BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c9776_g2_i1 len=904 path=[1312:0-903]

Length=904
                                                                      Score     E

gb|KDP43735.1|  hypothetical protein JCGZ_22362                         366   8e-124   
gb|AET95643.1|  chitinase                                               368   2e-123   
emb|CBI18788.3|  unnamed protein product                                366   3e-123   
emb|CAC14015.1|  chitinase                                              367   3e-123   Vitis vinifera
emb|CAN62784.1|  hypothetical protein VITISV_033490                     366   1e-122   Vitis vinifera
ref|XP_010033561.1|  PREDICTED: basic endochitinase-like                362   7e-122   
ref|XP_007046549.1|  Basic chitinase                                    361   1e-121   
dbj|BAH28788.1|  class II chitinase                                     360   4e-121   Vaccinium corymbosum [American blueberry]
gb|ABD66068.1|  chitinase                                               361   7e-121   Momordica charantia [balsam pear]
gb|KDO71433.1|  hypothetical protein CISIN_1g020187mg                   361   2e-120   
gb|ACX42261.1|  chitinase                                               360   2e-120   Camellia sinensis [black tea]
gb|AFN85534.1|  putative chitinase I precursor                          358   2e-120   
ref|XP_010033566.1|  PREDICTED: basic endochitinase-like                357   5e-120   
gb|AIE39009.1|  pathogenesis-related protein 3                          357   6e-120   
ref|XP_010040215.1|  PREDICTED: basic endochitinase-like                357   7e-120   
ref|XP_002269727.2|  PREDICTED: LOW QUALITY PROTEIN: basic endoch...    358   9e-120   Vitis vinifera
emb|CAB01591.1|  endochitinase                                          358   1e-119   Persea americana
ref|XP_010040216.1|  PREDICTED: basic endochitinase-like                356   2e-119   
gb|ADK98562.1|  putative chitinase                                      355   5e-119   
ref|XP_010242848.1|  PREDICTED: basic endochitinase-like                356   7e-119   
ref|XP_010941404.1|  PREDICTED: chitinase 1-like                        356   9e-119   
ref|XP_006425314.1|  hypothetical protein CICLE_v10026057mg             355   2e-118   
gb|AAG37276.1|AF320111_1  chitinase                                     352   4e-118   Fragaria x ananassa
gb|AAL16893.1|AF420225_1  class II chitinase                            352   5e-118   Fragaria x ananassa
emb|CAA92277.1|  chitinase                                              352   8e-118   Gossypium hirsutum [American cotton]
gb|ACJ38195.1|  chitinase                                               352   2e-117   Malus hupehensis
gb|ABD92819.1|  class Ib chitinase                                      352   3e-117   Limonium bicolor
ref|XP_009344657.1|  PREDICTED: endochitinase-like                      352   4e-117   
dbj|BAF47270.1|  chitinase C                                            352   4e-117   Ananas comosus
emb|CDJ26692.1|  unnamed protein product                                352   5e-117   
ref|XP_008393545.1|  PREDICTED: endochitinase-like                      351   6e-117   
ref|XP_008344215.1|  PREDICTED: endochitinase-like                      351   7e-117   
emb|CAA53626.1|  endochitinase                                          351   8e-117   Triticum aestivum [Canadian hard winter wheat]
gb|ACJ23248.1|  class I chitinase                                       350   1e-116   Festuca arundinacea [tall fescue]
gb|AHY24795.1|  endochitinase                                           350   2e-116   
gb|AHY24793.1|  endochitinase                                           350   2e-116   
gb|ACE79210.1|  chi31                                                   350   2e-116   Limonium bicolor
gb|ACM45713.1|  class I chitinase                                       350   3e-116   Pyrus pyrifolia [sha li]
ref|XP_009337094.1|  PREDICTED: endochitinase-like                      349   3e-116   
gb|KHG04995.1|  Basic endochitinase                                     347   3e-116   
ref|XP_008812110.1|  PREDICTED: chitinase 3-like                        349   4e-116   
ref|XP_009344658.1|  PREDICTED: endochitinase-like                      350   4e-116   
gb|AAF04454.1|AF000966_1  chitinase                                     349   4e-116   Poa pratensis
emb|CAN62783.1|  hypothetical protein VITISV_033489                     348   4e-116   Vitis vinifera
gb|AAT40738.1|  basic chitinase 2-2                                     349   5e-116   Nepenthes khasiana
emb|CBJ55936.1|  pathogenesis related gene 3                            346   1e-115   
gb|AHY24796.1|  endochitinase                                           348   1e-115   
dbj|BAG12896.1|  chitinase                                              347   2e-115   Bromus inermis [awnless brome grass]
dbj|BAO09558.1|  class I chitinase a                                    347   2e-115   
dbj|BAB82473.1|  chitinase 3                                            347   2e-115   Triticum aestivum [Canadian hard winter wheat]
emb|CDP01819.1|  unnamed protein product                                347   3e-115   
gb|AAR11388.1|  class I chitinase                                       347   3e-115   Triticum aestivum [Canadian hard winter wheat]
gb|AAP03088.1|  class Ia chitinase                                      347   3e-115   Galega orientalis
gb|EAZ02415.1|  hypothetical protein OsI_24517                          347   3e-115   Oryza sativa Indica Group [Indian rice]
gb|AHY24794.1|  endochitinase                                           347   4e-115   
gb|AAT40736.1|  basic chitinase 2-1                                     347   5e-115   Nepenthes khasiana
gb|AFK35074.1|  unknown                                                 347   5e-115   
ref|NP_001058626.1|  Os06g0726100                                       347   5e-115   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003604092.1|  Endochitinase                                      347   5e-115   
emb|CAA71402.1|  chitinase                                              347   6e-115   Medicago truncatula
gb|AAD54934.1|AF141372_1  chitinase precursor                           344   6e-115   Petroselinum crispum
ref|XP_010941401.1|  PREDICTED: 26 kDa endochitinase 1-like isofo...    346   7e-115   
gb|ADN39439.1|  class I chitinase isoform 2                             345   8e-115   
gb|AHY24791.1|  endochitinase                                           346   8e-115   
gb|AHY24792.1|  endochitinase                                           346   8e-115   
dbj|BAO09559.1|  class I chitinase b                                    346   8e-115   
ref|XP_010242849.1|  PREDICTED: basic endochitinase-like                346   9e-115   
ref|XP_008812099.1|  PREDICTED: chitinase 1-like                        346   1e-114   
gb|AAG23965.1|AF307511_1  class I chitinase                             345   1e-114   Vigna unguiculata subsp. sesquipedalis [yard-long-bean]
dbj|BAJ89873.1|  predicted protein                                      345   1e-114   
sp|Q9FRV1.1|CHIA_SECCE  RecName: Full=Basic endochitinase A; AltN...    345   1e-114   Secale cereale
ref|XP_010103320.1|  Endochitinase 1                                    345   2e-114   
gb|KDP25869.1|  hypothetical protein JCGZ_22899                         346   2e-114   
gb|AES74343.2|  Chitinase (Class I) / Hevein                            347   3e-114   
prf||2007234A  chitinase a                                              343   5e-114
ref|XP_010941399.1|  PREDICTED: chitinase 1-like isoform X1             344   6e-114   
pdb|4DWX|A  Chain A, Crystal Structure Of A Family Gh-19 Chitinas...    341   6e-114   
sp|Q9FRV0.1|CHIC_SECCE  RecName: Full=Basic endochitinase C; AltN...    342   8e-114   Secale cereale
sp|P29059.1|CHI3_TOBAC  RecName: Full=Endochitinase 3; Flags: Pre...    343   1e-113   Nicotiana tabacum [American tobacco]
ref|XP_009594039.1|  PREDICTED: endochitinase 3                         343   1e-113   
sp|P21226.2|CHI2_PEA  RecName: Full=Endochitinase A2; Flags: Prec...    343   1e-113   Pisum sativum [garden pea]
ref|XP_010103322.1|  Endochitinase 1                                    343   1e-113   
gb|AIW39714.1|  class I chitinase                                       342   1e-113   
dbj|BAO45893.1|  chitinase                                              343   2e-113   
ref|XP_007046548.1|  Basic chitinase                                    342   2e-113   
ref|XP_010941400.1|  PREDICTED: basic endochitinase A-like isofor...    343   2e-113   
ref|XP_002306220.1|  chitinase family protein                           342   2e-113   Populus trichocarpa [western balsam poplar]
gb|ADF47472.1|  class II chitinase                                      340   3e-113   
prf||1901378A  chitinase                                                342   3e-113
gb|KDP43737.1|  hypothetical protein JCGZ_22364                         342   3e-113   
ref|XP_003569604.1|  PREDICTED: basic endochitinase A-like              342   3e-113   
pir||T07838  chitinase (EC 3.2.1.14) - cucurbit                         342   4e-113
ref|XP_004163403.1|  PREDICTED: basic endochitinase A-like              342   4e-113   
emb|CAA39535.1|  chitinase                                              341   5e-113   Oryza sativa Japonica Group [Japonica rice]
gb|ACP43629.2|  chitinase                                               341   5e-113   Musa AB Group
ref|XP_011046301.1|  PREDICTED: endochitinase 2-like                    341   5e-113   
gb|AAT40030.1|  chitinase                                               341   6e-113   Zea diploperennis [chapule]
ref|XP_008241979.1|  PREDICTED: endochitinase-like                      341   7e-113   
gb|AAT40032.1|  chitinase                                               341   8e-113   Zea diploperennis [chapule]
gb|AAT40029.1|  chitinase                                               341   8e-113   Zea diploperennis [chapule]
sp|Q42993.1|CHI1_ORYSJ  RecName: Full=Chitinase 1; AltName: Full=...    341   8e-113   Oryza sativa Japonica Group [Japonica rice]
gb|AAB01895.1|  endochitinase                                           340   1e-112   Castanea sativa
gb|ACH92946.2|  class I chitinase                                       341   1e-112   Dimocarpus longan [longan]
gb|KHG07793.1|  Endochitinase                                           340   1e-112   
gb|AFY08283.1|  class Ia chitinase                                      340   1e-112   
sp|P06215.1|CHIT_PHAVU  RecName: Full=Endochitinase; Flags: Precu...    341   1e-112   Phaseolus vulgaris [French bean]
ref|NP_001238561.1|  chitinase class I precursor                        340   1e-112   
ref|XP_009797267.1|  PREDICTED: endochitinase 3                         341   2e-112   
gb|KHN00426.1|  Endochitinase                                           340   2e-112   
ref|NP_001268050.1|  class I extracellular chitinase precursor          340   2e-112   
gb|AAT40019.1|  chitinase                                               340   2e-112   Zea mays subsp. parviglumis [Balsas teosinte]
gb|AAT40016.1|  chitinase                                               340   2e-112   Zea mays subsp. parviglumis [Balsas teosinte]
gb|AAT40015.1|  chitinase                                               340   2e-112   Zea mays subsp. parviglumis [Balsas teosinte]
emb|CAC81811.1|  putative chitinase                                     340   2e-112   Musa acuminata [banana]
gb|AAT40017.1|  chitinase                                               340   2e-112   Zea mays subsp. parviglumis [Balsas teosinte]
gb|ACN55075.1|  chitinase Ib                                            340   2e-112   Chimonanthus praecox [wintersweet]
gb|EAZ02416.1|  hypothetical protein OsI_24518                          340   3e-112   Oryza sativa Indica Group [Indian rice]
ref|XP_002312919.2|  hypothetical protein POPTR_0009s14420g             339   3e-112   Populus trichocarpa [western balsam poplar]
gb|AAB41324.1|  class I chitinase                                       340   3e-112   Medicago sativa [alfalfa]
gb|ACJ62088.1|  chitinase                                               339   3e-112   Zea mays subsp. parviglumis [Balsas teosinte]
gb|ACJ62087.1|  chitinase                                               339   4e-112   Zea mays subsp. parviglumis [Balsas teosinte]
gb|AAY82488.1|  chitinase                                               339   4e-112   Ulmus pumila [dwarf elm]
gb|AAT40027.1|  chitinase                                               339   4e-112   Zea diploperennis [chapule]
gb|AAT40033.1|  chitinase                                               339   5e-112   Zea diploperennis [chapule]
gb|ABK96628.1|  unknown                                                 338   5e-112   Populus trichocarpa x Populus deltoides
pdb|4J0L|A  Chain A, Crystal Structure Of A Family Gh19 Chitinase...    336   6e-112   
ref|XP_007202270.1|  hypothetical protein PRUPE_ppa008859mg             338   6e-112   
ref|XP_003563255.1|  PREDICTED: basic endochitinase C                   337   7e-112   
gb|ACJ62113.1|  chitinase                                               338   7e-112   Zea mays subsp. parviglumis [Balsas teosinte]
ref|XP_008440900.1|  PREDICTED: chitinase 1-like isoform X2             338   8e-112   
gb|ACJ62151.1|  chitinase                                               338   1e-111   Zea mays subsp. parviglumis [Balsas teosinte]
gb|ABK27143.1|  unknown                                                 338   1e-111   Picea sitchensis
gb|AAT40014.1|  chitinase                                               338   1e-111   Zea mays subsp. parviglumis [Balsas teosinte]
ref|NP_001265906.1|  endochitinase A2-like precursor                    338   1e-111   
gb|AAT40013.1|  chitinase                                               338   1e-111   Zea mays subsp. parviglumis [Balsas teosinte]
gb|ACJ62121.1|  chitinase                                               338   1e-111   Zea mays subsp. parviglumis [Balsas teosinte]
gb|ACJ62107.1|  chitinase                                               338   1e-111   Zea mays subsp. parviglumis [Balsas teosinte]
gb|ACJ62106.1|  chitinase                                               338   1e-111   Zea mays subsp. parviglumis [Balsas teosinte]
gb|ACJ62108.1|  chitinase                                               338   1e-111   Zea mays subsp. parviglumis [Balsas teosinte]
gb|ACJ62111.1|  chitinase                                               338   1e-111   Zea mays subsp. parviglumis [Balsas teosinte]
gb|AAT40012.1|  chitinase                                               338   1e-111   Zea mays subsp. parviglumis [Balsas teosinte]
gb|ABK22517.1|  unknown                                                 337   1e-111   Picea sitchensis
gb|ACJ62086.1|  chitinase                                               338   1e-111   Zea mays subsp. parviglumis [Balsas teosinte]
gb|ACJ62114.1|  chitinase                                               338   1e-111   Zea mays subsp. parviglumis [Balsas teosinte]
gb|ACJ62131.1|  chitinase                                               338   1e-111   Zea mays subsp. parviglumis [Balsas teosinte]
gb|ACJ62095.1|  chitinase                                               338   1e-111   Zea mays subsp. parviglumis [Balsas teosinte]
gb|ACJ62157.1|  chitinase                                               337   1e-111   Zea mays subsp. parviglumis [Balsas teosinte]
ref|NP_001280823.1|  endochitinase-like precursor                       338   1e-111   
ref|XP_007137309.1|  hypothetical protein PHAVU_009G116600g             338   1e-111   
gb|ACJ62094.1|  chitinase                                               337   1e-111   Zea mays subsp. parviglumis [Balsas teosinte]
gb|ACJ62116.1|  chitinase                                               337   1e-111   Zea mays subsp. parviglumis [Balsas teosinte]
gb|ACJ62141.1|  chitinase                                               337   2e-111   Zea mays subsp. parviglumis [Balsas teosinte]
gb|ACJ62118.1|  chitinase                                               337   2e-111   Zea mays subsp. parviglumis [Balsas teosinte]
gb|ACJ62156.1|  chitinase                                               337   2e-111   Zea mays subsp. parviglumis [Balsas teosinte]
gb|AHX74093.1|  putative chitodextrinase                                338   2e-111   
gb|AAR27240.2|  class I chitinase                                       338   2e-111   Phaseolus vulgaris [French bean]
gb|ADP94987.1|  basic endochitinase-like protein                        335   2e-111   
gb|ADP94991.1|  basic endochitinase-like protein                        335   2e-111   
gb|AFC88126.1|  class I chitinase                                       337   2e-111   
gb|ACJ62136.1|  chitinase                                               337   2e-111   Zea mays subsp. parviglumis [Balsas teosinte]
gb|ADP95017.1|  basic endochitinase-like protein                        335   2e-111   
ref|XP_004134833.1|  PREDICTED: basic endochitinase A-like              337   2e-111   
ref|XP_007201290.1|  hypothetical protein PRUPE_ppa008646mg             337   2e-111   
gb|ACJ62138.1|  chitinase                                               337   3e-111   Zea mays subsp. parviglumis [Balsas teosinte]
pdb|3CQL|A  Chain A, Crystal Structure Of Gh Family 19 Chitinase ...    334   3e-111   
gb|ADP94993.1|  basic endochitinase-like protein                        335   3e-111   
gb|AEF59001.1|  class II chitinase                                      337   3e-111   
gb|ACJ62150.1|  chitinase                                               337   3e-111   Zea mays subsp. parviglumis [Balsas teosinte]
gb|AFK37149.1|  unknown                                                 337   3e-111   
ref|XP_008440899.1|  PREDICTED: endochitinase-like isoform X1           338   4e-111   
gb|ACL81177.1|  chitinase                                               336   5e-111   Chimonanthus praecox [wintersweet]
ref|XP_010028812.1|  PREDICTED: endochitinase-like                      337   5e-111   
ref|XP_004134832.1|  PREDICTED: endochitinase-like                      336   5e-111   
gb|ADP94997.1|  basic endochitinase-like protein                        334   6e-111   
ref|XP_004509418.1|  PREDICTED: endochitinase-like                      336   6e-111   
gb|KCW55631.1|  hypothetical protein EUGRSUZ_I01495                     336   7e-111   
dbj|BAK08350.1|  predicted protein                                      334   7e-111   
ref|XP_007137310.1|  hypothetical protein PHAVU_009G116700g             337   7e-111   
gb|ACJ62110.1|  chitinase                                               336   7e-111   Zea mays subsp. parviglumis [Balsas teosinte]
gb|AAP03087.1|  class Ib chitinase                                      336   7e-111   Galega orientalis
gb|ACJ62153.1|  chitinase                                               336   8e-111   Zea mays subsp. parviglumis [Balsas teosinte]
gb|ADP95002.1|  basic endochitinase-like protein                        333   8e-111   
gb|ACJ62117.1|  chitinase                                               336   8e-111   Zea mays subsp. parviglumis [Balsas teosinte]
ref|XP_006828992.1|  hypothetical protein AMTR_s00001p00243780          336   9e-111   
gb|ADP94995.1|  basic endochitinase-like protein                        333   1e-110   
gb|AFK33496.1|  unknown                                                 336   1e-110   
gb|ACJ62109.1|  chitinase                                               335   1e-110   Zea mays subsp. parviglumis [Balsas teosinte]
gb|ACJ62104.1|  chitinase                                               335   1e-110   Zea mays subsp. parviglumis [Balsas teosinte]
gb|ACJ62105.1|  chitinase                                               335   1e-110   Zea mays subsp. parviglumis [Balsas teosinte]
gb|ADP94989.1|  basic endochitinase-like protein                        333   1e-110   
gb|ABD64683.1|  chitinase class I basic                                 335   1e-110   Vitis vinifera
gb|AEZ67300.1|  chitinase 1                                             335   1e-110   
ref|XP_004163402.1|  PREDICTED: endochitinase-like                      335   2e-110   
emb|CAA61278.1|  chitinase class 1                                      335   2e-110   Vigna unguiculata
gb|AAA32641.1|  chitinase                                               335   2e-110   Allium sativum
ref|XP_009392872.1|  PREDICTED: chitinase 1-like                        335   2e-110   
ref|XP_006367160.1|  PREDICTED: basic endochitinase-like                333   2e-110   
ref|NP_001284473.1|  endochitinase-like precursor                       335   2e-110   
ref|XP_010242847.1|  PREDICTED: endochitinase A-like                    335   2e-110   
gb|AAQ84333.1|  OsmChiI-34                                              334   2e-110   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003563256.2|  PREDICTED: 26 kDa endochitinase 1                  335   2e-110   
ref|XP_009601274.1|  PREDICTED: basic endochitinase-like                332   3e-110   
gb|AAA32640.1|  chitinase                                               334   3e-110   Allium sativum
emb|CAA47921.1|  chitinase                                              332   3e-110   Solanum tuberosum [potatoes]
gb|AAG53609.1|  31.7 kDa class I endochitinase-antifreeze protein...    334   3e-110   Secale cereale
ref|XP_006828989.1|  hypothetical protein AMTR_s00001p00243300          335   4e-110   
gb|AAF04453.1|AF000964_1  chitinase                                     335   4e-110   Poa pratensis
sp|P51613.1|CHIB_VITVI  RecName: Full=Basic endochitinase; Flags:...    334   4e-110   Vitis vinifera
ref|XP_011045258.1|  PREDICTED: basic endochitinase-like                334   4e-110   
ref|XP_009606804.1|  PREDICTED: basic endochitinase                     332   6e-110   
ref|XP_002312923.2|  Chain A family protein                             333   6e-110   Populus trichocarpa [western balsam poplar]
ref|XP_004249000.1|  PREDICTED: endochitinase                           333   6e-110   
gb|KGN48980.1|  hypothetical protein Csa_6G508020                       335   8e-110   
sp|P05315.1|CHIT_SOLTU  RecName: Full=Endochitinase; Flags: Precu...    333   9e-110   Solanum tuberosum [potatoes]
ref|NP_001267891.1|  basic endochitinase precursor                      332   2e-109   
emb|CAC81812.1|  putative chitinase                                     332   2e-109   Musa acuminata [banana]
gb|AAX83262.1|  class II chitinase                                      330   2e-109   Triticum aestivum [Canadian hard winter wheat]
emb|CAB97002.1|  putative class I chitinase                             333   2e-109   Phaseolus vulgaris [French bean]
ref|XP_003629192.1|  Endochitinase                                      332   3e-109   
gb|AFK47528.1|  unknown                                                 332   3e-109   
ref|XP_004248637.1|  PREDICTED: endochitinase 4                         332   3e-109   
ref|XP_004248635.1|  PREDICTED: endochitinase 3-like                    332   3e-109   
pdb|4MST|A  Chain A, Crystal Structure Of A Putative Catalytic Do...    329   3e-109   
gb|AAA34070.1|  endochitinase precursor (EC 3.2.1.14)                   331   4e-109   Nicotiana tabacum [American tobacco]
sp|P36907.1|CHIX_PEA  RecName: Full=Endochitinase; Flags: Precursor     332   4e-109   Pisum sativum [garden pea]
ref|XP_009392870.1|  PREDICTED: chitinase 1-like                        331   4e-109   
prf||1712313A  basic chitinase                                          332   4e-109
gb|ACM47315.1|  chitinase                                               332   4e-109   Capsicum annuum
ref|XP_009775455.1|  PREDICTED: endochitinase B                         332   4e-109   
ref|XP_002439136.1|  hypothetical protein SORBIDRAFT_09g001210          332   4e-109   Sorghum bicolor [broomcorn]
gb|AFK26307.1|  chitinase 1                                             331   5e-109   
ref|XP_006340814.1|  PREDICTED: basic endochitinase-like                329   5e-109   
ref|XP_007137305.1|  hypothetical protein PHAVU_009G116300g             329   6e-109   
gb|ACJ06634.3|  class I chitinase                                       331   6e-109   Musa AB Group
sp|P24091.1|CHI2_TOBAC  RecName: Full=Endochitinase B; Short=CHN-...    331   7e-109   Nicotiana tabacum [American tobacco]
gb|AAM49597.2|  chitinase                                               331   7e-109   Leucaena leucocephala [cassie]
ref|XP_010029606.1|  PREDICTED: endochitinase-like                      328   9e-109   
ref|XP_009758310.1|  PREDICTED: basic endochitinase-like                328   1e-108   
ref|XP_006367377.1|  PREDICTED: endochitinase-like                      330   1e-108   
ref|NP_001266258.1|  basic endochitinase precursor                      328   1e-108   
ref|XP_010675192.1|  PREDICTED: basic endochitinase                     330   1e-108   
gb|AFK35483.1|  unknown                                                 330   1e-108   
sp|P85084.1|CHIT_CARPA  RecName: Full=Endochitinase                     327   1e-108   Carica papaya [mamon]
gb|ADN37756.1|  chitinase                                               331   2e-108   
ref|XP_009394061.1|  PREDICTED: endochitinase-like                      330   2e-108   
ref|XP_009617302.1|  PREDICTED: endochitinase A                         330   2e-108   
gb|AAP32201.1|  29 kDa chitinase-like thermal hysteresis protein        328   2e-108   Solanum dulcamara [climbing nightshade]
gb|ABZ80406.1|  chitinase class I                                       330   2e-108   Casuarina glauca
emb|CAC42881.1|  putative class I chitinase                             328   2e-108   Hevea brasiliensis [jebe]
ref|XP_006367375.1|  PREDICTED: endochitinase-like                      330   3e-108   
dbj|BAB82472.1|  chitinase 2                                            330   3e-108   Triticum aestivum [Canadian hard winter wheat]
gb|AFW75728.1|  hypothetical protein ZEAMMB73_827760                    331   3e-108   
gb|AAX83263.1|  class II chitinase                                      327   4e-108   Triticum aestivum [Canadian hard winter wheat]
ref|XP_010274238.1|  PREDICTED: endochitinase-like                      328   4e-108   
emb|CAA60590.1|  chitinase                                              329   4e-108   Oryza sativa [red rice]
sp|Q05537.1|CHID_SOLLC  RecName: Full=Basic endochitinase               326   4e-108   Solanum lycopersicum
gb|ADT91691.1|  endochitinase                                           329   5e-108   
gb|AAB23374.1|  basic chitinase                                         329   5e-108   Nicotiana tabacum [American tobacco]
ref|XP_008236111.1|  PREDICTED: endochitinase 2-like                    328   6e-108   
gb|ADQ43720.1|  class I chitinase                                       328   7e-108   
ref|NP_001234403.1|  basic 30 kDa endochitinase precursor               328   8e-108   
emb|CAD24068.1|  class I chitinase                                      327   9e-108   Hevea brasiliensis subsp. brasiliensis
emb|CAA38249.1|  endochitinase                                          328   9e-108   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009392871.1|  PREDICTED: chitinase 1-like                        326   1e-107   
sp|P52405.1|CHI3_SOLTU  RecName: Full=Endochitinase 3; Flags: Pre...    328   1e-107   Solanum tuberosum [potatoes]
gb|AAP03089.1|  class Ib chitinase 2                                    328   1e-107   Galega orientalis
pdb|1CNS|A  Chain A, Crystal Structure Of Chitinase At 1.91a Reso...    325   2e-107   
sp|P11955.4|CHI1_HORVU  RecName: Full=26 kDa endochitinase 1; Fla...    327   3e-107   Hordeum vulgare [barley]
sp|P52404.1|CHI2_SOLTU  RecName: Full=Endochitinase 2; Flags: Pre...    327   3e-107   Solanum tuberosum [potatoes]
gb|ABD47583.1|  chitinase                                               327   4e-107   Musa x paradisiaca [banana]
gb|AAC16011.1|  basic chitinase                                         326   4e-107   Elaeagnus umbellata [aki-gumi]
ref|XP_004287744.1|  PREDICTED: endochitinase-like                      327   4e-107   
ref|XP_002525743.1|  class I chitinase, putative                        326   5e-107   Ricinus communis
sp|P52403.1|CHI1_SOLTU  RecName: Full=Endochitinase 1; Flags: Pre...    326   5e-107   Solanum tuberosum [potatoes]
gb|EAY97966.1|  hypothetical protein OsI_19884                          326   6e-107   Oryza sativa Indica Group [Indian rice]
gb|AAR15893.1|  chitinase                                               326   6e-107   Oryza sativa [red rice]
ref|XP_007156222.1|  hypothetical protein PHAVU_003G268600g             327   7e-107   
gb|AHF88836.1|  chitinase-like protein                                  325   7e-107   
gb|AGO03752.1|  pathogenesis related protein 3                          323   1e-106   
ref|NP_001050373.2|  Os03g0418000                                       325   1e-106   
ref|XP_002447824.1|  hypothetical protein SORBIDRAFT_06g016510          323   1e-106   
gb|AHB62682.1|  putative VF chitinase I                                 325   1e-106   
ref|XP_007041668.1|  Basic chitinase                                    325   1e-106   
ref|XP_008440903.1|  PREDICTED: endochitinase-like                      325   1e-106   
gb|AAM77665.1|AF523071_1  chitinase KBchit5-3-1                         325   1e-106   
gb|AEF58999.1|  class I chitinase                                       325   2e-106   
gb|AAT40732.1|  basic chitinase 1-1                                     326   2e-106   
sp|Q41596.1|CHI1_THECC  RecName: Full=Endochitinase 1; Flags: Pre...    325   2e-106   
gb|EMT27215.1|  Basic endochitinase A                                   324   2e-106   
dbj|BAK07708.1|  predicted protein                                      325   2e-106   
gb|ABK24218.1|  unknown                                                 325   2e-106   
pir||JC5918  chitinase (EC 3.2.1.14) - two-rowed barley                 322   2e-106
gb|AAL05885.1|AF416677_1  endochitinase                                 321   3e-106   
dbj|BAK01982.1|  predicted protein                                      324   3e-106   
emb|CAA32351.1|  unnamed protein product                                323   4e-106   
emb|CAA82849.1|  chitinase class I                                      324   4e-106   
pdb|2BAA|A  Chain A, The Refined Crystal Structure Of An Endochit...    321   4e-106   
sp|P23951.1|CHI2_HORVU  RecName: Full=26 kDa endochitinase 2; Alt...    322   5e-106   
ref|XP_010040220.1|  PREDICTED: basic endochitinase-like                321   5e-106   
gb|AAL34318.1|L40337_1  chitinase                                       324   5e-106   
dbj|BAL04610.1|  class I chitinase LA-c                                 325   5e-106   
gb|AFY08285.1|  class II chitinase                                      321   5e-106   
ref|XP_006379301.1|  hypothetical protein POPTR_0009s14430g             324   6e-106   
dbj|BAD02824.1|  putative class I chitinase                             323   6e-106   
ref|NP_001055477.1|  Os05g0399400                                       324   6e-106   
ref|XP_011045270.1|  PREDICTED: acidic endochitinase WIN6               323   8e-106   
sp|Q39799.1|CHI1_GOSHI  RecName: Full=Endochitinase 1; Flags: Pre...    323   1e-105   
ref|XP_009146610.1|  PREDICTED: endochitinase CH25                      322   2e-105   
sp|Q09023.1|CHI2_BRANA  RecName: Full=Endochitinase CH25; Flags: ...    322   2e-105   
dbj|BAD02547.1|  putative class I chitinase                             322   3e-105   
ref|XP_003629191.1|  Endochitinase                                      331   4e-105   
emb|CDY42151.1|  BnaC05g40680D                                          322   5e-105   
gb|AAA51377.1|  chitinase                                               322   5e-105   
gb|AGW81842.1|  class I chitinase                                       321   5e-105   
gb|AGO03754.1|  pathogenesis related protein 3                          319   5e-105   
gb|AEF59005.1|  class I chitinase                                       322   5e-105   
gb|AAF69770.1|AF135130_1  class I chitinase                             320   6e-105   
gb|KHG16133.1|  Endochitinase 1                                         321   7e-105   
dbj|BAD02535.1|  putative class I chitinase                             320   8e-105   
gb|AAF69786.1|AF135146_1  class I chitinase                             320   9e-105   
gb|ABU25226.1|  chitinase                                               320   1e-104   
gb|AAF69773.1|AF135133_1  class I chitinase                             320   1e-104   
dbj|BAC53632.1|  cotyledoneous yieldin-like protein                     318   1e-104   
gb|AAF69793.1|AF135153_1  class I chitinase                             320   1e-104   
dbj|BAE43610.1|  putative class I chitinase                             320   1e-104   
gb|ADP94999.1|  basic endochitinase-like protein                        317   1e-104   
gb|AGO03753.1|  pathogenesis related protein 3                          318   1e-104   
pdb|3W3E|A  Chain A, Structure Of Vigna Unguiculata Chitinase Wit...    317   2e-104   
gb|AAF69792.1|AF135152_1  class I chitinase                             319   2e-104   
gb|AAF69775.1|AF135135_1  class I chitinase                             318   3e-104   
dbj|BAD02539.1|  putative class I chitinase                             319   3e-104   
ref|XP_006407328.1|  hypothetical protein EUTSA_v10021149mg             319   3e-104   
gb|AAF69783.1|AF135143_1  class I chitinase                             318   3e-104   
gb|AAF69781.1|AF135141_1  class I chitinase                             318   3e-104   
gb|ADP95016.1|  basic endochitinase-like protein                        317   4e-104   
gb|ADP95000.1|  basic endochitinase-like protein                        317   4e-104   
prf||1710349A  basic chitinase                                          319   5e-104
ref|XP_004146167.1|  PREDICTED: basic endochitinase-like                318   6e-104   
gb|AAF69780.1|AF135140_1  class I chitinase                             318   6e-104   
gb|ADP95003.1|  basic endochitinase-like protein                        316   6e-104   
sp|Q39785.2|CHI2_GOSHI  RecName: Full=Endochitinase 2; Flags: Pre...    317   6e-104   
gb|EMT27216.1|  Basic endochitinase A                                   317   7e-104   
gb|ACN96317.1|  class 1 chitinase                                       318   9e-104   
gb|ABK21438.1|  unknown                                                 318   1e-103   
ref|XP_010555448.1|  PREDICTED: endochitinase CH25                      317   1e-103   
ref|XP_006367378.1|  PREDICTED: LOW QUALITY PROTEIN: endochitinas...    317   2e-103   
ref|NP_001275122.1|  class I chitinase precursor                        317   2e-103   
gb|AAF69787.1|AF135147_1  class I chitinase                             316   2e-103   
ref|XP_004163409.1|  PREDICTED: endochitinase-like                      317   2e-103   
gb|AAF69784.1|AF135144_1  class I chitinase                             316   2e-103   
gb|AAF69772.1|AF135132_1  class I chitinase                             315   4e-103   
gb|AHF88837.1|  chitinase-like protein                                  317   4e-103   
ref|XP_007157976.1|  hypothetical protein PHAVU_002G114200g             314   4e-103   
gb|AAD11255.1|  class I chitinase                                       315   5e-103   
gb|AAF69791.1|AF135151_1  class I chitinase                             315   6e-103   
ref|XP_002884907.1|  basic endochitinase                                316   7e-103   
gb|KFK38603.1|  basic endochitinase                                     316   7e-103   
gb|AAF25602.1|AF153195_1  class I chitinase                             316   8e-103   
ref|XP_004135003.1|  PREDICTED: endochitinase-like                      315   9e-103   
ref|XP_006367747.1|  PREDICTED: basic 30 kDa endochitinase-like         315   9e-103   
ref|XP_010274239.1|  PREDICTED: basic endochitinase-like                316   1e-102   
emb|CDY50344.1|  BnaC01g38390D                                          317   1e-102   
ref|XP_004290042.1|  PREDICTED: endochitinase CH5B-like                 316   1e-102   
dbj|BAA82818.1|  basic endochitinase                                    315   1e-102   
ref|XP_010672242.1|  PREDICTED: endochitinase-like                      315   2e-102   
dbj|BAA82826.1|  basic endochitinase                                    315   2e-102   
emb|CAA57774.1|  chitinase (class II)                                   312   2e-102   
dbj|BAK04967.1|  predicted protein                                      314   3e-102   
gb|AAF69777.1|AF135137_1  class I chitinase                             314   3e-102   
dbj|BAA82810.1|  basic endochitinase                                    314   3e-102   
ref|NP_566426.2|  basic chitinase B                                     314   3e-102   
dbj|BAB13369.1|  class I chitinase                                      314   3e-102   
gb|AAK96819.1|  basic chitinase                                         314   3e-102   
dbj|BAA82814.1|  basic endochitinase                                    314   3e-102   
emb|CAA07413.1|  chitinase precursor                                    312   4e-102   
gb|AAV66072.1|  chitinase                                               314   4e-102   
ref|XP_006387602.1|  hypothetical protein POPTR_0790s00210g             313   5e-102   
gb|AAC16010.1|  acidic chitinase                                        314   5e-102   
gb|AAF69774.1|AF135134_1  class I chitinase                             312   5e-102   
gb|AAF69788.1|AF135148_1  class I chitinase                             312   6e-102   
pdb|1DXJ|A  Chain A, Structure Of The Chitinase From Jack Bean          310   6e-102   
ref|XP_011045248.1|  PREDICTED: acidic endochitinase WIN6-like          313   6e-102   
gb|AAA56787.1|  chitinase                                               313   8e-102   
gb|AAR18735.1|  chitinase                                               313   1e-101   
gb|AEZ67303.1|  chitinase 4                                             313   1e-101   
dbj|BAA82824.1|  basic endochitinase                                    312   2e-101   
ref|XP_009120632.1|  PREDICTED: endochitinase CH25-like                 311   3e-101   
gb|ADI79351.1|  chitinase                                               311   3e-101   
pdb|2DKV|A  Chain A, Crystal Structure Of Class I Chitinase From ...    311   4e-101   
ref|XP_003547902.2|  PREDICTED: LOW QUALITY PROTEIN: endochitinas...    321   4e-101   
ref|XP_010499059.1|  PREDICTED: basic endochitinase B                   311   5e-101   
gb|AFH78570.1|  class I chitinase-2                                     307   6e-101   
ref|NP_001055476.1|  Os05g0399300                                       311   7e-101   
gb|KEH20361.1|  Chitinase (Class Ib) / Hevein                           310   8e-101   
sp|Q7DNA1.1|CHI2_ORYSJ  RecName: Full=Chitinase 2; AltName: Full=...    311   8e-101   
dbj|BAJ98288.1|  predicted protein                                      311   8e-101   
ref|XP_004134831.1|  PREDICTED: endochitinase CH25-like                 308   8e-101   
ref|XP_006298138.1|  hypothetical protein CARUB_v10014185mg             310   8e-101   
gb|AAF69778.1|AF135138_1  class I chitinase                             309   1e-100   
sp|P16579.2|CHI6_POPTR  RecName: Full=Acidic endochitinase WIN6; ...    310   1e-100   
dbj|BAJ96701.1|  predicted protein                                      310   1e-100   
ref|XP_010465019.1|  PREDICTED: basic endochitinase B-like              310   2e-100   
gb|AAF69776.1|AF135136_1  class I chitinase                             309   2e-100   
gb|AAD34596.1|AF147497_1  endochitinase precursor                       309   2e-100   
ref|XP_009611126.1|  PREDICTED: endochitinase 3-like                    307   2e-100   
ref|XP_004163401.1|  PREDICTED: endochitinase CH25-like                 306   5e-100   
ref|XP_009401886.1|  PREDICTED: basic endochitinase-like                306   6e-100   
ref|XP_002312922.1|  hypothetical protein POPTR_0009s14390g             308   8e-100   
ref|XP_010465018.1|  PREDICTED: basic endochitinase B-like              308   1e-99    
ref|XP_004966507.1|  PREDICTED: chitinase 1-like                        307   1e-99    
gb|AAF69782.1|AF135142_1  class I chitinase                             306   2e-99    
gb|KCW45375.1|  hypothetical protein EUGRSUZ_L00939                     303   2e-99    
ref|XP_002987116.1|  hypothetical protein SELMODRAFT_269217             306   3e-99    
gb|AFK39833.1|  unknown                                                 304   3e-99    
gb|AAF64475.1|AF241267_1  chitinase 2                                   304   5e-99    
ref|XP_006379300.1|  hypothetical protein POPTR_0009s14410g             305   6e-99    
gb|ACN40115.1|  unknown                                                 303   1e-98    
ref|XP_007156221.1|  hypothetical protein PHAVU_003G268500g             304   1e-98    
ref|XP_009587826.1|  PREDICTED: endochitinase-like                      303   2e-98    
gb|AAT09427.1|  class II chitinase                                      301   4e-98    
dbj|BAK02041.1|  predicted protein                                      304   4e-98    
ref|XP_007157975.1|  hypothetical protein PHAVU_002G114100g             301   4e-98    
ref|XP_002987118.1|  hypothetical protein SELMODRAFT_446851             303   5e-98    
gb|ABK25320.1|  unknown                                                 301   6e-98    
gb|ADO32899.1|  chitinase 134                                           300   6e-98    
gb|ADM74277.1|  basic endochitinase-like protein                        300   7e-98    
pdb|2Z37|A  Chain A, Crystal Structure Of Brassica Juncea Chitina...    300   8e-98    
gb|AAF69785.1|AF135145_1  class I chitinase                             302   8e-98    
gb|ADM74271.1|  basic endochitinase-like protein                        300   8e-98    
ref|XP_010232173.1|  PREDICTED: cysteine-rich receptor-like prote...    314   8e-98    
emb|CDP19988.1|  unnamed protein product                                298   9e-98    
gb|ADM74287.1|  basic endochitinase-like protein                        300   9e-98    
pdb|2Z38|A  Chain A, Crystal Structure Of Chloride Bound Brassica...    300   9e-98    
ref|XP_009786482.1|  PREDICTED: endochitinase 3-like                    303   9e-98    
gb|ADM74273.1|  basic endochitinase-like protein                        300   1e-97    
ref|XP_002488863.1|  hypothetical protein SORBIDRAFT_3219s002010        302   1e-97    
ref|XP_002976208.1|  hypothetical protein SELMODRAFT_443112             302   1e-97    
gb|ACN40870.1|  unknown                                                 300   1e-97    
gb|ABK24020.1|  unknown                                                 300   1e-97    
pdb|2Z39|A  Chain A, Crystal Structure Of Brassica Juncea Chitina...    299   1e-97    
gb|ADM74281.1|  basic endochitinase-like protein                        299   2e-97    
gb|ADM74279.1|  basic endochitinase-like protein                        299   2e-97    
gb|AGS43119.1|  chitinase                                               301   2e-97    
ref|XP_003517142.1|  PREDICTED: endochitinase-like                      300   3e-97    
gb|EMT33556.1|  Basic endochitinase A                                   298   2e-96    
sp|P52406.1|CHI4_SOLTU  RecName: Full=Endochitinase 4; Flags: Pre...    298   2e-96    
gb|AAA34214.1|  chitinase                                               299   2e-96    
gb|KHN35972.1|  Endochitinase                                           300   3e-96    
gb|AAA18585.1|  chitinase                                               298   6e-96    
gb|AAF69789.1|AF135149_1  class I chitinase                             297   7e-96    
pir||S18750  chitinase (EC 3.2.1.14) precursor - western balsam p...    298   7e-96 
gb|ABK24203.1|  unknown                                                 295   8e-96    
gb|AAF02299.1|AF098302_1  chitinase                                     300   9e-96    
gb|ADP68560.1|  class 1 chitinase                                       296   1e-95    
gb|AAP35272.1|  chitinase                                               296   1e-95    
gb|EEE63651.1|  hypothetical protein OsJ_18468                          295   2e-95    
sp|P29021.1|CHIT_PETHY  RecName: Full=Acidic endochitinase; Flags...    294   2e-95    
gb|AAP35271.1|  chitinase                                               296   3e-95    
ref|XP_009135232.1|  PREDICTED: endochitinase CH25-like                 299   3e-95    
ref|XP_004985822.1|  PREDICTED: chitinase 11-like                       293   6e-95    
ref|XP_002312916.2|  hypothetical protein POPTR_0009s14400g             296   7e-95    
ref|XP_006387601.1|  hypothetical protein POPTR_0790s00200g             294   2e-94    
gb|EMT27214.1|  Basic endochitinase A                                   293   2e-94    
ref|XP_002441062.1|  hypothetical protein SORBIDRAFT_09g019660          296   2e-94    
ref|XP_009135234.1|  PREDICTED: endochitinase CH25-like                 295   2e-94    
ref|XP_006387600.1|  hypothetical protein POPTR_0790s00200g             294   2e-94    
ref|XP_009417775.1|  PREDICTED: chitinase 10-like                       293   2e-94    
emb|CAA82850.1|  chitinase class I                                      293   3e-94    
gb|KGN48981.1|  hypothetical protein Csa_6G508520                       290   3e-94    
prf||2014210B  chitinase class I:ISOTYPE=CH6                            293   3e-94 
ref|XP_006340817.1|  PREDICTED: acidic 27 kDa endochitinase-like        291   3e-94    
ref|XP_008645097.1|  PREDICTED: LOW QUALITY PROTEIN: basic endoch...    294   6e-94    
ref|XP_008656515.1|  PREDICTED: chitinase 10-like                       292   9e-94    
ref|NP_001048871.1|  Os03g0132900                                       290   1e-93    
ref|XP_003566262.1|  PREDICTED: chitinase 1-like                        294   2e-93    
gb|AIR76996.1|  chitinase 1                                             288   2e-93    
gb|ACN27592.1|  unknown                                                 289   2e-93    
ref|XP_006840381.1|  hypothetical protein AMTR_s00045p00134660          290   2e-93    
dbj|BAG28346.1|  chitinase                                              290   2e-93    
gb|AFW81546.1|  basic endochitinase A                                   292   4e-93    
tpg|DAA43202.1|  TPA: hypothetical protein ZEAMMB73_872241              288   4e-93    
ref|NP_001150560.1|  LOC100284192 precursor                             291   5e-93    
gb|ACH92943.1|  chitinase I                                             286   5e-93    
ref|XP_010231399.1|  PREDICTED: LOW QUALITY PROTEIN: chitinase 2-...    290   6e-93    
ref|XP_006467052.1|  PREDICTED: LOW QUALITY PROTEIN: endochitinas...    289   8e-93    
ref|XP_008448502.1|  PREDICTED: basic endochitinase C-like              290   1e-92    
ref|XP_010666842.1|  PREDICTED: endochitinase-like                      293   2e-92    
ref|NP_001234400.1|  acidic 27 kDa endochitinase precursor              286   2e-92    
ref|XP_010544255.1|  PREDICTED: endochitinase-like isoform X3           290   4e-92    
gb|AAC49718.1|  Pschi4                                                  286   5e-92    
gb|AAA62420.1|  class I acidic chitinase                                286   7e-92    
gb|EAY90476.1|  hypothetical protein OsI_12064                          288   7e-92    
emb|CDY00777.1|  BnaC03g37610D                                          285   9e-92    
ref|NP_001148217.1|  basic endochitinase C precursor                    285   1e-91    
ref|XP_008441134.1|  PREDICTED: endochitinase-like                      285   2e-91    
ref|XP_002439244.1|  hypothetical protein SORBIDRAFT_09g003040          285   2e-91    
ref|NP_001065196.1|  Os10g0542900                                       284   2e-91    
emb|CDY50524.1|  BnaA01g30560D                                          286   2e-91    
gb|EAY79390.1|  hypothetical protein OsI_34517                          284   3e-91    
ref|XP_010909413.1|  PREDICTED: chitinase 10                            285   3e-91    



>gb|KDP43735.1| hypothetical protein JCGZ_22362 [Jatropha curcas]
Length=250

 Score =   366 bits (940),  Expect = 8e-124, Method: Compositional matrix adjust.
 Identities = 176/243 (72%), Positives = 199/243 (82%), Gaps = 2/243 (1%)
 Frame = +3

Query  21   DVSSIISQAIFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAF  200
            DVSS+IS+  F++MLK+R+D  C A  FYTYDAFIAAAKSFG F TTGDLDTRKREVAAF
Sbjct  7    DVSSLISRETFNEMLKHRNDGNCPAKGFYTYDAFIAAAKSFGAFGTTGDLDTRKREVAAF  66

Query  201  LGQTSHETTGGWDAAPDGRYAWGYCFLRE-GTDDPYCNVTQEWSCAPGQKYFGRGPIQIS  377
            LGQTS ETTGGW +APDG YAWGYCF +E G    YC   Q+W CAPG+KY+GRGPIQIS
Sbjct  67   LGQTSQETTGGWASAPDGPYAWGYCFKQEQGNPGDYCVANQQWPCAPGKKYYGRGPIQIS  126

Query  378  YNYNYGAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPSP  557
            YNYNYG AG+A+G DL++NPD VATDPT+SFKTA WFWMTPQ  KPSCH VITG+W PS 
Sbjct  127  YNYNYGPAGRAIGVDLLNNPDAVATDPTISFKTALWFWMTPQSPKPSCHAVITGQWKPSA  186

Query  558  PDTAAGRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCSTQ  737
             DT AGRVPGYG++TNIINGGVECG  G + +   RIGFYKRYCDIF VGYG+NLDC  Q
Sbjct  187  SDTQAGRVPGYGVITNIINGGVECG-KGSNPRVEGRIGFYKRYCDIFKVGYGNNLDCYNQ  245

Query  738  TPY  746
             P+
Sbjct  246  RPF  248



>gb|AET95643.1| chitinase [Camellia sinensis]
Length=322

 Score =   368 bits (945),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 173/246 (70%), Positives = 207/246 (84%), Gaps = 6/246 (2%)
 Frame = +3

Query  21   DVSSIISQAIFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAF  200
            D+SS+IS+ +F+ MLK+R+D+ C    FYTYDAF+AAAKSFG F TTGD DTRKRE+AAF
Sbjct  80   DISSLISRDLFNQMLKHRNDASCPGNGFYTYDAFVAAAKSFGGFGTTGDTDTRKREIAAF  139

Query  201  LGQTSHETTGGWDAAPDGRYAWGYCFLREGTDDP---YCNVTQEWSCAPGQKYFGRGPIQ  371
            L QTSHETTGGW +APDG YAWGYC +RE   +P   YC+ +QEW CAPG++Y+GRGPIQ
Sbjct  140  LAQTSHETTGGWPSAPDGPYAWGYCHVRE--QNPAGDYCSPSQEWPCAPGKQYYGRGPIQ  197

Query  372  ISYNYNYGAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSP  551
            IS+NYNYG AGKA+G DL+ NPDLVATDPT+SFKTAFWFWMTPQ  KPSCHDVITG W+P
Sbjct  198  ISHNYNYGPAGKAIGSDLLGNPDLVATDPTISFKTAFWFWMTPQSPKPSCHDVITGSWTP  257

Query  552  SPPDTAAGRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCS  731
            S  DT+AGRVPGYG++TNIINGG+ECG  G + +  DRIGFYKRYCD+F VGYG+NLDC+
Sbjct  258  SSADTSAGRVPGYGVITNIINGGLECG-KGSNAQAEDRIGFYKRYCDLFGVGYGNNLDCN  316

Query  732  TQTPYS  749
             Q P++
Sbjct  317  NQQPFA  322



>emb|CBI18788.3| unnamed protein product [Vitis vinifera]
Length=285

 Score =   366 bits (940),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 170/244 (70%), Positives = 201/244 (82%), Gaps = 2/244 (1%)
 Frame = +3

Query  21   DVSSIISQAIFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAF  200
            D+SS+IS+++FD+MLK+R+D+ C    FYTY+AFI+A KSFG F TTGD +TRKRE+AAF
Sbjct  43   DISSLISKSLFDEMLKHRNDAACPGKGFYTYEAFISAVKSFGGFGTTGDTNTRKREIAAF  102

Query  201  LGQTSHETTGGWDAAPDGRYAWGYCFLRE-GTDDPYCNVTQEWSCAPGQKYFGRGPIQIS  377
            L QTSHETTGGW  APDG YAWGYCFLRE G    YC   Q+W CA G+KY+GRGPIQIS
Sbjct  103  LAQTSHETTGGWATAPDGPYAWGYCFLREQGNPGDYCVANQQWPCASGKKYYGRGPIQIS  162

Query  378  YNYNYGAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPSP  557
            YNYNYG AGKA+ YDL++NPD VATDPT+SFKTA WFWMTPQ  KPSCH VITG+W+PS 
Sbjct  163  YNYNYGPAGKAINYDLLNNPDAVATDPTISFKTALWFWMTPQSPKPSCHSVITGQWTPSS  222

Query  558  PDTAAGRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCSTQ  737
             DT+AGRVPGYGL+TNIINGG+ECG  G + +  DRIGFYKRYCD+  +GYG NLDC+ Q
Sbjct  223  SDTSAGRVPGYGLITNIINGGIECG-KGSNPQMEDRIGFYKRYCDLMGIGYGSNLDCNNQ  281

Query  738  TPYS  749
             P+S
Sbjct  282  RPFS  285



>emb|CAC14015.1| chitinase [Vitis vinifera]
Length=325

 Score =   367 bits (943),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 170/244 (70%), Positives = 202/244 (83%), Gaps = 2/244 (1%)
 Frame = +3

Query  21   DVSSIISQAIFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAF  200
            D+SS+IS+++FD+MLK+R+D+ C    FYT++AFI+A KSFG F TTGD +TRKRE+AAF
Sbjct  83   DISSLISKSLFDEMLKHRNDAACPGKGFYTHEAFISAVKSFGGFGTTGDTNTRKREIAAF  142

Query  201  LGQTSHETTGGWDAAPDGRYAWGYCFLRE-GTDDPYCNVTQEWSCAPGQKYFGRGPIQIS  377
            L QTSHETTGGW  APDG YAWGYCFLRE G    YC   Q+W CAPG+KY+GRGPIQIS
Sbjct  143  LAQTSHETTGGWATAPDGPYAWGYCFLREQGNPGDYCVANQQWPCAPGKKYYGRGPIQIS  202

Query  378  YNYNYGAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPSP  557
            YNYNYG AGKA+ YDL++NPD VATDPT+SFKTA WFWMTPQ  KPSCH VITG+W+PS 
Sbjct  203  YNYNYGPAGKAINYDLLNNPDAVATDPTISFKTALWFWMTPQSPKPSCHSVITGQWTPSS  262

Query  558  PDTAAGRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCSTQ  737
             DT+AGRVPGYGL+TNIINGG+ECG  G + +  DRIGFYKRYCD+  +GYG NLDC+ Q
Sbjct  263  SDTSAGRVPGYGLITNIINGGIECG-KGSNPQMEDRIGFYKRYCDLMGIGYGSNLDCNNQ  321

Query  738  TPYS  749
             P+S
Sbjct  322  RPFS  325



>emb|CAN62784.1| hypothetical protein VITISV_033490 [Vitis vinifera]
Length=325

 Score =   366 bits (940),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 170/244 (70%), Positives = 201/244 (82%), Gaps = 2/244 (1%)
 Frame = +3

Query  21   DVSSIISQAIFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAF  200
            D+SS+IS+++FD+MLK+R+D+ C    FYT +AFI+A KSFG F TTGD +TRKRE+AAF
Sbjct  83   DISSLISKSLFDEMLKHRNDAACPXKGFYTXEAFISAVKSFGGFGTTGDTNTRKREIAAF  142

Query  201  LGQTSHETTGGWDAAPDGRYAWGYCFLRE-GTDDPYCNVTQEWSCAPGQKYFGRGPIQIS  377
            L QTSHETTGGW  APDG YAWGYCFLRE G    YC   Q+W CAPG+KY+GRGPIQIS
Sbjct  143  LAQTSHETTGGWATAPDGPYAWGYCFLREQGNPGDYCVANQQWPCAPGKKYYGRGPIQIS  202

Query  378  YNYNYGAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPSP  557
            YNYNYG AGKA+ YDL++NPD VATDPT+SFKTA WFWMTPQ  KPSCH VITG+W+PS 
Sbjct  203  YNYNYGPAGKAINYDLLNNPDAVATDPTISFKTALWFWMTPQSPKPSCHSVITGQWTPSS  262

Query  558  PDTAAGRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCSTQ  737
             DT+AGRVPGYGL+TNIINGG+ECG  G + +  DRIGFYKRYCD+  +GYG NLDC+ Q
Sbjct  263  SDTSAGRVPGYGLITNIINGGIECG-KGSNPQMEDRIGFYKRYCDLMGIGYGSNLDCNNQ  321

Query  738  TPYS  749
             P+S
Sbjct  322  RPFS  325



>ref|XP_010033561.1| PREDICTED: basic endochitinase-like [Eucalyptus grandis]
 gb|KCW53252.1| hypothetical protein EUGRSUZ_J02518 [Eucalyptus grandis]
Length=266

 Score =   362 bits (929),  Expect = 7e-122, Method: Compositional matrix adjust.
 Identities = 168/244 (69%), Positives = 199/244 (82%), Gaps = 2/244 (1%)
 Frame = +3

Query  21   DVSSIISQAIFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAF  200
            D+ S+ISQ +F++MLK+R+D  C    FYTYDAFI AA+SFG F TTGD DTRKRE+AAF
Sbjct  24   DIGSLISQDLFNEMLKHRNDGSCPGNGFYTYDAFITAAQSFGGFGTTGDTDTRKREIAAF  83

Query  201  LGQTSHETTGGWDAAPDGRYAWGYCFLRE-GTDDPYCNVTQEWSCAPGQKYFGRGPIQIS  377
            L QTSHETTGGW +APDG YAWGYCFL+E G    YC   Q+W CAPG+KY+GRGPIQIS
Sbjct  84   LAQTSHETTGGWASAPDGPYAWGYCFLQEQGNPGDYCVANQQWPCAPGKKYYGRGPIQIS  143

Query  378  YNYNYGAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPSP  557
            YNYNYG AG+A+  DL++NPD VATDP +SFKTA WFWMTPQ  KPSCHDV+T +W PS 
Sbjct  144  YNYNYGPAGQAINSDLLNNPDAVATDPVISFKTALWFWMTPQSPKPSCHDVVTSQWQPSA  203

Query  558  PDTAAGRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCSTQ  737
             DTAAGRVPGYG++TNIINGG+ECG  G + +  DRIGFYKRYCD+ +VGYG+NLDC TQ
Sbjct  204  ADTAAGRVPGYGVITNIINGGIECG-KGSNAQVEDRIGFYKRYCDLLTVGYGNNLDCYTQ  262

Query  738  TPYS  749
             P++
Sbjct  263  QPFA  266



>ref|XP_007046549.1| Basic chitinase [Theobroma cacao]
 gb|EOX90706.1| Basic chitinase [Theobroma cacao]
Length=263

 Score =   361 bits (927),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 169/244 (69%), Positives = 197/244 (81%), Gaps = 2/244 (1%)
 Frame = +3

Query  21   DVSSIISQAIFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAF  200
            D++ +IS+ +F++MLK+R+D+ C    FYTYD FIAAA SFG F TTGD+DTRKRE+AAF
Sbjct  21   DITPLISRDLFNEMLKHRNDANCPGNGFYTYDGFIAAANSFGAFGTTGDVDTRKREIAAF  80

Query  201  LGQTSHETTGGWDAAPDGRYAWGYCFLRE-GTDDPYCNVTQEWSCAPGQKYFGRGPIQIS  377
            L QTSHETTGGW  APDG YAWGYCF++E G    YC  +QEW C PG+KYFGRGPIQIS
Sbjct  81   LAQTSHETTGGWATAPDGPYAWGYCFVQEQGNPGDYCVASQEWPCVPGKKYFGRGPIQIS  140

Query  378  YNYNYGAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPSP  557
            YNYNYG AGKA+  DL++NPD VA DPT+SFKTA WFWMTPQ  KPSCHDVITG+W PS 
Sbjct  141  YNYNYGPAGKAINVDLLNNPDAVARDPTISFKTALWFWMTPQSPKPSCHDVITGQWKPSA  200

Query  558  PDTAAGRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCSTQ  737
             DTAAGRVPGYG++TNIINGG+ECG  G + +  DRIGFYKRYCDI  V YGDNLDC  Q
Sbjct  201  QDTAAGRVPGYGVITNIINGGIECG-KGSNPQVEDRIGFYKRYCDILQVSYGDNLDCYNQ  259

Query  738  TPYS  749
             P++
Sbjct  260  RPFA  263



>dbj|BAH28788.1| class II chitinase [Vaccinium corymbosum]
Length=264

 Score =   360 bits (924),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 168/244 (69%), Positives = 202/244 (83%), Gaps = 2/244 (1%)
 Frame = +3

Query  21   DVSSIISQAIFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAF  200
            D+SS+IS+A F+ +LK+R+D+ C A  FYTY+AFIAAAK+FG F TTGD  T+KRE+AAF
Sbjct  21   DISSVISKATFEQILKHRNDAACPAKGFYTYEAFIAAAKAFGGFGTTGDAVTKKREIAAF  80

Query  201  LGQTSHETTGGWDAAPDGRYAWGYCFLREGTDDP-YCNVTQEWSCAPGQKYFGRGPIQIS  377
            L QTSHETTGGW  APDG YAWGYCFLRE  + P YC   Q+W CAPG+KY+GRGPIQIS
Sbjct  81   LAQTSHETTGGWATAPDGPYAWGYCFLREQGNPPNYCVANQQWPCAPGKKYYGRGPIQIS  140

Query  378  YNYNYGAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPSP  557
            YNYNYG AG+A+G DL++NPDLVATDPT+SFKTAFWFWMT Q  K S HDVITG+W+PS 
Sbjct  141  YNYNYGPAGRAIGSDLLANPDLVATDPTISFKTAFWFWMTAQSPKASSHDVITGRWTPSA  200

Query  558  PDTAAGRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCSTQ  737
             D+AAGRVPGYG++TNIINGG+ECG  G + ++ DRIGFYKRY DI  V YG+NLDC+ Q
Sbjct  201  ADSAAGRVPGYGVITNIINGGIECG-KGSNAQQQDRIGFYKRYSDILGVPYGNNLDCNNQ  259

Query  738  TPYS  749
             P++
Sbjct  260  RPFN  263



>gb|ABD66068.1| chitinase [Momordica charantia]
Length=314

 Score =   361 bits (927),  Expect = 7e-121, Method: Compositional matrix adjust.
 Identities = 168/243 (69%), Positives = 201/243 (83%), Gaps = 1/243 (0%)
 Frame = +3

Query  21   DVSSIISQAIFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAF  200
            DV  II+ AIFD MLKYR+D+RC +  FY+Y+AFI+A +SF  F TTGD  TRKRE+AAF
Sbjct  73   DVGRIITPAIFDQMLKYRNDARCPSNGFYSYNAFISATRSFPGFGTTGDDATRKRELAAF  132

Query  201  LGQTSHETTGGWDAAPDGRYAWGYCFLREGTDDPYCNVTQEWSCAPGQKYFGRGPIQISY  380
            LGQTSHETTGGW +APDG +AWGYCF+RE   D YC+  Q+W CAPGQKY+GRGPIQ+++
Sbjct  133  LGQTSHETTGGWPSAPDGPFAWGYCFIRERNQDTYCSPNQQWPCAPGQKYYGRGPIQLTH  192

Query  381  NYNYGAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPSPP  560
            NYNYG AG+ALG +L++NPD VATDPTVSFKTA WFWMTPQG KPS HDVI GKW PS  
Sbjct  193  NYNYGPAGRALGLNLLNNPDSVATDPTVSFKTAIWFWMTPQGNKPSSHDVIIGKWQPSGA  252

Query  561  DTAAGRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCSTQT  740
            D+AAGRVPGYG++TNIINGG+ECG  G   + ADRIGF+KRYCDI  +GYG+NLDC+ Q 
Sbjct  253  DSAAGRVPGYGVITNIINGGLECG-RGPDSRVADRIGFFKRYCDILRIGYGNNLDCNNQR  311

Query  741  PYS  749
            P++
Sbjct  312  PFA  314



>gb|KDO71433.1| hypothetical protein CISIN_1g020187mg [Citrus sinensis]
Length=329

 Score =   361 bits (926),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 169/244 (69%), Positives = 196/244 (80%), Gaps = 2/244 (1%)
 Frame = +3

Query  21   DVSSIISQAIFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAF  200
            ++ S+IS+ +F+ +LK+R+D+ C    FYTYDAFIAAAKSFG F TTGD DTRKRE+AAF
Sbjct  86   NIGSLISRDLFEQLLKHRNDAACQGKGFYTYDAFIAAAKSFGAFGTTGDTDTRKREIAAF  145

Query  201  LGQTSHETTGGWDAAPDGRYAWGYCFLRE-GTDDPYCNVTQEWSCAPGQKYFGRGPIQIS  377
            L QTSHETTGGW  APDG YAWGYCF +E G    YC  +Q+W CAPG+KYFGRGPIQIS
Sbjct  146  LAQTSHETTGGWPTAPDGPYAWGYCFKQEQGNPGDYCQPSQQWPCAPGKKYFGRGPIQIS  205

Query  378  YNYNYGAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPSP  557
            YNYNYG AGKA+  DL+ NPD VA DPT+SFKTAFWFWMTPQ  KPSCHDVITG+W PS 
Sbjct  206  YNYNYGPAGKAINVDLLGNPDAVANDPTISFKTAFWFWMTPQSPKPSCHDVITGQWKPSA  265

Query  558  PDTAAGRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCSTQ  737
             DT AGR+PGYG+VTNIINGG+ECG  G +    DRIGFYKRYCDI  V YG+NLDC+ Q
Sbjct  266  SDTQAGRLPGYGVVTNIINGGIECG-KGSNPNAEDRIGFYKRYCDILKVSYGNNLDCNNQ  324

Query  738  TPYS  749
             P++
Sbjct  325  RPFN  328



>gb|ACX42261.1| chitinase [Camellia sinensis]
Length=322

 Score =   360 bits (925),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 170/246 (69%), Positives = 203/246 (83%), Gaps = 6/246 (2%)
 Frame = +3

Query  21   DVSSIISQAIFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAF  200
            D+SS+IS+ +F+ MLK+RDD+ C    FYTYDAF+AAAKSFG F TTGD DTRKRE+AAF
Sbjct  80   DISSLISRDLFNQMLKHRDDASCPGKGFYTYDAFVAAAKSFGGFGTTGDTDTRKREIAAF  139

Query  201  LGQTSHETTGGWDAAPDGRYAWGYCFLREGTDDP---YCNVTQEWSCAPGQKYFGRGPIQ  371
            L QTSHETTGGW +APDG YAWGYC +RE   +P   YC+ +QEW CAPG++Y+GRGPIQ
Sbjct  140  LAQTSHETTGGWPSAPDGPYAWGYCHVRE--QNPAGDYCSASQEWPCAPGKQYYGRGPIQ  197

Query  372  ISYNYNYGAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSP  551
            IS+NYNYG AGKA+G DL+ NPDLVATD T+S KTAFWFWMTPQ  KPSCHDV TG W+P
Sbjct  198  ISHNYNYGPAGKAIGSDLLGNPDLVATDTTISIKTAFWFWMTPQSPKPSCHDVNTGGWTP  257

Query  552  SPPDTAAGRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCS  731
            S  DT+AGRVPGYG++TNIINGG+ECG  G + +  DRIGFYKRYCD+F V YG+NLDC+
Sbjct  258  SSADTSAGRVPGYGVITNIINGGLECG-KGSNAQAEDRIGFYKRYCDLFGVAYGNNLDCN  316

Query  732  TQTPYS  749
             Q P++
Sbjct  317  NQQPFA  322



>gb|AFN85534.1| putative chitinase I precursor [Olea europaea subsp. europaea]
Length=264

 Score =   358 bits (919),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 169/243 (70%), Positives = 199/243 (82%), Gaps = 2/243 (1%)
 Frame = +3

Query  24   VSSIISQAIFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAFL  203
            V SIIS+++FD+MLK+R+D  C A  FYTY+AFIAAA SFG F TTGD DTRKRE+AAFL
Sbjct  23   VDSIISKSLFDEMLKHRNDGNCPANGFYTYEAFIAAANSFGAFGTTGDTDTRKREIAAFL  82

Query  204  GQTSHETTGGWDAAPDGRYAWGYCFLREGTDDP-YCNVTQEWSCAPGQKYFGRGPIQISY  380
             QTSHETTGGW +APDG Y+WGYC+ +E  + P YC  +QEW CAPG+KYFGRGPIQISY
Sbjct  83   AQTSHETTGGWASAPDGPYSWGYCYKQEQGNPPDYCVASQEWPCAPGKKYFGRGPIQISY  142

Query  381  NYNYGAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPSPP  560
            NYNYG AGKA+G DL+++PD VA DPT+SFKTAFWFWMTPQ  KPSCHD ++G W PS  
Sbjct  143  NYNYGPAGKAIGSDLLNDPDAVANDPTISFKTAFWFWMTPQAPKPSCHDAMSGVWKPSAA  202

Query  561  DTAAGRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCSTQT  740
            DTAAGRVPGYG+VTNIINGG+ECG  G + +  DRIGFYKRYCD+  VGYG NLDC+ Q 
Sbjct  203  DTAAGRVPGYGVVTNIINGGIECG-KGSNPQMEDRIGFYKRYCDLLGVGYGPNLDCNNQK  261

Query  741  PYS  749
             ++
Sbjct  262  SFA  264



>ref|XP_010033566.1| PREDICTED: basic endochitinase-like [Eucalyptus grandis]
 gb|KCW53253.1| hypothetical protein EUGRSUZ_J02519 [Eucalyptus grandis]
Length=267

 Score =   357 bits (917),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 168/244 (69%), Positives = 196/244 (80%), Gaps = 2/244 (1%)
 Frame = +3

Query  21   DVSSIISQAIFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAF  200
            D+ S+IS+ +F++MLK+R+D  C A  FYTYDAFI AAKSFG F TTGD DTRKRE+AAF
Sbjct  25   DIGSLISRDLFNEMLKHRNDGNCPAKGFYTYDAFITAAKSFGGFGTTGDTDTRKREIAAF  84

Query  201  LGQTSHETTGGWDAAPDGRYAWGYCFLREGTDDP-YCNVTQEWSCAPGQKYFGRGPIQIS  377
            L QTSHETTGGW +APDG YAWGYC LRE  + P YC   Q+W CAPG+KY+GRGPIQIS
Sbjct  85   LAQTSHETTGGWASAPDGPYAWGYCQLREQGNPPDYCVANQQWPCAPGKKYYGRGPIQIS  144

Query  378  YNYNYGAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPSP  557
            YNYNYG AGKA+  DL++NPD VATDP +SFKTA WFW TPQ  KPSCH V  G+W PS 
Sbjct  145  YNYNYGPAGKAINSDLLNNPDTVATDPVISFKTALWFWTTPQSPKPSCHAVAAGQWQPSA  204

Query  558  PDTAAGRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCSTQ  737
             DTAAGRVPGYG++TNIINGG+ECG  G + +  DRIGFYKRYCD+  VGYG+NLDC TQ
Sbjct  205  ADTAAGRVPGYGVITNIINGGLECG-KGSNPQVQDRIGFYKRYCDLLKVGYGNNLDCYTQ  263

Query  738  TPYS  749
             P++
Sbjct  264  KPFA  267



>gb|AIE39009.1| pathogenesis-related protein 3, partial [Vaccinium virgatum]
Length=259

 Score =   357 bits (915),  Expect = 6e-120, Method: Compositional matrix adjust.
 Identities = 166/244 (68%), Positives = 200/244 (82%), Gaps = 2/244 (1%)
 Frame = +3

Query  21   DVSSIISQAIFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAF  200
            D+SS+IS+A F+ +LK+R+D+ C    FYTY+AFIAAAK+FG F TTGD  T+KRE+AAF
Sbjct  16   DISSVISKATFEQILKHRNDAACPGKGFYTYEAFIAAAKAFGGFGTTGDAVTKKREIAAF  75

Query  201  LGQTSHETTGGWDAAPDGRYAWGYCFLREGTDDP-YCNVTQEWSCAPGQKYFGRGPIQIS  377
            L QTSHETTGGW  APDG YAWGYCFLRE  + P YC   Q+W CAPG+KY+GRGPIQIS
Sbjct  76   LAQTSHETTGGWATAPDGPYAWGYCFLREQGNPPNYCVANQQWPCAPGKKYYGRGPIQIS  135

Query  378  YNYNYGAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPSP  557
            YNYNYG AG+A+G DL++NPDLVATDPT+SFKTA WFWMT Q  KPS HDVITG+W+PS 
Sbjct  136  YNYNYGPAGRAIGSDLLANPDLVATDPTISFKTALWFWMTAQSPKPSSHDVITGRWTPSA  195

Query  558  PDTAAGRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCSTQ  737
             D+A GRVPGYG++TNIINGG+ECG  G + ++ DRIGFYKRY DI  V YG+NLDC+ Q
Sbjct  196  ADSAGGRVPGYGVITNIINGGIECG-KGSNAQQQDRIGFYKRYSDILGVPYGNNLDCNNQ  254

Query  738  TPYS  749
             P++
Sbjct  255  RPFN  258



>ref|XP_010040215.1| PREDICTED: basic endochitinase-like [Eucalyptus grandis]
 gb|KCW45373.1| hypothetical protein EUGRSUZ_L00937 [Eucalyptus grandis]
Length=267

 Score =   357 bits (916),  Expect = 7e-120, Method: Compositional matrix adjust.
 Identities = 168/244 (69%), Positives = 196/244 (80%), Gaps = 2/244 (1%)
 Frame = +3

Query  21   DVSSIISQAIFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAF  200
            D+ S+IS+ +F++MLK+R+D  C A  FYTYDAFI AAKSFG F TTGD DTRKRE+AAF
Sbjct  25   DIGSLISRDLFNEMLKHRNDGNCPAKGFYTYDAFITAAKSFGGFGTTGDTDTRKREIAAF  84

Query  201  LGQTSHETTGGWDAAPDGRYAWGYCFLREGTDDP-YCNVTQEWSCAPGQKYFGRGPIQIS  377
            L QTSHETTGGW +APDG YAWGYC LRE  + P YC   Q+W CAPG+KY+GRGPIQIS
Sbjct  85   LAQTSHETTGGWASAPDGPYAWGYCQLREQGNPPDYCVANQQWPCAPGKKYYGRGPIQIS  144

Query  378  YNYNYGAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPSP  557
            YNYNYG AGKA+  DL++NPD VATDP +SFKTA WFW TPQ  KPSCH V  G+W PS 
Sbjct  145  YNYNYGPAGKAINSDLLNNPDTVATDPIISFKTALWFWTTPQSPKPSCHAVAAGQWQPSA  204

Query  558  PDTAAGRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCSTQ  737
             DTAAGRVPGYG++TNIINGG+ECG  G + +  DRIGFYKRYCD+  VGYG+NLDC TQ
Sbjct  205  ADTAAGRVPGYGVITNIINGGLECG-KGSNPQVQDRIGFYKRYCDLLKVGYGNNLDCYTQ  263

Query  738  TPYS  749
             P++
Sbjct  264  KPFA  267



>ref|XP_002269727.2| PREDICTED: LOW QUALITY PROTEIN: basic endochitinase [Vitis vinifera]
Length=324

 Score =   358 bits (920),  Expect = 9e-120, Method: Compositional matrix adjust.
 Identities = 167/244 (68%), Positives = 200/244 (82%), Gaps = 2/244 (1%)
 Frame = +3

Query  21   DVSSIISQAIFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAF  200
            D+SS+IS ++F+ MLK+R+D+ C    FYTY+AFI+AAKSFG F TTGD DTRKRE+AAF
Sbjct  82   DISSLISNSLFEQMLKHRNDAACPGKGFYTYEAFISAAKSFGGFGTTGDTDTRKREIAAF  141

Query  201  LGQTSHETTGGWDAAPDGRYAWGYCFLRE-GTDDPYCNVTQEWSCAPGQKYFGRGPIQIS  377
            L  TSHETTGGW  APDG YAWGYCF++E G    YC   Q+W CA G+KY+GRGPIQIS
Sbjct  142  LAXTSHETTGGWATAPDGPYAWGYCFVQEQGNPGDYCVANQQWPCAAGKKYYGRGPIQIS  201

Query  378  YNYNYGAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPSP  557
            YNYNYG AG+A+ YDL++NPD VATD T+SFKTA WFWMTPQ  KPSCHDVITG+W+PS 
Sbjct  202  YNYNYGPAGRAINYDLLNNPDAVATDATISFKTALWFWMTPQSPKPSCHDVITGQWTPSS  261

Query  558  PDTAAGRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCSTQ  737
             DTAAGRVPGYG++TNIINGG+ECG  G + +  DRIGFYKRYCDI  +GYG+NLDC  Q
Sbjct  262  ADTAAGRVPGYGVITNIINGGIECG-KGSNAQVEDRIGFYKRYCDIMGIGYGNNLDCYNQ  320

Query  738  TPYS  749
            +P++
Sbjct  321  SPFA  324



>emb|CAB01591.1| endochitinase [Persea americana]
Length=326

 Score =   358 bits (920),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 168/242 (69%), Positives = 198/242 (82%), Gaps = 2/242 (1%)
 Frame = +3

Query  24   VSSIISQAIFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAFL  203
            V+S+ISQ++F+ MLK+R+D+ C A  FYTY+AFIAAA SF  FA+ GD  TRKRE+AAFL
Sbjct  75   VASLISQSVFNQMLKHRNDAACQAKGFYTYNAFIAAANSFNGFASVGDTATRKREIAAFL  134

Query  204  GQTSHETTGGWDAAPDGRYAWGYCFLREGTDDP-YCNVTQEWSCAPGQKYFGRGPIQISY  380
             QTSHETTGGW  APDG YAWGYCFL+E  + P YC  T +W CAPG+KY+GRGPIQISY
Sbjct  135  AQTSHETTGGWATAPDGPYAWGYCFLKEQGNPPDYCVPTAQWPCAPGKKYYGRGPIQISY  194

Query  381  NYNYGAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPSPP  560
            NYNYG AG+A+GYDLI+NPD VATDP +SFKTA WFWMTPQ  KPSCH+VITG+W+PS  
Sbjct  195  NYNYGPAGRAIGYDLINNPDAVATDPVISFKTALWFWMTPQSPKPSCHNVITGRWTPSAA  254

Query  561  DTAAGRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCSTQT  740
            D AAGR+PGYG++TNIINGG+ECG  G +DK ADRIGFYKRYCD+  V YG NLDC  Q 
Sbjct  255  DRAAGRLPGYGVITNIINGGIECG-KGFNDKVADRIGFYKRYCDLLGVSYGSNLDCYNQR  313

Query  741  PY  746
             +
Sbjct  314  SF  315



>ref|XP_010040216.1| PREDICTED: basic endochitinase-like [Eucalyptus grandis]
 gb|KCW45374.1| hypothetical protein EUGRSUZ_L00938 [Eucalyptus grandis]
Length=267

 Score =   356 bits (913),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 167/244 (68%), Positives = 195/244 (80%), Gaps = 2/244 (1%)
 Frame = +3

Query  21   DVSSIISQAIFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAF  200
            D+ S+IS+ +F++MLK+R+D  C A  FYTYDAFI A KSFG F TTGD DTRKRE+AAF
Sbjct  25   DIGSLISRDLFNEMLKHRNDGNCPAKGFYTYDAFITATKSFGGFGTTGDTDTRKREIAAF  84

Query  201  LGQTSHETTGGWDAAPDGRYAWGYCFLREGTDDP-YCNVTQEWSCAPGQKYFGRGPIQIS  377
            L QTSHETTGGW +APDG YAWGYC LRE  + P YC   Q+W CAPG+KY+GRGPIQIS
Sbjct  85   LAQTSHETTGGWASAPDGPYAWGYCQLREQGNPPDYCVANQQWPCAPGKKYYGRGPIQIS  144

Query  378  YNYNYGAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPSP  557
            YNYNYG AGKA+  DL++NPD VATDP +SFKTA WFW TPQ  KPSCH V  G+W PS 
Sbjct  145  YNYNYGPAGKAINSDLLNNPDTVATDPVISFKTALWFWTTPQSPKPSCHAVAAGQWQPSA  204

Query  558  PDTAAGRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCSTQ  737
             DTAAGRVPGYG++TNIINGG+ECG  G + +  DRIGFYKRYCD+  VGYG+NLDC TQ
Sbjct  205  ADTAAGRVPGYGVITNIINGGLECG-KGSNPQVQDRIGFYKRYCDLLKVGYGNNLDCYTQ  263

Query  738  TPYS  749
             P++
Sbjct  264  KPFA  267



>gb|ADK98562.1| putative chitinase [Catharanthus roseus]
Length=263

 Score =   355 bits (910),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 163/244 (67%), Positives = 198/244 (81%), Gaps = 2/244 (1%)
 Frame = +3

Query  21   DVSSIISQAIFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAF  200
             V SI+S+++FD MLK+R+D+ C A  FYTY+AF++AA SFG F TTGD++TRKRE+AAF
Sbjct  21   QVGSIVSKSLFDQMLKHRNDANCAAKGFYTYEAFVSAAGSFGAFGTTGDINTRKREIAAF  80

Query  201  LGQTSHETTGGWDAAPDGRYAWGYCFLRE-GTDDPYCNVTQEWSCAPGQKYFGRGPIQIS  377
            L QTSHETTGGW  APDG YAWGYCF +E G    YC   Q+W CAPG+KYFGRGPIQ+S
Sbjct  81   LAQTSHETTGGWATAPDGPYAWGYCFKQEQGNPSSYCVQNQQWPCAPGKKYFGRGPIQLS  140

Query  378  YNYNYGAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPSP  557
            YNYNYG AG+A+G DL++NPDLVA D T+SFKTA WFWMTPQ  KPS HDV+TG+W PS 
Sbjct  141  YNYNYGPAGRAIGADLLNNPDLVANDATISFKTALWFWMTPQSPKPSSHDVMTGRWRPSG  200

Query  558  PDTAAGRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCSTQ  737
             D+AAGRVPGYG+VTNIINGG+ECG  G + +  +RIGF++RYCDI  V YGDNLDC+ Q
Sbjct  201  ADSAAGRVPGYGVVTNIINGGIECG-KGNNAQMQNRIGFFRRYCDILGVSYGDNLDCANQ  259

Query  738  TPYS  749
             P++
Sbjct  260  RPFA  263



>ref|XP_010242848.1| PREDICTED: basic endochitinase-like [Nelumbo nucifera]
Length=319

 Score =   356 bits (914),  Expect = 7e-119, Method: Compositional matrix adjust.
 Identities = 169/243 (70%), Positives = 199/243 (82%), Gaps = 2/243 (1%)
 Frame = +3

Query  21   DVSSIISQAIFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAF  200
            D++S+IS ++FD++LK+R+D  C A  FYTY+AFIAAA+SF  FATTGD  TRKRE+AAF
Sbjct  67   DITSLISSSLFDEILKHRNDGACPARGFYTYNAFIAAARSFSGFATTGDTTTRKREIAAF  126

Query  201  LGQTSHETTGGWDAAPDGRYAWGYCFLRE-GTDDPYCNVTQEWSCAPGQKYFGRGPIQIS  377
            L QTSHETTGGW  APDG YAWGYCF+RE G    YC+ + +W CA G+KY+GRGPIQIS
Sbjct  127  LAQTSHETTGGWATAPDGPYAWGYCFVREQGNPGDYCSPSPQWPCASGRKYYGRGPIQIS  186

Query  378  YNYNYGAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPSP  557
            YNYNYG AG+A+G DL++NPDLVATDPT+SFKTA WFWMTPQ  KPSCHDVITG+W+PS 
Sbjct  187  YNYNYGPAGRAIGVDLLNNPDLVATDPTISFKTAIWFWMTPQSPKPSCHDVITGQWTPSA  246

Query  558  PDTAAGRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCSTQ  737
             D AAGR PGYG++TNIINGG+ECG  G   + ADRIGFYKRYCDI  V YGDNLDC  Q
Sbjct  247  ADLAAGRAPGYGVITNIINGGIECG-KGYIPQVADRIGFYKRYCDILGVSYGDNLDCYNQ  305

Query  738  TPY  746
             P+
Sbjct  306  KPF  308



>ref|XP_010941404.1| PREDICTED: chitinase 1-like [Elaeis guineensis]
Length=308

 Score =   356 bits (913),  Expect = 9e-119, Method: Compositional matrix adjust.
 Identities = 168/243 (69%), Positives = 197/243 (81%), Gaps = 2/243 (1%)
 Frame = +3

Query  24   VSSIISQAIFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAFL  203
            V+S+IS ++FD MLK+R+D+ C A  FYTY+AFI+AA SF  F TTGD  TRKRE+AAFL
Sbjct  66   VASLISSSLFDQMLKHRNDAACPAKGFYTYNAFISAANSFSGFGTTGDDTTRKREIAAFL  125

Query  204  GQTSHETTGGWDAAPDGRYAWGYCFLREGTDDP-YCNVTQEWSCAPGQKYFGRGPIQISY  380
             QTSHETTGGW  APDG YAWGYCF +E  + P YC  + +W CAPG+KY+GRGPIQISY
Sbjct  126  AQTSHETTGGWATAPDGPYAWGYCFKQEQGNPPDYCVQSSQWPCAPGKKYYGRGPIQISY  185

Query  381  NYNYGAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPSPP  560
            NYNYG AGKA+G DL++NPDLVATDP VSF+TA WFWMTPQ  KPSCHDVITG+W+PS  
Sbjct  186  NYNYGPAGKAIGQDLLNNPDLVATDPVVSFQTALWFWMTPQSPKPSCHDVITGRWTPSAA  245

Query  561  DTAAGRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCSTQT  740
            D AAGRVPGYG++TNIINGG+ECG  G+    ADRIGFYKRYCD+  V YGDNLDC  Q 
Sbjct  246  DRAAGRVPGYGVITNIINGGIECG-KGQDSSVADRIGFYKRYCDLLGVSYGDNLDCYNQR  304

Query  741  PYS  749
            P++
Sbjct  305  PFN  307



>ref|XP_006425314.1| hypothetical protein CICLE_v10026057mg [Citrus clementina]
 gb|ESR38554.1| hypothetical protein CICLE_v10026057mg [Citrus clementina]
Length=329

 Score =   355 bits (912),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 166/244 (68%), Positives = 195/244 (80%), Gaps = 2/244 (1%)
 Frame = +3

Query  21   DVSSIISQAIFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAF  200
            ++ S+IS+ +F+ +LK+R+D+ C    FYTYDAFIAAA SFG F TTG+ DTRKRE+AAF
Sbjct  86   NIGSLISRDLFEQLLKHRNDAACQGKGFYTYDAFIAAANSFGAFGTTGNTDTRKREIAAF  145

Query  201  LGQTSHETTGGWDAAPDGRYAWGYCFLRE-GTDDPYCNVTQEWSCAPGQKYFGRGPIQIS  377
            L QTSHETTGGW  APDG YAWGYCF +E G    YC  +Q+W CAPG+KYFGRGPIQIS
Sbjct  146  LAQTSHETTGGWPTAPDGPYAWGYCFKQEQGNPGDYCQPSQQWPCAPGKKYFGRGPIQIS  205

Query  378  YNYNYGAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPSP  557
            YNYNYG AGKA+  DL+ NPD VA DPT+SFKTAFWFWMT Q  KPSCHDVITG+W PS 
Sbjct  206  YNYNYGPAGKAINVDLLRNPDAVANDPTISFKTAFWFWMTRQSPKPSCHDVITGQWKPSA  265

Query  558  PDTAAGRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCSTQ  737
             DT AGR+PGYG++TNIINGG+ECG  G + K  DRIGFYKRYCDI  V YG+NLDC+ Q
Sbjct  266  ADTQAGRLPGYGVITNIINGGIECG-KGSNPKAEDRIGFYKRYCDILKVSYGNNLDCNNQ  324

Query  738  TPYS  749
             P++
Sbjct  325  RPFN  328



>gb|AAG37276.1|AF320111_1 chitinase [Fragaria x ananassa]
Length=260

 Score =   352 bits (903),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 161/242 (67%), Positives = 199/242 (82%), Gaps = 1/242 (0%)
 Frame = +3

Query  21   DVSSIISQAIFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAF  200
            DV+S+IS ++FD MLKYR+D RC    FY YDAF++AA+SF  F TTGD+ T+K+E+AAF
Sbjct  20   DVASLISPSLFDQMLKYRNDGRCKGNGFYKYDAFVSAARSFNGFGTTGDVATQKKELAAF  79

Query  201  LGQTSHETTGGWDAAPDGRYAWGYCFLREGTDDPYCNVTQEWSCAPGQKYFGRGPIQISY  380
            LGQTSHETTGGW +APDG YAWGYCF++E  +  YC  + ++ CA G+KY+GRGPIQ+++
Sbjct  80   LGQTSHETTGGWPSAPDGPYAWGYCFIKELNEAVYCTPSAQYPCAAGKKYYGRGPIQLTH  139

Query  381  NYNYGAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPSPP  560
            NYNYG AGKA+G DLI+NPDLVATDP +SFKTA WFWMTPQG KPS HDVITG+W+PS  
Sbjct  140  NYNYGPAGKAIGVDLINNPDLVATDPVISFKTAIWFWMTPQGNKPSSHDVITGRWNPSAA  199

Query  561  DTAAGRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCSTQT  740
            D +AGRVPGYG++TNIINGG+ECG  G+ ++ ADRIGFYKRYC +  VG GDNLDC  Q 
Sbjct  200  DRSAGRVPGYGVITNIINGGLECG-RGQDNRVADRIGFYKRYCGMLGVGTGDNLDCYNQR  258

Query  741  PY  746
            P+
Sbjct  259  PF  260



>gb|AAL16893.1|AF420225_1 class II chitinase [Fragaria x ananassa]
Length=260

 Score =   352 bits (903),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 161/242 (67%), Positives = 199/242 (82%), Gaps = 1/242 (0%)
 Frame = +3

Query  21   DVSSIISQAIFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAF  200
            DV+S+IS ++FD MLKYR+D RC    FY YDAF++AA+SF  F TTGD+ T+K+E+AAF
Sbjct  20   DVASLISPSLFDQMLKYRNDGRCKGNGFYKYDAFVSAARSFNGFGTTGDVATQKKELAAF  79

Query  201  LGQTSHETTGGWDAAPDGRYAWGYCFLREGTDDPYCNVTQEWSCAPGQKYFGRGPIQISY  380
            LGQTSHETTGGW +APDG YAWGYCF++E  +  YC  + ++ CA G+KY+GRGPIQ+++
Sbjct  80   LGQTSHETTGGWPSAPDGPYAWGYCFIKELNEAVYCTPSAQYPCAAGKKYYGRGPIQLTH  139

Query  381  NYNYGAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPSPP  560
            NYNYG AGKA+G DLI+NPDLVATDP +SFKTA WFWMTPQG KPS HDVITG+W+PS  
Sbjct  140  NYNYGPAGKAIGVDLINNPDLVATDPVISFKTAIWFWMTPQGNKPSSHDVITGRWNPSAA  199

Query  561  DTAAGRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCSTQT  740
            D +AGRVPGYG++TNIINGG+ECG  G+ ++ ADRIGFYKRYC +  VG GDNLDC  Q 
Sbjct  200  DRSAGRVPGYGVITNIINGGLECG-RGQDNRVADRIGFYKRYCGMLGVGTGDNLDCYNQR  258

Query  741  PY  746
            P+
Sbjct  259  PF  260



>emb|CAA92277.1| chitinase [Gossypium hirsutum]
Length=263

 Score =   352 bits (902),  Expect = 8e-118, Method: Compositional matrix adjust.
 Identities = 166/244 (68%), Positives = 195/244 (80%), Gaps = 2/244 (1%)
 Frame = +3

Query  21   DVSSIISQAIFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAF  200
            D+SS+ISQ +F++MLK+R+D  C    FYTYDAFIAAA SFG F TTGD  TRKRE+AAF
Sbjct  21   DISSLISQDMFNEMLKHRNDGNCPGKGFYTYDAFIAAANSFGAFGTTGDDTTRKREIAAF  80

Query  201  LGQTSHETTGGWDAAPDGRYAWGYCFLRE-GTDDPYCNVTQEWSCAPGQKYFGRGPIQIS  377
            L QTSHETTGGW  APDG YAWGYC+++E G    YC   Q+W CAPG+KYFGRGPIQIS
Sbjct  81   LAQTSHETTGGWPTAPDGPYAWGYCYVQEQGNPGDYCVPNQQWPCAPGKKYFGRGPIQIS  140

Query  378  YNYNYGAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPSP  557
            YNYNYG AG+A+  +++++PDLVA DPT+SFKT  WFWMTPQ  KPS HDVITG+W PS 
Sbjct  141  YNYNYGPAGEAIKANILNDPDLVAKDPTISFKTGLWFWMTPQSPKPSSHDVITGQWKPSA  200

Query  558  PDTAAGRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCSTQ  737
             DTAAGRVPGYG++TNIINGG+ECG  G + +  DRIGFYKRYCDI  V YGDNLDC  Q
Sbjct  201  EDTAAGRVPGYGVITNIINGGIECG-KGSNPQVEDRIGFYKRYCDILKVSYGDNLDCYNQ  259

Query  738  TPYS  749
             P++
Sbjct  260  RPFA  263



>gb|ACJ38195.1| chitinase [Malus hupehensis]
Length=316

 Score =   352 bits (904),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 166/243 (68%), Positives = 198/243 (81%), Gaps = 2/243 (1%)
 Frame = +3

Query  21   DVSSIISQAIFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAF  200
            D+SS+IS ++FD MLKYR+D+RC +  FYTYDAF+AAA+SF  F TTGD  TRKRE+AAF
Sbjct  76   DISSLISSSVFDQMLKYRNDARCKSNGFYTYDAFVAAARSFNGFGTTGDDATRKRELAAF  135

Query  201  LGQTSHETTGGWDAAPDGRYAWGYCFLREGTDDPYCNVTQEWSCAPGQKYFGRGPIQISY  380
            L QTSHETTGGW++APDG YAWGYCF+ E   D YC+  Q + CA G+KY+GRGPIQ+++
Sbjct  136  LAQTSHETTGGWESAPDGPYAWGYCFVNEINQDVYCSSNQ-YPCAAGKKYYGRGPIQLTH  194

Query  381  NYNYGAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPSPP  560
            NYNY  AG+ALG DLI+NPDLVATDP VSFKTA WFWMTPQ  KPS HDVITG WSPS  
Sbjct  195  NYNYAQAGQALGQDLINNPDLVATDPVVSFKTAIWFWMTPQSNKPSSHDVITGTWSPSSE  254

Query  561  DTAAGRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCSTQT  740
            DT+AGRVPGYG++TNIINGG+ECG  G+ D+ A RIGFY+RYC+I  V  GDNLDC  Q 
Sbjct  255  DTSAGRVPGYGVITNIINGGLECGK-GQDDRVASRIGFYRRYCEILGVSPGDNLDCYNQR  313

Query  741  PYS  749
            P++
Sbjct  314  PFA  316



>gb|ABD92819.1| class Ib chitinase [Limonium bicolor]
Length=322

 Score =   352 bits (904),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 168/244 (69%), Positives = 202/244 (83%), Gaps = 3/244 (1%)
 Frame = +3

Query  21   DVSSIISQAIFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAF  200
            DVSSIISQ+ FD+MLK+R+D+ C    FYTY AFI+AA+SF  F TTGD DTRKRE+AAF
Sbjct  81   DVSSIISQSNFDEMLKHRNDNACSGHGFYTYAAFISAAQSFPGFGTTGDTDTRKRELAAF  140

Query  201  LGQTSHETTGGWDAAPDGRYAWGYCFLRE-GTDDPYCNVTQEWSCAPGQKYFGRGPIQIS  377
            LGQTSHETTGGW AAPDG YAWGYCF++E G    +C  + E+ CAPG++Y+GRGPIQ++
Sbjct  141  LGQTSHETTGGWAAAPDGPYAWGYCFVQEQGASGAFC-TSPEYPCAPGKQYYGRGPIQLT  199

Query  378  YNYNYGAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPSP  557
            +NYNY  AG A+  DLI+NPDLVATDPT+SFKTA WFWMTPQ  KPS HDVITGKW+PS 
Sbjct  200  HNYNYAQAGTAINQDLINNPDLVATDPTISFKTAIWFWMTPQSNKPSSHDVITGKWTPSS  259

Query  558  PDTAAGRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCSTQ  737
             D+AAGRVPGYG++TNIINGG+ECG  G   K+ DRIGFYKRYCD+  VGYG+NLDC++Q
Sbjct  260  ADSAAGRVPGYGVITNIINGGLECG-KGSIAKQEDRIGFYKRYCDVLGVGYGNNLDCNSQ  318

Query  738  TPYS  749
             P++
Sbjct  319  RPFA  322



>ref|XP_009344657.1| PREDICTED: endochitinase-like [Pyrus x bretschneideri]
Length=316

 Score =   352 bits (902),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 164/243 (67%), Positives = 196/243 (81%), Gaps = 1/243 (0%)
 Frame = +3

Query  21   DVSSIISQAIFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAF  200
            D+SS++S ++FD MLKYR+D RC +  FY YDAFIAAA+SF  F TTGD+ TRK+E+AAF
Sbjct  75   DISSLVSSSVFDQMLKYRNDGRCPSNGFYKYDAFIAAARSFNGFGTTGDVATRKKELAAF  134

Query  201  LGQTSHETTGGWDAAPDGRYAWGYCFLREGTDDPYCNVTQEWSCAPGQKYFGRGPIQISY  380
            L QTSHETTGGW +APDG YAWGYCF+ E   D YC  + ++ CA G+KY+GRGPIQ+++
Sbjct  135  LAQTSHETTGGWASAPDGPYAWGYCFVNERNQDVYCTPSSQYPCATGKKYYGRGPIQLTH  194

Query  381  NYNYGAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPSPP  560
            NYNYG AGKA+G DLI+NPDLVATDP VSFKTA WFWMTPQG KPS HDVITG+WSPS  
Sbjct  195  NYNYGQAGKAIGKDLINNPDLVATDPVVSFKTAIWFWMTPQGNKPSSHDVITGRWSPSTA  254

Query  561  DTAAGRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCSTQT  740
            D +AGRVPGYG++TNIINGGVECG  G+  + A RIGFY+RYC I  V  GDNLDC  Q 
Sbjct  255  DRSAGRVPGYGVITNIINGGVECG-KGQDARVASRIGFYRRYCQILGVNPGDNLDCYNQR  313

Query  741  PYS  749
            P++
Sbjct  314  PFA  316



>dbj|BAF47270.1| chitinase C [Ananas comosus]
Length=333

 Score =   352 bits (904),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 167/243 (69%), Positives = 198/243 (81%), Gaps = 2/243 (1%)
 Frame = +3

Query  24   VSSIISQAIFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAFL  203
            V+SI+S A+FD++L +R+D+ C A  FY Y+AFIAAA +F  F TTGDLDTRKRE+AAFL
Sbjct  86   VASIVSAALFDELLLHRNDAACPAHGFYQYEAFIAAANAFVGFGTTGDLDTRKREIAAFL  145

Query  204  GQTSHETTGGWDAAPDGRYAWGYCFLRE-GTDDPYCNVTQEWSCAPGQKYFGRGPIQISY  380
             QTSHETTGGW  APDG YAWGYCFL E G    YC  + +W CAPG+KY+GRGPIQISY
Sbjct  146  AQTSHETTGGWPTAPDGPYAWGYCFLEEVGATADYCVPSTQWPCAPGKKYYGRGPIQISY  205

Query  381  NYNYGAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPSPP  560
            NYNYG AG+ALG DL++NPDLVATDPT+SF+TA WFWMTPQ  KPSCHDVIT +W+PS  
Sbjct  206  NYNYGLAGEALGVDLLNNPDLVATDPTISFETALWFWMTPQSPKPSCHDVITDRWTPSAA  265

Query  561  DTAAGRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCSTQT  740
            D +AGR+PGYG++TNIINGG+ECG  G   + ADRIGFYKRYCDIF + YGDNLDC  Q 
Sbjct  266  DVSAGRLPGYGVITNIINGGLECG-IGPDSRVADRIGFYKRYCDIFGISYGDNLDCYDQK  324

Query  741  PYS  749
            P++
Sbjct  325  PFN  327



>emb|CDJ26692.1| unnamed protein product [Triticum aestivum]
Length=320

 Score =   352 bits (902),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 170/243 (70%), Positives = 194/243 (80%), Gaps = 2/243 (1%)
 Frame = +3

Query  24   VSSIISQAIFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAFL  203
            VSSIISQ++FD ML +R+D+ C A  FY Y AF+AAA SF  FATTG  D RKREVAAFL
Sbjct  79   VSSIISQSLFDQMLLHRNDAACQAKGFYNYGAFVAAANSFSGFATTGGADVRKREVAAFL  138

Query  204  GQTSHETTGGWDAAPDGRYAWGYCFLRE-GTDDPYCNVTQEWSCAPGQKYFGRGPIQISY  380
             QTSHETTGGW  APDG Y+WGYCF +E G    YC+   +W CAPG+KYFGRGPIQISY
Sbjct  139  AQTSHETTGGWPTAPDGPYSWGYCFNQERGAASDYCSPNSQWPCAPGKKYFGRGPIQISY  198

Query  381  NYNYGAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPSPP  560
            NYNYG AG+A+G DL++NPDLVATD TVSFKTA WFWMTPQ  KPS HDVITG+WSPS  
Sbjct  199  NYNYGPAGRAIGTDLLNNPDLVATDATVSFKTALWFWMTPQSPKPSSHDVITGRWSPSGA  258

Query  561  DTAAGRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCSTQT  740
            D AAGRVPGYG++TNIINGG+ECG  G+  + ADRIGFYKRYCD+  V YGDNLDC  Q 
Sbjct  259  DQAAGRVPGYGVITNIINGGLECG-RGQDGRVADRIGFYKRYCDLLGVSYGDNLDCYNQR  317

Query  741  PYS  749
            P++
Sbjct  318  PFA  320



>ref|XP_008393545.1| PREDICTED: endochitinase-like [Malus domestica]
Length=317

 Score =   351 bits (901),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 165/243 (68%), Positives = 198/243 (81%), Gaps = 2/243 (1%)
 Frame = +3

Query  21   DVSSIISQAIFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAF  200
            D+SS+IS ++FD MLKYR+D+RC +  FYTYDAF+AAA+SF  F TTGD  TRKRE+AAF
Sbjct  76   DISSLISSSVFDQMLKYRNDARCQSNGFYTYDAFVAAARSFNGFGTTGDDATRKRELAAF  135

Query  201  LGQTSHETTGGWDAAPDGRYAWGYCFLREGTDDPYCNVTQEWSCAPGQKYFGRGPIQISY  380
            L QTSHETTGGW++APDG YAWGYCF+ E   D YC+  Q + CA G+KY+GRGPIQ+++
Sbjct  136  LAQTSHETTGGWESAPDGPYAWGYCFVNEINQDVYCSSNQ-YPCAAGKKYYGRGPIQLTH  194

Query  381  NYNYGAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPSPP  560
            NYNY  AG+ALG DLI+NPDLVATDP VSF+TA WFWMTPQ  KPS HDVITG WSPS  
Sbjct  195  NYNYXQAGQALGQDLINNPDLVATDPVVSFRTAIWFWMTPQSNKPSSHDVITGTWSPSSA  254

Query  561  DTAAGRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCSTQT  740
            DT+AGRVPGYG++TNIINGG+ECG  G+ D+ A RIGFY+RYC+I  V  GDNLDC  Q 
Sbjct  255  DTSAGRVPGYGVITNIINGGLECGK-GQDDRVASRIGFYRRYCEILGVSPGDNLDCYNQR  313

Query  741  PYS  749
            P++
Sbjct  314  PFA  316



>ref|XP_008344215.1| PREDICTED: endochitinase-like [Malus domestica]
Length=319

 Score =   351 bits (901),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 165/243 (68%), Positives = 198/243 (81%), Gaps = 2/243 (1%)
 Frame = +3

Query  21   DVSSIISQAIFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAF  200
            D+SS+IS ++FD MLKYR+D+RC +  FYTYDAF+AAA+SF  F TTGD  TRKRE+AAF
Sbjct  78   DISSLISSSVFDQMLKYRNDARCQSNGFYTYDAFVAAARSFNGFGTTGDDATRKRELAAF  137

Query  201  LGQTSHETTGGWDAAPDGRYAWGYCFLREGTDDPYCNVTQEWSCAPGQKYFGRGPIQISY  380
            L QTSHETTGGW++APDG YAWGYCF+ E   D YC+  Q + CA G+KY+GRGPIQ+++
Sbjct  138  LAQTSHETTGGWESAPDGPYAWGYCFVNEINQDVYCSSNQ-YPCAAGKKYYGRGPIQLTH  196

Query  381  NYNYGAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPSPP  560
            NYNY  AG+ALG DLI+NPDLVATDP VSF+TA WFWMTPQ  KPS HDVITG WSPS  
Sbjct  197  NYNYXQAGQALGQDLINNPDLVATDPVVSFRTAIWFWMTPQSNKPSSHDVITGTWSPSSA  256

Query  561  DTAAGRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCSTQT  740
            DT+AGRVPGYG++TNIINGG+ECG  G+ D+ A RIGFY+RYC+I  V  GDNLDC  Q 
Sbjct  257  DTSAGRVPGYGVITNIINGGLECGK-GQDDRVASRIGFYRRYCEILGVSPGDNLDCYNQR  315

Query  741  PYS  749
            P++
Sbjct  316  PFA  318



>emb|CAA53626.1| endochitinase [Triticum aestivum]
Length=320

 Score =   351 bits (901),  Expect = 8e-117, Method: Compositional matrix adjust.
 Identities = 170/243 (70%), Positives = 194/243 (80%), Gaps = 2/243 (1%)
 Frame = +3

Query  24   VSSIISQAIFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAFL  203
            VSSIISQ++FD ML +R+D+ C A  FY Y AF+AAA SF  FATTG  D RKREVAAFL
Sbjct  79   VSSIISQSLFDQMLLHRNDAACQAKGFYNYGAFVAAANSFSGFATTGGADVRKREVAAFL  138

Query  204  GQTSHETTGGWDAAPDGRYAWGYCFLRE-GTDDPYCNVTQEWSCAPGQKYFGRGPIQISY  380
             QTSHETTGGW  APDG Y+WGYCF +E G    YC+   +W CAPG+KYFGRGPIQISY
Sbjct  139  AQTSHETTGGWPTAPDGPYSWGYCFNQERGAASDYCSPNSQWPCAPGKKYFGRGPIQISY  198

Query  381  NYNYGAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPSPP  560
            NYNYG AG+A+G DL++NPDLVATD TVSFKTA WFWMTPQ  KPS HDVITG+WSPS  
Sbjct  199  NYNYGPAGRAIGTDLLNNPDLVATDATVSFKTALWFWMTPQSPKPSSHDVITGRWSPSGA  258

Query  561  DTAAGRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCSTQT  740
            D AAGRVPGYG++TNIINGG+ECG  G+  + ADRIGFYKRYCD+  V YGDNLDC  Q 
Sbjct  259  DQAAGRVPGYGVITNIINGGLECG-RGQDGRVADRIGFYKRYCDLLGVTYGDNLDCYNQR  317

Query  741  PYS  749
            P++
Sbjct  318  PFA  320



>gb|ACJ23248.1| class I chitinase [Festuca arundinacea]
Length=316

 Score =   350 bits (899),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 168/243 (69%), Positives = 195/243 (80%), Gaps = 2/243 (1%)
 Frame = +3

Query  24   VSSIISQAIFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAFL  203
            VSSIISQ++FD ML +R+D+ C A  FY Y+AFIAAA  F  FATTG  D RKREVAAFL
Sbjct  75   VSSIISQSLFDQMLLHRNDAACPAKGFYNYNAFIAAANFFSGFATTGSTDVRKREVAAFL  134

Query  204  GQTSHETTGGWDAAPDGRYAWGYCFLRE-GTDDPYCNVTQEWSCAPGQKYFGRGPIQISY  380
             QTSHETTGGW  APDG Y+WGYCF +E G    YC+ + +W CA G+KY+GRGPIQISY
Sbjct  135  AQTSHETTGGWATAPDGPYSWGYCFKQEQGATSDYCSPSSQWPCAAGKKYYGRGPIQISY  194

Query  381  NYNYGAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPSPP  560
            NYNYG AGKA+G DL+ NPDLVATD TVSFKTA WFWMTPQ  KPS H+VITG+WSPS  
Sbjct  195  NYNYGPAGKAIGSDLLGNPDLVATDATVSFKTALWFWMTPQSPKPSSHNVITGRWSPSAA  254

Query  561  DTAAGRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCSTQT  740
            D AAGRVPGYG++TNIINGG+ECG  G+ ++ ADRIGFYKRYCD+  V YGDNLDC +Q 
Sbjct  255  DKAAGRVPGYGVITNIINGGLECG-KGQDNRVADRIGFYKRYCDLLGVSYGDNLDCYSQR  313

Query  741  PYS  749
            P++
Sbjct  314  PFA  316



>gb|AHY24795.1| endochitinase [Triticum aestivum]
Length=320

 Score =   350 bits (898),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 169/243 (70%), Positives = 194/243 (80%), Gaps = 2/243 (1%)
 Frame = +3

Query  24   VSSIISQAIFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAFL  203
            VSSIISQ++FD ML +R+D+ C A  FY Y AF+AAA SF  FATTG  D RKREVAAFL
Sbjct  79   VSSIISQSLFDQMLLHRNDAACQAKGFYNYGAFVAAANSFSGFATTGGADVRKREVAAFL  138

Query  204  GQTSHETTGGWDAAPDGRYAWGYCFLRE-GTDDPYCNVTQEWSCAPGQKYFGRGPIQISY  380
             QTSHETTGGW  APDG Y+WGYCF +E G    YC+   +W CAPG+KYFGRGPIQISY
Sbjct  139  AQTSHETTGGWPTAPDGPYSWGYCFNQERGAASDYCSPNSQWPCAPGKKYFGRGPIQISY  198

Query  381  NYNYGAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPSPP  560
            NYNYG AG+A+G DL++NPDLVAT+ TVSFKTA WFWMTPQ  KPS HDVITG+WSPS  
Sbjct  199  NYNYGPAGRAIGTDLLNNPDLVATNATVSFKTALWFWMTPQSPKPSSHDVITGRWSPSGA  258

Query  561  DTAAGRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCSTQT  740
            D AAGRVPGYG++TNIINGG+ECG  G+  + ADRIGFYKRYCD+  V YGDNLDC  Q 
Sbjct  259  DQAAGRVPGYGVITNIINGGLECG-RGQDGRVADRIGFYKRYCDLLGVSYGDNLDCYNQR  317

Query  741  PYS  749
            P++
Sbjct  318  PFA  320



>gb|AHY24793.1| endochitinase [Triticum aestivum]
Length=318

 Score =   350 bits (898),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 169/243 (70%), Positives = 194/243 (80%), Gaps = 2/243 (1%)
 Frame = +3

Query  24   VSSIISQAIFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAFL  203
            VSSIISQ++FD ML +R+D+ C A  FY Y AF+AAA SF  FATTG  D RKREVAAFL
Sbjct  77   VSSIISQSLFDQMLLHRNDAACQAKGFYNYGAFVAAANSFSGFATTGGTDVRKREVAAFL  136

Query  204  GQTSHETTGGWDAAPDGRYAWGYCFLRE-GTDDPYCNVTQEWSCAPGQKYFGRGPIQISY  380
             QTSHETTGGW  APDG Y+WGYCF +E G    YC  + +W CAPG+KYFGRGPIQIS+
Sbjct  137  AQTSHETTGGWPTAPDGPYSWGYCFNQERGATSDYCTPSSQWPCAPGKKYFGRGPIQISH  196

Query  381  NYNYGAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPSPP  560
            NYNYG AG+A+G DL++NPDLVATD TVSFKTA WFWMTPQ  KPS HDVITG+WSPS  
Sbjct  197  NYNYGPAGQAIGTDLLNNPDLVATDATVSFKTALWFWMTPQSPKPSSHDVITGRWSPSGT  256

Query  561  DTAAGRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCSTQT  740
            D AAGRVPGYG++TNIINGG+ECG  G+  + ADRIGFYKRYCD+  V YGDNLDC  Q 
Sbjct  257  DQAAGRVPGYGVITNIINGGLECG-RGQDARVADRIGFYKRYCDLLGVSYGDNLDCYNQR  315

Query  741  PYS  749
            P++
Sbjct  316  PFA  318



>gb|ACE79210.1| chi31 [Limonium bicolor]
Length=326

 Score =   350 bits (898),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 167/241 (69%), Positives = 200/241 (83%), Gaps = 3/241 (1%)
 Frame = +3

Query  21   DVSSIISQAIFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAF  200
            DVSSIISQ+ FD+MLK+R+D+ C    FYTY AFI+AA+SF  F TTGD DTRKRE+AAF
Sbjct  81   DVSSIISQSNFDEMLKHRNDNACSGHGFYTYAAFISAAQSFPGFGTTGDTDTRKRELAAF  140

Query  201  LGQTSHETTGGWDAAPDGRYAWGYCFLRE-GTDDPYCNVTQEWSCAPGQKYFGRGPIQIS  377
            LGQTSHETTGGW AAPDG YAWGYCF++E G    +C  + E+ CAPG++Y+GRGPIQ++
Sbjct  141  LGQTSHETTGGWAAAPDGPYAWGYCFVQEQGASGAFC-TSPEYPCAPGKQYYGRGPIQLT  199

Query  378  YNYNYGAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPSP  557
            +NYNY  AG A+  DLI+NPDLVATDPT+SFKTA WFWMTPQ  KPS HDVITGKW+PS 
Sbjct  200  HNYNYAQAGTAINQDLINNPDLVATDPTISFKTAIWFWMTPQSNKPSSHDVITGKWTPSS  259

Query  558  PDTAAGRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCSTQ  737
             D+AAGRVPGYG++TNIINGG+ECG  G   K+ DRIGFYKRYCD+  VGYG+NLDC++Q
Sbjct  260  ADSAAGRVPGYGVITNIINGGLECG-KGSIAKQEDRIGFYKRYCDVLGVGYGNNLDCNSQ  318

Query  738  T  740
            +
Sbjct  319  S  319



>gb|ACM45713.1| class I chitinase [Pyrus pyrifolia]
Length=317

 Score =   350 bits (897),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 164/243 (67%), Positives = 194/243 (80%), Gaps = 1/243 (0%)
 Frame = +3

Query  21   DVSSIISQAIFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAF  200
            DVSS+IS ++FD MLKYR+D RC +  FY YDAFI AA+SF  F TTGD+ TRK+E+ AF
Sbjct  76   DVSSLISSSVFDQMLKYRNDGRCPSNGFYKYDAFITAARSFNGFGTTGDVATRKKELVAF  135

Query  201  LGQTSHETTGGWDAAPDGRYAWGYCFLREGTDDPYCNVTQEWSCAPGQKYFGRGPIQISY  380
            L QTSHETTGGW +APDG YAWGYCF+ E   D YC  + ++ CA G+KY+GRGPIQ+++
Sbjct  136  LAQTSHETTGGWASAPDGPYAWGYCFVNERNQDVYCTPSSQYPCAAGKKYYGRGPIQLTH  195

Query  381  NYNYGAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPSPP  560
            NYNYG AGKA+G DLI+NPDLVATDP VSFKTA WFWMTPQG KPS HDVITG+WSPS  
Sbjct  196  NYNYGQAGKAIGKDLINNPDLVATDPVVSFKTAIWFWMTPQGNKPSSHDVITGRWSPSTA  255

Query  561  DTAAGRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCSTQT  740
            D +AGRVPGYG++TNIINGGVECG  G+  + A RIGFY+RYC I  V  GDNLDC  Q 
Sbjct  256  DRSAGRVPGYGVITNIINGGVECG-KGQDARVASRIGFYRRYCQILGVNPGDNLDCYNQR  314

Query  741  PYS  749
            P++
Sbjct  315  PFA  317



>ref|XP_009337094.1| PREDICTED: endochitinase-like [Pyrus x bretschneideri]
Length=317

 Score =   349 bits (896),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 161/243 (66%), Positives = 196/243 (81%), Gaps = 1/243 (0%)
 Frame = +3

Query  21   DVSSIISQAIFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAF  200
            DVSS++  ++FD MLKYR+D+RC +  FY YDAFI AA+SF  F TTGD+ TRK+E+ AF
Sbjct  76   DVSSLLGSSVFDQMLKYRNDARCPSNGFYKYDAFITAARSFNGFGTTGDVATRKKELVAF  135

Query  201  LGQTSHETTGGWDAAPDGRYAWGYCFLREGTDDPYCNVTQEWSCAPGQKYFGRGPIQISY  380
            L QTSHETTGGW +APDG YAWGYCF+ E   D YC  + ++ CA G+KY+GRGPIQ+++
Sbjct  136  LAQTSHETTGGWASAPDGPYAWGYCFVNEQNQDVYCTPSNQYPCAAGKKYYGRGPIQLTH  195

Query  381  NYNYGAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPSPP  560
            NYNYG AG+A+G DLI+NPDLVATDP VSF+TA WFWMTPQG KPS HDVITG+WSPS  
Sbjct  196  NYNYGQAGQAIGKDLINNPDLVATDPVVSFRTAIWFWMTPQGNKPSSHDVITGRWSPSSA  255

Query  561  DTAAGRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCSTQT  740
            DT+AGRVPGYG++TNIINGG+ECG  G+  + A RIGFY+RYC+I  V  GDNLDC  Q 
Sbjct  256  DTSAGRVPGYGVITNIINGGLECG-KGQDARVASRIGFYRRYCEILQVSPGDNLDCYNQR  314

Query  741  PYS  749
            P+S
Sbjct  315  PFS  317



>gb|KHG04995.1| Basic endochitinase [Gossypium arboreum]
Length=263

 Score =   347 bits (891),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 165/244 (68%), Positives = 192/244 (79%), Gaps = 2/244 (1%)
 Frame = +3

Query  21   DVSSIISQAIFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAF  200
            D+SS ISQ +F++MLK+R+D  C    FYTYDAFIAAA SFG F  TGD  TRKRE+AAF
Sbjct  21   DISSFISQDMFNEMLKHRNDGNCPGNGFYTYDAFIAAANSFGAFGATGDDATRKREIAAF  80

Query  201  LGQTSHETTGGWDAAPDGRYAWGYCFLRE-GTDDPYCNVTQEWSCAPGQKYFGRGPIQIS  377
            L QTSHETTGGW  APDG YAWGYC+++E G    YC   Q+W CAPG+KYFGRGPIQIS
Sbjct  81   LAQTSHETTGGWPTAPDGPYAWGYCYVQEQGNPGDYCVANQQWPCAPGKKYFGRGPIQIS  140

Query  378  YNYNYGAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPSP  557
            YNYNYG AG+A+  D++++PDLVA DPT+SFKT  WFWMTPQ  KPS H VITG+W PS 
Sbjct  141  YNYNYGPAGEAIKADILNDPDLVAKDPTISFKTGLWFWMTPQSPKPSSHGVITGQWKPSA  200

Query  558  PDTAAGRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCSTQ  737
             DTAAGRVPGYG++TNIINGG+ECG  G + +  DRIGFYKRYCDI  V YGDNLDC  Q
Sbjct  201  EDTAAGRVPGYGVITNIINGGIECG-KGSNPQVEDRIGFYKRYCDILKVSYGDNLDCYNQ  259

Query  738  TPYS  749
             P++
Sbjct  260  RPFA  263



>ref|XP_008812110.1| PREDICTED: chitinase 3-like [Phoenix dactylifera]
Length=319

 Score =   349 bits (896),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 166/243 (68%), Positives = 193/243 (79%), Gaps = 2/243 (1%)
 Frame = +3

Query  24   VSSIISQAIFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAFL  203
            V+S+IS ++FD MLK+R+D+ C A  FYTY+AFI AA SF  F TTGD   RKRE+AAFL
Sbjct  77   VASLISSSLFDQMLKHRNDAACQAKGFYTYNAFITAANSFAGFGTTGDDTIRKREIAAFL  136

Query  204  GQTSHETTGGWDAAPDGRYAWGYCFLREGTDDP-YCNVTQEWSCAPGQKYFGRGPIQISY  380
             QTSHETTGGW  APDG YAWGYCF +E  + P YC  + +W CA G+KY+GRGPIQISY
Sbjct  137  AQTSHETTGGWATAPDGPYAWGYCFKQEQGNPPAYCVQSAQWPCAAGKKYYGRGPIQISY  196

Query  381  NYNYGAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPSPP  560
            NYNYG AGKA+G DL++NPDLVATDP VSFKTA WFWMTPQ  KPS H+VITG+W+PS  
Sbjct  197  NYNYGPAGKAIGQDLLNNPDLVATDPVVSFKTALWFWMTPQSPKPSSHNVITGQWTPSAA  256

Query  561  DTAAGRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCSTQT  740
            D AAGRVPGYG++TNIINGG+ECG  G+    ADRIGFYKRYCDI  V YGDNLDC  Q 
Sbjct  257  DRAAGRVPGYGVITNIINGGIECG-KGQDSSVADRIGFYKRYCDILGVSYGDNLDCYNQR  315

Query  741  PYS  749
            P++
Sbjct  316  PFN  318



>ref|XP_009344658.1| PREDICTED: endochitinase-like [Pyrus x bretschneideri]
Length=323

 Score =   350 bits (897),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 166/243 (68%), Positives = 197/243 (81%), Gaps = 2/243 (1%)
 Frame = +3

Query  21   DVSSIISQAIFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAF  200
            D+SS+IS ++FD MLKYR+D RC +  FYTYDAF+AAA+SF  F TTGD  TRKRE+AAF
Sbjct  83   DISSLISSSVFDQMLKYRNDPRCQSNGFYTYDAFVAAARSFNGFGTTGDDATRKRELAAF  142

Query  201  LGQTSHETTGGWDAAPDGRYAWGYCFLREGTDDPYCNVTQEWSCAPGQKYFGRGPIQISY  380
            LGQTSHETTGGW++APDG YAWGYCF+ E   D YC+  Q + CA G+KY+GRGPIQ+++
Sbjct  143  LGQTSHETTGGWESAPDGPYAWGYCFVNEINQDVYCSSNQ-YPCAAGKKYYGRGPIQLTH  201

Query  381  NYNYGAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPSPP  560
            NYNYG AG A+G DLI+NPDLVATDP VSF+TA WFWMTPQ  KPS HDVITG WSPS  
Sbjct  202  NYNYGQAGPAIGKDLINNPDLVATDPVVSFRTAIWFWMTPQSNKPSSHDVITGTWSPSSA  261

Query  561  DTAAGRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCSTQT  740
            DT+AGRVPGYG++TNIINGG+ECG  G+  K A RIGFY+RYC+I  V  GDNLDC  Q 
Sbjct  262  DTSAGRVPGYGVITNIINGGLECG-KGQDAKVASRIGFYRRYCEILGVSPGDNLDCYNQR  320

Query  741  PYS  749
            P++
Sbjct  321  PFA  323



>gb|AAF04454.1|AF000966_1 chitinase [Poa pratensis]
Length=320

 Score =   349 bits (896),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 166/242 (69%), Positives = 195/242 (81%), Gaps = 2/242 (1%)
 Frame = +3

Query  24   VSSIISQAIFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAFL  203
            VSSI+SQ++F+ ML +R+D+ C A  FYTY+AFIAAA SF  F TTG  D RKREVAAFL
Sbjct  78   VSSIVSQSLFEQMLLHRNDAACLAKGFYTYNAFIAAANSFAGFGTTGSTDVRKREVAAFL  137

Query  204  GQTSHETTGGWDAAPDGRYAWGYCFLRE-GTDDPYCNVTQEWSCAPGQKYFGRGPIQISY  380
             QTSHETTGGW  APDG Y+WGYCF +E G    YC+ + +W CAPG+KYFGRGPIQISY
Sbjct  138  AQTSHETTGGWPTAPDGPYSWGYCFKQEQGATSDYCSPSSQWPCAPGKKYFGRGPIQISY  197

Query  381  NYNYGAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPSPP  560
            NYNYG AG+A+  DL++NPDLVATDPTVSFKTA WFWMT Q  KPS H VITG+WSPS  
Sbjct  198  NYNYGPAGQAIQTDLLNNPDLVATDPTVSFKTALWFWMTAQSPKPSSHAVITGQWSPSSA  257

Query  561  DTAAGRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCSTQT  740
            D AAGRVPGYG++TNIINGG+ECG  G+ ++ ADRIGFYKRYCD+  V YG+NLDC +Q 
Sbjct  258  DQAAGRVPGYGVITNIINGGLECG-KGQDNRVADRIGFYKRYCDLLGVSYGNNLDCYSQR  316

Query  741  PY  746
            P+
Sbjct  317  PF  318



>emb|CAN62783.1| hypothetical protein VITISV_033489 [Vitis vinifera]
Length=278

 Score =   348 bits (892),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 164/238 (69%), Positives = 196/238 (82%), Gaps = 3/238 (1%)
 Frame = +3

Query  21   DVSSIISQAIFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAF  200
            D+SS+IS+++F+ MLK+R+ + C    FYTY+AFI+AAKSFG F TTGD DT KRE+AAF
Sbjct  41   DISSLISKSLFEQMLKHRNXAACPGKGFYTYEAFISAAKSFGGFGTTGDTDTXKREIAAF  100

Query  201  LGQTSHETTGGWDAAPDGRYAWGYCFLREGTD-DPYCNVT-QEWSCAPGQKYFGRGPIQI  374
            L QTSHETTGGW  APDG YAWGYCF++E  +   YC  T Q+W CA G+KY+GRGPIQI
Sbjct  101  LAQTSHETTGGWXTAPDGPYAWGYCFVQEXXNPGDYCVATYQQWPCAAGKKYYGRGPIQI  160

Query  375  SYNYNYGAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPS  554
            SYNYNYG AG+A+ YDL++NPD VATD T+SFKTA WFWMTPQ  KPSCHDVITG+W+PS
Sbjct  161  SYNYNYGPAGRAINYDLLNNPDAVATDATISFKTALWFWMTPQSPKPSCHDVITGQWTPS  220

Query  555  PPDTAAGRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDC  728
              DTAAGRVPGYG++TNIINGG+ECG  G + +  DRIGFYKRYCDI  +GYG+NLDC
Sbjct  221  SADTAAGRVPGYGVITNIINGGIECG-KGSNAQVEDRIGFYKRYCDIMGIGYGNNLDC  277



>gb|AAT40738.1| basic chitinase 2-2 [Nepenthes khasiana]
 gb|AAT40739.1| basic chitinase 2-2 [Nepenthes khasiana]
Length=318

 Score =   349 bits (895),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 167/243 (69%), Positives = 195/243 (80%), Gaps = 2/243 (1%)
 Frame = +3

Query  21   DVSSIISQAIFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAF  200
            D SS++++  F+ MLK+R+D  C A  FYTYDAFIAAAKSF  FA TGD  TRKRE+AAF
Sbjct  68   DPSSLVTRDKFNQMLKHRNDGGCPAKGFYTYDAFIAAAKSFPAFAATGDAATRKREIAAF  127

Query  201  LGQTSHETTGGWDAAPDGRYAWGYCFLRE-GTDDPYCNVTQEWSCAPGQKYFGRGPIQIS  377
            L QTSHETTGGW +APDG YAWGYC+LRE G    YC  + +W C  G+KY+GRGPIQIS
Sbjct  128  LAQTSHETTGGWASAPDGPYAWGYCYLREQGNPGSYCVQSAQWPCVAGKKYYGRGPIQIS  187

Query  378  YNYNYGAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPSP  557
            YN+NYGAAGKA+G DL++NPDLV  DP VSFKTA WFWMTPQ  KPSCH+VITG+W+PS 
Sbjct  188  YNFNYGAAGKAIGVDLLNNPDLVEKDPVVSFKTAIWFWMTPQSPKPSCHEVITGRWTPSA  247

Query  558  PDTAAGRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCSTQ  737
             D +AGRVPG+G+VTNIINGGVECG  G+  + ADRIGFYKRYCDI  VGYG+NLDC  Q
Sbjct  248  ADKSAGRVPGFGVVTNIINGGVECG-HGQDARVADRIGFYKRYCDILGVGYGNNLDCYNQ  306

Query  738  TPY  746
             P+
Sbjct  307  RPF  309



>emb|CBJ55936.1| pathogenesis related gene 3 [Bupleurum kaoi]
Length=267

 Score =   346 bits (887),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 167/245 (68%), Positives = 196/245 (80%), Gaps = 4/245 (2%)
 Frame = +3

Query  21   DVSSIISQAIFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAF  200
            DV S+IS+ +F+DMLK+R+D+ C A  FYTY+AFI AAKSFG F TTGD DTRKRE+AAF
Sbjct  25   DVGSLISKPMFEDMLKHRNDAACPANGFYTYEAFIDAAKSFGAFGTTGDPDTRKREIAAF  84

Query  201  LGQTSHETTGGWDAAPDGRYAWGYCFLREGTDDP--YCNVTQEWSCAPGQKYFGRGPIQI  374
            L QTSHETTGGW  APDG YAWGYCF +E  + P  YC   Q+W CAPG+KY+GRGPIQI
Sbjct  85   LAQTSHETTGGWATAPDGAYAWGYCF-KEEQNQPADYCVQNQQWPCAPGKKYYGRGPIQI  143

Query  375  SYNYNYGAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPS  554
            SYNYNYG AG+A+G DL+ NPDLVA+DPT+SFKTA WFWMTPQ  KPS HD ITG W+PS
Sbjct  144  SYNYNYGPAGQAIGSDLLGNPDLVASDPTISFKTALWFWMTPQSPKPSSHDAITGVWNPS  203

Query  555  PPDTAAGRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCST  734
              D+AAGRVPGYG+VTNIINGG+ECG  G + +  DRIGF++RYC I  V  GDNLDC  
Sbjct  204  GADSAAGRVPGYGVVTNIINGGIECG-KGSNAQVEDRIGFFRRYCTILGVSPGDNLDCYN  262

Query  735  QTPYS  749
            Q P++
Sbjct  263  QRPFA  267



>gb|AHY24796.1| endochitinase [Triticum aestivum]
Length=320

 Score =   348 bits (892),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 168/243 (69%), Positives = 194/243 (80%), Gaps = 2/243 (1%)
 Frame = +3

Query  24   VSSIISQAIFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAFL  203
            VSSIISQ++FD ML +R+D+ C A  FY Y AF+AAA SF  FATTG  D RKREVAAFL
Sbjct  79   VSSIISQSLFDQMLLHRNDAACLAKGFYNYGAFVAAANSFSGFATTGGADVRKREVAAFL  138

Query  204  GQTSHETTGGWDAAPDGRYAWGYCFLRE-GTDDPYCNVTQEWSCAPGQKYFGRGPIQISY  380
             QTSHETTGGW  APDG Y+WGYCF +E G    YC+ + +W CAPG+KYFGRGPIQISY
Sbjct  139  AQTSHETTGGWPTAPDGPYSWGYCFNQERGATSDYCSPSSQWPCAPGKKYFGRGPIQISY  198

Query  381  NYNYGAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPSPP  560
            NYNYG AG+A+  DL++NPDLVATD TVSFKTA WFWMTPQ  KPS HDVITG+WSPS  
Sbjct  199  NYNYGPAGRAISTDLLNNPDLVATDATVSFKTALWFWMTPQSPKPSSHDVITGRWSPSGA  258

Query  561  DTAAGRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCSTQT  740
            D AAGRVPGYG++TNIINGG+ECG  G+  + ADRIGFYKRYCD+  V YG+NLDC  Q 
Sbjct  259  DQAAGRVPGYGVITNIINGGLECG-RGQDARVADRIGFYKRYCDLLGVSYGNNLDCYNQR  317

Query  741  PYS  749
            P++
Sbjct  318  PFA  320



>dbj|BAG12896.1| chitinase [Bromus inermis]
Length=319

 Score =   347 bits (891),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 167/243 (69%), Positives = 192/243 (79%), Gaps = 2/243 (1%)
 Frame = +3

Query  24   VSSIISQAIFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAFL  203
            VSS+ISQ++FD ML +R+D+ C A  FY Y AF+AAA SF  FATTG  D RKREVAAFL
Sbjct  78   VSSVISQSLFDQMLLHRNDAACQAKGFYNYAAFVAAAGSFPAFATTGGADVRKREVAAFL  137

Query  204  GQTSHETTGGWDAAPDGRYAWGYCFLRE-GTDDPYCNVTQEWSCAPGQKYFGRGPIQISY  380
             QTSHETTGGW  APDG Y+WGYCF +E G    YC  + +W CAPG+KYFGRGPIQIS+
Sbjct  138  AQTSHETTGGWPTAPDGPYSWGYCFNQERGATSDYCTPSSQWPCAPGKKYFGRGPIQISH  197

Query  381  NYNYGAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPSPP  560
            NYNYG AG+A+G DL+ NPDLVATD TVSFKTA WFWMTPQ  KPS HDVITG+WSPS  
Sbjct  198  NYNYGPAGRAIGADLLGNPDLVATDATVSFKTALWFWMTPQSPKPSSHDVITGQWSPSAA  257

Query  561  DTAAGRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCSTQT  740
            D AAGR PGYG++TNIINGG+ECG  G+  + ADRIGFYKRYCD+  V YGDNLDC  Q 
Sbjct  258  DQAAGRAPGYGVITNIINGGLECG-RGQDGRVADRIGFYKRYCDLLGVSYGDNLDCYNQR  316

Query  741  PYS  749
            P++
Sbjct  317  PFA  319



>dbj|BAO09558.1| class I chitinase a, partial [Morus alba]
Length=318

 Score =   347 bits (891),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 164/242 (68%), Positives = 197/242 (81%), Gaps = 1/242 (0%)
 Frame = +3

Query  21   DVSSIISQAIFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAF  200
            D+ SIIS++ FD +LK+R+D  C A  FYTYDAFIAAAK+F  F TTGD  TRKRE+AAF
Sbjct  69   DLGSIISRSTFDQLLKHRNDGACPARNFYTYDAFIAAAKAFPGFGTTGDDATRKREIAAF  128

Query  201  LGQTSHETTGGWDAAPDGRYAWGYCFLREGTDDPYCNVTQEWSCAPGQKYFGRGPIQISY  380
            LGQTSHETTGGWD APDG+YAWGYC++RE     YC+ +Q + CA G++Y+GRGPIQ+++
Sbjct  129  LGQTSHETTGGWDGAPDGKYAWGYCYVREQNQATYCSWSQTYPCASGRQYYGRGPIQLTW  188

Query  381  NYNYGAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPSPP  560
            NYNYG  G+ALG DL++NPDLVATDP V+FKTA WFWMTPQ  KPSCHDVITG+W+PS  
Sbjct  189  NYNYGQCGRALGLDLLNNPDLVATDPVVAFKTALWFWMTPQSPKPSCHDVITGRWNPSGA  248

Query  561  DTAAGRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCSTQT  740
            D +AGR PGYG++TNIINGG+ECG  G +    DRIGFYKRYCDIF +GYGDNLDC  Q 
Sbjct  249  DWSAGRAPGYGVLTNIINGGLECG-KGWNAAGEDRIGFYKRYCDIFRIGYGDNLDCYNQR  307

Query  741  PY  746
            P+
Sbjct  308  PF  309



>dbj|BAB82473.1| chitinase 3 [Triticum aestivum]
Length=319

 Score =   347 bits (891),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 167/243 (69%), Positives = 194/243 (80%), Gaps = 2/243 (1%)
 Frame = +3

Query  24   VSSIISQAIFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAFL  203
            VSSIISQ++FD ML +R+D+ C A  FY Y AF+AAA SF  FATTG  D +KREVAAFL
Sbjct  78   VSSIISQSLFDQMLLHRNDAACLAKGFYNYGAFVAAANSFSGFATTGSTDVKKREVAAFL  137

Query  204  GQTSHETTGGWDAAPDGRYAWGYCFLRE-GTDDPYCNVTQEWSCAPGQKYFGRGPIQISY  380
             QTSHETTGGW  APDG Y+WGYCF +E G    YC  + +W CAPG+KYFGRGPIQIS+
Sbjct  138  AQTSHETTGGWPTAPDGPYSWGYCFNQERGATSDYCTPSSQWPCAPGKKYFGRGPIQISH  197

Query  381  NYNYGAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPSPP  560
            NYNYG AG+A+G DL++NPDLVA+D TVSFKTA WFWMTPQ  KPS HDVITG+WSPS  
Sbjct  198  NYNYGPAGQAIGTDLLNNPDLVASDATVSFKTALWFWMTPQSPKPSSHDVITGRWSPSGA  257

Query  561  DTAAGRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCSTQT  740
            D AAGRVPGYG++TNIINGG+ECG  G+  + ADRIGFYKRYCD+  V YGDNLDC  Q 
Sbjct  258  DQAAGRVPGYGVITNIINGGLECG-RGQDGRVADRIGFYKRYCDLLGVSYGDNLDCYNQR  316

Query  741  PYS  749
            P++
Sbjct  317  PFA  319



>emb|CDP01819.1| unnamed protein product [Coffea canephora]
Length=324

 Score =   347 bits (891),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 164/243 (67%), Positives = 202/243 (83%), Gaps = 3/243 (1%)
 Frame = +3

Query  24   VSSIISQAIFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAFL  203
            +SS+ISQA+FD MLKYR+D RC +  FY+Y+AFI AA+SF  FATTG+ +T+KRE+AAFL
Sbjct  84   ISSLISQALFDQMLKYRNDPRCPSNGFYSYNAFITAAQSFPGFATTGNDETQKREIAAFL  143

Query  204  GQTSHETTGGWDAAPDGRYAWGYCFLRE-GTDDPYCNVTQEWSCAPGQKYFGRGPIQISY  380
            GQTSHETTGGW +APDG YAWGYCF+ E G    +C+ +  W C  G++Y+GRGPIQ+++
Sbjct  144  GQTSHETTGGWPSAPDGPYAWGYCFITENGASGSFCD-SPSWPCPAGKQYYGRGPIQLTH  202

Query  381  NYNYGAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPSPP  560
            NYNYG AG+A+G DLI+NPDLVATD  +SFKTA WFWMTPQ  KPSCHDVITG W+PS  
Sbjct  203  NYNYGLAGQAIGADLINNPDLVATDAVISFKTAIWFWMTPQSNKPSCHDVITGAWTPSGA  262

Query  561  DTAAGRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCSTQT  740
            DT+AGRVPGYG++TNIINGG+ECG  G +DK ADRIGFYKRYCD+F +GYG+NLDC  Q 
Sbjct  263  DTSAGRVPGYGVITNIINGGLECG-MGTNDKVADRIGFYKRYCDLFGIGYGNNLDCYNQR  321

Query  741  PYS  749
            P++
Sbjct  322  PFA  324



>gb|AAR11388.1| class I chitinase [Triticum aestivum]
Length=319

 Score =   347 bits (890),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 167/243 (69%), Positives = 194/243 (80%), Gaps = 2/243 (1%)
 Frame = +3

Query  24   VSSIISQAIFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAFL  203
            VSSIISQ++FD ML +R+D+ C A  FY Y AF+AAA SF  FATTG  D +KREVAAFL
Sbjct  78   VSSIISQSLFDQMLLHRNDAACLAKGFYNYGAFVAAANSFSGFATTGSTDVKKREVAAFL  137

Query  204  GQTSHETTGGWDAAPDGRYAWGYCFLRE-GTDDPYCNVTQEWSCAPGQKYFGRGPIQISY  380
             QTSHETTGGW  APDG Y+WGYCF +E G    YC  + +W CAPG+KYFGRGPIQIS+
Sbjct  138  AQTSHETTGGWPTAPDGPYSWGYCFNQERGATSDYCTPSSQWPCAPGKKYFGRGPIQISH  197

Query  381  NYNYGAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPSPP  560
            NYNYG AG+A+G DL++NPDLVA+D TVSFKTA WFWMTPQ  KPS HDVITG+WSPS  
Sbjct  198  NYNYGPAGQAIGTDLLNNPDLVASDATVSFKTALWFWMTPQSPKPSSHDVITGRWSPSGA  257

Query  561  DTAAGRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCSTQT  740
            D AAGRVPGYG++TNIINGG+ECG  G+  + ADRIGFYKRYCD+  V YGDNLDC  Q 
Sbjct  258  DQAAGRVPGYGVITNIINGGLECG-RGQDARVADRIGFYKRYCDLLGVSYGDNLDCYNQR  316

Query  741  PYS  749
            P++
Sbjct  317  PFA  319



>gb|AAP03088.1| class Ia chitinase [Galega orientalis]
Length=326

 Score =   347 bits (890),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 163/241 (68%), Positives = 190/241 (79%), Gaps = 1/241 (0%)
 Frame = +3

Query  24   VSSIISQAIFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAFL  203
            + SIIS+  F+ MLK+RDD+ C    FY+YDAFI+AAK+F  F   GD  T+KREVAAFL
Sbjct  73   LGSIISRDTFNQMLKHRDDNACQGKGFYSYDAFISAAKAFPNFGNNGDTATKKREVAAFL  132

Query  204  GQTSHETTGGWDAAPDGRYAWGYCFLREGTDDPYCNVTQEWSCAPGQKYFGRGPIQISYN  383
            GQTSHETTGGW  APDG YAWGYCFLRE     YC  + ++ CA G+KY+GRGPIQIS+N
Sbjct  133  GQTSHETTGGWPTAPDGPYAWGYCFLREQNPSDYCQSSSQFPCASGKKYYGRGPIQISWN  192

Query  384  YNYGAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPSPPD  563
            YNYG  G+A+G DL++NPDLVATDP +SFKTA WFWMTPQ  KPSCHDVITG W PS  D
Sbjct  193  YNYGPCGRAIGVDLLNNPDLVATDPVISFKTALWFWMTPQSPKPSCHDVITGGWKPSSAD  252

Query  564  TAAGRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCSTQTP  743
             AAGR+PGYG VTNIINGG+ECG  G+  +  DRIGFYKRYCDIF +GYGDNLDC +Q P
Sbjct  253  RAAGRLPGYGAVTNIINGGLECG-RGQDSRVQDRIGFYKRYCDIFGIGYGDNLDCGSQRP  311

Query  744  Y  746
            +
Sbjct  312  F  312



>gb|EAZ02415.1| hypothetical protein OsI_24517 [Oryza sativa Indica Group]
Length=320

 Score =   347 bits (890),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 171/245 (70%), Positives = 193/245 (79%), Gaps = 3/245 (1%)
 Frame = +3

Query  24   VSSIISQAIFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAFL  203
            V+SIIS ++FD ML +R+D  C A  FYTYDAF+AAA ++ +FATTGD DT KREVAAFL
Sbjct  76   VASIISPSLFDQMLLHRNDQACAAKGFYTYDAFVAAANAYPDFATTGDADTCKREVAAFL  135

Query  204  GQTSHETTGGWDAAPDGRYAWGYCFLRE--GTDDPYCNVTQEWSCAPGQKYFGRGPIQIS  377
             QTSHETTGGW  APDG Y+WGYCF  E  G    YC    EW CA G+KY+GRGPIQI+
Sbjct  136  AQTSHETTGGWPTAPDGPYSWGYCFKEENNGNAPTYCEPKPEWPCAAGKKYYGRGPIQIT  195

Query  378  YNYNYGAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPSP  557
            YNYNYG AG+A+G DL++NPDLVA+D TVSFKTAFWFWMTPQ  KPSCH VITG+W+PS 
Sbjct  196  YNYNYGPAGQAIGSDLLNNPDLVASDATVSFKTAFWFWMTPQSPKPSCHAVITGQWTPSA  255

Query  558  PDTAAGRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCSTQ  737
             D AAGRVPGYG +TNIINGGVECG  G  DK ADRIGFYKRYCD+  V YGDNLDC  Q
Sbjct  256  DDQAAGRVPGYGEITNIINGGVECG-HGADDKVADRIGFYKRYCDMLGVSYGDNLDCYNQ  314

Query  738  TPYSP  752
             PY P
Sbjct  315  RPYPP  319



>gb|AHY24794.1| endochitinase [Triticum aestivum]
Length=318

 Score =   347 bits (890),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 169/244 (69%), Positives = 195/244 (80%), Gaps = 4/244 (2%)
 Frame = +3

Query  24   VSSIISQAIFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAFL  203
            VSSIISQ++FD ML +R+D+ C A  FY Y AF+AAA SF  FATTG  D RKREVAAFL
Sbjct  77   VSSIISQSLFDQMLLHRNDAACQAKGFYNYGAFVAAANSFSGFATTGGTDVRKREVAAFL  136

Query  204  GQTSHETTGGWDAAPDGRYAWGYCF--LREGTDDPYCNVTQEWSCAPGQKYFGRGPIQIS  377
             QTSHETTGGW  APDG Y+WGYCF   R+ T D YC  + +W CAPG++YFGRGPIQIS
Sbjct  137  AQTSHETTGGWPTAPDGPYSWGYCFNQERDATSD-YCTPSSQWPCAPGKEYFGRGPIQIS  195

Query  378  YNYNYGAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPSP  557
            +NYNYG AG+A+G DL++NPDLVATD TVSFKTA WFWMTPQ  KPS HDVITG+WSPS 
Sbjct  196  HNYNYGPAGQAIGTDLLNNPDLVATDATVSFKTALWFWMTPQSPKPSSHDVITGRWSPSG  255

Query  558  PDTAAGRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCSTQ  737
             D AAGRVPGYG++TNIINGG+ECG  G+  + ADRIGFYKRYCD+  V YGDNLDC  Q
Sbjct  256  TDQAAGRVPGYGVITNIINGGLECG-RGQDARVADRIGFYKRYCDLLGVSYGDNLDCYNQ  314

Query  738  TPYS  749
             P++
Sbjct  315  RPFA  318



>gb|AAT40736.1| basic chitinase 2-1 [Nepenthes khasiana]
 gb|AAT40737.1| basic chitinase 2-1 [Nepenthes khasiana]
Length=318

 Score =   347 bits (889),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 167/243 (69%), Positives = 194/243 (80%), Gaps = 2/243 (1%)
 Frame = +3

Query  21   DVSSIISQAIFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAF  200
            D SS++++  F+ MLK+R+D  C A  FYTYDAFIAAAKSF  FA TGD  TRKRE+AAF
Sbjct  68   DPSSLVTRDKFNQMLKHRNDGGCPAKGFYTYDAFIAAAKSFPAFAATGDAATRKREIAAF  127

Query  201  LGQTSHETTGGWDAAPDGRYAWGYCFLRE-GTDDPYCNVTQEWSCAPGQKYFGRGPIQIS  377
            L QTSHETTGGW +APDG YAWGYC+LRE G    YC  + +W C  G+KY+GRGPIQIS
Sbjct  128  LAQTSHETTGGWASAPDGPYAWGYCYLREQGNPGSYCVQSAQWPCVAGKKYYGRGPIQIS  187

Query  378  YNYNYGAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPSP  557
            YN+NYGAAGKA+G DL++NPDLV  DP VSFKTA WFWMTPQ  KPSCH VITG+W+PS 
Sbjct  188  YNFNYGAAGKAIGVDLLNNPDLVEKDPVVSFKTAIWFWMTPQSPKPSCHAVITGRWTPSA  247

Query  558  PDTAAGRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCSTQ  737
             D +AGRVPG+G+VTNIINGGVECG  G+  + ADRIGFYKRYCDI  VGYG+NLDC  Q
Sbjct  248  ADKSAGRVPGFGVVTNIINGGVECG-HGQDARVADRIGFYKRYCDILGVGYGNNLDCYNQ  306

Query  738  TPY  746
             P+
Sbjct  307  RPF  309



>gb|AFK35074.1| unknown [Medicago truncatula]
Length=325

 Score =   347 bits (889),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 164/243 (67%), Positives = 193/243 (79%), Gaps = 2/243 (1%)
 Frame = +3

Query  21   DVSSIISQAIFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAF  200
            D+ S+IS+  F++MLK+RDDS C     YTYDAFI+AAK+F  FA  GD  T+KRE+AAF
Sbjct  68   DLGSLISRDTFNNMLKHRDDSGCQGKRLYTYDAFISAAKAFPNFANNGDTATKKREIAAF  127

Query  201  LGQTSHETTGGWDAAPDGRYAWGYCFLREGT-DDPYCNVTQEWSCAPGQKYFGRGPIQIS  377
            LGQTSHETTGGW  APDG YAWGYCF+RE      YC  + E+ CA G++Y+GRGPIQIS
Sbjct  128  LGQTSHETTGGWATAPDGPYAWGYCFVREQNPSSTYCQPSSEFPCASGKQYYGRGPIQIS  187

Query  378  YNYNYGAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPSP  557
            +NYNYG  G+A+G DL++NPDLVATDP +SFKTA WFWMTPQ  KPSCHDVITG+WSPS 
Sbjct  188  WNYNYGQCGRAIGVDLLNNPDLVATDPVISFKTALWFWMTPQSPKPSCHDVITGRWSPSS  247

Query  558  PDTAAGRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCSTQ  737
             D AAGR+PGYG VTNIINGG+ECG  G+  +  DRIGFYKRYCDI  VGYGDNLDC +Q
Sbjct  248  ADRAAGRLPGYGTVTNIINGGLECG-RGQDGRVQDRIGFYKRYCDILGVGYGDNLDCFSQ  306

Query  738  TPY  746
             P+
Sbjct  307  RPF  309



>ref|NP_001058626.1| Os06g0726100 [Oryza sativa Japonica Group]
 sp|P24626.2|CHI3_ORYSJ RecName: Full=Chitinase 3; AltName: Full=Basic endochitinase 
1; AltName: Full=Class I chitinase c; Short=OsChia1c; AltName: 
Full=Pathogenesis related (PR)-3 chitinase 3; Flags: Precursor 
[Oryza sativa Japonica Group]
 dbj|BAA03751.1| endochitinase [Oryza sativa Japonica Group]
 dbj|BAD61708.1| endochitinase [Oryza sativa Japonica Group]
 dbj|BAD61800.1| endochitinase [Oryza sativa Japonica Group]
 dbj|BAF20540.1| Os06g0726100 [Oryza sativa Japonica Group]
 dbj|BAG87832.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|ADM86858.1| endochitinase [Oryza sativa Japonica Group]
Length=320

 Score =   347 bits (889),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 171/245 (70%), Positives = 193/245 (79%), Gaps = 3/245 (1%)
 Frame = +3

Query  24   VSSIISQAIFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAFL  203
            V+SIIS ++FD ML +R+D  C A  FYTYDAF+AAA ++ +FATTGD DT KREVAAFL
Sbjct  76   VASIISPSLFDQMLLHRNDQACAAKGFYTYDAFVAAANAYPDFATTGDADTCKREVAAFL  135

Query  204  GQTSHETTGGWDAAPDGRYAWGYCFLRE--GTDDPYCNVTQEWSCAPGQKYFGRGPIQIS  377
             QTSHETTGGW  APDG Y+WGYCF  E  G    YC    EW CA G+KY+GRGPIQI+
Sbjct  136  AQTSHETTGGWPTAPDGPYSWGYCFKEENNGNAPTYCEPKPEWPCAAGKKYYGRGPIQIT  195

Query  378  YNYNYGAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPSP  557
            YNYNYG AG+A+G DL++NPDLVA+D TVSFKTAFWFWMTPQ  KPSCH VITG+W+PS 
Sbjct  196  YNYNYGPAGQAIGSDLLNNPDLVASDATVSFKTAFWFWMTPQSPKPSCHAVITGQWTPSA  255

Query  558  PDTAAGRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCSTQ  737
             D AAGRVPGYG +TNIINGGVECG  G  DK ADRIGFYKRYCD+  V YGDNLDC  Q
Sbjct  256  DDQAAGRVPGYGEITNIINGGVECG-HGADDKVADRIGFYKRYCDMLGVSYGDNLDCYNQ  314

Query  738  TPYSP  752
             PY P
Sbjct  315  RPYPP  319



>ref|XP_003604092.1| Endochitinase [Medicago truncatula]
Length=324

 Score =   347 bits (889),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 164/243 (67%), Positives = 193/243 (79%), Gaps = 2/243 (1%)
 Frame = +3

Query  21   DVSSIISQAIFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAF  200
            D+ S+IS+  F++MLK+RDDS C     YTYDAFI+AAK+F  FA  GD  T+KRE+AAF
Sbjct  67   DLGSLISRDTFNNMLKHRDDSGCQGKRLYTYDAFISAAKAFPNFANNGDTATKKREIAAF  126

Query  201  LGQTSHETTGGWDAAPDGRYAWGYCFLREGT-DDPYCNVTQEWSCAPGQKYFGRGPIQIS  377
            LGQTSHETTGGW  APDG YAWGYCF+RE      YC  + E+ CA G++Y+GRGPIQIS
Sbjct  127  LGQTSHETTGGWATAPDGPYAWGYCFVREQNPSSTYCQPSSEFPCASGKQYYGRGPIQIS  186

Query  378  YNYNYGAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPSP  557
            +NYNYG  G+A+G DL++NPDLVATDP +SFKTA WFWMTPQ  KPSCHDVITG+WSPS 
Sbjct  187  WNYNYGQCGRAIGVDLLNNPDLVATDPVISFKTALWFWMTPQSPKPSCHDVITGRWSPSS  246

Query  558  PDTAAGRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCSTQ  737
             D AAGR+PGYG VTNIINGG+ECG  G+  +  DRIGFYKRYCDI  VGYGDNLDC +Q
Sbjct  247  ADRAAGRLPGYGTVTNIINGGLECG-RGQDGRVQDRIGFYKRYCDILGVGYGDNLDCFSQ  305

Query  738  TPY  746
             P+
Sbjct  306  RPF  308



>emb|CAA71402.1| chitinase [Medicago truncatula]
Length=325

 Score =   347 bits (889),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 164/243 (67%), Positives = 193/243 (79%), Gaps = 2/243 (1%)
 Frame = +3

Query  21   DVSSIISQAIFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAF  200
            D+ S+IS+  F++MLK+RDDS C     YTYDAFI+AAK+F  FA  GD  T+KRE+AAF
Sbjct  68   DLGSLISRDTFNNMLKHRDDSGCQGKRLYTYDAFISAAKAFPNFANNGDTATKKREIAAF  127

Query  201  LGQTSHETTGGWDAAPDGRYAWGYCFLREGT-DDPYCNVTQEWSCAPGQKYFGRGPIQIS  377
            LGQTSHETTGGW  APDG YAWGYCF+RE      YC  + E+ CA G++Y+GRGPIQIS
Sbjct  128  LGQTSHETTGGWATAPDGPYAWGYCFVREQNPSSTYCQPSSEFPCASGKQYYGRGPIQIS  187

Query  378  YNYNYGAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPSP  557
            +NYNYG  G+A+G DL++NPDLVATDP +SFKTA WFWMTPQ  KPSCHDVITG+WSPS 
Sbjct  188  WNYNYGQCGRAIGVDLLNNPDLVATDPVISFKTALWFWMTPQSPKPSCHDVITGRWSPSS  247

Query  558  PDTAAGRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCSTQ  737
             D AAGR+PGYG VTNIINGG+ECG  G+  +  DRIGFYKRYCDI  VGYGDNLDC +Q
Sbjct  248  ADRAAGRLPGYGTVTNIINGGLECG-RGQDGRVQDRIGFYKRYCDILGVGYGDNLDCFSQ  306

Query  738  TPY  746
             P+
Sbjct  307  RPF  309



>gb|AAD54934.1|AF141372_1 chitinase precursor [Petroselinum crispum]
Length=267

 Score =   344 bits (883),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 166/245 (68%), Positives = 196/245 (80%), Gaps = 4/245 (2%)
 Frame = +3

Query  21   DVSSIISQAIFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAF  200
            DV S+IS+A+F+DMLK+R+D+ C A  FYTY+AFI A K+FG F TTGD DTRKRE+AAF
Sbjct  25   DVGSLISKAMFEDMLKHRNDANCPAKGFYTYEAFIDATKAFGAFGTTGDPDTRKREIAAF  84

Query  201  LGQTSHETTGGWDAAPDGRYAWGYCFLREGTDDP--YCNVTQEWSCAPGQKYFGRGPIQI  374
            L QTSHETTGGW +APDG YAWGYC+ +E  + P  YC+ +QEW CAP +KY+GRGPIQI
Sbjct  85   LAQTSHETTGGWASAPDGPYAWGYCY-KEEQNPPSDYCSPSQEWPCAPNKKYYGRGPIQI  143

Query  375  SYNYNYGAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPS  554
            SYNYNYG AGKA+G DL+ NPDLVA+D T+SFKTA WFWMTPQ  KPS HD ITG W PS
Sbjct  144  SYNYNYGPAGKAIGSDLLGNPDLVASDATISFKTALWFWMTPQSPKPSSHDAITGVWKPS  203

Query  555  PPDTAAGRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCST  734
              D+AAGRVPGYG+VTNIINGG+ECG  G + +  DRIGF+KRYC I  V  GDNLDC  
Sbjct  204  AADSAAGRVPGYGVVTNIINGGIECG-KGSNPQVEDRIGFFKRYCTILGVSPGDNLDCYN  262

Query  735  QTPYS  749
            Q P++
Sbjct  263  QRPFA  267



>ref|XP_010941401.1| PREDICTED: 26 kDa endochitinase 1-like isoform X3 [Elaeis guineensis]
Length=326

 Score =   346 bits (888),  Expect = 7e-115, Method: Compositional matrix adjust.
 Identities = 164/239 (69%), Positives = 192/239 (80%), Gaps = 2/239 (1%)
 Frame = +3

Query  24   VSSIISQAIFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAFL  203
            V+S+IS ++FD MLK+R+D+ C A  FYTY+AFI AA SF  F TTGD  TRKRE+AAFL
Sbjct  76   VASLISSSLFDQMLKHRNDADCPAKGFYTYNAFIYAANSFSGFGTTGDDTTRKREIAAFL  135

Query  204  GQTSHETTGGWDAAPDGRYAWGYCFLREGTDDP-YCNVTQEWSCAPGQKYFGRGPIQISY  380
             QTSHETTGGW  APDG YAWGYCF +E  + P YC  + +W CAPG+KY+GRGPIQISY
Sbjct  136  AQTSHETTGGWATAPDGPYAWGYCFKQEQGNPPDYCVQSSQWPCAPGKKYYGRGPIQISY  195

Query  381  NYNYGAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPSPP  560
            NYNYG AG+A+G DL++ PDLVATDP VSF+TA WFWMTPQ  KPSCHDVITG+W+PS  
Sbjct  196  NYNYGPAGEAIGLDLLNKPDLVATDPVVSFQTALWFWMTPQSPKPSCHDVITGRWTPSAA  255

Query  561  DTAAGRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCSTQ  737
            D AAGRVPGYG++TNIINGG+ECG  G     ADRIGFYKRYCDI  V +GDNLDC ++
Sbjct  256  DRAAGRVPGYGVITNIINGGIECG-KGRDSSVADRIGFYKRYCDILGVSHGDNLDCESK  313



>gb|ADN39439.1| class I chitinase isoform 2, partial [Castanea sativa]
Length=298

 Score =   345 bits (885),  Expect = 8e-115, Method: Compositional matrix adjust.
 Identities = 161/243 (66%), Positives = 192/243 (79%), Gaps = 2/243 (1%)
 Frame = +3

Query  21   DVSSIISQAIFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAF  200
            DV S+IS ++FD MLKYR+D RC +  FYTY+AFIAAA+SF  F TTGD+ TRKRE+AAF
Sbjct  58   DVGSLISASLFDQMLKYRNDPRCKSNGFYTYNAFIAAARSFNGFGTTGDVTTRKRELAAF  117

Query  201  LGQTSHETTGGWDAAPDGRYAWGYCFLREGTDDPYCNVTQEWSCAPGQKYFGRGPIQISY  380
            L QTSHETTGGW  APDG YAWGYCF+ E     YC  ++ W C  G++Y+GRGPIQ+++
Sbjct  118  LAQTSHETTGGWATAPDGPYAWGYCFIMENNKQTYC-TSKSWPCVFGKQYYGRGPIQLTH  176

Query  381  NYNYGAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPSPP  560
            NYNYG AGKA+G DLI+NPDLVAT+PT+SFKTA WFWMTPQ  KPS HDVI G W PS  
Sbjct  177  NYNYGQAGKAIGADLINNPDLVATNPTISFKTAIWFWMTPQANKPSSHDVIIGNWRPSAA  236

Query  561  DTAAGRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCSTQT  740
            DT+AGRVP YG++TNIINGG+ECG  G  D+ A+RIGFYKRYCD   V YG+NLDC  Q 
Sbjct  237  DTSAGRVPSYGVITNIINGGLECG-HGSDDRVANRIGFYKRYCDTLGVSYGNNLDCYNQK  295

Query  741  PYS  749
            P++
Sbjct  296  PFA  298



>gb|AHY24791.1| endochitinase [Triticum aestivum]
Length=319

 Score =   346 bits (887),  Expect = 8e-115, Method: Compositional matrix adjust.
 Identities = 166/243 (68%), Positives = 194/243 (80%), Gaps = 2/243 (1%)
 Frame = +3

Query  24   VSSIISQAIFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAFL  203
            VSSIISQ++FD ML +R+D+ C A  FY Y AF+AAA SF  FATTG  D +KREVAAFL
Sbjct  78   VSSIISQSLFDQMLLHRNDAACLAKGFYNYGAFVAAANSFSGFATTGSTDVKKREVAAFL  137

Query  204  GQTSHETTGGWDAAPDGRYAWGYCFLRE-GTDDPYCNVTQEWSCAPGQKYFGRGPIQISY  380
             QTSHETTGGW  APDG Y+WGYCF +E G    YC  + +W CAPG+KYFGRGPIQIS+
Sbjct  138  AQTSHETTGGWPTAPDGPYSWGYCFNQERGATSDYCTPSSQWPCAPGKKYFGRGPIQISH  197

Query  381  NYNYGAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPSPP  560
            NYNYG AG+A+G DL++NPDLVA+D TVSFKTA WFWMTPQ  KPS HDVITG+WSPS  
Sbjct  198  NYNYGPAGQAIGTDLLNNPDLVASDATVSFKTALWFWMTPQSPKPSSHDVITGRWSPSGA  257

Query  561  DTAAGRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCSTQT  740
            D AAGRVPGYG++TNIINGG+ECG  G+  + ADRIGF+KRYCD+  V YGDNLDC  Q 
Sbjct  258  DQAAGRVPGYGVITNIINGGLECG-RGQDGRVADRIGFHKRYCDLLGVSYGDNLDCYNQR  316

Query  741  PYS  749
            P++
Sbjct  317  PFA  319



>gb|AHY24792.1| endochitinase [Triticum aestivum]
Length=317

 Score =   346 bits (887),  Expect = 8e-115, Method: Compositional matrix adjust.
 Identities = 168/243 (69%), Positives = 194/243 (80%), Gaps = 2/243 (1%)
 Frame = +3

Query  24   VSSIISQAIFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAFL  203
            VSSIISQ++FD ML +R+D+ C A  FY Y AF+AAA SF  FATTG  D RKREVAAFL
Sbjct  76   VSSIISQSLFDQMLLHRNDAACQAKGFYNYGAFVAAANSFPGFATTGGADFRKREVAAFL  135

Query  204  GQTSHETTGGWDAAPDGRYAWGYCFLRE-GTDDPYCNVTQEWSCAPGQKYFGRGPIQISY  380
             QTSHETTGGW  APDG Y+WGYCF +E G    YC  + +W CAPG+KYFGRGPIQIS+
Sbjct  136  AQTSHETTGGWPTAPDGPYSWGYCFNQERGATSDYCTPSSQWPCAPGKKYFGRGPIQISH  195

Query  381  NYNYGAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPSPP  560
            NYNYG AG+A+G DL++NPDLVATD TVSFKTA WFWMTPQ  KPS HDVITG+WSPS  
Sbjct  196  NYNYGPAGRAIGTDLLNNPDLVATDATVSFKTALWFWMTPQSPKPSSHDVITGRWSPSGA  255

Query  561  DTAAGRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCSTQT  740
            D AAGRVPGYG++TNIINGG+ECG  G+  + ADRIGFYKRYCD+  V YG+NLDC  Q 
Sbjct  256  DQAAGRVPGYGVITNIINGGLECG-RGQDARVADRIGFYKRYCDLLGVSYGNNLDCYNQR  314

Query  741  PYS  749
            P++
Sbjct  315  PFA  317



>dbj|BAO09559.1| class I chitinase b, partial [Morus alba]
Length=318

 Score =   346 bits (887),  Expect = 8e-115, Method: Compositional matrix adjust.
 Identities = 163/242 (67%), Positives = 197/242 (81%), Gaps = 1/242 (0%)
 Frame = +3

Query  21   DVSSIISQAIFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAF  200
            D+ SIIS++ FD +LK+R+D  C A  FYTYDAFIAAAK+F  F TTGD  TRKRE+AAF
Sbjct  69   DLGSIISRSTFDQLLKHRNDGACPARNFYTYDAFIAAAKAFPGFGTTGDDATRKREIAAF  128

Query  201  LGQTSHETTGGWDAAPDGRYAWGYCFLREGTDDPYCNVTQEWSCAPGQKYFGRGPIQISY  380
            LGQTSHETTGGWD APDG+YAWGYC++RE     YC+ +Q + CA G++Y+GRGPIQ+++
Sbjct  129  LGQTSHETTGGWDGAPDGKYAWGYCYVREQNQATYCSWSQTYPCASGRQYYGRGPIQLTW  188

Query  381  NYNYGAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPSPP  560
            NYNYG  G+ALG DL++NPDLVATDP V+FKTA WFWMTPQ  KPSCHDVITG+W+PS  
Sbjct  189  NYNYGQCGRALGLDLLNNPDLVATDPVVAFKTALWFWMTPQSPKPSCHDVITGRWNPSGA  248

Query  561  DTAAGRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCSTQT  740
            D +AGR PGYG++TNIINGG+ECG  G +    DRIGFYKRYCDIF +GYG+NLDC  Q 
Sbjct  249  DWSAGRAPGYGVLTNIINGGLECG-KGWNAAGEDRIGFYKRYCDIFGIGYGNNLDCYNQR  307

Query  741  PY  746
            P+
Sbjct  308  PF  309



>ref|XP_010242849.1| PREDICTED: basic endochitinase-like [Nelumbo nucifera]
Length=320

 Score =   346 bits (887),  Expect = 9e-115, Method: Compositional matrix adjust.
 Identities = 167/243 (69%), Positives = 197/243 (81%), Gaps = 3/243 (1%)
 Frame = +3

Query  21   DVSSIISQAIFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAF  200
            D++S+I++++FD++LK+R+   C    FYTYDAFIAAA+SF  FATTGD  TRKRE+AAF
Sbjct  69   DITSLITRSLFDEILKHRNGGGCPGG-FYTYDAFIAAARSFTGFATTGDTTTRKREIAAF  127

Query  201  LGQTSHETTGGWDAAPDGRYAWGYCFLRE-GTDDPYCNVTQEWSCAPGQKYFGRGPIQIS  377
            L QTSHETTGGW  APDG YAWGYCF++E G    YC+ T +W CAPG+KY+GRGPIQIS
Sbjct  128  LAQTSHETTGGWATAPDGPYAWGYCFVQEQGNPGDYCSPTPQWPCAPGRKYYGRGPIQIS  187

Query  378  YNYNYGAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPSP  557
            YNYNYG AG+A+G DL++NPDLVATDPT+SFKTA WFWMTPQ  KPSCHDVITG+W PS 
Sbjct  188  YNYNYGPAGRAIGVDLLNNPDLVATDPTISFKTAIWFWMTPQSPKPSCHDVITGQWXPSA  247

Query  558  PDTAAGRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCSTQ  737
             D AAGR PGYG++TNIINGG+ECG  G   + ADRIGFYKRYCDI  V YGDNLDC  Q
Sbjct  248  ADXAAGRAPGYGVITNIINGGIECG-KGYIPQVADRIGFYKRYCDILGVSYGDNLDCYNQ  306

Query  738  TPY  746
              +
Sbjct  307  RSF  309



>ref|XP_008812099.1| PREDICTED: chitinase 1-like [Phoenix dactylifera]
Length=319

 Score =   346 bits (887),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 164/243 (67%), Positives = 191/243 (79%), Gaps = 2/243 (1%)
 Frame = +3

Query  24   VSSIISQAIFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAFL  203
            V+S+IS ++FD MLK+R+D+ C A  FYTY+AFI AA SF  F TTGD   RKRE+AAFL
Sbjct  77   VASLISSSLFDQMLKHRNDAACQAKGFYTYNAFITAANSFAGFGTTGDDTIRKREIAAFL  136

Query  204  GQTSHETTGGWDAAPDGRYAWGYCFLREGTDDP-YCNVTQEWSCAPGQKYFGRGPIQISY  380
             QTSHETTGGW  APDG YAWGYCF +E  + P YC  + +W CA G+KY+GRGPIQISY
Sbjct  137  AQTSHETTGGWATAPDGPYAWGYCFKQEQGNPPAYCVQSAQWPCAAGKKYYGRGPIQISY  196

Query  381  NYNYGAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPSPP  560
            NYNYG AGKA+G DL+ NPDLVAT+P VSFKTA WFWMTPQ  KPS H+VITG+W+PS  
Sbjct  197  NYNYGPAGKAIGQDLLKNPDLVATNPVVSFKTALWFWMTPQSPKPSSHNVITGQWTPSAA  256

Query  561  DTAAGRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCSTQT  740
            D +AGRVPGYGL+TNIINGG+ECG  G+    ADRIGFYKRYCDI  V YG NLDC  Q 
Sbjct  257  DQSAGRVPGYGLITNIINGGIECG-KGQDKSVADRIGFYKRYCDILGVSYGGNLDCYNQR  315

Query  741  PYS  749
            P++
Sbjct  316  PFN  318



>gb|AAG23965.1|AF307511_1 class I chitinase [Vigna unguiculata subsp. sesquipedalis]
Length=297

 Score =   345 bits (884),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 163/242 (67%), Positives = 194/242 (80%), Gaps = 1/242 (0%)
 Frame = +3

Query  21   DVSSIISQAIFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAF  200
            D+S++I +A FD MLK+R+D  C A  FYTYDAFIAAA++F  F  TGD  TRKRE+AAF
Sbjct  46   DLSALIPRATFDQMLKHRNDGACPARGFYTYDAFIAAARAFPSFGNTGDTATRKREIAAF  105

Query  201  LGQTSHETTGGWDAAPDGRYAWGYCFLREGTDDPYCNVTQEWSCAPGQKYFGRGPIQISY  380
            LGQTSHETTGGW +APDG YAWGYCF+RE     YC+ T ++ CA GQ+Y+GRGPIQIS+
Sbjct  106  LGQTSHETTGGWPSAPDGPYAWGYCFVREQNPSAYCSPTPQFPCASGQQYYGRGPIQISW  165

Query  381  NYNYGAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPSPP  560
            NYNYG  G A+G DLI+NPDLVATDP VSFK+A WFWMTPQ  KPS HDVIT +W+PS  
Sbjct  166  NYNYGQCGNAIGVDLINNPDLVATDPVVSFKSAIWFWMTPQSPKPSSHDVITSQWTPSAA  225

Query  561  DTAAGRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCSTQT  740
            D AAGR+PGYG VTNIINGG+ECG  G+  +  DRIGF+KRYCD+F VGYG+NLDC +Q 
Sbjct  226  DVAAGRLPGYGTVTNIINGGLECG-RGQDSRVEDRIGFFKRYCDLFGVGYGNNLDCYSQA  284

Query  741  PY  746
            P+
Sbjct  285  PF  286



>dbj|BAJ89873.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ85898.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=320

 Score =   345 bits (886),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 166/240 (69%), Positives = 191/240 (80%), Gaps = 2/240 (1%)
 Frame = +3

Query  33   IISQAIFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAFLGQT  212
            IISQ++FD ML +R+D+ C A  FY Y AF+AAA SF  FATTG  D RKREVAAFL QT
Sbjct  82   IISQSLFDQMLLHRNDAACQAKGFYNYGAFVAAANSFPGFATTGGTDVRKREVAAFLAQT  141

Query  213  SHETTGGWDAAPDGRYAWGYCFLRE-GTDDPYCNVTQEWSCAPGQKYFGRGPIQISYNYN  389
            SHETTGGW  APDG Y+WGYCF +E G    YC  + +W CAPG+KYFGRGPIQIS+NYN
Sbjct  142  SHETTGGWPTAPDGPYSWGYCFNQERGATSDYCTPSSQWPCAPGKKYFGRGPIQISHNYN  201

Query  390  YGAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPSPPDTA  569
            YG AG+A+G DL++NPDLVATD TVSFKTA WFWMTPQ  KPS HDVITG+WSPS  D A
Sbjct  202  YGPAGRAIGADLLNNPDLVATDATVSFKTALWFWMTPQSPKPSSHDVITGRWSPSGTDQA  261

Query  570  AGRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCSTQTPYS  749
            AGRVPGYG++TNIINGG+ECG  G+  + ADRIGFYKRYCD+  V YGDNLDC  Q P++
Sbjct  262  AGRVPGYGVITNIINGGLECG-RGQDARVADRIGFYKRYCDLLGVSYGDNLDCYNQRPFA  320



>sp|Q9FRV1.1|CHIA_SECCE RecName: Full=Basic endochitinase A; AltName: Full=Rye seed chitinase-a; 
Short=RSC-a; Flags: Precursor [Secale cereale]
 dbj|BAB18519.1| seed chitinase-a [Secale cereale]
Length=321

 Score =   345 bits (886),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 164/243 (67%), Positives = 193/243 (79%), Gaps = 2/243 (1%)
 Frame = +3

Query  24   VSSIISQAIFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAFL  203
            VSSI+S+A+FD ML +R+D  C A  FYTYDAF+AAA +F  F TTG  DTRKREVAAFL
Sbjct  80   VSSIVSRALFDRMLLHRNDGACQAKGFYTYDAFVAAAGAFPGFGTTGSTDTRKREVAAFL  139

Query  204  GQTSHETTGGWDAAPDGRYAWGYCFLRE-GTDDPYCNVTQEWSCAPGQKYFGRGPIQISY  380
             QTSHETTGGW  APDG +AWGYCF +E G    YC  + +W CAPG+ Y+GRGPIQ+S+
Sbjct  140  AQTSHETTGGWATAPDGAFAWGYCFKQERGATSNYCTPSAQWPCAPGKSYYGRGPIQLSH  199

Query  381  NYNYGAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPSPP  560
            NYNYG AG+A+G DL+ NPDLVATDPTVSFKTA WFWMT Q  KPS H VITG+WSPS  
Sbjct  200  NYNYGPAGRAIGVDLLRNPDLVATDPTVSFKTAMWFWMTAQAPKPSSHAVITGQWSPSGT  259

Query  561  DTAAGRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCSTQT  740
            D AAGRVPG+G++TNI+NGG+ECG  G+  + ADRIGFYKRYCDI  VGYG+NLDC  Q 
Sbjct  260  DRAAGRVPGFGVITNIVNGGIECGH-GQDSRVADRIGFYKRYCDILRVGYGNNLDCYNQR  318

Query  741  PYS  749
            P++
Sbjct  319  PFA  321



>ref|XP_010103320.1| Endochitinase 1 [Morus notabilis]
 gb|EXB95387.1| Endochitinase 1 [Morus notabilis]
Length=325

 Score =   345 bits (886),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 164/251 (65%), Positives = 199/251 (79%), Gaps = 1/251 (0%)
 Frame = +3

Query  21   DVSSIISQAIFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAF  200
            D+ SIIS++ FD +LK+R+D  C A  FYTYDAFIAA K+F  F TTGD  TRKRE+AAF
Sbjct  76   DLGSIISRSTFDQLLKHRNDGACPARNFYTYDAFIAATKAFPGFGTTGDDATRKREIAAF  135

Query  201  LGQTSHETTGGWDAAPDGRYAWGYCFLREGTDDPYCNVTQEWSCAPGQKYFGRGPIQISY  380
            LGQTSHETTGGWD+APDG+YAWGYCF++E     YC+ +  + CA G++Y+GRGPIQ+++
Sbjct  136  LGQTSHETTGGWDSAPDGKYAWGYCFIKEKNQATYCSSSPTYPCASGKQYYGRGPIQLTW  195

Query  381  NYNYGAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPSPP  560
            NYNYG  G+ALG DL++NPDLVATDP V+FKTA WFWMTPQ  KPSCHDVITGKW+PS  
Sbjct  196  NYNYGQCGRALGLDLLNNPDLVATDPVVAFKTALWFWMTPQSPKPSCHDVITGKWNPSGA  255

Query  561  DTAAGRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCSTQT  740
            DT+AGR  GYG +TNIINGG+ECG  G +    DRIGFYKRYCDIF VGYG+NLDC  Q 
Sbjct  256  DTSAGRAAGYGAITNIINGGLECG-KGWNAAVEDRIGFYKRYCDIFKVGYGNNLDCYNQR  314

Query  741  PYSP*ELLVTL  773
            P+    L+ ++
Sbjct  315  PFGSGLLVDSM  325



>gb|KDP25869.1| hypothetical protein JCGZ_22899 [Jatropha curcas]
Length=338

 Score =   346 bits (887),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 164/244 (67%), Positives = 199/244 (82%), Gaps = 3/244 (1%)
 Frame = +3

Query  21   DVSSIISQAIFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAF  200
            ++SS+ISQ +F++MLK+R+DS C A  FYTYDAFI+AA+SF  F T GD+DTRKRE+AAF
Sbjct  75   NISSLISQDMFNEMLKHRNDSNCPANGFYTYDAFISAAQSFDGFGTIGDIDTRKREIAAF  134

Query  201  LGQTSHETTGGWDAAPDGRYAWGYCFLREGTDD-PYCNVTQEWSCAPGQKYFGRGPIQIS  377
            LGQTSHETTGGW +APDG +AWGYC+ +E   +  YC  T+EW+CAPG+KY+GRGPI IS
Sbjct  135  LGQTSHETTGGWPSAPDGPFAWGYCYNQEQDKEVNYCVPTKEWACAPGKKYYGRGPILIS  194

Query  378  YNYNYGAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPSP  557
            YN+NYGAAGKA+G DL++NPD VA DP +SFKTA WFWMTPQ  KPSCH VITG+W PS 
Sbjct  195  YNFNYGAAGKAIGIDLLNNPDAVAADPIISFKTALWFWMTPQSPKPSCHAVITGQWKPSA  254

Query  558  PDTAAGRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVG-YGDNLDCST  734
             D  AGR+PGYG+++NII+G  ECG  G + K  +RIGFYKRYCDIF VG YGDNLDCS 
Sbjct  255  SDVQAGRLPGYGVISNIISGSTECG-KGSNPKVENRIGFYKRYCDIFKVGDYGDNLDCSK  313

Query  735  QTPY  746
            Q P+
Sbjct  314  QRPF  317



>gb|AES74343.2| Chitinase (Class I) / Hevein [Medicago truncatula]
Length=382

 Score =   347 bits (890),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 164/243 (67%), Positives = 193/243 (79%), Gaps = 2/243 (1%)
 Frame = +3

Query  21   DVSSIISQAIFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAF  200
            D+ S+IS+  F++MLK+RDDS C     YTYDAFI+AAK+F  FA  GD  T+KRE+AAF
Sbjct  125  DLGSLISRDTFNNMLKHRDDSGCQGKRLYTYDAFISAAKAFPNFANNGDTATKKREIAAF  184

Query  201  LGQTSHETTGGWDAAPDGRYAWGYCFLREGT-DDPYCNVTQEWSCAPGQKYFGRGPIQIS  377
            LGQTSHETTGGW  APDG YAWGYCF+RE      YC  + E+ CA G++Y+GRGPIQIS
Sbjct  185  LGQTSHETTGGWATAPDGPYAWGYCFVREQNPSSTYCQPSSEFPCASGKQYYGRGPIQIS  244

Query  378  YNYNYGAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPSP  557
            +NYNYG  G+A+G DL++NPDLVATDP +SFKTA WFWMTPQ  KPSCHDVITG+WSPS 
Sbjct  245  WNYNYGQCGRAIGVDLLNNPDLVATDPVISFKTALWFWMTPQSPKPSCHDVITGRWSPSS  304

Query  558  PDTAAGRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCSTQ  737
             D AAGR+PGYG VTNIINGG+ECG  G+  +  DRIGFYKRYCDI  VGYGDNLDC +Q
Sbjct  305  ADRAAGRLPGYGTVTNIINGGLECG-RGQDGRVQDRIGFYKRYCDILGVGYGDNLDCFSQ  363

Query  738  TPY  746
             P+
Sbjct  364  RPF  366



>prf||2007234A chitinase a
Length=302

 Score =   343 bits (881),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 164/243 (67%), Positives = 193/243 (79%), Gaps = 2/243 (1%)
 Frame = +3

Query  24   VSSIISQAIFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAFL  203
            VSSI+S+A+FD ML +R+D  C A  FYTYDAF+AAA +F  F TTG  DTRKREVAAFL
Sbjct  61   VSSIVSRALFDRMLLHRNDGACQAKGFYTYDAFVAAAGAFPGFGTTGSTDTRKREVAAFL  120

Query  204  GQTSHETTGGWDAAPDGRYAWGYCFLRE-GTDDPYCNVTQEWSCAPGQKYFGRGPIQISY  380
             QTSHETTGGW  APDG +AWGYCF +E G    YC  + +W CAPG+ Y+GRGPIQ+S+
Sbjct  121  AQTSHETTGGWATAPDGAFAWGYCFKQERGAISNYCTPSAQWPCAPGKSYYGRGPIQLSH  180

Query  381  NYNYGAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPSPP  560
            NYNYG AG+A+G DL+ NPDLVATDPTVSFKTA WFWMT Q  KPS H VITG+WSPS  
Sbjct  181  NYNYGPAGRAIGVDLLRNPDLVATDPTVSFKTAMWFWMTAQAPKPSSHAVITGQWSPSGT  240

Query  561  DTAAGRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCSTQT  740
            D AAGRVPG+G++TNI+NGG+ECG  G+  + ADRIGFYKRYCDI  VGYG+NLDC  Q 
Sbjct  241  DRAAGRVPGFGVITNIVNGGIECG-HGQDSRVADRIGFYKRYCDILGVGYGNNLDCYNQR  299

Query  741  PYS  749
            P++
Sbjct  300  PFA  302



>ref|XP_010941399.1| PREDICTED: chitinase 1-like isoform X1 [Elaeis guineensis]
Length=336

 Score =   344 bits (883),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 164/243 (67%), Positives = 193/243 (79%), Gaps = 2/243 (1%)
 Frame = +3

Query  24   VSSIISQAIFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAFL  203
            V+S+IS ++FD ML +R+D+ C A  FYTYDAFI+AA  F  F TTGD  TRKRE+AAFL
Sbjct  80   VASLISSSLFDQMLMHRNDAVCPANGFYTYDAFISAANFFSGFGTTGDDTTRKREIAAFL  139

Query  204  GQTSHETTGGWDAAPDGRYAWGYCFLRE-GTDDPYCNVTQEWSCAPGQKYFGRGPIQISY  380
             QTSHETTGGW  APDG YAWGYCF  E G    YC  + +W CAPG+KY+GRGPIQISY
Sbjct  140  AQTSHETTGGWATAPDGPYAWGYCFKEEQGATSDYCVQSAQWPCAPGKKYYGRGPIQISY  199

Query  381  NYNYGAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPSPP  560
            NYNYG AG+A+G DL++NPDLVAT+P VSF+TA WFWMTPQ  KPSCHDVITG+W+PS  
Sbjct  200  NYNYGPAGEAIGQDLLNNPDLVATNPDVSFETALWFWMTPQSPKPSCHDVITGQWTPSAA  259

Query  561  DTAAGRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCSTQT  740
            D AAGRVPGYG++TNIINGG+ECG  G+  +  DRIGFYKRYCD+  V YGDNLDC  Q 
Sbjct  260  DQAAGRVPGYGVITNIINGGLECG-RGQDSRVEDRIGFYKRYCDLLGVSYGDNLDCYNQR  318

Query  741  PYS  749
            P++
Sbjct  319  PFN  321



>pdb|4DWX|A Chain A, Crystal Structure Of A Family Gh-19 Chitinase From Rye 
Seeds
 pdb|4DWX|B Chain B, Crystal Structure Of A Family Gh-19 Chitinase From Rye 
Seeds
 pdb|4DYG|A Chain A, Crystal Structure Of A Family Gh-19 Chitinase From Rye 
Seeds In Complex With (glcnac)4
 pdb|4DYG|B Chain B, Crystal Structure Of A Family Gh-19 Chitinase From Rye 
Seeds In Complex With (glcnac)4
Length=244

 Score =   341 bits (874),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 164/243 (67%), Positives = 189/243 (78%), Gaps = 2/243 (1%)
 Frame = +3

Query  24   VSSIISQAIFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAFL  203
            VSSIIS A FD ML +R+D  C A  FYTYDAF+AAA +F  F  TG  D RKR+VAAFL
Sbjct  3    VSSIISHAQFDRMLLHRNDGACQAKGFYTYDAFVAAANAFPGFGATGSTDARKRDVAAFL  62

Query  204  GQTSHETTGGWDAAPDGRYAWGYCFLRE-GTDDPYCNVTQEWSCAPGQKYFGRGPIQISY  380
             QTSHETTGGW  APDG +AWGYCF +E G    YC  + +W CAPG++Y+GRGPIQ+S+
Sbjct  63   AQTSHETTGGWATAPDGAFAWGYCFKQERGAAADYCTPSAQWPCAPGKRYYGRGPIQLSH  122

Query  381  NYNYGAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPSPP  560
            NYNYG AG+A+G DL+ NPDLVATDPTVSFKTA WFWMT Q  KPS H VITGKWSPS  
Sbjct  123  NYNYGPAGRAIGVDLLRNPDLVATDPTVSFKTALWFWMTAQAPKPSSHAVITGKWSPSGA  182

Query  561  DTAAGRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCSTQT  740
            D AAGR PG+G++TNIINGG+ECG  G+  + ADRIGFYKRYCDI  VGYGDNLDC  Q 
Sbjct  183  DRAAGRAPGFGVITNIINGGLECG-HGQDSRVADRIGFYKRYCDILGVGYGDNLDCYNQR  241

Query  741  PYS  749
            P++
Sbjct  242  PFA  244



>sp|Q9FRV0.1|CHIC_SECCE RecName: Full=Basic endochitinase C; AltName: Full=Rye seed chitinase-c; 
Short=RSC-c; Flags: Precursor [Secale cereale]
 dbj|BAB18520.1| seed chitinase-c [Secale cereale]
Length=266

 Score =   342 bits (876),  Expect = 8e-114, Method: Compositional matrix adjust.
 Identities = 164/243 (67%), Positives = 189/243 (78%), Gaps = 2/243 (1%)
 Frame = +3

Query  24   VSSIISQAIFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAFL  203
            VSSIIS A FD ML +R+D  C A  FYTYDAF+AAA +F  F  TG  D RKR+VAAFL
Sbjct  25   VSSIISHAQFDRMLLHRNDGACQAKGFYTYDAFVAAANAFPGFGATGSTDARKRDVAAFL  84

Query  204  GQTSHETTGGWDAAPDGRYAWGYCFLRE-GTDDPYCNVTQEWSCAPGQKYFGRGPIQISY  380
             QTSHETTGGW  APDG +AWGYCF +E G    YC  + +W CAPG++Y+GRGPIQ+S+
Sbjct  85   AQTSHETTGGWATAPDGAFAWGYCFKQERGAAADYCTPSAQWPCAPGKRYYGRGPIQLSH  144

Query  381  NYNYGAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPSPP  560
            NYNYG AG+A+G DL+ NPDLVATDPTVSFKTA WFWMT Q  KPS H VITGKWSPS  
Sbjct  145  NYNYGPAGRAIGVDLLRNPDLVATDPTVSFKTALWFWMTAQAPKPSSHAVITGKWSPSGA  204

Query  561  DTAAGRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCSTQT  740
            D AAGR PG+G++TNIINGG+ECG  G+  + ADRIGFYKRYCDI  VGYGDNLDC  Q 
Sbjct  205  DRAAGRAPGFGVITNIINGGLECG-HGQDSRVADRIGFYKRYCDILGVGYGDNLDCYNQR  263

Query  741  PYS  749
            P++
Sbjct  264  PFA  266



>sp|P29059.1|CHI3_TOBAC RecName: Full=Endochitinase 3; Flags: Precursor [Nicotiana tabacum]
 emb|CAA45821.1| chitinase C class I [Nicotiana tabacum]
Length=334

 Score =   343 bits (881),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 161/252 (64%), Positives = 194/252 (77%), Gaps = 2/252 (1%)
 Frame = +3

Query  21   DVSSIISQAIFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAF  200
            D+S+IIS ++FD MLK+R+D+ C    FYTY+AFI AA+SF  F TTGD   RKREVAAF
Sbjct  84   DISNIISSSMFDQMLKHRNDNTCQGKSFYTYNAFITAARSFRGFGTTGDTTRRKREVAAF  143

Query  201  LGQTSHETTGGWDAAPDGRYAWGYCFLREGTDDP-YCNVTQEWSCAPGQKYFGRGPIQIS  377
              QTSHETTGGWD APDGRYAWGYC+LRE  + P YC  + +W CAPGQKY+GRGPIQIS
Sbjct  144  FAQTSHETTGGWDTAPDGRYAWGYCYLREQGNPPSYCVQSSQWPCAPGQKYYGRGPIQIS  203

Query  378  YNYNYGAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPSP  557
            YNYNYG  G+A+G +L++NPDLVAT+  VSFK+A WFWMT Q  KPSCHDVITG+W+PS 
Sbjct  204  YNYNYGPCGRAIGQNLLNNPDLVATNAVVSFKSAIWFWMTAQSPKPSCHDVITGRWTPSA  263

Query  558  PDTAAGRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCSTQ  737
             D AA R+PGYG++TNIINGG+ECG  G   +  DRIGFY+RYC I  V  GDN+DC  Q
Sbjct  264  ADRAANRLPGYGVITNIINGGLECG-HGSDARVQDRIGFYRRYCSILGVSPGDNIDCGNQ  322

Query  738  TPYSP*ELLVTL  773
              ++   LL T+
Sbjct  323  KSFNSGLLLETM  334



>ref|XP_009594039.1| PREDICTED: endochitinase 3 [Nicotiana tomentosiformis]
Length=334

 Score =   343 bits (881),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 161/252 (64%), Positives = 194/252 (77%), Gaps = 2/252 (1%)
 Frame = +3

Query  21   DVSSIISQAIFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAF  200
            D+S+IIS ++FD MLK+R+D+ C    FYTY+AFI AA+SF  F TTGD   RKREVAAF
Sbjct  84   DISNIISSSMFDQMLKHRNDNACQGKSFYTYNAFITAARSFRGFGTTGDTTRRKREVAAF  143

Query  201  LGQTSHETTGGWDAAPDGRYAWGYCFLREGTDDP-YCNVTQEWSCAPGQKYFGRGPIQIS  377
              QTSHETTGGWD APDGRYAWGYC+LRE  + P YC  + +W CAPGQKY+GRGPIQIS
Sbjct  144  FAQTSHETTGGWDTAPDGRYAWGYCYLREQGNPPSYCVQSSQWPCAPGQKYYGRGPIQIS  203

Query  378  YNYNYGAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPSP  557
            YNYNYG  G+A+G +L++NPDLVAT+  VSFK+A WFWMT Q  KPSCHDVITG+W+PS 
Sbjct  204  YNYNYGPCGRAIGQNLLNNPDLVATNAVVSFKSAIWFWMTAQSPKPSCHDVITGRWTPSA  263

Query  558  PDTAAGRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCSTQ  737
             D AA R+PGYG++TNIINGG+ECG  G   +  DRIGFY+RYC I  V  GDN+DC  Q
Sbjct  264  ADRAANRLPGYGVITNIINGGLECG-HGSDARVQDRIGFYRRYCSILGVSPGDNIDCGNQ  322

Query  738  TPYSP*ELLVTL  773
              ++   LL T+
Sbjct  323  KSFNSGLLLETM  334



>sp|P21226.2|CHI2_PEA RecName: Full=Endochitinase A2; Flags: Precursor [Pisum sativum]
 gb|AAA75196.1| chitinase class I [Pisum sativum]
Length=324

 Score =   343 bits (880),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 160/237 (68%), Positives = 189/237 (80%), Gaps = 1/237 (0%)
 Frame = +3

Query  36   ISQAIFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAFLGQTS  215
            IS   F++MLK+R+D+ C    FYTYDAF++AAK+F  FA  GD  T+KRE+AAFLGQTS
Sbjct  72   ISGDTFNNMLKHRNDNACQGKPFYTYDAFLSAAKAFPNFANKGDTATKKREIAAFLGQTS  131

Query  216  HETTGGWDAAPDGRYAWGYCFLREGTDDPYCNVTQEWSCAPGQKYFGRGPIQISYNYNYG  395
            HETTGGW  APDG YAWGYCFLRE     YC  + E+ CA G++Y+GRGPIQIS+NYNYG
Sbjct  132  HETTGGWPTAPDGPYAWGYCFLREQNPSTYCQASSEFPCASGKQYYGRGPIQISWNYNYG  191

Query  396  AAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPSPPDTAAG  575
              G+A+G DL++NPDLVATDP +SFKTA WFWMTPQ  KPSCHDVITG W+PS  D AAG
Sbjct  192  QCGRAIGVDLLNNPDLVATDPVISFKTALWFWMTPQSPKPSCHDVITGGWTPSSADRAAG  251

Query  576  RVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCSTQTPY  746
            R+PGYG VTNIINGG+ECG  G+  +  DRIGFYKRYCDIF +GYGDNLDC +Q P+
Sbjct  252  RLPGYGTVTNIINGGLECG-RGQDSRVQDRIGFYKRYCDIFGIGYGDNLDCYSQRPF  307



>ref|XP_010103322.1| Endochitinase 1 [Morus notabilis]
 gb|EXB95389.1| Endochitinase 1 [Morus notabilis]
Length=325

 Score =   343 bits (880),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 163/242 (67%), Positives = 194/242 (80%), Gaps = 1/242 (0%)
 Frame = +3

Query  21   DVSSIISQAIFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAF  200
            D  SIIS++ FD +LK+R+D  C A  FYTYDAFIAA K+F  F TTGD  TRKRE+AAF
Sbjct  76   DPGSIISRSTFDQLLKHRNDGACPARNFYTYDAFIAATKAFPGFGTTGDDATRKREIAAF  135

Query  201  LGQTSHETTGGWDAAPDGRYAWGYCFLREGTDDPYCNVTQEWSCAPGQKYFGRGPIQISY  380
            LGQTSHETTGGWD APDG+YAWGYC++RE     YC+ +Q + CA G++Y+GRGPIQ+++
Sbjct  136  LGQTSHETTGGWDGAPDGKYAWGYCYVREQNQATYCSWSQTYPCASGRQYYGRGPIQLTW  195

Query  381  NYNYGAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPSPP  560
            NYNYG  G+ALG DL++NPDLVATDP V+FKTA WFWMTPQ  KPSCHDVITGKW+PS  
Sbjct  196  NYNYGQCGRALGLDLLNNPDLVATDPVVAFKTALWFWMTPQSPKPSCHDVITGKWNPSGA  255

Query  561  DTAAGRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCSTQT  740
            DT+AGR  GYG +TNIINGG+ECG  G +    DRIGFYKRYCDIF +GYG+NLDC  Q 
Sbjct  256  DTSAGRAAGYGAITNIINGGLECG-KGWNAAVEDRIGFYKRYCDIFRIGYGNNLDCYNQR  314

Query  741  PY  746
            P+
Sbjct  315  PF  316



>gb|AIW39714.1| class I chitinase, partial [Vigna unguiculata]
Length=297

 Score =   342 bits (877),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 161/242 (67%), Positives = 194/242 (80%), Gaps = 1/242 (0%)
 Frame = +3

Query  21   DVSSIISQAIFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAF  200
            D+S++I +A FD MLK+R+D  C A  FYTYDAFIAAA++F  F  TGD  TRKRE+AAF
Sbjct  46   DLSALIPRATFDQMLKHRNDGACPARGFYTYDAFIAAARAFPSFGNTGDTATRKREIAAF  105

Query  201  LGQTSHETTGGWDAAPDGRYAWGYCFLREGTDDPYCNVTQEWSCAPGQKYFGRGPIQISY  380
            LGQTSHETTGGW +APDG YAWGYCF+RE     YC+ T ++ CA GQ+Y+GRGPIQIS+
Sbjct  106  LGQTSHETTGGWPSAPDGPYAWGYCFVREQNPSAYCSPTPQFPCASGQQYYGRGPIQISW  165

Query  381  NYNYGAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPSPP  560
            NYNYG  G A+G DLI+NPDLVATDP VSFK+A WFWMTPQ  KPS HDVIT +W+PS  
Sbjct  166  NYNYGQCGNAIGVDLINNPDLVATDPVVSFKSAIWFWMTPQSPKPSSHDVITSQWTPSAA  225

Query  561  DTAAGRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCSTQT  740
            D AAG++PGYG VTNIINGG+ECG  G+  +  DRIGF+K+YCD+F VGYG+NLDC +Q 
Sbjct  226  DVAAGKLPGYGTVTNIINGGLECG-RGQDSRVEDRIGFFKQYCDLFGVGYGNNLDCYSQA  284

Query  741  PY  746
            P+
Sbjct  285  PF  286



>dbj|BAO45893.1| chitinase [Acacia mangium]
Length=323

 Score =   343 bits (879),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 166/247 (67%), Positives = 196/247 (79%), Gaps = 1/247 (0%)
 Frame = +3

Query  24   VSSIISQAIFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAFL  203
            ++ IIS+  F+ MLK+RDD  C A  FYTYDAFI AA SF  FATTGD  TRKREVAAFL
Sbjct  75   LTDIISRDNFNQMLKHRDDGACPARGFYTYDAFIQAAGSFPAFATTGDAATRKREVAAFL  134

Query  204  GQTSHETTGGWDAAPDGRYAWGYCFLREGTDDPYCNVTQEWSCAPGQKYFGRGPIQISYN  383
            GQTSHETTGGW  APDG YAWGYCF +E     YC  + ++ CAPG++Y+GRGPIQ+S+N
Sbjct  135  GQTSHETTGGWATAPDGPYAWGYCFKQERNPSDYCAPSAQYPCAPGKQYYGRGPIQLSWN  194

Query  384  YNYGAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPSPPD  563
            YNYG AG+A+G DL++NPDLVATDP +SFKTA WFW+TPQ  KPSCHDVITG+W+PS  D
Sbjct  195  YNYGPAGRAIGVDLLNNPDLVATDPVISFKTALWFWVTPQWPKPSCHDVITGRWTPSDAD  254

Query  564  TAAGRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCSTQTP  743
             AAGR+PGYG VTNIINGG+ECG  G+  + ADRIGF+KRYCDI  VGYGDNLDC +Q P
Sbjct  255  RAAGRLPGYGTVTNIINGGLECG-RGQDSRVADRIGFFKRYCDILGVGYGDNLDCYSQRP  313

Query  744  YSP*ELL  764
            +    L+
Sbjct  314  FGSSSLI  320



>ref|XP_007046548.1| Basic chitinase [Theobroma cacao]
 gb|EOX90705.1| Basic chitinase [Theobroma cacao]
Length=311

 Score =   342 bits (878),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 164/243 (67%), Positives = 194/243 (80%), Gaps = 3/243 (1%)
 Frame = +3

Query  21   DVSSIISQAIFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAF  200
            DVSSII++++FD MLKYR+D RC +  FYTYDAFI AA+SFG F TTGDL TRKRE+AAF
Sbjct  70   DVSSIITRSLFDQMLKYRNDGRCPSNGFYTYDAFITAARSFGGFGTTGDLTTRKRELAAF  129

Query  201  LGQTSHETTGGWDAAPDGRYAWGYCFLREGTD-DPYCNVTQEWSCAPGQKYFGRGPIQIS  377
             GQTSHETTGGW  APDG YAWGYCF+RE +   PYC     W CAPG++YFGRGPIQ++
Sbjct  130  FGQTSHETTGGWPTAPDGPYAWGYCFIREQSPPGPYC-TPGAWPCAPGRQYFGRGPIQLT  188

Query  378  YNYNYGAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPSP  557
            +NYNYG AG A+  DLI+NPDLVATD  +SFKTA WFWMTPQG KPS H VI G+W+PS 
Sbjct  189  HNYNYGPAGNAIREDLINNPDLVATDAIISFKTAIWFWMTPQGNKPSSHRVIIGQWTPSA  248

Query  558  PDTAAGRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCSTQ  737
             DTAA R+PGYG++TNIINGG+ECG  G  ++ A RIGFY+RYCD+  V YG+NLDC  Q
Sbjct  249  ADTAANRLPGYGVITNIINGGLECG-RGPDNRVASRIGFYRRYCDLLGVSYGNNLDCYNQ  307

Query  738  TPY  746
             P+
Sbjct  308  RPF  310



>ref|XP_010941400.1| PREDICTED: basic endochitinase A-like isoform X2 [Elaeis guineensis]
Length=330

 Score =   343 bits (879),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 163/239 (68%), Positives = 191/239 (80%), Gaps = 2/239 (1%)
 Frame = +3

Query  24   VSSIISQAIFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAFL  203
            V+S+IS ++FD ML +R+D+ C A  FYTYDAFI+AA  F  F TTGD  TRKRE+AAFL
Sbjct  80   VASLISSSLFDQMLMHRNDAVCPANGFYTYDAFISAANFFSGFGTTGDDTTRKREIAAFL  139

Query  204  GQTSHETTGGWDAAPDGRYAWGYCFLREGTDDP-YCNVTQEWSCAPGQKYFGRGPIQISY  380
             QTSHETTGGW  APDG YAWGYCF +E  + P YC  + +W CAPG+KY+GRGPIQISY
Sbjct  140  AQTSHETTGGWATAPDGPYAWGYCFKQEQGNPPDYCVQSSQWPCAPGKKYYGRGPIQISY  199

Query  381  NYNYGAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPSPP  560
            NYNYG AG+A+G DL++ PDLVATDP VSF+TA WFWMTPQ  KPSCHDVITG+W+PS  
Sbjct  200  NYNYGPAGEAIGLDLLNKPDLVATDPVVSFQTALWFWMTPQSPKPSCHDVITGRWTPSAA  259

Query  561  DTAAGRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCSTQ  737
            D AAGRVPGYG++TNIINGG+ECG  G     ADRIGFYKRYCDI  V +GDNLDC ++
Sbjct  260  DRAAGRVPGYGVITNIINGGIECG-KGRDSSVADRIGFYKRYCDILGVSHGDNLDCESK  317



>ref|XP_002306220.1| chitinase family protein [Populus trichocarpa]
 gb|EEE86731.1| chitinase family protein [Populus trichocarpa]
Length=321

 Score =   342 bits (878),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 161/242 (67%), Positives = 194/242 (80%), Gaps = 1/242 (0%)
 Frame = +3

Query  21   DVSSIISQAIFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAF  200
            D++SIIS+  F++MLK+R+D  C A  FYTYDAFI+AAK+F  F TTGD+ TRKRE+AAF
Sbjct  70   DLTSIISREKFNEMLKHRNDGGCPAKGFYTYDAFISAAKAFPGFGTTGDVATRKREIAAF  129

Query  201  LGQTSHETTGGWDAAPDGRYAWGYCFLREGTDDPYCNVTQEWSCAPGQKYFGRGPIQISY  380
             GQTSHETTGGW  APDG YAWGYC++RE     YC  +  + CA G++Y+GRGP+Q+S+
Sbjct  130  FGQTSHETTGGWQTAPDGPYAWGYCYVREQNPGSYCAPSSTYPCAGGKQYYGRGPMQLSW  189

Query  381  NYNYGAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPSPP  560
            NYNYG  GKA+G DL++NPDLVATDP +SFKTA WFWMTPQ  KPSCH+VITG+WSPS  
Sbjct  190  NYNYGQCGKAIGVDLLNNPDLVATDPVISFKTAIWFWMTPQSPKPSCHNVITGRWSPSGA  249

Query  561  DTAAGRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCSTQT  740
            D+AAGRVPGYG++TNIINGG+ECG  G   +  DRIGFYKRYCDI  VGYG NLDC  Q 
Sbjct  250  DSAAGRVPGYGVLTNIINGGLECG-MGWKSQVEDRIGFYKRYCDILGVGYGSNLDCYNQR  308

Query  741  PY  746
            P+
Sbjct  309  PF  310



>gb|ADF47472.1| class II chitinase [Rhododendron irroratum]
 gb|ADF47475.1| class II chitinase [Rhododendron irroratum]
Length=264

 Score =   340 bits (872),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 160/244 (66%), Positives = 199/244 (82%), Gaps = 3/244 (1%)
 Frame = +3

Query  24   VSSIISQAIFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAFL  203
            +SS+IS+A+F++MLK+R+D+ C    FYTY+AFIAAAK+FG F TTGD  T+KRE+AAFL
Sbjct  22   ISSLISKAVFENMLKHRNDAACQGKGFYTYEAFIAAAKAFGGFGTTGDDATKKREIAAFL  81

Query  204  GQTSHETTGGWDAAPDGRYAWGYCFLREGTDDP-YCNVTQE-WSCAPGQKYFGRGPIQIS  377
             +TSHETTGGW  APDG YAWGYCF+ E  + P YC+  Q+ + CA G+KYFGRGPIQI+
Sbjct  82   ARTSHETTGGWPTAPDGPYAWGYCFVTEQGNPPDYCDGNQQQYPCAAGKKYFGRGPIQIT  141

Query  378  YNYNYGAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPSP  557
            +NYNYG AG A+G +L++NPDLVATDPT+SFKTA WFWMTPQ  KPS HDVITG+W+PS 
Sbjct  142  HNYNYGPAGTAIGSNLLANPDLVATDPTISFKTALWFWMTPQSPKPSSHDVITGRWTPSA  201

Query  558  PDTAAGRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCSTQ  737
             D+AAGRVPGYG++TNIINGG+ECG  G   ++ DRIGFYKRY  I  VG G+NLDC+ Q
Sbjct  202  ADSAAGRVPGYGVITNIINGGIECG-KGSTTQQEDRIGFYKRYSGIMGVGTGNNLDCNNQ  260

Query  738  TPYS  749
             P++
Sbjct  261  RPFA  264



>prf||1901378A chitinase
Length=307

 Score =   342 bits (876),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 164/245 (67%), Positives = 194/245 (79%), Gaps = 4/245 (2%)
 Frame = +3

Query  24   VSSIISQAIFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAFL  203
            V+SI+S+++FD ML +R+D+ C A  FYTYDAF+AAA +F  FATTGD  TRKREVAAFL
Sbjct  63   VASIVSRSLFDQMLLHRNDAACPAKNFYTYDAFVAAANAFPSFATTGDAATRKREVAAFL  122

Query  204  GQTSHETTGGWDAAPDGRYAWGYCFLREGTDDP---YCNVTQEWSCAPGQKYFGRGPIQI  374
             QTSHETTGGW  APDG Y+WGYCF  E   +    YC  + +W CA G+KY+GRGPIQI
Sbjct  123  AQTSHETTGGWATAPDGPYSWGYCFKEENNGNVGSDYCVQSSQWPCAAGKKYYGRGPIQI  182

Query  375  SYNYNYGAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPS  554
            SYNYNYG AG+A+G +L+SNPDLVA+D TVSFKTAFWFWMTPQ  KPSCH V+TG+W+P+
Sbjct  183  SYNYNYGPAGQAIGSNLLSNPDLVASDATVSFKTAFWFWMTPQSPKPSCHAVMTGQWTPN  242

Query  555  PPDTAAGRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCST  734
              D AAGRVPGYG+VTNIINGGVECG  G   + ADRIGFYKRYCD+  V YG NLDC  
Sbjct  243  GNDQAAGRVPGYGVVTNIINGGVECG-HGADSRVADRIGFYKRYCDMLGVSYGANLDCYN  301

Query  735  QTPYS  749
            Q P++
Sbjct  302  QRPFN  306



>gb|KDP43737.1| hypothetical protein JCGZ_22364 [Jatropha curcas]
Length=322

 Score =   342 bits (877),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 162/244 (66%), Positives = 194/244 (80%), Gaps = 2/244 (1%)
 Frame = +3

Query  21   DVSSIISQAIFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAF  200
            DVSSII+ A+FD MLKYR+D RC +  FYTY+AFI+AA+SF  F T+GDLDTRKRE+AAF
Sbjct  81   DVSSIITPALFDQMLKYRNDPRCQSNGFYTYNAFISAARSFNGFGTSGDLDTRKRELAAF  140

Query  201  LGQTSHETTGGWDAAPDGRYAWGYCFLREGTDDPYCNVTQEWSCAPGQKYFGRGPIQISY  380
            L QTSHETTGGW +APDG YAWGYCF+RE     YC+ + EW C  G++Y+GRGPIQ+++
Sbjct  141  LAQTSHETTGGWPSAPDGPYAWGYCFVRENDRQTYCS-SSEWPCPAGRQYYGRGPIQLTH  199

Query  381  NYNYGAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPSPP  560
            NYNYG AG+AL  DLI+NPDLVATDP +SFKTA WFWMTPQG KPS H+VI G+W+PS  
Sbjct  200  NYNYGLAGRALREDLINNPDLVATDPVISFKTAIWFWMTPQGNKPSSHNVIIGQWTPSDA  259

Query  561  DTAAGRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCSTQT  740
            D AA RVPGYG++TNIINGG+ECG  G +DK   RIGFY+RY  I  V  G NLDC  Q 
Sbjct  260  DRAANRVPGYGVITNIINGGLECG-QGANDKVESRIGFYRRYSGILGVSTGGNLDCYNQR  318

Query  741  PYSP  752
            P++P
Sbjct  319  PFAP  322



>ref|XP_003569604.1| PREDICTED: basic endochitinase A-like [Brachypodium distachyon]
Length=322

 Score =   342 bits (877),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 164/243 (67%), Positives = 194/243 (80%), Gaps = 2/243 (1%)
 Frame = +3

Query  24   VSSIISQAIFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAFL  203
            VSSI+ +++FD ML +R+D+ C A  FYTYDAF+AAA SF  FATTG  D RKREVAAFL
Sbjct  81   VSSIVPRSLFDRMLLHRNDAACQAKGFYTYDAFVAAANSFPGFATTGGADVRKREVAAFL  140

Query  204  GQTSHETTGGWDAAPDGRYAWGYCFLRE-GTDDPYCNVTQEWSCAPGQKYFGRGPIQISY  380
             QTSHETTGGW  APDG ++WGYCF +E G    YC  + +W CA G+KY+GRGPIQIS+
Sbjct  141  AQTSHETTGGWPTAPDGPFSWGYCFNQERGATSDYCTQSSQWPCAAGKKYYGRGPIQISH  200

Query  381  NYNYGAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPSPP  560
            NYNYG AG+A+  DL+ NPDLVATDPTVSFKTAFWFWMT Q  KPS HDVITG+WSPS  
Sbjct  201  NYNYGPAGQAIRADLLGNPDLVATDPTVSFKTAFWFWMTAQAPKPSSHDVITGRWSPSGA  260

Query  561  DTAAGRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCSTQT  740
            D AAGRVPG+G++TNIINGG+ECG  G+ ++ ADRIGFYKRYCD+  V YGDNLDC  Q 
Sbjct  261  DQAAGRVPGFGVITNIINGGLECG-RGQDNRVADRIGFYKRYCDLLGVSYGDNLDCYNQR  319

Query  741  PYS  749
            P++
Sbjct  320  PFA  322



>pir||T07838 chitinase (EC 3.2.1.14) - cucurbit
 dbj|BAA31131.1| chitinase [Cucurbita cv. Ebisu Nankin]
Length=311

 Score =   342 bits (876),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 162/242 (67%), Positives = 194/242 (80%), Gaps = 1/242 (0%)
 Frame = +3

Query  21   DVSSIISQAIFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAF  200
             V SII++A+++ MLKY  D RC +  FY Y+AFI AA+SF  F TTGD  TRKRE+AAF
Sbjct  71   SVGSIINEALYNQMLKYSKDPRCPSNGFYRYNAFITAAQSFSGFGTTGDAATRKRELAAF  130

Query  201  LGQTSHETTGGWDAAPDGRYAWGYCFLREGTDDPYCNVTQEWSCAPGQKYFGRGPIQISY  380
             GQTSHETTGGW  APDG YAWGYCF+RE   D YC+  Q+W CA GQKY+GRGPIQ+++
Sbjct  131  FGQTSHETTGGWATAPDGPYAWGYCFIRERNQDVYCSPNQQWPCAAGQKYYGRGPIQLTH  190

Query  381  NYNYGAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPSPP  560
            NYNYG AG+AL  +L++NPDLVATDP V+FKTA WFWMTPQG KPSCHDVITG+W PS  
Sbjct  191  NYNYGPAGRALNLNLLNNPDLVATDPVVAFKTAIWFWMTPQGNKPSCHDVITGRWQPSAA  250

Query  561  DTAAGRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCSTQT  740
            D+AAGRVPGYG++TNIINGG+ECG  G   + ADRIGFYKRYCD+  +GYG+NLDC+ Q 
Sbjct  251  DSAAGRVPGYGVITNIINGGLECG-RGADSRVADRIGFYKRYCDLLGIGYGNNLDCNNQR  309

Query  741  PY  746
             +
Sbjct  310  SF  311



>ref|XP_004163403.1| PREDICTED: basic endochitinase A-like [Cucumis sativus]
Length=320

 Score =   342 bits (876),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 158/241 (66%), Positives = 189/241 (78%), Gaps = 1/241 (0%)
 Frame = +3

Query  24   VSSIISQAIFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAFL  203
            V SIIS+++++ MLKY  DSRC +  FYTY+AFI AA+SF EF  TG ++TRKREVAAFL
Sbjct  81   VGSIISESLYNQMLKYSRDSRCPSNGFYTYNAFITAARSFPEFGNTGSVETRKREVAAFL  140

Query  204  GQTSHETTGGWDAAPDGRYAWGYCFLREGTDDPYCNVTQEWSCAPGQKYFGRGPIQISYN  383
            GQTSHETTGGW  APDG YAWGYCF+RE     YC  +Q+W CA GQ+Y+GRGPIQ+++N
Sbjct  141  GQTSHETTGGWPTAPDGPYAWGYCFIRERNQQTYCTPSQQWPCASGQQYYGRGPIQLTHN  200

Query  384  YNYGAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPSPPD  563
            YNYG AG A+G  L+++PDLVATD  VSFKTA WFWMT QG KPSCH+VI G W PS  D
Sbjct  201  YNYGPAGNAIGAPLLASPDLVATDAVVSFKTALWFWMTAQGNKPSCHNVIIGNWQPSSAD  260

Query  564  TAAGRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCSTQTP  743
             AAGR PGYG++TNIINGG+ECG  G  D+  DRIGFYKRYCD+  +GYG+NLDC  Q  
Sbjct  261  NAAGRSPGYGVITNIINGGLECG-HGPDDRVKDRIGFYKRYCDMLGIGYGNNLDCYNQRS  319

Query  744  Y  746
            +
Sbjct  320  F  320



>emb|CAA39535.1| chitinase [Oryza sativa Japonica Group]
Length=303

 Score =   341 bits (874),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 164/245 (67%), Positives = 194/245 (79%), Gaps = 4/245 (2%)
 Frame = +3

Query  24   VSSIISQAIFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAFL  203
            V+SI+S+++FD ML +R+D+ C A  FYTYDAF+AAA +F  FATTGD  TRKREVAAFL
Sbjct  59   VASIVSRSLFDQMLLHRNDAACPAKNFYTYDAFVAAANAFPSFATTGDAATRKREVAAFL  118

Query  204  GQTSHETTGGWDAAPDGRYAWGYCFLREGTDDP---YCNVTQEWSCAPGQKYFGRGPIQI  374
             QTSHETTGGW  APDG Y+WGYCF  E   +    YC  + +W CA G+KY+GRGPIQI
Sbjct  119  AQTSHETTGGWATAPDGPYSWGYCFKEENNGNVGSDYCVQSSQWPCAAGKKYYGRGPIQI  178

Query  375  SYNYNYGAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPS  554
            SYNYNYG AG+A+G +L+SNPDLVA+D TVSFKTAFWFWMTPQ  KPSCH V+TG+W+P+
Sbjct  179  SYNYNYGPAGQAIGSNLLSNPDLVASDATVSFKTAFWFWMTPQSPKPSCHAVMTGQWTPN  238

Query  555  PPDTAAGRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCST  734
              D AAGRVPGYG+VTNIINGGVECG  G   + ADRIGFYKRYCD+  V YG NLDC  
Sbjct  239  GNDQAAGRVPGYGVVTNIINGGVECG-HGADSRVADRIGFYKRYCDMLGVSYGANLDCYN  297

Query  735  QTPYS  749
            Q P++
Sbjct  298  QRPFN  302



>gb|ACP43629.2| chitinase [Musa AB Group]
 gb|ADH10170.2| chitinase [Musa AB Group]
Length=307

 Score =   341 bits (874),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 161/243 (66%), Positives = 193/243 (79%), Gaps = 2/243 (1%)
 Frame = +3

Query  24   VSSIISQAIFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAFL  203
            V+SIIS ++F+ MLK+R+D+ C    FYTY+AFIAAA SF  F TTGD  T+KRE+AAFL
Sbjct  66   VASIISSSLFEQMLKHRNDAACPGKGFYTYNAFIAAASSFSGFGTTGDDATKKREIAAFL  125

Query  204  GQTSHETTGGWDAAPDGRYAWGYCFLREGT-DDPYCNVTQEWSCAPGQKYFGRGPIQISY  380
             QTSHETTGGW  APDG YAWGYCF++E      YC  + +W CA G+KY+GRGPIQIS+
Sbjct  126  AQTSHETTGGWATAPDGPYAWGYCFVQEQNPSSDYCVASSQWPCAAGKKYYGRGPIQISF  185

Query  381  NYNYGAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPSPP  560
            NYNYG AG+A+G DL++NPDLVATD T+SFKTA WFWMTPQ  KPSCH+VITG W+PS  
Sbjct  186  NYNYGPAGRAIGSDLLNNPDLVATDATISFKTALWFWMTPQSPKPSCHNVITGGWTPSNA  245

Query  561  DTAAGRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCSTQT  740
            D AAGR+PGYG+ TNIINGG+ECG  G   + ADRIGFYKRYCD+  V YGDNLDC  Q+
Sbjct  246  DRAAGRLPGYGVTTNIINGGLECG-KGSDARVADRIGFYKRYCDLLGVSYGDNLDCYNQS  304

Query  741  PYS  749
            P++
Sbjct  305  PFT  307



>ref|XP_011046301.1| PREDICTED: endochitinase 2-like [Populus euphratica]
Length=319

 Score =   341 bits (875),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 160/242 (66%), Positives = 194/242 (80%), Gaps = 1/242 (0%)
 Frame = +3

Query  21   DVSSIISQAIFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAF  200
            D++SIIS+  F++MLK+R+D  C A  FYTYDAFI+AAK+F  F TTGD+ TRKRE+AAF
Sbjct  68   DLTSIISREKFNEMLKHRNDGGCPAKGFYTYDAFISAAKAFPGFGTTGDVATRKREIAAF  127

Query  201  LGQTSHETTGGWDAAPDGRYAWGYCFLREGTDDPYCNVTQEWSCAPGQKYFGRGPIQISY  380
             GQTSHETTGGW  APDG YAWGYC++RE     YC  +  + CA G++Y+GRGP+Q+S+
Sbjct  128  FGQTSHETTGGWKTAPDGPYAWGYCYVREQNPGSYCAPSSTYPCASGKQYYGRGPMQLSW  187

Query  381  NYNYGAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPSPP  560
            NYNYG  G+A+G DL++NPDLVATDP +SFKTA WFWMTPQ  KPSCH+VITG+WSPS  
Sbjct  188  NYNYGQCGRAIGVDLLNNPDLVATDPVISFKTAIWFWMTPQSPKPSCHNVITGRWSPSGA  247

Query  561  DTAAGRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCSTQT  740
            D+AAGRVPGYG++TNIINGG+ECG  G   +  DRIGFYKRYCDI  VGYG NLDC  Q 
Sbjct  248  DSAAGRVPGYGVLTNIINGGLECG-MGWKSQVEDRIGFYKRYCDILGVGYGSNLDCYNQR  306

Query  741  PY  746
            P+
Sbjct  307  PF  308



>gb|AAT40030.1| chitinase [Zea diploperennis]
 gb|AAT40031.1| chitinase [Zea diploperennis]
 gb|AAT40034.1| chitinase [Zea diploperennis]
Length=321

 Score =   341 bits (875),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 163/245 (67%), Positives = 195/245 (80%), Gaps = 4/245 (2%)
 Frame = +3

Query  24   VSSIISQAIFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAFL  203
            V+SIIS+++F+ ML +R+D+ C A  FYTY  FIAAA +F  F TTG  D +KRE+AAFL
Sbjct  77   VASIISESLFNQMLLHRNDAACPANGFYTYAGFIAAANAFPGFGTTGAPDVQKRELAAFL  136

Query  204  GQTSHETTGGWDAAPDGRYAWGYCFLRE--GTDDP-YCNVTQEWSCAPGQKYFGRGPIQI  374
             QTSHETTGGW  APDG YAWGYCF  E  G   P YC  + +W CA G+KY+GRGPIQI
Sbjct  137  AQTSHETTGGWATAPDGPYAWGYCFKEEQGGASGPDYCEASAQWPCAAGKKYYGRGPIQI  196

Query  375  SYNYNYGAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPS  554
            SYNYNYG AG+A+G  +++NPDLVATDPTVSF+TA WFWMTPQ  KPSCHDV+TG+W+PS
Sbjct  197  SYNYNYGPAGQAIGAGILANPDLVATDPTVSFETAVWFWMTPQSPKPSCHDVMTGQWTPS  256

Query  555  PPDTAAGRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCST  734
              DTAAGR+PGYG+VTNIINGG+ECG  G   + ADRIGFYKRYCD+  V YGDNLDC+ 
Sbjct  257  AADTAAGRLPGYGVVTNIINGGLECG-HGADSRVADRIGFYKRYCDLLGVSYGDNLDCAN  315

Query  735  QTPYS  749
            QTP++
Sbjct  316  QTPFN  320



>ref|XP_008241979.1| PREDICTED: endochitinase-like [Prunus mume]
Length=321

 Score =   341 bits (875),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 159/233 (68%), Positives = 188/233 (81%), Gaps = 1/233 (0%)
 Frame = +3

Query  51   FDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAFLGQTSHETTG  230
            FD MLKYR+D+RC +  FY YDAFIAAA++F  F TTGD+  RKRE+AAFL QTSHETTG
Sbjct  90   FDQMLKYRNDARCKSNGFYKYDAFIAAARTFSGFGTTGDVTVRKRELAAFLAQTSHETTG  149

Query  231  GWDAAPDGRYAWGYCFLREGTDDPYCNVTQEWSCAPGQKYFGRGPIQISYNYNYGAAGKA  410
            GW  APDG YAWGYCF+ E   D YC  + ++ CA G+KY+GRGPIQ+++NYNYG AGKA
Sbjct  150  GWATAPDGPYAWGYCFINENNQDVYCTPSAQYPCAAGKKYYGRGPIQLTHNYNYGQAGKA  209

Query  411  LGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPSPPDTAAGRVPGY  590
            +G DLI+NPDLVATDP VSF+TA WFWMTPQG KPS HDVITG+WSPS  DT+AGRVPGY
Sbjct  210  IGQDLIANPDLVATDPVVSFRTAIWFWMTPQGNKPSSHDVITGRWSPSAADTSAGRVPGY  269

Query  591  GLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCSTQTPYS  749
            G++TNIINGG+ECG  G+ D+ A RIGFYKRY  I  V  GDNLDC +Q P++
Sbjct  270  GVITNIINGGLECG-HGQDDRVASRIGFYKRYSQILGVSPGDNLDCYSQRPFA  321



>gb|AAT40032.1| chitinase [Zea diploperennis]
 gb|AAT40035.1| chitinase [Zea diploperennis]
Length=321

 Score =   341 bits (874),  Expect = 8e-113, Method: Compositional matrix adjust.
 Identities = 163/245 (67%), Positives = 195/245 (80%), Gaps = 4/245 (2%)
 Frame = +3

Query  24   VSSIISQAIFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAFL  203
            V+SIIS+++F+ ML +R+D+ C A  FYTY  FIAAA +F  F TTG  D +KRE+AAFL
Sbjct  77   VASIISESLFNQMLLHRNDAACPANGFYTYAGFIAAANAFPGFGTTGAPDVQKRELAAFL  136

Query  204  GQTSHETTGGWDAAPDGRYAWGYCFLRE--GTDDP-YCNVTQEWSCAPGQKYFGRGPIQI  374
             QTSHETTGGW  APDG YAWGYCF  E  G   P YC  + +W CA G+KY+GRGPIQI
Sbjct  137  AQTSHETTGGWATAPDGPYAWGYCFKEEQGGASGPDYCEASAQWPCAAGKKYYGRGPIQI  196

Query  375  SYNYNYGAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPS  554
            SYNYNYG AG+A+G  +++NPDLVATDPTVSF+TA WFWMTPQ  KPSCHDV+TG+W+PS
Sbjct  197  SYNYNYGPAGQAIGAGILANPDLVATDPTVSFETAVWFWMTPQSPKPSCHDVMTGQWTPS  256

Query  555  PPDTAAGRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCST  734
              DTAAGR+PGYG+VTNIINGG+ECG  G   + ADRIGFYKRYCD+  V YGDNLDC+ 
Sbjct  257  AADTAAGRLPGYGVVTNIINGGLECG-HGADSRVADRIGFYKRYCDLLGVSYGDNLDCAN  315

Query  735  QTPYS  749
            QTP++
Sbjct  316  QTPFN  320



>gb|AAT40029.1| chitinase [Zea diploperennis]
Length=321

 Score =   341 bits (874),  Expect = 8e-113, Method: Compositional matrix adjust.
 Identities = 163/245 (67%), Positives = 195/245 (80%), Gaps = 4/245 (2%)
 Frame = +3

Query  24   VSSIISQAIFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAFL  203
            V+SIIS+++F+ ML +R+D+ C A  FYTY  FIAAA +F  F TTG  D +KRE+AAFL
Sbjct  77   VASIISESLFNQMLLHRNDAACPANGFYTYAGFIAAANAFPGFGTTGAPDVQKRELAAFL  136

Query  204  GQTSHETTGGWDAAPDGRYAWGYCFLRE--GTDDP-YCNVTQEWSCAPGQKYFGRGPIQI  374
             QTSHETTGGW  APDG YAWGYCF  E  G   P YC  + +W CA G+KY+GRGPIQI
Sbjct  137  AQTSHETTGGWATAPDGPYAWGYCFKEEQGGASGPDYCEASAQWPCAAGKKYYGRGPIQI  196

Query  375  SYNYNYGAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPS  554
            SYNYNYG AG+A+G  +++NPDLVATDPTVSF+TA WFWMTPQ  KPSCHDV+TG+W+PS
Sbjct  197  SYNYNYGPAGQAIGAGILANPDLVATDPTVSFETAVWFWMTPQSPKPSCHDVMTGQWTPS  256

Query  555  PPDTAAGRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCST  734
              DTAAGR+PGYG+VTNIINGG+ECG  G   + ADRIGFYKRYCD+  V YGDNLDC+ 
Sbjct  257  AADTAAGRLPGYGVVTNIINGGLECG-HGADSRVADRIGFYKRYCDLLGVSYGDNLDCAN  315

Query  735  QTPYS  749
            QTP++
Sbjct  316  QTPFN  320



>sp|Q42993.1|CHI1_ORYSJ RecName: Full=Chitinase 1; AltName: Full=Class I chitinase a; 
Short=OsChia1a; AltName: Full=Pathogenesis related (PR)-3 chitinase 
1; Flags: Precursor [Oryza sativa Japonica Group]
 dbj|BAA03749.1| endochitinase [Oryza sativa Japonica Group]
 dbj|BAD61709.1| endochitinase [Oryza sativa Japonica Group]
 dbj|BAD61801.1| endochitinase [Oryza sativa Japonica Group]
 gb|ABL74564.1| chitinase [Oryza sativa Japonica Group]
 gb|EAZ38338.1| hypothetical protein OsJ_22713 [Oryza sativa Japonica Group]
Length=323

 Score =   341 bits (875),  Expect = 8e-113, Method: Compositional matrix adjust.
 Identities = 164/245 (67%), Positives = 194/245 (79%), Gaps = 4/245 (2%)
 Frame = +3

Query  24   VSSIISQAIFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAFL  203
            V+SI+S+++FD ML +R+D+ C A  FYTYDAF+AAA +F  FATTGD  TRKREVAAFL
Sbjct  79   VASIVSRSLFDQMLLHRNDAACPAKNFYTYDAFVAAANAFPSFATTGDAATRKREVAAFL  138

Query  204  GQTSHETTGGWDAAPDGRYAWGYCFLREGTDDP---YCNVTQEWSCAPGQKYFGRGPIQI  374
             QTSHETTGGW  APDG Y+WGYCF  E   +    YC  + +W CA G+KY+GRGPIQI
Sbjct  139  AQTSHETTGGWATAPDGPYSWGYCFKEENNGNVGSDYCVQSSQWPCAAGKKYYGRGPIQI  198

Query  375  SYNYNYGAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPS  554
            SYNYNYG AG+A+G +L+SNPDLVA+D TVSFKTAFWFWMTPQ  KPSCH V+TG+W+P+
Sbjct  199  SYNYNYGPAGQAIGSNLLSNPDLVASDATVSFKTAFWFWMTPQSPKPSCHAVMTGQWTPN  258

Query  555  PPDTAAGRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCST  734
              D AAGRVPGYG+VTNIINGGVECG  G   + ADRIGFYKRYCD+  V YG NLDC  
Sbjct  259  GNDQAAGRVPGYGVVTNIINGGVECG-HGADSRVADRIGFYKRYCDMLGVSYGANLDCYN  317

Query  735  QTPYS  749
            Q P++
Sbjct  318  QRPFN  322



>gb|AAB01895.1| endochitinase [Castanea sativa]
 emb|CAA64868.1| chitinase Ib [Castanea sativa]
Length=316

 Score =   340 bits (873),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 158/239 (66%), Positives = 189/239 (79%), Gaps = 2/239 (1%)
 Frame = +3

Query  33   IISQAIFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAFLGQT  212
            +IS ++FD MLKYR+D RC +  FYTY+AFIAAA+SF  F TTGD+ TRKRE+AAFL QT
Sbjct  80   LISASLFDQMLKYRNDPRCKSNGFYTYNAFIAAARSFNGFGTTGDVTTRKRELAAFLAQT  139

Query  213  SHETTGGWDAAPDGRYAWGYCFLREGTDDPYCNVTQEWSCAPGQKYFGRGPIQISYNYNY  392
            SHETTGGW  APDG YAWGYCF+ E     YC  ++ W C  G++Y+GRGPIQ+++NYNY
Sbjct  140  SHETTGGWATAPDGPYAWGYCFVMENNKQTYC-TSKSWPCVFGKQYYGRGPIQLTHNYNY  198

Query  393  GAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPSPPDTAA  572
            G AGKA+G DLI+NPDLVAT+PT+SFKTA WFWMTPQ  KPS HDVI G W PS  DT+A
Sbjct  199  GQAGKAIGADLINNPDLVATNPTISFKTAIWFWMTPQANKPSSHDVIIGNWRPSAADTSA  258

Query  573  GRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCSTQTPYS  749
            GRVP YG++TNIINGG+ECG  G  D+ A+RIGFYKRYCD   V YG+NLDC  Q P++
Sbjct  259  GRVPSYGVITNIINGGLECG-HGSDDRVANRIGFYKRYCDTLGVSYGNNLDCYNQKPFA  316



>gb|ACH92946.2| class I chitinase [Dimocarpus longan]
 gb|ADK70388.1| class I chitinase [Dimocarpus longan]
Length=322

 Score =   341 bits (874),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 161/245 (66%), Positives = 198/245 (81%), Gaps = 5/245 (2%)
 Frame = +3

Query  21   DVSSIISQAIFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAF  200
            DV SIIS+A+F+ MLKYR+D+RC +  FYTY+AFI AA+SF  F T+GD DTRKRE+AAF
Sbjct  81   DVGSIISEALFNQMLKYRNDARCPSNGFYTYNAFITAARSFNGFGTSGDADTRKRELAAF  140

Query  201  LGQTSHETTGGWDAAPDGRYAWGYCFLREGTDDP--YCNVTQEWSCAPGQKYFGRGPIQI  374
            L QTSHETTGGW +APDG YAWGYCF+RE  D+P  +C  + +W C PG++YFGRGPIQ+
Sbjct  141  LAQTSHETTGGWPSAPDGPYAWGYCFIRE-RDNPGTFC-TSSDWPCPPGRQYFGRGPIQL  198

Query  375  SYNYNYGAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPS  554
            ++NYNYG AG+A+  DLI+NPDL ATDP +SFKTA WFWMTPQG KPS H+VI G W+PS
Sbjct  199  THNYNYGQAGRAIEADLINNPDLAATDPVISFKTAIWFWMTPQGNKPSSHNVIIGSWTPS  258

Query  555  PPDTAAGRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCST  734
              D +A RVPGYG++TNIINGG ECG +G +DK A RIGFY+RYCD+  V YG+NLDC  
Sbjct  259  DADRSANRVPGYGVITNIINGGRECG-SGANDKVASRIGFYRRYCDVLGVSYGNNLDCYN  317

Query  735  QTPYS  749
            Q P++
Sbjct  318  QRPFA  322



>gb|KHG07793.1| Endochitinase [Gossypium arboreum]
Length=314

 Score =   340 bits (873),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 162/242 (67%), Positives = 191/242 (79%), Gaps = 3/242 (1%)
 Frame = +3

Query  24   VSSIISQAIFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAFL  203
            V SII++ +F+ MLKYR+D RC +  FYTYDAFIAAA+SF  F TTGDL TRKRE+AAF 
Sbjct  74   VGSIITRDLFNQMLKYRNDPRCPSNGFYTYDAFIAAARSFNGFGTTGDLATRKRELAAFF  133

Query  204  GQTSHETTGGWDAAPDGRYAWGYCFLREGTD-DPYCNVTQEWSCAPGQKYFGRGPIQISY  380
            GQTSHETTGGW  APDG YAWGYCF+RE  +  PYC     W CAPG+ YFGRGPIQ+++
Sbjct  134  GQTSHETTGGWPTAPDGPYAWGYCFIREQNNPGPYC-TPGSWPCAPGRLYFGRGPIQLTH  192

Query  381  NYNYGAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPSPP  560
            NYNYG AG+A+G DLI+NPD+VAT+  +SFKTA WFWMTPQG KPSCH VI G+W PS  
Sbjct  193  NYNYGPAGRAIGEDLINNPDIVATNAIISFKTAIWFWMTPQGNKPSCHSVIIGQWRPSGA  252

Query  561  DTAAGRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCSTQT  740
            DT AGRVPGYG++TNIINGG+ECG  G  ++ A RIGFY+RYCDI  + YG NLDC  Q 
Sbjct  253  DTEAGRVPGYGVITNIINGGLECG-RGPDNRVASRIGFYRRYCDILGINYGSNLDCYNQR  311

Query  741  PY  746
            P+
Sbjct  312  PF  313



>gb|AFY08283.1| class Ia chitinase [Acacia koa]
Length=323

 Score =   340 bits (873),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 162/241 (67%), Positives = 194/241 (80%), Gaps = 1/241 (0%)
 Frame = +3

Query  24   VSSIISQAIFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAFL  203
            ++ IIS+  F+ MLK+RDD  C A  FYTYDAFI AA+SF  FATTGD   RKREVAAFL
Sbjct  75   LADIISRDNFNKMLKHRDDGACPARGFYTYDAFIQAARSFPAFATTGDAAMRKREVAAFL  134

Query  204  GQTSHETTGGWDAAPDGRYAWGYCFLREGTDDPYCNVTQEWSCAPGQKYFGRGPIQISYN  383
            GQTSHETTGGW  APDG YAWGYCF +E     YC  + ++ CAPG++Y+GRGPIQ+S+N
Sbjct  135  GQTSHETTGGWATAPDGPYAWGYCFKQERNPSDYCAPSAQYPCAPGKQYYGRGPIQLSWN  194

Query  384  YNYGAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPSPPD  563
            YNYG AG+A+G DL++NPDLVATDP +SFKTA WFW+TPQ  KPSCHDVITG+W+PS  D
Sbjct  195  YNYGPAGRAIGVDLLNNPDLVATDPVISFKTALWFWVTPQSPKPSCHDVITGRWTPSGAD  254

Query  564  TAAGRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCSTQTP  743
             AAGR+PGYG VTNIINGG+ECG  G+  + ADRIGF++RYCD+  VGYGDNLDC +Q P
Sbjct  255  RAAGRLPGYGTVTNIINGGLECG-RGQDSRVADRIGFFQRYCDLLGVGYGDNLDCYSQGP  313

Query  744  Y  746
            +
Sbjct  314  F  314



>sp|P06215.1|CHIT_PHAVU RecName: Full=Endochitinase; Flags: Precursor [Phaseolus vulgaris]
 gb|AAA33756.1| chitinase (EC 3.2.1.14) [Phaseolus vulgaris]
Length=328

 Score =   341 bits (874),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 161/251 (64%), Positives = 195/251 (78%), Gaps = 1/251 (0%)
 Frame = +3

Query  21   DVSSIISQAIFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAF  200
            D+S++IS++ FD MLK+R+D  C A  FYTYDAFIAAAK++  F  TGD  TRKRE+AAF
Sbjct  75   DLSALISRSTFDQMLKHRNDGACPAKGFYTYDAFIAAAKAYPSFGNTGDTATRKREIAAF  134

Query  201  LGQTSHETTGGWDAAPDGRYAWGYCFLREGTDDPYCNVTQEWSCAPGQKYFGRGPIQISY  380
            LGQTSHETTGGW  APDG YAWGYCF+RE     YC+ T ++ CAPGQ+Y+GRGPIQIS+
Sbjct  135  LGQTSHETTGGWATAPDGPYAWGYCFVRERNPSTYCSATPQFPCAPGQQYYGRGPIQISW  194

Query  381  NYNYGAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPSPP  560
            NYNYG  G+A+G DL++ PDLVATD  +SFK+A WFWMT Q  KPS HDVIT +W+PS  
Sbjct  195  NYNYGQCGRAIGVDLLNKPDLVATDSVISFKSALWFWMTAQSPKPSSHDVITSRWTPSSA  254

Query  561  DTAAGRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCSTQT  740
            D AA R+PGYG VTNIINGG+ECG  G+  +  DRIGF+KRYCD+  VGYG+NLDC +QT
Sbjct  255  DVAARRLPGYGTVTNIINGGLECG-RGQDSRVQDRIGFFKRYCDLLGVGYGNNLDCYSQT  313

Query  741  PYSP*ELLVTL  773
            P+    LL  L
Sbjct  314  PFGNSLLLSDL  324



>ref|NP_001238561.1| chitinase class I precursor [Glycine max]
 gb|AAF17593.1|AF202731_1 chitinase class I [Glycine max]
 gb|AAK01734.1|AF335589_1 chitinase class I [Glycine max]
Length=320

 Score =   340 bits (873),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 159/243 (65%), Positives = 192/243 (79%), Gaps = 2/243 (1%)
 Frame = +3

Query  21   DVSSIISQAIFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAF  200
            D+S +IS ++FD MLKYR+D RC    FY YDAFIAAA SF  F TTGD +TRK+E+AAF
Sbjct  80   DISRLISSSLFDQMLKYRNDGRCSGHGFYRYDAFIAAAGSFNGFGTTGDDNTRKKEIAAF  139

Query  201  LGQTSHETTGGWDAAPDGRYAWGYCFLREGTDDPYCNVTQEWSCAPGQKYFGRGPIQISY  380
            L QTSHETTGGW +APDG YAWGYCF+ E     YC+    W CA G+KY+GRGPIQ+++
Sbjct  140  LAQTSHETTGGWASAPDGPYAWGYCFINEQNQATYCD-GGNWPCAAGKKYYGRGPIQLTH  198

Query  381  NYNYGAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPSPP  560
            NYNYG AGKALG DLI+NPDLVATD TVSFKTA WFWMT QG KPS HDVITG+W+PS  
Sbjct  199  NYNYGQAGKALGLDLINNPDLVATDATVSFKTALWFWMTAQGNKPSSHDVITGRWTPSSA  258

Query  561  DTAAGRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCSTQT  740
            D++AGR PGYG++TNIINGG+ECG  G+ ++  DRIGFY+RYC +  +  GDNLDC+ Q 
Sbjct  259  DSSAGRAPGYGVITNIINGGLECGH-GQDNRVQDRIGFYRRYCQMMGISPGDNLDCNNQR  317

Query  741  PYS  749
            P++
Sbjct  318  PFA  320



>ref|XP_009797267.1| PREDICTED: endochitinase 3 [Nicotiana sylvestris]
Length=333

 Score =   341 bits (874),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 160/252 (63%), Positives = 193/252 (77%), Gaps = 2/252 (1%)
 Frame = +3

Query  21   DVSSIISQAIFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAF  200
            D+S+IIS ++FD MLK+R+D+ C    FYTY+AFI AA+SF  F TTGD   RKREVAAF
Sbjct  83   DISNIISSSMFDQMLKHRNDNACQGKGFYTYNAFITAARSFRGFGTTGDTTRRKREVAAF  142

Query  201  LGQTSHETTGGWDAAPDGRYAWGYCFLREGTDDP-YCNVTQEWSCAPGQKYFGRGPIQIS  377
              QTSHETTGGWD APDGRYAWGYC+LRE  + P YC  + +W CAPGQKY+GRGPIQIS
Sbjct  143  FAQTSHETTGGWDTAPDGRYAWGYCYLREQGNPPSYCVQSSQWPCAPGQKYYGRGPIQIS  202

Query  378  YNYNYGAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPSP  557
            YNYNYG  G+A+G +L++NPDLVAT+  VSFK+A WFWMT Q  KPSCHDVITG+W+PS 
Sbjct  203  YNYNYGPCGRAIGQNLLNNPDLVATNAVVSFKSAIWFWMTAQSPKPSCHDVITGRWTPSA  262

Query  558  PDTAAGRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCSTQ  737
             D AA R+PGYG++TNIINGG+ECG  G   +  DRIGFY+RYC I  V  GDN+DC  Q
Sbjct  263  ADRAANRLPGYGVITNIINGGLECG-HGSDARVRDRIGFYRRYCSILGVSPGDNIDCGNQ  321

Query  738  TPYSP*ELLVTL  773
              ++   LL  +
Sbjct  322  RSFNSGLLLEAM  333



>gb|KHN00426.1| Endochitinase [Glycine soja]
Length=317

 Score =   340 bits (872),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 159/243 (65%), Positives = 192/243 (79%), Gaps = 2/243 (1%)
 Frame = +3

Query  21   DVSSIISQAIFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAF  200
            D+S +IS ++FD MLKYR+D RC    FY YDAFIAAA SF  F TTGD +TRK+E+AAF
Sbjct  77   DISRLISSSLFDQMLKYRNDGRCSGHGFYRYDAFIAAAGSFNGFGTTGDDNTRKKEIAAF  136

Query  201  LGQTSHETTGGWDAAPDGRYAWGYCFLREGTDDPYCNVTQEWSCAPGQKYFGRGPIQISY  380
            L QTSHETTGGW +APDG YAWGYCF+ E     YC+    W CA G+KY+GRGPIQ+++
Sbjct  137  LAQTSHETTGGWASAPDGPYAWGYCFINEQNQATYCD-GGNWPCAAGKKYYGRGPIQLTH  195

Query  381  NYNYGAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPSPP  560
            NYNYG AGKALG DLI+NPDLVATD TVSFKTA WFWMT QG KPS HDVITG+W+PS  
Sbjct  196  NYNYGQAGKALGLDLINNPDLVATDATVSFKTALWFWMTAQGNKPSSHDVITGRWTPSSA  255

Query  561  DTAAGRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCSTQT  740
            D++AGR PGYG++TNIINGG+ECG  G+ ++  DRIGFY+RYC +  +  GDNLDC+ Q 
Sbjct  256  DSSAGRAPGYGVITNIINGGLECGH-GQDNRVQDRIGFYRRYCQMMGISPGDNLDCNNQR  314

Query  741  PYS  749
            P++
Sbjct  315  PFA  317



>ref|NP_001268050.1| class I extracellular chitinase precursor [Vitis vinifera]
 gb|AAD04295.1| class I extracellular chitinase [Vitis vinifera]
Length=325

 Score =   340 bits (873),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 160/244 (66%), Positives = 192/244 (79%), Gaps = 2/244 (1%)
 Frame = +3

Query  21   DVSSIISQAIFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAF  200
            D+SS+IS+++FD+MLK+R+D+ C    FYTY+AFI+A KSFG F TTGD +T+KRE+AA 
Sbjct  83   DISSLISKSLFDEMLKHRNDAACPGKGFYTYEAFISAVKSFGGFGTTGDTNTQKREIAAC  142

Query  201  LGQTSHETTGGWDAAPDGRYAWGYCFLRE-GTDDPYCNVTQEWSCAPGQKYFGRGPIQIS  377
            L QTSHETTGGW  AP      G    RE G    YC   Q+W CAPG+KY+GRGPIQIS
Sbjct  143  LAQTSHETTGGWATAPRWTICMGILLPREQGNPGDYCVANQQWPCAPGKKYYGRGPIQIS  202

Query  378  YNYNYGAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPSP  557
            YNYNYG AGKA+ YDL++NPD VATDPT+SFKTA WFWMTPQ  KPSCH VITG+W+PS 
Sbjct  203  YNYNYGPAGKAINYDLLNNPDAVATDPTISFKTALWFWMTPQSPKPSCHSVITGQWTPSS  262

Query  558  PDTAAGRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCSTQ  737
             DT+AGRVPGYGL+TNIINGG+ECG  G + +  DRIGFYKRYCD+  +GYG NLDC+ Q
Sbjct  263  SDTSAGRVPGYGLITNIINGGIECG-KGSNPQMEDRIGFYKRYCDLMGIGYGSNLDCNNQ  321

Query  738  TPYS  749
             P+S
Sbjct  322  RPFS  325



>gb|AAT40019.1| chitinase [Zea mays subsp. parviglumis]
 gb|ACJ62161.1| chitinase [Zea mays subsp. parviglumis]
Length=323

 Score =   340 bits (872),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 163/245 (67%), Positives = 195/245 (80%), Gaps = 4/245 (2%)
 Frame = +3

Query  24   VSSIISQAIFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAFL  203
            V+SIIS+++F+ ML +R+D+ C A  FYTY  FIAAA +F  F TTG  D +KRE+AAFL
Sbjct  79   VASIISESLFNQMLLHRNDAACPANGFYTYAGFIAAANAFPGFGTTGAPDVQKRELAAFL  138

Query  204  GQTSHETTGGWDAAPDGRYAWGYCFLRE--GTDDP-YCNVTQEWSCAPGQKYFGRGPIQI  374
             QTSHETTGGW  APDG YAWGYCF  E  G   P YC  + +W CA G+KY+GRGPIQI
Sbjct  139  AQTSHETTGGWATAPDGPYAWGYCFKEEQGGASGPDYCEPSAQWPCAAGKKYYGRGPIQI  198

Query  375  SYNYNYGAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPS  554
            SYNYNYG AG+A+G  +++NPDLVATDPTVSF+TA WFWMTPQ  KPSCHDV+TG+W+PS
Sbjct  199  SYNYNYGPAGQAIGAGILANPDLVATDPTVSFETAVWFWMTPQSPKPSCHDVMTGQWTPS  258

Query  555  PPDTAAGRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCST  734
              DTAAGR+PGYG+VTNIINGG+ECG  G   + ADRIGFYKRYCD+  V YGDNLDC+ 
Sbjct  259  AADTAAGRLPGYGVVTNIINGGLECG-HGADSRVADRIGFYKRYCDLLGVSYGDNLDCAN  317

Query  735  QTPYS  749
            QTP++
Sbjct  318  QTPFN  322



>gb|AAT40016.1| chitinase [Zea mays subsp. parviglumis]
 gb|ACJ62103.1| chitinase [Zea mays subsp. parviglumis]
Length=322

 Score =   340 bits (872),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 163/245 (67%), Positives = 195/245 (80%), Gaps = 4/245 (2%)
 Frame = +3

Query  24   VSSIISQAIFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAFL  203
            V+SIIS+++F+ ML +R+D+ C A  FYTY  FIAAA +F  F TTG  D +KRE+AAFL
Sbjct  78   VASIISESLFNQMLLHRNDAACPANGFYTYAGFIAAANAFPGFGTTGAPDVQKRELAAFL  137

Query  204  GQTSHETTGGWDAAPDGRYAWGYCFLRE--GTDDP-YCNVTQEWSCAPGQKYFGRGPIQI  374
             QTSHETTGGW  APDG YAWGYCF  E  G   P YC  + +W CA G+KY+GRGPIQI
Sbjct  138  AQTSHETTGGWATAPDGPYAWGYCFKEEQGGASGPDYCEPSAQWPCAAGKKYYGRGPIQI  197

Query  375  SYNYNYGAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPS  554
            SYNYNYG AG+A+G  +++NPDLVATDPTVSF+TA WFWMTPQ  KPSCHDV+TG+W+PS
Sbjct  198  SYNYNYGPAGQAIGAGILANPDLVATDPTVSFETAVWFWMTPQSPKPSCHDVMTGQWTPS  257

Query  555  PPDTAAGRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCST  734
              DTAAGR+PGYG+VTNIINGG+ECG  G   + ADRIGFYKRYCD+  V YGDNLDC+ 
Sbjct  258  AADTAAGRLPGYGVVTNIINGGLECG-HGADSRVADRIGFYKRYCDLLGVSYGDNLDCAN  316

Query  735  QTPYS  749
            QTP++
Sbjct  317  QTPFN  321



>gb|AAT40015.1| chitinase [Zea mays subsp. parviglumis]
 gb|AAT40023.1| chitinase [Zea mays subsp. parviglumis]
 gb|ACJ62091.1| chitinase [Zea mays subsp. parviglumis]
 gb|ACJ62097.1| chitinase [Zea mays subsp. parviglumis]
 gb|ACJ62101.1| chitinase [Zea mays subsp. parviglumis]
 gb|ACJ62115.1| chitinase [Zea mays subsp. parviglumis]
 gb|ACJ62158.1| chitinase [Zea mays subsp. parviglumis]
Length=321

 Score =   340 bits (872),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 163/245 (67%), Positives = 195/245 (80%), Gaps = 4/245 (2%)
 Frame = +3

Query  24   VSSIISQAIFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAFL  203
            V+SIIS+++F+ ML +R+D+ C A  FYTY  FIAAA +F  F TTG  D +KRE+AAFL
Sbjct  77   VASIISESLFNQMLLHRNDAACPANGFYTYAGFIAAANAFPGFGTTGAPDVQKRELAAFL  136

Query  204  GQTSHETTGGWDAAPDGRYAWGYCFLRE--GTDDP-YCNVTQEWSCAPGQKYFGRGPIQI  374
             QTSHETTGGW  APDG YAWGYCF  E  G   P YC  + +W CA G+KY+GRGPIQI
Sbjct  137  AQTSHETTGGWATAPDGPYAWGYCFKEEQGGASGPDYCEPSAQWPCAAGKKYYGRGPIQI  196

Query  375  SYNYNYGAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPS  554
            SYNYNYG AG+A+G  +++NPDLVATDPTVSF+TA WFWMTPQ  KPSCHDV+TG+W+PS
Sbjct  197  SYNYNYGPAGQAIGAGILANPDLVATDPTVSFETAVWFWMTPQSPKPSCHDVMTGQWTPS  256

Query  555  PPDTAAGRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCST  734
              DTAAGR+PGYG+VTNIINGG+ECG  G   + ADRIGFYKRYCD+  V YGDNLDC+ 
Sbjct  257  AADTAAGRLPGYGVVTNIINGGLECG-HGADSRVADRIGFYKRYCDLLGVSYGDNLDCAN  315

Query  735  QTPYS  749
            QTP++
Sbjct  316  QTPFN  320



>emb|CAC81811.1| putative chitinase [Musa acuminata]
Length=318

 Score =   340 bits (872),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 161/243 (66%), Positives = 191/243 (79%), Gaps = 2/243 (1%)
 Frame = +3

Query  24   VSSIISQAIFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAFL  203
            V+SIIS ++F+ MLK+R+D+ C    FYTY+AFIAAA SF  F TTGD   +KRE+AAFL
Sbjct  69   VASIISSSLFEQMLKHRNDAACPGKGFYTYNAFIAAANSFSGFGTTGDDAKKKREIAAFL  128

Query  204  GQTSHETTGGWDAAPDGRYAWGYCFLREGT-DDPYCNVTQEWSCAPGQKYFGRGPIQISY  380
             QTSHETTGGW  APDG YAWGYCF++E      YC  + +W CA G+KY+GRGPIQIS+
Sbjct  129  AQTSHETTGGWATAPDGPYAWGYCFVQEQNPSSDYCVASSQWPCAAGKKYYGRGPIQISF  188

Query  381  NYNYGAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPSPP  560
            NYNYG AG+A+G DL++NPDLVATD T+SFKTA WFWMTPQ  KPSCHDVITG W+PS  
Sbjct  189  NYNYGPAGRAIGSDLLNNPDLVATDATISFKTALWFWMTPQSPKPSCHDVITGSWTPSNA  248

Query  561  DTAAGRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCSTQT  740
            D AAGR+PGYG+ TNIINGG+ECG  G   + ADRIGFYKRYCD+  V YGDNLDC  Q 
Sbjct  249  DQAAGRLPGYGVTTNIINGGLECGK-GYDARVADRIGFYKRYCDLLGVSYGDNLDCYNQR  307

Query  741  PYS  749
            P++
Sbjct  308  PFA  310



>gb|AAT40017.1| chitinase [Zea mays subsp. parviglumis]
Length=321

 Score =   340 bits (871),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 163/245 (67%), Positives = 195/245 (80%), Gaps = 4/245 (2%)
 Frame = +3

Query  24   VSSIISQAIFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAFL  203
            V+SIIS+++F+ ML +R+D+ C A  FYTY  FIAAA +F  F TTG  D +KRE+AAFL
Sbjct  77   VASIISESLFNQMLLHRNDAACPANGFYTYAGFIAAANAFPGFGTTGAPDVQKRELAAFL  136

Query  204  GQTSHETTGGWDAAPDGRYAWGYCFLRE--GTDDP-YCNVTQEWSCAPGQKYFGRGPIQI  374
             QTSHETTGGW  APDG YAWGYCF  E  G   P YC  + +W CA G+KY+GRGPIQI
Sbjct  137  AQTSHETTGGWATAPDGPYAWGYCFKEEQGGASGPDYCEPSAQWPCAAGKKYYGRGPIQI  196

Query  375  SYNYNYGAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPS  554
            SYNYNYG AG+A+G  +++NPDLVATDPTVSF+TA WFWMTPQ  KPSCHDV+TG+W+PS
Sbjct  197  SYNYNYGPAGQAIGAGILANPDLVATDPTVSFETAVWFWMTPQSPKPSCHDVMTGQWTPS  256

Query  555  PPDTAAGRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCST  734
              DTAAGR+PGYG+VTNIINGG+ECG  G   + ADRIGFYKRYCD+  V YGDNLDC+ 
Sbjct  257  AADTAAGRLPGYGVVTNIINGGLECG-HGADSRVADRIGFYKRYCDLLGVSYGDNLDCAN  315

Query  735  QTPYS  749
            QTP++
Sbjct  316  QTPFN  320



>gb|ACN55075.1| chitinase Ib [Chimonanthus praecox]
Length=317

 Score =   340 bits (871),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 163/243 (67%), Positives = 192/243 (79%), Gaps = 2/243 (1%)
 Frame = +3

Query  24   VSSIISQAIFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAFL  203
            V S+ISQ  F+ +LK+R+D+ C A  FYTYDAF+ AA SF  FA+TGD +TRK+E+AAFL
Sbjct  75   VGSLISQDQFEQILKHRNDASCPANGFYTYDAFVNAANSFSGFASTGDTNTRKKEIAAFL  134

Query  204  GQTSHETTGGWDAAPDGRYAWGYCFLREGTDDP-YCNVTQEWSCAPGQKYFGRGPIQISY  380
            GQTSHETTGGW AAPDG YAWGYC+ +E  D P YC     W CA G+KY+GRGP+QISY
Sbjct  135  GQTSHETTGGWAAAPDGPYAWGYCYKQEQGDPPAYCESNPTWPCAAGKKYYGRGPMQISY  194

Query  381  NYNYGAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPSPP  560
            NYNYG AG+A+G DL++NPDLVATDP +SFKTA WFWMT Q  KPSCHDVITG WSPS  
Sbjct  195  NYNYGPAGQAIGVDLLNNPDLVATDPVISFKTAIWFWMTAQSPKPSCHDVITGAWSPSDA  254

Query  561  DTAAGRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCSTQT  740
            D+AAGRVPGYG++TNIINGG+ECG  G   + ADRIGFY+RYC I  V  GDNLDC  Q 
Sbjct  255  DSAAGRVPGYGVITNIINGGLECG-KGTDARVADRIGFYQRYCQILGVSPGDNLDCYNQR  313

Query  741  PYS  749
            P++
Sbjct  314  PFN  316



>gb|EAZ02416.1| hypothetical protein OsI_24518 [Oryza sativa Indica Group]
Length=323

 Score =   340 bits (871),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 163/245 (67%), Positives = 193/245 (79%), Gaps = 4/245 (2%)
 Frame = +3

Query  24   VSSIISQAIFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAFL  203
            V+SI+S+++FD ML +R+D+ C A   YTYDAF+AAA +F  FATTGD  TRKREVAAFL
Sbjct  79   VASIVSRSLFDQMLLHRNDAACPAKNLYTYDAFVAAANAFPSFATTGDAATRKREVAAFL  138

Query  204  GQTSHETTGGWDAAPDGRYAWGYCFLREGTDDP---YCNVTQEWSCAPGQKYFGRGPIQI  374
             QTSHETTGGW  APDG Y+WGYCF  E   +    YC  + +W CA G+KY+GRGPIQI
Sbjct  139  AQTSHETTGGWATAPDGPYSWGYCFKEENNGNVGSDYCVQSSQWPCAAGKKYYGRGPIQI  198

Query  375  SYNYNYGAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPS  554
            SYNYNYG AG+A+G +L+SNPDLVA+D TVSFKTAFWFWMTPQ  KPSCH V+TG+W+P+
Sbjct  199  SYNYNYGPAGQAIGSNLLSNPDLVASDATVSFKTAFWFWMTPQSPKPSCHAVMTGQWTPN  258

Query  555  PPDTAAGRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCST  734
              D AAGRVPGYG+VTNIINGGVECG  G   + ADRIGFYKRYCD+  V YG NLDC  
Sbjct  259  GNDQAAGRVPGYGVVTNIINGGVECG-HGADSRVADRIGFYKRYCDMLGVSYGANLDCYN  317

Query  735  QTPYS  749
            Q P++
Sbjct  318  QRPFN  322



>ref|XP_002312919.2| hypothetical protein POPTR_0009s14420g [Populus trichocarpa]
 gb|EEE86874.2| hypothetical protein POPTR_0009s14420g [Populus trichocarpa]
Length=318

 Score =   339 bits (870),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 158/243 (65%), Positives = 191/243 (79%), Gaps = 1/243 (0%)
 Frame = +3

Query  21   DVSSIISQAIFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAF  200
            D+ SIIS A FD+MLK+R+D  C    FYTY+AFI+AA +F  F TTGD +TRKRE+AAF
Sbjct  67   DLGSIISSAKFDEMLKHRNDGGCPGKGFYTYNAFISAANAFSGFGTTGDANTRKREIAAF  126

Query  201  LGQTSHETTGGWDAAPDGRYAWGYCFLREGTDDPYCNVTQEWSCAPGQKYFGRGPIQISY  380
            LGQTSHETTGGW  APDG YAWGYCF++E     YC+ +  + CA G++Y+GRGP+Q+S+
Sbjct  127  LGQTSHETTGGWQTAPDGAYAWGYCFVKEQNPGTYCSPSSTYPCAGGKQYYGRGPVQLSW  186

Query  381  NYNYGAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPSPP  560
            NYNYG  GKA+G DL++NPDLVATDP +SFKTA WFWMT Q  KPSCH VITG WSPS  
Sbjct  187  NYNYGQCGKAIGVDLLNNPDLVATDPVISFKTAIWFWMTAQSPKPSCHSVITGNWSPSGA  246

Query  561  DTAAGRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCSTQT  740
            D+AAGRVPGYG++TNIINGG+ECG   +   E DRIGFYKRYCD+  VGYG+NLDC  Q 
Sbjct  247  DSAAGRVPGYGVLTNIINGGLECGMGWKQQVE-DRIGFYKRYCDLLGVGYGNNLDCYNQK  305

Query  741  PYS  749
             ++
Sbjct  306  SFA  308



>gb|AAB41324.1| class I chitinase [Medicago sativa]
 gb|AAB41325.1| class I chitinase [Medicago sativa]
 gb|ABX90065.1| class I chitinase [Medicago sativa]
Length=327

 Score =   340 bits (871),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 160/237 (68%), Positives = 187/237 (79%), Gaps = 1/237 (0%)
 Frame = +3

Query  36   ISQAIFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAFLGQTS  215
            IS+  F++MLK+RDDS C     YTYDAFI+AAK+F  FA  GD  T+KRE+AAFLGQTS
Sbjct  76   ISRDTFNNMLKHRDDSGCQGKGLYTYDAFISAAKAFPNFANNGDTATKKREIAAFLGQTS  135

Query  216  HETTGGWDAAPDGRYAWGYCFLREGTDDPYCNVTQEWSCAPGQKYFGRGPIQISYNYNYG  395
            HETTGGW  APDG YAWGYCF+RE     YC  + E+ CA G++Y+GRGPIQIS+NYNYG
Sbjct  136  HETTGGWATAPDGPYAWGYCFVREQNPSTYCQPSSEFPCASGKQYYGRGPIQISWNYNYG  195

Query  396  AAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPSPPDTAAG  575
              G+A+G DL++NPDLVATDP +SFKTA WFWMTPQ  KPSCHDVITG+WSPS  D AAG
Sbjct  196  QCGRAIGVDLLNNPDLVATDPVISFKTALWFWMTPQSPKPSCHDVITGRWSPSSADRAAG  255

Query  576  RVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCSTQTPY  746
            R+ GYG VTNIINGG+ECG  G+  +  DRIGFYKRYCDI  VGYG NLDC +Q P+
Sbjct  256  RLSGYGTVTNIINGGLECG-RGQDGRVQDRIGFYKRYCDILGVGYGANLDCFSQRPF  311



>gb|ACJ62088.1| chitinase [Zea mays subsp. parviglumis]
 gb|ACJ62098.1| chitinase [Zea mays subsp. parviglumis]
Length=321

 Score =   339 bits (870),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 162/245 (66%), Positives = 195/245 (80%), Gaps = 4/245 (2%)
 Frame = +3

Query  24   VSSIISQAIFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAFL  203
            V+SIIS+++F+ ML +R+D+ C A  FYTY  FIAAA +F  F TTG  D +KRE+AAFL
Sbjct  77   VASIISESLFNQMLLHRNDAACPANGFYTYAGFIAAANAFPGFGTTGAPDVQKRELAAFL  136

Query  204  GQTSHETTGGWDAAPDGRYAWGYCFLRE--GTDDP-YCNVTQEWSCAPGQKYFGRGPIQI  374
             QTSHETTGGW  APDG YAWGYCF  E  G   P YC  + +W CA G+KY+GRGPIQI
Sbjct  137  AQTSHETTGGWATAPDGPYAWGYCFKEEQGGASGPDYCEPSAQWPCAAGKKYYGRGPIQI  196

Query  375  SYNYNYGAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPS  554
            SYNYNYG AG+A+G  +++NPD+VATDPTVSF+TA WFWMTPQ  KPSCHDV+TG+W+PS
Sbjct  197  SYNYNYGPAGQAIGAGILANPDMVATDPTVSFETAVWFWMTPQSPKPSCHDVMTGQWTPS  256

Query  555  PPDTAAGRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCST  734
              DTAAGR+PGYG+VTNIINGG+ECG  G   + ADRIGFYKRYCD+  V YGDNLDC+ 
Sbjct  257  AADTAAGRLPGYGVVTNIINGGLECG-HGADSRVADRIGFYKRYCDLLGVSYGDNLDCAN  315

Query  735  QTPYS  749
            QTP++
Sbjct  316  QTPFN  320



>gb|ACJ62087.1| chitinase [Zea mays subsp. parviglumis]
Length=321

 Score =   339 bits (870),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 162/245 (66%), Positives = 195/245 (80%), Gaps = 4/245 (2%)
 Frame = +3

Query  24   VSSIISQAIFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAFL  203
            V+SIIS+++F+ ML +R+D+ C A  FYTY  FIAAA +F  F TTG  D +KRE+AAFL
Sbjct  77   VASIISESLFNQMLLHRNDAACPANGFYTYAGFIAAANAFPGFGTTGAPDVQKRELAAFL  136

Query  204  GQTSHETTGGWDAAPDGRYAWGYCFLRE--GTDDP-YCNVTQEWSCAPGQKYFGRGPIQI  374
             QTSHETTGGW  APDG YAWGYCF  E  G   P YC  + +W CA G+KY+GRGPIQI
Sbjct  137  AQTSHETTGGWATAPDGPYAWGYCFKEEQGGASGPDYCEPSAQWPCAAGKKYYGRGPIQI  196

Query  375  SYNYNYGAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPS  554
            SYNYNYG AG+A+G  +++NPD+VATDPTVSF+TA WFWMTPQ  KPSCHDV+TG+W+PS
Sbjct  197  SYNYNYGPAGQAIGAGILANPDMVATDPTVSFETAVWFWMTPQSPKPSCHDVMTGQWTPS  256

Query  555  PPDTAAGRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCST  734
              DTAAGR+PGYG+VTNIINGG+ECG  G   + ADRIGFYKRYCD+  V YGDNLDC+ 
Sbjct  257  AADTAAGRLPGYGVVTNIINGGLECG-HGADSRVADRIGFYKRYCDLLGVSYGDNLDCAN  315

Query  735  QTPYS  749
            QTP++
Sbjct  316  QTPFN  320



>gb|AAY82488.1| chitinase [Ulmus pumila]
Length=317

 Score =   339 bits (869),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 164/248 (66%), Positives = 194/248 (78%), Gaps = 2/248 (1%)
 Frame = +3

Query  33   IISQAIFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAFLGQT  212
            +IS + F+DMLK+R+D  C A  FYTYDAFIAAAK+F  F TTGD  TRKRE+AAFLGQT
Sbjct  71   LISSSAFNDMLKHRNDGGCPAKGFYTYDAFIAAAKAFPAFGTTGDDATRKREIAAFLGQT  130

Query  213  SHETTGGWDAAPDGRYAWGYCFLREGT-DDPYCNVTQEWSCAPGQKYFGRGPIQISYNYN  389
            SHETTGGW +APDG Y+WGYCF RE      YC+ +  W CA G++YFGRGPIQ+S+NYN
Sbjct  131  SHETTGGWASAPDGPYSWGYCFNREQNPSSDYCSSSPTWPCASGKRYFGRGPIQLSWNYN  190

Query  390  YGAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPSPPDTA  569
            YG  G+A+G DL++NPDLVATDP +SFKTA WFWMTPQ  KPSCHDVITG+WSPS  D +
Sbjct  191  YGQCGRAIGADLLNNPDLVATDPVISFKTALWFWMTPQSPKPSCHDVITGRWSPSGTDQS  250

Query  570  AGRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCSTQTPYS  749
            AGRV GYG++TNIINGG+ECG  G+  +  DRIGFYKRYCDI   GYG+NLDC  Q P+ 
Sbjct  251  AGRVAGYGMITNIINGGIECG-KGQVPQVEDRIGFYKRYCDILKGGYGNNLDCYNQRPFG  309

Query  750  P*ELLVTL  773
               LL T+
Sbjct  310  NGLLLDTM  317



>gb|AAT40027.1| chitinase [Zea diploperennis]
Length=321

 Score =   339 bits (869),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 162/245 (66%), Positives = 194/245 (79%), Gaps = 4/245 (2%)
 Frame = +3

Query  24   VSSIISQAIFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAFL  203
            V+SII +++F+ ML +R+D+ C A  FYTY  FIAAA +F  F TTG  D +KRE+AAFL
Sbjct  77   VASIIPESLFNQMLLHRNDAACPANGFYTYAGFIAAANAFPGFGTTGAPDVQKRELAAFL  136

Query  204  GQTSHETTGGWDAAPDGRYAWGYCFLRE--GTDDP-YCNVTQEWSCAPGQKYFGRGPIQI  374
             QTSHETTGGW  APDG YAWGYCF  E  G   P YC  + +W CA G+KY+GRGPIQI
Sbjct  137  AQTSHETTGGWATAPDGPYAWGYCFKEEQGGASGPDYCEASAQWPCAAGKKYYGRGPIQI  196

Query  375  SYNYNYGAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPS  554
            SYNYNYG AG+A+G  +++NPDLVATDPTVSF+TA WFWMTPQ  KPSCHDV+TG+W+PS
Sbjct  197  SYNYNYGPAGQAIGAGILANPDLVATDPTVSFETAVWFWMTPQSPKPSCHDVMTGQWTPS  256

Query  555  PPDTAAGRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCST  734
              DTAAGR+PGYG+VTNIINGG+ECG  G   + ADRIGFYKRYCD+  V YGDNLDC+ 
Sbjct  257  AADTAAGRLPGYGVVTNIINGGLECG-HGADSRVADRIGFYKRYCDLLGVSYGDNLDCAN  315

Query  735  QTPYS  749
            QTP++
Sbjct  316  QTPFN  320



>gb|AAT40033.1| chitinase [Zea diploperennis]
Length=321

 Score =   339 bits (869),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 162/245 (66%), Positives = 194/245 (79%), Gaps = 4/245 (2%)
 Frame = +3

Query  24   VSSIISQAIFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAFL  203
            V+SII +++F+ ML +R+D+ C A  FYTY  FIAAA +F  F TTG  D +KRE+AAFL
Sbjct  77   VASIIPESLFNQMLLHRNDAACPANGFYTYAGFIAAANAFPGFGTTGAPDVQKRELAAFL  136

Query  204  GQTSHETTGGWDAAPDGRYAWGYCFLRE--GTDDP-YCNVTQEWSCAPGQKYFGRGPIQI  374
             QTSHETTGGW  APDG YAWGYCF  E  G   P YC  + +W CA G+KY+GRGPIQI
Sbjct  137  AQTSHETTGGWATAPDGPYAWGYCFKEEQGGASGPDYCEASAQWPCAAGKKYYGRGPIQI  196

Query  375  SYNYNYGAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPS  554
            SYNYNYG AG+A+G  +++NPDLVATDPTVSF+TA WFWMTPQ  KPSCHDV+TG+W+PS
Sbjct  197  SYNYNYGPAGQAIGAGILANPDLVATDPTVSFETAVWFWMTPQSPKPSCHDVMTGQWTPS  256

Query  555  PPDTAAGRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCST  734
              DTAAGR+PGYG+VTNIINGG+ECG  G   + ADRIGFYKRYCD+  V YGDNLDC+ 
Sbjct  257  AADTAAGRLPGYGVVTNIINGGLECG-HGADSRVADRIGFYKRYCDLLGVSYGDNLDCAN  315

Query  735  QTPYS  749
            QTP++
Sbjct  316  QTPFN  320



>gb|ABK96628.1| unknown [Populus trichocarpa x Populus deltoides]
Length=318

 Score =   338 bits (868),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 157/243 (65%), Positives = 191/243 (79%), Gaps = 1/243 (0%)
 Frame = +3

Query  21   DVSSIISQAIFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAF  200
            D+ SIIS A FD+MLK+R+D  C    FYTY+AFI+AA +F  F TTGD +TRKRE+AAF
Sbjct  67   DLGSIISSAKFDEMLKHRNDGGCPGKGFYTYNAFISAANAFSGFGTTGDANTRKREIAAF  126

Query  201  LGQTSHETTGGWDAAPDGRYAWGYCFLREGTDDPYCNVTQEWSCAPGQKYFGRGPIQISY  380
            LGQTSHETTGGW  APDG YAWGYCF++E     YC+ +  + CA G++Y+GRGP+Q+S+
Sbjct  127  LGQTSHETTGGWQTAPDGAYAWGYCFVKEQNPGTYCSPSSTYPCAGGKQYYGRGPVQLSW  186

Query  381  NYNYGAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPSPP  560
            NYNYG  GKA+G DL++NPDLVATDP +SFKTA WFWMT Q  KPSCH +ITG WSPS  
Sbjct  187  NYNYGQCGKAIGVDLLNNPDLVATDPVISFKTAIWFWMTAQSPKPSCHSIITGNWSPSGA  246

Query  561  DTAAGRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCSTQT  740
            D+AAGRVPGYG++TNIINGG+ECG   +   E DRIGFYKRYCD+  VGYG+NLDC  Q 
Sbjct  247  DSAAGRVPGYGVLTNIINGGLECGMGWKQQVE-DRIGFYKRYCDLLGVGYGNNLDCYNQK  305

Query  741  PYS  749
             ++
Sbjct  306  SFA  308



>pdb|4J0L|A Chain A, Crystal Structure Of A Family Gh19 Chitinase (w72a/e67q 
Mutant) From Rye Seeds In Complex With Two (glcnac)4 Molecules
Length=244

 Score =   336 bits (861),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 162/243 (67%), Positives = 188/243 (77%), Gaps = 2/243 (1%)
 Frame = +3

Query  24   VSSIISQAIFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAFL  203
            VSSIIS A FD ML +R+D  C A  FYTYDAF+AAA +F  F  TG  D RKR+VAAFL
Sbjct  3    VSSIISHAQFDRMLLHRNDGACQAKGFYTYDAFVAAANAFPGFGATGSTDARKRDVAAFL  62

Query  204  GQTSHETTGGWDAAPDGRYAWGYCFLRE-GTDDPYCNVTQEWSCAPGQKYFGRGPIQISY  380
             QTSH+TTGG   APDG +AWGYCF +E G    YC  + +W CAPG++Y+GRGPIQ+S+
Sbjct  63   AQTSHQTTGGAATAPDGAFAWGYCFKQERGAAADYCTPSAQWPCAPGKRYYGRGPIQLSH  122

Query  381  NYNYGAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPSPP  560
            NYNYG AG+A+G DL+ NPDLVATDPTVSFKTA WFWMT Q  KPS H VITGKWSPS  
Sbjct  123  NYNYGPAGRAIGVDLLRNPDLVATDPTVSFKTALWFWMTAQAPKPSSHAVITGKWSPSGA  182

Query  561  DTAAGRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCSTQT  740
            D AAGR PG+G++TNIINGG+ECG  G+  + ADRIGFYKRYCDI  VGYGDNLDC  Q 
Sbjct  183  DRAAGRAPGFGVITNIINGGLECG-HGQDSRVADRIGFYKRYCDILGVGYGDNLDCYNQR  241

Query  741  PYS  749
            P++
Sbjct  242  PFA  244



>ref|XP_007202270.1| hypothetical protein PRUPE_ppa008859mg [Prunus persica]
 gb|EMJ03469.1| hypothetical protein PRUPE_ppa008859mg [Prunus persica]
Length=316

 Score =   338 bits (868),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 156/235 (66%), Positives = 189/235 (80%), Gaps = 1/235 (0%)
 Frame = +3

Query  45   AIFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAFLGQTSHET  224
            A+FD MLKYR+D+RC +  FY YDAF+AAA++F  F TTGD++ RK+E+AAFL QTSHET
Sbjct  83   AVFDQMLKYRNDARCKSNGFYKYDAFVAAARTFNGFGTTGDVNVRKKELAAFLAQTSHET  142

Query  225  TGGWDAAPDGRYAWGYCFLREGTDDPYCNVTQEWSCAPGQKYFGRGPIQISYNYNYGAAG  404
            TGGW  APDG YAWGYCF+ E   D YC  + ++ CA G+KY+GRGPIQ+++NYNYG AG
Sbjct  143  TGGWATAPDGPYAWGYCFINENNQDVYCTPSAQYPCAAGKKYYGRGPIQLTHNYNYGPAG  202

Query  405  KALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPSPPDTAAGRVP  584
             A+G DLI+NPDLVATDP VSF+TA WFWMTPQG KPS HDVITG+WSPS  D +AGRVP
Sbjct  203  NAIGKDLIANPDLVATDPVVSFRTAMWFWMTPQGNKPSSHDVITGRWSPSAADKSAGRVP  262

Query  585  GYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCSTQTPYS  749
            GYG++TNIINGG+ECG  G+  + ADRIGFYKRY +I  V  GDNLDC  Q P++
Sbjct  263  GYGVITNIINGGLECG-RGQDARVADRIGFYKRYSEILGVSPGDNLDCYNQRPFA  316



>ref|XP_003563255.1| PREDICTED: basic endochitinase C [Brachypodium distachyon]
Length=265

 Score =   337 bits (863),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 159/243 (65%), Positives = 188/243 (77%), Gaps = 2/243 (1%)
 Frame = +3

Query  24   VSSIISQAIFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAFL  203
            VSSI+S+++FD ML +R++  C A  FYTYDAFIAAA SF  F TTG+ D RKREVAAFL
Sbjct  24   VSSIVSRSLFDRMLLHRNEGACQAKGFYTYDAFIAAANSFRGFGTTGNADVRKREVAAFL  83

Query  204  GQTSHETTGGWDAAPDGRYAWGYCFLRE-GTDDPYCNVTQEWSCAPGQKYFGRGPIQISY  380
             QTSHETTGGW  APDG YAWGYCF +E G    +C  + +W C PG++Y+GRGPI +S+
Sbjct  84   AQTSHETTGGWATAPDGAYAWGYCFKQERGVTSDFCTPSAQWPCVPGKRYYGRGPIHLSH  143

Query  381  NYNYGAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPSPP  560
            NYNYG AGKA+G DL+ NPDLVATDPTVSFKTA WFWMT Q  KPS H V TG+W PS  
Sbjct  144  NYNYGPAGKAIGVDLLRNPDLVATDPTVSFKTALWFWMTAQAPKPSAHAVATGQWKPSAA  203

Query  561  DTAAGRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCSTQT  740
            D  AGRVPG+G++TNI+NGGVECG  G+  + ADRIGFYKRYCDI  V YGD+LDC  Q 
Sbjct  204  DRTAGRVPGFGVITNIVNGGVECG-HGQDIRVADRIGFYKRYCDILGVSYGDSLDCYNQR  262

Query  741  PYS  749
            P++
Sbjct  263  PFA  265



>gb|ACJ62113.1| chitinase [Zea mays subsp. parviglumis]
Length=321

 Score =   338 bits (868),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 162/245 (66%), Positives = 194/245 (79%), Gaps = 4/245 (2%)
 Frame = +3

Query  24   VSSIISQAIFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAFL  203
            V+SII +++F+ ML +R+D+ C A  FYTY  FIAAA +F  F TTG  D +KRE+AAFL
Sbjct  77   VASIIPESLFNQMLLHRNDAACAANGFYTYAGFIAAANAFPGFGTTGAPDVQKRELAAFL  136

Query  204  GQTSHETTGGWDAAPDGRYAWGYCFLRE--GTDDP-YCNVTQEWSCAPGQKYFGRGPIQI  374
             QTSHETTGGW  APDG YAWGYCF  E  G   P YC  + +W CA G+KY+GRGPIQI
Sbjct  137  AQTSHETTGGWATAPDGPYAWGYCFKEEQGGASGPDYCEPSAQWPCAAGKKYYGRGPIQI  196

Query  375  SYNYNYGAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPS  554
            SYNYNYG AG+A+G  +++NPDLVATDPTVSF+TA WFWMTPQ  KPSCHDV+TG+W+PS
Sbjct  197  SYNYNYGPAGQAIGAGILANPDLVATDPTVSFETAVWFWMTPQSPKPSCHDVMTGQWTPS  256

Query  555  PPDTAAGRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCST  734
              DTAAGR+PGYG+VTNIINGG+ECG  G   + ADRIGFYKRYCD+  V YGDNLDC+ 
Sbjct  257  AADTAAGRLPGYGVVTNIINGGLECG-HGADSRVADRIGFYKRYCDLLGVSYGDNLDCAN  315

Query  735  QTPYS  749
            QTP++
Sbjct  316  QTPFN  320



>ref|XP_008440900.1| PREDICTED: chitinase 1-like isoform X2 [Cucumis melo]
Length=317

 Score =   338 bits (867),  Expect = 8e-112, Method: Compositional matrix adjust.
 Identities = 158/241 (66%), Positives = 187/241 (78%), Gaps = 1/241 (0%)
 Frame = +3

Query  24   VSSIISQAIFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAFL  203
            V SII+++++  MLKY  DSRC +  FYTY+AFI AA+SF  F TTGD  TRKRE+AAF 
Sbjct  78   VGSIITESLYKQMLKYSTDSRCPSNGFYTYNAFITAAQSFPGFGTTGDDATRKRELAAFF  137

Query  204  GQTSHETTGGWDAAPDGRYAWGYCFLREGTDDPYCNVTQEWSCAPGQKYFGRGPIQISYN  383
            GQTSHETTGGW +APDG YAWGYCF+RE   D YC  + +W C  GQKY+GRGPIQ+++N
Sbjct  138  GQTSHETTGGWASAPDGPYAWGYCFIREINQDVYCTPSSQWPCVSGQKYYGRGPIQLTHN  197

Query  384  YNYGAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPSPPD  563
            YNYG AG AL  +L+SNPDLVAT+  +SFK A WFWMTPQG KPSCH+VITG W PS  D
Sbjct  198  YNYGPAGNALSLNLLSNPDLVATNAIISFKAAIWFWMTPQGNKPSCHNVITGNWQPSSAD  257

Query  564  TAAGRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCSTQTP  743
            +AAGRVPGYG++TNIINGG+ECG  G   +  DRIGFYKRYCDI  +GYG NLDC  Q  
Sbjct  258  SAAGRVPGYGVLTNIINGGLECG-HGPDSRVEDRIGFYKRYCDILGIGYGSNLDCYNQQS  316

Query  744  Y  746
            +
Sbjct  317  F  317



>gb|ACJ62151.1| chitinase [Zea mays subsp. parviglumis]
Length=323

 Score =   338 bits (867),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 162/245 (66%), Positives = 194/245 (79%), Gaps = 4/245 (2%)
 Frame = +3

Query  24   VSSIISQAIFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAFL  203
            V+SII +++F+ ML +R+D+ C A  FYTY  FIAAA +F  F TTG  D +KRE+AAFL
Sbjct  79   VASIIPESLFNQMLLHRNDAACPANGFYTYAGFIAAANAFPGFGTTGAPDVQKRELAAFL  138

Query  204  GQTSHETTGGWDAAPDGRYAWGYCFLRE--GTDDP-YCNVTQEWSCAPGQKYFGRGPIQI  374
             QTSHETTGGW  APDG YAWGYCF  E  G   P YC  + +W CA G+KY+GRGPIQI
Sbjct  139  AQTSHETTGGWATAPDGPYAWGYCFKEEQGGASGPDYCEPSAQWPCAAGKKYYGRGPIQI  198

Query  375  SYNYNYGAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPS  554
            SYNYNYG AG+A+G  +++NPDLVATDPTVSF+TA WFWMTPQ  KPSCHDV+TG+W+PS
Sbjct  199  SYNYNYGPAGQAIGAGILANPDLVATDPTVSFETAVWFWMTPQSPKPSCHDVMTGQWTPS  258

Query  555  PPDTAAGRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCST  734
              DTAAGR+PGYG+VTNIINGG+ECG  G   + ADRIGFYKRYCD+  V YGDNLDC+ 
Sbjct  259  AADTAAGRLPGYGVVTNIINGGLECG-HGADSRVADRIGFYKRYCDLLGVSYGDNLDCAN  317

Query  735  QTPYS  749
            QTP++
Sbjct  318  QTPFN  322



>gb|ABK27143.1| unknown [Picea sitchensis]
 gb|ACN40614.1| unknown [Picea sitchensis]
Length=308

 Score =   338 bits (866),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 157/243 (65%), Positives = 192/243 (79%), Gaps = 3/243 (1%)
 Frame = +3

Query  24   VSSIISQAIFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAFL  203
            VSS+I+++IF+D+LK+R+D+ C A  FY+YDAFIAAA +F  F TTGDL ++KRE+AAF 
Sbjct  52   VSSVITESIFNDLLKHRNDAGCKAKGFYSYDAFIAAANAFPGFGTTGDLTSQKRELAAFF  111

Query  204  GQTSHETTGGWDAAPDGRYAWGYCFLREGTDDP--YCNVTQEWSCAPGQKYFGRGPIQIS  377
            GQTSHETTGGW  APDG YAWGYCF  E  + P  YC  + +W CA G++Y+GRGP+QIS
Sbjct  112  GQTSHETTGGWPTAPDGPYAWGYCFKEEQGNPPGEYCQASSQWPCASGKRYYGRGPVQIS  171

Query  378  YNYNYGAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPSP  557
            +NYNYG AGKA+G+D I+NPD+VA D TVSFKTA WFWMT Q  KPSCH+V+ G W PS 
Sbjct  172  WNYNYGPAGKAVGFDGINNPDIVANDATVSFKTAVWFWMTEQSPKPSCHNVMAGGWGPSG  231

Query  558  PDTAAGRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCSTQ  737
             DTAAGR  GYG+VTNIINGG+ECG  G   ++ DRIGFYKRYCDI  V YG NLDC++Q
Sbjct  232  SDTAAGRAAGYGVVTNIINGGLECGK-GSDSRQEDRIGFYKRYCDILGVSYGSNLDCNSQ  290

Query  738  TPY  746
             P+
Sbjct  291  KPF  293



>gb|AAT40014.1| chitinase [Zea mays subsp. parviglumis]
 gb|AAT40022.1| chitinase [Zea mays subsp. parviglumis]
 gb|AAT40024.1| chitinase [Zea mays subsp. parviglumis]
 gb|AAT40025.1| chitinase [Zea mays subsp. parviglumis]
 gb|AAT40026.1| chitinase [Zea mays subsp. parviglumis]
 gb|AAT40028.1| chitinase [Zea diploperennis]
 gb|ACJ62089.1| chitinase [Zea mays subsp. parviglumis]
 gb|ACJ62090.1| chitinase [Zea mays subsp. parviglumis]
 gb|ACJ62093.1| chitinase [Zea mays subsp. parviglumis]
 gb|ACJ62096.1| chitinase [Zea mays subsp. parviglumis]
 gb|ACJ62100.1| chitinase [Zea mays subsp. parviglumis]
 gb|ACJ62124.1| chitinase [Zea mays subsp. parviglumis]
 gb|ACJ62126.1| chitinase [Zea mays subsp. parviglumis]
 gb|ACJ62127.1| chitinase [Zea mays subsp. parviglumis]
 gb|ACJ62128.1| chitinase [Zea mays subsp. parviglumis]
 gb|ACJ62129.1| chitinase [Zea mays subsp. parviglumis]
 gb|ACJ62130.1| chitinase [Zea mays subsp. parviglumis]
 gb|ACJ62133.1| chitinase [Zea mays subsp. parviglumis]
 gb|ACJ62135.1| chitinase [Zea mays subsp. parviglumis]
 gb|ACJ62155.1| chitinase [Zea mays subsp. parviglumis]
 gb|ACJ62159.1| chitinase [Zea mays subsp. parviglumis]
Length=321

 Score =   338 bits (867),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 162/245 (66%), Positives = 194/245 (79%), Gaps = 4/245 (2%)
 Frame = +3

Query  24   VSSIISQAIFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAFL  203
            V+SII +++F+ ML +R+D+ C A  FYTY  FIAAA +F  F TTG  D +KRE+AAFL
Sbjct  77   VASIIPESLFNQMLLHRNDAACPANGFYTYAGFIAAANAFPGFGTTGAPDVQKRELAAFL  136

Query  204  GQTSHETTGGWDAAPDGRYAWGYCFLRE--GTDDP-YCNVTQEWSCAPGQKYFGRGPIQI  374
             QTSHETTGGW  APDG YAWGYCF  E  G   P YC  + +W CA G+KY+GRGPIQI
Sbjct  137  AQTSHETTGGWATAPDGPYAWGYCFKEEQGGASGPDYCEPSAQWPCAAGKKYYGRGPIQI  196

Query  375  SYNYNYGAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPS  554
            SYNYNYG AG+A+G  +++NPDLVATDPTVSF+TA WFWMTPQ  KPSCHDV+TG+W+PS
Sbjct  197  SYNYNYGPAGQAIGAGILANPDLVATDPTVSFETAVWFWMTPQSPKPSCHDVMTGQWTPS  256

Query  555  PPDTAAGRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCST  734
              DTAAGR+PGYG+VTNIINGG+ECG  G   + ADRIGFYKRYCD+  V YGDNLDC+ 
Sbjct  257  AADTAAGRLPGYGVVTNIINGGLECG-HGADSRVADRIGFYKRYCDLLGVSYGDNLDCAN  315

Query  735  QTPYS  749
            QTP++
Sbjct  316  QTPFN  320



>ref|NP_001265906.1| endochitinase A2-like precursor [Cicer arietinum]
 emb|CAA10189.1| class I chitinase [Cicer arietinum]
Length=328

 Score =   338 bits (867),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 157/233 (67%), Positives = 187/233 (80%), Gaps = 1/233 (0%)
 Frame = +3

Query  51   FDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAFLGQTSHETTG  230
            F+ MLK+RDDS C    FYTY+AFIAAAK F +    GD  T+KRE+AAFLGQTSHETTG
Sbjct  78   FNQMLKHRDDSGCEGKGFYTYEAFIAAAKYFPDLGNNGDTATKKREIAAFLGQTSHETTG  137

Query  231  GWDAAPDGRYAWGYCFLREGTDDPYCNVTQEWSCAPGQKYFGRGPIQISYNYNYGAAGKA  410
            GW +APDG YAWGYCFLRE     YC  + E+ CA G++Y+GRGPIQ+S+NYNYG  G+A
Sbjct  138  GWSSAPDGPYAWGYCFLREQNPSTYCQPSSEYPCASGKQYYGRGPIQLSWNYNYGQCGRA  197

Query  411  LGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPSPPDTAAGRVPGY  590
            +G DL++NPDLVATDP +SFKTA WFWMTPQ  KPSCHDVITG+W+PS  D AAGR+PGY
Sbjct  198  IGVDLLNNPDLVATDPVISFKTAIWFWMTPQSPKPSCHDVITGRWNPSTSDRAAGRLPGY  257

Query  591  GLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCSTQTPYS  749
            G VTNIINGG+ECG  G   +  DRIGFYKRYCDIF + YGDN+DC++QTP++
Sbjct  258  GTVTNIINGGLECG-RGHDSRVQDRIGFYKRYCDIFGIVYGDNIDCASQTPFA  309



>gb|AAT40013.1| chitinase [Zea mays subsp. parviglumis]
 gb|AAT40021.1| chitinase [Zea mays subsp. parviglumis]
 gb|ACJ62092.1| chitinase [Zea mays subsp. parviglumis]
 gb|ACJ62137.1| chitinase [Zea mays subsp. parviglumis]
 gb|ACJ62142.1| chitinase [Zea mays subsp. parviglumis]
 gb|ACJ62145.1| chitinase [Zea mays subsp. parviglumis]
 gb|ACJ62152.1| chitinase [Zea mays subsp. parviglumis]
Length=321

 Score =   338 bits (867),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 162/245 (66%), Positives = 194/245 (79%), Gaps = 4/245 (2%)
 Frame = +3

Query  24   VSSIISQAIFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAFL  203
            V+SII +++F+ ML +R+D+ C A  FYTY  FIAAA +F  F TTG  D +KRE+AAFL
Sbjct  77   VASIIPESLFNQMLLHRNDAACPANGFYTYAGFIAAANAFPGFGTTGAPDVQKRELAAFL  136

Query  204  GQTSHETTGGWDAAPDGRYAWGYCFLRE--GTDDP-YCNVTQEWSCAPGQKYFGRGPIQI  374
             QTSHETTGGW  APDG YAWGYCF  E  G   P YC  + +W CA G+KY+GRGPIQI
Sbjct  137  AQTSHETTGGWATAPDGPYAWGYCFKEEQGGASGPDYCEPSAQWPCAAGKKYYGRGPIQI  196

Query  375  SYNYNYGAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPS  554
            SYNYNYG AG+A+G  +++NPDLVATDPTVSF+TA WFWMTPQ  KPSCHDV+TG+W+PS
Sbjct  197  SYNYNYGPAGQAIGAGILANPDLVATDPTVSFETAVWFWMTPQSPKPSCHDVMTGQWTPS  256

Query  555  PPDTAAGRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCST  734
              DTAAGR+PGYG+VTNIINGG+ECG  G   + ADRIGFYKRYCD+  V YGDNLDC+ 
Sbjct  257  AADTAAGRLPGYGVVTNIINGGLECG-HGADSRVADRIGFYKRYCDLLGVSYGDNLDCAN  315

Query  735  QTPYS  749
            QTP++
Sbjct  316  QTPFN  320



>gb|ACJ62121.1| chitinase [Zea mays subsp. parviglumis]
 gb|ACJ62122.1| chitinase [Zea mays subsp. parviglumis]
Length=317

 Score =   338 bits (866),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 162/245 (66%), Positives = 194/245 (79%), Gaps = 4/245 (2%)
 Frame = +3

Query  24   VSSIISQAIFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAFL  203
            V+SII +++F+ ML +R+D+ C A  FYTY  FIAAA +F  F TTG  D +KRE+AAFL
Sbjct  73   VASIIPESLFNQMLLHRNDAACPANGFYTYAGFIAAANAFPGFGTTGAPDVQKRELAAFL  132

Query  204  GQTSHETTGGWDAAPDGRYAWGYCFLRE--GTDDP-YCNVTQEWSCAPGQKYFGRGPIQI  374
             QTSHETTGGW  APDG YAWGYCF  E  G   P YC  + +W CA G+KY+GRGPIQI
Sbjct  133  AQTSHETTGGWATAPDGPYAWGYCFKEEQGGASGPDYCEPSAQWPCAAGKKYYGRGPIQI  192

Query  375  SYNYNYGAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPS  554
            SYNYNYG AG+A+G  +++NPDLVATDPTVSF+TA WFWMTPQ  KPSCHDV+TG+W+PS
Sbjct  193  SYNYNYGPAGQAIGAGILANPDLVATDPTVSFETAVWFWMTPQSPKPSCHDVMTGQWTPS  252

Query  555  PPDTAAGRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCST  734
              DTAAGR+PGYG+VTNIINGG+ECG  G   + ADRIGFYKRYCD+  V YGDNLDC+ 
Sbjct  253  AADTAAGRLPGYGVVTNIINGGLECG-HGADSRVADRIGFYKRYCDLLGVSYGDNLDCAN  311

Query  735  QTPYS  749
            QTP++
Sbjct  312  QTPFN  316



>gb|ACJ62107.1| chitinase [Zea mays subsp. parviglumis]
Length=318

 Score =   338 bits (866),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 162/245 (66%), Positives = 194/245 (79%), Gaps = 4/245 (2%)
 Frame = +3

Query  24   VSSIISQAIFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAFL  203
            V+SII +++F+ ML +R+D+ C A  FYTY  FIAAA +F  F TTG  D +KRE+AAFL
Sbjct  74   VASIIPESLFNQMLLHRNDAACPANGFYTYAGFIAAANAFPGFGTTGAPDVQKRELAAFL  133

Query  204  GQTSHETTGGWDAAPDGRYAWGYCFLRE--GTDDP-YCNVTQEWSCAPGQKYFGRGPIQI  374
             QTSHETTGGW  APDG YAWGYCF  E  G   P YC  + +W CA G+KY+GRGPIQI
Sbjct  134  AQTSHETTGGWATAPDGPYAWGYCFKEEQGGASGPDYCEPSAQWPCAAGKKYYGRGPIQI  193

Query  375  SYNYNYGAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPS  554
            SYNYNYG AG+A+G  +++NPDLVATDPTVSF+TA WFWMTPQ  KPSCHDV+TG+W+PS
Sbjct  194  SYNYNYGPAGQAIGAGILANPDLVATDPTVSFETAVWFWMTPQSPKPSCHDVMTGQWTPS  253

Query  555  PPDTAAGRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCST  734
              DTAAGR+PGYG+VTNIINGG+ECG  G   + ADRIGFYKRYCD+  V YGDNLDC+ 
Sbjct  254  AADTAAGRLPGYGVVTNIINGGLECG-HGADSRVADRIGFYKRYCDLLGVSYGDNLDCAN  312

Query  735  QTPYS  749
            QTP++
Sbjct  313  QTPFN  317



>gb|ACJ62106.1| chitinase [Zea mays subsp. parviglumis]
 gb|ACJ62119.1| chitinase [Zea mays subsp. parviglumis]
Length=318

 Score =   338 bits (866),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 162/245 (66%), Positives = 194/245 (79%), Gaps = 4/245 (2%)
 Frame = +3

Query  24   VSSIISQAIFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAFL  203
            V+SII +++F+ ML +R+D+ C A  FYTY  FIAAA +F  F TTG  D +KRE+AAFL
Sbjct  74   VASIIPESLFNQMLLHRNDAACPANGFYTYAGFIAAANAFPGFGTTGAPDVQKRELAAFL  133

Query  204  GQTSHETTGGWDAAPDGRYAWGYCFLRE--GTDDP-YCNVTQEWSCAPGQKYFGRGPIQI  374
             QTSHETTGGW  APDG YAWGYCF  E  G   P YC  + +W CA G+KY+GRGPIQI
Sbjct  134  AQTSHETTGGWATAPDGPYAWGYCFKEEQGGASGPDYCEPSAQWPCAAGKKYYGRGPIQI  193

Query  375  SYNYNYGAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPS  554
            SYNYNYG AG+A+G  +++NPDLVATDPTVSF+TA WFWMTPQ  KPSCHDV+TG+W+PS
Sbjct  194  SYNYNYGPAGQAIGAGILANPDLVATDPTVSFETAVWFWMTPQSPKPSCHDVMTGQWTPS  253

Query  555  PPDTAAGRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCST  734
              DTAAGR+PGYG+VTNIINGG+ECG  G   + ADRIGFYKRYCD+  V YGDNLDC+ 
Sbjct  254  AADTAAGRLPGYGVVTNIINGGLECG-HGADSRVADRIGFYKRYCDLLGVSYGDNLDCAN  312

Query  735  QTPYS  749
            QTP++
Sbjct  313  QTPFN  317



>gb|ACJ62108.1| chitinase [Zea mays subsp. parviglumis]
Length=322

 Score =   338 bits (867),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 162/245 (66%), Positives = 194/245 (79%), Gaps = 4/245 (2%)
 Frame = +3

Query  24   VSSIISQAIFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAFL  203
            V+SII +++F+ ML +R+D+ C A  FYTY  FIAAA +F  F TTG  D +KRE+AAFL
Sbjct  78   VASIIPESLFNQMLLHRNDAACPANGFYTYAGFIAAANAFPGFGTTGAPDVQKRELAAFL  137

Query  204  GQTSHETTGGWDAAPDGRYAWGYCFLRE--GTDDP-YCNVTQEWSCAPGQKYFGRGPIQI  374
             QTSHETTGGW  APDG YAWGYCF  E  G   P YC  + +W CA G+KY+GRGPIQI
Sbjct  138  AQTSHETTGGWATAPDGPYAWGYCFKEEQGGASGPDYCEPSAQWPCAAGKKYYGRGPIQI  197

Query  375  SYNYNYGAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPS  554
            SYNYNYG AG+A+G  +++NPDLVATDPTVSF+TA WFWMTPQ  KPSCHDV+TG+W+PS
Sbjct  198  SYNYNYGPAGQAIGAGILANPDLVATDPTVSFETAVWFWMTPQSPKPSCHDVMTGQWTPS  257

Query  555  PPDTAAGRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCST  734
              DTAAGR+PGYG+VTNIINGG+ECG  G   + ADRIGFYKRYCD+  V YGDNLDC+ 
Sbjct  258  AADTAAGRLPGYGVVTNIINGGLECG-HGADSRVADRIGFYKRYCDLLGVSYGDNLDCAN  316

Query  735  QTPYS  749
            QTP++
Sbjct  317  QTPFN  321



>gb|ACJ62111.1| chitinase [Zea mays subsp. parviglumis]
 gb|ACJ62112.1| chitinase [Zea mays subsp. parviglumis]
 gb|ACJ62123.1| chitinase [Zea mays subsp. parviglumis]
 gb|ACJ62134.1| chitinase [Zea mays subsp. parviglumis]
Length=322

 Score =   338 bits (867),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 162/245 (66%), Positives = 194/245 (79%), Gaps = 4/245 (2%)
 Frame = +3

Query  24   VSSIISQAIFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAFL  203
            V+SII +++F+ ML +R+D+ C A  FYTY  FIAAA +F  F TTG  D +KRE+AAFL
Sbjct  78   VASIIPESLFNQMLLHRNDAACPANGFYTYAGFIAAANAFPGFGTTGAPDVQKRELAAFL  137

Query  204  GQTSHETTGGWDAAPDGRYAWGYCFLRE--GTDDP-YCNVTQEWSCAPGQKYFGRGPIQI  374
             QTSHETTGGW  APDG YAWGYCF  E  G   P YC  + +W CA G+KY+GRGPIQI
Sbjct  138  AQTSHETTGGWATAPDGPYAWGYCFKEEQGGASGPDYCEPSAQWPCAAGKKYYGRGPIQI  197

Query  375  SYNYNYGAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPS  554
            SYNYNYG AG+A+G  +++NPDLVATDPTVSF+TA WFWMTPQ  KPSCHDV+TG+W+PS
Sbjct  198  SYNYNYGPAGQAIGAGILANPDLVATDPTVSFETAVWFWMTPQSPKPSCHDVMTGQWTPS  257

Query  555  PPDTAAGRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCST  734
              DTAAGR+PGYG+VTNIINGG+ECG  G   + ADRIGFYKRYCD+  V YGDNLDC+ 
Sbjct  258  AADTAAGRLPGYGVVTNIINGGLECG-HGADSRVADRIGFYKRYCDLLGVSYGDNLDCAN  316

Query  735  QTPYS  749
            QTP++
Sbjct  317  QTPFN  321



>gb|AAT40012.1| chitinase [Zea mays subsp. parviglumis]
 gb|AAT40018.1| chitinase [Zea mays subsp. parviglumis]
 gb|AAT40020.1| chitinase [Zea mays subsp. parviglumis]
 gb|ACJ62132.1| chitinase [Zea mays subsp. parviglumis]
 gb|ACJ62154.1| chitinase [Zea mays subsp. parviglumis]
 gb|ACJ62160.1| chitinase [Zea mays subsp. parviglumis]
Length=322

 Score =   338 bits (867),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 162/245 (66%), Positives = 194/245 (79%), Gaps = 4/245 (2%)
 Frame = +3

Query  24   VSSIISQAIFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAFL  203
            V+SII +++F+ ML +R+D+ C A  FYTY  FIAAA +F  F TTG  D +KRE+AAFL
Sbjct  78   VASIIPESLFNQMLLHRNDAACPANGFYTYAGFIAAANAFPGFGTTGAPDVQKRELAAFL  137

Query  204  GQTSHETTGGWDAAPDGRYAWGYCFLRE--GTDDP-YCNVTQEWSCAPGQKYFGRGPIQI  374
             QTSHETTGGW  APDG YAWGYCF  E  G   P YC  + +W CA G+KY+GRGPIQI
Sbjct  138  AQTSHETTGGWATAPDGPYAWGYCFKEEQGGASGPDYCEPSAQWPCAAGKKYYGRGPIQI  197

Query  375  SYNYNYGAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPS  554
            SYNYNYG AG+A+G  +++NPDLVATDPTVSF+TA WFWMTPQ  KPSCHDV+TG+W+PS
Sbjct  198  SYNYNYGPAGQAIGAGILANPDLVATDPTVSFETAVWFWMTPQSPKPSCHDVMTGQWTPS  257

Query  555  PPDTAAGRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCST  734
              DTAAGR+PGYG+VTNIINGG+ECG  G   + ADRIGFYKRYCD+  V YGDNLDC+ 
Sbjct  258  AADTAAGRLPGYGVVTNIINGGLECG-HGADSRVADRIGFYKRYCDLLGVSYGDNLDCAN  316

Query  735  QTPYS  749
            QTP++
Sbjct  317  QTPFN  321



>gb|ABK22517.1| unknown [Picea sitchensis]
 gb|ABK22792.1| unknown [Picea sitchensis]
Length=308

 Score =   337 bits (865),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 157/243 (65%), Positives = 192/243 (79%), Gaps = 3/243 (1%)
 Frame = +3

Query  24   VSSIISQAIFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAFL  203
            VSS+I+++IF+D+LK+R+D+ C A  FY+YDAFIAAA +F  F TTGDL ++KRE+AAF 
Sbjct  52   VSSVITESIFNDLLKHRNDAGCKAKGFYSYDAFIAAANAFPGFGTTGDLTSQKRELAAFF  111

Query  204  GQTSHETTGGWDAAPDGRYAWGYCFLREGTDDP--YCNVTQEWSCAPGQKYFGRGPIQIS  377
            GQTSHETTGGW  APDG YAWGYCF  E  + P  YC  + +W CA G++Y+GRGP+QIS
Sbjct  112  GQTSHETTGGWPTAPDGPYAWGYCFKEEQGNPPGEYCQASSQWPCASGKRYYGRGPVQIS  171

Query  378  YNYNYGAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPSP  557
            +NYNYG AGKA+G+D I+NPD+VA D TVSFKTA WFWMT Q  KPSCH+V+ G W PS 
Sbjct  172  WNYNYGPAGKAVGFDGINNPDIVANDATVSFKTAVWFWMTEQSPKPSCHNVMAGGWGPSG  231

Query  558  PDTAAGRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCSTQ  737
             DTAAGR  GYG+VTNIINGG+ECG  G   ++ DRIGFYKRYCDI  V YG NLDC++Q
Sbjct  232  SDTAAGRAAGYGVVTNIINGGLECGK-GSDSRQEDRIGFYKRYCDILGVSYGSNLDCNSQ  290

Query  738  TPY  746
             P+
Sbjct  291  KPF  293



>gb|ACJ62086.1| chitinase [Zea mays subsp. parviglumis]
Length=320

 Score =   338 bits (866),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 162/245 (66%), Positives = 194/245 (79%), Gaps = 4/245 (2%)
 Frame = +3

Query  24   VSSIISQAIFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAFL  203
            V+SII +++F+ ML +R+D+ C A  FYTY  FIAAA +F  F TTG  D +KRE+AAFL
Sbjct  76   VASIIPESLFNQMLLHRNDAACPANGFYTYAGFIAAANAFPGFGTTGAPDVQKRELAAFL  135

Query  204  GQTSHETTGGWDAAPDGRYAWGYCFLRE--GTDDP-YCNVTQEWSCAPGQKYFGRGPIQI  374
             QTSHETTGGW  APDG YAWGYCF  E  G   P YC  + +W CA G+KY+GRGPIQI
Sbjct  136  AQTSHETTGGWATAPDGPYAWGYCFKEEQGGASGPDYCEPSAQWPCAAGKKYYGRGPIQI  195

Query  375  SYNYNYGAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPS  554
            SYNYNYG AG+A+G  +++NPDLVATDPTVSF+TA WFWMTPQ  KPSCHDV+TG+W+PS
Sbjct  196  SYNYNYGPAGQAIGAGILANPDLVATDPTVSFETAVWFWMTPQSPKPSCHDVMTGQWTPS  255

Query  555  PPDTAAGRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCST  734
              DTAAGR+PGYG+VTNIINGG+ECG  G   + ADRIGFYKRYCD+  V YGDNLDC+ 
Sbjct  256  AADTAAGRLPGYGVVTNIINGGLECG-HGADSRVADRIGFYKRYCDLLGVSYGDNLDCAN  314

Query  735  QTPYS  749
            QTP++
Sbjct  315  QTPFN  319



>gb|ACJ62114.1| chitinase [Zea mays subsp. parviglumis]
Length=322

 Score =   338 bits (866),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 162/245 (66%), Positives = 194/245 (79%), Gaps = 4/245 (2%)
 Frame = +3

Query  24   VSSIISQAIFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAFL  203
            V+SII +++F+ ML +R+D+ C A  FYTY  FIAAA +F  F TTG  D +KRE+AAFL
Sbjct  78   VASIIPESLFNQMLLHRNDAACPANGFYTYAGFIAAANAFPGFGTTGAPDVQKRELAAFL  137

Query  204  GQTSHETTGGWDAAPDGRYAWGYCFLRE--GTDDP-YCNVTQEWSCAPGQKYFGRGPIQI  374
             QTSHETTGGW  APDG YAWGYCF  E  G   P YC  + +W CA G+KY+GRGPIQI
Sbjct  138  AQTSHETTGGWATAPDGPYAWGYCFKEEQGGASGPDYCGPSAQWPCAAGKKYYGRGPIQI  197

Query  375  SYNYNYGAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPS  554
            SYNYNYG AG+A+G  +++NPDLVATDPTVSF+TA WFWMTPQ  KPSCHDV+TG+W+PS
Sbjct  198  SYNYNYGPAGQAIGAGILANPDLVATDPTVSFETAVWFWMTPQSPKPSCHDVMTGQWTPS  257

Query  555  PPDTAAGRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCST  734
              DTAAGR+PGYG+VTNIINGG+ECG  G   + ADRIGFYKRYCD+  V YGDNLDC+ 
Sbjct  258  AADTAAGRLPGYGVVTNIINGGLECG-HGADSRVADRIGFYKRYCDLLGVSYGDNLDCAN  316

Query  735  QTPYS  749
            QTP++
Sbjct  317  QTPFN  321



>gb|ACJ62131.1| chitinase [Zea mays subsp. parviglumis]
 gb|ACJ62139.1| chitinase [Zea mays subsp. parviglumis]
Length=321

 Score =   338 bits (866),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 162/245 (66%), Positives = 194/245 (79%), Gaps = 4/245 (2%)
 Frame = +3

Query  24   VSSIISQAIFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAFL  203
            V+SII +++F+ ML +R+D+ C A  FYTY  FIAAA +F  F TTG  D +KRE+AAFL
Sbjct  77   VASIIPESLFNQMLLHRNDAACPANGFYTYAGFIAAANAFPGFGTTGAPDVQKRELAAFL  136

Query  204  GQTSHETTGGWDAAPDGRYAWGYCFLRE--GTDDP-YCNVTQEWSCAPGQKYFGRGPIQI  374
             QTSHETTGGW  APDG YAWGYCF  E  G   P YC  + +W CA G+KY+GRGPIQI
Sbjct  137  AQTSHETTGGWATAPDGPYAWGYCFKEEQGGASGPDYCEPSAQWPCAAGKKYYGRGPIQI  196

Query  375  SYNYNYGAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPS  554
            SYNYNYG AG+A+G  +++NPDLVATDPTVSF+TA WFWMTPQ  KPSCHDV+TG+W+PS
Sbjct  197  SYNYNYGPAGQAIGAGILANPDLVATDPTVSFETAVWFWMTPQSPKPSCHDVMTGQWTPS  256

Query  555  PPDTAAGRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCST  734
              DTAAGR+PGYG+VTNIINGG+ECG  G   + ADRIGFYKRYCD+  V YGDNLDC+ 
Sbjct  257  AADTAAGRLPGYGVVTNIINGGLECG-HGADSRVADRIGFYKRYCDLLGVSYGDNLDCAN  315

Query  735  QTPYS  749
            QTP++
Sbjct  316  QTPFN  320



>gb|ACJ62095.1| chitinase [Zea mays subsp. parviglumis]
 gb|ACJ62102.1| chitinase [Zea mays subsp. parviglumis]
 gb|ACJ62120.1| chitinase [Zea mays subsp. parviglumis]
 gb|ACJ62146.1| chitinase [Zea mays subsp. parviglumis]
 gb|ACJ62148.1| chitinase [Zea mays subsp. parviglumis]
 gb|ACJ62149.1| chitinase [Zea mays subsp. parviglumis]
Length=317

 Score =   338 bits (866),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 162/245 (66%), Positives = 194/245 (79%), Gaps = 4/245 (2%)
 Frame = +3

Query  24   VSSIISQAIFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAFL  203
            V+SII +++F+ ML +R+D+ C A  FYTY  FIAAA +F  F TTG  D +KRE+AAFL
Sbjct  73   VASIIPESLFNQMLLHRNDAACPANGFYTYAGFIAAANAFPGFGTTGAPDVQKRELAAFL  132

Query  204  GQTSHETTGGWDAAPDGRYAWGYCFLRE--GTDDP-YCNVTQEWSCAPGQKYFGRGPIQI  374
             QTSHETTGGW  APDG YAWGYCF  E  G   P YC  + +W CA G+KY+GRGPIQI
Sbjct  133  AQTSHETTGGWATAPDGPYAWGYCFKEEQGGASGPDYCEPSAQWPCAAGKKYYGRGPIQI  192

Query  375  SYNYNYGAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPS  554
            SYNYNYG AG+A+G  +++NPDLVATDPTVSF+TA WFWMTPQ  KPSCHDV+TG+W+PS
Sbjct  193  SYNYNYGPAGQAIGAGILANPDLVATDPTVSFETAVWFWMTPQSPKPSCHDVMTGQWTPS  252

Query  555  PPDTAAGRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCST  734
              DTAAGR+PGYG+VTNIINGG+ECG  G   + ADRIGFYKRYCD+  V YGDNLDC+ 
Sbjct  253  AADTAAGRLPGYGVVTNIINGGLECG-HGADSRVADRIGFYKRYCDLLGVSYGDNLDCAN  311

Query  735  QTPYS  749
            QTP++
Sbjct  312  QTPFN  316



>gb|ACJ62157.1| chitinase [Zea mays subsp. parviglumis]
Length=312

 Score =   337 bits (865),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 162/245 (66%), Positives = 194/245 (79%), Gaps = 4/245 (2%)
 Frame = +3

Query  24   VSSIISQAIFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAFL  203
            V+SII +++F+ ML +R+D+ C A  FYTY  FIAAA +F  F TTG  D +KRE+AAFL
Sbjct  68   VASIIPESLFNQMLLHRNDAACPANGFYTYAGFIAAANAFPGFGTTGAPDVQKRELAAFL  127

Query  204  GQTSHETTGGWDAAPDGRYAWGYCFLRE--GTDDP-YCNVTQEWSCAPGQKYFGRGPIQI  374
             QTSHETTGGW  APDG YAWGYCF  E  G   P YC  + +W CA G+KY+GRGPIQI
Sbjct  128  AQTSHETTGGWATAPDGPYAWGYCFKEEQGGASGPDYCEPSAQWPCAAGKKYYGRGPIQI  187

Query  375  SYNYNYGAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPS  554
            SYNYNYG AG+A+G  +++NPDLVATDPTVSF+TA WFWMTPQ  KPSCHDV+TG+W+PS
Sbjct  188  SYNYNYGPAGQAIGAGILANPDLVATDPTVSFETAVWFWMTPQSPKPSCHDVMTGQWTPS  247

Query  555  PPDTAAGRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCST  734
              DTAAGR+PGYG+VTNIINGG+ECG  G   + ADRIGFYKRYCD+  V YGDNLDC+ 
Sbjct  248  AADTAAGRLPGYGVVTNIINGGLECG-HGADSRVADRIGFYKRYCDLLGVSYGDNLDCAN  306

Query  735  QTPYS  749
            QTP++
Sbjct  307  QTPFN  311



>ref|NP_001280823.1| endochitinase-like precursor [Malus domestica]
 gb|ADQ39593.1| class II chitinase [Malus domestica]
Length=317

 Score =   338 bits (866),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 157/233 (67%), Positives = 188/233 (81%), Gaps = 1/233 (0%)
 Frame = +3

Query  51   FDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAFLGQTSHETTG  230
            FD MLKYR+D RC +  FY YDAFIAAA+SF  F TTGD+ TRK+E+AAFL QTSHETTG
Sbjct  86   FDQMLKYRNDGRCPSNGFYKYDAFIAAARSFNGFGTTGDVATRKKELAAFLAQTSHETTG  145

Query  231  GWDAAPDGRYAWGYCFLREGTDDPYCNVTQEWSCAPGQKYFGRGPIQISYNYNYGAAGKA  410
            GW +APDG YAWGYCF+ E   D YC  + ++ CA G+KY+GRGPIQ+++NYNYG AG+A
Sbjct  146  GWASAPDGPYAWGYCFVNEKNQDVYCTPSSQYPCAAGKKYYGRGPIQLTHNYNYGQAGQA  205

Query  411  LGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPSPPDTAAGRVPGY  590
            +G DLI+NPDLVATDP VSF+TA WFWMTPQG KPS HDVITG+WSPS  D +AGRVPGY
Sbjct  206  IGKDLINNPDLVATDPVVSFRTAIWFWMTPQGNKPSSHDVITGRWSPSSADKSAGRVPGY  265

Query  591  GLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCSTQTPYS  749
            G++TNIINGG+ECG  G+  + A RIGFY+RYC+I  V  GDNLDC  Q P++
Sbjct  266  GVITNIINGGLECG-KGQDARVASRIGFYRRYCEILQVSPGDNLDCYNQRPFA  317



>ref|XP_007137309.1| hypothetical protein PHAVU_009G116600g [Phaseolus vulgaris]
 sp|P36361.1|CHI5_PHAVU RecName: Full=Endochitinase CH5B; Flags: Precursor [Phaseolus 
vulgaris]
 gb|AAB23263.1| chitinase [Phaseolus vulgaris]
 gb|ESW09303.1| hypothetical protein PHAVU_009G116600g [Phaseolus vulgaris]
Length=327

 Score =   338 bits (866),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 157/242 (65%), Positives = 192/242 (79%), Gaps = 1/242 (0%)
 Frame = +3

Query  21   DVSSIISQAIFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAF  200
            D+S++IS++ FD +LK+R+D  C A  FYTYDAFIAAAK++  F  TGD  TRKRE+AAF
Sbjct  74   DLSALISRSTFDQVLKHRNDGACPAKGFYTYDAFIAAAKAYPSFGNTGDTATRKREIAAF  133

Query  201  LGQTSHETTGGWDAAPDGRYAWGYCFLREGTDDPYCNVTQEWSCAPGQKYFGRGPIQISY  380
            LGQTSHETTGGW  APDG YAWGYCF+RE     YC+ T ++ CAPGQ+Y+GRGPIQIS+
Sbjct  134  LGQTSHETTGGWATAPDGPYAWGYCFVRERNPSAYCSATPQFPCAPGQQYYGRGPIQISW  193

Query  381  NYNYGAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPSPP  560
            NYNYG  G+A+G DL++ PDLVATD  +SFK+A WFWMT Q  KPS HDVIT +W+PS  
Sbjct  194  NYNYGQCGRAIGVDLLNKPDLVATDSVISFKSALWFWMTAQSPKPSSHDVITSRWTPSSA  253

Query  561  DTAAGRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCSTQT  740
            D AA R+PGYG VTNIINGG+ECG  G+  +  DRIGF+KRYCD+  VGYG+NLDC +QT
Sbjct  254  DVAARRLPGYGTVTNIINGGLECG-RGQDSRVQDRIGFFKRYCDLLGVGYGNNLDCYSQT  312

Query  741  PY  746
            P+
Sbjct  313  PF  314



>gb|ACJ62094.1| chitinase [Zea mays subsp. parviglumis]
 gb|ACJ62125.1| chitinase [Zea mays subsp. parviglumis]
Length=316

 Score =   337 bits (865),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 162/245 (66%), Positives = 194/245 (79%), Gaps = 4/245 (2%)
 Frame = +3

Query  24   VSSIISQAIFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAFL  203
            V+SII +++F+ ML +R+D+ C A  FYTY  FIAAA +F  F TTG  D +KRE+AAFL
Sbjct  72   VASIIPESLFNQMLLHRNDAACPANGFYTYAGFIAAANAFPGFGTTGAPDVQKRELAAFL  131

Query  204  GQTSHETTGGWDAAPDGRYAWGYCFLRE--GTDDP-YCNVTQEWSCAPGQKYFGRGPIQI  374
             QTSHETTGGW  APDG YAWGYCF  E  G   P YC  + +W CA G+KY+GRGPIQI
Sbjct  132  AQTSHETTGGWATAPDGPYAWGYCFKEEQGGASGPDYCEPSAQWPCAAGKKYYGRGPIQI  191

Query  375  SYNYNYGAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPS  554
            SYNYNYG AG+A+G  +++NPDLVATDPTVSF+TA WFWMTPQ  KPSCHDV+TG+W+PS
Sbjct  192  SYNYNYGPAGQAIGAGILANPDLVATDPTVSFETAVWFWMTPQSPKPSCHDVMTGQWTPS  251

Query  555  PPDTAAGRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCST  734
              DTAAGR+PGYG+VTNIINGG+ECG  G   + ADRIGFYKRYCD+  V YGDNLDC+ 
Sbjct  252  AADTAAGRLPGYGVVTNIINGGLECG-HGADSRVADRIGFYKRYCDLLGVSYGDNLDCAN  310

Query  735  QTPYS  749
            QTP++
Sbjct  311  QTPFN  315



>gb|ACJ62116.1| chitinase [Zea mays subsp. parviglumis]
 gb|ACJ62147.1| chitinase [Zea mays subsp. parviglumis]
Length=317

 Score =   337 bits (865),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 162/245 (66%), Positives = 194/245 (79%), Gaps = 4/245 (2%)
 Frame = +3

Query  24   VSSIISQAIFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAFL  203
            V+SII +++F+ ML +R+D+ C A  FYTY  FIAAA +F  F TTG  D +KRE+AAFL
Sbjct  73   VASIIPESLFNQMLLHRNDAACPANGFYTYAGFIAAANAFPGFGTTGAPDVQKRELAAFL  132

Query  204  GQTSHETTGGWDAAPDGRYAWGYCFLRE--GTDDP-YCNVTQEWSCAPGQKYFGRGPIQI  374
             QTSHETTGGW  APDG YAWGYCF  E  G   P YC  + +W CA G+KY+GRGPIQI
Sbjct  133  AQTSHETTGGWATAPDGPYAWGYCFKEEQGGASGPDYCEPSAQWPCAAGKKYYGRGPIQI  192

Query  375  SYNYNYGAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPS  554
            SYNYNYG AG+A+G  +++NPDLVATDPTVSF+TA WFWMTPQ  KPSCHDV+TG+W+PS
Sbjct  193  SYNYNYGPAGQAIGAGILANPDLVATDPTVSFETAVWFWMTPQSPKPSCHDVMTGQWTPS  252

Query  555  PPDTAAGRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCST  734
              DTAAGR+PGYG+VTNIINGG+ECG  G   + ADRIGFYKRYCD+  V YGDNLDC+ 
Sbjct  253  AADTAAGRLPGYGVVTNIINGGLECG-HGADSRVADRIGFYKRYCDLLGVSYGDNLDCAN  311

Query  735  QTPYS  749
            QTP++
Sbjct  312  QTPFN  316



>gb|ACJ62141.1| chitinase [Zea mays subsp. parviglumis]
 gb|ACJ62143.1| chitinase [Zea mays subsp. parviglumis]
 gb|ACJ62144.1| chitinase [Zea mays subsp. parviglumis]
Length=316

 Score =   337 bits (865),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 162/245 (66%), Positives = 194/245 (79%), Gaps = 4/245 (2%)
 Frame = +3

Query  24   VSSIISQAIFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAFL  203
            V+SII +++F+ ML +R+D+ C A  FYTY  FIAAA +F  F TTG  D +KRE+AAFL
Sbjct  72   VASIIPESLFNQMLLHRNDAACPANGFYTYAGFIAAANAFPGFGTTGAPDVQKRELAAFL  131

Query  204  GQTSHETTGGWDAAPDGRYAWGYCFLRE--GTDDP-YCNVTQEWSCAPGQKYFGRGPIQI  374
             QTSHETTGGW  APDG YAWGYCF  E  G   P YC  + +W CA G+KY+GRGPIQI
Sbjct  132  AQTSHETTGGWATAPDGPYAWGYCFKEEQGGASGPDYCEPSAQWPCAAGKKYYGRGPIQI  191

Query  375  SYNYNYGAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPS  554
            SYNYNYG AG+A+G  +++NPDLVATDPTVSF+TA WFWMTPQ  KPSCHDV+TG+W+PS
Sbjct  192  SYNYNYGPAGQAIGAGILANPDLVATDPTVSFETAVWFWMTPQSPKPSCHDVMTGQWTPS  251

Query  555  PPDTAAGRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCST  734
              DTAAGR+PGYG+VTNIINGG+ECG  G   + ADRIGFYKRYCD+  V YGDNLDC+ 
Sbjct  252  AADTAAGRLPGYGVVTNIINGGLECG-HGADSRVADRIGFYKRYCDLLGVSYGDNLDCAN  310

Query  735  QTPYS  749
            QTP++
Sbjct  311  QTPFN  315



>gb|ACJ62118.1| chitinase [Zea mays subsp. parviglumis]
Length=317

 Score =   337 bits (865),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 162/245 (66%), Positives = 194/245 (79%), Gaps = 4/245 (2%)
 Frame = +3

Query  24   VSSIISQAIFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAFL  203
            V+SII +++F+ ML +R+D+ C A  FYTY  FIAAA +F  F TTG  D +KRE+AAFL
Sbjct  73   VASIIPESLFNQMLLHRNDAACPANGFYTYAGFIAAANAFPGFGTTGAPDVQKRELAAFL  132

Query  204  GQTSHETTGGWDAAPDGRYAWGYCFLRE--GTDDP-YCNVTQEWSCAPGQKYFGRGPIQI  374
             QTSHETTGGW  APDG YAWGYCF  E  G   P YC  + +W CA G+KY+GRGPIQI
Sbjct  133  AQTSHETTGGWATAPDGPYAWGYCFKEEQGGASGPDYCEPSAQWPCAAGKKYYGRGPIQI  192

Query  375  SYNYNYGAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPS  554
            SYNYNYG AG+A+G  +++NPDLVATDPTVSF+TA WFWMTPQ  KPSCHDV+TG+W+PS
Sbjct  193  SYNYNYGPAGQAIGAGILANPDLVATDPTVSFETAVWFWMTPQSPKPSCHDVMTGQWTPS  252

Query  555  PPDTAAGRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCST  734
              DTAAGR+PGYG+VTNIINGG+ECG  G   + ADRIGFYKRYCD+  V YGDNLDC+ 
Sbjct  253  AADTAAGRLPGYGVVTNIINGGLECG-HGADSRVADRIGFYKRYCDLLGVSYGDNLDCAN  311

Query  735  QTPYS  749
            QTP++
Sbjct  312  QTPFN  316



>gb|ACJ62156.1| chitinase [Zea mays subsp. parviglumis]
Length=309

 Score =   337 bits (864),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 162/245 (66%), Positives = 194/245 (79%), Gaps = 4/245 (2%)
 Frame = +3

Query  24   VSSIISQAIFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAFL  203
            V+SII +++F+ ML +R+D+ C A  FYTY  FIAAA +F  F TTG  D +KRE+AAFL
Sbjct  65   VASIIPESLFNQMLLHRNDAACPANGFYTYAGFIAAANAFPGFGTTGAPDVQKRELAAFL  124

Query  204  GQTSHETTGGWDAAPDGRYAWGYCFLRE--GTDDP-YCNVTQEWSCAPGQKYFGRGPIQI  374
             QTSHETTGGW  APDG YAWGYCF  E  G   P YC  + +W CA G+KY+GRGPIQI
Sbjct  125  AQTSHETTGGWATAPDGPYAWGYCFKEEQGGASGPDYCEPSAQWPCAAGKKYYGRGPIQI  184

Query  375  SYNYNYGAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPS  554
            SYNYNYG AG+A+G  +++NPDLVATDPTVSF+TA WFWMTPQ  KPSCHDV+TG+W+PS
Sbjct  185  SYNYNYGPAGQAIGAGILANPDLVATDPTVSFETAVWFWMTPQSTKPSCHDVMTGQWTPS  244

Query  555  PPDTAAGRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCST  734
              DTAAGR+PGYG+VTNIINGG+ECG  G   + ADRIGFYKRYCD+  V YGDNLDC+ 
Sbjct  245  AADTAAGRLPGYGVVTNIINGGLECG-HGADSRVADRIGFYKRYCDLLGVSYGDNLDCAN  303

Query  735  QTPYS  749
            QTP++
Sbjct  304  QTPFN  308



>gb|AHX74093.1| putative chitodextrinase [Eucommia ulmoides]
Length=323

 Score =   338 bits (866),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 158/243 (65%), Positives = 192/243 (79%), Gaps = 2/243 (1%)
 Frame = +3

Query  21   DVSSIISQAIFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAF  200
            D++S+I++  F++ML++ +D+ C A  FYTYDAFI+AA+SF  FATTGD   R RE+AAF
Sbjct  73   DITSLITRDTFNNMLRHSNDAACPARNFYTYDAFISAARSFAGFATTGDSSVRGRELAAF  132

Query  201  LGQTSHETTGGWDAAPDGRYAWGYCFLRE-GTDDPYCNVTQEWSCAPGQKYFGRGPIQIS  377
              QTSHETTGGW  APDG YAWGYCFLRE G    YC  + +W CA G++Y+GRGP+QIS
Sbjct  133  FAQTSHETTGGWATAPDGPYAWGYCFLREQGNPGDYCQPSAQWPCASGRQYYGRGPMQIS  192

Query  378  YNYNYGAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPSP  557
            +NYNYG  G+A+G DL++NPDLV TDP +SF+TA WFWMTPQ  KPSCHDVITG+WSPS 
Sbjct  193  FNYNYGPCGRAIGADLLNNPDLVITDPIISFRTAIWFWMTPQSPKPSCHDVITGRWSPSG  252

Query  558  PDTAAGRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCSTQ  737
             DTAAGR+PG+G VTNIINGG+ECG  G   +  DRIGFY+RYCDI  VGYGDNLDC  Q
Sbjct  253  ADTAAGRLPGFGTVTNIINGGLECG-HGSDPRVQDRIGFYRRYCDILGVGYGDNLDCGNQ  311

Query  738  TPY  746
             P+
Sbjct  312  RPF  314



>gb|AAR27240.2| class I chitinase [Phaseolus vulgaris]
Length=327

 Score =   338 bits (866),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 157/242 (65%), Positives = 192/242 (79%), Gaps = 1/242 (0%)
 Frame = +3

Query  21   DVSSIISQAIFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAF  200
            D+S++IS++ FD +LK+R+D  C A  FYTYDAFIAAAK++  F  TGD  TRKRE+AAF
Sbjct  74   DLSALISRSTFDQVLKHRNDGVCPAKGFYTYDAFIAAAKAYPSFGNTGDTATRKREIAAF  133

Query  201  LGQTSHETTGGWDAAPDGRYAWGYCFLREGTDDPYCNVTQEWSCAPGQKYFGRGPIQISY  380
            LGQTSHETTGGW  APDG YAWGYCF+RE     YC+ T ++ CAPGQ+Y+GRGPIQIS+
Sbjct  134  LGQTSHETTGGWATAPDGPYAWGYCFVRERNPSAYCSATPQFPCAPGQQYYGRGPIQISW  193

Query  381  NYNYGAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPSPP  560
            NYNYG  G+A+G DL++ PDLVATD  +SFK+A WFWMT Q  KPS HDVIT +W+PS  
Sbjct  194  NYNYGQCGRAIGVDLLNKPDLVATDSVISFKSALWFWMTAQSPKPSSHDVITSRWTPSSA  253

Query  561  DTAAGRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCSTQT  740
            D AA R+PGYG VTNIINGG+ECG  G+  +  DRIGF+KRYCD+  VGYG+NLDC +QT
Sbjct  254  DVAARRLPGYGTVTNIINGGLECG-RGQDSRVQDRIGFFKRYCDLLGVGYGNNLDCYSQT  312

Query  741  PY  746
            P+
Sbjct  313  PF  314



>gb|ADP94987.1| basic endochitinase-like protein, partial [Picea sitchensis]
 gb|ADP94988.1| basic endochitinase-like protein, partial [Picea sitchensis]
 gb|ADP94994.1| basic endochitinase-like protein, partial [Picea sitchensis]
 gb|ADP95005.1| basic endochitinase-like protein, partial [Picea sitchensis]
 gb|ADP95006.1| basic endochitinase-like protein, partial [Picea sitchensis]
 gb|ADP95007.1| basic endochitinase-like protein, partial [Picea sitchensis]
 gb|ADP95008.1| basic endochitinase-like protein, partial [Picea sitchensis]
 gb|ADP95009.1| basic endochitinase-like protein, partial [Picea sitchensis]
 gb|ADP95010.1| basic endochitinase-like protein, partial [Picea sitchensis]
 gb|ADP95011.1| basic endochitinase-like protein, partial [Picea sitchensis]
 gb|ADP95012.1| basic endochitinase-like protein, partial [Picea sitchensis]
 gb|ADP95013.1| basic endochitinase-like protein, partial [Picea sitchensis]
 gb|ADP95014.1| basic endochitinase-like protein, partial [Picea sitchensis]
 gb|ADP95018.1| basic endochitinase-like protein, partial [Picea sitchensis]
 gb|ADP95019.1| basic endochitinase-like protein, partial [Picea sitchensis]
 gb|ADP95020.1| basic endochitinase-like protein, partial [Picea sitchensis]
 gb|ADP95021.1| basic endochitinase-like protein, partial [Picea sitchensis]
Length=257

 Score =   335 bits (859),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 157/243 (65%), Positives = 192/243 (79%), Gaps = 3/243 (1%)
 Frame = +3

Query  24   VSSIISQAIFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAFL  203
            VSS+I+++IF+D+LK+R+D+ C A  FY+YDAFIAAA +F  F TTGDL ++KRE+AAF 
Sbjct  1    VSSVITESIFNDLLKHRNDAGCKAKGFYSYDAFIAAANAFPGFGTTGDLTSQKRELAAFF  60

Query  204  GQTSHETTGGWDAAPDGRYAWGYCFLREGTDDP--YCNVTQEWSCAPGQKYFGRGPIQIS  377
            GQTSHETTGGW  APDG YAWGYCF  E  + P  YC  + +W CA G++Y+GRGP+QIS
Sbjct  61   GQTSHETTGGWPTAPDGPYAWGYCFKEEQGNPPGEYCQASSQWPCASGKRYYGRGPVQIS  120

Query  378  YNYNYGAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPSP  557
            +NYNYG AGKA+G+D I+NPD+VA D TVSFKTA WFWMT Q  KPSCH+V+ G W PS 
Sbjct  121  WNYNYGPAGKAVGFDGINNPDIVANDATVSFKTAVWFWMTEQSPKPSCHNVMAGGWGPSG  180

Query  558  PDTAAGRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCSTQ  737
             DTAAGR  GYG+VTNIINGG+ECG  G   ++ DRIGFYKRYCDI  V YG NLDC++Q
Sbjct  181  SDTAAGRAAGYGVVTNIINGGLECG-KGSDSRQEDRIGFYKRYCDILGVSYGSNLDCNSQ  239

Query  738  TPY  746
             P+
Sbjct  240  KPF  242



>gb|ADP94991.1| basic endochitinase-like protein, partial [Picea sitchensis]
 gb|ADP94992.1| basic endochitinase-like protein, partial [Picea sitchensis]
Length=257

 Score =   335 bits (859),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 157/243 (65%), Positives = 192/243 (79%), Gaps = 3/243 (1%)
 Frame = +3

Query  24   VSSIISQAIFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAFL  203
            VSS+I+++IF+D+LK+R+D+ C A  FY+YDAFIAAA +F  F TTGDL ++KRE+AAF 
Sbjct  1    VSSVITESIFNDLLKHRNDAGCKAKGFYSYDAFIAAANAFPGFGTTGDLTSQKRELAAFF  60

Query  204  GQTSHETTGGWDAAPDGRYAWGYCFLREGTDDP--YCNVTQEWSCAPGQKYFGRGPIQIS  377
            GQTSHETTGGW  APDG YAWGYCF  E  + P  YC  + +W CA G++Y+GRGP+QIS
Sbjct  61   GQTSHETTGGWPTAPDGPYAWGYCFKEEQGNPPGEYCQASSQWPCASGKRYYGRGPVQIS  120

Query  378  YNYNYGAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPSP  557
            +NYNYG AGKA+G+D I+NPD+VA D TVSFKTA WFWMT Q  KPSCH+V+ G W PS 
Sbjct  121  WNYNYGRAGKAVGFDGINNPDIVANDATVSFKTAVWFWMTEQSPKPSCHNVMAGGWGPSG  180

Query  558  PDTAAGRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCSTQ  737
             DTAAGR  GYG+VTNIINGG+ECG  G   ++ DRIGFYKRYCDI  V YG NLDC++Q
Sbjct  181  SDTAAGRAAGYGVVTNIINGGLECG-KGSDSRQEDRIGFYKRYCDILGVSYGSNLDCNSQ  239

Query  738  TPY  746
             P+
Sbjct  240  KPF  242



>gb|AFC88126.1| class I chitinase [Hippophae rhamnoides]
Length=317

 Score =   337 bits (864),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 157/250 (63%), Positives = 192/250 (77%), Gaps = 1/250 (0%)
 Frame = +3

Query  24   VSSIISQAIFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAFL  203
            + S+IS   F+ MLK+R+D  C A  FYTYDAFI AAK+F  F TTG+  TRK+E+AAF 
Sbjct  69   IESVISSNTFNQMLKHRNDGGCKAKGFYTYDAFIKAAKAFPNFGTTGNDATRKKEIAAFF  128

Query  204  GQTSHETTGGWDAAPDGRYAWGYCFLREGTDDPYCNVTQEWSCAPGQKYFGRGPIQISYN  383
            GQTSHETTGGW +APDG YAWGYCF+RE     YC+    + CAPG++Y+GRGP+Q+S+N
Sbjct  129  GQTSHETTGGWASAPDGPYAWGYCFVREQNPSAYCSPNPTYPCAPGKQYYGRGPMQLSWN  188

Query  384  YNYGAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPSPPD  563
            YNYG  G+A+G D++ NPDLVATDP VSFKTA WFWMTPQ  KPSCHDVITG+W+PS  D
Sbjct  189  YNYGQCGRAIGVDILKNPDLVATDPVVSFKTAIWFWMTPQSPKPSCHDVITGRWNPSGAD  248

Query  564  TAAGRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCSTQTP  743
             ++GRV GYG +TNIINGG+ECG  G+  +  DRIGFYKRYCDI  VGYG+NLDC  Q P
Sbjct  249  QSSGRVAGYGAITNIINGGLECG-KGKTPQVEDRIGFYKRYCDILKVGYGNNLDCYNQRP  307

Query  744  YSP*ELLVTL  773
            +    L+ T+
Sbjct  308  FGSGLLVDTM  317



>gb|ACJ62136.1| chitinase [Zea mays subsp. parviglumis]
Length=322

 Score =   337 bits (865),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 161/245 (66%), Positives = 194/245 (79%), Gaps = 4/245 (2%)
 Frame = +3

Query  24   VSSIISQAIFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAFL  203
            V+SII +++F+ ML +R+D+ C A  FYTY  FIAAA +F  F TTG  D +KRE+AAFL
Sbjct  78   VASIIPESLFNQMLLHRNDAACPANGFYTYAGFIAAANAFPGFGTTGAPDVQKRELAAFL  137

Query  204  GQTSHETTGGWDAAPDGRYAWGYCFLRE--GTDDP-YCNVTQEWSCAPGQKYFGRGPIQI  374
             QTSHETTGGW  APDG YAWGYCF  E  G   P YC  + +W CA G+KY+GRGPIQI
Sbjct  138  AQTSHETTGGWATAPDGPYAWGYCFKEEQGGASGPDYCEPSAQWPCAAGKKYYGRGPIQI  197

Query  375  SYNYNYGAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPS  554
            SYNYNYG AG+A+G  +++NPD+VATDPTVSF+TA WFWMTPQ  KPSCHDV+TG+W+PS
Sbjct  198  SYNYNYGPAGQAIGAGILANPDMVATDPTVSFETAVWFWMTPQSPKPSCHDVMTGQWTPS  257

Query  555  PPDTAAGRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCST  734
              DTAAGR+PGYG+VTNIINGG+ECG  G   + ADRIGFYKRYCD+  V YGDNLDC+ 
Sbjct  258  AADTAAGRLPGYGVVTNIINGGLECG-HGADSRVADRIGFYKRYCDLLGVSYGDNLDCAN  316

Query  735  QTPYS  749
            QTP++
Sbjct  317  QTPFN  321



>gb|ADP95017.1| basic endochitinase-like protein, partial [Picea sitchensis]
Length=257

 Score =   335 bits (859),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 157/243 (65%), Positives = 192/243 (79%), Gaps = 3/243 (1%)
 Frame = +3

Query  24   VSSIISQAIFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAFL  203
            VSS+I+++IF+D+LK+R+D+ C A  FY+YDAFIAAA +F  F TTGDL ++KRE+AAF 
Sbjct  1    VSSVITESIFNDLLKHRNDAGCKAKGFYSYDAFIAAANAFPGFGTTGDLTSQKRELAAFF  60

Query  204  GQTSHETTGGWDAAPDGRYAWGYCFLREGTDDP--YCNVTQEWSCAPGQKYFGRGPIQIS  377
            GQTSHETTGGW  APDG YAWGYCF  E  + P  YC  + +W CA G++Y+GRGP+QIS
Sbjct  61   GQTSHETTGGWPTAPDGPYAWGYCFKEEQGNPPGEYCQASSQWPCASGKRYYGRGPVQIS  120

Query  378  YNYNYGAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPSP  557
            +NYNYG AGKA+G+D I+NPD+VA D TVSFKTA WFWMT Q  KPSCH+V+ G W PS 
Sbjct  121  WNYNYGPAGKAVGFDGINNPDIVANDATVSFKTAVWFWMTAQSPKPSCHNVMAGGWGPSG  180

Query  558  PDTAAGRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCSTQ  737
             DTAAGR  GYG+VTNIINGG+ECG  G   ++ DRIGFYKRYCDI  V YG NLDC++Q
Sbjct  181  SDTAAGRAAGYGVVTNIINGGLECG-KGSDSRQEDRIGFYKRYCDILGVSYGSNLDCNSQ  239

Query  738  TPY  746
             P+
Sbjct  240  KPF  242



>ref|XP_004134833.1| PREDICTED: basic endochitinase A-like [Cucumis sativus]
 gb|KGN48979.1| hypothetical protein Csa_6G507520 [Cucumis sativus]
Length=320

 Score =   337 bits (865),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 156/241 (65%), Positives = 187/241 (78%), Gaps = 1/241 (0%)
 Frame = +3

Query  24   VSSIISQAIFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAFL  203
            V SIIS+++++ MLKY  DSRC +  FYTY+AFI AA+ F  F  TG ++TRKREVAAF 
Sbjct  81   VGSIISESLYNQMLKYSRDSRCPSNGFYTYNAFITAARFFPAFGNTGSVETRKREVAAFF  140

Query  204  GQTSHETTGGWDAAPDGRYAWGYCFLREGTDDPYCNVTQEWSCAPGQKYFGRGPIQISYN  383
            GQTSHETTGGW  APDG YAWGYCF+RE     YC  +Q+W CA GQ+Y+GRGPIQ+++N
Sbjct  141  GQTSHETTGGWPTAPDGPYAWGYCFIRERNQQAYCTPSQQWPCASGQQYYGRGPIQLTHN  200

Query  384  YNYGAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPSPPD  563
            YNYG AG A+G  L+++PDLVATD  VSFKTA WFWMT QG KPSCH+VITG W PS  D
Sbjct  201  YNYGPAGNAIGAPLLASPDLVATDAVVSFKTALWFWMTAQGNKPSCHNVITGNWQPSSAD  260

Query  564  TAAGRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCSTQTP  743
             AAGR PGYG++TNIINGG+ECG  G  D+  DRIGFYKRYCD+  +GYG+NLDC  Q  
Sbjct  261  NAAGRSPGYGVITNIINGGLECG-HGPDDRVKDRIGFYKRYCDMLGIGYGNNLDCYNQRS  319

Query  744  Y  746
            +
Sbjct  320  F  320



>ref|XP_007201290.1| hypothetical protein PRUPE_ppa008646mg [Prunus persica]
 gb|EMJ02489.1| hypothetical protein PRUPE_ppa008646mg [Prunus persica]
Length=323

 Score =   337 bits (865),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 159/242 (66%), Positives = 191/242 (79%), Gaps = 1/242 (0%)
 Frame = +3

Query  21   DVSSIISQAIFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAF  200
            D+ S++S+  F+ MLK+R+D  C A  FYTYDAFIAAAKSF  FA TGD  T+KRE+AAF
Sbjct  71   DIGSLVSRNTFNQMLKHRNDGGCPAKGFYTYDAFIAAAKSFPNFAKTGDAATQKREIAAF  130

Query  201  LGQTSHETTGGWDAAPDGRYAWGYCFLREGTDDPYCNVTQEWSCAPGQKYFGRGPIQISY  380
            L QTSHETTGGW +APDG Y+WGYC+L+E     YC     + CA G++Y+GRGPIQ+S+
Sbjct  131  LAQTSHETTGGWASAPDGPYSWGYCYLKEQNPGSYCAWDPNYPCAAGKQYYGRGPIQLSW  190

Query  381  NYNYGAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPSPP  560
            NYNYG  GKA+G DL++NPDLVATDP +SFKTA WFWMTPQ  KPSCHDVITG+W+PS  
Sbjct  191  NYNYGQCGKAIGEDLLNNPDLVATDPVISFKTALWFWMTPQSPKPSCHDVITGRWNPSGA  250

Query  561  DTAAGRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCSTQT  740
            D +AGRVPGYG+ TNIINGG+ECG  G + K  DRIGFYKRYCD+  VGYG+NLDC  Q 
Sbjct  251  DKSAGRVPGYGVTTNIINGGLECG-KGWNAKVEDRIGFYKRYCDLLGVGYGNNLDCYNQK  309

Query  741  PY  746
            P+
Sbjct  310  PF  311



>gb|ACJ62138.1| chitinase [Zea mays subsp. parviglumis]
Length=321

 Score =   337 bits (864),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 162/245 (66%), Positives = 194/245 (79%), Gaps = 4/245 (2%)
 Frame = +3

Query  24   VSSIISQAIFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAFL  203
            V+SIIS+++F+ ML +R+D+ C A  FYTY  FIAAA +F  F TTG  D +KRE+AAFL
Sbjct  77   VASIISESLFNQMLLHRNDAACPANGFYTYAGFIAAANAFPGFGTTGAPDVQKRELAAFL  136

Query  204  GQTSHETTGGWDAAPDGRYAWGYCFLRE--GTDDP-YCNVTQEWSCAPGQKYFGRGPIQI  374
             QTSHETTGGW  APDG YAWGYCF  E  G   P YC  + +W CA G+KY+GRGPIQI
Sbjct  137  AQTSHETTGGWATAPDGPYAWGYCFKEEQGGASGPDYCEPSAQWPCAAGKKYYGRGPIQI  196

Query  375  SYNYNYGAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPS  554
            SYNYNYG AG+A+G  +++NPDLVATDPTVSF+TA WFWMTPQ  KPSCHDV+TG+W+PS
Sbjct  197  SYNYNYGPAGQAIGAGILANPDLVATDPTVSFETAVWFWMTPQSPKPSCHDVMTGQWTPS  256

Query  555  PPDTAAGRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCST  734
              DTAAGR+PGY +VTNIINGG+ECG  G   + ADRIGFYKRYCD+  V YGDNLDC+ 
Sbjct  257  AADTAAGRLPGYDVVTNIINGGLECG-HGADSRVADRIGFYKRYCDLLGVSYGDNLDCAN  315

Query  735  QTPYS  749
            QTP++
Sbjct  316  QTPFN  320



>pdb|3CQL|A Chain A, Crystal Structure Of Gh Family 19 Chitinase From Carica 
Papaya
 pdb|3CQL|B Chain B, Crystal Structure Of Gh Family 19 Chitinase From Carica 
Papaya
Length=243

 Score =   334 bits (857),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 158/242 (65%), Positives = 189/242 (78%), Gaps = 2/242 (1%)
 Frame = +3

Query  24   VSSIISQAIFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAFL  203
            +  IIS+++FD MLK+R++  C A  FYTYDAFIAAAKSF  F TTG  D RKRE+AAFL
Sbjct  2    IEKIISRSMFDQMLKHRNNPACPAKGFYTYDAFIAAAKSFPSFGTTGSTDVRKREIAAFL  61

Query  204  GQTSHETTGGWDAAPDGRYAWGYCFLRE-GTDDPYCNVTQEWSCAPGQKYFGRGPIQISY  380
            GQTSHETTGGW +APDG YAWGYCFL+E      YC  +  + CAPG+ Y+GRGPIQ+S+
Sbjct  62   GQTSHETTGGWPSAPDGPYAWGYCFLKERNPSSNYCAPSPRYPCAPGKSYYGRGPIQLSW  121

Query  381  NYNYGAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPSPP  560
            NYNYG  G+AL  +L+ NPDLVATD  +SFKTA WFWMTPQ  KPSCHDVITG+W PS  
Sbjct  122  NYNYGPCGEALRVNLLGNPDLVATDRVISFKTALWFWMTPQAPKPSCHDVITGRWQPSAA  181

Query  561  DTAAGRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCSTQT  740
            DTAAGR+PGYG++TNIINGG+ECG  G + + ADRIGF++RYC I  VG G+NLDC  Q 
Sbjct  182  DTAAGRLPGYGVITNIINGGLECG-KGPNPQVADRIGFFRRYCGILGVGTGNNLDCYNQR  240

Query  741  PY  746
            P+
Sbjct  241  PF  242



>gb|ADP94993.1| basic endochitinase-like protein, partial [Picea sitchensis]
Length=257

 Score =   335 bits (858),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 157/243 (65%), Positives = 192/243 (79%), Gaps = 3/243 (1%)
 Frame = +3

Query  24   VSSIISQAIFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAFL  203
            VSS+I+++IF+D+LK+R+D+ C A  FY+YDAFIAAA +F  F TTGDL ++KRE+AAF 
Sbjct  1    VSSVITESIFNDLLKHRNDAGCKAKGFYSYDAFIAAANAFPGFGTTGDLTSQKRELAAFF  60

Query  204  GQTSHETTGGWDAAPDGRYAWGYCFLREGTDDP--YCNVTQEWSCAPGQKYFGRGPIQIS  377
            GQTSHETTGGW  APDG YAWGYCF  E  + P  YC  + +W CA G++Y+GRGP+QIS
Sbjct  61   GQTSHETTGGWPTAPDGPYAWGYCFKEEQGNPPGEYCQASSQWPCASGKRYYGRGPVQIS  120

Query  378  YNYNYGAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPSP  557
            +NYNYG AGKA+G+D I+NPD+VA D TVSFKTA WFWMT Q  KPSCH+V+ G W PS 
Sbjct  121  WNYNYGPAGKAVGFDGINNPDVVANDATVSFKTAVWFWMTEQSPKPSCHNVMAGGWGPSG  180

Query  558  PDTAAGRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCSTQ  737
             DTAAGR  GYG+VTNIINGG+ECG  G   ++ DRIGFYKRYCDI  V YG NLDC++Q
Sbjct  181  SDTAAGRAAGYGVVTNIINGGLECG-KGSDSRQEDRIGFYKRYCDILGVSYGSNLDCNSQ  239

Query  738  TPY  746
             P+
Sbjct  240  KPF  242



>gb|AEF59001.1| class II chitinase [Picea engelmannii x Picea glauca]
Length=308

 Score =   337 bits (863),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 156/243 (64%), Positives = 192/243 (79%), Gaps = 3/243 (1%)
 Frame = +3

Query  24   VSSIISQAIFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAFL  203
            VSS+I+++IF+++LK+R+D+ C A  FY+YDAFIAAA +F  F TTGDL ++KRE+AAF 
Sbjct  52   VSSVITESIFNNLLKHRNDAGCKAKGFYSYDAFIAAANAFPGFGTTGDLTSQKRELAAFF  111

Query  204  GQTSHETTGGWDAAPDGRYAWGYCFLREGTDDP--YCNVTQEWSCAPGQKYFGRGPIQIS  377
            GQTSHETTGGW  APDG YAWGYCF  E  + P  YC  + +W CA G++Y+GRGP+QIS
Sbjct  112  GQTSHETTGGWPTAPDGPYAWGYCFKEEQGNPPGEYCQASSQWPCASGKRYYGRGPVQIS  171

Query  378  YNYNYGAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPSP  557
            +NYNYG AGKA+G+D I+NPD+VA D TVSFKTA WFWMT Q  KPSCH+V+ G W PS 
Sbjct  172  WNYNYGPAGKAVGFDGINNPDIVANDATVSFKTAVWFWMTEQSPKPSCHNVMAGGWGPSG  231

Query  558  PDTAAGRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCSTQ  737
             DTAAGR  GYG+VTNIINGG+ECG  G   ++ DRIGFYKRYCDI  V YG NLDC++Q
Sbjct  232  SDTAAGRAAGYGVVTNIINGGLECGK-GSDSRQEDRIGFYKRYCDILGVSYGSNLDCNSQ  290

Query  738  TPY  746
             P+
Sbjct  291  KPF  293



>gb|ACJ62150.1| chitinase [Zea mays subsp. parviglumis]
Length=321

 Score =   337 bits (864),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 161/245 (66%), Positives = 194/245 (79%), Gaps = 4/245 (2%)
 Frame = +3

Query  24   VSSIISQAIFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAFL  203
            V+SII +++F+ ML +R+D+ C A  FYTY  FIAAA +F  F TTG  D +KRE+AAFL
Sbjct  77   VASIIPESLFNQMLLHRNDAACPANGFYTYAGFIAAANAFPGFGTTGAPDVQKRELAAFL  136

Query  204  GQTSHETTGGWDAAPDGRYAWGYCFLRE--GTDDP-YCNVTQEWSCAPGQKYFGRGPIQI  374
             QTSHETTGGW  APDG YAWGYCF  E  G   P YC  + +W CA G+KY+GRGPIQI
Sbjct  137  AQTSHETTGGWATAPDGPYAWGYCFKEEQGGASGPDYCEPSAQWPCAAGKKYYGRGPIQI  196

Query  375  SYNYNYGAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPS  554
            SYNYNYG AG+A+G  +++NPDL+ATDPTVSF+TA WFWMTPQ  KPSCHDV+TG+W+PS
Sbjct  197  SYNYNYGPAGQAIGAGILANPDLMATDPTVSFETAVWFWMTPQSPKPSCHDVMTGQWTPS  256

Query  555  PPDTAAGRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCST  734
              DTAAGR+PGYG+VTNIINGG+ECG  G   + ADRIGFYKRYCD+  V YGDNLDC+ 
Sbjct  257  AADTAAGRLPGYGVVTNIINGGLECG-HGADSRVADRIGFYKRYCDLLGVSYGDNLDCAN  315

Query  735  QTPYS  749
            QTP++
Sbjct  316  QTPFN  320



>gb|AFK37149.1| unknown [Lotus japonicus]
Length=324

 Score =   337 bits (864),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 159/242 (66%), Positives = 194/242 (80%), Gaps = 2/242 (1%)
 Frame = +3

Query  24   VSSIISQAIFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAFL  203
            V S+IS ++F+ +LKYR+D RC A  FYTYDAFI AA+SF  F TTGD  TRK+E+AAFL
Sbjct  85   VGSLISSSLFNQLLKYRNDGRCAANGFYTYDAFITAARSFNGFGTTGDDATRKKELAAFL  144

Query  204  GQTSHETTGGWDAAPDGRYAWGYCFLREGTDDPYCNVTQEWSCAPGQKYFGRGPIQISYN  383
             QTSHETTGGW +APDG YAWGYCF+ E     YC+ +++W C PG++Y+GRGPIQ+++N
Sbjct  145  AQTSHETTGGWPSAPDGPYAWGYCFVSERNRADYCD-SKDWPCTPGKQYYGRGPIQLTHN  203

Query  384  YNYGAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPSPPD  563
            YNYG AGKA+  DLIS+PDLV+ DP VSFKTA WFWMT Q  KPSCHDVITGKW+P+  D
Sbjct  204  YNYGLAGKAIQQDLISDPDLVSRDPIVSFKTAIWFWMTRQANKPSCHDVITGKWTPTSAD  263

Query  564  TAAGRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCSTQTP  743
            ++AGRVPGYG++TNIINGGVEC    ++DK  DRIGFYKRYC IF V  GDNLDC+ Q P
Sbjct  264  SSAGRVPGYGVITNIINGGVEC-ENRQNDKVQDRIGFYKRYCQIFRVSPGDNLDCNNQRP  322

Query  744  YS  749
            ++
Sbjct  323  FA  324



>ref|XP_008440899.1| PREDICTED: endochitinase-like isoform X1 [Cucumis melo]
Length=361

 Score =   338 bits (867),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 158/241 (66%), Positives = 187/241 (78%), Gaps = 1/241 (0%)
 Frame = +3

Query  24   VSSIISQAIFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAFL  203
            V SII+++++  MLKY  DSRC +  FYTY+AFI AA+SF  F TTGD  TRKRE+AAF 
Sbjct  122  VGSIITESLYKQMLKYSTDSRCPSNGFYTYNAFITAAQSFPGFGTTGDDATRKRELAAFF  181

Query  204  GQTSHETTGGWDAAPDGRYAWGYCFLREGTDDPYCNVTQEWSCAPGQKYFGRGPIQISYN  383
            GQTSHETTGGW +APDG YAWGYCF+RE   D YC  + +W C  GQKY+GRGPIQ+++N
Sbjct  182  GQTSHETTGGWASAPDGPYAWGYCFIREINQDVYCTPSSQWPCVSGQKYYGRGPIQLTHN  241

Query  384  YNYGAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPSPPD  563
            YNYG AG AL  +L+SNPDLVAT+  +SFK A WFWMTPQG KPSCH+VITG W PS  D
Sbjct  242  YNYGPAGNALSLNLLSNPDLVATNAIISFKAAIWFWMTPQGNKPSCHNVITGNWQPSSAD  301

Query  564  TAAGRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCSTQTP  743
            +AAGRVPGYG++TNIINGG+ECG  G   +  DRIGFYKRYCDI  +GYG NLDC  Q  
Sbjct  302  SAAGRVPGYGVLTNIINGGLECG-HGPDSRVEDRIGFYKRYCDILGIGYGSNLDCYNQQS  360

Query  744  Y  746
            +
Sbjct  361  F  361



>gb|ACL81177.1| chitinase [Chimonanthus praecox]
Length=317

 Score =   336 bits (862),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 162/243 (67%), Positives = 191/243 (79%), Gaps = 2/243 (1%)
 Frame = +3

Query  24   VSSIISQAIFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAFL  203
            V S+ISQ  F+ +LK+R+D+ C A  FYTY AF+ AA SF  FA+TGD +TRK+E+AAFL
Sbjct  75   VGSLISQDQFEQILKHRNDASCPANGFYTYVAFVNAANSFSGFASTGDTNTRKKEIAAFL  134

Query  204  GQTSHETTGGWDAAPDGRYAWGYCFLREGTDDP-YCNVTQEWSCAPGQKYFGRGPIQISY  380
            GQTSHETTGGW AAPDG YAWGYC+ +E  D P YC     W CA G+KY+GRGP+QISY
Sbjct  135  GQTSHETTGGWAAAPDGPYAWGYCYKQEQGDPPAYCESNPTWPCAAGKKYYGRGPMQISY  194

Query  381  NYNYGAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPSPP  560
            NYNYG AG+A+G DL++NPDLVATDP +SFKTA WFWMT Q  KPSCHDVITG WSPS  
Sbjct  195  NYNYGPAGQAIGVDLLNNPDLVATDPVISFKTAIWFWMTAQSPKPSCHDVITGAWSPSDA  254

Query  561  DTAAGRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCSTQT  740
            D+AAGRVPGYG++TNIINGG+ECG  G   + ADRIGFY+RYC I  V  GDNLDC  Q 
Sbjct  255  DSAAGRVPGYGVITNIINGGLECG-KGTDARVADRIGFYQRYCQIVEVSPGDNLDCYNQR  313

Query  741  PYS  749
            P++
Sbjct  314  PFN  316



>ref|XP_010028812.1| PREDICTED: endochitinase-like [Eucalyptus grandis]
Length=333

 Score =   337 bits (864),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 159/247 (64%), Positives = 193/247 (78%), Gaps = 1/247 (0%)
 Frame = +3

Query  33   IISQAIFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAFLGQT  212
            +IS+  F+ +LK+R+D+ C A  FYTYDAF+AAAKSF  F TTGD  TRKRE+AAFL QT
Sbjct  88   LISRDTFNQLLKHRNDAGCPAKGFYTYDAFVAAAKSFPAFGTTGDAATRKREIAAFLAQT  147

Query  213  SHETTGGWDAAPDGRYAWGYCFLREGTDDPYCNVTQEWSCAPGQKYFGRGPIQISYNYNY  392
            SHETTGGW +APDG Y+WGYC+L+E     YC+    + CAPG++Y+GRGPIQ+S+NYNY
Sbjct  148  SHETTGGWASAPDGPYSWGYCYLKEQNPSAYCSPNPTYPCAPGKQYYGRGPIQLSWNYNY  207

Query  393  GAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPSPPDTAA  572
            G  G+A+G DL+ NPDLVATDP VSFKTA WFWMTPQ  KPSCH VITG+W+PS  D +A
Sbjct  208  GQCGRAIGVDLLKNPDLVATDPVVSFKTAIWFWMTPQSPKPSCHGVITGQWAPSAADKSA  267

Query  573  GRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCSTQTPYSP  752
            GRV GYG VTNIINGG+ECG  G+  +  DRIGFYKRYCDI  VGYG+NLDC +Q P+  
Sbjct  268  GRVVGYGTVTNIINGGLECG-RGKDARVEDRIGFYKRYCDILGVGYGNNLDCYSQRPFGS  326

Query  753  *ELLVTL  773
              L+ T+
Sbjct  327  GLLVDTM  333



>ref|XP_004134832.1| PREDICTED: endochitinase-like [Cucumis sativus]
Length=316

 Score =   336 bits (862),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 155/238 (65%), Positives = 187/238 (79%), Gaps = 1/238 (0%)
 Frame = +3

Query  33   IISQAIFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAFLGQT  212
            II++++F+ MLKY  DS+C +  FYTY+AFI AA+SF +F TTGD  TRKRE+AAF GQT
Sbjct  80   IITESLFNQMLKYSTDSQCPSNGFYTYNAFITAAQSFPDFGTTGDDATRKRELAAFFGQT  139

Query  213  SHETTGGWDAAPDGRYAWGYCFLREGTDDPYCNVTQEWSCAPGQKYFGRGPIQISYNYNY  392
            SHETTGGW +APDG YAWGYCF+RE   D YC  + +W C  GQKY+GRGP+Q+++NYNY
Sbjct  140  SHETTGGWASAPDGPYAWGYCFIRERNQDVYCTPSDQWPCVAGQKYYGRGPMQLTHNYNY  199

Query  393  GAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPSPPDTAA  572
            G AG AL  +L+SNPDLVAT+  +SFK A WFWMTPQG KPSCHDVITG W PS  D AA
Sbjct  200  GPAGNALSLNLLSNPDLVATNAIISFKAAIWFWMTPQGNKPSCHDVITGNWQPSGTDNAA  259

Query  573  GRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCSTQTPY  746
            GRVPGYG++TNIINGG+ECG  G   +  DRIGFYKRYCD+  +GYG NLDC+ Q  +
Sbjct  260  GRVPGYGVITNIINGGLECG-HGPDSRVEDRIGFYKRYCDMLGIGYGSNLDCNNQQSF  316



>gb|ADP94997.1| basic endochitinase-like protein, partial [Picea sitchensis]
 gb|ADP94998.1| basic endochitinase-like protein, partial [Picea sitchensis]
 gb|ADP95001.1| basic endochitinase-like protein, partial [Picea sitchensis]
Length=257

 Score =   334 bits (856),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 157/243 (65%), Positives = 192/243 (79%), Gaps = 3/243 (1%)
 Frame = +3

Query  24   VSSIISQAIFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAFL  203
            VSS+I+++IF+D+LK+R+D+ C A  FY+YDAFIAAA +F  F TTGDL ++KRE+AAF 
Sbjct  1    VSSVITESIFNDLLKHRNDAGCKAKGFYSYDAFIAAANAFPGFGTTGDLTSQKRELAAFF  60

Query  204  GQTSHETTGGWDAAPDGRYAWGYCFLREGTDDP--YCNVTQEWSCAPGQKYFGRGPIQIS  377
            GQTSHETTGGW  APDG YAWGYCF  E  + P  YC  + EW CA G++Y+GRGP+Q+S
Sbjct  61   GQTSHETTGGWPTAPDGPYAWGYCFKEEQGNPPGEYCQASSEWPCAFGKRYYGRGPVQLS  120

Query  378  YNYNYGAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPSP  557
            +NYNYG AGKA+G+D I+NPD+VA D TVSFKTA WFWMT Q  KPSCH+V+ G W PS 
Sbjct  121  WNYNYGPAGKAVGFDGINNPDIVANDATVSFKTAVWFWMTEQSPKPSCHNVMAGGWGPSG  180

Query  558  PDTAAGRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCSTQ  737
             DTAAGR  GYG+VTNIINGG+ECG  G   ++ DRIGFYKRYCDI  V YG NLDC++Q
Sbjct  181  SDTAAGRAAGYGVVTNIINGGLECG-KGSDSRQEDRIGFYKRYCDILGVSYGSNLDCNSQ  239

Query  738  TPY  746
             P+
Sbjct  240  KPF  242



>ref|XP_004509418.1| PREDICTED: endochitinase-like [Cicer arietinum]
Length=318

 Score =   336 bits (862),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 155/243 (64%), Positives = 192/243 (79%), Gaps = 2/243 (1%)
 Frame = +3

Query  21   DVSSIISQAIFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAF  200
            DV  ++  ++F+ MLKYR+D RC    FYTYDAFIAAA+SF  F TTGD  TRKRE+AAF
Sbjct  78   DVGRLVPSSLFEQMLKYRNDGRCPGHGFYTYDAFIAAAQSFNGFGTTGDDTTRKRELAAF  137

Query  201  LGQTSHETTGGWDAAPDGRYAWGYCFLREGTDDPYCNVTQEWSCAPGQKYFGRGPIQISY  380
              QTSHETTGGW +APDG YAWGYCF+ E + + YC  +++W C PG+ Y GRGPIQ+++
Sbjct  138  FAQTSHETTGGWASAPDGPYAWGYCFVNENSQENYC-TSKDWPCPPGKSYHGRGPIQLTH  196

Query  381  NYNYGAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPSPP  560
            NYNYG AGK +G DLI+NPDLV+T+PTVSFKTA WFWMTPQ  KPS HDVI GKW+PS  
Sbjct  197  NYNYGEAGKVIGEDLINNPDLVSTNPTVSFKTAIWFWMTPQANKPSSHDVIIGKWTPSND  256

Query  561  DTAAGRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCSTQT  740
            D++AGRVPGYG++TNIINGG+ECG  G+ DK  DR+GF++RYC +  V  GDNLDC+ Q 
Sbjct  257  DSSAGRVPGYGVITNIINGGIECG-HGQDDKVDDRVGFFRRYCQLLGVNPGDNLDCNNQR  315

Query  741  PYS  749
            P++
Sbjct  316  PFA  318



>gb|KCW55631.1| hypothetical protein EUGRSUZ_I01495 [Eucalyptus grandis]
Length=317

 Score =   336 bits (861),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 159/247 (64%), Positives = 193/247 (78%), Gaps = 1/247 (0%)
 Frame = +3

Query  33   IISQAIFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAFLGQT  212
            +IS+  F+ +LK+R+D+ C A  FYTYDAF+AAAKSF  F TTGD  TRKRE+AAFL QT
Sbjct  72   LISRDTFNQLLKHRNDAGCPAKGFYTYDAFVAAAKSFPAFGTTGDAATRKREIAAFLAQT  131

Query  213  SHETTGGWDAAPDGRYAWGYCFLREGTDDPYCNVTQEWSCAPGQKYFGRGPIQISYNYNY  392
            SHETTGGW +APDG Y+WGYC+L+E     YC+    + CAPG++Y+GRGPIQ+S+NYNY
Sbjct  132  SHETTGGWASAPDGPYSWGYCYLKEQNPSAYCSPNPTYPCAPGKQYYGRGPIQLSWNYNY  191

Query  393  GAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPSPPDTAA  572
            G  G+A+G DL+ NPDLVATDP VSFKTA WFWMTPQ  KPSCH VITG+W+PS  D +A
Sbjct  192  GQCGRAIGVDLLKNPDLVATDPVVSFKTAIWFWMTPQSPKPSCHGVITGQWAPSAADKSA  251

Query  573  GRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCSTQTPYSP  752
            GRV GYG VTNIINGG+ECG  G+  +  DRIGFYKRYCDI  VGYG+NLDC +Q P+  
Sbjct  252  GRVVGYGTVTNIINGGLECG-RGKDARVEDRIGFYKRYCDILGVGYGNNLDCYSQRPFGS  310

Query  753  *ELLVTL  773
              L+ T+
Sbjct  311  GLLVDTM  317



>dbj|BAK08350.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=266

 Score =   334 bits (856),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 159/243 (65%), Positives = 191/243 (79%), Gaps = 2/243 (1%)
 Frame = +3

Query  24   VSSIISQAIFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAFL  203
            VSSI+S+A FD ML +R+D  C A  FYTYDAF+AAA +F  F TTG  D +KREVAAFL
Sbjct  25   VSSIVSRAQFDRMLLHRNDGACQAKGFYTYDAFVAAASAFPGFGTTGSADAQKREVAAFL  84

Query  204  GQTSHETTGGWDAAPDGRYAWGYCFLRE-GTDDPYCNVTQEWSCAPGQKYFGRGPIQISY  380
             QTSHETTGGW  APDG +AWGYCF +E G    YC  + +W CAPG++Y+GRGPIQ+S+
Sbjct  85   AQTSHETTGGWATAPDGAFAWGYCFKQERGASSDYCTPSAQWPCAPGKRYYGRGPIQLSH  144

Query  381  NYNYGAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPSPP  560
            NYNYG AG+A+G DL++NPDLVATD TV+FKTA WFWMT Q  KPS H VI G+WSPS  
Sbjct  145  NYNYGPAGRAIGVDLLANPDLVATDATVAFKTAIWFWMTAQPPKPSSHAVIAGQWSPSGA  204

Query  561  DTAAGRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCSTQT  740
            D AAGRVPG+G++TNIINGG+ECG  G+  + ADRIGFYKRYCDI  VGYG+NLD  +Q 
Sbjct  205  DRAAGRVPGFGVITNIINGGIECG-HGQDSRVADRIGFYKRYCDILGVGYGNNLDRYSQR  263

Query  741  PYS  749
            P++
Sbjct  264  PFA  266



>ref|XP_007137310.1| hypothetical protein PHAVU_009G116700g [Phaseolus vulgaris]
 gb|ESW09304.1| hypothetical protein PHAVU_009G116700g [Phaseolus vulgaris]
Length=349

 Score =   337 bits (864),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 157/251 (63%), Positives = 197/251 (78%), Gaps = 1/251 (0%)
 Frame = +3

Query  21   DVSSIISQAIFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAF  200
            D+S++I ++ F+ MLK+R+++ C A  FYTYDAFIAAAKS+  F  TGD  TRKRE+AAF
Sbjct  96   DLSALIPESTFEQMLKHRNNAACPARGFYTYDAFIAAAKSYPSFGNTGDTATRKREIAAF  155

Query  201  LGQTSHETTGGWDAAPDGRYAWGYCFLREGTDDPYCNVTQEWSCAPGQKYFGRGPIQISY  380
            LGQTSHETTGGW  APDG +AWGYCF+RE     YC+ T ++ CAPGQ+Y+GRGPIQ+S+
Sbjct  156  LGQTSHETTGGWATAPDGPFAWGYCFVREVNPGTYCSATPQFPCAPGQQYYGRGPIQLSW  215

Query  381  NYNYGAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPSPP  560
            NYNY   G+A+G DLI+NPDLVATD  +SFK+A WFWMT Q  KPS HDVIT +W+PSP 
Sbjct  216  NYNYAQCGRAIGVDLINNPDLVATDRLISFKSALWFWMTAQSPKPSSHDVITSRWTPSPA  275

Query  561  DTAAGRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCSTQT  740
            D AA R+PGYG VTNIINGG+ECG  G+  +  +RIGF+KRYCD+  +GYG+NLDC++QT
Sbjct  276  DVAARRLPGYGTVTNIINGGLECG-RGQDSRVENRIGFFKRYCDMLGIGYGNNLDCNSQT  334

Query  741  PYSP*ELLVTL  773
            P+    LL  L
Sbjct  335  PFGNSLLLSDL  345



>gb|ACJ62110.1| chitinase [Zea mays subsp. parviglumis]
 gb|ACJ62140.1| chitinase [Zea mays subsp. parviglumis]
Length=321

 Score =   336 bits (861),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 161/245 (66%), Positives = 193/245 (79%), Gaps = 4/245 (2%)
 Frame = +3

Query  24   VSSIISQAIFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAFL  203
            V+SII +++F+ ML +R+D+ C A  FYTY  FIAAA +F  F TTG  D +KRE+AAFL
Sbjct  77   VASIIPESLFNQMLLHRNDAACPANGFYTYAGFIAAANAFPGFGTTGAPDVQKRELAAFL  136

Query  204  GQTSHETTGGWDAAPDGRYAWGYCFLRE--GTDDP-YCNVTQEWSCAPGQKYFGRGPIQI  374
             QTSHETTGGW  APDG YAWGYCF  E  G   P YC  + +W CA G+KY+GRGPIQI
Sbjct  137  AQTSHETTGGWATAPDGPYAWGYCFKEEQGGASGPDYCEPSAQWPCAAGKKYYGRGPIQI  196

Query  375  SYNYNYGAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPS  554
            SYNYNYG AG+A+G  +++NPDLVATDPTVSF+TA WFWMTPQ  KPSCHDV+TG+W+PS
Sbjct  197  SYNYNYGPAGQAIGAGILANPDLVATDPTVSFETAVWFWMTPQSPKPSCHDVMTGQWTPS  256

Query  555  PPDTAAGRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCST  734
              DTAA R+PGYG+VTNIINGG+ECG  G   + ADRIGFYKRYCD+  V YGDNLDC+ 
Sbjct  257  AADTAANRLPGYGVVTNIINGGLECG-HGADSRVADRIGFYKRYCDLLGVSYGDNLDCAN  315

Query  735  QTPYS  749
            QTP++
Sbjct  316  QTPFN  320



>gb|AAP03087.1| class Ib chitinase [Galega orientalis]
Length=326

 Score =   336 bits (862),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 158/243 (65%), Positives = 191/243 (79%), Gaps = 1/243 (0%)
 Frame = +3

Query  21   DVSSIISQAIFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAF  200
            DV  +I  ++FD MLKYR+D RC    FYTYD FIAAA+SF  F TTGD +TRK+E+AAF
Sbjct  85   DVGRLIPSSLFDQMLKYRNDGRCPGHGFYTYDGFIAAARSFNGFGTTGDDNTRKKELAAF  144

Query  201  LGQTSHETTGGWDAAPDGRYAWGYCFLREGTDDPYCNVTQEWSCAPGQKYFGRGPIQISY  380
            L QTSHETTGGW  APDG YAWGYCF+ E         + +W CAPG++Y+GRGPIQI++
Sbjct  145  LAQTSHETTGGWATAPDGPYAWGYCFVSEQNAQGDFCTSGDWPCAPGKRYYGRGPIQITH  204

Query  381  NYNYGAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPSPP  560
            NYNYG AGKA+G DLI+NPDLV+T+PTVSFKTA WFWMTPQG KPS HDVITG+W+PS  
Sbjct  205  NYNYGPAGKAIGEDLINNPDLVSTNPTVSFKTAIWFWMTPQGNKPSSHDVITGRWTPSSA  264

Query  561  DTAAGRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCSTQT  740
            D +AGRVPGYG++TNIINGG+ECG  G+  +  DR+GFY+RYC I  V  GDNLDC+ Q 
Sbjct  265  DNSAGRVPGYGVITNIINGGLECG-HGQDPRVDDRVGFYRRYCQILGVSPGDNLDCNNQR  323

Query  741  PYS  749
            P++
Sbjct  324  PFA  326



>gb|ACJ62153.1| chitinase [Zea mays subsp. parviglumis]
Length=322

 Score =   336 bits (861),  Expect = 8e-111, Method: Compositional matrix adjust.
 Identities = 161/245 (66%), Positives = 193/245 (79%), Gaps = 4/245 (2%)
 Frame = +3

Query  24   VSSIISQAIFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAFL  203
            V+SII +++F+ ML +R+D+ C A  FYTY  FIAAA +F  F TTG  D +KRE+AAFL
Sbjct  78   VASIIPESLFNQMLLHRNDAACPANGFYTYAGFIAAANAFPGFGTTGAPDVQKRELAAFL  137

Query  204  GQTSHETTGGWDAAPDGRYAWGYCFLRE--GTDDP-YCNVTQEWSCAPGQKYFGRGPIQI  374
             QTSHETTGGW  APDG YAWGYCF  E  G   P YC  + +W CA G+KY+GRGPIQI
Sbjct  138  AQTSHETTGGWATAPDGPYAWGYCFKEEQGGASGPDYCEPSAQWPCAAGKKYYGRGPIQI  197

Query  375  SYNYNYGAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPS  554
            SYNYNYG AG+A+G  +++NPDLVATDPTVSF+TA WFWMTPQ  KPSCHDV+TG+W+PS
Sbjct  198  SYNYNYGPAGQAIGAGILANPDLVATDPTVSFETAVWFWMTPQSPKPSCHDVMTGQWTPS  257

Query  555  PPDTAAGRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCST  734
              DTAA R+PGYG+VTNIINGG+ECG  G   + ADRIGFYKRYCD+  V YGDNLDC+ 
Sbjct  258  AADTAANRLPGYGVVTNIINGGLECG-HGADSRVADRIGFYKRYCDLLGVSYGDNLDCAN  316

Query  735  QTPYS  749
            QTP++
Sbjct  317  QTPFN  321



>gb|ADP95002.1| basic endochitinase-like protein, partial [Picea sitchensis]
Length=257

 Score =   333 bits (855),  Expect = 8e-111, Method: Compositional matrix adjust.
 Identities = 157/243 (65%), Positives = 192/243 (79%), Gaps = 3/243 (1%)
 Frame = +3

Query  24   VSSIISQAIFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAFL  203
            VSS+I+++IF+D+LK+R+D+ C A  FY+YDAFIAAA +F  F TTGDL ++KRE+AAF 
Sbjct  1    VSSVITESIFNDLLKHRNDAGCKAKGFYSYDAFIAAANAFPGFGTTGDLTSQKRELAAFF  60

Query  204  GQTSHETTGGWDAAPDGRYAWGYCFLREGTDDP--YCNVTQEWSCAPGQKYFGRGPIQIS  377
            GQTSHETTGGW  APDG YAWGYCF  E  + P  YC  + +W CA G++Y+GRGP+QIS
Sbjct  61   GQTSHETTGGWPTAPDGPYAWGYCFKEEQGNPPGEYCQASSQWPCAFGKRYYGRGPVQIS  120

Query  378  YNYNYGAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPSP  557
            +NYNYG AGKA+G+D I+NPD+VA D TVSFKTA WFWMT Q  KPSCH+V+ G W PS 
Sbjct  121  WNYNYGPAGKAVGFDGINNPDIVANDATVSFKTAVWFWMTEQSPKPSCHNVMAGGWGPSG  180

Query  558  PDTAAGRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCSTQ  737
             DTAAGR  GYG+VTNIINGG+ECG  G   ++ DRIGFYKRYCDI  V YG NLDC++Q
Sbjct  181  SDTAAGRAAGYGVVTNIINGGLECG-KGSDSRQEDRIGFYKRYCDILGVSYGSNLDCNSQ  239

Query  738  TPY  746
             P+
Sbjct  240  KPF  242



>gb|ACJ62117.1| chitinase [Zea mays subsp. parviglumis]
Length=318

 Score =   336 bits (861),  Expect = 8e-111, Method: Compositional matrix adjust.
 Identities = 161/245 (66%), Positives = 193/245 (79%), Gaps = 4/245 (2%)
 Frame = +3

Query  24   VSSIISQAIFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAFL  203
            V+SII +++F+ ML +R+D+ C A  FYTY  FIAAA +F  F TTG  D +KRE+AAFL
Sbjct  74   VASIIPESLFNQMLLHRNDAACPANGFYTYAGFIAAANAFPGFGTTGAPDVQKRELAAFL  133

Query  204  GQTSHETTGGWDAAPDGRYAWGYCFLRE--GTDDP-YCNVTQEWSCAPGQKYFGRGPIQI  374
             QTSHETTGGW  APDG YAWGYCF  E  G   P YC  + +W CA G+KY+GRGPIQI
Sbjct  134  AQTSHETTGGWATAPDGPYAWGYCFKEEQGGASGPDYCEPSAQWPCAAGKKYYGRGPIQI  193

Query  375  SYNYNYGAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPS  554
            SYNYNYG AG+A+G  +++NPDLVATDPTVSF+TA WFWMTPQ  KPSCHDV+TG+W+PS
Sbjct  194  SYNYNYGPAGQAIGAGILANPDLVATDPTVSFETAVWFWMTPQSPKPSCHDVMTGQWTPS  253

Query  555  PPDTAAGRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCST  734
              DTAA R+PGYG+VTNIINGG+ECG  G   + ADRIGFYKRYCD+  V YGDNLDC+ 
Sbjct  254  AADTAANRLPGYGVVTNIINGGLECG-HGADSRVADRIGFYKRYCDLLGVSYGDNLDCAN  312

Query  735  QTPYS  749
            QTP++
Sbjct  313  QTPFN  317



>ref|XP_006828992.1| hypothetical protein AMTR_s00001p00243780 [Amborella trichopoda]
 gb|ERM96408.1| hypothetical protein AMTR_s00001p00243780 [Amborella trichopoda]
Length=334

 Score =   336 bits (862),  Expect = 9e-111, Method: Compositional matrix adjust.
 Identities = 161/242 (67%), Positives = 189/242 (78%), Gaps = 1/242 (0%)
 Frame = +3

Query  24   VSSIISQAIFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAFL  203
            V+S+ISQ++FD MLK+R+D+ C    FYTY AFI AAKSF  F TTGD  T+KRE+AAFL
Sbjct  93   VASLISQSLFDQMLKHRNDAACKGNGFYTYSAFITAAKSFPAFGTTGDTATQKREIAAFL  152

Query  204  GQTSHETTGGWDAAPDGRYAWGYCFLREGTDDPYCNVTQEWSCAPGQKYFGRGPIQISYN  383
             QTS ETTGGW  APDG YAWGYCF+ E     YC  + +W CA G+KY+GRGPIQIS+N
Sbjct  153  AQTSKETTGGWATAPDGPYAWGYCFVNEQGGSDYCQPSAQWPCAGGKKYYGRGPIQISWN  212

Query  384  YNYGAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPSPPD  563
            YNYG AGKA+G+D ISNPD VATD  +SFKTAFWFWMTPQ  KPS HDVITG+W+PS  D
Sbjct  213  YNYGQAGKAIGFDGISNPDAVATDAVISFKTAFWFWMTPQPPKPSAHDVITGRWTPSAAD  272

Query  564  TAAGRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCSTQTP  743
             +AGRVPGYG++TNIINGG+ECG  G   +  DRIGFYKRYCD+  V YGDNLDC  Q P
Sbjct  273  RSAGRVPGYGVITNIINGGLECG-HGSDARVIDRIGFYKRYCDLMGVPYGDNLDCYNQRP  331

Query  744  YS  749
            ++
Sbjct  332  FT  333



>gb|ADP94995.1| basic endochitinase-like protein, partial [Picea sitchensis]
 gb|ADP94996.1| basic endochitinase-like protein, partial [Picea sitchensis]
Length=257

 Score =   333 bits (854),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 156/243 (64%), Positives = 191/243 (79%), Gaps = 3/243 (1%)
 Frame = +3

Query  24   VSSIISQAIFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAFL  203
            VSS+I+++IF+D+LK+R+D+ C A  FY+YDAFIAAA +F  F TTGDL ++KRE+AAF 
Sbjct  1    VSSVITESIFNDLLKHRNDAGCKAKGFYSYDAFIAAANAFPGFGTTGDLTSQKRELAAFF  60

Query  204  GQTSHETTGGWDAAPDGRYAWGYCFLREGTDDP--YCNVTQEWSCAPGQKYFGRGPIQIS  377
            GQTSHETTGGW  APDG YAWGYCF  E  + P  YC  + +W CA G++Y+GRGP+QIS
Sbjct  61   GQTSHETTGGWPTAPDGPYAWGYCFKEEQGNPPGEYCQASSQWPCASGKRYYGRGPVQIS  120

Query  378  YNYNYGAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPSP  557
            +NYNYG AGK +G+D I+NPD+VA D TVSFKTA WFWMT Q  KPSCH+V+ G W PS 
Sbjct  121  WNYNYGPAGKTVGFDGINNPDIVANDATVSFKTAVWFWMTEQSPKPSCHNVMAGGWGPSG  180

Query  558  PDTAAGRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCSTQ  737
             DTAAGR  GYG+VTNIINGG+ECG  G   ++ DRIGFYKRYCDI  V YG NLDC++Q
Sbjct  181  SDTAAGRAAGYGVVTNIINGGLECG-KGSDSRQEDRIGFYKRYCDILGVSYGSNLDCNSQ  239

Query  738  TPY  746
             P+
Sbjct  240  KPF  242



>gb|AFK33496.1| unknown [Lotus japonicus]
Length=324

 Score =   336 bits (861),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 159/242 (66%), Positives = 193/242 (80%), Gaps = 2/242 (1%)
 Frame = +3

Query  24   VSSIISQAIFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAFL  203
            V S+IS ++F+ +LKYR+D RC A  FYTYDAFI AA+SF  F TTGD  TRK+E+AAFL
Sbjct  85   VGSLISSSLFNQLLKYRNDGRCAANGFYTYDAFITAARSFNGFGTTGDDATRKKELAAFL  144

Query  204  GQTSHETTGGWDAAPDGRYAWGYCFLREGTDDPYCNVTQEWSCAPGQKYFGRGPIQISYN  383
             QTSHETTGGW +APDG YAWGYCF+ E     YC+ +++W C PG++Y+GRGPIQ+++N
Sbjct  145  AQTSHETTGGWPSAPDGPYAWGYCFVSERNRADYCD-SKDWPCTPGKQYYGRGPIQLTHN  203

Query  384  YNYGAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPSPPD  563
            YNYG AGKA+  DLIS+PDLV+ DP VSFKTA WFWMT Q  KPSCHDVITGKW+P+  D
Sbjct  204  YNYGLAGKAIQQDLISDPDLVSRDPIVSFKTAIWFWMTRQANKPSCHDVITGKWTPTSAD  263

Query  564  TAAGRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCSTQTP  743
             +AGRVPGYG++TNIINGGVEC    ++DK  DRIGFYKRYC IF V  GDNLDC+ Q P
Sbjct  264  GSAGRVPGYGVITNIINGGVEC-ENRQNDKVQDRIGFYKRYCQIFRVSPGDNLDCNNQRP  322

Query  744  YS  749
            ++
Sbjct  323  FA  324



>gb|ACJ62109.1| chitinase [Zea mays subsp. parviglumis]
Length=316

 Score =   335 bits (860),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 161/245 (66%), Positives = 193/245 (79%), Gaps = 4/245 (2%)
 Frame = +3

Query  24   VSSIISQAIFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAFL  203
            V+SII +++F+ ML +R+D+ C A  FYTY  FIAAA +F  F TTG  D +KRE+AAFL
Sbjct  72   VASIIPESLFNQMLLHRNDAACPANGFYTYAGFIAAANAFPGFGTTGAPDVQKRELAAFL  131

Query  204  GQTSHETTGGWDAAPDGRYAWGYCFLRE--GTDDP-YCNVTQEWSCAPGQKYFGRGPIQI  374
             QTSHETTGGW  APDG YAWGYCF  E  G   P YC  + +W CA G+KY+GRGPIQI
Sbjct  132  AQTSHETTGGWATAPDGPYAWGYCFKEEQGGASGPDYCEPSAQWPCAAGKKYYGRGPIQI  191

Query  375  SYNYNYGAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPS  554
            SYNYNYG AG+A+G  +++NPDLVATDPTVSF+TA WFWMTPQ  KPSCHDV+TG+W+PS
Sbjct  192  SYNYNYGPAGQAIGAGILANPDLVATDPTVSFETAVWFWMTPQSPKPSCHDVMTGQWTPS  251

Query  555  PPDTAAGRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCST  734
              DTAA R+PGYG+VTNIINGG+ECG  G   + ADRIGFYKRYCD+  V YGDNLDC+ 
Sbjct  252  AADTAANRLPGYGVVTNIINGGLECG-HGADSRVADRIGFYKRYCDLLGVSYGDNLDCAN  310

Query  735  QTPYS  749
            QTP++
Sbjct  311  QTPFN  315



>gb|ACJ62104.1| chitinase [Zea mays subsp. parviglumis]
Length=317

 Score =   335 bits (860),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 161/245 (66%), Positives = 193/245 (79%), Gaps = 4/245 (2%)
 Frame = +3

Query  24   VSSIISQAIFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAFL  203
            V+SII +++F+ ML +R+D+ C A  FYTY  FIAAA +F  F TTG  D +KRE+AAFL
Sbjct  73   VASIIPESLFNQMLLHRNDAACPANGFYTYAGFIAAANAFPGFGTTGAPDVQKRELAAFL  132

Query  204  GQTSHETTGGWDAAPDGRYAWGYCFLRE--GTDDP-YCNVTQEWSCAPGQKYFGRGPIQI  374
             QTSHETTGGW  APDG YAWGYCF  E  G   P YC  + +W CA G+KY+GRGPIQI
Sbjct  133  AQTSHETTGGWATAPDGPYAWGYCFKEEQGGASGPDYCEPSAQWPCAAGKKYYGRGPIQI  192

Query  375  SYNYNYGAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPS  554
            SYNYNYG AG+A+G  +++NPDLVATDPTVSF+TA WFWMTPQ  KPSCHDV+TG+W+PS
Sbjct  193  SYNYNYGPAGQAIGAGILANPDLVATDPTVSFETAVWFWMTPQSPKPSCHDVMTGQWTPS  252

Query  555  PPDTAAGRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCST  734
              DTAA R+PGYG+VTNIINGG+ECG  G   + ADRIGFYKRYCD+  V YGDNLDC+ 
Sbjct  253  AADTAANRLPGYGVVTNIINGGLECG-HGADSRVADRIGFYKRYCDLLGVSYGDNLDCAN  311

Query  735  QTPYS  749
            QTP++
Sbjct  312  QTPFN  316



>gb|ACJ62105.1| chitinase [Zea mays subsp. parviglumis]
Length=317

 Score =   335 bits (859),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 161/245 (66%), Positives = 193/245 (79%), Gaps = 4/245 (2%)
 Frame = +3

Query  24   VSSIISQAIFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAFL  203
            V+SII +++F+ ML +R+D+ C A  FYTY  FIAAA +F  F TTG  D +KRE+AAFL
Sbjct  73   VASIIPESLFNQMLLHRNDAACPANGFYTYAGFIAAANAFPGFGTTGAPDVQKRELAAFL  132

Query  204  GQTSHETTGGWDAAPDGRYAWGYCFLRE--GTDDP-YCNVTQEWSCAPGQKYFGRGPIQI  374
             QTSHETTGGW  APDG YAWGYCF  E  G   P YC  + +W CA G+KY+GRGPIQI
Sbjct  133  AQTSHETTGGWATAPDGPYAWGYCFKEEQGGASGPDYCEPSAQWPCAAGKKYYGRGPIQI  192

Query  375  SYNYNYGAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPS  554
            SYNYNYG AG+A+G  +++NPD VATDPTVSF+TA WFWMTPQ  KPSCHDV+TG+W+PS
Sbjct  193  SYNYNYGPAGQAIGAGILANPDRVATDPTVSFETAVWFWMTPQSPKPSCHDVMTGQWTPS  252

Query  555  PPDTAAGRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCST  734
              DTAAGR+PGYG+VTNIINGG+ECG  G   + ADRIGFYKRYCD+  V YGDNLDC+ 
Sbjct  253  AADTAAGRLPGYGVVTNIINGGLECG-HGADSRVADRIGFYKRYCDLLGVSYGDNLDCAN  311

Query  735  QTPYS  749
            QTP++
Sbjct  312  QTPFN  316



>gb|ADP94989.1| basic endochitinase-like protein, partial [Picea sitchensis]
 gb|ADP94990.1| basic endochitinase-like protein, partial [Picea sitchensis]
Length=257

 Score =   333 bits (854),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 156/243 (64%), Positives = 191/243 (79%), Gaps = 3/243 (1%)
 Frame = +3

Query  24   VSSIISQAIFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAFL  203
            VSS+I+++IF+D+LK+R+D+ C A  FY+YDAFIAAA +F  F T GDL ++KRE+AAF 
Sbjct  1    VSSVITESIFNDLLKHRNDAGCKAKGFYSYDAFIAAANAFPGFGTIGDLTSQKRELAAFF  60

Query  204  GQTSHETTGGWDAAPDGRYAWGYCFLREGTDDP--YCNVTQEWSCAPGQKYFGRGPIQIS  377
            GQTSHETTGGW  APDG YAWGYCF  E  + P  YC  + +W CA G++Y+GRGP+QIS
Sbjct  61   GQTSHETTGGWPTAPDGPYAWGYCFKEEQGNPPGEYCQASSQWPCASGKRYYGRGPVQIS  120

Query  378  YNYNYGAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPSP  557
            +NYNYG AGKA+G+D I+NPD+VA D TVSFKTA WFWMT Q  KPSCH+V+ G W PS 
Sbjct  121  WNYNYGPAGKAVGFDGINNPDIVANDATVSFKTAVWFWMTEQSPKPSCHNVMAGGWGPSG  180

Query  558  PDTAAGRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCSTQ  737
             DTAAGR  GYG+VTNIINGG+ECG  G   ++ DRIGFYKRYCDI  V YG NLDC++Q
Sbjct  181  SDTAAGRAAGYGVVTNIINGGLECG-KGSDSRQEDRIGFYKRYCDILGVSYGSNLDCNSQ  239

Query  738  TPY  746
             P+
Sbjct  240  KPF  242



>gb|ABD64683.1| chitinase class I basic [Vitis vinifera]
Length=314

 Score =   335 bits (859),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 165/252 (65%), Positives = 200/252 (79%), Gaps = 2/252 (1%)
 Frame = +3

Query  21   DVSSIISQAIFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAF  200
            D+  +I++++F+DMLK+R++  C    FYTYDAFIAAAK+F  F TTGD  TRKRE+AAF
Sbjct  64   DIGQLITRSMFNDMLKHRNEGSCPGKGFYTYDAFIAAAKAFPGFGTTGDTTTRKREIAAF  123

Query  201  LGQTSHETTGGWDAAPDGRYAWGYCFLRE-GTDDPYCNVTQEWSCAPGQKYFGRGPIQIS  377
            L QTSHETTGGW +APDG YAWGYC+LRE G+   YC  + +W CA G+KY+GRGPIQIS
Sbjct  124  LAQTSHETTGGWASAPDGPYAWGYCYLREQGSPGAYCVPSAQWPCAAGRKYYGRGPIQIS  183

Query  378  YNYNYGAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPSP  557
            YNYNYG AGKA+G DL++NPDLVATD  +SFKTAFWFWMTPQ  KPSCH+VITG W+PS 
Sbjct  184  YNYNYGQAGKAIGVDLVNNPDLVATDAVISFKTAFWFWMTPQSPKPSCHNVITGGWTPSG  243

Query  558  PDTAAGRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCSTQ  737
             D +AGR+PG+G++TNIINGGVECG  G   +  DRIGFYKRYCDI  V YG+NLDC+ Q
Sbjct  244  ADRSAGRLPGFGVITNIINGGVECG-KGVVPQVQDRIGFYKRYCDILRVSYGNNLDCNNQ  302

Query  738  TPYSP*ELLVTL  773
             P+    LL T+
Sbjct  303  RPFGSGLLLDTI  314



>gb|AEZ67300.1| chitinase 1 [Populus x canadensis]
Length=318

 Score =   335 bits (859),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 158/240 (66%), Positives = 188/240 (78%), Gaps = 1/240 (0%)
 Frame = +3

Query  30   SIISQAIFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAFLGQ  209
            SIIS A FD+MLK+R+D  C    FYTY+AFI+AA +F  F TTGD DTRKRE+AAFLGQ
Sbjct  70   SIISSAKFDEMLKHRNDGGCPGKGFYTYNAFISAANAFPGFGTTGDADTRKREIAAFLGQ  129

Query  210  TSHETTGGWDAAPDGRYAWGYCFLREGTDDPYCNVTQEWSCAPGQKYFGRGPIQISYNYN  389
            TSHETTGGW  APDG YAWGYCF++E     YC  +  + CA G++Y+GRGP+Q+S+NYN
Sbjct  130  TSHETTGGWQTAPDGPYAWGYCFVKEQNPGSYCAPSSTYPCAGGKQYYGRGPVQLSWNYN  189

Query  390  YGAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPSPPDTA  569
            YG  GKA+G DL++NPDLVATDP +SFKT  WFWMT Q  KPSCH VITGKWSPS  D+A
Sbjct  190  YGQCGKAIGVDLLNNPDLVATDPVISFKTVIWFWMTAQSPKPSCHSVITGKWSPSGADSA  249

Query  570  AGRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCSTQTPYS  749
            AGRVPGYG++TNIINGG+ECG   +   E DRIGFYKRYCD+  VGYG+NLDC  Q  ++
Sbjct  250  AGRVPGYGVLTNIINGGLECGMGWKQQVE-DRIGFYKRYCDLLGVGYGNNLDCYNQKSFA  308



>ref|XP_004163402.1| PREDICTED: endochitinase-like [Cucumis sativus]
Length=316

 Score =   335 bits (859),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 154/238 (65%), Positives = 187/238 (79%), Gaps = 1/238 (0%)
 Frame = +3

Query  33   IISQAIFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAFLGQT  212
            II++++++ MLKY  DSRC +  FYTY+AFI AA+SF +F TTGD  TRKRE+AAF GQT
Sbjct  80   IITESLYNQMLKYSTDSRCPSNGFYTYNAFITAAQSFPDFGTTGDDATRKRELAAFFGQT  139

Query  213  SHETTGGWDAAPDGRYAWGYCFLREGTDDPYCNVTQEWSCAPGQKYFGRGPIQISYNYNY  392
            SHETTGGW +APDG YAWGYCF+RE   D YC  + +W C  GQKY+GRGP+Q+++NYNY
Sbjct  140  SHETTGGWASAPDGPYAWGYCFIREINQDVYCTPSDQWPCVAGQKYYGRGPMQLTHNYNY  199

Query  393  GAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPSPPDTAA  572
            G AG AL  +L+SNPDLVAT+  +SFK A WFWMTPQG KPSCH+VITG W PS  D AA
Sbjct  200  GPAGNALSLNLLSNPDLVATNAIISFKAAIWFWMTPQGNKPSCHNVITGNWQPSGTDNAA  259

Query  573  GRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCSTQTPY  746
            GRVPGYG++TNIINGG+ECG  G   +  DRIGFYKRYCD+  +GYG NLDC+ Q  +
Sbjct  260  GRVPGYGVITNIINGGLECG-HGPDSRVEDRIGFYKRYCDMLGIGYGSNLDCNNQQSF  316



>emb|CAA61278.1| chitinase class 1 [Vigna unguiculata]
Length=321

 Score =   335 bits (859),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 161/242 (67%), Positives = 191/242 (79%), Gaps = 2/242 (1%)
 Frame = +3

Query  21   DVSSIISQAIFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAF  200
            D+S++I    FD MLK+R+D  C A  FYTYDAFIA A++F  F  TGD  TRKRE+AAF
Sbjct  71   DLSALIP-GHFDQMLKHRNDGACPARGFYTYDAFIAGARAFPSFGNTGDTATRKREIAAF  129

Query  201  LGQTSHETTGGWDAAPDGRYAWGYCFLREGTDDPYCNVTQEWSCAPGQKYFGRGPIQISY  380
            LGQTSHETTGGW +APDG YAWGYCF+RE     YC+ T ++ CA GQ+Y+GRGPIQIS+
Sbjct  130  LGQTSHETTGGWPSAPDGPYAWGYCFVREQNPSAYCSPTPQFPCASGQQYYGRGPIQISW  189

Query  381  NYNYGAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPSPP  560
            NYNYG  G A+G DLI+NPDLVATDP VSFK+A WFWMTPQ  KPS HDVIT +W+PS  
Sbjct  190  NYNYGQCGNAIGVDLINNPDLVATDPVVSFKSAIWFWMTPQSPKPSSHDVITSQWTPSAA  249

Query  561  DTAAGRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCSTQT  740
            D AAGR+PGYG VTNIINGG+ECG  G+  +  DRIGF+KRYCD+F VGYG+NLDC +Q 
Sbjct  250  DVAAGRLPGYGTVTNIINGGLECG-RGQDSRVEDRIGFFKRYCDLFGVGYGNNLDCYSQA  308

Query  741  PY  746
            P+
Sbjct  309  PF  310



>gb|AAA32641.1| chitinase, partial [Allium sativum]
 prf||2001449A chitinase 1
Length=318

 Score =   335 bits (859),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 159/242 (66%), Positives = 189/242 (78%), Gaps = 2/242 (1%)
 Frame = +3

Query  24   VSSIISQAIFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAFL  203
            V+SIIS ++F+ ML +R+D+ C A  FYTYDAFIAAA SFG F TTGD++ +KRE+AAF 
Sbjct  78   VASIISSSLFNQMLLHRNDAACPANGFYTYDAFIAAANSFGGFGTTGDINAQKRELAAFF  137

Query  204  GQTSHETTGGWDAAPDGRYAWGYCFLRE-GTDDPYCNVTQEWSCAPGQKYFGRGPIQISY  380
             QTSHETTGG+ +APDG YAWGYCF +E G    YC  + ++ CAPG+KY+GRGPIQISY
Sbjct  138  AQTSHETTGGYPSAPDGPYAWGYCFKQEQGNPSDYCQASAQYPCAPGKKYYGRGPIQISY  197

Query  381  NYNYGAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPSPP  560
            NYNYG  G A+  DL++NPDLVATDPT+SFKTA WFWMT Q  KPSCH V TG+W PS  
Sbjct  198  NYNYGQCGNAIHQDLLNNPDLVATDPTISFKTAIWFWMTAQSPKPSCHAVATGQWQPSAA  257

Query  561  DTAAGRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCSTQT  740
            D AAGRVPG+G++TNIINGGVECG  G     ADRIG+YKRYCD+  VGYGDNLDC  Q 
Sbjct  258  DQAAGRVPGFGVITNIINGGVECG-HGSDTHVADRIGYYKRYCDLLQVGYGDNLDCGNQA  316

Query  741  PY  746
             +
Sbjct  317  HF  318



>ref|XP_009392872.1| PREDICTED: chitinase 1-like [Musa acuminata subsp. malaccensis]
Length=315

 Score =   335 bits (858),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 161/243 (66%), Positives = 188/243 (77%), Gaps = 2/243 (1%)
 Frame = +3

Query  24   VSSIISQAIFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAFL  203
            V SIIS ++F+ MLK+R+D+ C    FYTY AFIAAA  F  F TTGD   RKRE+AAFL
Sbjct  66   VDSIISSSLFEQMLKHRNDAACPGKGFYTYTAFIAAANFFSGFGTTGDDTARKREIAAFL  125

Query  204  GQTSHETTGGWDAAPDGRYAWGYCFLREGTD-DPYCNVTQEWSCAPGQKYFGRGPIQISY  380
             QTSHETTGGW  APDG YAWGYCF++E      YC  + +W CA G+KY+GRGPIQIS+
Sbjct  126  AQTSHETTGGWATAPDGPYAWGYCFVQEQNPPSDYCVASSQWPCAAGKKYYGRGPIQISF  185

Query  381  NYNYGAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPSPP  560
            NYNYG AG+A+G DL++NPDLVATD T+SFKTA WFWMTPQ  KPSCHDVITG+W+PS  
Sbjct  186  NYNYGPAGRAIGSDLLNNPDLVATDATISFKTALWFWMTPQSPKPSCHDVITGRWTPSNA  245

Query  561  DTAAGRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCSTQT  740
            D AAGR PGYG+ TNIINGG+ECG  G   + ADRIGFYKRYCD+  V YGDNLDC  Q 
Sbjct  246  DQAAGRRPGYGVTTNIINGGLECG-KGYDARVADRIGFYKRYCDLLGVSYGDNLDCYNQR  304

Query  741  PYS  749
            P++
Sbjct  305  PFA  307



>ref|XP_006367160.1| PREDICTED: basic endochitinase-like [Solanum tuberosum]
Length=264

 Score =   333 bits (853),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 154/243 (63%), Positives = 190/243 (78%), Gaps = 2/243 (1%)
 Frame = +3

Query  21   DVSSIISQAIFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAF  200
            DV S+I++ +F+ +  +R+D+ C A  FYTY+AFI A KSF  F TTGD +TRK+E+AAF
Sbjct  21   DVGSVINKNLFERIFLHRNDAACAAKGFYTYEAFITATKSFAAFGTTGDTNTRKKEIAAF  80

Query  201  LGQTSHETTGGWDAAPDGRYAWGYCFLRE-GTDDPYCNVTQEWSCAPGQKYFGRGPIQIS  377
            L QTSHETTGGW  APDG Y+WGYCF +E G+   YC   Q+W CAPG+KYFGRGPIQIS
Sbjct  81   LAQTSHETTGGWATAPDGPYSWGYCFKQEQGSPGDYCVANQQWPCAPGKKYFGRGPIQIS  140

Query  378  YNYNYGAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPSP  557
            YNYNYG AG+A+G +L++NPDLVA D  VSFKTA WFWMTPQ  KPS HDVITG+WSPS 
Sbjct  141  YNYNYGPAGRAIGVNLLNNPDLVANDAVVSFKTALWFWMTPQQPKPSAHDVITGRWSPSA  200

Query  558  PDTAAGRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCSTQ  737
             D+AAGRVPG+G++TNIINGG+EC   G + +  +RIGFY+RYC I  V  G+NLDC+ Q
Sbjct  201  ADSAAGRVPGFGVITNIINGGIECN-KGSNAQMDNRIGFYRRYCQILGVDPGNNLDCANQ  259

Query  738  TPY  746
             P+
Sbjct  260  RPF  262



>ref|NP_001284473.1| endochitinase-like precursor [Cucumis melo]
 dbj|BAB40817.2| endochitinase MCHT-2 [Cucumis melo]
Length=311

 Score =   335 bits (858),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 157/241 (65%), Positives = 187/241 (78%), Gaps = 2/241 (1%)
 Frame = +3

Query  24   VSSIISQAIFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAFL  203
            V SIIS+++++ MLKY  D RC +  FYTY+AFI AA+SF  F TTGD  TRKRE+AAF 
Sbjct  73   VGSIISESLYNQMLKYSRDPRCPSNGFYTYNAFITAARSFPTFGTTGDATTRKREIAAFF  132

Query  204  GQTSHETTGGWDAAPDGRYAWGYCFLREGTDDPYCNVTQEWSCAPGQKYFGRGPIQISYN  383
            GQTSHETTGGW  APDG YAWGY ++RE     YC  +Q+W CAPGQ+Y+GRGPIQ+++N
Sbjct  133  GQTSHETTGGWSTAPDGPYAWGYWYIRERNQQTYCTPSQQWPCAPGQQYYGRGPIQLTHN  192

Query  384  YNYGAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPSPPD  563
            YNYG AGKA+G  L++NPD  ATDP  SFKTA WFWMT QG KPSCH+VITG W PS  D
Sbjct  193  YNYGPAGKAIGAPLLTNPD-TATDPVTSFKTALWFWMTAQGNKPSCHNVITGNWQPSSAD  251

Query  564  TAAGRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCSTQTP  743
             AAGRVPGYG++TNIINGG+ECG  G  D+  DRIGFYKRYCD+  +GYG+NLDC  Q  
Sbjct  252  NAAGRVPGYGVITNIINGGLECG-RGPDDRVKDRIGFYKRYCDMLGIGYGNNLDCYNQRS  310

Query  744  Y  746
            +
Sbjct  311  F  311



>ref|XP_010242847.1| PREDICTED: endochitinase A-like [Nelumbo nucifera]
Length=316

 Score =   335 bits (858),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 160/244 (66%), Positives = 198/244 (81%), Gaps = 5/244 (2%)
 Frame = +3

Query  21   DVSSIISQAIFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAF  200
            DV+S+I++ +F++MLK+R+D  C +  FYTY+AFI AA+SF  FATTGD +TRKRE+AAF
Sbjct  75   DVTSLINETLFNEMLKHRNDVVC-SNGFYTYNAFITAARSFTGFATTGDTNTRKREIAAF  133

Query  201  LGQTSHETTGGWDAAPDGRYAWGYCFLREGTDDP--YCNVTQEWSCAPGQKYFGRGPIQI  374
            LGQTSHETTGGW  APDG YAWGYCF+ E  ++P  +C+ + +W CAPG+KY+GRGPIQI
Sbjct  134  LGQTSHETTGGWATAPDGPYAWGYCFIEE-RNNPGDFCSPSTQWPCAPGKKYYGRGPIQI  192

Query  375  SYNYNYGAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPS  554
            S+NYNYG AG+ +G DL++NPDLVATD T+SFKTA WFWMTPQ  KPSCHDVI+G+W+P+
Sbjct  193  SHNYNYGPAGRYIGSDLLNNPDLVATDATISFKTALWFWMTPQSPKPSCHDVISGQWTPT  252

Query  555  PPDTAAGRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCST  734
              DTA GRVPGYG++TNIINGG ECG  G   +  DRIGFYKRYCD+  V YGDNLDC  
Sbjct  253  ATDTAGGRVPGYGVITNIINGGNECG-RGTVAQVEDRIGFYKRYCDMLGVSYGDNLDCYN  311

Query  735  QTPY  746
            Q  +
Sbjct  312  QRSF  315



>gb|AAQ84333.1| OsmChiI-34 [Oryza sativa Japonica Group]
Length=298

 Score =   334 bits (856),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 162/240 (68%), Positives = 189/240 (79%), Gaps = 3/240 (1%)
 Frame = +3

Query  24   VSSIISQAIFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAFL  203
            V+SI+S+++FD ML +R+D+ C A  FYTYDAF+AAA +F  FATTGD  TRKREVAAFL
Sbjct  59   VASIVSRSLFDQMLLHRNDAACPAKNFYTYDAFVAAANAFPSFATTGDAATRKREVAAFL  118

Query  204  GQTSHETTGGWDAAPDGRYAWGYCFLRE--GTDDPYCNVTQEWSCAPGQKYFGRGPIQIS  377
             QTSHETTGGW  APDG Y+WGYCF  E  G    YC    EW CA G+KY+GRGPIQI+
Sbjct  119  AQTSHETTGGWPTAPDGPYSWGYCFKEENNGNAPTYCEPKPEWPCAAGKKYYGRGPIQIT  178

Query  378  YNYNYGAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPSP  557
            YNY+YG AG+A+G +L+SNPDLVA+D TVS KTAFWFWMTPQ  KPSCH V+TG+W+P+ 
Sbjct  179  YNYSYGPAGQAIGSNLLSNPDLVASDATVSLKTAFWFWMTPQSPKPSCHAVMTGQWTPNG  238

Query  558  PDTAAGRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCSTQ  737
             D AAGRVPGYG+VTNIINGGVECG  G   + ADRIGFYKRYCD+  V YG NLDC  Q
Sbjct  239  NDQAAGRVPGYGVVTNIINGGVECG-HGADSRVADRIGFYKRYCDMLGVSYGANLDCYNQ  297



>ref|XP_003563256.2| PREDICTED: 26 kDa endochitinase 1 [Brachypodium distachyon]
Length=328

 Score =   335 bits (859),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 157/242 (65%), Positives = 190/242 (79%), Gaps = 2/242 (1%)
 Frame = +3

Query  24   VSSIISQAIFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAFL  203
            V+S++S+++F+ ML +R+D  C A  FYTYDAF+AAA SF  F TTG  D RKREVAAFL
Sbjct  87   VASVVSRSLFERMLLHRNDGACQAKGFYTYDAFLAAANSFPGFGTTGATDVRKREVAAFL  146

Query  204  GQTSHETTGGWDAAPDGRYAWGYCFLRE-GTDDPYCNVTQEWSCAPGQKYFGRGPIQISY  380
             QTSHETTGGW  APDG Y+WGYCF +E G    YC  + +W CAPG++Y+GRGPIQ+S+
Sbjct  147  AQTSHETTGGWATAPDGPYSWGYCFKQERGATSDYCTPSAQWPCAPGKRYYGRGPIQLSH  206

Query  381  NYNYGAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPSPP  560
            NYNYG AG+A+G DL+ NPDLVATDPTVSFKTA WFWMT Q  KPS H V TG+W PS  
Sbjct  207  NYNYGPAGRAIGVDLLRNPDLVATDPTVSFKTAMWFWMTAQSPKPSAHAVATGQWRPSRA  266

Query  561  DTAAGRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCSTQT  740
            D AA RVPG+G++TNI+NGG+ECG  G+  + ADRIGFYKRYCD+  VGYGDNLDC+ Q 
Sbjct  267  DRAARRVPGFGVITNIVNGGIECG-HGQDSRVADRIGFYKRYCDLLGVGYGDNLDCNNQR  325

Query  741  PY  746
            P+
Sbjct  326  PF  327



>ref|XP_009601274.1| PREDICTED: basic endochitinase-like [Nicotiana tomentosiformis]
Length=263

 Score =   332 bits (852),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 157/243 (65%), Positives = 189/243 (78%), Gaps = 3/243 (1%)
 Frame = +3

Query  21   DVSSIISQAIFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAF  200
            DV +++S+ +F+ +L +R+D+ C A  FYTYDAFIAAA+SFG F TTGD +TRK+E AAF
Sbjct  21   DVGALVSKDMFERLLLHRNDANC-AKGFYTYDAFIAAARSFGAFGTTGDTNTRKKEFAAF  79

Query  201  LGQTSHETTGGWDAAPDGRYAWGYCFLREGTDDP-YCNVTQEWSCAPGQKYFGRGPIQIS  377
            L QTSHETTGGW  APDG Y+WGYCF +E  + P YC   Q+W CAPG+KYFGRGP+QIS
Sbjct  80   LAQTSHETTGGWATAPDGPYSWGYCFKQEQGNPPDYCVANQQWPCAPGKKYFGRGPMQIS  139

Query  378  YNYNYGAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPSP  557
            YNYNYG AGKA+G DL+ NPD VA +  VSFKTA WFWMT Q  KPS HDVITGKW PS 
Sbjct  140  YNYNYGPAGKAIGVDLLKNPDAVANNAVVSFKTALWFWMTAQQPKPSAHDVITGKWRPSG  199

Query  558  PDTAAGRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCSTQ  737
             D++AGRVPGYGL+TNIINGG+ECG     + E +RIGFY+RYC I  V  G+NLDC+ Q
Sbjct  200  ADSSAGRVPGYGLITNIINGGIECGKGSNQNME-NRIGFYRRYCQILGVDAGNNLDCAKQ  258

Query  738  TPY  746
             P+
Sbjct  259  RPF  261



>gb|AAA32640.1| chitinase, partial [Allium sativum]
Length=302

 Score =   334 bits (856),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 159/242 (66%), Positives = 188/242 (78%), Gaps = 2/242 (1%)
 Frame = +3

Query  24   VSSIISQAIFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAFL  203
            V+SIIS ++F+ ML +R+D+ C A  FYT DAFIAAA SF  F TTGD DT+KRE+AAF 
Sbjct  62   VASIISSSLFNQMLLHRNDAACPANGFYTIDAFIAAANSFSGFGTTGDTDTQKRELAAFF  121

Query  204  GQTSHETTGGWDAAPDGRYAWGYCFLREGTDDP-YCNVTQEWSCAPGQKYFGRGPIQISY  380
             QTSHETTGG+ +APDG YAWGYCF +E  + P YC  + ++ CAPG+KY+GRGPIQISY
Sbjct  122  AQTSHETTGGYASAPDGPYAWGYCFKQEQGNPPDYCQASAQYPCAPGKKYYGRGPIQISY  181

Query  381  NYNYGAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPSPP  560
            NYNYG  G A+  DL++NPDLVA+DP +SFKTA WFWMT Q  KPSCH V TG+W PS  
Sbjct  182  NYNYGQCGNAINQDLLNNPDLVASDPAISFKTAIWFWMTAQSPKPSCHAVATGQWQPSAA  241

Query  561  DTAAGRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCSTQT  740
            D AAGRVPG+G++TNIINGGVECG  G     ADRIGFYKRYCD+F VGYGDNLDC  Q 
Sbjct  242  DQAAGRVPGFGVITNIINGGVECG-HGSDPSVADRIGFYKRYCDLFQVGYGDNLDCGNQA  300

Query  741  PY  746
             +
Sbjct  301  HF  302



>emb|CAA47921.1| chitinase [Solanum tuberosum]
Length=264

 Score =   332 bits (852),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 154/243 (63%), Positives = 191/243 (79%), Gaps = 2/243 (1%)
 Frame = +3

Query  21   DVSSIISQAIFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAF  200
            DV S+I++ +F+ +  +R+D+ C A  FYTY+AFI A KSF  F TTGD +TRK+E+AAF
Sbjct  21   DVGSLINKNLFERIFLHRNDAACAAKGFYTYEAFITATKSFAAFGTTGDTNTRKKEIAAF  80

Query  201  LGQTSHETTGGWDAAPDGRYAWGYCFLRE-GTDDPYCNVTQEWSCAPGQKYFGRGPIQIS  377
            L QTSHETTGGW  APDG Y+WGYCF +E G+   YC  +Q+W CAPG+KYFGRGPIQIS
Sbjct  81   LAQTSHETTGGWATAPDGPYSWGYCFKQEQGSPGDYCVASQQWPCAPGKKYFGRGPIQIS  140

Query  378  YNYNYGAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPSP  557
            YNYNYG AG+A+G +L++NPDLVA D  VSFKTA WFWMTPQ  KPS HDVITG+WSPS 
Sbjct  141  YNYNYGPAGRAIGVNLLNNPDLVANDAVVSFKTALWFWMTPQQPKPSAHDVITGRWSPSA  200

Query  558  PDTAAGRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCSTQ  737
             D+AAGRVPG+G++TNIINGG+EC   G + +  +RIGFY+RYC I  V  G+NLDC+ Q
Sbjct  201  ADSAAGRVPGFGVITNIINGGIECS-KGSNAQMDNRIGFYRRYCQILGVDPGNNLDCANQ  259

Query  738  TPY  746
             P+
Sbjct  260  RPF  262



>gb|AAG53609.1| 31.7 kDa class I endochitinase-antifreeze protein precursor [Secale 
cereale]
Length=318

 Score =   334 bits (857),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 170/243 (70%), Positives = 194/243 (80%), Gaps = 2/243 (1%)
 Frame = +3

Query  24   VSSIISQAIFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAFL  203
            VSSIISQ++FD ML +R+D+ C A  FY Y AFIAAA SF  FATTG  D RKREVAAFL
Sbjct  77   VSSIISQSLFDQMLLHRNDAACLAKGFYNYGAFIAAANSFSAFATTGGTDVRKREVAAFL  136

Query  204  GQTSHETTGGWDAAPDGRYAWGYCFLRE-GTDDPYCNVTQEWSCAPGQKYFGRGPIQISY  380
             QTSHETTGGW  APDG Y+WGYCF +E G    YC+ + +W CAPG+KYFGRGPIQISY
Sbjct  137  AQTSHETTGGWPTAPDGPYSWGYCFNQERGAPSDYCSPSSQWPCAPGKKYFGRGPIQISY  196

Query  381  NYNYGAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPSPP  560
            NYNYG AG+A+G DL++NPDLVATD TVSFKTA WFWMTPQ  KPS HDVITG+WSPS  
Sbjct  197  NYNYGPAGRAIGTDLLNNPDLVATDATVSFKTALWFWMTPQSPKPSSHDVITGRWSPSGA  256

Query  561  DTAAGRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCSTQT  740
            D AAGRVPGYG++TNIINGG+ECG  G+  + ADRIGFYKRYCD+  V YG NLDC  Q 
Sbjct  257  DQAAGRVPGYGVITNIINGGLECG-RGQDARVADRIGFYKRYCDLLGVSYGHNLDCYNQR  315

Query  741  PYS  749
            P++
Sbjct  316  PFA  318



>ref|XP_006828989.1| hypothetical protein AMTR_s00001p00243300 [Amborella trichopoda]
 gb|ERM96405.1| hypothetical protein AMTR_s00001p00243300 [Amborella trichopoda]
Length=330

 Score =   335 bits (858),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 158/242 (65%), Positives = 190/242 (79%), Gaps = 1/242 (0%)
 Frame = +3

Query  24   VSSIISQAIFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAFL  203
            V+S+ISQ++FD M K+R+++ C     YTY+AFI AAKSF  F TTGD  T+K+E+AAFL
Sbjct  73   VASLISQSLFDQMFKHRNENSCEGRDIYTYNAFITAAKSFPAFGTTGDTTTQKKEIAAFL  132

Query  204  GQTSHETTGGWDAAPDGRYAWGYCFLREGTDDPYCNVTQEWSCAPGQKYFGRGPIQISYN  383
             QTS ETTGGW  APDG YAWGYCF+ E   D YC  + +W CA G+KY+GRGPIQIS+N
Sbjct  133  AQTSKETTGGWADAPDGPYAWGYCFVNEKRRDDYCQASAQWPCAGGKKYYGRGPIQISWN  192

Query  384  YNYGAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPSPPD  563
            YNYG AG+A+G+D I+NPD VATD  +SFKTAFWFWMTPQ  KPS HDVITG W+PS  D
Sbjct  193  YNYGQAGRAIGFDGINNPDAVATDAVISFKTAFWFWMTPQSPKPSAHDVITGGWTPSAAD  252

Query  564  TAAGRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCSTQTP  743
             +AGRVPGYG++TNIINGG+ECG  G  D+ ADRIGFYKRYCD+  V YGDNLDC  Q P
Sbjct  253  RSAGRVPGYGVITNIINGGLECG-HGSDDRVADRIGFYKRYCDLMGVPYGDNLDCYNQRP  311

Query  744  YS  749
            ++
Sbjct  312  FN  313



>gb|AAF04453.1|AF000964_1 chitinase [Poa pratensis]
Length=340

 Score =   335 bits (858),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 158/243 (65%), Positives = 190/243 (78%), Gaps = 2/243 (1%)
 Frame = +3

Query  24   VSSIISQAIFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAFL  203
            VSS++SQ++F+ ML +R+D  C A  FYTY AFIAAA SF  F TTG  D RKREVAAFL
Sbjct  78   VSSLVSQSLFEQMLLHRNDPSCQANGFYTYKAFIAAANSFAGFGTTGSTDVRKREVAAFL  137

Query  204  GQTSHETTGGWDAAPDGRYAWGYCFLRE-GTDDPYCNVTQEWSCAPGQKYFGRGPIQISY  380
             QTSHETTGGW  APDG Y+WGYC+ +E G    YC+ + +W CAPG+KYFGRGPIQIS+
Sbjct  138  AQTSHETTGGWPTAPDGPYSWGYCYKQEQGATSDYCSPSSQWPCAPGKKYFGRGPIQISF  197

Query  381  NYNYGAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPSPP  560
            NYNYG AG+A+  DL++NPDLVA++ TVSF+TA WFWMT Q  KPS H VITG+WSPS  
Sbjct  198  NYNYGPAGQAIQTDLLNNPDLVASNATVSFRTALWFWMTAQSPKPSSHAVITGQWSPSSA  257

Query  561  DTAAGRVPGYGLVTNIINGGVECGPAGEHDKE-ADRIGFYKRYCDIFSVGYGDNLDCSTQ  737
            D AAGRVPGYG++TNIINGG+ECG   ++    ADRIGFYKRYCD+  V YGDNLDC  +
Sbjct  258  DQAAGRVPGYGVITNIINGGLECGKGQDNRVAVADRIGFYKRYCDLLGVSYGDNLDCYNE  317

Query  738  TPY  746
            +P+
Sbjct  318  SPF  320



>sp|P51613.1|CHIB_VITVI RecName: Full=Basic endochitinase; Flags: Precursor [Vitis vinifera]
 emb|CAA90970.1| chitinase [Vitis vinifera]
 emb|CAC14014.1| chitinase [Vitis vinifera]
 gb|ABB53242.1| chitinase class I [Vitis vinifera]
 emb|CAN76701.1| hypothetical protein VITISV_016509 [Vitis vinifera]
Length=314

 Score =   334 bits (856),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 165/252 (65%), Positives = 200/252 (79%), Gaps = 2/252 (1%)
 Frame = +3

Query  21   DVSSIISQAIFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAF  200
            D+  +I++++F+DMLK+R++  C    FYTYDAFIAAAK+F  F TTGD  TRKRE+AAF
Sbjct  64   DIGQLITRSMFNDMLKHRNEGSCPGKGFYTYDAFIAAAKAFPGFGTTGDTTTRKREIAAF  123

Query  201  LGQTSHETTGGWDAAPDGRYAWGYCFLRE-GTDDPYCNVTQEWSCAPGQKYFGRGPIQIS  377
            L QTSHETTGGW +APDG YAWGYC+LRE G+   YC  + +W CA G+KY+GRGPIQIS
Sbjct  124  LAQTSHETTGGWASAPDGPYAWGYCYLREQGSPGAYCVPSAQWPCAAGRKYYGRGPIQIS  183

Query  378  YNYNYGAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPSP  557
            YNYNYG AGKA+G DL++NPDLVATD  +SFKTAFWFWMTPQ  KPSCH+VITG W+PS 
Sbjct  184  YNYNYGQAGKAIGVDLVNNPDLVATDAVISFKTAFWFWMTPQSPKPSCHNVITGGWTPSG  243

Query  558  PDTAAGRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCSTQ  737
             D +AGR+PG+G++TNIINGGVECG  G   +  DRIGFYKRYCDI  V YG+NLDC+ Q
Sbjct  244  ADRSAGRLPGFGVITNIINGGVECG-KGVVPQVQDRIGFYKRYCDILRVSYGNNLDCNNQ  302

Query  738  TPYSP*ELLVTL  773
             P+    LL T+
Sbjct  303  RPFGSGLLLDTI  314



>ref|XP_011045258.1| PREDICTED: basic endochitinase-like [Populus euphratica]
Length=318

 Score =   334 bits (856),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 158/240 (66%), Positives = 188/240 (78%), Gaps = 1/240 (0%)
 Frame = +3

Query  30   SIISQAIFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAFLGQ  209
            SIIS A FD+MLK+R+D  C    FYTY+AFI+AA +F  F TTGD  TRKRE+AAFLGQ
Sbjct  70   SIISSAKFDEMLKHRNDGGCPGKGFYTYNAFISAANAFPGFGTTGDAGTRKREIAAFLGQ  129

Query  210  TSHETTGGWDAAPDGRYAWGYCFLREGTDDPYCNVTQEWSCAPGQKYFGRGPIQISYNYN  389
            TSHETTGGW  APDG YAWGYCF++E     YC+ +  + CA G++Y+GRGP+Q+S+NYN
Sbjct  130  TSHETTGGWQTAPDGPYAWGYCFVKEQNPGSYCSPSSTYPCAGGKQYYGRGPVQLSWNYN  189

Query  390  YGAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPSPPDTA  569
            YG  GKA+G DL++NPDLVATDP +SFKTA WFWMT Q  KPSCH VITG WSPS  DTA
Sbjct  190  YGQCGKAIGVDLLNNPDLVATDPVISFKTAIWFWMTAQSPKPSCHSVITGNWSPSGADTA  249

Query  570  AGRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCSTQTPYS  749
            AGRVPGYG++TNIINGG+ECG   +   E DRIGFYKRYCD+  VGYG+NLDC  Q  ++
Sbjct  250  AGRVPGYGVLTNIINGGLECGMGWKQQVE-DRIGFYKRYCDLLGVGYGNNLDCYNQRSFA  308



>ref|XP_009606804.1| PREDICTED: basic endochitinase [Nicotiana tomentosiformis]
 dbj|BAA33971.1| chitinase 134 [Nicotiana tabacum]
Length=265

 Score =   332 bits (850),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 152/243 (63%), Positives = 189/243 (78%), Gaps = 2/243 (1%)
 Frame = +3

Query  21   DVSSIISQAIFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAF  200
            DV +++S+ +F+ +L +R+D+ C A  FYTY+AF+ A +SFG F TTGD +TRK+E+AAF
Sbjct  22   DVGALVSKNLFERILLHRNDANCPAKGFYTYEAFVTATRSFGAFGTTGDTNTRKKEIAAF  81

Query  201  LGQTSHETTGGWDAAPDGRYAWGYCFLREGTDDP-YCNVTQEWSCAPGQKYFGRGPIQIS  377
            L QTSHETTGGW  APDG Y+WGYCF +E    P YC   Q+W CAPG+ YFGRGPIQIS
Sbjct  82   LAQTSHETTGGWATAPDGPYSWGYCFKQEQGSPPNYCVANQQWPCAPGKTYFGRGPIQIS  141

Query  378  YNYNYGAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPSP  557
            YNYNYG AG+A+G DL++NPDLVA DP VSFKTA WFWMTPQ  KPS HDVITG+W+PS 
Sbjct  142  YNYNYGPAGRAIGSDLLNNPDLVANDPVVSFKTALWFWMTPQQPKPSAHDVITGRWTPSA  201

Query  558  PDTAAGRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCSTQ  737
             D+AA RVPG+G++TNIINGG+EC   G + +   RIGFY+RYC I  V  G+NLDC+ Q
Sbjct  202  ADSAARRVPGFGVITNIINGGIECN-KGSNAQMQSRIGFYRRYCQILGVDPGNNLDCANQ  260

Query  738  TPY  746
             P+
Sbjct  261  KPF  263



>ref|XP_002312923.2| Chain A family protein [Populus trichocarpa]
 gb|EEE86878.2| Chain A family protein [Populus trichocarpa]
Length=318

 Score =   333 bits (855),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 156/240 (65%), Positives = 187/240 (78%), Gaps = 1/240 (0%)
 Frame = +3

Query  30   SIISQAIFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAFLGQ  209
            SIIS   FD+MLK+R+D  C    FYTY AFI+AA +F  F TTGD DTRKRE+AAFLGQ
Sbjct  70   SIISSEKFDEMLKHRNDGGCPGKGFYTYSAFISAANAFPGFGTTGDADTRKREIAAFLGQ  129

Query  210  TSHETTGGWDAAPDGRYAWGYCFLREGTDDPYCNVTQEWSCAPGQKYFGRGPIQISYNYN  389
            TSHETTGGW  APDG YAWGYCF++E     YC+ +  + CA G++Y+GRGP+Q+S+NYN
Sbjct  130  TSHETTGGWQTAPDGPYAWGYCFVKEQNPGSYCSPSSTYPCADGKQYYGRGPVQLSWNYN  189

Query  390  YGAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPSPPDTA  569
            YG  GKA+G DL++NPDLVATDP +SFKTA WFWMT Q  KPSCH VITG WSPS  D+A
Sbjct  190  YGQCGKAIGVDLLNNPDLVATDPVISFKTAIWFWMTAQSPKPSCHSVITGNWSPSGADSA  249

Query  570  AGRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCSTQTPYS  749
            AGRVPGYG++TNIINGG+ECG  G   +  DRIGFY+RYCD+  VGYG+NLDC  Q  ++
Sbjct  250  AGRVPGYGVLTNIINGGLECG-MGRKQQVEDRIGFYQRYCDLLGVGYGNNLDCYNQKSFA  308



>ref|XP_004249000.1| PREDICTED: endochitinase [Solanum lycopersicum]
Length=322

 Score =   333 bits (855),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 153/244 (63%), Positives = 192/244 (79%), Gaps = 3/244 (1%)
 Frame = +3

Query  21   DVSSIISQAIFDDMLKYRDDSRCHAPW-FYTYDAFIAAAKSFGEFATTGDLDTRKREVAA  197
            D+ S+IS ++FD MLK+R+++ C     FY+Y+AFI AA+SF  F T+GD++ RKRE+AA
Sbjct  78   DLGSVISNSMFDQMLKHRNENSCQGKNNFYSYNAFITAARSFPGFGTSGDINARKREIAA  137

Query  198  FLGQTSHETTGGWDAAPDGRYAWGYCFLRE-GTDDPYCNVTQEWSCAPGQKYFGRGPIQI  374
            F  QTSHETTGGW +APDG +AWGYCFLRE G    YC+ + +W CAPG+KYFGRGPIQI
Sbjct  138  FFAQTSHETTGGWPSAPDGPFAWGYCFLRERGNPGDYCSPSSQWPCAPGRKYFGRGPIQI  197

Query  375  SYNYNYGAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPS  554
            S+NYNYG  G+A+G DL++NPDLVATDP +SFKTA WFWMTPQ  KPSCHDVI G+W+PS
Sbjct  198  SHNYNYGPCGRAIGVDLLNNPDLVATDPVISFKTAIWFWMTPQSPKPSCHDVIIGRWNPS  257

Query  555  PPDTAAGRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCST  734
              D +A R+PG+G++TNIINGG+ECG  G  ++  DRIGFY+RYC I  V  GDNLDC  
Sbjct  258  AGDRSANRLPGFGVITNIINGGLECG-RGNDNRVQDRIGFYRRYCGILGVSTGDNLDCGN  316

Query  735  QTPY  746
            Q P+
Sbjct  317  QRPF  320



>gb|KGN48980.1| hypothetical protein Csa_6G508020 [Cucumis sativus]
Length=360

 Score =   335 bits (858),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 154/238 (65%), Positives = 187/238 (79%), Gaps = 1/238 (0%)
 Frame = +3

Query  33   IISQAIFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAFLGQT  212
            II++++++ MLKY  DSRC +  FYTY+AFI AA+SF +F TTGD  TRKRE+AAF GQT
Sbjct  124  IITESLYNQMLKYSTDSRCPSNGFYTYNAFITAAQSFPDFGTTGDDATRKRELAAFFGQT  183

Query  213  SHETTGGWDAAPDGRYAWGYCFLREGTDDPYCNVTQEWSCAPGQKYFGRGPIQISYNYNY  392
            SHETTGGW +APDG YAWGYCF+RE   D YC  + +W C  GQKY+GRGP+Q+++NYNY
Sbjct  184  SHETTGGWASAPDGPYAWGYCFIREINQDVYCTPSDQWPCVAGQKYYGRGPMQLTHNYNY  243

Query  393  GAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPSPPDTAA  572
            G AG AL  +L+SNPDLVAT+  +SFK A WFWMTPQG KPSCH+VITG W PS  D AA
Sbjct  244  GPAGNALSLNLLSNPDLVATNAIISFKAAIWFWMTPQGNKPSCHNVITGNWQPSSIDRAA  303

Query  573  GRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCSTQTPY  746
            GRVPGYG++TNIINGG+ECG  G   +  DRIGFYKRYCD+  +GYG NLDC+ Q  +
Sbjct  304  GRVPGYGVITNIINGGLECG-HGPDSRVEDRIGFYKRYCDMLGIGYGSNLDCNNQQSF  360



>sp|P05315.1|CHIT_SOLTU RecName: Full=Endochitinase; Flags: Precursor [Solanum tuberosum]
 emb|CAA30142.1| endochitinase [Solanum tuberosum]
 emb|CAA33517.1| pre-chitinase (AA -26 to 302) [Solanum tuberosum]
Length=328

 Score =   333 bits (855),  Expect = 9e-110, Method: Compositional matrix adjust.
 Identities = 157/252 (62%), Positives = 193/252 (77%), Gaps = 2/252 (1%)
 Frame = +3

Query  21   DVSSIISQAIFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAF  200
            D+ S IS ++FD MLK+R+++ C    FY+Y+AFI AA+SF  F T+GD++ RKRE+AAF
Sbjct  78   DLGSAISNSMFDQMLKHRNENSCQGKNFYSYNAFINAARSFPGFGTSGDINARKREIAAF  137

Query  201  LGQTSHETTGGWDAAPDGRYAWGYCFLRE-GTDDPYCNVTQEWSCAPGQKYFGRGPIQIS  377
              QTSHETTGGW +APDG YAWGYCFLRE G    YC  + +W CAPG+KYFGRGPIQIS
Sbjct  138  FAQTSHETTGGWASAPDGPYAWGYCFLRERGNPGDYCPPSSQWPCAPGRKYFGRGPIQIS  197

Query  378  YNYNYGAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPSP  557
            +NYNYG  G+A+G DL++NPDLVATDP +SFKTA WFWMTPQ  KPSCHDVI G+W+PS 
Sbjct  198  HNYNYGPCGRAIGVDLLNNPDLVATDPVISFKTALWFWMTPQSPKPSCHDVIIGRWNPSS  257

Query  558  PDTAAGRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCSTQ  737
             D AA R+PG+G++TNIINGG+ECG  G  ++  DRIGFY+RYC I  V  GDNLDC  Q
Sbjct  258  ADRAANRLPGFGVITNIINGGLECG-RGTDNRVQDRIGFYRRYCSILGVTPGDNLDCVNQ  316

Query  738  TPYSP*ELLVTL  773
              +    L+ TL
Sbjct  317  RWFGNALLVDTL  328



>ref|NP_001267891.1| basic endochitinase precursor [Vitis vinifera]
 gb|ABD64684.1| chitinase class I basic [Vitis vinifera]
Length=314

 Score =   332 bits (851),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 164/252 (65%), Positives = 199/252 (79%), Gaps = 2/252 (1%)
 Frame = +3

Query  21   DVSSIISQAIFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAF  200
            D+  +I++++F+DMLK+R++  C    FYTYDAFIAAAK+F  F TTGD  TRKRE+AAF
Sbjct  64   DIGQLITRSMFNDMLKHRNEGSCPGKGFYTYDAFIAAAKAFPGFGTTGDTTTRKREIAAF  123

Query  201  LGQTSHETTGGWDAAPDGRYAWGYCFLRE-GTDDPYCNVTQEWSCAPGQKYFGRGPIQIS  377
            L QTSHETTGGW +APDG YAWGYC+LRE G+   YC  + +W CA G+KY+GRGPIQIS
Sbjct  124  LAQTSHETTGGWASAPDGPYAWGYCYLREQGSPGAYCVPSAQWPCAAGRKYYGRGPIQIS  183

Query  378  YNYNYGAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPSP  557
            YNYNYG AGKA+G DL++NPDLVATD  +SFKTAFWFWMTPQ  KPSCH+VITG W+PS 
Sbjct  184  YNYNYGQAGKAIGVDLVNNPDLVATDAVISFKTAFWFWMTPQSPKPSCHNVITGGWTPSG  243

Query  558  PDTAAGRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCSTQ  737
             D +A R+PG+G++TNIINGGVECG  G   +  DRIGFYKRYCDI  V YG+NLDC+ Q
Sbjct  244  ADRSAERLPGFGVITNIINGGVECG-KGVVPQVQDRIGFYKRYCDILRVSYGNNLDCNKQ  302

Query  738  TPYSP*ELLVTL  773
             P+    LL T+
Sbjct  303  KPFGSGLLLDTI  314



>emb|CAC81812.1| putative chitinase [Musa acuminata]
Length=317

 Score =   332 bits (852),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 157/235 (67%), Positives = 187/235 (80%), Gaps = 2/235 (1%)
 Frame = +3

Query  48   IFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAFLGQTSHETT  227
            +F+ MLK+R+D+ C    FYTY+AFIAAA SF  F TTGD  T+KRE+AAFL QTSHETT
Sbjct  84   LFEQMLKHRNDAACPGKGFYTYNAFIAAANSFSGFGTTGDDATKKREIAAFLAQTSHETT  143

Query  228  GGWDAAPDGRYAWGYCFLREGTD-DPYCNVTQEWSCAPGQKYFGRGPIQISYNYNYGAAG  404
            GGW  APDG YAWGYCF++E      YC  + +W CA G+KY+GRGPIQIS+NYNYG AG
Sbjct  144  GGWATAPDGPYAWGYCFVQEQNPPSDYCVASSQWPCAAGKKYYGRGPIQISFNYNYGPAG  203

Query  405  KALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPSPPDTAAGRVP  584
            +A+G DL++NPDLVATD T+SFKTA WFWMTPQ  KPSCHDVITG+W+PS  D AAGR+P
Sbjct  204  RAIGSDLLNNPDLVATDATISFKTALWFWMTPQSPKPSCHDVITGRWTPSNADRAAGRLP  263

Query  585  GYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCSTQTPYS  749
            GYG+ TNIINGG+ECG  G   + ADRIGFYKRYCD+  V YGDNLDC  Q+P++
Sbjct  264  GYGVTTNIINGGLECG-KGSDARVADRIGFYKRYCDLLGVSYGDNLDCYNQSPFT  317



>gb|AAX83262.1| class II chitinase [Triticum aestivum]
 gb|EMS47713.1| Basic endochitinase C [Triticum urartu]
Length=266

 Score =   330 bits (846),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 164/243 (67%), Positives = 193/243 (79%), Gaps = 2/243 (1%)
 Frame = +3

Query  24   VSSIISQAIFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAFL  203
            VSS++S+A FD ML +R+D  C A  FYTYDAF+AAA +F  F TTG  D +KREVAAFL
Sbjct  25   VSSVVSRAQFDRMLLHRNDGACQAKGFYTYDAFVAAAAAFPGFGTTGSADAQKREVAAFL  84

Query  204  GQTSHETTGGWDAAPDGRYAWGYCFLRE-GTDDPYCNVTQEWSCAPGQKYFGRGPIQISY  380
             QTSHETTGGW  APDG +AWGYCF +E G    YC  + +W CAPG++Y+GRGPIQ+S+
Sbjct  85   AQTSHETTGGWATAPDGAFAWGYCFKQERGAASDYCTPSAQWPCAPGKRYYGRGPIQLSH  144

Query  381  NYNYGAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPSPP  560
            NYNYG AG+A+G DL+SNPDLVATDPTVSFKTA WFWMT Q  KPS H VITG+WSPS  
Sbjct  145  NYNYGPAGRAIGVDLLSNPDLVATDPTVSFKTAMWFWMTAQAPKPSSHAVITGQWSPSGA  204

Query  561  DTAAGRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCSTQT  740
            D AAGRVPG+G++TNIINGG+ECG  G+  + ADRIGFYKRYCDI  VGYGDNLDC  Q 
Sbjct  205  DRAAGRVPGFGVITNIINGGIECG-HGQDSRVADRIGFYKRYCDILGVGYGDNLDCYNQR  263

Query  741  PYS  749
            P++
Sbjct  264  PFA  266



>emb|CAB97002.1| putative class I chitinase [Phaseolus vulgaris]
Length=349

 Score =   333 bits (854),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 152/242 (63%), Positives = 193/242 (80%), Gaps = 1/242 (0%)
 Frame = +3

Query  21   DVSSIISQAIFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAF  200
            D+S++I ++ F+ MLK+R+++ C A  FYTYDAFIAAAKS+  F  TGD  TRKRE+AAF
Sbjct  96   DLSALIPESTFEQMLKHRNNAACPARGFYTYDAFIAAAKSYPSFGNTGDTATRKREIAAF  155

Query  201  LGQTSHETTGGWDAAPDGRYAWGYCFLREGTDDPYCNVTQEWSCAPGQKYFGRGPIQISY  380
            LGQTSHETTGGW  APDG +AWGYCF+RE     YC+ T ++ CAPGQ+Y+GRGPIQ+S+
Sbjct  156  LGQTSHETTGGWATAPDGPFAWGYCFVREVNPGTYCSATPQFPCAPGQQYYGRGPIQLSW  215

Query  381  NYNYGAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPSPP  560
            NYNY   G+A+G DL++NPDLVATD  +SFK+A WFWMT Q  KPS HDVIT +W+PS  
Sbjct  216  NYNYAQCGRAIGVDLLNNPDLVATDSVISFKSALWFWMTAQSPKPSSHDVITSRWTPSSA  275

Query  561  DTAAGRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCSTQT  740
            D AA R+PGYG VTNIINGG+ECG  G+  +  +RIGF+KRYCD+  +GYG+NLDC++QT
Sbjct  276  DVAARRLPGYGTVTNIINGGLECG-RGQDSRVQNRIGFFKRYCDMLGIGYGNNLDCNSQT  334

Query  741  PY  746
            P+
Sbjct  335  PF  336



>ref|XP_003629192.1| Endochitinase [Medicago truncatula]
 gb|AET03668.1| Chitinase (Class Ib) / Hevein [Medicago truncatula]
Length=320

 Score =   332 bits (851),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 157/244 (64%), Positives = 193/244 (79%), Gaps = 3/244 (1%)
 Frame = +3

Query  21   DVSSIISQAIFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAF  200
            DV S+IS ++FD+MLKYR+D RC A  FY+YD+FI AA+SF  F TTGD +TRKREVAAF
Sbjct  79   DVGSLISSSMFDEMLKYRNDPRCAARGFYSYDSFITAARSFNGFGTTGDENTRKREVAAF  138

Query  201  LGQTSHETTGGWDAAPDGRYAWGYCFLRE-GTDDPYCNVTQEWSCAPGQKYFGRGPIQIS  377
            LGQTSHETTGGW  APDG YAWGYCF+ E      YC+    W CAPG++Y+GRGPIQ++
Sbjct  139  LGQTSHETTGGWPTAPDGPYAWGYCFVNERNPPSDYCS-PGTWPCAPGKRYYGRGPIQLT  197

Query  378  YNYNYGAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPSP  557
            +NYNYG AG+A+  DLI+NPDLV+++P+VSF+TA WFWMTPQG KPS HDVITG+W+PS 
Sbjct  198  HNYNYGPAGRAINQDLINNPDLVSSNPSVSFRTALWFWMTPQGNKPSSHDVITGRWTPSD  257

Query  558  PDTAAGRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCSTQ  737
             D +A RVPGYG++TNIINGG+ECG  G+  +  DRIGFYKRYC +     GDNLDC  Q
Sbjct  258  ADRSARRVPGYGVITNIINGGLECG-RGQDPRVEDRIGFYKRYCQLLRTTTGDNLDCYNQ  316

Query  738  TPYS  749
             P++
Sbjct  317  RPFA  320



>gb|AFK47528.1| unknown [Medicago truncatula]
 gb|AET03667.2| Chitinase (Class Ib) / Hevein [Medicago truncatula]
Length=320

 Score =   332 bits (851),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 157/243 (65%), Positives = 190/243 (78%), Gaps = 1/243 (0%)
 Frame = +3

Query  21   DVSSIISQAIFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAF  200
            DV SII  ++FD MLKYR+D RC    FYTYD FIAAA+SF  F TTGD  TRK+E+AAF
Sbjct  79   DVGSIIPSSLFDQMLKYRNDQRCAGHGFYTYDGFIAAARSFNGFGTTGDDATRKKELAAF  138

Query  201  LGQTSHETTGGWDAAPDGRYAWGYCFLREGTDDPYCNVTQEWSCAPGQKYFGRGPIQISY  380
            L QTSHETTGGW +APDG YAWGYCF+ E           +W CAPG++Y+GRGPIQ+++
Sbjct  139  LAQTSHETTGGWPSAPDGPYAWGYCFVTEKDAQGDFCSPGDWPCAPGKRYYGRGPIQLTH  198

Query  381  NYNYGAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPSPP  560
            NYNYG AGKA+  DLI+NPDLV+T+PTVSFKTA WFWMTPQ  KPS HDVITG+W+PS  
Sbjct  199  NYNYGQAGKAINEDLINNPDLVSTNPTVSFKTAIWFWMTPQANKPSSHDVITGRWTPSAA  258

Query  561  DTAAGRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCSTQT  740
            D++AGRVPGYG++TNIINGG+ECG  G+  K  DR+GFY+RYC I  V  G+NLDC+ Q 
Sbjct  259  DSSAGRVPGYGVITNIINGGLECG-HGQDPKVEDRVGFYRRYCQILGVNPGNNLDCNNQR  317

Query  741  PYS  749
            P++
Sbjct  318  PFA  320



>ref|XP_004248637.1| PREDICTED: endochitinase 4 [Solanum lycopersicum]
Length=329

 Score =   332 bits (851),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 158/253 (62%), Positives = 193/253 (76%), Gaps = 3/253 (1%)
 Frame = +3

Query  21   DVSSIISQAIFDDMLKYRDDSRCHAPW-FYTYDAFIAAAKSFGEFATTGDLDTRKREVAA  197
            D+SS+IS ++FD MLK+R+++ C     FY+Y+AFI AA+SF  F TTGD   RKRE+AA
Sbjct  78   DISSVISNSMFDQMLKHRNENSCQGKNNFYSYNAFINAARSFRGFGTTGDNTARKREIAA  137

Query  198  FLGQTSHETTGGWDAAPDGRYAWGYCFLRE-GTDDPYCNVTQEWSCAPGQKYFGRGPIQI  374
            F  QTSHETTGGW +APDG YAWGYCFLRE G+   YC  + +W CAPG+KYFGRGPIQI
Sbjct  138  FFAQTSHETTGGWPSAPDGPYAWGYCFLREQGSPGDYCTPSSQWPCAPGRKYFGRGPIQI  197

Query  375  SYNYNYGAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPS  554
            S+NYNYG  G+A+G DL++NPDLVATDP +SFK+A WFWMTPQ  KPSCHDVITG+W PS
Sbjct  198  SHNYNYGPCGRAIGADLLNNPDLVATDPVISFKSAIWFWMTPQSPKPSCHDVITGRWQPS  257

Query  555  PPDTAAGRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCST  734
              D AA R+PG+G++TNIINGG+ECG  G   +  DRIGFY+RYC I  V  GDNLDC  
Sbjct  258  GADRAANRLPGFGVITNIINGGLECG-RGSDSRVQDRIGFYRRYCGILGVSPGDNLDCGN  316

Query  735  QTPYSP*ELLVTL  773
            Q  +    L+ T+
Sbjct  317  QRSFGNGLLVDTM  329



>ref|XP_004248635.1| PREDICTED: endochitinase 3-like [Solanum lycopersicum]
Length=330

 Score =   332 bits (852),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 156/253 (62%), Positives = 195/253 (77%), Gaps = 3/253 (1%)
 Frame = +3

Query  21   DVSSIISQAIFDDMLKYRDDSRCHAPW-FYTYDAFIAAAKSFGEFATTGDLDTRKREVAA  197
            D+S +IS ++FD ML +R+D+ C     FY+Y+AFI+AAKSF  F T+GD   RKRE+AA
Sbjct  79   DLSGVISNSMFDQMLNHRNDNTCQGKNNFYSYNAFISAAKSFPGFGTSGDTTARKREIAA  138

Query  198  FLGQTSHETTGGWDAAPDGRYAWGYCFLRE-GTDDPYCNVTQEWSCAPGQKYFGRGPIQI  374
            F  QTSHETTGGW  APDG YAWGYCFLRE G+   YC  + +W CAPG+KYFGRGPIQI
Sbjct  139  FFAQTSHETTGGWPTAPDGPYAWGYCFLREQGSPGDYCTPSSQWPCAPGRKYFGRGPIQI  198

Query  375  SYNYNYGAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPS  554
            S+NYNYG  G+A+G DL++NPDLVATDP++SFK+A WFWMTPQ  KPSCHDVITG+W PS
Sbjct  199  SHNYNYGPCGRAIGVDLLNNPDLVATDPSISFKSAIWFWMTPQSPKPSCHDVITGRWQPS  258

Query  555  PPDTAAGRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCST  734
              D AA R+PG+G++TNIINGG+ECG  G  ++  DRIGFY+RYC+I  V  G+NLDC +
Sbjct  259  NVDQAANRLPGFGVITNIINGGLECG-HGNDNRVQDRIGFYRRYCEILGVSPGNNLDCGS  317

Query  735  QTPYSP*ELLVTL  773
            Q  +    L+ T+
Sbjct  318  QRSFGNGLLVDTM  330



>pdb|4MST|A Chain A, Crystal Structure Of A Putative Catalytic Domain Of 
A Chitinase-like Protein (hbclp1) From Hevea Brasiliensis
 pdb|4MST|B Chain B, Crystal Structure Of A Putative Catalytic Domain Of 
A Chitinase-like Protein (hbclp1) From Hevea Brasiliensis
Length=242

 Score =   329 bits (843),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 158/240 (66%), Positives = 191/240 (80%), Gaps = 2/240 (1%)
 Frame = +3

Query  30   SIISQAIFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAFLGQ  209
            SIIS++ F++MLK+R+D+ C A  FYTYDAFI+AAK+F  F TTGD+DT KRE+AAF GQ
Sbjct  1    SIISRSTFEEMLKHRNDAACPAKGFYTYDAFISAAKAFPAFGTTGDVDTCKREIAAFFGQ  60

Query  210  TSHETTGGWDAAPDGRYAWGYCFLRE-GTDDPYCNVTQEWSCAPGQKYFGRGPIQISYNY  386
            TSH TTGGW  APDG YAWGYC+  E      YC+ +  + CAPG+KY+GRGPIQ+S+NY
Sbjct  61   TSHATTGGWPTAPDGPYAWGYCYKEELNQASSYCSPSPAYPCAPGKKYYGRGPIQLSWNY  120

Query  387  NYGAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPSPPDT  566
            NYG  G+ALG DL++NPDLVATD  +SFK A WFWMTPQ  KPSCHDVITG+WSP+  D 
Sbjct  121  NYGQCGQALGLDLLNNPDLVATDRVISFKAAIWFWMTPQFPKPSCHDVITGQWSPTGHDI  180

Query  567  AAGRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCSTQTPY  746
            +AGR PGYG++TNIINGG+ECG  G   +  DRIGFYKRYCD+F+VGYG NLDC  QTP+
Sbjct  181  SAGRAPGYGVITNIINGGLECG-RGWDARVEDRIGFYKRYCDMFAVGYGSNLDCYNQTPF  239



>gb|AAA34070.1| endochitinase precursor (EC 3.2.1.14), partial [Nicotiana tabacum]
 prf||1302305A chitinase
Length=310

 Score =   331 bits (849),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 156/252 (62%), Positives = 190/252 (75%), Gaps = 2/252 (1%)
 Frame = +3

Query  21   DVSSIISQAIFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAF  200
            D+ SIIS ++FD MLK+R+D+ C    FY+Y+AFI AA+SF  F T+GD   RKRE+AAF
Sbjct  60   DLGSIISSSMFDQMLKHRNDNACQGKGFYSYNAFINAARSFPGFGTSGDTTARKREIAAF  119

Query  201  LGQTSHETTGGWDAAPDGRYAWGYCFLRE-GTDDPYCNVTQEWSCAPGQKYFGRGPIQIS  377
              QTSHETTGGW  APDG YAWGYC+LRE G+   YC  + +W CAPG+KYFGRGPIQIS
Sbjct  120  FAQTSHETTGGWATAPDGPYAWGYCWLREQGSPGDYCTPSGQWPCAPGRKYFGRGPIQIS  179

Query  378  YNYNYGAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPSP  557
            +NYNYG  G+A+G DL++NPDLVATDP +SFK+A WFWMTPQ  KPSCHDVI G+W PS 
Sbjct  180  HNYNYGPCGRAIGVDLLNNPDLVATDPVISFKSALWFWMTPQSPKPSCHDVIIGRWQPSS  239

Query  558  PDTAAGRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCSTQ  737
             D AA R+PG+G++TNIINGG+ECG  G   +  DRIGFY+RYC I  V  GDNLDC  Q
Sbjct  240  ADRAANRLPGFGVITNIINGGLECG-RGTDSRVQDRIGFYRRYCSILGVSPGDNLDCGNQ  298

Query  738  TPYSP*ELLVTL  773
              +    L+ T+
Sbjct  299  RSFGNGLLVDTM  310



>sp|P36907.1|CHIX_PEA RecName: Full=Endochitinase; Flags: Precursor [Pisum sativum]
 emb|CAA45359.1| chitinase [Pisum sativum]
Length=320

 Score =   332 bits (850),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 156/244 (64%), Positives = 196/244 (80%), Gaps = 3/244 (1%)
 Frame = +3

Query  21   DVSSIISQAIFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAF  200
            DV  ++  ++FD MLKYR+D RC    FYTYDAFIAAA+SF  F TTGD +T+K+E+AAF
Sbjct  79   DVGRLVPSSLFDQMLKYRNDGRCAGHGFYTYDAFIAAARSFNGFGTTGDDNTKKKELAAF  138

Query  201  LGQTSHETTGGWDAAPDGRYAWGYCFLRE-GTDDPYCNVTQEWSCAPGQKYFGRGPIQIS  377
            L QTSHETTGGW  APDG YAWGYCF+ E  T + YC+  ++W CAPG+KY+GRGPIQ++
Sbjct  139  LAQTSHETTGGWPTAPDGPYAWGYCFVSEQNTQEVYCS-PKDWPCAPGKKYYGRGPIQLT  197

Query  378  YNYNYGAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPSP  557
            +NYNYG AG+A+  DLI+NPDL++T+PTVSFKTA WFWMTPQ  KPS HDVITG+W+PS 
Sbjct  198  HNYNYGLAGQAIKEDLINNPDLLSTNPTVSFKTAIWFWMTPQANKPSSHDVITGRWTPSA  257

Query  558  PDTAAGRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCSTQ  737
             D++AGRVPGYG++TNIINGG+ECG  G+ ++  DR+GFYKRYC IF V  G NLDC+ Q
Sbjct  258  ADSSAGRVPGYGVITNIINGGIECG-HGQDNRVDDRVGFYKRYCQIFGVDPGGNLDCNNQ  316

Query  738  TPYS  749
              ++
Sbjct  317  RSFA  320



>ref|XP_009392870.1| PREDICTED: chitinase 1-like [Musa acuminata subsp. malaccensis]
Length=315

 Score =   331 bits (849),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 156/235 (66%), Positives = 186/235 (79%), Gaps = 2/235 (1%)
 Frame = +3

Query  48   IFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAFLGQTSHETT  227
            +F+ MLK+R+D+ C    FY Y+AFIAAA SF  F TTGD  T+KRE+AAFL QTSHETT
Sbjct  82   LFEQMLKHRNDAACPGKGFYMYNAFIAAANSFSGFGTTGDDATKKREIAAFLAQTSHETT  141

Query  228  GGWDAAPDGRYAWGYCFLREGTD-DPYCNVTQEWSCAPGQKYFGRGPIQISYNYNYGAAG  404
            GGW  APDG YAWGYCF++E      YC  + +W CA G+KY+GRGPIQIS+NYNYG AG
Sbjct  142  GGWATAPDGPYAWGYCFVQEQNPPSDYCVASSQWPCAAGKKYYGRGPIQISFNYNYGPAG  201

Query  405  KALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPSPPDTAAGRVP  584
            +A+G DL++NPDLVATD T+SFKTA WFWMTPQ  KPSCHDVITG W+PS  D AAGR+P
Sbjct  202  RAIGSDLLNNPDLVATDATISFKTALWFWMTPQSPKPSCHDVITGSWTPSNADRAAGRLP  261

Query  585  GYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCSTQTPYS  749
            GYG+ TNIINGG+ECG  G   + ADRIGFYKRYCD+  V YGDNLDC +Q+P++
Sbjct  262  GYGVTTNIINGGLECG-KGSDARVADRIGFYKRYCDLLGVSYGDNLDCYSQSPFT  315



>prf||1712313A basic chitinase
Length=336

 Score =   332 bits (851),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 161/250 (64%), Positives = 193/250 (77%), Gaps = 3/250 (1%)
 Frame = +3

Query  24   VSSIISQAIFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAFL  203
            V+SI+S+++FD ML +R+D+ C A  FYTYDAF+AAA +F  FA  GD DT KREVAAFL
Sbjct  78   VASIVSRSLFDLMLLHRNDAACPASNFYTYDAFVAAASAFPGFAAAGDADTNKREVAAFL  137

Query  204  GQTSHETTGGWDAAPDGRYAWGYCFLRE--GTDDPYCNVTQEWSCAPGQKYFGRGPIQIS  377
             QTSHETTGGW  APDG Y WGYCF  E  G    YC  + +W CA G+KY+GRGPIQ+S
Sbjct  138  AQTSHETTGGWATAPDGPYTWGYCFKEENGGAGPDYCQQSAQWPCAAGKKYYGRGPIQLS  197

Query  378  YNYNYGAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPSP  557
            YN+NYG AG+A+G DL+ +PDLVA+D TVSF TAFWFWMTPQ  KPSC+ V TG+W+PS 
Sbjct  198  YNFNYGPAGQAIGADLLGDPDLVASDATVSFDTAFWFWMTPQSPKPSCNAVATGQWTPSA  257

Query  558  PDTAAGRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCSTQ  737
             D  AGRVPGYG++TNIINGG+ECG  GE D+ ADRIGFYKRYCDI  V YG NLDC +Q
Sbjct  258  DDQRAGRVPGYGVITNIINGGLECG-HGEDDRIADRIGFYKRYCDILGVSYGANLDCYSQ  316

Query  738  TPYSP*ELLV  767
             P +P +L +
Sbjct  317  RPSAPPKLRL  326



>gb|ACM47315.1| chitinase [Capsicum annuum]
Length=322

 Score =   332 bits (850),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 158/244 (65%), Positives = 189/244 (77%), Gaps = 3/244 (1%)
 Frame = +3

Query  21   DVSSIISQAIFDDMLKYRDDSRCHAPW-FYTYDAFIAAAKSFGEFATTGDLDTRKREVAA  197
            D+ SIIS ++FD+MLK+R+D+ C     FY+Y+AFI AAKSF  F TTGD   RKRE+AA
Sbjct  71   DLGSIISNSMFDEMLKHRNDNACQGKNNFYSYNAFITAAKSFPGFGTTGDTAVRKREIAA  130

Query  198  FLGQTSHETTGGWDAAPDGRYAWGYCFLRE-GTDDPYCNVTQEWSCAPGQKYFGRGPIQI  374
            F  QTSHETTGGW  APDG YAWGYCFLRE G+   YC+ + +W CAPG+KYFGRGPIQI
Sbjct  131  FFAQTSHETTGGWPTAPDGPYAWGYCFLREQGSPGDYCSPSGQWPCAPGRKYFGRGPIQI  190

Query  375  SYNYNYGAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPS  554
            SYNYNYG  G+A+G DL++NPDLVATD  +SFK+A WFWMTPQ  KPSCHDVITG+W PS
Sbjct  191  SYNYNYGPCGRAIGVDLLNNPDLVATDSVISFKSAIWFWMTPQSPKPSCHDVITGRWQPS  250

Query  555  PPDTAAGRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCST  734
              D AA R+PG+G++TNIINGG+ECG  G  ++  DRIGFY+RYC I  V  GDNLDC  
Sbjct  251  SADRAANRLPGFGVITNIINGGLECG-HGNDNRVQDRIGFYRRYCGILGVSPGDNLDCGN  309

Query  735  QTPY  746
            Q  +
Sbjct  310  QRSF  313



>ref|XP_009775455.1| PREDICTED: endochitinase B [Nicotiana sylvestris]
 emb|CAC17793.1| endochitinase [Nicotiana sylvestris]
Length=324

 Score =   332 bits (850),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 156/252 (62%), Positives = 190/252 (75%), Gaps = 2/252 (1%)
 Frame = +3

Query  21   DVSSIISQAIFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAF  200
            D+ SIIS ++FD MLK+R+D+ C    FY+Y+AFI AA+SF  F T+GD   RKRE+AAF
Sbjct  74   DLGSIISSSMFDQMLKHRNDNACQGKGFYSYNAFINAARSFPGFGTSGDTTARKREIAAF  133

Query  201  LGQTSHETTGGWDAAPDGRYAWGYCFLRE-GTDDPYCNVTQEWSCAPGQKYFGRGPIQIS  377
              QTSHETTGGW  APDG YAWGYC+LRE G+   YC  + +W CAPG+KYFGRGPIQIS
Sbjct  134  FAQTSHETTGGWATAPDGPYAWGYCWLREQGSPGDYCTSSGQWPCAPGRKYFGRGPIQIS  193

Query  378  YNYNYGAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPSP  557
            +NYNYG  G+A+G DL++NPDLVATDP +SFK+A WFWMTPQ  KPSCHDVI G+W PS 
Sbjct  194  HNYNYGPCGRAIGVDLLNNPDLVATDPVISFKSALWFWMTPQSPKPSCHDVIIGRWQPSS  253

Query  558  PDTAAGRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCSTQ  737
             D AA R+PG+G++TNIINGG+ECG  G   +  DRIGFY+RYC I  V  GDNLDC  Q
Sbjct  254  ADRAANRLPGFGVITNIINGGLECG-RGTDSRVQDRIGFYRRYCSILGVSPGDNLDCGNQ  312

Query  738  TPYSP*ELLVTL  773
              +    L+ T+
Sbjct  313  RSFGNGLLVDTM  324



>ref|XP_002439136.1| hypothetical protein SORBIDRAFT_09g001210 [Sorghum bicolor]
 gb|EES17566.1| hypothetical protein SORBIDRAFT_09g001210 [Sorghum bicolor]
Length=321

 Score =   332 bits (850),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 161/246 (65%), Positives = 192/246 (78%), Gaps = 5/246 (2%)
 Frame = +3

Query  24   VSSIISQAIFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTG-DLDTRKREVAAF  200
            V+SIIS+++F+ ML +R+D+ C A  FYTY AFIAAA SF  F TTG   D +KRE+AAF
Sbjct  75   VASIISESVFNQMLLHRNDAGCPANGFYTYAAFIAAANSFPGFGTTGASPDVQKRELAAF  134

Query  201  LGQTSHETTGGWDAAPDGRYAWGYCFLRE--GTDDP-YCNVTQEWSCAPGQKYFGRGPIQ  371
            L QTSHETTGGW  APDG YAWGYCF  E  G   P YC  + +W CA G+KY+GRGPIQ
Sbjct  135  LAQTSHETTGGWATAPDGAYAWGYCFKEEKDGASGPDYCEPSTQWPCAAGKKYYGRGPIQ  194

Query  372  ISYNYNYGAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSP  551
            ISYNYNYG AG+A+G  +++NPDLVA D TVSF+TA WFWMTPQ  KPSCHDV+TG+W+P
Sbjct  195  ISYNYNYGPAGQAIGAGILANPDLVAADATVSFETAVWFWMTPQSPKPSCHDVMTGQWTP  254

Query  552  SPPDTAAGRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCS  731
            S  D AAGR+PGYG+VTNIINGG+ECG  G   + ADRIGFYKRYCD+  V YGDNLDC+
Sbjct  255  SAADIAAGRLPGYGVVTNIINGGLECG-HGADTRVADRIGFYKRYCDLLGVSYGDNLDCA  313

Query  732  TQTPYS  749
             Q P++
Sbjct  314  NQMPFN  319



>gb|AFK26307.1| chitinase 1 [Aegiceras corniculatum]
Length=316

 Score =   331 bits (849),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 158/242 (65%), Positives = 188/242 (78%), Gaps = 2/242 (1%)
 Frame = +3

Query  24   VSSIISQAIFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAFL  203
            +SS+IS+  F+ +L +R+D+ C A  FYTYDAF+AAA SF  FATTGD +TRK+E+AAFL
Sbjct  74   ISSLISRDTFNQLLLHRNDNACPARNFYTYDAFVAAATSFKGFATTGDTNTRKKEIAAFL  133

Query  204  GQTSHETTGGWDAAPDGRYAWGYCFLREGTDDP-YCNVTQEWSCAPGQKYFGRGPIQISY  380
             QTSHETTGGW  APDG YAWGYCF +E  + P YC  + +W CA G+KY+GRGPIQISY
Sbjct  134  AQTSHETTGGWATAPDGPYAWGYCFKKEQGNPPDYCVQSSQWPCAAGKKYYGRGPIQISY  193

Query  381  NYNYGAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPSPP  560
            NYNYG AGK++G DL+ NPDLV  D  +SFKTA WFWMTPQ  KPS HDVITG+W+PS  
Sbjct  194  NYNYGPAGKSIGSDLLGNPDLVENDAIISFKTAIWFWMTPQSPKPSSHDVITGRWTPSAA  253

Query  561  DTAAGRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCSTQT  740
            DT AGRVPGYG++TNIINGGVECG  G   +  +RIGFYKRYC I  V  GDNLDC+ Q 
Sbjct  254  DTGAGRVPGYGVITNIINGGVECG-HGTDSRVQNRIGFYKRYCQIMGVNPGDNLDCANQR  312

Query  741  PY  746
            P+
Sbjct  313  PF  314



>ref|XP_006340814.1| PREDICTED: basic endochitinase-like [Solanum tuberosum]
Length=263

 Score =   329 bits (844),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 157/243 (65%), Positives = 184/243 (76%), Gaps = 2/243 (1%)
 Frame = +3

Query  21   DVSSIISQAIFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAF  200
            DV ++IS+ IF+ ML +R+D+ C    FYTYDAFI AA+SFG F TTG+ +TRK+E+AAF
Sbjct  20   DVGALISKDIFERMLLHRNDANCDGKGFYTYDAFITAARSFGAFGTTGNTNTRKKEIAAF  79

Query  201  LGQTSHETTGGWDAAPDGRYAWGYCFLREGTDDP-YCNVTQEWSCAPGQKYFGRGPIQIS  377
            L QTS ETTGGW  APDG ++WGYCF +E    P YC   Q+W CAPG+KYFGRGPIQIS
Sbjct  80   LAQTSLETTGGWQTAPDGPFSWGYCFKQERGSPPDYCVANQQWPCAPGKKYFGRGPIQIS  139

Query  378  YNYNYGAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPSP  557
            YNYNYG AGKA+G DL+ NPD VA DP VSFKTA WFWMT Q  KPS H VITGKW P+ 
Sbjct  140  YNYNYGPAGKAIGVDLLRNPDAVANDPVVSFKTALWFWMTAQRPKPSAHYVITGKWRPTG  199

Query  558  PDTAAGRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCSTQ  737
             D +AGRV GYGL+TNIINGG+ECG     + E +RIGFYKRYC I  V  G NLDC+ Q
Sbjct  200  ADLSAGRVSGYGLITNIINGGIECGKGSNQNME-NRIGFYKRYCQILGVNPGVNLDCAKQ  258

Query  738  TPY  746
            TP+
Sbjct  259  TPF  261



>ref|XP_007137305.1| hypothetical protein PHAVU_009G116300g [Phaseolus vulgaris]
 gb|ESW09299.1| hypothetical protein PHAVU_009G116300g [Phaseolus vulgaris]
Length=273

 Score =   329 bits (844),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 151/241 (63%), Positives = 187/241 (78%), Gaps = 1/241 (0%)
 Frame = +3

Query  24   VSSIISQAIFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAFL  203
            +S++I +  F++MLK+R++  C    FYTY+AFIAAAKS+  F   GD  TRKRE+AAFL
Sbjct  25   LSALIPKDTFEEMLKHRNNPACPGRGFYTYEAFIAAAKSYPRFGNIGDTATRKREIAAFL  84

Query  204  GQTSHETTGGWDAAPDGRYAWGYCFLREGTDDPYCNVTQEWSCAPGQKYFGRGPIQISYN  383
             QTSHETTGGW  APDG YAWGYCFLRE     YC+ T ++ CAPGQ+Y+GRGPIQ+S+N
Sbjct  85   AQTSHETTGGWPTAPDGPYAWGYCFLREVNQGTYCSATPQFPCAPGQQYYGRGPIQLSWN  144

Query  384  YNYGAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPSPPD  563
            YNY   G A+G DLI+NPDLVATD  +SFK A WFWMTPQ  KPSCH+VIT +W PS  D
Sbjct  145  YNYAQCGSAIGLDLINNPDLVATDRLISFKAALWFWMTPQSPKPSCHNVITSRWIPSLAD  204

Query  564  TAAGRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCSTQTP  743
             AA R+PGYG VTNIINGG+ECG  G+  +  +RIGF+KRYCD+  +GYG+NLDC++QTP
Sbjct  205  VAARRLPGYGTVTNIINGGLECG-RGQDSRVENRIGFFKRYCDMLGIGYGNNLDCNSQTP  263

Query  744  Y  746
            +
Sbjct  264  F  264



>gb|ACJ06634.3| class I chitinase [Musa AB Group]
 gb|ADH10169.2| chitinase [Musa AB Group]
Length=315

 Score =   331 bits (848),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 156/235 (66%), Positives = 186/235 (79%), Gaps = 2/235 (1%)
 Frame = +3

Query  48   IFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAFLGQTSHETT  227
            +F+ MLK+R+D+ C    FYTY+AFIAAA SF  F TTGD  T+KRE+AAFL QTSHETT
Sbjct  82   LFEQMLKHRNDAACPGNGFYTYNAFIAAANSFSGFGTTGDDATKKREIAAFLAQTSHETT  141

Query  228  GGWDAAPDGRYAWGYCFLREGT-DDPYCNVTQEWSCAPGQKYFGRGPIQISYNYNYGAAG  404
            GGW  APDG YAWGYCF++E      YC  + +W CA G+KY+GRGPIQIS+NYNYG AG
Sbjct  142  GGWATAPDGPYAWGYCFVQEQNPSSDYCVASSQWPCAAGKKYYGRGPIQISFNYNYGPAG  201

Query  405  KALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPSPPDTAAGRVP  584
            +A+G DL++NPDLVATD T+SFKTA WFWMTPQ  KPSCH+VITG W+PS  D AAGR+P
Sbjct  202  RAIGSDLLNNPDLVATDATISFKTALWFWMTPQSPKPSCHNVITGGWTPSNADRAAGRLP  261

Query  585  GYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCSTQTPYS  749
            GYG+ TNIINGG+ECG  G   + ADRIGFYKRYCD+  V YGDNLDC  Q+P++
Sbjct  262  GYGVTTNIINGGLECG-KGSDARVADRIGFYKRYCDLLGVSYGDNLDCYNQSPFT  315



>sp|P24091.1|CHI2_TOBAC RecName: Full=Endochitinase B; Short=CHN-B; Flags: Precursor 
[Nicotiana tabacum]
 emb|CAA35945.1| chitinase [Nicotiana tabacum]
 emb|CAA45822.1| chitinase B class I [Nicotiana tabacum]
Length=324

 Score =   331 bits (848),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 156/252 (62%), Positives = 190/252 (75%), Gaps = 2/252 (1%)
 Frame = +3

Query  21   DVSSIISQAIFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAF  200
            D+ SIIS ++FD MLK+R+D+ C    FY+Y+AFI AA+SF  F T+GD   RKRE+AAF
Sbjct  74   DLGSIISSSMFDQMLKHRNDNACQGKGFYSYNAFINAARSFPGFGTSGDTTARKREIAAF  133

Query  201  LGQTSHETTGGWDAAPDGRYAWGYCFLRE-GTDDPYCNVTQEWSCAPGQKYFGRGPIQIS  377
              QTSHETTGGW  APDG YAWGYC+LRE G+   YC  + +W CAPG+KYFGRGPIQIS
Sbjct  134  FAQTSHETTGGWATAPDGPYAWGYCWLREQGSPGDYCTPSGQWPCAPGRKYFGRGPIQIS  193

Query  378  YNYNYGAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPSP  557
            +NYNYG  G+A+G DL++NPDLVATDP +SFK+A WFWMTPQ  KPSCHDVI G+W PS 
Sbjct  194  HNYNYGPCGRAIGVDLLNNPDLVATDPVISFKSALWFWMTPQSPKPSCHDVIIGRWQPSS  253

Query  558  PDTAAGRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCSTQ  737
             D AA R+PG+G++TNIINGG+ECG  G   +  DRIGFY+RYC I  V  GDNLDC  Q
Sbjct  254  ADRAANRLPGFGVITNIINGGLECG-RGTDSRVQDRIGFYRRYCSILGVSPGDNLDCGNQ  312

Query  738  TPYSP*ELLVTL  773
              +    L+ T+
Sbjct  313  RSFGNGLLVDTM  324



>gb|AAM49597.2| chitinase [Leucaena leucocephala]
Length=326

 Score =   331 bits (849),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 159/251 (63%), Positives = 195/251 (78%), Gaps = 2/251 (1%)
 Frame = +3

Query  24   VSSIISQAIFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAFL  203
            ++ IIS+  F+ MLK+R+D+ C A  FYTYDAFI AAKSF  F +TGD  TRKREVAAFL
Sbjct  77   LTGIISRDTFNQMLKHRNDAACPANGFYTYDAFILAAKSFPAFGSTGDDATRKREVAAFL  136

Query  204  GQTSHETTGGWDAAPDGRYAWGYCFLRE-GTDDPYCNVTQEWSCAPGQKYFGRGPIQISY  380
            GQTSHETTGGW +APDG YAWGYCF +E      YC  + ++ CAPG++Y+GRGP+Q+S+
Sbjct  137  GQTSHETTGGWPSAPDGPYAWGYCFKQERNPPSAYCQPSSQYPCAPGKQYYGRGPMQLSW  196

Query  381  NYNYGAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPSPP  560
            NYNYG  G+A+G DL+++PDLVA+D  +SFKTA WFWMT Q  KPSCHDVITG+W+PS  
Sbjct  197  NYNYGQCGRAIGADLLNSPDLVASDAVISFKTALWFWMTAQSPKPSCHDVITGRWTPSGA  256

Query  561  DTAAGRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCSTQT  740
            DTAAGR+PGYG  TNIINGG+ECG  G+  + ADRIGF+KRYCDI  VGYG NLDC +Q 
Sbjct  257  DTAAGRLPGYGTTTNIINGGLECG-RGQDARVADRIGFFKRYCDILRVGYGSNLDCYSQR  315

Query  741  PYSP*ELLVTL  773
            P+    L+  L
Sbjct  316  PFGSSSLIDVL  326



>ref|XP_010029606.1| PREDICTED: endochitinase-like [Eucalyptus grandis]
 gb|KCW56536.1| hypothetical protein EUGRSUZ_I02271 [Eucalyptus grandis]
Length=268

 Score =   328 bits (842),  Expect = 9e-109, Method: Compositional matrix adjust.
 Identities = 162/244 (66%), Positives = 184/244 (75%), Gaps = 2/244 (1%)
 Frame = +3

Query  21   DVSSIISQAIFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAF  200
            DVSS+IS+A FD +LK+R+D  C A  FYTYDAF+AAAKSF  F TT   DTR +EVAAF
Sbjct  26   DVSSVISRAQFDQLLKHRNDQACPAKGFYTYDAFVAAAKSFPGFGTTSTRDTRYQEVAAF  85

Query  201  LGQTSHETTGGWDAAPDGRYAWGYCFLRE-GTDDPYCNVTQEWSCAPGQKYFGRGPIQIS  377
            L QTSHETTGG   APDG YAWGYCF+ E      YC+    W CAPG+KY+GRGPIQI+
Sbjct  86   LAQTSHETTGGKKGAPDGPYAWGYCFVEERDRSRDYCDPKSGWPCAPGRKYYGRGPIQIT  145

Query  378  YNYNYGAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPSP  557
            +NYNYG AG++L  DLI NPD VA DP +SF+TA WFWMTPQ  KPS HDVITG+W PSP
Sbjct  146  HNYNYGQAGRSLHSDLIKNPDAVAKDPVLSFRTALWFWMTPQPPKPSSHDVITGRWRPSP  205

Query  558  PDTAAGRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCSTQ  737
             D AAGRVPGYGL+TNIING  ECG  G +    DRIGFYKRY DI  VGYG+NLDC  Q
Sbjct  206  ADQAAGRVPGYGLITNIINGREECG-KGPNQFVEDRIGFYKRYSDILKVGYGNNLDCYNQ  264

Query  738  TPYS  749
             PY+
Sbjct  265  KPYA  268



>ref|XP_009758310.1| PREDICTED: basic endochitinase-like [Nicotiana sylvestris]
Length=265

 Score =   328 bits (842),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 150/243 (62%), Positives = 188/243 (77%), Gaps = 2/243 (1%)
 Frame = +3

Query  21   DVSSIISQAIFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAF  200
            DV +++S+ +F+ +L +R+D+ C A  FYTY+AFI A ++FG F TTGD +TRK+E+AAF
Sbjct  22   DVGALVSKNLFERILLHRNDANCPAKGFYTYEAFITATRAFGTFGTTGDTNTRKKEIAAF  81

Query  201  LGQTSHETTGGWDAAPDGRYAWGYCFLREGTDDP-YCNVTQEWSCAPGQKYFGRGPIQIS  377
            L QTSHETTGGW  APD  Y+WGYCF +E    P YC   Q+W CAPG+ YFGRGPIQIS
Sbjct  82   LAQTSHETTGGWATAPDSPYSWGYCFKQEQGSPPNYCVANQQWPCAPGKSYFGRGPIQIS  141

Query  378  YNYNYGAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPSP  557
            YNYNYG AG+A+G DL++NPDLVA DP VSFKTA WFWMTPQ  KPS HDVITG+W+PS 
Sbjct  142  YNYNYGPAGRAIGRDLLNNPDLVANDPVVSFKTALWFWMTPQQPKPSAHDVITGRWTPSA  201

Query  558  PDTAAGRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCSTQ  737
             D AA RVPG+G++TNI+NGG+EC   G + +   RIGFY+RYC I  V  G+NLDC++Q
Sbjct  202  ADLAARRVPGFGVITNIVNGGIECN-KGSNAQMQSRIGFYRRYCQILGVDPGNNLDCASQ  260

Query  738  TPY  746
             P+
Sbjct  261  RPF  263



>ref|XP_006367377.1| PREDICTED: endochitinase-like [Solanum tuberosum]
Length=321

 Score =   330 bits (847),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 154/244 (63%), Positives = 190/244 (78%), Gaps = 3/244 (1%)
 Frame = +3

Query  21   DVSSIISQAIFDDMLKYRDDSRCHAPW-FYTYDAFIAAAKSFGEFATTGDLDTRKREVAA  197
            D+ S+IS ++FD MLK+R+++ C     FY+Y+AFI AA+SF  F TTGD++ RKRE+AA
Sbjct  77   DLGSVISNSMFDQMLKHRNENSCQGKNNFYSYNAFITAARSFPGFGTTGDINARKREIAA  136

Query  198  FLGQTSHETTGGWDAAPDGRYAWGYCFLRE-GTDDPYCNVTQEWSCAPGQKYFGRGPIQI  374
            F  QTSHETTGGW +APDG +AWGYCFLRE G    YC+ + +W CAPG+KYFGRGPIQI
Sbjct  137  FFAQTSHETTGGWPSAPDGPFAWGYCFLREQGNPGDYCSPSSQWPCAPGRKYFGRGPIQI  196

Query  375  SYNYNYGAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPS  554
            S+NYNYG  G A+G DL++NPDLVATDP +SFKTA WFWMT Q  KPSCHDVI G+W+PS
Sbjct  197  SHNYNYGPCGSAIGADLLNNPDLVATDPVISFKTALWFWMTTQSPKPSCHDVIIGRWNPS  256

Query  555  PPDTAAGRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCST  734
              D AA R+PG+G++TNIINGG+ECG  G  ++  DRIGFY+RYC I  V  GDNLDC  
Sbjct  257  AGDRAANRLPGFGVITNIINGGLECG-RGNDNRVQDRIGFYRRYCGILGVSPGDNLDCGN  315

Query  735  QTPY  746
            Q P+
Sbjct  316  QRPF  319



>ref|NP_001266258.1| basic endochitinase precursor [Solanum lycopersicum]
 gb|AAB08443.1| chitinase, class II [Solanum lycopersicum]
Length=263

 Score =   328 bits (841),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 152/243 (63%), Positives = 191/243 (79%), Gaps = 2/243 (1%)
 Frame = +3

Query  21   DVSSIISQAIFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAF  200
            ++SS+IS+ +F+ +L +R+D+ C A  FYTY+AFI A K+F  F TTGD +TR +E+AAF
Sbjct  21   NISSLISKNLFERILVHRNDAACGAKGFYTYEAFITATKTFAAFGTTGDTNTRNKEIAAF  80

Query  201  LGQTSHETTGGWDAAPDGRYAWGYCFLRE-GTDDPYCNVTQEWSCAPGQKYFGRGPIQIS  377
            L QTSHETTGGW  APDG Y+WGYC+ +E G+   YC  +Q+W CAPG+KYFGRGPIQIS
Sbjct  81   LAQTSHETTGGWATAPDGPYSWGYCYKQEQGSPGDYCASSQQWPCAPGKKYFGRGPIQIS  140

Query  378  YNYNYGAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPSP  557
            YNYNYGAAG A+G +L++NPDLVA D  VSFKTA WFWMT Q  KPS HDVITG+WSPS 
Sbjct  141  YNYNYGAAGSAIGVNLLNNPDLVANDAVVSFKTALWFWMTAQQPKPSAHDVITGRWSPSV  200

Query  558  PDTAAGRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCSTQ  737
             D+AAGRVPG+G++TNIINGG+EC  +G +    +RIGFY+RYC I  V  G+NLDC+ Q
Sbjct  201  ADSAAGRVPGFGVITNIINGGMECN-SGSNALMDNRIGFYRRYCQILGVDPGNNLDCANQ  259

Query  738  TPY  746
             P+
Sbjct  260  RPF  262



>ref|XP_010675192.1| PREDICTED: basic endochitinase [Beta vulgaris subsp. vulgaris]
Length=328

 Score =   330 bits (847),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 157/244 (64%), Positives = 192/244 (79%), Gaps = 3/244 (1%)
 Frame = +3

Query  21   DVSSIISQAIFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAF  200
            DV SII+ A+++ MLK+R+++ C    FYTY+AFIAAA+SF  F T+GD  TRKRE+AAF
Sbjct  65   DVGSIITPALYEQMLKHRNENSCPGNGFYTYNAFIAAARSFSGFGTSGDDSTRKRELAAF  124

Query  201  LGQTSHETTGGWDAAPDGRYAWGYCFLRE-GTDDPYCNVTQEWSCAPGQKYFGRGPIQIS  377
              QTSHETTGGW  APDG Y+WGYCFLRE      YC+ +  W C  G+ Y+GRGPIQ++
Sbjct  125  FAQTSHETTGGWATAPDGPYSWGYCFLREQNAQGAYCD-SPSWPCPAGKLYYGRGPIQLT  183

Query  378  YNYNYGAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPSP  557
            +NYNYG AG+A+  DLI+NPDLVATD T+SFKTA WFWMT QG KPSCH+VI G W+PS 
Sbjct  184  HNYNYGLAGQAINVDLINNPDLVATDATISFKTAIWFWMTAQGNKPSCHNVIVGGWNPSS  243

Query  558  PDTAAGRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCSTQ  737
             D AAGRVPGYG++TNIINGG+ECG  G++ K ADRIGFYKRYCDI  V YG+NLDC +Q
Sbjct  244  ADQAAGRVPGYGVITNIINGGLECG-KGQNAKVADRIGFYKRYCDILGVSYGNNLDCYSQ  302

Query  738  TPYS  749
             P++
Sbjct  303  QPFA  306



>gb|AFK35483.1| unknown [Medicago truncatula]
Length=320

 Score =   330 bits (846),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 156/243 (64%), Positives = 189/243 (78%), Gaps = 1/243 (0%)
 Frame = +3

Query  21   DVSSIISQAIFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAF  200
            DV SII  ++FD MLKYR+D RC    FYTYD FIAAA+SF  F TTGD  TRK+E+AAF
Sbjct  79   DVGSIIPSSLFDQMLKYRNDQRCAGHGFYTYDGFIAAARSFNGFGTTGDDATRKKELAAF  138

Query  201  LGQTSHETTGGWDAAPDGRYAWGYCFLREGTDDPYCNVTQEWSCAPGQKYFGRGPIQISY  380
            L QTSHETTGGW +APDG YAWGYCF+ E           +W CAPG++Y+GRGPIQ+++
Sbjct  139  LAQTSHETTGGWPSAPDGPYAWGYCFVTEKDAQGDFCSPGDWPCAPGKRYYGRGPIQLTH  198

Query  381  NYNYGAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPSPP  560
            NYNYG AGKA+  DLI+NPDLV+T+PTVSFKTA WFWM PQ  KPS HDVITG+W+PS  
Sbjct  199  NYNYGQAGKAINEDLINNPDLVSTNPTVSFKTAIWFWMAPQANKPSSHDVITGRWTPSAA  258

Query  561  DTAAGRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCSTQT  740
            D++AGRVPGYG++TNIINGG+ECG  G+  K  DR+GFY+RYC I  V  G+NLDC+ Q 
Sbjct  259  DSSAGRVPGYGVITNIINGGLECG-HGQDPKVEDRVGFYRRYCQILGVNPGNNLDCNNQR  317

Query  741  PYS  749
            P++
Sbjct  318  PFA  320



>sp|P85084.1|CHIT_CARPA RecName: Full=Endochitinase [Carica papaya]
Length=243

 Score =   327 bits (839),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 151/242 (62%), Positives = 189/242 (78%), Gaps = 2/242 (1%)
 Frame = +3

Query  24   VSSIISQAIFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAFL  203
            +  IIS+++FD MLK+R++  C A  FYTYDAF+AAAKSF  F TTG  D RKRE+AAFL
Sbjct  2    IEKIISRSMFDQMLKHRNNPACPAKGFYTYDAFLAAAKSFPSFGTTGSTDVRKRELAAFL  61

Query  204  GQTSHETTGGWDAAPDGRYAWGYCFLRE-GTDDPYCNVTQEWSCAPGQKYFGRGPIQISY  380
            GQTSHETTGGW +APDG YAWGYCFL+E      YC  +  + CAPG+ Y+GRGP+Q+S+
Sbjct  62   GQTSHETTGGWPSAPDGPYAWGYCFLKERNPSSNYCAPSPRYPCAPGKSYYGRGPLQLSW  121

Query  381  NYNYGAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPSPP  560
            NYNYG  G+AL  +L+ NPDLVATD  +SFKTA WFWMTPQ  KPSCHDV+TG+W PS  
Sbjct  122  NYNYGPCGEALRVNLLGNPDLVATDRVLSFKTALWFWMTPQAPKPSCHDVLTGRWQPSAA  181

Query  561  DTAAGRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCSTQT  740
            DTAAGR+PGYG++TN++NGG+ECG  G + + ADR+GF++RYC +  VG G+NLDC  Q 
Sbjct  182  DTAAGRLPGYGVLTNLLNGGLECG-KGPNPQVADRLGFFRRYCGLLGVGTGNNLDCYNQR  240

Query  741  PY  746
            P+
Sbjct  241  PF  242



>gb|ADN37756.1| chitinase [Morus alba var. multicaulis]
Length=358

 Score =   331 bits (849),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 154/243 (63%), Positives = 187/243 (77%), Gaps = 1/243 (0%)
 Frame = +3

Query  21   DVSSIISQAIFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAF  200
            D+++I+S+++F++ML +R+D    A  FYTYD F+ AA+ + EF  TG L+ RKREVAAF
Sbjct  97   DITNIVSESLFNEMLLHRNDDPNCAVGFYTYDGFVTAARRYPEFGATGTLEDRKREVAAF  156

Query  201  LGQTSHETTGGWDAAPDGRYAWGYCFLRE-GTDDPYCNVTQEWSCAPGQKYFGRGPIQIS  377
             GQTSHETTGGW  APDG Y WGYCF+RE GT   YC  + EW C PGQ Y+GRGPIQ+S
Sbjct  157  FGQTSHETTGGWPTAPDGPYTWGYCFVREVGTPSGYCVPSNEWPCVPGQSYYGRGPIQLS  216

Query  378  YNYNYGAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPSP  557
            YN+NYG AG ALG  L+SNPDLVATD  VSF+TA WFWMTPQ  KPSCHDVITG+W+P+P
Sbjct  217  YNFNYGQAGAALGLHLLSNPDLVATDVVVSFETALWFWMTPQAPKPSCHDVITGQWTPTP  276

Query  558  PDTAAGRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCSTQ  737
             D AAGR+PGYG+ TNIINGG+ECG  G  D+  +RIGFY RYC +  V  GDNL+C  Q
Sbjct  277  ADRAAGRLPGYGMTTNIINGGLECGGQGPDDRVENRIGFYLRYCGLLGVDPGDNLNCYNQ  336

Query  738  TPY  746
            +PY
Sbjct  337  SPY  339



>ref|XP_009394061.1| PREDICTED: endochitinase-like [Musa acuminata subsp. malaccensis]
Length=313

 Score =   330 bits (845),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 161/243 (66%), Positives = 188/243 (77%), Gaps = 9/243 (4%)
 Frame = +3

Query  21   DVSSIISQAIFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAF  200
            DV+SIIS ++FD MLK+R+        FY YDAFIAAA SF  F TTGD  TR RE+AAF
Sbjct  68   DVASIISSSLFDQMLKHRNP-------FYKYDAFIAAANSFSGFGTTGDATTRAREIAAF  120

Query  201  LGQTSHETTGGWDAAPDGRYAWGYCFLREGTDDP-YCNVTQEWSCAPGQKYFGRGPIQIS  377
            L QTSHETTGGW  APDG YAWGY ++ E +D   +C    EW CAPG+KY+GRGP+QIS
Sbjct  121  LAQTSHETTGGWATAPDGPYAWGYYYVTEQSDTSDHCQWRPEWPCAPGKKYYGRGPMQIS  180

Query  378  YNYNYGAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPSP  557
            +NYNYG AG+A+G DL++NPDLVATDP VSFKTA WFWMTPQ  KPSCHDVITG+W+PS 
Sbjct  181  FNYNYGPAGQAIGVDLLNNPDLVATDPVVSFKTALWFWMTPQSPKPSCHDVITGRWTPST  240

Query  558  PDTAAGRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCSTQ  737
             D +AGR+PGYG+VTNIINGG+ECG  G   + ADRIGFYK YCD+  V YGDNLDC  Q
Sbjct  241  ADQSAGRLPGYGVVTNIINGGLECG-IGPDARVADRIGFYKTYCDLLGVSYGDNLDCYGQ  299

Query  738  TPY  746
             P+
Sbjct  300  RPF  302



>ref|XP_009617302.1| PREDICTED: endochitinase A [Nicotiana tomentosiformis]
 sp|P08252.2|CHI1_TOBAC RecName: Full=Endochitinase A; Short=CHN-A; Flags: Precursor 
[Nicotiana tabacum]
 emb|CAA34812.1| chitinase precursor [Nicotiana tabacum]
 emb|CAA34813.1| chitinase precursor (AA -23 to 306) [Nicotiana tabacum]
Length=329

 Score =   330 bits (846),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 156/252 (62%), Positives = 190/252 (75%), Gaps = 2/252 (1%)
 Frame = +3

Query  21   DVSSIISQAIFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAF  200
            D+ SIIS ++FD MLK+R+D+ C    FY+Y+AFI AA+SF  F T+GD   RKRE+AAF
Sbjct  79   DLGSIISSSMFDQMLKHRNDNACQGKGFYSYNAFINAARSFPGFGTSGDTTARKREIAAF  138

Query  201  LGQTSHETTGGWDAAPDGRYAWGYCFLRE-GTDDPYCNVTQEWSCAPGQKYFGRGPIQIS  377
              QTSHETTGGW  APDG YAWGYC+LRE G+   YC  + +W CAPG+KYFGRGPIQIS
Sbjct  139  FAQTSHETTGGWATAPDGPYAWGYCWLREQGSPGDYCTPSGQWPCAPGRKYFGRGPIQIS  198

Query  378  YNYNYGAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPSP  557
            +NYNYG  G+A+G DL++NPDLVATDP +SFK+A WFWMTPQ  KPSCHDVI G+W PS 
Sbjct  199  HNYNYGPCGRAIGVDLLNNPDLVATDPVISFKSALWFWMTPQSPKPSCHDVIIGRWQPSA  258

Query  558  PDTAAGRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCSTQ  737
             D AA R+PG+G++TNIINGG+ECG  G   +  DRIGFY+RYC I  V  GDNLDC  Q
Sbjct  259  GDRAANRLPGFGVITNIINGGLECG-RGTDSRVQDRIGFYRRYCSILGVSPGDNLDCGNQ  317

Query  738  TPYSP*ELLVTL  773
              +    L+ T+
Sbjct  318  RSFGNGLLVDTM  329



>gb|AAP32201.1| 29 kDa chitinase-like thermal hysteresis protein [Solanum dulcamara]
Length=267

 Score =   328 bits (840),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 156/253 (62%), Positives = 189/253 (75%), Gaps = 3/253 (1%)
 Frame = +3

Query  21   DVSSIISQAIFDDMLKYRDDSRCHAPW-FYTYDAFIAAAKSFGEFATTGDLDTRKREVAA  197
            D+ S+IS ++FD MLK+R+D+ C     FY+Y+AFI AA+SF  F TTGD   RKRE+AA
Sbjct  16   DLGSVISNSMFDQMLKHRNDNACQGKGNFYSYNAFINAARSFRGFGTTGDTTARKREIAA  75

Query  198  FLGQTSHETTGGWDAAPDGRYAWGYCFLRE-GTDDPYCNVTQEWSCAPGQKYFGRGPIQI  374
            F  QTSHETTGGW  APDG YAWGYCFLRE G+   YC  + +W CAPG+KYFGRGPIQI
Sbjct  76   FFAQTSHETTGGWPTAPDGPYAWGYCFLREQGSPGDYCTPSSQWPCAPGRKYFGRGPIQI  135

Query  375  SYNYNYGAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPS  554
            S+NYNYG  G+A+G DL++NPDLVAT+P +SFK+A WFWMTPQ  K SCH VITG W PS
Sbjct  136  SHNYNYGPCGRAIGVDLLNNPDLVATNPVISFKSAIWFWMTPQSPKSSCHGVITGFWQPS  195

Query  555  PPDTAAGRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCST  734
              D AA R+PG+G++TNIINGG+ECG  G  ++  DRIGFYKRYC I  V  G NLDC  
Sbjct  196  GSDKAANRLPGFGVITNIINGGLECG-HGNDNRVQDRIGFYKRYCGILGVSPGGNLDCGN  254

Query  735  QTPYSP*ELLVTL  773
            Q P+    L+ T+
Sbjct  255  QRPFGKGLLVFTM  267



>gb|ABZ80406.1| chitinase class I [Casuarina glauca]
Length=319

 Score =   330 bits (845),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 156/238 (66%), Positives = 186/238 (78%), Gaps = 1/238 (0%)
 Frame = +3

Query  33   IISQAIFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAFLGQT  212
            +IS + FD++LK+R+D  C A  FYTYDAF+AAA +F +FATTGD  T+KRE+AAFL QT
Sbjct  74   LISSSTFDNLLKHRNDDACPAKGFYTYDAFVAAANAFPDFATTGDTATQKREIAAFLAQT  133

Query  213  SHETTGGWDAAPDGRYAWGYCFLREGTDDPYCNVTQEWSCAPGQKYFGRGPIQISYNYNY  392
            SHETTGGW  APDG YAWGYCFLR+     YC     + CAPGQ+Y+GRGPIQ+S+NYNY
Sbjct  134  SHETTGGWATAPDGPYAWGYCFLRKQNPGSYCAWNPTYPCAPGQQYYGRGPIQLSWNYNY  193

Query  393  GAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPSPPDTAA  572
            G  G ALG DL++NPDLVATDP +SFK+A WFWMTPQ  KPSCHDVITG+W+PS  D AA
Sbjct  194  GMCGTALGVDLLNNPDLVATDPVISFKSALWFWMTPQSPKPSCHDVITGRWNPSDADKAA  253

Query  573  GRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCSTQTPY  746
            GR PGYG+VTNIINGG+ECG  G ++K   RIGF+KR+CD F V YG NLDC  Q  +
Sbjct  254  GRDPGYGVVTNIINGGLECG-KGLNEKVEGRIGFFKRFCDTFGVDYGSNLDCYNQESF  310



>emb|CAC42881.1| putative class I chitinase [Hevea brasiliensis]
Length=295

 Score =   328 bits (842),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 158/240 (66%), Positives = 191/240 (80%), Gaps = 2/240 (1%)
 Frame = +3

Query  30   SIISQAIFDDMLKYRDDSRCHAPWFYTYDAFIAAAKSFGEFATTGDLDTRKREVAAFLGQ  209
            SIIS++ F++MLK+R+D+ C A  FYTYDAFI+AAK+F  F TTGD+DT KRE+AAF GQ
Sbjct  54   SIISRSTFEEMLKHRNDAACPAKGFYTYDAFISAAKAFPAFGTTGDVDTCKREIAAFFGQ  113

Query  210  TSHETTGGWDAAPDGRYAWGYCFLRE-GTDDPYCNVTQEWSCAPGQKYFGRGPIQISYNY  386
            TSH TTGGW  APDG YAWGYC+  E      YC+ +  + CAPG+KY+GRGPIQ+S+NY
Sbjct  114  TSHATTGGWPTAPDGPYAWGYCYKEELNQASSYCSPSPAYPCAPGKKYYGRGPIQLSWNY  173

Query  387  NYGAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPSPPDT  566
            NYG  G+ALG DL++NPDLVATD  +SFK A WFWMTPQ  KPSCHDVITG+WSP+  D 
Sbjct  174  NYGQCGQALGLDLLNNPDLVATDRVISFKAAIWFWMTPQFPKPSCHDVITGQWSPTGHDI  233

Query  567  AAGRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCSTQTPY  746
            +AGR PGYG++TNIINGG+ECG  G   +  DRIGFYKRYCD+F+VGYG NLDC  QTP+
Sbjct  234  SAGRAPGYGVITNIINGGLECG-RGWDARVEDRIGFYKRYCDMFAVGYGSNLDCYNQTPF  292



>ref|XP_006367375.1| PREDICTED: endochitinase-like [Solanum tuberosum]
Length=321

 Score =   330 bits (845),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 153/244 (63%), Positives = 190/244 (78%), Gaps = 3/244 (1%)
 Frame = +3

Query  21   DVSSIISQAIFDDMLKYRDDSRCHAPW-FYTYDAFIAAAKSFGEFATTGDLDTRKREVAA  197
            D+ S+IS ++FD MLK+R+++ C     FY+Y+AFI AA+SF  F TTGD++ RKRE+AA
Sbjct  77   DLGSVISNSMFDQMLKHRNENSCQGKNNFYSYNAFITAARSFSGFGTTGDINARKREIAA  136

Query  198  FLGQTSHETTGGWDAAPDGRYAWGYCFLRE-GTDDPYCNVTQEWSCAPGQKYFGRGPIQI  374
            F  QTSHETTGGW +APDG +AWGYCFLRE G    YC+ + +W CAPG+KYFGRGPIQI
Sbjct  137  FFAQTSHETTGGWPSAPDGPFAWGYCFLREQGNPGDYCSPSSQWPCAPGRKYFGRGPIQI  196

Query  375  SYNYNYGAAGKALGYDLISNPDLVATDPTVSFKTAFWFWMTPQGAKPSCHDVITGKWSPS  554
            S+NYNYG  G A+G DL++NPDLVATDP +SFKTA WFWMT Q  KPSCHDVI G+W+PS
Sbjct  197  SHNYNYGPCGSAIGADLLNNPDLVATDPVISFKTALWFWMTTQLPKPSCHDVIIGRWNPS  256

Query  555  PPDTAAGRVPGYGLVTNIINGGVECGPAGEHDKEADRIGFYKRYCDIFSVGYGDNLDCST  734
              D AA R+PG+G++TNIINGG+ECG  G  ++  DRIGF++RYC I  V  GDNLDC  
Sbjct  257  AGDRAANRLPGFGVITNIINGGLECG-RGNDNRVQDRIGFHRRYCGILGVSPGDNLDCGN  315

Query  735  QTPY  746
            Q P+
Sbjct  316  QRPF  319



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1863241968852