sbjct  158  DIADQPIAMIAKGLSQL--GEMNREVEEALDEHGQAMVRILEEADQLRLNTVKELVNILT  215

Query  366  PKQAVKFLTAVMRFQ  322
            P QAV FL A  +  
Sbjct  216  PLQAVDFLVASKKLH  230



>ref|XP_006442481.1| hypothetical protein CICLE_v10022056mg [Citrus clementina]
 gb|ESR55721.1| hypothetical protein CICLE_v10022056mg [Citrus clementina]
Length=231

 Score = 84.3 bits (207),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 68/201 (34%), Positives = 103/201 (51%), Gaps = 35/201 (17%)
 Frame = -1

Query  825  LVGRVLAHYQeyyaektkaaeEDVFVFFASPWMSRLEQSFLWLSGFKPSMLFWVV--ESS  652
            LV + L HY EYY  K+  A+ DVF  FA+PW S LE+S  W++G++P+ +F +V  ESS
Sbjct  43   LVAKTLTHYTEYYKVKSAEAQRDVFNVFAAPWASSLERSLHWIAGWRPTTVFHLVYTESS  102

Query  651  M-----------------EGALSEEQRCKVGMLRAETARVENAISKAMASAQETVAAPPI  523
                               G LS  Q  +V  L+ ET + ENAI+  ++  Q+       
Sbjct  103  TLFESHIVDILRGLRTGDLGDLSPSQFRRVSELQCETVKEENAITDELSEWQDG------  156

Query  522  LGLLKRAEELVDGEVSELDAVMGDLKQSMGRLMGNADALRGSTASKILEILNPKQAVKFL  343
                  A ELV G+ S   A + +  + +  ++  AD LR  T  +++++L  +QAV+FL
Sbjct  157  ------ASELV-GDCS---ASVDEKIRLLVSIVQKADDLRLRTVRRVVDLLTTQQAVEFL  206

Query  342  TAVMRFQREARRWGLYNDSQR  280
             A    Q   R+WGL  D +R
Sbjct  207  IAAAELQFGVRKWGLDQDRRR  227



>ref|XP_004293959.1| PREDICTED: uncharacterized protein LOC101299272 [Fragaria vesca 
subsp. vesca]
Length=253

 Score = 84.3 bits (207),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 60/208 (29%), Positives = 104/208 (50%), Gaps = 23/208 (11%)
 Frame = -1

Query  840  EQCGGLVGRVLAHYQeyyaektkaaeEDVFVFFASPWMSRLEQSFLWLSGFKPSMLFWVV  661
            EQ   L G+ + H+++Y  ++ K A +D+  +FA  W S  E S +W++G +PS+ F ++
Sbjct  39   EQLKQLAGKCITHFEDYIKKRNKLAHKDISAYFAPDWCSPWENSLIWIAGCRPSLFFRLI  98

Query  660  ----ESSMEGALSE----------------EQRCKVGMLRAETARVENAISKAMASAQET  541
                 S +E  L+E                 Q   V  L+++T   E  ++  +A+ QE 
Sbjct  99   YALSGSEVESNLTEFLRGTKNGYLGEVMSSTQLVMVNALQSKTISEEERLTMRLAALQED  158

Query  540  VAAPPILGLLKRAEELVDGEVS-ELDAVMGDLKQSMGRLMGNADALRGSTASKILEILNP  364
            +A  PI  + K   ++  GE++ E++  + D  Q M +L+  AD LR +T  ++L+IL P
Sbjct  159  IADQPIAMIAKGLSKV--GEMNEEVEKALDDHGQHMVKLLEEADELRMNTLKEVLKILTP  216

Query  363  KQAVKFLTAVMRFQREARRWGLYNDSQR  280
             Q V FL A  +      +WG   D + 
Sbjct  217  LQGVDFLVASKKLHLCVHKWGRQRDQKH  244



>gb|EYU23355.1| hypothetical protein MIMGU_mgv1a023684mg, partial [Erythranthe 
guttata]
Length=261

 Score = 84.3 bits (207),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 70/256 (27%), Positives = 121/256 (47%), Gaps = 43/256 (17%)
 Frame = -1

Query  951  VGE--DFTAFYHGWLMNQDAIFEQLESFLaaaaaaddDREQCGG---LVGRVLAHYQeyy  787
            VGE   F  F+  W++ Q+   ++L S            ++ GG   +V +V+ HY+ YY
Sbjct  2    VGEHVSFHMFFDSWMVEQNYQLQELVS----------ATKEWGGRSDVVEQVVHHYEHYY  51

Query  786  aektkaaeEDVFVFFASPWMSRLEQSFLWLSGFKPSMLFWV--------VESSME-----  646
              K+  A++D+   F+  W S LE++F+W+ G++P+  F +        +E+++E     
Sbjct  52   KTKSMWAKKDILSMFSPTWTSSLEKAFMWVGGWRPTTAFHLLYSKCGLQLEAALEDYHHL  111

Query  645  ---------GALSEEQRCKVGMLRAETARVENAISKAMASAQETVAAPPILGLLKRAEEL  493
                     G LS  Q  +V  L   T R E  I++ +A  QET+A   ++ L    E +
Sbjct  112  PSGLNTGDLGDLSHSQMVRVDELHKSTLREEKMITEKLAKKQETIADSSMVRLT--TELM  169

Query  492  VDGEVSE----LDAVMGDLKQSMGRLMGNADALRGSTASKILEILNPKQAVKFLTAVMRF  325
            V  E  +    +DA +   +  + R++  AD LR  T  +++ IL+P Q   FL A    
Sbjct  170  VHMEEHDQQVVVDAALASKENGLVRVLQMADDLRLKTLKELILILSPIQGAYFLIAAAEL  229

Query  324  QREARRWGLYNDSQRE  277
              +   WG   D+ R+
Sbjct  230  HLKIHEWGKNRDASRK  245



>ref|XP_011085982.1| PREDICTED: transcription factor HBP-1b(c38)-like [Sesamum indicum]
Length=253

 Score = 84.3 bits (207),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 64/236 (27%), Positives = 111/236 (47%), Gaps = 21/236 (9%)
 Frame = -1

Query  936  TAFYHGWLMNQDAIFEQLESFLaaaaaaddDREQCGGLVGRVLAHYQeyyaektkaaeED  757
            + FY  W+  Q+    +L   ++  A       +   L+ +++ HYQ+Y   ++  A  D
Sbjct  10   SCFYQEWMNLQEEELSELNRAISLNANGRTADAELTRLIEKIMDHYQDYVQRRSLMARAD  69

Query  756  VFVFFASPWMSRLEQSFLWLSGFKPS----MLFWVVESSMEGALSE--------------  631
            V  +FA  W + LE+S LW+ G +PS    +++ +    +E  LSE              
Sbjct  70   VSPYFAPTWCTSLERSVLWIGGCRPSSFVRLIYALCGEEIESHLSEFLRGVRIGHLGELS  129

Query  630  -EQRCKVGMLRAETARVENAISKAMASAQETVAAPPILGLLKRAEELVDGEVSE-LDAVM  457
              Q   V  L+++T R E  +   +A  QE V   P+  +  +       EVS+ L+  +
Sbjct  130  GRQISMVDELQSKTIREERKLCTRLAGLQENVLDHPLASIAVKTRGR-SCEVSDNLEDAL  188

Query  456  GDLKQSMGRLMGNADALRGSTASKILEILNPKQAVKFLTAVMRFQREARRWGLYND  289
                ++M  ++G AD LR +T  +++ IL P+QAV FL A  + +   + WG  ND
Sbjct  189  DKHGRAMAEILGEADQLRLNTLREVVGILTPRQAVDFLAAGKKLRLCMQDWGKKND  244



>gb|EYU35712.1| hypothetical protein MIMGU_mgv1a011847mg [Erythranthe guttata]
Length=269

 Score = 84.3 bits (207),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 69/250 (28%), Positives = 107/250 (43%), Gaps = 32/250 (13%)
 Frame = -1

Query  939  FTAFYHGWLMNQDAIFEQLESFLaaaaaaddDREQCGG------LVGRVLAHYQeyyaek  778
            F +F+  WL+ QD   E+L S                        + RV+ HY++YY  K
Sbjct  13   FHSFFESWLVEQDHYLEELVSASKRRRVHHHPSAADDDDTVLRQKIARVIDHYEQYYRAK  72

Query  777  tkaaeEDVFVFFASPWMSRLEQSFLWLSGFKPSMLFWVVESS------------MEG---  643
            +  A+ D    F  PW S LE +FLW+ G++P+M F ++ S             ++G   
Sbjct  73   STCAKTDALPMFNPPWRSSLEDAFLWIGGWRPTMAFHLLYSKSGLQLQDKLADLLQGLAA  132

Query  642  ----ALSEEQRCKVGMLRAETARVENAISKAMASAQETVAAPPILGLLKRAEELV-----  490
                 LS  Q  ++  L+  T R E  IS+ +A  QE VA   ++ L     E +     
Sbjct  133  GDLADLSPPQVNQINDLQRATVREEKEISEKLAKQQEKVADTSMVELSNAVTEAMRNPAA  192

Query  489  --DGEVSELDAVMGDLKQSMGRLMGNADALRGSTASKILEILNPKQAVKFLTAVMRFQRE  316
              DG    + A +   +  +  ++  AD LR  T  K+L +L+P Q V FL A       
Sbjct  193  ADDGGGGRVAAALAPKEVGLAEVLQRADDLRLKTLKKVLGVLSPIQGVHFLIAAAELHLR  252

Query  315  ARRWGLYNDS  286
               WG+  D+
Sbjct  253  LHEWGMKRDA  262



>ref|XP_008793320.1| PREDICTED: transcription factor HBP-1b(c38)-like [Phoenix dactylifera]
Length=274

 Score = 84.3 bits (207),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 65/203 (32%), Positives = 101/203 (50%), Gaps = 21/203 (10%)
 Frame = -1

Query  825  LVGRVLAHYQeyyaektkaaeEDVFVFFASPWMSRLEQSFLWLSGFKPSMLFWVVESS--  652
            LV RVL H + YY  K  +A+ DV   F+  W S  E  FLW+ G++PS+ F ++ S   
Sbjct  66   LVRRVLGHCEYYYRAKAASAKRDVTPMFSPTWTSSSENLFLWVGGWRPSVAFHLIYSKSG  125

Query  651  ----------MEGA-------LSEEQRCKVGMLRAETARVENAISKAMASAQETVAAPPI  523
                      + GA       LS+ Q  ++  L+  T R+E  IS+  A  QE VA   +
Sbjct  126  IQLESQLAEVIRGASTRDLADLSQGQLKRIDELQRRTIRIEKEISEEEARTQEGVADKQM  185

Query  522  LGLLKRAEEL-VDGEVSEL-DAVMGDLKQSMGRLMGNADALRGSTASKILEILNPKQAVK  349
            + L     E+  DG+ +E+ +  M D +  M R++  ADALR  T   ++EIL P Q + 
Sbjct  186  VLLSHVLREMGRDGKAAEMMEPAMQDKRAGMERVLERADALRQETLKGVVEILRPMQTIH  245

Query  348  FLTAVMRFQREARRWGLYNDSQR  280
            FL      +   R +G+  D+++
Sbjct  246  FLITAAELRLRVREYGMKKDAEK  268



>ref|XP_010434503.1| PREDICTED: transcription factor TGA6-like isoform X1 [Camelina 
sativa]
Length=231

 Score = 83.6 bits (205),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 66/219 (30%), Positives = 106/219 (48%), Gaps = 6/219 (3%)
 Frame = -1

Query  951  VGEDFTAFYHGWLMNQDAIFEQLESFLaaaaaaddDREQCGGLVGRVLAHYQeyyaektk  772
            V E F  FY  W++  +    QL        +  + R     L+ ++  H++ YY  K  
Sbjct  5    VEEKFLEFYENWVIQLEQYLHQLLIAHNTTMSEIELR----ALISKLTTHHKAYYTAKWA  60

Query  771  aaeEDVFVFFASPWMSRLEQSFLWLSGFKPSMLFWVVESSMEG--ALSEEQRCKVGMLRA  598
            A  EDV  FF   W++ LE++  WL+G+KPS +F +V+   +    L E Q  K+  LRA
Sbjct  61   AIGEDVLAFFGPVWLTPLEKACFWLTGWKPSTVFRMVDRLRKSRLVLVEAQVRKLEELRA  120

Query  597  ETARVENAISKAMASAQETVAAPPILGLLKRAEELVDGEVSELDAVMGDLKQSMGRLMGN  418
            +T   E  I + +   Q  +    ++ L +    +    V  ++A +  L   + +++  
Sbjct  121  KTKFEEQKIEREVERYQVAMGDRKMVELARLGCHVGGESVVVVEAAVKGLATGLEKMVKA  180

Query  417  ADALRGSTASKILEILNPKQAVKFLTAVMRFQREARRWG  301
            AD +R  T   IL+IL P Q V+FL A   FQ + RRWG
Sbjct  181  ADCVRLKTLKGILDILAPPQCVEFLAAAAAFQVQLRRWG  219



>ref|XP_006362387.1| PREDICTED: transcription factor TGA4-like [Solanum tuberosum]
Length=222

 Score = 83.2 bits (204),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 66/217 (30%), Positives = 108/217 (50%), Gaps = 9/217 (4%)
 Frame = -1

Query  951  VGEDFTAFYHGWLMNQDAIFEQLESFLaaaaaaddDREQCGGLVGRVLAHYQeyyaektk  772
            VGE+F  ++  W++  + + +QL                   LV ++  H+++YY  K  
Sbjct  5    VGENFRKYFENWMIQLEELLKQL----VIVPRETSYVNDHESLVSKMTTHHKDYYTAKWA  60

Query  771  aaeEDVFVFFASPWMSRLEQSFLWLSGFKPSMLFWVVESSMEGALSEEQRCKVGMLRAET  592
            AA ED+  FF   W+S LE  + W++G+KPSM F +V     GA S+EQ   +  LR + 
Sbjct  61   AAHEDILAFFTPMWLSPLEIVYSWITGWKPSMAFRLVGG---GAFSDEQLKNIDGLRVKI  117

Query  591  ARVENAISKAMASAQETVAAPPILGLLKRAEELVDGEVSELDAVMGDLKQSMGRLMGNAD  412
               E  + + M   Q  +    ++ L +      + E+ EL   +  L+ S+ R+M  AD
Sbjct  118  RGEEEKVEREMERQQVAIGDRKMVELARIKNSDNNDELVEL--ALKGLRMSLERVMKMAD  175

Query  411  ALRGSTASKILEILNPKQAVKFLTAVMRFQREARRWG  301
             +R  T   +LEIL+P Q+V FL A+   Q + R+ G
Sbjct  176  CVRLKTLKGLLEILSPIQSVDFLAAISTIQIQMRKRG  212



>ref|XP_008673985.1| PREDICTED: transcription factor PERIANTHIA-like [Zea mays]
 tpg|DAA54358.1| TPA: hypothetical protein ZEAMMB73_657016 [Zea mays]
Length=224

 Score = 83.2 bits (204),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 73/226 (32%), Positives = 113/226 (50%), Gaps = 12/226 (5%)
 Frame = -1

Query  945  EDFTAFYHGWLMNQDAIFEQLESFLaaaaaaddDREQCGGLVGRVLAHYQeyyaektkaa  766
            ED  +FY  W+  ++ I   L + LA         +    LV   +AH   YY  K++ A
Sbjct  5    EDMASFYDAWVGREEQIVADLTTALALPPRRRS--DALAPLVDAAVAHVVAYYEHKSRLA  62

Query  765  eEDVFVFFASPWMSRLEQSFLWLSGFKPSMLFWVVESSMEGALSEEQRCKVGMLRAETAR  586
            + DV       W++ LE++FLW  G+KP+++F  VE  +   +  EQR  +  LRA TA 
Sbjct  63   DRDVVAALDPCWLNPLERTFLWAWGWKPALMFRFVEGGV--GVRPEQRRALEELRAATAA  120

Query  585  VENAISKAMASAQETVAAPPILGLLKRAEELVDGEVSELDAVMGDLKQSMGRLMGNADAL  406
             E  +   +A+ QE++A P +L  L+R   L +GE  E  AV+    +S+  L+  ADAL
Sbjct  121  NEREVDMQVAAVQESLAGPRVLAALRRQPPL-NGEADEAVAVVA---RSLRVLLAAADAL  176

Query  405  RGSTASKILEILNPKQAVKFLTAVMRF----QREARRWGLYNDSQR  280
            R  T   ++ +L P QA   + A++ F     R  R W   +  QR
Sbjct  177  RDRTLRGVVGLLAPDQAGAVVAAMLGFHLAVHRAGRDWTSSHGGQR  222



>ref|XP_009379553.1| PREDICTED: transcription factor TGA6-like [Pyrus x bretschneideri]
Length=285

 Score = 84.0 bits (206),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 67/218 (31%), Positives = 99/218 (45%), Gaps = 32/218 (15%)
 Frame = -1

Query  831  GGLVGRVLAHYQeyyaektkaaeEDVFVFFASPWMSRLEQSFLWLSGFKPSMLFWV----  664
            G LV RV+ HY+ YY  K++ A++DV    +  W+S LE +FLW+ G++PSM F +    
Sbjct  63   GKLVERVVKHYEHYYEVKSRWAKQDVLGMLSPSWLSSLEDAFLWIGGWRPSMAFHLFHSK  122

Query  663  ----------------VESSMEGA---LSEEQRCKVGMLRAETARVENAISKAMASAQET  541
                              SS +G    LS  Q  ++  ++  T + E  IS+ MA  QE 
Sbjct  123  SGLQLEARVSEFIRGFCSSSSKGNLADLSSHQLTQMDQMQQRTVKEERDISEKMAKRQEA  182

Query  540  VAAPPILGLLKRAEELV-----DGEVSELD----AVMGDLKQSMGRLMGNADALRGSTAS  388
            VA   ++ L     EL+     D  V+E D    + +   +Q +  ++  AD LR  T  
Sbjct  183  VADSSMVNLSHVITELMNAGSGDDPVAEEDPRVESALASKEQGLEEILHRADNLRLRTLK  242

Query  387  KILEILNPKQAVKFLTAVMRFQREARRWGLYNDSQREA  274
             +  IL P QAV FL A          WG   D+   A
Sbjct  243  SVTHILTPIQAVHFLIAAAELHLRVHDWGKEKDATSHA  280



>ref|XP_008337157.1| PREDICTED: transcription factor HBP-1b(c38)-like [Malus domestica]
Length=284

 Score = 84.0 bits (206),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 65/219 (30%), Positives = 96/219 (44%), Gaps = 33/219 (15%)
 Frame = -1

Query  831  GGLVGRVLAHYQeyyaektkaaeEDVFVFFASPWMSRLEQSFLWLSGFKPSMLFWVVESS  652
            G LV RV+ HY+ YY  K++  ++DV    +  W+S LE +FLW+ G++PSM F +  S 
Sbjct  61   GTLVERVVKHYEHYYEVKSRWVKQDVLGMLSPSWLSSLEDAFLWIGGWRPSMAFHLFHSK  120

Query  651  ----ME-------------------GALSEEQRCKVGMLRAETARVENAISKAMASAQET  541
                +E                     LS  Q  +V  ++  T + E  IS+ MA  QE 
Sbjct  121  SGLQLEVRVAEFIRGFCSSGSKGDLADLSSHQLTQVDQMQQRTVKEERDISEKMAKRQEA  180

Query  540  VAAPPILGLLKRAEELVDG----------EVSELDAVMGDLKQSMGRLMGNADALRGSTA  391
            VA   ++GL     EL+D           E   ++  +   ++ +  ++  AD LR  T 
Sbjct  181  VADSSLVGLSHVITELMDAGNGXDDPVAEEDPRVEYALASKEEGLEEVLHRADNLRLXTL  240

Query  390  SKILEILNPKQAVKFLTAVMRFQREARRWGLYNDSQREA  274
              I  IL P QAV FL A          WG   D+   A
Sbjct  241  KAITHILTPIQAVHFLIAAAELHLRLHDWGKKKDATTRA  279



>ref|XP_003636790.1| Transcription factor TGA5 [Medicago truncatula]
 gb|KEH36610.1| seed dormancy control protein [Medicago truncatula]
 gb|KEH36614.1| seed dormancy control protein [Medicago truncatula]
Length=233

 Score = 83.2 bits (204),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 75/228 (33%), Positives = 117/228 (51%), Gaps = 13/228 (6%)
 Frame = -1

Query  954  IVGEDFTAFYHGWLMNQDAIFEQLESFLaaaaaaddDREQCGGLVGRVLAHYQeyyaekt  775
            +V E F+ FY  W++  + I  QL            + ++   LV +V AH +EYY  K 
Sbjct  4    LVVERFSEFYEKWVVKLEEIQRQLLEISKKKTEVTMNEQELKALVSKVTAHVKEYYTVKW  63

Query  774  kaaeEDVFVFFASPWMSRLEQSFLWLSGFKPSMLFWVVESSM-EGALSEEQRCKV-GMLR  601
             AA EDV VFF   W++ LE + LW++G+KPS +F ++E    E  ++EEQ+ K+ G LR
Sbjct  64   GAAHEDVLVFFTPTWLTPLENAHLWVTGWKPSTVFHILEDPKGEFNMTEEQKKKILGELR  123

Query  600  AETARVENAISKAMASAQETVAAPPILGLLK---RAEE---LVDGEVS-ELDAVMGDLKQ  442
                  E  + + M   Q  +A   ++ L K   RA++    VDG V   L+ V   L+ 
Sbjct  124  VRIRMEEEKVEREMERQQVAMADLKMVELAKLSCRAKKDDGRVDGMVGVALNGVFAGLE-  182

Query  441  SMGRLMGNADALRGSTASKILEILNPKQAVKFLTAVMRFQREARRWGL  298
               ++M  +D  R  +   +L+IL+P Q V FL A +  Q   R+ G+
Sbjct  183  ---KVMKTSDCARLKSLKGVLDILSPIQCVDFLAAHIGMQLWLRQLGM  227



>ref|XP_009757325.1| PREDICTED: transcription factor TGA5-like [Nicotiana sylvestris]
Length=275

 Score = 83.6 bits (205),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 77/257 (30%), Positives = 119/257 (46%), Gaps = 36/257 (14%)
 Frame = -1

Query  939  FTAFYHGWLMNQDAIFEQLESF---LaaaaaaddDREQCGGLVGRVLAHYQeyyaektka  769
            F  F+  WL  Q+   ++L S    ++       +      L+ RV+ HY+ YY EK+K 
Sbjct  18   FHKFFETWLAEQNQELKELVSASRDVSKDNNIVVEERVLVPLIERVIQHYEGYYGEKSKY  77

Query  768  aeEDVFVFFASPWMSRLEQSFLWLSGFKPSMLFWVV--ESSME-----------------  646
             EEDVF      W S LE +FLW+ G++PSM F ++  +S ++                 
Sbjct  78   TEEDVFGMLNPTWRSNLEGAFLWIGGWRPSMAFHLLYSKSGLQFEPRLPQLIRGITTGDL  137

Query  645  GALSEEQRCKVGMLRAETARVENAISKAMASAQETVAAPPILGLLKRAEELVDGEV----  478
            G LS +Q  KV  L+ +T R E   S+ +A  QETVA   ++ L     +L+        
Sbjct  138  GDLSPDQISKVDELQKKTIREEKDSSEKLAKVQETVADASMVELSHVVTQLMMISGGGGG  197

Query  477  ---SELDAVMGDLKQSMGRLMGNADALRGSTASKILEILNPKQAVKFLTAVMRFQREARR  307
                E++A +   ++ +  ++  AD LR +T  +IL IL P QA+ FL A          
Sbjct  198  ILEEEVEANLATKEEGLVIILQKADNLRLNTLKEILAILTPTQAIHFLIAAAELHLRLHE  257

Query  306  WG-------LYNDSQRE  277
            WG       LY+D+  E
Sbjct  258  WGKKKDAATLYSDANPE  274



>ref|XP_006285198.1| hypothetical protein CARUB_v10006552mg [Capsella rubella]
 gb|EOA18096.1| hypothetical protein CARUB_v10006552mg [Capsella rubella]
Length=235

 Score = 82.4 bits (202),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 67/222 (30%), Positives = 105/222 (47%), Gaps = 8/222 (4%)
 Frame = -1

Query  951  VGEDFTAFYHGWLMNQDAIFEQLESFLaaaaaaddDREQCGGLVGRVLAHYQeyyaektk  772
            V E F  FY  W++  +    QL   L A         +   L+ ++  H++ YY  K  
Sbjct  5    VEEKFLEFYDNWVIQLEQYLHQL---LNARNNNTMTEIELRALISKLTTHHKAYYIAKWA  61

Query  771  aaeEDVFVFFASPWMSRLEQSFLWLSGFKPSMLFWVVES-----SMEGALSEEQRCKVGM  607
            A  EDV  FF   W++ LE++  WL+G+KPS  F ++E      S    L E Q  K+  
Sbjct  62   AIGEDVLAFFGPVWLNPLEKACFWLTGWKPSTAFRMLERLRKSWSPTVVLLEAQVTKLEE  121

Query  606  LRAETARVENAISKAMASAQETVAAPPILGLLKRAEELVDGEVSELDAVMGDLKQSMGRL  427
            LR +T   E  I + M   Q ++    ++ + +    +    V  ++A +  L   + ++
Sbjct  122  LRFKTKFEEQKIEREMERYQVSMGDRKMVEIARLGCHVGGESVVVVEAAVKGLATGLEKM  181

Query  426  MGNADALRGSTASKILEILNPKQAVKFLTAVMRFQREARRWG  301
            +  AD +R  T   IL+IL P Q V+FL A   FQ + RRWG
Sbjct  182  VKAADCVRLKTLKGILDILAPPQCVEFLAAAAAFQVQLRRWG  223



>ref|XP_006384064.1| hypothetical protein POPTR_0004s05690g [Populus trichocarpa]
 gb|ERP61861.1| hypothetical protein POPTR_0004s05690g [Populus trichocarpa]
Length=245

 Score = 82.4 bits (202),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 68/236 (29%), Positives = 109/236 (46%), Gaps = 14/236 (6%)
 Frame = -1

Query  951  VGEDFTAFYHGWLMNQDAIFEQL-ESFLaaaaaaddDREQCGGLVGRVLAHYQeyyaekt  775
            VGE F+ F+  W    D   + L  +          D+ +   LV +V  HY++Y+  K 
Sbjct  5    VGERFSEFFEKWACQLDEYLQLLLRASKQRVINTVCDQRELQTLVSKVTQHYKDYFTIKW  64

Query  774  kaaeEDVFVFFASPWMSRLEQSFLWLSGFKPSMLFWVVES--------SMEGALSEEQRC  619
              A EDV  FF   W S LE ++ W +G+KPS +F +++S        S    L++EQ  
Sbjct  65   SLAHEDVLAFFCPIWGSPLENAYSWFTGWKPSTIFKLIDSTRINRVPGSSLAELTQEQLR  124

Query  618  KVGMLRAETARVENAISKAMASAQETVAAPPILGLLKRAEELVDGEVSE-----LDAVMG  454
            K+  LR +    E  + + M   Q  +A   +  L +    + D E  +     ++  M 
Sbjct  125  KIEELRVKIRLEEEKVEREMERQQVAMADRKMFELARLTGRVKDSETMDQFDGLVEVAMK  184

Query  453  DLKQSMGRLMGNADALRGSTASKILEILNPKQAVKFLTAVMRFQREARRWGLYNDS  286
             L   + ++M  AD +R  T   +L++L+P Q V FL A    Q + R+WG   DS
Sbjct  185  GLMAGLEKVMKAADCVRLRTLKGVLDVLSPLQCVDFLAATTMLQIQLRQWGKRRDS  240



>ref|XP_006414070.1| hypothetical protein EUTSA_v10027258mg [Eutrema salsugineum]
 gb|ESQ55523.1| hypothetical protein EUTSA_v10027258mg [Eutrema salsugineum]
Length=264

 Score = 82.8 bits (203),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 67/243 (28%), Positives = 111/243 (46%), Gaps = 34/243 (14%)
 Frame = -1

Query  927  YHGWLMNQDAIFEQLESFLaaaaaaddDREQCGGLVGRVLAHYQeyyaektkaaeEDVFV  748
            YH W+  Q      L+  L           + G LVG ++  +Q+Y  ++++ ++     
Sbjct  15   YHEWMSLQAKRIVDLKEALTTKDD-----RKLGELVGEIVDEFQKYTKKRSELSDRSCSS  69

Query  747  FFASPWMSRLEQSFLWLSGFKPSMLFWVV------------------------ESSMEGA  640
            +FA  W S LE S LW+ G +PS    V+                        E+  +G+
Sbjct  70   YFAPSWNSSLENSLLWMGGCRPSSFIRVIYATCGSQAETQLSQYLLKIDENIHENHGDGS  129

Query  639  LSEEQRCKVGMLRAETARV---ENAISKAMASAQETVAAPPILGLLKRAEELVDGEVSEL  469
            LS+    ++G +     +V   E+ +SK  A+ QE VA  PI  +   A +LV+  V+ +
Sbjct  130  LSDLTSVQLGQINELHMKVIEKEDKLSKKAANLQEDVADMPI-AVTAYATDLVEAGVA-V  187

Query  468  DAVMGDLKQSMGRLMGNADALRGSTASKILEILNPKQAVKFLTAVMRFQREARRWGLYND  289
            + V+   ++ +G LM  AD LR  T  KI+E++ P QA +FL A  R       WG   +
Sbjct  188  ENVLDKHEECLGVLMAEADKLRVETLKKIVEVMTPVQAAEFLLAGKRLHVSLHEWGRVRE  247

Query  288  SQR  280
             +R
Sbjct  248  ERR  250



>emb|CDO96810.1| unnamed protein product [Coffea canephora]
Length=237

 Score = 82.4 bits (202),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 66/236 (28%), Positives = 113/236 (48%), Gaps = 24/236 (10%)
 Frame = -1

Query  951  VGEDFTAFYHGWLMNQDAIFEQLESFLaaaaaaddDREQCG--GLVGRVLAHYQeyyaek  778
            + E F+ F+  W+     + E ++  L          E+     LV ++  H+++YY  K
Sbjct  5    IEEKFSNFFEIWM---SKLEEYVQHHLTLKKENKSSDEEVHYVPLVNKLTQHHKDYYTAK  61

Query  777  tkaaeEDVFVFFASPWMSRLEQSFLWLSGFKPSMLFWVVESSMEGA---------LSEEQ  625
               A EDV  FF   W+S LE ++LW++G+KPSM+F +V+S  +G          LSEEQ
Sbjct  62   WACASEDVLAFFTPVWLSPLENAYLWITGWKPSMIFRLVDSLRKGQVPGATSLADLSEEQ  121

Query  624  RCKVGMLRAETARVENAISKAMASAQ------ETVAAPPILGLLKRAEELVDGEVSELDA  463
              K+  LR+     E  + + M   Q      + V    ++ L K  E L     S+++ 
Sbjct  122  VKKIEGLRSRIRVDEEKVEREMERQQVAMADRKMVELARLVSLTKNGEHLAAASSSQING  181

Query  462  V----MGDLKQSMGRLMGNADALRGSTASKILEILNPKQAVKFLTAVMRFQREARR  307
            +    + +L   + ++M  AD +R  T   +L++LNP Q+  FL +    Q + R+
Sbjct  182  LVEMAIKELLAGLEKVMKMADCVRLKTLKGVLDVLNPMQSADFLASSSVLQIQMRK  237



>ref|XP_006370140.1| DNA-binding family protein [Populus trichocarpa]
 gb|ERP66709.1| DNA-binding family protein [Populus trichocarpa]
Length=232

 Score = 82.0 bits (201),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 71/232 (31%), Positives = 112/232 (48%), Gaps = 36/232 (16%)
 Frame = -1

Query  939  FTAFYHGWLMNQDAIFEQLESFLaaaaaaddDREQCGGLVGRVLAHYQeyyaektkaaeE  760
            FT FY  W    + + EQL +      ++ DDR     L  ++++HY E+Y  K+ A E 
Sbjct  7    FTRFYDTWFDQLNQLLEQLRT-APKPPSSQDDRSHLSSLAQKIVSHYAEFYRVKSMAIES  65

Query  759  DVFVFFASPWMSRLEQSFLWLSGFKPSMLFWVV--ESSM-----------------EGAL  637
            DV   F +PW S  E+S  W++G++P+ LF +V  ESS+                  G L
Sbjct  66   DVLSVFTAPWASCFERSLHWIAGWRPTTLFHLVYTESSILFEFHIADILKGRSTGDLGDL  125

Query  636  SEEQRCKVGMLRAETARVENAISKAMASAQETVAAPPILGLLKRAEELVDGEVSELDAVM  457
            S  Q  +V  L+ ET + ENAI+  ++  Q++            A E++ G  ++L    
Sbjct  126  SPNQFRRVSELQCETVKEENAITGELSEWQDS------------ANEVMLGSFTDL----  169

Query  456  GDLKQSMGRLMGNADALRGSTASKILEILNPKQAVKFLTAVMRFQREARRWG  301
            GD    +  ++  AD LR  T  +++E+L  +QAV+FL A    Q     WG
Sbjct  170  GDKVGRLVSVVKKADDLRLRTIKRVVELLTTQQAVEFLVAAGELQFGVYGWG  221



>ref|XP_003596341.1| Transcription factor TGA5 [Medicago truncatula]
 gb|ABD32966.1| tumor-related protein-like, putative [Medicago truncatula]
 gb|AES66592.1| transcription factor TGA5-like protein [Medicago truncatula]
Length=222

 Score = 81.6 bits (200),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 70/240 (29%), Positives = 116/240 (48%), Gaps = 43/240 (18%)
 Frame = -1

Query  942  DFTAFYHGWLMNQDAIFEQLESFLaaaaaaddDREQCGGLVGRVLAHYQeyyaektkaae  763
            +F  FY  W    + +  QL+        +   +     L+ +VL+H+Q+YY  K+ AAE
Sbjct  3    NFAQFYESWHTQFNNLIHQLK-------LSTSTQTDSEELIQKVLSHHQDYYNAKSMAAE  55

Query  762  EDVFVFFASPWMSRLEQSFLWLSGFKPSMLFWVV--ESSM-----------------EGA  640
            +D     ASPW + LE+S  W++G++P+  F ++  ESS+                  G 
Sbjct  56   KDPLHVLASPWATTLERSLHWIAGWRPTTAFHLIYTESSLLFESHIIDILRGFRTGDLGD  115

Query  639  LSEEQRCKVGMLRAETARVENAISKAMASAQETVAAPPILGLLKRAEELVDGEVSELDAV  460
            LS  Q  +V  L+ +T + ENAI++ ++  Q+  +A  ++G             SE D  
Sbjct  116  LSPNQFRRVSDLQCDTVKEENAITEELSEWQD--SASDMMG-------------SEAD--  158

Query  459  MGDLKQSMGRLMGNADALRGSTASKILEILNPKQAVKFLTAVMRFQREARRWGLYNDSQR  280
            + D  + +  ++  AD LR  T   ++E L+P+QAV+FL A        R WGL +D  R
Sbjct  159  INDKIERLVSIIKKADDLRLRTLRSVVEFLSPQQAVEFLIASAELVVGIRGWGLNHDRSR  218



>gb|EYU23876.1| hypothetical protein MIMGU_mgv11b017687mg [Erythranthe guttata]
Length=270

 Score = 82.4 bits (202),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 71/249 (29%), Positives = 115/249 (46%), Gaps = 29/249 (12%)
 Frame = -1

Query  942  DFTAFYHGWLMNQDAIFEQLESFLaaaaaaddDREQCGGLVGRVLAHYQeyyaektkaae  763
            +F  FY  W    +    +L +                GLV RV++HY+EYY  KTK A+
Sbjct  8    NFQEFYVKWQNKHNQHLYELTNASKTQPQQPQSDSSLSGLVERVISHYEEYYRIKTKWAK  67

Query  762  EDVFVFFASPWMSRLEQSFLWLSGFKPSMLFWVV--ESSME-----------------GA  640
             DV++  + PW S LE +FLW+ G++P+  F ++  +S ++                 G 
Sbjct  68   TDVYLLLSPPWNSPLEDAFLWVGGWRPTTAFHLLYSKSGLQFQAQFSNMLIGAKTGDLGD  127

Query  639  LSEEQRCKVGMLRAETARVENAISKAMASAQETVAAPPILGLLKRAEELVDGEV------  478
            LS +Q  ++ + +  T + E  I++  A  Q+ VA   ++GL   A       V      
Sbjct  128  LSLDQLGRIDIFQKGTIQEEREITEKEAKQQDRVADKEMVGLSHDASSESTRPVGGTSLD  187

Query  477  --SELDAVMGDLKQSMGRLMGNADALRGSTASKILEILNPKQAVKFLTAVMRFQREARRW  304
              S +++V+   ++    L+ +AD LR  T   +++IL+P QAV FL A    Q     W
Sbjct  188  IGSLVNSVLKPKEEGFQMLLQSADELRMKTLKGVIDILSPIQAVHFLIAAAELQLCLHEW  247

Query  303  GLYNDSQRE  277
            G   D Q E
Sbjct  248  G--KDKQDE  254



>ref|XP_006582492.1| PREDICTED: transcription factor HBP-1b(c38)-like [Glycine max]
Length=136

 Score = 79.7 bits (195),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 44/114 (39%), Positives = 78/114 (68%), Gaps = 5/114 (4%)
 Frame = -1

Query  813  VLAHYQeyyaektkaaeEDVFVFFASPWMSRLEQSFLWLSGFKPSMLFWVVESSMEGALS  634
            VL+HYQ++  EK+  A +DV++ F+ PW+S  E++ LW+  +KPS++  +V+ +++G L+
Sbjct  2    VLSHYQQFMEEKSNVANDDVYLLFSPPWLSAYERALLWIGDYKPSLIHRLVDGAVKG-LT  60

Query  633  EEQRCKVGMLRAETARVENAISKAMASAQETVAAPPILGLLKRAEELVDGEVSE  472
             EQR +V   R +T R E  +++A+AS QE++A+  +L L +    +VDGE+ E
Sbjct  61   AEQRGRVERTRDKTKRAERELTEAVASVQESMASRRMLELTR----VVDGEIME  110



>gb|EYU23360.1| hypothetical protein MIMGU_mgv1a019261mg [Erythranthe guttata]
Length=289

 Score = 82.4 bits (202),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 70/264 (27%), Positives = 118/264 (45%), Gaps = 48/264 (18%)
 Frame = -1

Query  951  VGE--DFTAFYHGWLMNQDAIFEQLESFLaaaaaaddDREQCGG-------LVGRVLAHY  799
            VGE   F  F+  W++ Q+   ++L S           +E  GG       +V +V+ HY
Sbjct  21   VGEHVSFHMFFDSWMVEQNYQLQELVS---------ATKEWGGGSVLLIPDVVEQVVHHY  71

Query  798  QeyyaektkaaeEDVFVFFASPWMSRLEQSFLWLSGFKPSMLFWVV--------ESSME-  646
            + YY  K+  A++D+   F+  W   LE++F+W  G++P+  F ++        E++ E 
Sbjct  72   EHYYKTKSMWAKKDILSMFSPTWTHSLEKAFMWAGGWRPATTFHLLYSKCGLQLEAAFED  131

Query  645  -------------GALSEEQRCKVGMLRAETARVENAISKAMASAQETVAAPPILGLLK-  508
                         G LS  Q  +V  L   T   E  I++ +A  QET+A   ++GL   
Sbjct  132  DYHLPSGLNTGDLGDLSHSQMVRVDELHKRTLWEEKMITEKLAKKQETIADSSMVGLTHS  191

Query  507  -------RAEELVDGEVSELDAVMGDLKQSMGRLMGNADALRGSTASKILEILNPKQAVK  349
                   R EE    +   +DA +   ++ +  ++  AD LR  T  +++ IL+P Q V 
Sbjct  192  VATELMIRVEEHDHDQQVVVDAALASKEKGLVVILQMADDLRLKTLKQLILILSPIQGVH  251

Query  348  FLTAVMRFQREARRWGLYNDSQRE  277
            FL A      +   WG   D+ R+
Sbjct  252  FLIAAAELHLKIHEWGKNRDASRK  275



>ref|XP_004489078.1| PREDICTED: transcription factor HBP-1b(c38)-like [Cicer arietinum]
Length=223

 Score = 81.3 bits (199),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 68/242 (28%), Positives = 113/242 (47%), Gaps = 51/242 (21%)
 Frame = -1

Query  939  FTAFYHGWLMNQDAIFEQLESFLaaaaaaddDREQCGGLVGRVLAHYQeyyaektkaaeE  760
            F  FY  W      + +QL +          ++     L+ +V++H+++YY  K+ AAE+
Sbjct  7    FAQFYDSWFDQFHCLVQQLNT---------PNQTDAEELIRKVMSHHEDYYNAKSMAAEK  57

Query  759  DVFVFFASPWMSRLEQSFLWLSGFKPSMLFWVV--ESSM-----------------EGAL  637
            D     ASPW + LE+S  W++G++P+  F ++  ESS+                  G L
Sbjct  58   DPLHVLASPWATTLERSLYWIAGWRPTTAFHLIYTESSLLFESHIIDILRGLRTGDLGDL  117

Query  636  SEEQRCKVGMLRAETARVENAISKAMASAQETVAAPPILGLLKRAEELVDGEVSELDAVM  457
            S  Q  +V  L+ +T + ENAI++ ++  Q+                      SEL    
Sbjct  118  SPTQFRRVSDLQCDTVKEENAITEELSEWQDN--------------------ASELMGSE  157

Query  456  GDLKQSMGRL---MGNADALRGSTASKILEILNPKQAVKFLTAVMRFQREARRWGLYNDS  286
             D+ +++GRL   +  AD LR  T   ++E L+P+QA++FL A        R WGL +D 
Sbjct  158  DDINENIGRLVCIIKKADDLRLRTLRSVVEFLSPQQAIEFLIASAELLVGIRGWGLNHDR  217

Query  285  QR  280
             R
Sbjct  218  SR  219



>ref|XP_009799260.1| PREDICTED: transcription factor TGA6-like [Nicotiana sylvestris]
Length=286

 Score = 82.0 bits (201),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 70/247 (28%), Positives = 115/247 (47%), Gaps = 28/247 (11%)
 Frame = -1

Query  945  EDFTAFYHGWLMNQDAIFEQL-ESFLaaaaaaddDREQCGGLVGRVLAHYQeyyaektka  769
            E F  F+  WL+ Q+   +QL  +        +++R     ++ RV+ HY+ YY EK+++
Sbjct  18   ETFHKFFESWLVEQNQDLDQLVRASKEVNGIEENNRIMLSPIIQRVIQHYENYYKEKSRS  77

Query  768  aeEDVFVFFASPWMSRLEQSFLWLSGFKPSM-------------------LFWVVESSME  646
            A+EDV       W S LE +FLW+ G++PSM                   LF  + +   
Sbjct  78   AKEDVLGMLNPTWRSNLEDAFLWIGGWRPSMAFHLLYSKSGLQLEAGFHDLFRGISTGDL  137

Query  645  GALSEEQRCKVGMLRAETARVENAISKAMASAQETVAAPPILGLLKRAEELVDGE-----  481
            G LS  Q  K+  L+ +T + E  +S+ +A  QET+A   ++ L     E++  E     
Sbjct  138  GDLSGIQLGKIDELQNKTLKEEKKLSERLAKVQETMADTSMVELSHVVSEILREEGRQVE  197

Query  480  ---VSELDAVMGDLKQSMGRLMGNADALRGSTASKILEILNPKQAVKFLTAVMRFQREAR  310
                 ++   +   ++++  ++  AD LR  T  +IL IL P QAV FL A         
Sbjct  198  ETEEEKVKNNIAKKEENLLEVLKKADDLRLRTLKEILGILKPIQAVHFLIAAAELHLRIH  257

Query  309  RWGLYND  289
             WG+  D
Sbjct  258  DWGMKKD  264



>emb|CBI30697.3| unnamed protein product [Vitis vinifera]
Length=211

 Score = 80.9 bits (198),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 74/231 (32%), Positives = 111/231 (48%), Gaps = 31/231 (13%)
 Frame = -1

Query  951  VGEDFTAFYHGWLMNQDAIFEQLESFLaaaaaaddDREQCGGLVGRVLAHYQeyyaektk  772
            V E F  FY  W+   +   E L+  L  +       E+   LV RV  H +EYY  K  
Sbjct  5    VEERFIEFYEKWMCQLE---ENLQRLLKVSREIPHRTER-EALVSRVTTHLKEYYNAKWA  60

Query  771  aaeEDVFVFFASPWMSRLEQSFLWLSGFKPSMLFWVVESSMEG-----ALSEEQRCKVGM  607
            AA EDV  FF+  W+S LE ++LW++G+KPS  F ++ES  +      +L+E Q+  +  
Sbjct  61   AAHEDVLAFFSPVWLSPLENAYLWVTGWKPSTAFRLIESLRQTGVPGESLAEMQQVALAD  120

Query  606  LR-AETARVENAISKAMASAQETVAAPPILGLLKRAEELVDGEVSELDAVMGDLKQSMGR  430
             +  E AR  + +S    +++E        GL++ A   + G +S L+           R
Sbjct  121  RKMVELARAASRVSNGGLASEEN-------GLVEVA---LKGLLSGLE-----------R  159

Query  429  LMGNADALRGSTASKILEILNPKQAVKFLTAVMRFQREARRWGLYNDSQRE  277
            +M  AD  R  T   ILE+L+P Q V FL A + F    R+WG+      E
Sbjct  160  VMKAADCARLKTLKGILEVLSPLQCVDFLAATLMFHVNLRKWGIKRAGPHE  210



>ref|XP_010062825.1| PREDICTED: transcription factor HBP-1b(c38)-like [Eucalyptus 
grandis]
 gb|KCW69956.1| hypothetical protein EUGRSUZ_F03274 [Eucalyptus grandis]
Length=234

 Score = 81.3 bits (199),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 70/236 (30%), Positives = 109/236 (46%), Gaps = 43/236 (18%)
 Frame = -1

Query  939  FTAFYHGWLMNQDAIFEQLESFLaaaaaaddDREQCGGLVGRVLAHYQeyyaektkaaeE  760
            F  FY GW      + +QL +       + D   Q   LV + + HY EY+  K    + 
Sbjct  4    FDRFYGGWQEQLRHLVDQLAA-APKPPISPDHHHQLHHLVSKFMDHYAEYHRTKALEVDR  62

Query  759  DVFVFFASPWMSRLEQSFLWLSGFKPSMLFWVV--ESSME-----------------GAL  637
            DV    A+PW++ LE+S  W+ G +P+ +F +V  ESS+                  G L
Sbjct  63   DVLSVLAAPWITALERSLQWIGGCRPTTVFHLVYTESSILFESHMIDILRGYRTGDLGDL  122

Query  636  SEEQRCKVGMLRAETARVENAISKAMASAQETVAAPPILGLLKRAEELVDGEVSELDAVM  457
            S  Q   V  L+ +T R ENAI++ ++  Q                   DG +S+L    
Sbjct  123  SPSQFRGVSELQCDTVREENAITEELSEWQ-------------------DG-MSDLMVAS  162

Query  456  GDLKQSMGRL---MGNADALRGSTASKILEILNPKQAVKFLTAVMRFQREARRWGL  298
             +L++ +G+L   +  AD LR  T  +++E+L P+QAV+FL +    Q   R WGL
Sbjct  163  SNLEEKIGKLGAIVKKADDLRLKTVRRVVELLTPQQAVEFLISASELQFGIRGWGL  218



>gb|KFK43297.1| hypothetical protein AALP_AA1G105800 [Arabis alpina]
Length=138

 Score = 79.3 bits (194),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 46/117 (39%), Positives = 65/117 (56%), Gaps = 2/117 (2%)
 Frame = -1

Query  624  RCKVGMLRAETARVENAISKAMASAQETVAAPPILGLLKR--AEELVDGEVSELDAVMGD  451
            R ++  LR+ET R E  + +  A  Q++VA PP++   +R  A  +VDGE S+L+  M  
Sbjct  21   RHRILTLRSETRRKERDVMRDYALVQQSVADPPVMLAARRVGARGMVDGEESDLEEAMEV  80

Query  450  LKQSMGRLMGNADALRGSTASKILEILNPKQAVKFLTAVMRFQREARRWGLYNDSQR  280
            LK  M   M NAD LR ST  K++EIL P QA+K L ++       R  G   D +R
Sbjct  81   LKSGMAAAMNNADQLRCSTVGKVVEILTPSQAIKVLRSIGELHLRLREMGSERDHER  137



>ref|XP_008227573.1| PREDICTED: transcription factor TGA2-like [Prunus mume]
Length=272

 Score = 81.6 bits (200),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 60/207 (29%), Positives = 96/207 (46%), Gaps = 27/207 (13%)
 Frame = -1

Query  825  LVGRVLAHYQeyyaektkaaeEDVFVFFASPWMSRLEQSFLWLSGFKPSMLFWVVESS--  652
            LV RV+ HY++YY  K++  ++DV    +  W + LE +FLW+ G++PSM F +  S   
Sbjct  59   LVERVVKHYEQYYEAKSRWVKQDVLRMLSPSWTTSLEDAFLWIGGWRPSMTFHLFYSKSG  118

Query  651  ----------MEG-------ALSEEQRCKVGMLRAETARVENAISKAMASAQETVAAPPI  523
                      +EG        +S+ Q  +V  L+  T + E  I++ MA  QE+VA    
Sbjct  119  LQLEARLTELIEGLGTGDLADISQHQLMQVDHLQRRTVKEERDITEKMAKQQESVADTST  178

Query  522  LGLLKRAEELVDG--------EVSELDAVMGDLKQSMGRLMGNADALRGSTASKILEILN  367
            + L     EL+          E   +++V+   ++ +  ++  AD+LR  T   I  IL 
Sbjct  179  VELSHVITELMSANGGHEHEVEADRVESVLASKERGLEEILQRADSLRLKTLKAITHILT  238

Query  366  PKQAVKFLTAVMRFQREARRWGLYNDS  286
            P QAV F  A          WG   D+
Sbjct  239  PIQAVHFFIAAAELHLRLHDWGKKEDA  265



>ref|XP_009402767.1| PREDICTED: TGACG-sequence-specific DNA-binding protein TGA-1A-like 
[Musa acuminata subsp. malaccensis]
Length=270

 Score = 81.3 bits (199),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 74/241 (31%), Positives = 106/241 (44%), Gaps = 29/241 (12%)
 Frame = -1

Query  945  EDFTAFYHGWLMNQDAIFEQLESFLaaaaaaddDREQCGGLVGRVLAHYQeyyaektkaa  766
            E F  F+  WL  Q+   + L +  A+A      R     LV RVL HY+ YY  K  + 
Sbjct  25   EHFAKFFECWLAEQERDLQVLRTAAASAGEELRLR----PLVDRVLGHYEYYYCAKAASV  80

Query  765  eEDVFVFFASPWMSRLEQSFLWLSGFKPSMLFWVVESS---------ME----------G  643
              DV   F   W S  E  FLW  G++P+M F ++ S          +E           
Sbjct  81   RRDVLPMFNPTWTSSTENLFLWAGGWRPTMAFHLLYSKSGLQFEPRLLELIVGNPTRDLA  140

Query  642  ALSEEQRCKVGMLRAETARVENAISKAMASAQETVAAPPILGLLKRAEELVDGEVSELDA  463
             LS +Q  ++  L   T R+E  IS+  A  QE+VA   ++ L      L + E  E DA
Sbjct  141  DLSPDQLERIDGLHRLTVRLEKEISEEEAQVQESVADARMVEL---THALAESEEVEADA  197

Query  462  VMGDLKQS---MGRLMGNADALRGSTASKILEILNPKQAVKFLTAVMRFQREARRWGLYN  292
            +  ++K+    M  ++  AD LR  T   ++EIL P QAV FL A      +   +G   
Sbjct  198  MEQEMKRKRDRMNEVLQRADQLRLETLKGLVEILKPVQAVHFLIAAAELHLKVHEFGKSK  257

Query  291  D  289
            D
Sbjct  258  D  258



>ref|XP_011085984.1| PREDICTED: transcription factor TGA5-like [Sesamum indicum]
Length=329

 Score = 82.0 bits (201),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 77/234 (33%), Positives = 117/234 (50%), Gaps = 20/234 (9%)
 Frame = -1

Query  951  VGEDFTAFYHGWLMNQDAIFEQLESFLaaaaaaddDREQCGGLVGRVLAHYQeyyaektk  772
            V E F+ FY  W+   D +   L+  L  +            +V ++ AH++EYY  K  
Sbjct  84   VEEKFSDFYAKWM---DQLEHLLQLLLVVSRDGHSQEAGYQSMVNKLTAHHKEYYTFKWA  140

Query  771  aaeEDVFVFFASPWMSRLEQSFLWLSGFKPSMLFWVVES----SMEG-----ALSEEQRC  619
            +A EDV  FFA  WMS LE ++LW++G+KPS +F +VES      EG      L+EEQ  
Sbjct  141  SAHEDVLAFFAPVWMSPLENAYLWVTGWKPSTVFRLVESLRGVQPEGGMKLSGLTEEQVK  200

Query  618  KVGMLRAETARVENAISKAMASAQETVAAPPI--LGLLKRAEELVDG--EVSELDAV---  460
            K+  LR +    E  + + M   Q  +A   +  L  L+R  +   G   V+++D +   
Sbjct  201  KIEALRVKIKVEEERVEREMERQQVGMADRKMVELATLERQAKKNGGAATVAQVDGLVEV  260

Query  459  -MGDLKQSMGRLMGNADALRGSTASKILEILNPKQAVKFLTAVMRFQREARRWG  301
             +  L   + ++M  AD +R  T   +L+ILNP Q V FL A    Q + R+WG
Sbjct  261  ALKGLLAGLEKVMKMADCVRLKTLKGMLDILNPMQCVDFLAAASMLQIQIRKWG  314



>ref|XP_009764515.1| PREDICTED: transcription factor TGA6 [Nicotiana sylvestris]
Length=235

 Score = 80.5 bits (197),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 70/239 (29%), Positives = 115/239 (48%), Gaps = 24/239 (10%)
 Frame = -1

Query  951  VGEDFTAFYHGWLMNQDAIFEQLESFLaaaaaaddDR---EQCGGLVGRVLAHYQeyyae  781
            V ++F+ ++  W+        QLE FL        +    +    LV ++  H+++YY  
Sbjct  5    VQKNFSNYFENWM-------SQLEEFLRLLLMVPKETSYVKDHESLVNKMTTHHKDYYTV  57

Query  780  ktkaaeEDVFVFFASPWMSRLEQSFLWLSGFKPSMLFWVVESSMEGALSEEQRCKVGMLR  601
            K  AA ED+  FF   W+S LE ++LW++G+KPSM F +V ++ E  LS+EQ   +  L+
Sbjct  58   KWAAAHEDILSFFNPVWLSPLENAYLWVTGWKPSMAFRLVGANSE--LSDEQVKSIDALK  115

Query  600  AETARVENAISKAMASAQETVAAPPILGL--LKRAEELVDGEVSELDA----------VM  457
             +    E  + + M   Q  +    ++ L  L  +     G  S+ D+           +
Sbjct  116  VKIRAEEERVEREMERQQVALGDRKMVELARLNSSRVRTSGCSSDSDSNNQLDGLVEVAL  175

Query  456  GDLKQSMGRLMGNADALRGSTASKILEILNPKQAVKFLTAVMRFQREARRWGLYNDSQR  280
              L  S+ R+M  AD  R  T   +L+ILNPKQ V  L A+   Q + R+WG   ++ R
Sbjct  176  KGLMVSLERVMKMADCARLKTLKGLLDILNPKQCVDLLAAITMLQIQMRKWGRKKENLR  234



>ref|XP_010999748.1| PREDICTED: transcription factor TGA6 [Populus euphratica]
Length=245

 Score = 80.9 bits (198),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 68/236 (29%), Positives = 111/236 (47%), Gaps = 14/236 (6%)
 Frame = -1

Query  951  VGEDFTAFYHGWLMNQDAIFEQL-ESFLaaaaaaddDREQCGGLVGRVLAHYQeyyaekt  775
            VGE F+ F+  W    D   + L  +          D+ +   LV +V  HY++Y+  K 
Sbjct  5    VGERFSEFFEKWACQLDEYLQLLLRASKQRVIDTVCDQRELQTLVSKVTQHYKDYFTIKW  64

Query  774  kaaeEDVFVFFASPWMSRLEQSFLWLSGFKPSMLFWVVES--------SMEGALSEEQRC  619
              A EDV  FF   W + LE ++ W +G+KPS +F +++S        S    L++EQ  
Sbjct  65   SLAHEDVLAFFCPIWGNPLENAYSWFTGWKPSTIFKLIDSTRINRVPGSSLAELTQEQLG  124

Query  618  KVGMLRAETARVENAISKAMASAQETVAAPPILGLLKRAEELVDGE-VSELDAV----MG  454
            K+  LR +    E  + + M   Q  +A   +  L +    + D E +++ D +    M 
Sbjct  125  KIEELRVKIRLEEEKVEREMERQQVAMADRKMFELARLTGRVKDSETIAQFDGLVEVAMK  184

Query  453  DLKQSMGRLMGNADALRGSTASKILEILNPKQAVKFLTAVMRFQREARRWGLYNDS  286
             L   + ++M  AD +R  T   +L++L+P Q V FL A    Q + R+WG   DS
Sbjct  185  GLMVGLEKVMKAADCVRLRTLKGVLDVLSPLQCVDFLAATSTLQIQLRQWGKRRDS  240



>ref|XP_010316825.1| PREDICTED: transcription factor TGA6 [Solanum lycopersicum]
Length=219

 Score = 80.1 bits (196),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 68/217 (31%), Positives = 114/217 (53%), Gaps = 9/217 (4%)
 Frame = -1

Query  951  VGEDFTAFYHGWLMNQDAIFEQLESFLaaaaaaddDREQCGGLVGRVLAHYQeyyaektk  772
            V E+FT ++  W++  + + +QL   +    +  +D E    LV ++  H++ YY  K  
Sbjct  5    VAENFTKYFENWMIQLEELLKQL-VIVPRETSYVNDHEL---LVSKMTTHHKNYYTAKWA  60

Query  771  aaeEDVFVFFASPWMSRLEQSFLWLSGFKPSMLFWVVESSMEGALSEEQRCKVGMLRAET  592
            AA ED+  FF   W+S LE  + W++G+KPSM F +V S   GA S+E+   +  LR + 
Sbjct  61   AAHEDILAFFTPMWLSPLEIVYSWITGWKPSMAFRLV-SGGGGAFSDEELKNIDGLRVKI  119

Query  591  ARVENAISKAMASAQETVAAPPILGLLKRAEELVDGEVSELDAVMGDLKQSMGRLMGNAD  412
               E  + + M   Q  +    ++ L +   +  + E+ EL   +  L+ S+ R+M  AD
Sbjct  120  RGEEEKVEREMERQQVAIGDRKMVELARIRND--NDELVEL--ALKGLRMSLERVMKMAD  175

Query  411  ALRGSTASKILEILNPKQAVKFLTAVMRFQREARRWG  301
             +R  T   +LEIL+P Q+V FL A+   Q + R+ G
Sbjct  176  CVRLKTLKGLLEILSPLQSVDFLAAISTIQIQMRKRG  212



>ref|XP_004239641.1| PREDICTED: transcription factor TGA6-like [Solanum lycopersicum]
Length=273

 Score = 80.9 bits (198),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 71/248 (29%), Positives = 117/248 (47%), Gaps = 30/248 (12%)
 Frame = -1

Query  948  GEDFTAFYHGWLMNQDAIFEQLESFLaaaaaaddDREQC-GGLVGRVLAHYQeyyaektk  772
            G+ F  F+  WL+ Q    E L+  + A+    ++ +     L+  V+ HY+EYY EK++
Sbjct  8    GKSFHKFFESWLVKQS---EDLDELVRASEEYKNNNDMLLSPLIHSVVKHYEEYYREKSQ  64

Query  771  aaeEDVFVFFASPWMSRLEQSFLWLSGFKPSMLFWV--------VESSME----------  646
             A  DV       W+S LE +FLW+ G++PSM F +        +E+++           
Sbjct  65   YAASDVLGMLHPSWLSNLEDAFLWIGGWRPSMAFHLLYSKSGIQLEANLHELIRGFSKED  124

Query  645  -GALSEEQRCKVGMLRAETARVENAISKAMASAQETVAAPPILGLLKRAEELV-------  490
             G LS +Q   +  L+ +T   E  +S+ +A  QE+VA   ++ L     EL+       
Sbjct  125  LGNLSGQQLGLIDELQHKTISEERKLSEKLAIVQESVADTSMVELSHVVSELMREQLVVH  184

Query  489  DGEVSELDAVMGDLKQSMGRLMGNADALRGSTASKILEILNPKQAVKFLTAVMRFQREAR  310
            + E  ++   +   ++S+  L+  AD LR ST  +IL I  P Q+V FL A         
Sbjct  185  EEEEKKIGKNISKKEESLLDLLKKADDLRLSTIKEILRISTPIQSVHFLIAAAELHLRVH  244

Query  309  RWGLYNDS  286
             WG   D+
Sbjct  245  EWGKNKDA  252



>ref|XP_010686461.1| PREDICTED: transcription factor HBP-1b(c38) [Beta vulgaris subsp. 
vulgaris]
Length=251

 Score = 80.5 bits (197),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 65/230 (28%), Positives = 107/230 (47%), Gaps = 21/230 (9%)
 Frame = -1

Query  954  IVGEDFTAFYHGWLMNQDAIFEQLESFLaaaaaaddDREQCGGLVGRVLAHYQeyyaekt  775
            +V E F ++Y  WL       +QLE  L           +   +V     H++EYY  K 
Sbjct  10   LVEEKFCSYYEEWL-------KQLELHLQQLVLGHQLDYET--MVTTFTTHHKEYYTAKW  60

Query  774  kaaeEDVFVFFASPWMSRLEQSFLWLSGFKPSMLFWVVES--------SMEGALSEEQRC  619
             AA +D+  FF+  W S LE +F W +G+KPS +F VV+S        +    LS+EQ  
Sbjct  61   AAAHDDILAFFSPQWASPLESAFTWATGWKPSTVFRVVDSLRKTRAPLTSLAQLSDEQAQ  120

Query  618  KVGMLRAETARVENAISKAMASAQETVAAPPILGLLKRAEELVDGEVSELDAVMG----D  451
            K+G L  +    E  + + M   Q  +    ++ L + +  +   E S +D ++G     
Sbjct  121  KIGELGVKIKLEEQKVDREMERQQVAMGDLKMVELARVSSRVNANESSRVDKIVGVAVKG  180

Query  450  LKQSMGRLMGNADALRGSTASKILEILNPKQAVKFLTAVMRFQREARRWG  301
            L   + ++M   D +R      +L++L+P+Q V FL      Q + R+WG
Sbjct  181  LFDGLEKVMKMGDYVRLKALKGVLDVLSPRQKVDFLAVFAMLQIQIRKWG  230



>ref|XP_002870027.1| hypothetical protein ARALYDRAFT_492990 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH46286.1| hypothetical protein ARALYDRAFT_492990 [Arabidopsis lyrata subsp. 
lyrata]
Length=281

 Score = 80.5 bits (197),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 62/208 (30%), Positives = 97/208 (47%), Gaps = 28/208 (13%)
 Frame = -1

Query  825  LVGRVLAHYQeyyaektkaaeEDVFVFFASPWMSRLEQSFLWLSGFKPSMLFWV------  664
            LVG+++  +Q+Y  ++++ +      +FA  W S LE   LW+ G +PS    V      
Sbjct  50   LVGKIVNDFQKYTEKRSELSRRSCSSYFAPSWNSSLENGLLWMGGCRPSSFIRVIYSLCG  109

Query  663  -----------------VESSMEGALSE---EQRCKVGMLRAETARVENAISKAMASAQE  544
                             VE +  G++S+    Q  K+  L  +    E+ I+K  A+ QE
Sbjct  110  SQAETQLSQYLLKVDENVEENQGGSMSDLNATQLAKINDLHIQVIEKEDQITKKSANLQE  169

Query  543  TVAAPPILGLLKRAEELVDGEVSELDAVMGDLKQSMGRLMGNADALRGSTASKILEILNP  364
             VA  PI  +   A +LVDG++   DA +   ++ M  LM  AD LR  T  KI+E++ P
Sbjct  170  DVADMPI-AIAAYATDLVDGDMLVEDA-LDKHEEGMAVLMTEADKLRFETLRKIVEVVTP  227

Query  363  KQAVKFLTAVMRFQREARRWGLYNDSQR  280
             QA +FL A  R       WG   + +R
Sbjct  228  VQAAEFLLAGKRLHISLHEWGRVREERR  255



>emb|CDO96811.1| unnamed protein product [Coffea canephora]
Length=259

 Score = 80.1 bits (196),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 66/234 (28%), Positives = 107/234 (46%), Gaps = 22/234 (9%)
 Frame = -1

Query  927  YHGWLMNQDAIFEQLESFLaaaaaaddDREQCGGLVGRVLAHYQeyyaektkaaeEDVFV  748
            +H W++ Q+A   ++   L       D       LV + + H+Q Y  E+T+ A++ V  
Sbjct  19   FHEWMILQEADLSEMLQALTVEDNFGDRDVLLRQLVQKNVEHFQAYADERTRLAQDHVSP  78

Query  747  FFASPWMSRLEQSFLWLSGFKPSMLFWVV--------ESSM-------------EGALSE  631
            FFA  W S LE S LWL+G +PS+   ++        ES +             E +L+ 
Sbjct  79   FFAPSWCSSLENSLLWLAGCRPSLFITLIYALSGIEIESHIPEFLQGTRTSELSELSLAA  138

Query  630  EQRCKVGMLRAETARVENAISKAMASAQETVAAPPILGLLKRAEELVDGEVSELDAVMGD  451
             Q   +  L+  T + E  +S+ +A  QE +A  P   + K +  +    V + D  + +
Sbjct  139  PQLSMINQLQRRTIKQEEELSQQLACLQEKIADQPFALIAKESSHVASQNV-QADEALDE  197

Query  450  LKQSMGRLMGNADALRGSTASKILEILNPKQAVKFLTAVMRFQREARRWGLYND  289
               SM R++  AD LR  T  +++ IL+P QAV FL A  +       WG   D
Sbjct  198  HSTSMVRILEEADKLRIKTLKEMMNILSPVQAVDFLVAGKKLHLCIHDWGQKRD  251



>ref|XP_008806140.1| PREDICTED: transcription factor TGA7-like [Phoenix dactylifera]
Length=277

 Score = 80.5 bits (197),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 64/198 (32%), Positives = 100/198 (51%), Gaps = 22/198 (11%)
 Frame = -1

Query  837  QCGGLVGRVLAHYQeyyaektkaaeEDVFVFFASPWMSRLEQSFLWLSGFKPSMLFWVVE  658
            Q   LV  VL HY+ YY  K  +A  DV   F++ W S  E+ FLW  G++PS  F ++ 
Sbjct  53   QLRSLVEMVLGHYEYYYRAKLASARRDVLTIFSTAWASSTEKLFLWAGGWRPSAAFQLLY  112

Query  657  SSM---------EGA--------LSEEQRCKVGMLRAETARVENAISKAMASAQETVAAP  529
            S +         +G         LS  Q  +V  L+ +T + E  IS+  A AQE VA P
Sbjct  113  SELGRRIERCLVQGVLRVQDLTRLSALQLEQVDRLQRKTIKTERKISEEEAKAQELVAWP  172

Query  528  PILGLLKRAEELVDG--EVSELDAVMGDLKQSMGRLMGNADALRGSTASKILEILNPKQA  355
             ++ +   + E+ +   EV+ ++  +   K++M R++  AD LR  T   ++ IL P+QA
Sbjct  173  QMVEI---SHEITESGREVAAMEEGLVGAKEAMKRVLERADQLRMETIKGVVGILRPRQA  229

Query  354  VKFLTAVMRFQREARRWG  301
            V+FL A  +      R+G
Sbjct  230  VQFLAAAGKLLLRVHRFG  247



>dbj|BAA05470.1| tumor-related protein [Nicotiana glauca x Nicotiana langsdorffii]
Length=287

 Score = 80.5 bits (197),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 68/212 (32%), Positives = 102/212 (48%), Gaps = 32/212 (15%)
 Frame = -1

Query  825  LVGRVLAHYQeyyaektkaaeEDVFVFFASPWMSRLEQSFLWLSGFKPSMLFWVV--ESS  652
            L+ RV+ HY+ YY EK+K  EEDVF      W S LE +FLW+ G++PSM F ++  +S 
Sbjct  59   LIKRVIQHYEGYYEEKSKYTEEDVFGMLNPTWRSNLEGAFLWIGGWRPSMAFHLLYSKSG  118

Query  651  ME-----------------GALSEEQRCKVGMLRAETARVENAISKAMASAQETVAAPPI  523
            ++                 G LS +Q  KV  L+ +T R E   S+ +A  QETVA   +
Sbjct  119  LQFEARLPQLIRGITTGDLGYLSPDQIDKVDELQKKTIREEKKSSEKLARVQETVADASM  178

Query  522  LGLLKRAEEL--VDGEV-----------SELDAVMGDLKQSMGRLMGNADALRGSTASKI  382
            + L     +L  + G              E++A +   ++ +  ++  AD LR +T  +I
Sbjct  179  VELSHIVTQLMMISGSRGGGGGGGKILDEEVEANLATKEEGLIIILQKADNLRLNTLKEI  238

Query  381  LEILNPKQAVKFLTAVMRFQREARRWGLYNDS  286
            L IL P QA+ FL A          WG   D+
Sbjct  239  LAILTPTQAIHFLIAAAELHLRLHEWGKIEDA  270



>ref|XP_011082768.1| PREDICTED: transcription factor TGA1 [Sesamum indicum]
Length=227

 Score = 79.7 bits (195),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 72/240 (30%), Positives = 111/240 (46%), Gaps = 38/240 (16%)
 Frame = -1

Query  939  FTAFYHGWLMNQDAIFEQLESFLaaaaaaddDREQCGGLVGRVLAHYQeyyaektkaaeE  760
            F  FY  W      + +QL S        ++   Q   LV + ++HY EYY  K+ AA+ 
Sbjct  3    FQRFYDTWFEQLRQLVQQL-SEAPIPPTTEEHHLQLRQLVHKAMSHYAEYYRAKSAAAKH  61

Query  759  DVFVFFASPWMSRLEQSFLWLSGFKPSMLFWVV--ESSM-----------------EGAL  637
            DV  FF++PW + LE+S  W+ G++P+  F +V  ESS+                  G L
Sbjct  62   DVLAFFSAPWTTSLERSLHWIGGWRPTTAFHLVYTESSILFESHVVDILRGFHTGDLGDL  121

Query  636  SEEQRCKVGMLRAETARVENAISKAMASAQETVAAPPILGLLKRAEELVDGEVSELDAVM  457
            S  Q  +V  L+ ET + EN I+  ++  Q+      ILG  K  +              
Sbjct  122  SPGQFRRVSELQIETVQQENDITDELSDWQDDTT--DILG-TKYGD--------------  164

Query  456  GDLK-QSMGRLMGNADALRGSTASKILEILNPKQAVKFLTAVMRFQREARRWGLYNDSQR  280
            GD K + + +++  AD LR  T   ++E+L P+QA +FL A        R WG+  D +R
Sbjct  165  GDRKMEKLAKILERADQLRLKTIETLVELLTPQQAAEFLVAAAELHFGVRGWGIRVDRER  224



>gb|EEC71515.1| hypothetical protein OsI_03809 [Oryza sativa Indica Group]
Length=294

 Score = 80.5 bits (197),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 82/261 (31%), Positives = 115/261 (44%), Gaps = 51/261 (20%)
 Frame = -1

Query  933  AFYHGWLMNQDAIFEQLESFLaaaaaaddDREQCGGLVGRVLAHYQeyyaektkaaeEDV  754
            A Y  W+  Q+A   +LE+  A AAA      +   +V R +  Y EY + +   A ED 
Sbjct  8    ACYQRWIAGQEAGLGELEASSANAAAGRATDGELRAVVERCMRGYAEYVSTRRALAREDG  67

Query  753  FVFFASPWMSRLEQSFLWLSGFKPSMLFWVVES--------------SMEGAL-------  637
               FA PW +  E S LW+ G +PS+   ++ S              S  GAL       
Sbjct  68   AALFAPPWCTSFENSVLWIGGCRPSLTIRLLYSLSGEGLEEHIEEFISGRGALGAARGMG  127

Query  636  ----SEEQRCKVGMLRAETARVENAISKAMASAQETVAAPPIL-----------------  520
                +  Q   V  L   T R E+A+S  +A+ QE VA  P+L                 
Sbjct  128  LLGITARQLELVNDLHRRTLRDEDALSDRLATLQEDVADRPLLPIVRERATAAAAALGAG  187

Query  519  ----GLLKRAEELV---DGEVS-ELDAVMGDLKQSMGRLMGNADALRGSTASKIL-EILN  367
                GL  R   +V   +G V  E+DA +G  K  +GRL+  AD LR STA  ++ EIL 
Sbjct  188  ASCDGLATRTRLVVATPEGAVDHEVDAAIGRYKAGLGRLLEEADELRMSTAQTLVTEILT  247

Query  366  PKQAVKFLTAVMRFQREARRW  304
            P+QAV+ L A  +   + R W
Sbjct  248  PRQAVETLVAAKQLHLKVRSW  268



>gb|EYU43340.1| hypothetical protein MIMGU_mgv1a020768mg, partial [Erythranthe 
guttata]
Length=244

 Score = 79.7 bits (195),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 58/198 (29%), Positives = 96/198 (48%), Gaps = 26/198 (13%)
 Frame = -1

Query  825  LVGRVLAHYQeyyaektkaaeEDVFVFFASPWMSRLEQSFLWLSGFKPSMLFWVV-----  661
            L+ +++AH+ EY   ++  A+ DV  +FA  W + LE+S LW+ G +PS    ++     
Sbjct  51   LIDKIMAHFVEYTQIRSCMAQADVSPYFAPTWCTSLERSVLWIGGCRPSSFIRLIYALSG  110

Query  660  ---ESSME-----------GALSEEQRCKVGMLRAETARVENAISKAMASAQETVAAPPI  523
               ES +            G LS +Q   V  L+  T   E  +S  MAS QE +   P+
Sbjct  111  LEIESRLSEFLRGARIGNLGGLSGDQIFMVDELQGRTIGEERKLSTRMASLQEDLLDHPL  170

Query  522  LGLLKRAEELVDGEVSELDAVMGDLKQSMGRLMGNADALRGSTASKILEILNPKQAVKFL  343
              +  ++E         LDA + D  ++M  ++  AD LR S+  +++ IL P+QAV F+
Sbjct  171  ASIAVKSE-------GNLDAALDDHGRAMAEMLAEADQLRLSSLKELIGILTPRQAVDFM  223

Query  342  TAVMRFQREARRWGLYND  289
             A  + +   + WG   D
Sbjct  224  AAGKKLRLCMQDWGKKRD  241



>ref|XP_006467638.1| PREDICTED: TGACG-sequence-specific DNA-binding protein TGA-2.1-like 
[Citrus sinensis]
Length=239

 Score = 79.7 bits (195),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 68/227 (30%), Positives = 113/227 (50%), Gaps = 14/227 (6%)
 Frame = -1

Query  951  VGEDFTAFYHGWLMNQDAIFEQLESFLaaaaaaddDREQCGGLVGRVLAHYQeyyaektk  772
            V E F  F+  W+   D   +QL   +  +  +  + EQ   LV ++ +HY+EYY  K  
Sbjct  5    VEEKFAEFFEKWVCQLDDYSQQL---IRISKESSSEAEQ-QALVSKLTSHYKEYYTVKWA  60

Query  771  aaeEDVFVFFASPWMSRLEQSFLWLSGFKPSMLFWVVESSME---------GALSEEQRC  619
             A EDV VF+   W+S  E ++ W++G+KPS++F +V+S  +           L+E+Q  
Sbjct  61   LAHEDVLVFYCPVWVSTFEMAYSWVTGWKPSIIFRLVDSLRKTMVPGGGSLAELTEQQLR  120

Query  618  KVGMLRAETARVENAISKAMASAQETVAAPPILGLLKRAEELVDGEVSEL-DAVMGDLKQ  442
            K+  LR +    E  + + M   Q  +A   ++ L +    L +GEV  L +  +  L  
Sbjct  121  KIEELRLKIRLEEEKVEREMERQQVALADRKMVELARLTSRLSNGEVDGLVEVALKGLLS  180

Query  441  SMGRLMGNADALRGSTASKILEILNPKQAVKFLTAVMRFQREARRWG  301
             + ++M  AD +R  T   IL++L+ KQ+V FL      Q +   WG
Sbjct  181  GLEKVMKAADCVRLKTLKGILDVLSTKQSVDFLAGTSILQIQMSIWG  227



>ref|XP_010920869.1| PREDICTED: transcription factor TGA3-like [Elaeis guineensis]
Length=260

 Score = 79.7 bits (195),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 66/202 (33%), Positives = 94/202 (47%), Gaps = 21/202 (10%)
 Frame = -1

Query  822  VGRVLAHYQeyyaektkaaeEDVFVFFASPWMSRLEQSFLWLSGFKPSMLFWVVESS---  652
            V RVL H + YY  K   A  DV   F+  W S  E  FLW+ G++PS+ F ++ S    
Sbjct  53   VERVLGHCENYYRAKAACATRDVTPMFSPTWTSSTENLFLWVGGWRPSVAFHLLYSKSGL  112

Query  651  -MEGALSE---------------EQRCKVGMLRAETARVENAISKAMASAQETVAAPPIL  520
             +E  L E               EQ  ++  L+  T R E  IS+  A  QE VA   ++
Sbjct  113  QLEAQLGEVIRGVPTRDLADLSLEQLQRINELQCRTIRKEKEISEEEARTQEGVADTQMV  172

Query  519  GLLKRAEELV-DGEVSEL-DAVMGDLKQSMGRLMGNADALRGSTASKILEILNPKQAVKF  346
             L     E     E +E+ +  M + ++ MGR++  AD LR  T   ++EIL P QAV F
Sbjct  173  ELSHVLSETGGTAEAAEMMETAMQEKREGMGRVLEKADELRLETLKGVVEILRPMQAVHF  232

Query  345  LTAVMRFQREARRWGLYNDSQR  280
            L A    Q     +G   D++R
Sbjct  233  LIAAAELQLWLHEYGTKKDAER  254



>ref|XP_011007917.1| PREDICTED: transcription factor HBP-1b(c38) [Populus euphratica]
Length=232

 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 70/232 (30%), Positives = 110/232 (47%), Gaps = 36/232 (16%)
 Frame = -1

Query  939  FTAFYHGWLMNQDAIFEQLESFLaaaaaaddDREQCGGLVGRVLAHYQeyyaektkaaeE  760
            FT FY  W    + + EQL +      ++ DDR     L  ++++HY E+Y  K+ A E 
Sbjct  7    FTRFYDTWFDQLNQLLEQLRT-APKPPSSQDDRSHLSSLAQKIVSHYAEFYRMKSMAIES  65

Query  759  DVFVFFASPWMSRLEQSFLWLSGFKPSMLFWVV--ESSM-----------------EGAL  637
            DV   F +PW S  E+S  W++G++P+ LF +V  ESS+                  G L
Sbjct  66   DVLSVFTAPWASCFERSLHWIAGWRPTTLFHLVYTESSILFEFHIADILKGRSTGDLGDL  125

Query  636  SEEQRCKVGMLRAETARVENAISKAMASAQETVAAPPILGLLKRAEELVDGEVSELDAVM  457
            S  Q  +V  L+ ET + ENAI+  ++  Q++            A E++ G  + L    
Sbjct  126  SPNQFRRVSELQCETVKEENAITGELSDWQDS------------ANEVMLGSFTNL----  169

Query  456  GDLKQSMGRLMGNADALRGSTASKILEILNPKQAVKFLTAVMRFQREARRWG  301
            GD    +  ++  AD LR  T  +++E+L  +QAV+FL A          WG
Sbjct  170  GDKVGRLVSVVKKADDLRLRTIRRVVELLTTQQAVEFLVAAGELHFGVYGWG  221



>ref|XP_006285421.1| hypothetical protein CARUB_v10006838mg [Capsella rubella]
 gb|EOA18319.1| hypothetical protein CARUB_v10006838mg [Capsella rubella]
Length=281

 Score = 79.7 bits (195),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 61/203 (30%), Positives = 93/203 (46%), Gaps = 28/203 (14%)
 Frame = -1

Query  831  GGLVGRVLAHYQeyyaektkaaeEDVFVFFASPWMSRLEQSFLWLSGFKPS----MLFWV  664
            G LVG++L  +++Y  ++++ +      +    W S LE   LW+ G +PS    +++ +
Sbjct  49   GELVGKILNDFKKYAEKRSELSNRSCSSYLTPSWNSALENGLLWMGGCRPSSFVRVIYAL  108

Query  663  VESSMEGALSE----------------------EQRCKVGMLRAETARVENAISKAMASA  550
              S  E  LS+                       Q  K+  L  +    E+ ++K  AS 
Sbjct  109  CGSQAETQLSQYLLDIDENVKVNHGVFMSDLTATQLAKINELHMKVIEKEDKVTKKSASL  168

Query  549  QETVAAPPILGLLKRAEELVDGEVSELDAVMGDLKQSMGRLMGNADALRGSTASKILEIL  370
            QE VA  PI  +   A +LVDG V   DA +   ++ M  LMG AD LR  T  KI+E++
Sbjct  169  QENVADMPI-AIAAYAMDLVDGNVVVKDA-LDKHEEGMAALMGEADTLRFETLRKIVEVI  226

Query  369  NPKQAVKFLTAVMRFQREARRWG  301
             P QA +FL A  R       WG
Sbjct  227  TPVQAAEFLLAGKRLHVSLHEWG  249



>gb|AHA62826.1| delay of germination 1 B, partial [Lepidium sativum]
Length=260

 Score = 79.3 bits (194),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 54/183 (30%), Positives = 85/183 (46%), Gaps = 28/183 (15%)
 Frame = -1

Query  747  FFASPWMSRLEQSFLWLSGFKPSMLFWVVES---------------SMEG----------  643
            ++A  W S LE + LW+ G +PS  F +V +                M+G          
Sbjct  79   YYAPSWNSPLENALLWMGGCRPSSFFRLVYALCGSQTEIRVTQYLRDMDGLESSGGIGTS  138

Query  642  --ALSEEQRCKVGMLRAETARVENAISKAMASAQETVAAPPILGLLKRAEELVDGEVSEL  469
               L+ EQ  K+ +L  +    E  ++K +AS QE  A  PI   +   EE V      +
Sbjct  139  LSDLTAEQLAKINVLHVKIIEEEEKMTKKVASLQEDAADIPI-ATVAYEEEHVGKPNMVV  197

Query  468  DAVMGDLKQSMGRLMGNADALRGSTASKILEILNPKQAVKFLTAVMRFQREARRWGLYND  289
            D  +   +++M +L+G AD+LR  T +K++EIL+P QA  FL A  +      +WG   D
Sbjct  198  DQALDKQEEAMAKLLGEADSLRVDTITKVVEILSPVQAADFLLAGKKLHLSMHQWGTMRD  257

Query  288  SQR  280
             +R
Sbjct  258  RRR  260



>ref|XP_003634633.1| PREDICTED: transcription factor TGA4-like [Vitis vinifera]
Length=246

 Score = 79.0 bits (193),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 63/233 (27%), Positives = 101/233 (43%), Gaps = 25/233 (11%)
 Frame = -1

Query  939  FTAFYHGWLMNQDAIFEQLESFLaaaaaaddDREQCGGLVGRVLAHYQeyyaektkaaeE  760
            F   +  W+  Q    + L+  L        D +    L+ + L H+Q+Y A + + ++ 
Sbjct  9    FHCCFQDWINQQ---HQDLQELLQVLDTDSPDSDHLRHLIQKSLQHFQDYSATRAELSKL  65

Query  759  DVFVFFASPWMSRLEQSFLWLSGFKPS----MLFWVVESSMEGAL---------------  637
            D   FF   W++  E SFLWL G +PS    +L+ +  S ++  L               
Sbjct  66   DAPSFFCPSWITSFENSFLWLGGCRPSLAIRLLYSISGSELQAQLPDFLKGCTRGNLADI  125

Query  636  SEEQRCKVGMLRAETARVENAISKAMASAQETVAAPPILGLLKRAEELVDGEVSE-LDAV  460
            S  Q   +  L     R E+ +S  MAS QE  A  P+  + K+   +  GE S  +++ 
Sbjct  126  SATQLISINALHGWIVREEDRLSSRMASMQEDTADEPLAIIAKKLRTV--GEYSRTVNSA  183

Query  459  MGDLKQSMGRLMGNADALRGSTASKILEILNPKQAVKFLTAVMRFQREARRWG  301
            +    Q++ R++  AD LR ST   + EIL P Q   FL A  +       WG
Sbjct  184  IETHSQALARVLEEADKLRLSTFKGLQEILTPLQGAHFLVASKKLHLSMHEWG  236



>emb|CDY66844.1| BnaC07g50150D [Brassica napus]
Length=285

 Score = 79.0 bits (193),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 66/245 (27%), Positives = 108/245 (44%), Gaps = 32/245 (13%)
 Frame = -1

Query  927  YHGWLMNQDAIFEQLESFLaaaaaaddDREQCGGLVGRVLAHYQeyyaektkaaeEDVFV  748
            Y+ W+  Q      L+  L +  +   D  +   LVGR++  +Q Y  ++++ A+     
Sbjct  19   YYEWMRTQSKHIVDLKEVLMSQRSNAYDHHKLEELVGRIVNDFQNYADKRSELADRSCSS  78

Query  747  FFASPWMSRLEQSFLWLSGFKPSMLFWVV-----------------------------ES  655
            +FA  W S LE   LW+ G +PS    ++                             +S
Sbjct  79   YFAPSWNSSLENGLLWMGGCRPSSFMRIIYALCGSHAETQLSQYLLKMDGEVVDGHDGDS  138

Query  654  SMEGALSEEQRCKVGMLRAETARVENAISKAMASAQETVAAPPILGLLKRAEELVDGEVS  475
            SM   L+  Q  K+  L  E    E+ +SK  A+ QE VA  PI  +   + + V+ +V+
Sbjct  139  SM-SELNATQLAKINDLHVEVIDKEDKLSKLSANMQEDVADMPI-AVTAFSRDSVEADVA  196

Query  474  ELDAVMGDLKQSMGRLMGNADALRGSTASKILEILNPKQAVKFLTAVMRFQREARRWGLY  295
              DA +   ++ M  L+ +AD LR  T  KI+E+L P QA +FL +  R       WG  
Sbjct  197  VEDA-LDKHEEGMAVLIADADKLRLETLKKIVEVLTPVQAAEFLLSGKRLHVSLHEWGRV  255

Query  294  NDSQR  280
             + +R
Sbjct  256  REERR  260



>ref|XP_008371485.1| PREDICTED: TGACG-sequence-specific DNA-binding protein TGA-1A 
[Malus domestica]
Length=237

 Score = 78.2 bits (191),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 53/164 (32%), Positives = 85/164 (52%), Gaps = 8/164 (5%)
 Frame = -1

Query  759  DVFVFFASPWMSRLEQSFLWLSGFKPSMLFWVVESSMEG---ALSEEQRCKVGMLRAETA  589
            DV  FF   W S LE ++ W++G+KPSMLF +VES  +    ++SEEQ  KV  LR +  
Sbjct  66   DVLAFFCPVWSSPLENAYSWVTGWKPSMLFQLVESLKKTRLVSMSEEQVRKVEQLRQKMR  125

Query  588  RVENAISKAMASAQETVAAPPILGLLKRAEELVDGEVSE-----LDAVMGDLKQSMGRLM  424
              E+ + + M   Q  +A   ++ L + A    +GE +      ++  M  +   +  +M
Sbjct  126  YEEDKVEREMERQQVAMADRRMVELARLATRARNGEAAAELEGLVNVAMKVMLSGLEGVM  185

Query  423  GNADALRGSTASKILEILNPKQAVKFLTAVMRFQREARRWGLYN  292
              AD +R  T   +L++L+P Q+V+ L A    Q + R WG  N
Sbjct  186  KAADCVRLKTLKGLLDLLSPLQSVELLAATCMLQIKLREWGGRN  229



>ref|NP_193604.2| uncharacterized protein [Arabidopsis thaliana]
 gb|AAX55185.1| hypothetical protein At4g18690 [Arabidopsis thaliana]
 gb|AAZ52737.1| hypothetical protein At4g18690 [Arabidopsis thaliana]
 gb|AEE84076.1| uncharacterized protein AT4G18690 [Arabidopsis thaliana]
Length=282

 Score = 78.6 bits (192),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 61/208 (29%), Positives = 97/208 (47%), Gaps = 28/208 (13%)
 Frame = -1

Query  825  LVGRVLAHYQeyyaektkaaeEDVFVFFASPWMSRLEQSFLWLSGFKPSMLFWV------  664
            LVG+++  +Q+Y  ++++ +      +FA  W S LE   LW+ G +PS    V      
Sbjct  50   LVGKIVNDFQKYTEKRSELSRRSCSSYFAPSWNSPLENGLLWMGGCRPSSFIRVIYSLCG  109

Query  663  -----------------VESSMEGALSE---EQRCKVGMLRAETARVENAISKAMASAQE  544
                             VE +  G++S+    Q  K+  L  +    E+ I+K  A+ QE
Sbjct  110  SQAETQLSQYLLKIDENVEVNHGGSMSDLNASQLAKINDLHIKVIEKEDKITKKSANLQE  169

Query  543  TVAAPPILGLLKRAEELVDGEVSELDAVMGDLKQSMGRLMGNADALRGSTASKILEILNP  364
             VA  PI  +   A +L++G+V   DA +   ++ M  LM  AD LR  T  KI++++ P
Sbjct  170  NVADMPI-AIAAYATDLMNGDVVVEDA-LDKYEEGMAVLMVEADKLRFETLRKIVDVVTP  227

Query  363  KQAVKFLTAVMRFQREARRWGLYNDSQR  280
             QA +FL A  R       WG   + QR
Sbjct  228  VQAAEFLLAGKRLHISLHEWGRVREEQR  255



>emb|CAB37454.1| putative protein [Arabidopsis thaliana]
 emb|CAB78871.1| putative protein [Arabidopsis thaliana]
Length=368

 Score = 80.1 bits (196),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 61/208 (29%), Positives = 97/208 (47%), Gaps = 28/208 (13%)
 Frame = -1

Query  825  LVGRVLAHYQeyyaektkaaeEDVFVFFASPWMSRLEQSFLWLSGFKPSMLFWV------  664
            LVG+++  +Q+Y  ++++ +      +FA  W S LE   LW+ G +PS    V      
Sbjct  50   LVGKIVNDFQKYTEKRSELSRRSCSSYFAPSWNSPLENGLLWMGGCRPSSFIRVIYSLCG  109

Query  663  -----------------VESSMEGALSE---EQRCKVGMLRAETARVENAISKAMASAQE  544
                             VE +  G++S+    Q  K+  L  +    E+ I+K  A+ QE
Sbjct  110  SQAETQLSQYLLKIDENVEVNHGGSMSDLNASQLAKINDLHIKVIEKEDKITKKSANLQE  169

Query  543  TVAAPPILGLLKRAEELVDGEVSELDAVMGDLKQSMGRLMGNADALRGSTASKILEILNP  364
             VA  PI  +   A +L++G+V   DA +   ++ M  LM  AD LR  T  KI++++ P
Sbjct  170  NVADMPI-AIAAYATDLMNGDVVVEDA-LDKYEEGMAVLMVEADKLRFETLRKIVDVVTP  227

Query  363  KQAVKFLTAVMRFQREARRWGLYNDSQR  280
             QA +FL A  R       WG   + QR
Sbjct  228  VQAAEFLLAGKRLHISLHEWGRVREEQR  255



>gb|KDO77874.1| hypothetical protein CISIN_1g046619mg [Citrus sinensis]
Length=239

 Score = 78.2 bits (191),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 68/226 (30%), Positives = 116/226 (51%), Gaps = 16/226 (7%)
 Frame = -1

Query  951  VGEDFTAFYHGWLMNQDAIFEQLESFLaaaaaaddDREQCGGLVGRVLAHYQeyyaektk  772
            V E F  F+  W+   D   +QL   +  +  +  + EQ   LV ++ +HY+EYY  K  
Sbjct  5    VEEKFAEFFEKWVCQLDDYSQQL---IRISKESSSEAEQ-QALVSKLTSHYKEYYTVKWA  60

Query  771  aaeEDVFVFFASPWMSRLEQSFLWLSGFKPSMLFWVVESSME---------GALSEEQRC  619
             A EDV VF+   W+S  E ++ W++G+KPS++F +V+S  +           L+E+Q  
Sbjct  61   LAHEDVLVFYCPVWVSTFEMAYSWVTGWKPSIIFRLVDSLRKTMVPGGGSLAELTEQQLR  120

Query  618  KVGMLRAETARVENAISKAMASAQETVAAPPILGLLKRAEELVDGEVSEL-DAVMGDLKQ  442
            K+  LR +    E  + + M   Q  +A   ++ L +    L +GEV  L +  +  L  
Sbjct  121  KIEELRLKIRLEEEKVEREMERQQVALADRKMVELARLTSRLSNGEVDGLVEVALKGLLS  180

Query  441  SMGRLMGNADALRGSTASKILEILNPKQAVKFL--TAVMRFQREAR  310
             + ++M  AD +R  T   IL++L+ KQ+V FL  T++++ Q   R
Sbjct  181  GLEKVMKAADCVRLKTLKGILDVLSTKQSVDFLAGTSILQIQMSIR  226



>ref|XP_010920258.1| PREDICTED: transcription factor TGA2 [Elaeis guineensis]
Length=257

 Score = 78.2 bits (191),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 68/248 (27%), Positives = 114/248 (46%), Gaps = 33/248 (13%)
 Frame = -1

Query  939  FTAFYHGWLMNQDAIFEQLESFLaaaaaaddDREQCGGLVGRVLAHYQeyyaektkaaeE  760
            F + +  W+  Q++   +L   + +     D R +   LV + + HY+EY  ++   A E
Sbjct  5    FRSCFDEWVREQESDLNELLESMQSERRESDSRLR--ELVEKSMRHYKEYSEKRRALARE  62

Query  759  DVFVFFASPWMSRLEQSFLWLSGFKPSMLF--------WVVESSMEG-------------  643
            D   FF  PW +  E SFLWL G +P++          + +E+ ++              
Sbjct  63   DGPTFFCPPWCTAFENSFLWLGGCRPTLSIRLLYALSGYELEAHLDDILAPGGLAAAFQR  122

Query  642  ---ALSEEQRCKVGMLRAETARVENAISKAMASAQETVAAPPILGL----LKRAEELVDG  484
                LS  Q   V  L   T + E+ +S  MA+ QE VA  P+L +     +R  E+ +G
Sbjct  123  GLVGLSAAQLATVNDLHCRTLKEEDRLSAKMATLQEDVADKPLLPIAVDRARRRAEVAEG  182

Query  483  EVSE--LDAVMGDLKQSMGRLMGNADALRGST-ASKILEILNPKQAVKFLTAVMRFQREA  313
                  ++A M + ++ +  ++  AD LR +T  + + EIL P QAV+ L A  + Q   
Sbjct  183  SGGREVVEATMKEHEEKLAGMVEEADQLRVATLRTLVTEILTPLQAVELLVAAKQLQLSV  242

Query  312  RRWGLYND  289
            R+WG   D
Sbjct  243  RQWGQRRD  250



>ref|XP_002985809.1| hypothetical protein SELMODRAFT_123200 [Selaginella moellendorffii]
 gb|EFJ12986.1| hypothetical protein SELMODRAFT_123200 [Selaginella moellendorffii]
Length=245

 Score = 77.8 bits (190),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 62/235 (26%), Positives = 106/235 (45%), Gaps = 26/235 (11%)
 Frame = -1

Query  948  GEDFTAFYHGWLMNQDAIFEQLESFLaaaaaaddDREQCGGLVGRVLAHYQeyyaektka  769
             E +T FY  W   Q    E+LE  L +  +      +   LV +   HY  YY  K  A
Sbjct  9    NESYTDFYDDWSNTQLQQLEELERALNSNMS----ESEIKALVDKAKMHYDYYYGAKDNA  64

Query  768  aeEDVFVFFASPWMSRLEQSFLWLSGFKPSMLFWV-------------------VESSME  646
            A+++V       W + LE +F+W  G++P+M+F +                   V+S   
Sbjct  65   AKQNVLQVMTPAWKTPLETAFMWTGGWRPTMVFQLAYALAGQLVEAELSELLSGVDSPSL  124

Query  645  GALSEEQRCKVGMLRAETARVENAISKAMASAQETVAAPPILGLLKRAEELVDGEVSELD  466
             +LS  Q  ++  ++ +  + E+ IS  MA  Q+ +A  P +G+    + L   E  +++
Sbjct  125  ASLSARQLERINEMQVKVQKQEDDISHRMAVLQQGMADQPFVGI---TQTLAASEDDKME  181

Query  465  AVMGDLKQSMGRLMGNADALRGSTASKILEILNPKQAVKFLTAVMRFQREARRWG  301
            A +    + +  L+  AD LR  T   +L+ L P QA ++L A  + Q   R+ G
Sbjct  182  AALDSKLKDLESLLEEADNLRRETLHNMLDTLTPVQAAQYLVAAAQLQVAFRKIG  236



>ref|XP_007148035.1| hypothetical protein PHAVU_006G175000g [Phaseolus vulgaris]
 gb|ESW20029.1| hypothetical protein PHAVU_006G175000g [Phaseolus vulgaris]
Length=305

 Score = 78.6 bits (192),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 63/220 (29%), Positives = 109/220 (50%), Gaps = 8/220 (4%)
 Frame = -1

Query  939  FTAFYHGWLMNQDAIFEQLESFLaaaaaaddDREQCGGLVGRVLAHYQeyyaektkaaeE  760
            F+ FY  W    + I +QL    +         ++   LV  V +H +EYY  K   A +
Sbjct  70   FSEFYENWTGKLEDILQQLLQVSSQRTEVVKTEQELQALVSTVTSHLKEYYTTKWGIAHD  129

Query  759  DVFVFFASPWMSRLEQSFLWLSGFKPSMLFWVVESSMEG---ALSEEQRCKVGMLRAETA  589
            +V +FF+ PW++ LE + LW++G+KPS +F  VE+  +G    ++EEQ  K+  L+ +  
Sbjct  130  NVLIFFSPPWLNPLENAQLWMTGWKPSTVFRQVENLKKGNVLVMTEEQEKKMEELKMKIK  189

Query  588  RVENAISKAMASAQETVAAPPILGLLKRAEELVDGEVSELDAV----MGDLKQSMGRLMG  421
              E  + + M   Q  +A   ++ L K          SE+D+V    + ++   + R+M 
Sbjct  190  MEEEKVEREMERQQVAMADRRMVQLSKLTSR-ARSAGSEMDSVAEVAVKEVLAGLERVMK  248

Query  420  NADALRGSTASKILEILNPKQAVKFLTAVMRFQREARRWG  301
             +D +R  T   +L++L P Q+V FL A +       +WG
Sbjct  249  ASDCVRLKTLKGVLDLLTPMQSVDFLAANITTLLRFNQWG  288



>ref|XP_004156023.1| PREDICTED: transcription factor TGA6-like [Cucumis sativus]
 gb|KGN54766.1| hypothetical protein Csa_4G463190 [Cucumis sativus]
Length=255

 Score = 77.8 bits (190),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 69/253 (27%), Positives = 107/253 (42%), Gaps = 38/253 (15%)
 Frame = -1

Query  939  FTAFYHGWLMNQDAIFEQLESFLaaaaaaddDREQCGGLVGRVLAHYQeyyaektkaaeE  760
            F  F+  W+  Q+    +L S                 L+ RV+ HY+ YY  K++  E+
Sbjct  7    FGEFFQKWMKEQNQYLTELISTAKGGNNMV-----AEALMKRVMEHYEHYYKVKSRWVEK  61

Query  759  DVFVFFASPWMSRLEQSFLWLSGFKPSMLFWVVESS----MEG---------------AL  637
            D     +  W+S  E +FLWL G++P+M F ++ S     +EG                L
Sbjct  62   DTLGILSPSWISSFEDAFLWLGGWRPTMAFHLLYSKSGLQLEGRLLDLIHGLSTGDLADL  121

Query  636  SEEQRCKVGMLRAETARVENAISKAMASAQETVAAPPILGLLKRAEELV----------D  487
            S  Q  K+  L+    + E  I++ MA  QET+A P ++ L   A +            D
Sbjct  122  SSHQVIKIDTLQRGVVKQEKEITEKMAKYQETIADPSMVELSHMATKFKMGTSGGGGQND  181

Query  486  GEVS----ELDAVMGDLKQSMGRLMGNADALRGSTASKILEILNPKQAVKFLTAVMRFQR  319
            GE++    EL   +   +  +  ++  AD LR  T  +I+ IL   Q V FL A      
Sbjct  182  GELNMVEEELKLALATKECGLKEVVKMADELRLETLKQIIGILTLTQRVHFLIAAAELHL  241

Query  318  EARRWGLYNDSQR  280
                WGL  DS +
Sbjct  242  RIHEWGLKRDSDQ  254



>ref|XP_002984747.1| hypothetical protein SELMODRAFT_181239 [Selaginella moellendorffii]
 gb|EFJ13997.1| hypothetical protein SELMODRAFT_181239 [Selaginella moellendorffii]
Length=245

 Score = 77.4 bits (189),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 63/235 (27%), Positives = 106/235 (45%), Gaps = 26/235 (11%)
 Frame = -1

Query  948  GEDFTAFYHGWLMNQDAIFEQLESFLaaaaaaddDREQCGGLVGRVLAHYQeyyaektka  769
             E +T FY  W   Q    E+LE  L +  +      +   LV +   HY  YY  K  A
Sbjct  9    NERYTDFYDDWSNTQLQQLEELERALNSNMS----ESEIKALVDKAKMHYDYYYGAKDNA  64

Query  768  aeEDVFVFFASPWMSRLEQSFLWLSGFKPSMLFWV-------------------VESSME  646
            A+++V       W + LE +F+W  G++P+M+F +                   V+S   
Sbjct  65   AKQNVLQVMTPAWKTPLETAFMWTGGWRPTMVFQLAYALAGQLVEAELSDLLSGVDSPSL  124

Query  645  GALSEEQRCKVGMLRAETARVENAISKAMASAQETVAAPPILGLLKRAEELVDGEVSELD  466
             +LS  Q  K+  ++ +  + E+ IS  MA  Q+ +A  P +G+    + L   E  +++
Sbjct  125  ASLSARQLEKINEMQVKVQKQEDDISHRMAVLQQGMADQPFVGI---TQTLAASEDDKME  181

Query  465  AVMGDLKQSMGRLMGNADALRGSTASKILEILNPKQAVKFLTAVMRFQREARRWG  301
            A +    + +  L+  AD LR  T   +L+ L P QA ++L A  + Q   R+ G
Sbjct  182  AAVDSKLKDLESLLEEADNLRRETLHNMLDTLTPVQAAQYLVAAAQLQVAFRKIG  236



>gb|KFK28539.1| hypothetical protein AALP_AA7G009900 [Arabis alpina]
Length=274

 Score = 77.8 bits (190),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 62/206 (30%), Positives = 93/206 (45%), Gaps = 26/206 (13%)
 Frame = -1

Query  825  LVGRVLAHYQeyyaektkaaeEDVFVFFASPWMSRLEQSFLWLSGFKPSMLFWVV-----  661
            LVG ++  +Q+Y  ++ + +      +FA  W S LE   LW+ G +PS    V+     
Sbjct  48   LVGVIVNDFQKYAEKRRELSHRSCSSYFAPSWNSSLENGLLWMGGCRPSSFIRVIYALCG  107

Query  660  ----------------ESSMEGALSE---EQRCKVGMLRAETARVENAISKAMASAQETV  538
                               ++G +SE    Q  K+  L  +    E+ ISK  AS QE V
Sbjct  108  SQIETQISQYLHKIDGNEKVDGLMSELTATQLAKINELHIKVIEKEDKISKKSASMQEDV  167

Query  537  AAPPILGLLKRAEELVDGEVSELDAVMGDLKQSMGRLMGNADALRGSTASKILEILNPKQ  358
            A  PI  +   A++LV+  V   DA +   ++ M  LM  AD LR  T  KI+E++ P Q
Sbjct  168  ADMPI-AVTAYAKDLVEAGVVVEDA-LDKHEEGMAVLMEEADKLRVETLRKIVEVVTPVQ  225

Query  357  AVKFLTAVMRFQREARRWGLYNDSQR  280
            A +FL A  R       WG   + +R
Sbjct  226  AAEFLLAGKRLHVSLHEWGRVREERR  251



>ref|XP_010317335.1| PREDICTED: transcription factor HBP-1b(c38)-like [Solanum lycopersicum]
Length=250

 Score = 77.4 bits (189),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 60/201 (30%), Positives = 93/201 (46%), Gaps = 24/201 (12%)
 Frame = -1

Query  825  LVGRVLAHYQeyyaektkaaeEDVFVFFASPWMSRLEQSFLWLSGFKPSMLFWVV-----  661
            L  +++ H+QE+   + + A +DV  FFA    S LE S LW++G +PS    ++     
Sbjct  51   LAEKIIQHFQEHSDNRLRLARKDVSPFFAPVTCSPLENSVLWIAGCRPSSFIRLIYALCG  110

Query  660  -ESSMEGA--------------LSEEQRCKVGMLRAETARVENAISKAMASAQETVAAPP  526
             E  ++G               LSE+Q   +  L+ +T R E  IS   AS QE     P
Sbjct  111  FEPDVQGTDPCLEGIVTEDLRELSEKQLRMINELQGKTIREERRISTKFASLQEDTVDQP  170

Query  525  ILGLLKRAEELVDGEVSELDAVMGDLKQSMGRLMGNADALRGSTASKILEILNPKQAVKF  346
            + G +K+     +     LD   G     M  ++  AD LR  T  +I+ IL P QAV++
Sbjct  171  LAGKMKKEGHGCEKADEALDEHSG----HMADVIEEADRLRMKTLKEIVNILEPVQAVEY  226

Query  345  LTAVMRFQREARRWGLYNDSQ  283
            L A  + +   ++WG   D Q
Sbjct  227  LAAAKKMRFCVQQWGEKRDQQ  247



>ref|XP_010025725.1| PREDICTED: transcription factor TGA2-like [Eucalyptus grandis]
 gb|KCW62438.1| hypothetical protein EUGRSUZ_H05080 [Eucalyptus grandis]
Length=285

 Score = 77.8 bits (190),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 72/251 (29%), Positives = 119/251 (47%), Gaps = 35/251 (14%)
 Frame = -1

Query  945  EDFTAFYHGWLMNQDAIFEQLESFLaaaaaaddDREQC-GGLVGRVLAHYQeyyaektka  769
            E F  F+  WL+ Q+   + L   ++A++ A D  +Q    L+ RV+ HY++YY  K+++
Sbjct  22   ESFHKFFECWLVEQN---QHLHDLISASSPARDGDDQALRPLIDRVMLHYEQYYKAKSRS  78

Query  768  aeEDVFVFFASPWMSRLEQSFLWLSGFKPSMLFWVVESS----MEGALSE----------  631
            A+++V   F+  W S  E +FLW+ G++PSM F ++ S     +E  L+E          
Sbjct  79   AKQNVLAMFSPTWRSSFEDAFLWIGGWRPSMAFHLLYSKSGLQLEAQLAELIRGLATSDL  138

Query  630  -----EQRCKVGMLRAETARVENAISKAMASAQETVAAPPILGLLKRAEEL---------  493
                  Q   +   +  T   E AI++  A  QETVA   ++ L     E+         
Sbjct  139  ADLSPSQLALIDDRQRTTIHQEKAITEKFAKHQETVADASMVELSHTITEMMRAGGGDAA  198

Query  492  VDGEVS---ELDAVMGDLKQSMGRLMGNADALRGSTASKILEILNPKQAVKFLTAVMRFQ  322
            V+ E +   E+++ +   ++ +  ++  AD LR ST  +IL IL   QAV FL A     
Sbjct  199  VENEAAMEEEVESALAAKEEGLEEMLQMADDLRLSTLKEILNILTSMQAVHFLIAAAELH  258

Query  321  REARRWGLYND  289
                 WG   D
Sbjct  259  LRIHEWGKKKD  269



>ref|XP_007025355.1| Delay of germination 1, putative [Theobroma cacao]
 gb|EOY27977.1| Delay of germination 1, putative [Theobroma cacao]
Length=408

 Score = 79.3 bits (194),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 58/177 (33%), Positives = 82/177 (46%), Gaps = 22/177 (12%)
 Frame = -1

Query  759  DVFVFFASPWMSRLEQSFLWLSGFKPSM----LFWVVESSME---------------GAL  637
            DV   FA  W + LE S LW+ G +PSM     + +  S +E               G +
Sbjct  69   DVSGLFAPSWNTALENSLLWIGGCRPSMYIRLTYALCGSQVEFQLLEILQGLARGDLGQI  128

Query  636  SEEQRCKVGMLRAETARVENAISKAMASAQETVAAPPILGLLKRAEELVDGEVS-ELDAV  460
            S  Q  K+  L  +T + E  +S  +AS QE +A  PI  + KR   +  GE S E+D  
Sbjct  129  SATQLGKINDLHMKTMKEEERLSNNLASLQENIADQPIAVIAKRLCRV--GESSGEVDRA  186

Query  459  MGDLKQSMGRLMGNADALRGSTASKILEILNPKQAVKFLTAVMRFQREARRWGLYND  289
            + + + SM  ++  AD LR ST  ++L IL P Q V FL A  +       WG   D
Sbjct  187  LDEHESSMANILQEADKLRLSTLKELLGILTPVQGVDFLAASKKLHLCMHEWGKTRD  243



>gb|EYU45430.1| hypothetical protein MIMGU_mgv1a012463mg [Erythranthe guttata]
Length=250

 Score = 77.4 bits (189),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 66/232 (28%), Positives = 111/232 (48%), Gaps = 15/232 (6%)
 Frame = -1

Query  951  VGED--FTAFYHGWLMNQDAIFEQLESFLaaaaaaddDREQCGGLVGRVLAHYQeyyaek  778
            VGE   F  F+  W++ Q+   ++L     +AA+A     +   L+  V+ HY+ YY  K
Sbjct  15   VGEHVSFHMFFDSWIVEQNHQLQEL----VSAASASASASEASVLIPLVVQHYEHYYKTK  70

Query  777  tkaaeEDVFVFFASPWMSRLEQSFLWLSGFKPSMLFWVVESSM------EGALSEEQRCK  616
            +  A++D+   F   W S LE++++W+ G++P+M F ++ S         G LS  Q  +
Sbjct  71   SMWAKKDILSMFRPSWRSSLEKAYMWVGGWRPTMTFHLLYSKCGLQFQDTGNLSHSQMER  130

Query  615  VGMLRAETARVENAISKAMASAQETVAAPPILGLLKRAEELVDGEVSE---LDAVMGDLK  445
            V  L   T   E  I++ +A  QET+A   ++ L   +    D  V     +DA +   +
Sbjct  131  VDKLHKTTLWKEKMITEKLAKLQETMADSSMVELTDHSRHGGDQVVHHQGLVDAALAPKE  190

Query  444  QSMGRLMGNADALRGSTASKILEILNPKQAVKFLTAVMRFQREARRWGLYND  289
            + +  ++  AD LR +T   ++ IL+P Q V FL A          WG   D
Sbjct  191  KGLVGILQMADELRLNTLKDLILILSPIQGVYFLIAAAELHLRMHDWGKKRD  242



>ref|XP_008442175.1| PREDICTED: transcription factor TGA2-like isoform X2 [Cucumis 
melo]
Length=280

 Score = 77.8 bits (190),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 72/256 (28%), Positives = 110/256 (43%), Gaps = 34/256 (13%)
 Frame = -1

Query  945  EDFTAFYHGWLMNQDAIFEQLESFLaaaaaaddDREQCG-GLVGRVLAHYQeyyaektka  769
            E F  F+  W+  Q+    +L S +      D+D +     L+ RV+ HY+ YY  K+  
Sbjct  24   ESFGEFFKKWMKEQNQYLTELISTVKGGGNKDNDGDIVAEALMKRVMEHYEHYYRVKSHW  83

Query  768  aeEDVFVFFASPWMSRLEQSFLWLSGFKPSMLFWVVESS----MEG--------------  643
             E+D     +  W+S  E +FLWL G++P+M F ++ S     +EG              
Sbjct  84   VEKDALGILSPSWISSFEDAFLWLGGWRPTMAFHLLYSKSGLQLEGRLLDLIHGLSTGDL  143

Query  642  -ALSEEQRCKVGMLRAETARVENAISKAMASAQETVAAPPILGLLKRA-----EELVDGE  481
              LS  Q  K+  L+    + E  I++ MA  QET+A P ++ L   A     E    GE
Sbjct  144  ADLSSHQVVKIDTLQRGVVKQEKEITEKMAKYQETIADPSMVELSHMATKFKMETSGGGE  203

Query  480  VS---------ELDAVMGDLKQSMGRLMGNADALRGSTASKILEILNPKQAVKFLTAVMR  328
             +         EL   +   +  +  ++  AD LR  T  +I+ IL   Q V FL A   
Sbjct  204  QNNRDLSMVEEELKLALAGKEDGLKEVVKMADELRLGTLKQIIGILTSTQRVHFLIAAAE  263

Query  327  FQREARRWGLYNDSQR  280
                   WGL  DS +
Sbjct  264  LHLRIHEWGLKRDSDQ  279



>ref|XP_008443347.1| PREDICTED: uncharacterized protein LOC103486954 [Cucumis melo]
Length=291

 Score = 77.8 bits (190),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 53/182 (29%), Positives = 90/182 (49%), Gaps = 28/182 (15%)
 Frame = -1

Query  747  FFASPWMSRLEQSFLWLSGFKPS----MLFWVVESSME-----------------GALSE  631
             FA  W + LE+S LW++G +PS    + + +   S E                 G LS 
Sbjct  101  LFAPTWCTSLEKSLLWMAGCRPSIFIRLTYALTSCSTEPLTNDGDNKNSDSFIGIGELSP  160

Query  630  EQRCKVGMLRAETARVENAISKAMASAQETVAAPPILGLLKRA----EELVDGEVSELDA  463
             Q  +V  L   T + E  ++  +AS QE +A  PI  ++ +     E +++ E +E+  
Sbjct  161  SQMTRVNGLHMRTIKAEQKLTDELASWQEELADDPIAVIVAKGDCGDEVVMNNEEAEM--  218

Query  462  VMGDLKQSMGRLMGNADALRGSTASK-ILEILNPKQAVKFLTAVMRFQREARRWGLYNDS  286
             + + ++ MG ++G AD LR +T  + +LEIL P QA++FL A  + Q    +WG   D 
Sbjct  219  ALKEHEKVMGEVIGKADKLRLNTMKELVLEILKPTQALQFLVASKKLQLSLHQWGKRRDE  278

Query  285  QR  280
            ++
Sbjct  279  KQ  280



>gb|EPS63781.1| hypothetical protein M569_11002, partial [Genlisea aurea]
Length=357

 Score = 78.6 bits (192),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 54/164 (33%), Positives = 87/164 (53%), Gaps = 6/164 (4%)
 Frame = -1

Query  828  GLVGRVLAHYQeyyaektkaaeEDVFVFFASPWMSRLEQSFLWLSGFKPSMLFWVVESSM  649
            GL+ + + HY + +  K   A  DVF   +  W S  E+ F W+ GF+PS L  ++   +
Sbjct  179  GLISKGMRHYSDLFTMKASVARADVFYLMSGLWSSSAERFFFWIGGFRPSELLKLLGPHL  238

Query  648  EGALSEEQRCKVGMLRAETARVENAISKAMASAQETVAAPPILGLLKRAEELVDGEVSEL  469
            E  LSE+QR ++  LR    + E+A+S+ M    + VA       L   EE     + ++
Sbjct  239  E-PLSEQQRLEISNLRQSCQQAEDALSQGMEKLHQIVADTISGSCL--GEE--GNCLQQI  293

Query  468  DAVMGDLKQSMGRLMGNADALRGSTASKILEILNPKQAVKFLTA  337
            ++ +G+L +S+ R +G AD LR  T  +I  +L+P QA K L A
Sbjct  294  NSAVGNL-ESLVRFVGQADHLRHETLQQISRMLSPHQAAKGLLA  336



>ref|XP_008439732.1| PREDICTED: transcription factor TGA5 [Cucumis melo]
 ref|XP_008439733.1| PREDICTED: transcription factor TGA5 [Cucumis melo]
 ref|XP_008439734.1| PREDICTED: transcription factor TGA5 [Cucumis melo]
 ref|XP_008439735.1| PREDICTED: transcription factor TGA5 [Cucumis melo]
 ref|XP_008439736.1| PREDICTED: transcription factor TGA5 [Cucumis melo]
Length=263

 Score = 77.0 bits (188),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 60/204 (29%), Positives = 97/204 (48%), Gaps = 22/204 (11%)
 Frame = -1

Query  837  QCGGLVGRVLAHYQeyyaektkaaeEDVFVFFASPWMSRLEQSFLWLSGFKPSMLFWVVE  658
            Q   LV + +  +Q+Y   + + A+ DV +FFA  W S  E S LW++G +P++   +  
Sbjct  52   QLTQLVDKSIEEFQDYIDRRMQLAKNDVSLFFAPVWCSTREASLLWIAGCRPTIFIRLAY  111

Query  657  S------------------SME---GALSEEQRCKVGMLRAETARVENAISKAMASAQET  541
            S                  SME   G L+ +Q  ++  L+  T + E  ++  +A  QE 
Sbjct  112  SLTGYELETRMAQFLQGMKSMEDIAGELTPQQMEQLDSLQMRTIKEEERLTSELARVQEE  171

Query  540  VAAPPILGLLKRAEELVDGEVSELDAVMGDLKQSMGRLMGNADALRGSTASKILEILNPK  361
            +A   ++G+  R+ +   G + EL+  +      M RL+  AD LR  T +++ EIL P 
Sbjct  172  MADQTVVGIAMRSMKEQIG-IEELERALEKQDGEMVRLIQQADKLRIRTLNELTEILRPL  230

Query  360  QAVKFLTAVMRFQREARRWGLYND  289
            QAV FL    +     R WG  ND
Sbjct  231  QAVLFLAFSKKLHLSVREWGQRND  254



>ref|XP_002528014.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF34370.1| conserved hypothetical protein [Ricinus communis]
Length=271

 Score = 77.0 bits (188),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 69/247 (28%), Positives = 114/247 (46%), Gaps = 28/247 (11%)
 Frame = -1

Query  939  FTAFYHGWLMNQDAIFEQL-ESFLaaaaaaddDREQCGGLVGRVLAHYQeyyaektkaae  763
            F  F+  WL+ Q    ++L  +        +++ +    L+ RVL HY++YY+ K+K A+
Sbjct  22   FHDFFEWWLVEQKQELDELISASKQKLNNKNNNHDSLQPLINRVLEHYEQYYSAKSKWAK  81

Query  762  EDVFVFFASPWMSRLEQSFLWLSGFKPSMLFWV--------VESSME-----------GA  640
             DV   F+  W S LE +FLW+ G++PSM F +        +E+ +            G 
Sbjct  82   HDVLAMFSPSWTSPLEDAFLWIGGWRPSMAFHLLYSKSGLQLEAQLHDVIRGLCTGDLGD  141

Query  639  LSEEQRCKVGMLRAETARVENAISKAMASAQETVAAPPILGL------LKRAE-ELVDGE  481
            LS  Q  +V   +    R E  I++ MA  Q TVA   ++ L       +R E   +  E
Sbjct  142  LSPNQLVQVDEFQRRIIREEKNITENMAKHQATVADTSMVELTHAISKTRRDEGSSIGNE  201

Query  480  VSE-LDAVMGDLKQSMGRLMGNADALRGSTASKILEILNPKQAVKFLTAVMRFQREARRW  304
            V E +++ +    + + +++  AD LR  T   I++IL P Q V FL A           
Sbjct  202  VQERVESTLKTKLEGLEKVLQKADDLRLRTLKGIIDILTPDQTVHFLIAAAELHLRLHEL  261

Query  303  GLYNDSQ  283
            G   D++
Sbjct  262  GKKMDTK  268



>emb|CDX97614.1| BnaA05g24650D [Brassica napus]
Length=237

 Score = 76.6 bits (187),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 76/244 (31%), Positives = 111/244 (45%), Gaps = 36/244 (15%)
 Frame = -1

Query  945  EDFTAFYHGWLMNQDAIFEQLESFLaaaaaadd-DREQCGGLVGRVLAHYQeyyaektka  769
            E F  F H W+         L S       +   D E+    V RV+   +EY+  K   
Sbjct  8    ESFKKFQHTWIGQLQHHLNHLRSVQNHHRNSATGDEERLREAVQRVMELCREYHRAKLAT  67

Query  768  aeEDVFVFFASPWMSRLEQSFLWLSGFKPSMLFWVV--ESSM--------------EGAL  637
             E+DV    A+PW S LE+S  W+  ++P+ LF +V  ESS+               G L
Sbjct  68   TEKDVVGVMAAPWSSALERSLHWVGDWRPTTLFHLVYTESSILFESRIVDILRGFRTGDL  127

Query  636  SE---EQRCKVGMLRAETARVENAISKAMASAQETVAAPPILGLLKRAEELVDGEVSELD  466
            S+    Q  KV  L+ ET + ENAI++ ++  Q+             A ELV G VS LD
Sbjct  128  SDLSPSQFRKVSELQCETVKEENAITEELSEWQDD------------ASELVMGTVSNLD  175

Query  465  AVMGDLKQSMGRLMGNADALRGSTASKILEILNPKQAVKFLTAVMRFQREARRWGLYNDS  286
              +  L + + R    AD LR  T + ++E+L+P Q  +FL A    +R    WG  +D 
Sbjct  176  QRIRRLAEIVHR----ADDLRLRTITGVVELLSPLQQAEFLIAAAELRRGVSGWGSSHDR  231

Query  285  QREA  274
            +R A
Sbjct  232  RRSA  235



>ref|XP_003634664.1| PREDICTED: transcription factor HBP-1b(c38) [Vitis vinifera]
Length=231

 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 70/240 (29%), Positives = 108/240 (45%), Gaps = 38/240 (16%)
 Frame = -1

Query  939  FTAFYHGWLMNQDAIFEQLESFLaaaaaaddDREQCGGLVGRVLAHYQeyyaektkaaeE  760
            F +F   W  +   + +QL   LA  A A D       LV +V  HY +YY   +  A  
Sbjct  3    FESFNEAWFDHLHDLLQQLR--LAPKATAPDRDRALLDLVHKVRTHYSQYYRAMSYTARH  60

Query  759  DVFVFFASPWMSRLEQSFLWLSGFKPSMLFWVVESSME-------------------GAL  637
            DV   FA+PW S LE+S  W++G++P++ F ++ +                      G L
Sbjct  61   DVVSLFAAPWSSSLERSLHWVAGWRPTIAFHLIYTHSSILFETHIVDILRGAHNGDLGDL  120

Query  636  SEEQRCKVGMLRAETARVENAISKAMASAQETVAAPPILGLLKRAEELVDGEVSELDAVM  457
            S  Q  +V  L+ +T   EN I+  ++    +V+             LV      ++ V 
Sbjct  121  SPAQLQRVSELQCQTVGEENEITAELSECFNSVSG------------LVGAVFDPVENV-  167

Query  456  GDLKQSMGRLMGNADALRGSTASKILEILNPKQAVKFLTAVMRFQREARRWGLYNDSQRE  277
                + +  ++  A+ LR  T   ++EILNP+QAV+FL AVM  Q   R  GL +D  RE
Sbjct  168  ----ERLRNVVERAENLRFRTICSVVEILNPQQAVEFLVAVMELQFWVRGMGLCHDRVRE  223



>ref|XP_008442174.1| PREDICTED: transcription factor TGA2-like isoform X1 [Cucumis 
melo]
Length=281

 Score = 77.0 bits (188),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 74/257 (29%), Positives = 111/257 (43%), Gaps = 35/257 (14%)
 Frame = -1

Query  945  EDFTAFYHGWLMNQDAIFEQLESFLaaaaaaddDREQCG-GLVGRVLAHYQeyyaektka  769
            E F  F+  W+  Q+    +L S +      D+D +     L+ RV+ HY+ YY  K+  
Sbjct  24   ESFGEFFKKWMKEQNQYLTELISTVKGGGNKDNDGDIVAEALMKRVMEHYEHYYRVKSHW  83

Query  768  aeEDVFVFFASP-WMSRLEQSFLWLSGFKPSMLFWVVESS----MEG-------------  643
             E+D      SP W+S  E +FLWL G++P+M F ++ S     +EG             
Sbjct  84   VEKDALAGILSPSWISSFEDAFLWLGGWRPTMAFHLLYSKSGLQLEGRLLDLIHGLSTGD  143

Query  642  --ALSEEQRCKVGMLRAETARVENAISKAMASAQETVAAPPILGLLKRA-----EELVDG  484
               LS  Q  K+  L+    + E  I++ MA  QET+A P ++ L   A     E    G
Sbjct  144  LADLSSHQVVKIDTLQRGVVKQEKEITEKMAKYQETIADPSMVELSHMATKFKMETSGGG  203

Query  483  EVS---------ELDAVMGDLKQSMGRLMGNADALRGSTASKILEILNPKQAVKFLTAVM  331
            E +         EL   +   +  +  ++  AD LR  T  +I+ IL   Q V FL A  
Sbjct  204  EQNNRDLSMVEEELKLALAGKEDGLKEVVKMADELRLGTLKQIIGILTSTQRVHFLIAAA  263

Query  330  RFQREARRWGLYNDSQR  280
                    WGL  DS +
Sbjct  264  ELHLRIHEWGLKRDSDQ  280



>ref|NP_001237999.1| bZIP transcription factor bZIP132 [Glycine max]
 gb|ABI34670.1| bZIP transcription factor bZIP132 [Glycine max]
Length=225

 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 68/242 (28%), Positives = 112/242 (46%), Gaps = 53/242 (22%)
 Frame = -1

Query  939  FTAFYHGWLMNQDAIFEQLESFLaaaaaaddDREQCGGLVGRVLAHYQeyyaektkaaeE  760
            F  FY  W       FE+L+S +          E    ++ +V+ H+Q YY  K+ AAE+
Sbjct  13   FADFYEQW-------FEELQSLMQQLRGEGRKEE----VMEKVMWHHQNYYVAKSAAAEK  61

Query  759  DVFVFFASPWMSRLEQSFLWLSGFKPSMLFWVV--ESSME-----------------GAL  637
            D    F SPW + LE+S  W++G++P+  F ++  ESS+                  G L
Sbjct  62   DPLNVFLSPWATTLERSLHWITGWRPTTAFHLIYTESSLMFESHIIDILQGLRTGDLGDL  121

Query  636  SEEQRCKVGMLRAETARVENAISKAMASAQETVAAPPILGLLKRAEELVDGEVSELDAVM  457
            S  Q  +V  ++ +T + ENAI++ ++  Q++                    VSE+    
Sbjct  122  SPSQFRRVSDIQCDTVKEENAITEELSEWQDS--------------------VSEMMGPG  161

Query  456  GDLKQSMGRL---MGNADALRGSTASKILEILNPKQAVKFLTAVMRFQREARRWGLYNDS  286
             ++   +GRL   +  AD LR  T   ++ +L+P+QA++FL A        R WGL +D 
Sbjct  162  ANINDKIGRLVCIIKKADDLRLRTLRSVVGLLSPQQAIEFLIASAELLVGIRGWGLNHDR  221

Query  285  QR  280
             R
Sbjct  222  PR  223



>ref|XP_010089698.1| hypothetical protein L484_006320 [Morus notabilis]
 gb|EXB38221.1| hypothetical protein L484_006320 [Morus notabilis]
Length=249

 Score = 76.3 bits (186),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 57/202 (28%), Positives = 97/202 (48%), Gaps = 22/202 (11%)
 Frame = -1

Query  825  LVGRVLAHYQeyyaektkaaeEDVFVFFASPWMSRLEQSFLWLSGFKPS----MLFWVVE  658
            L  + + H++ Y ++++  +  DV  FF+  W +  E S  W++G +PS    +++ +  
Sbjct  44   LAQKAIEHFESYISQRSSLSRNDVASFFSPSWCTPWENSLFWIAGCRPSAFIRLIYALDG  103

Query  657  SSMEGALSEEQRCK---------------VGMLRAETARVENAISKAMASAQETVAAPPI  523
            + +E  LSE  R K               V  L+  T R E  ++  +A  QE VA  PI
Sbjct  104  ADIESKLSEILRGKTVGDIGDLSARQMRAVDELQRRTIREEERLTARLAGLQEDVADQPI  163

Query  522  LGLLKRAEELVDGEVS-ELDAVMGDLKQSMGRLMGNADALRGSTASKILEILNPKQAVKF  346
              + K  + +  GE+S E++ V+ + +QSM  ++  AD LR +T  +IL IL P Q V+F
Sbjct  164  SAIAKGVDRI--GEMSGEIEKVLNEHEQSMAEVLEEADKLRLNTLKEILGILRPVQGVEF  221

Query  345  LTAVMRFQREARRWGLYNDSQR  280
            L    +       W    D  +
Sbjct  222  LAMSKKLHLCVHEWSKKRDQNK  243



>ref|XP_010449481.1| PREDICTED: uncharacterized protein LOC104731707 [Camelina sativa]
Length=282

 Score = 76.6 bits (187),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 69/242 (29%), Positives = 103/242 (43%), Gaps = 28/242 (12%)
 Frame = -1

Query  927  YHGWLMNQDAIFEQLESFLaaaaaaddDREQCGGLVGRVLAHYQeyyaektkaaeEDVFV  748
            Y+ W+  Q      L+  L     A  D  + G LVG++L  ++ Y  ++++ +      
Sbjct  18   YYQWMGLQAKHIVDLKEALINHHRASGDDHKLGELVGQILNDFKRYAEKRSELSGRSCSS  77

Query  747  FFASPWMSRLEQSFLWLSGFKPSMLFWV-----------------------VESSMEGAL  637
            + +  W S LE   LW+ G +PS    V                       VE +  G +
Sbjct  78   YLSPSWNSSLENGLLWMGGCRPSSFIRVIYALCGSQAETQLSQYLLKIDESVEVNHSGFM  137

Query  636  SE---EQRCKVGMLRAETARVENAISKAMASAQETVAAPPILGLLKRAEELVDGEVSELD  466
            S+    Q  K+  L  +    E+ I+K  A+ QE VA  PI  +     +LVDG V   D
Sbjct  138  SDLTATQLAKINELHMKVIEKEDKITKKSANLQENVADMPI-AIAAYTMDLVDGNVVVKD  196

Query  465  AVMGDLKQSMGRLMGNADALRGSTASKILEILNPKQAVKFLTAVMRFQREARRWGLYNDS  286
            A +   ++ M  LM  AD LR  T  KI+EI+ P QA +FL A  R       WG   + 
Sbjct  197  A-LDKHEEDMAALMAEADKLRFETLRKIVEIVTPVQAAEFLLAGKRLHVSLHEWGRVREE  255

Query  285  QR  280
             R
Sbjct  256  GR  257



>ref|XP_009350852.1| PREDICTED: transcription factor TGA6 [Pyrus x bretschneideri]
Length=237

 Score = 76.3 bits (186),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 54/164 (33%), Positives = 87/164 (53%), Gaps = 8/164 (5%)
 Frame = -1

Query  759  DVFVFFASPWMSRLEQSFLWLSGFKPSMLFWVVESSMEG---ALSEEQRCKVGMLRAETA  589
            DV  FF   W S LE ++ W++G+KPSMLF ++ES  +    ++SEEQ  KV  LR +  
Sbjct  66   DVLAFFCPVWSSPLENAYSWVTGWKPSMLFQLIESLKKTRLVSMSEEQVRKVEQLRQKMK  125

Query  588  RVENAISKAMASAQETVAAPPILGLLKRAEELVDGE-VSELDAVMGDLKQSM----GRLM  424
              E+ + + M   Q  +A   ++ L + A    +GE  +EL+ ++    + M      +M
Sbjct  126  YEEDKVEREMERQQVAMADRRMVELARLATRARNGEAAAELEGLVNVAVKVMLSGLEGVM  185

Query  423  GNADALRGSTASKILEILNPKQAVKFLTAVMRFQREARRWGLYN  292
              AD +R  T   +L++L+P Q+V+FL A    Q +   WG  N
Sbjct  186  KAADCVRLKTLKGLLDLLSPLQSVEFLAATCMVQIKLGEWGRRN  229



>ref|XP_002534284.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF28101.1| conserved hypothetical protein [Ricinus communis]
Length=253

 Score = 76.3 bits (186),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 65/237 (27%), Positives = 112/237 (47%), Gaps = 20/237 (8%)
 Frame = -1

Query  951  VGEDFTAFYHGWLMNQDAIFEQLESFLaaaaaaddDREQCG----GLVGRVLAHYQeyya  784
            V + F+ F   W+   D    QL   +++    +     C      +V +V  HY+EYY 
Sbjct  7    VEDRFSEFLEKWMRLLDGYLLQLRKVVSSKDRLNKHGTYCDEKLQAIVSKVAQHYKEYYI  66

Query  783  ektkaaeEDVFVFFASPWMSRLEQSFLWLSGFKPSMLFWVVE-----------SSMEGAL  637
             K   A EDV  FF+  W+S LE +  W++ +KPS++F +V+           SS    L
Sbjct  67   IKWALAHEDVLAFFSPTWISPLETASSWITDWKPSVVFKLVDSLRTNHRVPGPSSTLAEL  126

Query  636  SEEQRCKVGMLRAETARVENAISKAMASAQETVAAPPILGLLKRAEELV-DGEVSELD--  466
            ++EQ  K+  L+ +    E  + + M   Q  +A   ++ L +    +  DG+VS+++  
Sbjct  127  TQEQVRKIEELKLKIRLEEQKVEREMERQQVAIADRKMVELARWVYRVKNDGKVSQVEGL  186

Query  465  --AVMGDLKQSMGRLMGNADALRGSTASKILEILNPKQAVKFLTAVMRFQREARRWG  301
              A +      + ++M  AD +R      IL++L+P Q V+FL A      + R+WG
Sbjct  187  VQAALNGALAGLEKVMKAADCVRLRALKGILDVLSPFQCVEFLAATAMLHIQLRQWG  243



>ref|XP_006449514.1| hypothetical protein CICLE_v10017869mg [Citrus clementina]
 gb|ESR62754.1| hypothetical protein CICLE_v10017869mg [Citrus clementina]
Length=239

 Score = 75.9 bits (185),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 70/226 (31%), Positives = 117/226 (52%), Gaps = 16/226 (7%)
 Frame = -1

Query  951  VGEDFTAFYHGWLMNQDAIFEQLESFLaaaaaaddDREQCGGLVGRVLAHYQeyyaektk  772
            V E F  F+  W+   D   +QL   +  +  +  + EQ   LV ++ +HY+EYY  K  
Sbjct  5    VEEKFAEFFEKWVCQLDDYSQQL---IRISKESSSEAEQ-QALVSKLTSHYKEYYTVKWA  60

Query  771  aaeEDVFVFFASPWMSRLEQSFLWLSGFKPSMLFWVVES----SMEGA-----LSEEQRC  619
             A EDV VF+   W+S  E +  W++G+KPS++F +V+S     + GA     L+E+Q  
Sbjct  61   LAHEDVLVFYCPVWVSTFEMACSWVTGWKPSIIFRLVDSLRKTMVPGAGSLAELTEQQLR  120

Query  618  KVGMLRAETARVENAISKAMASAQETVAAPPILGLLKRAEELVDGEVSEL-DAVMGDLKQ  442
            K+  LR +    E  + + M   Q  +A   ++ L +    L +GEV  L +  +  L  
Sbjct  121  KIEELRLKIRLEEEKVEREMERQQVALADRKMVELARLTSRLSNGEVDGLVEVALKGLLS  180

Query  441  SMGRLMGNADALRGSTASKILEILNPKQAVKFL--TAVMRFQREAR  310
             + ++M  AD +R  T   IL++L+ KQ+V FL  T++++ Q   R
Sbjct  181  GLEKVMKAADCVRLKTLKGILDVLSTKQSVDFLAGTSILQTQMSIR  226



>gb|EYU23363.1| hypothetical protein MIMGU_mgv1a023034mg [Erythranthe guttata]
Length=292

 Score = 76.6 bits (187),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 65/252 (26%), Positives = 111/252 (44%), Gaps = 32/252 (13%)
 Frame = -1

Query  939  FTAFYHGWLMNQDAIFEQLES-------FLaaaaaaddDREQCGGLVGRVLAHYQeyyae  781
            F  F+  W++ Q+   ++L S            A     R     +V +V+ HY+ YY  
Sbjct  25   FHMFFDSWIVEQNHHLQKLVSASKEWGGGGGGVAFDVSGRSVLIPVVEQVVHHYEHYYKT  84

Query  780  ktkaaeEDVFVFFASPWMSRLEQSFLWLSGFKPSMLFWV--------VESSME-------  646
            K+  A++D+   F+  W   LE++F+W+ G++P+    +        +E++ E       
Sbjct  85   KSMWAKKDILSMFSPTWTHSLEKAFMWVGGWRPATAIHLLYSKCGLQLEAAFEGDYLPRG  144

Query  645  ------GALSEEQRCKVGMLRAETARVENAISKAMASAQETVAAPPILG----LLKRAEE  496
                  G LS  Q  +V  L   T   E  I++ +A  QET+A   ++G    L+ R EE
Sbjct  145  LNTGDLGDLSHSQMVRVDELHKSTLWEEKMITEKLAKQQETIADSSMVGLTTELMIRVEE  204

Query  495  LVDGEVSELDAVMGDLKQSMGRLMGNADALRGSTASKILEILNPKQAVKFLTAVMRFQRE  316
                +   +DA +   ++ +  ++  AD LR  T   ++ IL P Q V FL A      +
Sbjct  205  HDHDQQVVVDAALASKEKGLVVILQMADDLRLKTLKGLILILTPIQGVHFLIAAAELHLK  264

Query  315  ARRWGLYNDSQR  280
               WG   D+ R
Sbjct  265  IHEWGKNRDASR  276



>ref|XP_009789761.1| PREDICTED: transcription factor TGA2-like [Nicotiana sylvestris]
Length=234

 Score = 75.9 bits (185),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 59/204 (29%), Positives = 96/204 (47%), Gaps = 42/204 (21%)
 Frame = -1

Query  825  LVGRVLAHYQeyyaektkaaeEDVFVFFASPWMSRLEQSFLWLSGFKPSMLFWVVESSME  646
            LV +  +HY EYY  K+ AA+ D+   F++PW + LE+S  W++G++P+  F ++ +   
Sbjct  48   LVQKFTSHYYEYYRVKSMAAKNDILHIFSAPWSNSLERSLYWIAGWRPTTAFHIIYTKSS  107

Query  645  -------------------GALSEEQRCKVGMLRAETARVENAISKAMASAQETVAAPPI  523
                               G LS  Q  ++   + ET + ENAI++ ++  Q++  A  I
Sbjct  108  ILFESPIVDILRGFGNGDLGDLSPNQLSRLSEFQYETVQQENAITEQLSDWQDSGNA--I  165

Query  522  LGLLKRAEELVDGEVSELDAVMGDLKQSMGRL---MGNADALRGSTASKILEILNPKQAV  352
            +G                   MGD+   MGRL   +  AD LR  T   +L++L  +QA 
Sbjct  166  IG------------------TMGDVDGKMGRLVEILEKADQLRMKTIENLLQLLTAQQAA  207

Query  351  KFLTAVMRFQREARRWGLYNDSQR  280
            +FL          R WG+ +D QR
Sbjct  208  EFLILAAHLLFGIRGWGVNHDRQR  231



>gb|ACV41800.1| delay of germination 1 [Lepidium sativum]
 gb|ACV41801.1| delay of germination 1 A [Lepidium sativum]
Length=279

 Score = 75.9 bits (185),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 57/183 (31%), Positives = 84/183 (46%), Gaps = 28/183 (15%)
 Frame = -1

Query  747  FFASPWMSRLEQSFLWLSGFKPSMLFWVV----------------------ESS--MEGA  640
            ++A  W + LE + LW+ G +PS  F +V                      ESS  M  +
Sbjct  79   YYAPSWNTPLENALLWMGGCRPSSFFRLVYALCGSETEIRVTQYLRDIDGLESSGGMGTS  138

Query  639  LSE---EQRCKVGMLRAETARVENAISKAMASAQETVAAPPILGLLKRAEELVDGEVSEL  469
            LS+   EQ  K+ +L  +    E  ++K +AS QE  A  PI   +   EE V      +
Sbjct  139  LSDLTAEQLAKINILHVKIIEDEEKMTKKVASLQEDAADIPI-ATVAYEEEHVGKPNMVV  197

Query  468  DAVMGDLKQSMGRLMGNADALRGSTASKILEILNPKQAVKFLTAVMRFQREARRWGLYND  289
            D  +   ++SM +L+G AD LR  T  KI+EIL+P +A  FL A  +       WG   D
Sbjct  198  DQALDKQEESMAKLLGEADNLRVETLVKIVEILSPVEAANFLLAGKKLHLSMHEWGTMRD  257

Query  288  SQR  280
             +R
Sbjct  258  RRR  260



>gb|AGG09198.1| delay of germination 1a [Lepidium papillosum]
Length=279

 Score = 75.9 bits (185),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 57/183 (31%), Positives = 84/183 (46%), Gaps = 28/183 (15%)
 Frame = -1

Query  747  FFASPWMSRLEQSFLWLSGFKPSMLFWVV----------------------ESS--MEGA  640
            ++A  W + LE + LW+ G +PS  F +V                      ESS  M  +
Sbjct  79   YYAPSWNTPLENALLWMGGCRPSSFFRLVYALCGSETEIRVTQYLRDIDGLESSGGMGTS  138

Query  639  LSE---EQRCKVGMLRAETARVENAISKAMASAQETVAAPPILGLLKRAEELVDGEVSEL  469
            LS+   EQ  K+ +L  +    E  ++K +AS QE  A  PI   +   EE V      +
Sbjct  139  LSDLTAEQLAKINILHVKIIEDEEKMTKKVASLQEDAADIPI-ATVAYEEEHVGKPNMVV  197

Query  468  DAVMGDLKQSMGRLMGNADALRGSTASKILEILNPKQAVKFLTAVMRFQREARRWGLYND  289
            D  +   ++SM +L+G AD LR  T  KI+EIL+P +A  FL A  +       WG   D
Sbjct  198  DQALDKQEESMAKLLGEADNLRVETLVKIVEILSPVEAANFLLAGKKLHLSMHEWGTMRD  257

Query  288  SQR  280
             +R
Sbjct  258  RRR  260



>ref|XP_009607760.1| PREDICTED: transcription factor TGA6-like [Nicotiana tomentosiformis]
Length=255

 Score = 75.5 bits (184),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 63/229 (28%), Positives = 97/229 (42%), Gaps = 27/229 (12%)
 Frame = -1

Query  930  FYHGWLMNQDAIFEQLESFLaaaaaaddDREQCGGLVGRVLAHYQeyyaektkaaeEDVF  751
             Y  W+ NQ+    +LE+    A     +  +   L+ R++ ++Q Y   +++ A  DV 
Sbjct  26   LYQSWMYNQNQELNELENAATLARENQKNDTELNQLLARMVNNFQGYVNGRSRLARVDVS  85

Query  750  VFFASPWMSRLEQSFLWLSGFKPSMLFWV--------VESSME-----------GALSEE  628
             +FA  W + LE S LW+ G +PS    +        +ES +            G LS E
Sbjct  86   PYFAPTWCTPLENSVLWIGGCRPSSFIRLIYALCGMEIESHLNEFLQGTKIGDFGQLSGE  145

Query  627  QRCKVGMLRAETARVENAISKAMASAQETVAAPPILGLLKRAEELVDGEVSELDAVMGDL  448
            Q   +  L+ +    E      +AS QE V   PI    K  E          +  +   
Sbjct  146  QVTMIDKLQRKIIVEERKHCSKLASLQEDVVDQPIATAAKNRE--------NEEEPLNKH  197

Query  447  KQSMGRLMGNADALRGSTASKILEILNPKQAVKFLTAVMRFQREARRWG  301
             Q M  L+  AD LR +   +IL IL P Q V++L A  R +   +RWG
Sbjct  198  GQGMTTLLEEADELRMNALKEILGILTPIQGVEYLAAAKRIRLCLQRWG  246



>gb|EPS72055.1| hypothetical protein M569_02704, partial [Genlisea aurea]
Length=158

 Score = 73.9 bits (180),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 41/146 (28%), Positives = 79/146 (54%), Gaps = 8/146 (5%)
 Frame = -1

Query  747  FFASPWMSRLEQSFLWLSGFKPSMLFWVVESSMEGALSEEQRCKVGMLRAETARVENAIS  568
            F+++PW++ LEQ +LW +G++P++ F V+ES     ++EEQR K+  LR  T   E  + 
Sbjct  1    FYSAPWLTPLEQCYLWHTGYRPTISFNVLESLPPAGITEEQRRKIEALRERTRMDEAKVD  60

Query  567  KAMASAQETVAAPPILGLLKRAEELVDGE--------VSELDAVMGDLKQSMGRLMGNAD  412
              M   Q  VA+  ++ ++    + +  +         + + A +  +   + ++M +AD
Sbjct  61   TEMERHQVEVASRRVVDVVATERKALRSQDPTAMAEAAAMVRATVNGMVAGVEKVMRSAD  120

Query  411  ALRGSTASKILEILNPKQAVKFLTAV  334
              R      IL++LNP Q ++FLT++
Sbjct  121  CARLRCLKGILDVLNPDQRLRFLTSM  146



>ref|XP_006432080.1| hypothetical protein CICLE_v10002078mg [Citrus clementina]
 ref|XP_006464938.1| PREDICTED: transcription factor TGA2-like [Citrus sinensis]
 gb|ESR45320.1| hypothetical protein CICLE_v10002078mg [Citrus clementina]
 gb|KDO52212.1| hypothetical protein CISIN_1g023115mg [Citrus sinensis]
Length=287

 Score = 75.9 bits (185),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 71/255 (28%), Positives = 114/255 (45%), Gaps = 35/255 (14%)
 Frame = -1

Query  948  GEDFTAFYHGWLMNQDAIFEQLESFLaaaaaaddDREQCG--GLVGRVLAHYQeyyaekt  775
            GE F  F+  WL+ Q+   + L++ ++A+   +++         V  V+ HY++YY  K+
Sbjct  28   GESFQKFFESWLVEQN---QHLQALISASKQQENNSSSSNFEEQVRVVVEHYEQYYRAKS  84

Query  774  kaaeEDVFVFFASPWMSRLEQSFLWLSGFKPSMLFWVVESS----MEGA-----------  640
            +  + DV       W S LE SFLW+ G++PSM F ++ S     +EG            
Sbjct  85   RWVKLDVLGMLTPSWRSSLEDSFLWIGGWRPSMAFHLLYSKSGLQLEGKLHDLIRGLSSG  144

Query  639  ----LSEEQRCKVGMLRAETARVENAISKAMASAQETVAAPPILGLLKRAEELVDGEVSE  472
                LS  Q  +V  L+    + E  +S+ +A  QETVA   ++ L     EL+      
Sbjct  145  DLGDLSPTQLTRVDGLQRVIIKEEKDLSEKLAKYQETVADSSLVELSHVVTELMSTNDDR  204

Query  471  LDA---VMGDLKQS--------MGRLMGNADALRGSTASKILEILNPKQAVKFLTAVMRF  325
             D+   +M D  +S        +  +   AD LR  T   +++IL P QAV FL A    
Sbjct  205  QDSDRRLMDDQIESNFVTKEAKLEEIFHKADDLRLKTFKAVIDILTPIQAVHFLIAAAEL  264

Query  324  QREARRWGLYNDSQR  280
                  WG   D++ 
Sbjct  265  HLRLHDWGKQRDARH  279



>ref|XP_007048544.1| TGACG-sequence-specific DNA-binding protein TGA-2.1, putative 
[Theobroma cacao]
 gb|EOX92701.1| TGACG-sequence-specific DNA-binding protein TGA-2.1, putative 
[Theobroma cacao]
Length=245

 Score = 75.1 bits (183),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 67/233 (29%), Positives = 109/233 (47%), Gaps = 34/233 (15%)
 Frame = -1

Query  945  EDFTAFYHGWLMNQDAIFEQLESFLaaaaaaddDREQCGGLVGRVLAHYQeyyaektkaa  766
            E F  F+  WL+ Q+   ++L +      +  DD   C  L+ RVL +Y+ YY  K +  
Sbjct  13   ETFQNFFECWLVEQNQHLQELIAASQQHHSTADDDSLCS-LIKRVLENYEHYYKAKARWG  71

Query  765  eEDVFVFFASPWMSRLEQSFLWLSGFKPSMLFWVV--ESSME-----------------G  643
            +EDV    +  W S  + +FLW+ G++P M F ++  +S ++                 G
Sbjct  72   KEDVLAMLSPAWTSTFKDAFLWIGGWRPIMAFHLLYFKSGLQLEDQLNELIRGMGRGDLG  131

Query  642  ALSEEQRCKVGMLRAETARVENAISKAMASAQETVAAPPILGLLKRAEELVDGEVSEL--  469
             LS  Q  ++  L+A+T + E  +++ MA  QETVA   +L L      LV G   E   
Sbjct  132  DLSPCQLSRIDELQAKTIKEEKEVTEKMAKHQETVADSSMLEL----NHLVSGNDEERGW  187

Query  468  --------DAVMGDLKQSMGRLMGNADALRGSTASKILEILNPKQAVKFLTAV  334
                    ++ M   ++ +  ++  AD LR  T   +++IL P QAV FL A 
Sbjct  188  GRCGSGEGESAMECKEEGLKEMLQRADDLRLRTLKAVIDILTPIQAVHFLIAA  240



>gb|EPS65159.1| hypothetical protein M569_09619, partial [Genlisea aurea]
Length=358

 Score = 76.6 bits (187),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 63/209 (30%), Positives = 95/209 (45%), Gaps = 14/209 (7%)
 Frame = -1

Query  939  FTAFYHGWLMNQDAIFEQLESFLaaaaaaddDREQCGGLVGRVLAHYQeyyaektkaaeE  760
            F   Y  W   QD   + L+  L + A       +   LV R + HY   ++ K   A+ 
Sbjct  145  FENEYRNWAEAQDRHVDDLKRALESNAGDS----ELDALVERGMKHYSHLFSMKASVAKA  200

Query  759  DVFVFFASPWMSRLEQSFLWLSGFKPSMLFWVVESSMEGALSEEQRCKVGMLRAETARVE  580
            DV    +  W S  E+ F W+ GF+PS L  V+   +E  LSE+QR  V  LR    + E
Sbjct  201  DVLYVMSGLWRSSAERFFFWMGGFRPSELIKVLAVHLE-PLSEQQRLDVSNLRQSCQQAE  259

Query  579  NAISKAMASAQETVAAPPILGLLKRAEELVDG--EVSELDAVMGDLKQSMGRLMGNADAL  406
            +A+S  +    + +A   + G       L DG   + E+ A  G +  S+ R  G AD L
Sbjct  260  DALSHGIEKLHQIIADMIVGG------RLGDGNCHLPEISAAAGKID-SLVRFAGQADHL  312

Query  405  RGSTASKILEILNPKQAVKFLTAVMRFQR  319
            R  T  ++  IL+P+QA     A+  + R
Sbjct  313  RQETLQQVTRILSPRQAATCFLAMSDYFR  341



>ref|XP_009629955.1| PREDICTED: transcription factor TGA1-like [Nicotiana tomentosiformis]
Length=227

 Score = 74.7 bits (182),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 68/242 (28%), Positives = 110/242 (45%), Gaps = 43/242 (18%)
 Frame = -1

Query  939  FTAFYHGWLMNQDAIFEQLESFLaaaaaaddDREQCGGLVGRVLAHYQeyyaektkaaeE  760
            F  F+  W      I +QL+      A   +  E    L+ +  +HY EYY  K+ AA+ 
Sbjct  4    FHQFHEAWHEQLREIAQQLKKS-PRPATNQEQHELHTQLIQKFTSHYYEYYRVKSMAAKN  62

Query  759  DVFVFFASPWMSRLEQSFLWLSGFKPSMLFWV--VESS----------MEG-------AL  637
            D+   F +PW + LE+S  W++G++P+  F +   ESS          + G        L
Sbjct  63   DILHIFTAPWSNSLERSLYWIAGWRPTTAFHIFYTESSILFESQIVDILRGFRNGDLVDL  122

Query  636  SEEQRCKVGMLRAETARVENAISKAMASAQETVAAPPILGLLKRAEELVDGEVSELDAVM  457
            S  Q  +   L+ ET + ENAI++ ++  Q++                     +++   M
Sbjct  123  SPNQLSRFSELQYETVQQENAITEQLSDWQDSA--------------------NDMIGTM  162

Query  456  GDLKQSMGRL---MGNADALRGSTASKILEILNPKQAVKFLTAVMRFQREARRWGLYNDS  286
            GD+ + M RL   +  AD LR  T   +L++L  +QAV+FL A        R WG+ +D 
Sbjct  163  GDVDRKMERLVEILEKADQLRMKTIENLLQLLTAQQAVEFLIAAAHLLFGIRGWGVNHDR  222

Query  285  QR  280
            QR
Sbjct  223  QR  224



>ref|XP_006414069.1| hypothetical protein EUTSA_v10025925mg [Eutrema salsugineum]
 gb|ESQ55522.1| hypothetical protein EUTSA_v10025925mg [Eutrema salsugineum]
Length=284

 Score = 75.5 bits (184),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 61/212 (29%), Positives = 97/212 (46%), Gaps = 30/212 (14%)
 Frame = -1

Query  831  GGLVGRVLAHYQeyyaektkaaeEDVFVFFASPWMSRLEQSFLWLSGFKPSMLFWVV---  661
            G LVG ++  +Q+Y   +++ + +    +FA  W S LE   LW+ G +PS    V+   
Sbjct  50   GELVGEIVDDFQKYTKRRSELSHQSCSSYFAPSWNSSLENGLLWMGGSRPSSFIRVIYAM  109

Query  660  ----------------------ESSMEGALSE---EQRCKVGMLRAETARVENAISKAMA  556
                                  E+  +G++S+    Q  ++  L  +  + E+ ISK  A
Sbjct  110  CGSQTETQLSQYLFIKIDENIHENHGDGSMSQLTSTQLWQINELHMKVIKEEDKISKKAA  169

Query  555  SAQETVAAPPILGLLKRAEELVDGEVSELDAVMGDLKQSMGRLMGNADALRGSTASKILE  376
            S QE  A  PI  +   A +LV+  V+  DA +   ++ M  LM  AD LR  T  KI+E
Sbjct  170  SLQEDAADMPI-AVTAYATDLVEAGVAVEDA-LDKHEECMAVLMVEADKLRFETLRKIVE  227

Query  375  ILNPKQAVKFLTAVMRFQREARRWGLYNDSQR  280
            ++ P QA +FL A  R       WG   + +R
Sbjct  228  VVTPVQAAEFLLAKKRLYVSLHEWGRVREERR  259



>ref|XP_010439824.1| PREDICTED: uncharacterized protein LOC104723191 [Camelina sativa]
Length=279

 Score = 75.1 bits (183),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 68/242 (28%), Positives = 104/242 (43%), Gaps = 28/242 (12%)
 Frame = -1

Query  927  YHGWLMNQDAIFEQLESFLaaaaaaddDREQCGGLVGRVLAHYQeyyaektkaaeEDVFV  748
            Y+ W+  Q      L+  L     A DD  + G LVG++L  +++Y  ++++ +      
Sbjct  18   YYEWMGLQAKHIVDLKEALINHHRASDDDHKLGELVGQILNDFEKYAEKRSELSHRSCSS  77

Query  747  FFASPWMSRLEQSFLWLSGFKPSMLFWV-----------------------VESSMEGAL  637
            + +  W S LE   LW+ G +PS    V                       VE +  G +
Sbjct  78   YLSPSWNSSLENGLLWMGGCRPSSFIRVIYALCGSQAETQLSQYLLKIDESVEVNHSGFM  137

Query  636  SE---EQRCKVGMLRAETARVENAISKAMASAQETVAAPPILGLLKRAEELVDGEVSELD  466
            S+    Q  K+  L  E    E+ I+K  A+ QE VA  PI  +     +LVDG V   D
Sbjct  138  SDLTATQLAKINELHMEVIEKEDKITKKSANLQENVADMPI-AIAAYTMDLVDGNVVVKD  196

Query  465  AVMGDLKQSMGRLMGNADALRGSTASKILEILNPKQAVKFLTAVMRFQREARRWGLYNDS  286
            A +   ++ M  L+   D LR  T  KI+E++ P QA +FL A  R       WG   + 
Sbjct  197  A-LDKHEEDMAALVTEGDKLRFETLRKIVEVVTPVQAAEFLLAGKRLHVSLHEWGRVREE  255

Query  285  QR  280
             R
Sbjct  256  GR  257



>emb|CDY70293.1| BnaCnng67640D [Brassica napus]
Length=248

 Score = 74.7 bits (182),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 60/211 (28%), Positives = 97/211 (46%), Gaps = 32/211 (15%)
 Frame = -1

Query  825  LVGRVLAHYQeyyaektkaaeEDVFVFFASPWMSRLEQSFLWLSGFKPSMLFWVV-----  661
            LVGR++  +Q+Y  ++++ A+     +FA  W S LE   LW+ G +PS    ++     
Sbjct  16   LVGRIVNDFQKYADKRSELADRSCSCYFAPSWNSSLENGLLWMGGCRPSSFMRIIYALCG  75

Query  660  ------------------------ESSMEGALSEEQRCKVGMLRAETARVENAISKAMAS  553
                                    +SSM   L+  Q  K+  L  E    E+ +SK  A+
Sbjct  76   SHAETQLSQYLLKMDGEVVDGHDGDSSM-SELNATQLAKINDLHVEVIAKEDKLSKLSAN  134

Query  552  AQETVAAPPILGLLKRAEELVDGEVSELDAVMGDLKQSMGRLMGNADALRGSTASKILEI  373
             QE VA  PI  +   + + V+ +V+  DA +   ++ M  L+ +AD LR  T  KI+E+
Sbjct  135  MQEDVADMPI-AVTAFSSDSVEADVAVEDA-LDKHEEGMAVLIADADKLRLETLKKIVEV  192

Query  372  LNPKQAVKFLTAVMRFQREARRWGLYNDSQR  280
            L P QA +FL +  R       WG   + +R
Sbjct  193  LTPVQAAEFLLSGKRLHVSLHEWGRVREERR  223



>ref|XP_010313918.1| PREDICTED: transcription factor TGA5-like [Solanum lycopersicum]
Length=232

 Score = 74.7 bits (182),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 59/239 (25%), Positives = 116/239 (49%), Gaps = 40/239 (17%)
 Frame = -1

Query  939  FTAFYHGWLMNQDAIFEQLESFLaaaaaaddDREQCGGLVGRVLAHYQeyyaektkaaeE  760
            F  F+  W  +   + +Q+ S L      + D +    L+ +V++H  EYY  K+ AA+ 
Sbjct  4    FQKFHEEWHGHLRELVQQM-SKLPKFCTTNQDEQNTKLLIQKVISHINEYYRVKSLAAKN  62

Query  759  DVFVFFASPWMSRLEQSFLWLSGFKPSMLFWVV--------ESSMEGA-----------L  637
            D+   F++PW + LE+S  W++G++P+  F ++        ES +              L
Sbjct  63   DILYIFSAPWSNSLERSLYWIAGWRPTTAFHIIYSECGIQLESHITNILNGFRNGDLADL  122

Query  636  SEEQRCKVGMLRAETARVENAISKAMASAQETVAAPPILGLLKRAEELVDGEVSELDAVM  457
            S +Q  +   L+ ET + EN I++ +++ Q++V             ++++    +++ ++
Sbjct  123  SPDQLTRFSELQCETIQQENNITEQLSNWQDSV------------NDIIENIDKKMETLL  170

Query  456  GDLKQSMGRLMGNADALRGSTASKILEILNPKQAVKFLTAVMRFQREARRWGLYNDSQR  280
            G LK+        AD +R +T   ++ +L P+Q ++F  A      E R WG+  D+QR
Sbjct  171  GILKR--------ADEVRLNTLHNLVHLLTPQQLLEFFIAASNLLFEIRSWGINYDNQR  221



>ref|XP_009136952.1| PREDICTED: uncharacterized protein LOC103861007 [Brassica rapa]
Length=287

 Score = 75.1 bits (183),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 60/211 (28%), Positives = 97/211 (46%), Gaps = 32/211 (15%)
 Frame = -1

Query  825  LVGRVLAHYQeyyaektkaaeEDVFVFFASPWMSRLEQSFLWLSGFKPSMLFWVV-----  661
            LVGR++  +Q+Y  ++++ A+     +FA  W S LE   LW+ G +PS    ++     
Sbjct  55   LVGRIVNDFQKYADKRSELADRSCSCYFAPSWNSSLENGLLWMGGCRPSSFMRIIYALCG  114

Query  660  ------------------------ESSMEGALSEEQRCKVGMLRAETARVENAISKAMAS  553
                                    +SSM   L+  Q  K+  L  E    E+ +SK  A+
Sbjct  115  SHAETQLSQYLLKMDGEVVDGHDGDSSM-SELNATQLAKINDLHVEVIAKEDKLSKLSAN  173

Query  552  AQETVAAPPILGLLKRAEELVDGEVSELDAVMGDLKQSMGRLMGNADALRGSTASKILEI  373
             QE VA  PI  +   + + V+ +V+  DA +   ++ M  L+ +AD LR  T  KI+E+
Sbjct  174  MQEDVADMPI-AVTAFSSDSVEADVAVEDA-LDKHEEGMAVLIADADKLRLETLKKIVEV  231

Query  372  LNPKQAVKFLTAVMRFQREARRWGLYNDSQR  280
            L P QA +FL +  R       WG   + +R
Sbjct  232  LTPVQAAEFLLSGKRLHVSLHEWGRVREERR  262



>gb|KFK28541.1| hypothetical protein AALP_AA7G010100 [Arabis alpina]
Length=267

 Score = 74.7 bits (182),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 57/180 (32%), Positives = 82/180 (46%), Gaps = 26/180 (14%)
 Frame = -1

Query  747  FFASPWMSRLEQSFLWLSGFKPSMLFWV--------VESSM-------------EGALSE  631
            +FA  W S LE S LW+ G +PS    V        VE+ +             +G +SE
Sbjct  77   YFAPSWNSSLENSLLWMGGCRPSSFIRVIYALCGSQVETQIFQYLHKIDGNKKDDGLMSE  136

Query  630  ---EQRCKVGMLRAETARVENAISKAMASAQETVAAPPILGLLKRAEELVDGEVSELDAV  460
                Q  K+  L  +  + E+ ISK  A+ QE VA  PI  +    ++LV+  V   DA 
Sbjct  137  LTATQLAKINELHMKVIKKEDKISKKSANMQEDVADMPI-AVTAYTKDLVEAGVVVEDA-  194

Query  459  MGDLKQSMGRLMGNADALRGSTASKILEILNPKQAVKFLTAVMRFQREARRWGLYNDSQR  280
            +   ++ M  LM  AD LR  T  KI+E++ P QA +F+ A  R       WG   +  R
Sbjct  195  LDKYEEGMAVLMAEADKLRVETLRKIVEVVTPVQAAEFILAGKRLHVSLHEWGRVREDGR  254



>gb|EYU45030.1| hypothetical protein MIMGU_mgv1a018123mg [Erythranthe guttata]
Length=467

 Score = 77.0 bits (188),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 70/243 (29%), Positives = 109/243 (45%), Gaps = 44/243 (18%)
 Frame = -1

Query  939  FTAFYHGWLMNQDAIFEQLESFLaaaaaaddDREQCGGLVGRVLAHYQeyyaektkaaeE  760
            F  +Y  W      + +QL S        D+   Q   L+ + ++HY +YYA K+ +A+ 
Sbjct  243  FQCYYDTWFSQLRQLVQQL-SQSPNPPTTDEHHHQLRQLINKAMSHYADYYAAKSVSAKH  301

Query  759  DVFVFFASPWMSRLEQSFLWLSGFKPSMLFWVV--ESSM-----------------EGAL  637
            DV  FF+ PW + LE+S  W+ G++P+  F +V  ESS+                  G L
Sbjct  302  DVLEFFSPPWTTALERSLHWIGGWRPTTAFHLVYTESSILFESHVIDILRGFHTGDLGDL  361

Query  636  SEEQRCKVGMLRAETARVENAISKAMASAQETVAAPPILGLLKRAEELVDGEVSEL-DAV  460
            S  Q  +V  L+ +T   EN I+  ++  Q+                    E S+L  A+
Sbjct  362  SPAQFARVSELQIQTVHEENDITDDLSDWQD--------------------EASDLAAAI  401

Query  459  MGDLKQSMGRLMG---NADALRGSTASKILEILNPKQAVKFLTAVMRFQREARRWGLYND  289
             GD+ + M +L+G    AD LR  T   ++E+L  +Q  +FL A    Q     WGL  D
Sbjct  402  YGDVGRKMEKLVGILERADQLRLRTMKSLVELLTLQQGAEFLVAAAELQFGIHGWGLQQD  461

Query  288  SQR  280
              R
Sbjct  462  RHR  464


 Score = 58.2 bits (139),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 50/192 (26%), Positives = 88/192 (46%), Gaps = 22/192 (11%)
 Frame = -1

Query  837  QCGGLVGRVLAHYQeyyaektkaaeEDVFVFFASPWMSRLEQSFLWLSGFKPS----MLF  670
            Q   LV + + H++EY  ++   A+ D     +  W + LE + LW+ G +PS    +++
Sbjct  39   QTKRLVEKGVQHFEEYCGKRAVMAQHDAISLMSPAWCTSLENAALWVGGCRPSLSIRLVY  98

Query  669  WVVESSMEGALSE---------------EQRCKVGMLRAETARVENAISKAMASAQETVA  535
             V  S ++  L E               +Q   +  L     + E+ IS  +A+ QE +A
Sbjct  99   SVCGSELDEQLEEFLRGVRKGNLAEISGQQLHMINALHCRIVKEEDKISARIATLQEEIA  158

Query  534  APPILGLLKRAEELVDGEVS-ELDAVMGDLKQSMGRLMGNADALRGSTASKILEILNPKQ  358
              P+  + K AE +  GE S +++        S+  ++  AD LR ST  +++ IL P Q
Sbjct  159  DKPLAVIAKGAERV--GEWSRDVERAANAHSLSLAGILVEADRLRLSTFKELMAILTPSQ  216

Query  357  AVKFLTAVMRFQ  322
            A+  L A  +  
Sbjct  217  ALDLLIATKKLH  228



>ref|XP_006643777.1| PREDICTED: transcription factor TGA6-like [Oryza brachyantha]
Length=266

 Score = 74.7 bits (182),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 70/232 (30%), Positives = 102/232 (44%), Gaps = 31/232 (13%)
 Frame = -1

Query  948  GEDFTAFYHGWLMNQ--DAIFEQLESFLaaaaaaddDREQCGGLVGRVLAHYQeyyaekt  775
            GE F  F+  W+  Q  D    +  +  + A    D R    GLV RVL HY+ YY  K+
Sbjct  20   GETFAKFFECWISEQSRDLAALRSAASASPAPPDVDLR----GLVDRVLGHYEYYYRTKS  75

Query  774  kaaeEDVFVFFASPWMSRLEQSFLWLSGFKPS----MLFWVVESSME-------------  646
             AA  DV   F+  W S  E  +LW  G++P+    +L+    + +E             
Sbjct  76   AAASNDVLCMFSPSWTSTTENLYLWCGGWRPTAALHLLYSKSGAQLEAQLPMFLTGGSLG  135

Query  645  ----GALSEEQRCKVGMLRAETARVENAISKAMASAQETVAAPPILGLLKRAEELVDGEV  478
                G LS EQ      L+  T R E  I  A+ASAQE++A   ++ L          +V
Sbjct  136  TNDLGDLSAEQLQAADQLQRSTVRKEREIENAVASAQESLATVKMVALAGGG----GMDV  191

Query  477  SELDAVMGDLKQSMGRLMGNADALRGSTASKILEILNPKQAVKFLTAVMRFQ  322
              ++  M    + M R++  AD LR  T  +++ +L P QAV FL A     
Sbjct  192  EAMETEMKSKAEGMKRVLEMADGLRLETMREVVALLRPSQAVHFLIAAAELH  243



>gb|KFK28536.1| hypothetical protein AALP_AA7G009500 [Arabis alpina]
Length=195

 Score = 73.9 bits (180),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 62/188 (33%), Positives = 94/188 (50%), Gaps = 6/188 (3%)
 Frame = -1

Query  828  GLVGRVLAHYQeyyaektkaaeEDVFVFFASPWMSRLEQSFLWLSGFKPSMLFWVVESSM  649
            GL+ ++  H++ YY  K  A  EDV  FF   W++ LE+S  WL+G+KPS  F +VE   
Sbjct  8    GLISKLTTHHKAYYTAKWAAIGEDVLAFFGPVWLNPLEKSCFWLTGWKPSTAFRMVERLR  67

Query  648  EGA--LSEEQRCKVGMLRAETARVENAISKAMASAQETVAAPPILGLLKRAEELVDGEVS  475
            +    L E Q  K+  LR +T   E  I + M   Q  +A   ++ L +    +  G   
Sbjct  68   KSTVVLVEAQAKKLEELRVKTRFEEEKIEREMERYQVAMADRKMVELARLGCHVGGGGGG  127

Query  474  E----LDAVMGDLKQSMGRLMGNADALRGSTASKILEILNPKQAVKFLTAVMRFQREARR  307
            E    ++A +  L   + +++  AD +R  T   IL+IL P Q V+FL     FQ + RR
Sbjct  128  ESMVVVEAAVKGLAMGLEKMVKAADCVRLKTLMGILDILAPPQCVEFLAETAAFQVQLRR  187

Query  306  WGLYNDSQ  283
            WG    +Q
Sbjct  188  WGNERHNQ  195



>emb|CDY70896.1| BnaCnng70220D [Brassica napus]
 emb|CDX98510.1| BnaC05g38650D [Brassica napus]
Length=237

 Score = 74.3 bits (181),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 75/244 (31%), Positives = 110/244 (45%), Gaps = 36/244 (15%)
 Frame = -1

Query  945  EDFTAFYHGWLMNQDAIFEQLESFLaaaaaadd-DREQCGGLVGRVLAHYQeyyaektka  769
            E F  F H W+         L S       +   D E+    V RV+   +EY+  K   
Sbjct  8    ESFKKFQHTWVEQLQHHLNHLRSVQNHHRNSATGDEERLREAVERVMELCREYHRAKLAT  67

Query  768  aeEDVFVFFASPWMSRLEQSFLWLSGFKPSMLFWVV--ESSM--------------EGAL  637
             E+DV    A+PW S LE+S  W+  ++P+ LF +V  ESS+               G L
Sbjct  68   TEKDVVGLMAAPWSSALERSLHWVGDWRPTTLFHLVYTESSILFESRIVDILRGFRTGDL  127

Query  636  SE---EQRCKVGMLRAETARVENAISKAMASAQETVAAPPILGLLKRAEELVDGEVSELD  466
            S+    Q   V  L+ ET + ENAI++ ++  Q+             A ELV G VS LD
Sbjct  128  SDLSPSQFRTVSELQCETVKEENAITEDLSEWQDD------------ASELVMGTVSNLD  175

Query  465  AVMGDLKQSMGRLMGNADALRGSTASKILEILNPKQAVKFLTAVMRFQREARRWGLYNDS  286
              +  L + + R    AD LR  T + ++E+L+P Q  +FL A    +R    WG  +D 
Sbjct  176  QRIRRLAEIVHR----ADDLRLRTITGVVELLSPLQQAEFLIAAAELRRGVSGWGSSHDR  231

Query  285  QREA  274
            +R A
Sbjct  232  RRSA  235



>ref|XP_009613589.1| PREDICTED: transcription factor TGA6 [Nicotiana tomentosiformis]
Length=237

 Score = 73.9 bits (180),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 64/233 (27%), Positives = 112/233 (48%), Gaps = 24/233 (10%)
 Frame = -1

Query  951  VGEDFTAFYHGWLMNQDAIFEQLESFLaaaaaaddDREQCGG---LVGRVLAHYQeyyae  781
            V ++F+ ++  W+        QLE FL        +         LV ++ AH+++YY  
Sbjct  5    VEKNFSNYFENWM-------SQLEEFLRLLLIVPKEISHVKDHETLVNKMTAHHKDYYTA  57

Query  780  ktkaaeEDVFVFFASPWMSRLEQSFLWLSGFKPSMLFWVVESSMEGALSEEQRCKVGMLR  601
            K  AA ED+  FF   W+S LE ++LW++G+KPSM F ++  +    LS+EQ   +  L+
Sbjct  58   KWAAAHEDILSFFNPVWLSPLENAYLWVTGWKPSMAFRLLVGA-TSELSDEQVKSIDALK  116

Query  600  AETARVENAISKAMASAQETVAAPPILGLLK------------RAEELVDGEVSEL-DAV  460
             +    E  + + M   Q  +    ++ L +             ++  ++ ++  L +  
Sbjct  117  VKIRAEEERVEREMERQQVALGDRKMVELARLNSSTRVRTSGCTSDSHLNNQLDGLVEVA  176

Query  459  MGDLKQSMGRLMGNADALRGSTASKILEILNPKQAVKFLTAVMRFQREARRWG  301
            +  L  S+ R+M  AD +R  T   +L+ILNP Q V  L A+   Q + R+WG
Sbjct  177  LKGLMISLERVMKMADCVRLKTLKGLLDILNPTQCVGLLAAISMLQIQMRKWG  229



>ref|XP_010093103.1| hypothetical protein L484_007912 [Morus notabilis]
 gb|EXB53541.1| hypothetical protein L484_007912 [Morus notabilis]
Length=292

 Score = 74.7 bits (182),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 73/265 (28%), Positives = 113/265 (43%), Gaps = 47/265 (18%)
 Frame = -1

Query  945  EDFTAFYHGWLMNQDAIFEQLESFLaaaaaaddDREQCG--GLVGRVLAHYQeyyaektk  772
            E F  F+  WL  Q+   + L+  ++AA +     ++     L+ RV+ HY+ YY  K  
Sbjct  23   ESFQKFFECWLSGQN---QHLQELISAAKSPASAADEAALRSLIERVVKHYECYYRAKAT  79

Query  771  aaeEDVFVFFASPWMSRLEQSFLWLSGFKPSMLFWVVESS------MEGALSE-------  631
             +  DV       W S LE +FLW+ G++PSM F ++ S         G LSE       
Sbjct  80   WSRRDVLAMLTPSWRSTLEDAFLWIGGWRPSMAFHLLYSKSGLQLEAPGRLSELINAMTT  139

Query  630  -----------------EQRCKVGMLRAETARVENAISKAMASAQETVAAPPILGLLKRA  502
                             EQ  +V  L+  T + E  IS+ MA  QET+AAP I+ L    
Sbjct  140  TTATATAIREDLADISPEQLSRVDGLQRRTIKEEKEISEEMAKRQETLAAPDIVELSHVV  199

Query  501  EELV--------DGE----VSELDAVMGDLKQSMGRLMGNADALRGSTASKILEILNPKQ  358
             E +        DG+       ++  +   ++ +  ++  AD LR  T   ++ +L P Q
Sbjct  200  SEQMTAGGGGSRDGDEEEEEERVETALKPKEKGLEEVLERADELRLRTLKDVIHLLTPIQ  259

Query  357  AVKFLTAVMRFQREARRWGLYNDSQ  283
            AV FL A          WG   D++
Sbjct  260  AVHFLIAAAELHLRIHEWGKKRDAK  284



>ref|XP_009792613.1| PREDICTED: transcription factor TGA6-like [Nicotiana sylvestris]
Length=260

 Score = 74.3 bits (181),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 59/229 (26%), Positives = 99/229 (43%), Gaps = 27/229 (12%)
 Frame = -1

Query  930  FYHGWLMNQDAIFEQLESFLaaaaaaddDREQCGGLVGRVLAHYQeyyaektkaaeEDVF  751
             Y  W+ NQ+    +L++    A        +   L+ R++ ++Q Y   +++ A  D+ 
Sbjct  26   LYESWMENQNQELNELQNAATLARKNQKTDTELNQLLARMVNNFQGYVNGRSRLARVDIS  85

Query  750  VFFASPWMSRLEQSFLWLSGFKPSMLF--------WVVESSME-----------GALSEE  628
             +FA  W + LE S LW+ G +PS             +ES +            G LS +
Sbjct  86   PYFAPTWCTPLENSVLWIGGCRPSSFIRPIYALCGMEIESHLTEFLQGMEISDFGQLSGK  145

Query  627  QRCKVGMLRAETARVENAISKAMASAQETVAAPPILGLLKRAEELVDGEVSELDAVMGDL  448
            Q   +  L  ++   E  +S  +AS QE V   PI+     +E          +  +   
Sbjct  146  QIMLIDKLHRKSIVEERKLSSKLASLQEDVVDQPIITAANNSE--------NEEEPLNKH  197

Query  447  KQSMGRLMGNADALRGSTASKILEILNPKQAVKFLTAVMRFQREARRWG  301
             Q M  L+  AD LR +T  +IL IL P Q V++L +  R +   ++WG
Sbjct  198  GQGMTTLLEEADELRMNTLKEILGILTPIQGVEYLASAKRIRLSLQQWG  246



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3662590002799