BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c97664_g1_i1 len=120 path=[1:0-119]

Length=120
                                                                      Score     E

ref|XP_009778045.1|  PREDICTED: RNA polymerase II C-terminal doma...  65.5    7e-11   
ref|XP_009778044.1|  PREDICTED: RNA polymerase II C-terminal doma...  65.5    8e-11   
ref|XP_009587695.1|  PREDICTED: RNA polymerase II C-terminal doma...  65.5    8e-11   
ref|XP_009587693.1|  PREDICTED: RNA polymerase II C-terminal doma...  65.5    9e-11   
ref|XP_009587694.1|  PREDICTED: RNA polymerase II C-terminal doma...  65.5    9e-11   
ref|XP_009778042.1|  PREDICTED: RNA polymerase II C-terminal doma...  65.5    9e-11   
ref|XP_009778043.1|  PREDICTED: RNA polymerase II C-terminal doma...  65.5    9e-11   
ref|XP_004246330.1|  PREDICTED: RNA polymerase II C-terminal doma...  62.0    1e-09   
ref|XP_006366356.1|  PREDICTED: RNA polymerase II C-terminal doma...  62.0    2e-09   
emb|CDP06497.1|  unnamed protein product                              58.5    2e-08   
ref|XP_010654171.1|  PREDICTED: RNA polymerase II C-terminal doma...  57.8    4e-08   
ref|XP_010654172.1|  PREDICTED: RNA polymerase II C-terminal doma...  57.8    4e-08   
emb|CBI30403.3|  unnamed protein product                              57.8    4e-08   
ref|XP_011094992.1|  PREDICTED: RNA polymerase II C-terminal doma...  56.2    1e-07   
ref|XP_009419735.1|  PREDICTED: RNA polymerase II C-terminal doma...  55.8    2e-07   
ref|XP_008388216.1|  PREDICTED: RNA polymerase II C-terminal doma...  55.5    2e-07   
ref|XP_006481011.1|  PREDICTED: RNA polymerase II C-terminal doma...  55.1    2e-07   
gb|KDP24468.1|  hypothetical protein JCGZ_25032                       55.1    3e-07   
gb|KDO47720.1|  hypothetical protein CISIN_1g003896mg                 55.1    3e-07   
ref|XP_006429346.1|  hypothetical protein CICLE_v10011105mg           55.1    3e-07   
ref|XP_006429344.1|  hypothetical protein CICLE_v10011105mg           55.1    3e-07   
ref|XP_006481007.1|  PREDICTED: RNA polymerase II C-terminal doma...  55.1    3e-07   
gb|KDO47719.1|  hypothetical protein CISIN_1g003896mg                 55.1    3e-07   
ref|XP_006429349.1|  hypothetical protein CICLE_v10011105mg           55.1    3e-07   
ref|XP_006481006.1|  PREDICTED: RNA polymerase II C-terminal doma...  55.1    3e-07   
ref|XP_006481010.1|  PREDICTED: RNA polymerase II C-terminal doma...  55.1    3e-07   
gb|KDO75880.1|  hypothetical protein CISIN_1g002166mg                 55.1    3e-07   
ref|XP_009377793.1|  PREDICTED: RNA polymerase II C-terminal doma...  55.1    3e-07   
ref|XP_011086104.1|  PREDICTED: RNA polymerase II C-terminal doma...  55.1    3e-07   
ref|XP_008449298.1|  PREDICTED: RNA polymerase II C-terminal doma...  55.1    3e-07   
ref|XP_008449306.1|  PREDICTED: RNA polymerase II C-terminal doma...  55.1    3e-07   
ref|XP_008370073.1|  PREDICTED: RNA polymerase II C-terminal doma...  55.1    3e-07   
ref|XP_009344717.1|  PREDICTED: RNA polymerase II C-terminal doma...  55.1    3e-07   
ref|XP_008359783.1|  PREDICTED: RNA polymerase II C-terminal doma...  55.1    3e-07   
ref|XP_010256578.1|  PREDICTED: RNA polymerase II C-terminal doma...  55.1    3e-07   
ref|XP_006467834.1|  PREDICTED: RNA polymerase II C-terminal doma...  55.1    3e-07   
ref|XP_010256579.1|  PREDICTED: RNA polymerase II C-terminal doma...  55.1    3e-07   
ref|XP_009344716.1|  PREDICTED: RNA polymerase II C-terminal doma...  55.1    3e-07   
ref|XP_010256580.1|  PREDICTED: RNA polymerase II C-terminal doma...  55.1    4e-07   
ref|XP_010256577.1|  PREDICTED: RNA polymerase II C-terminal doma...  55.1    4e-07   
ref|XP_010256576.1|  PREDICTED: RNA polymerase II C-terminal doma...  55.1    4e-07   
gb|KDO75879.1|  hypothetical protein CISIN_1g002166mg                 55.1    4e-07   
gb|KDO75878.1|  hypothetical protein CISIN_1g002166mg                 55.1    4e-07   
ref|XP_008359784.1|  PREDICTED: RNA polymerase II C-terminal doma...  55.1    4e-07   
ref|XP_010037703.1|  PREDICTED: RNA polymerase II C-terminal doma...  54.7    4e-07   
ref|XP_008243929.1|  PREDICTED: RNA polymerase II C-terminal doma...  54.7    4e-07   
ref|XP_008243921.1|  PREDICTED: RNA polymerase II C-terminal doma...  54.7    4e-07   
gb|KGN54371.1|  hypothetical protein Csa_4G308610                     54.7    4e-07   
ref|XP_008243912.1|  PREDICTED: RNA polymerase II C-terminal doma...  54.7    5e-07   
ref|XP_004147918.1|  PREDICTED: RNA polymerase II C-terminal doma...  54.7    5e-07   
ref|XP_004167060.1|  PREDICTED: RNA polymerase II C-terminal doma...  54.7    5e-07   
ref|XP_007204939.1|  hypothetical protein PRUPE_ppa001155mg           54.7    5e-07   
ref|XP_006449302.1|  hypothetical protein CICLE_v10014168mg           54.7    5e-07   
ref|XP_010037704.1|  PREDICTED: RNA polymerase II C-terminal doma...  54.3    6e-07   
ref|XP_010037706.1|  PREDICTED: RNA polymerase II C-terminal doma...  54.3    6e-07   
ref|XP_011006883.1|  PREDICTED: RNA polymerase II C-terminal doma...  54.3    6e-07   
ref|XP_006377325.1|  hypothetical protein POPTR_0011s04910g           54.3    6e-07   
gb|EYU41877.1|  hypothetical protein MIMGU_mgv1a001645mg              54.3    6e-07   
ref|XP_010037702.1|  PREDICTED: RNA polymerase II C-terminal doma...  54.3    6e-07   
gb|KHG23066.1|  RNA polymerase II C-terminal domain phosphatase-l...  54.3    6e-07   
ref|XP_007025680.1|  C-terminal domain phosphatase-like 1 isoform 1   53.9    9e-07   
ref|XP_007025681.1|  C-terminal domain phosphatase-like 1 isoform 2   53.9    9e-07   
ref|XP_007026746.1|  RNA polymerase II C-terminal domain phosphat...  53.5    1e-06   
ref|XP_007025682.1|  C-terminal domain phosphatase-like 1 isoform 3   53.9    1e-06   
ref|XP_004134718.1|  PREDICTED: RNA polymerase II C-terminal doma...  53.5    1e-06   
ref|XP_007026743.1|  RNA polymerase II C-terminal domain phosphat...  53.5    1e-06   
ref|XP_007026744.1|  RNA polymerase II C-terminal domain phosphat...  53.5    1e-06   
ref|XP_011027882.1|  PREDICTED: RNA polymerase II C-terminal doma...  53.5    1e-06   
ref|XP_007026745.1|  RNA polymerase II C-terminal domain phosphat...  53.5    1e-06   
ref|XP_002305017.2|  hypothetical protein POPTR_0004s04010g           53.5    1e-06   Populus trichocarpa [western balsam poplar]
ref|XP_007026742.1|  RNA polymerase II C-terminal domain phosphat...  53.5    1e-06   
ref|XP_004302639.1|  PREDICTED: RNA polymerase II C-terminal doma...  53.5    1e-06   
gb|KDP20941.1|  hypothetical protein JCGZ_21412                       53.5    1e-06   
ref|XP_010100555.1|  RNA polymerase II C-terminal domain phosphat...  53.5    1e-06   
emb|CDO99573.1|  unnamed protein product                              53.1    1e-06   
gb|KHG00173.1|  RNA polymerase II C-terminal domain phosphatase-l...  53.1    1e-06   
ref|XP_010037707.1|  PREDICTED: RNA polymerase II C-terminal doma...  52.8    2e-06   
ref|XP_010109623.1|  hypothetical protein L484_015578                 52.8    2e-06   
gb|EPS63357.1|  hypothetical protein M569_11428                       52.8    2e-06   
ref|XP_009789678.1|  PREDICTED: RNA polymerase II C-terminal doma...  52.8    2e-06   
ref|XP_008439881.1|  PREDICTED: RNA polymerase II C-terminal doma...  52.4    2e-06   
ref|XP_006347069.1|  PREDICTED: RNA polymerase II C-terminal doma...  52.8    2e-06   
ref|XP_009623032.1|  PREDICTED: RNA polymerase II C-terminal doma...  52.8    2e-06   
ref|XP_004232844.1|  PREDICTED: RNA polymerase II C-terminal doma...  52.8    2e-06   
ref|NP_001190199.1|  RNA polymerase II C-terminal domain phosphat...  52.0    3e-06   
ref|XP_002870934.1|  hypothetical protein ARALYDRAFT_486948           52.0    3e-06   
ref|XP_006287118.1|  hypothetical protein CARUB_v10000279mg           52.0    3e-06   
emb|CDX94046.1|  BnaC07g36800D                                        52.4    3e-06   
emb|CDX98696.1|  BnaA03g44810D                                        52.4    3e-06   
ref|XP_006398634.1|  hypothetical protein EUTSA_v10012754mg           52.0    3e-06   
ref|XP_009137204.1|  PREDICTED: RNA polymerase II C-terminal doma...  52.4    3e-06   
ref|NP_195747.2|  RNA polymerase II C-terminal domain phosphatase...  52.0    3e-06   Arabidopsis thaliana [mouse-ear cress]
emb|CAB69855.1|  hypothetical protein                                 52.0    4e-06   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002519032.1|  double-stranded RNA binding protein, putative    52.0    4e-06   Ricinus communis
ref|XP_010543883.1|  PREDICTED: RNA polymerase II C-terminal doma...  52.0    4e-06   
ref|XP_002267987.3|  PREDICTED: RNA polymerase II C-terminal doma...  52.0    4e-06   Vitis vinifera
ref|XP_002528114.1|  double-stranded RNA binding protein, putative    52.0    4e-06   Ricinus communis
ref|XP_006413748.1|  hypothetical protein EUTSA_v10024324mg           52.0    4e-06   
ref|XP_006583810.1|  PREDICTED: RNA polymerase II C-terminal doma...  52.0    4e-06   
ref|XP_006647581.1|  PREDICTED: RNA polymerase II C-terminal doma...  52.0    4e-06   
ref|XP_003529311.2|  PREDICTED: RNA polymerase II C-terminal doma...  52.0    4e-06   
ref|XP_006413749.1|  hypothetical protein EUTSA_v10024324mg           52.0    4e-06   
ref|XP_010423929.1|  PREDICTED: RNA polymerase II C-terminal doma...  51.6    5e-06   
ref|XP_010452007.1|  PREDICTED: RNA polymerase II C-terminal doma...  51.6    5e-06   
emb|CAJ86376.1|  OSIGBa0155K17.3                                      51.6    5e-06   Oryza sativa [red rice]
ref|NP_001047536.1|  Os02g0639000                                     51.6    5e-06   Oryza sativa Japonica Group [Japonica rice]
gb|EEC77684.1|  hypothetical protein OsI_16738                        51.6    5e-06   Oryza sativa Indica Group [Indian rice]
gb|EEE61383.1|  hypothetical protein OsJ_15551                        51.6    5e-06   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010490587.1|  PREDICTED: RNA polymerase II C-terminal doma...  51.6    5e-06   
gb|EEC73671.1|  hypothetical protein OsI_08218                        51.6    5e-06   Oryza sativa Indica Group [Indian rice]
emb|CBI35690.3|  unnamed protein product                              51.6    5e-06   
emb|CAN72816.1|  hypothetical protein VITISV_004100                   51.6    5e-06   Vitis vinifera
dbj|BAG91496.1|  unnamed protein product                              51.6    5e-06   Oryza sativa Japonica Group [Japonica rice]
emb|CAD41201.2|  OSJNBa0074L08.12                                     51.6    5e-06   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001053381.1|  Os04g0529500                                     51.6    5e-06   Oryza sativa Japonica Group [Japonica rice]
emb|CDY31421.1|  BnaC03g64030D                                        51.6    6e-06   
ref|XP_003542763.1|  PREDICTED: RNA polymerase II C-terminal doma...  51.6    6e-06   
gb|KHN10024.1|  RNA polymerase II C-terminal domain phosphatase-l...  51.6    6e-06   
ref|XP_009108487.1|  PREDICTED: RNA polymerase II C-terminal doma...  51.6    6e-06   
gb|KHG27063.1|  RNA polymerase II C-terminal domain phosphatase-l...  51.6    6e-06   
emb|CDX76438.1|  BnaA08g09620D                                        51.6    6e-06   
ref|XP_010686545.1|  PREDICTED: RNA polymerase II C-terminal doma...  51.6    6e-06   
emb|CBG76444.1|  OO_Ba0013J05-OO_Ba0033A15.31                         51.2    8e-06   Oryza officinalis
ref|XP_010932999.1|  PREDICTED: RNA polymerase II C-terminal doma...  51.2    8e-06   
ref|XP_010933000.1|  PREDICTED: RNA polymerase II C-terminal doma...  51.2    8e-06   
gb|KEH31100.1|  double-stranded RNA-binding motif protein             51.2    9e-06   
ref|XP_007140361.1|  hypothetical protein PHAVU_008G105400g           50.8    9e-06   
ref|XP_007140360.1|  hypothetical protein PHAVU_008G105400g           50.8    9e-06   
ref|XP_010241993.1|  PREDICTED: RNA polymerase II C-terminal doma...  50.8    1e-05   
ref|XP_007140362.1|  hypothetical protein PHAVU_008G105400g           50.8    1e-05   
ref|XP_010057454.1|  PREDICTED: RNA polymerase II C-terminal doma...  50.8    1e-05   
gb|KHN22742.1|  RNA polymerase II C-terminal domain phosphatase-l...  50.8    1e-05   
gb|KHN07491.1|  RNA polymerase II C-terminal domain phosphatase-l...  50.8    1e-05   
ref|XP_010918443.1|  PREDICTED: RNA polymerase II C-terminal doma...  50.8    1e-05   
ref|XP_010918442.1|  PREDICTED: RNA polymerase II C-terminal doma...  50.8    1e-05   
ref|XP_010918441.1|  PREDICTED: RNA polymerase II C-terminal doma...  50.8    1e-05   
ref|XP_010529411.1|  PREDICTED: RNA polymerase II C-terminal doma...  50.4    1e-05   
ref|XP_003623236.1|  RNA polymerase II C-terminal domain phosphat...  50.4    1e-05   
ref|XP_010235763.1|  PREDICTED: RNA polymerase II C-terminal doma...  50.4    1e-05   
ref|XP_010529412.1|  PREDICTED: RNA polymerase II C-terminal doma...  50.4    1e-05   
ref|XP_010235762.1|  PREDICTED: RNA polymerase II C-terminal doma...  50.4    1e-05   
ref|XP_003569958.1|  PREDICTED: RNA polymerase II C-terminal doma...  50.4    1e-05   
ref|XP_004976316.1|  PREDICTED: RNA polymerase II C-terminal doma...  50.4    1e-05   
gb|EYU27926.1|  hypothetical protein MIMGU_mgv1a000848mg              50.4    1e-05   
ref|XP_002452510.1|  hypothetical protein SORBIDRAFT_04g027200        50.4    2e-05   Sorghum bicolor [broomcorn]
gb|KFK24628.1|  hypothetical protein AALP_AA8G004100                  50.1    2e-05   
emb|CDX80779.1|  BnaC03g00330D                                        50.1    2e-05   
ref|XP_009336327.1|  PREDICTED: RNA polymerase II C-terminal doma...  50.4    2e-05   
ref|XP_010923074.1|  PREDICTED: RNA polymerase II C-terminal doma...  50.1    2e-05   
ref|XP_008643903.1|  PREDICTED: hypothetical protein isoform X1       50.1    2e-05   
ref|XP_007159305.1|  hypothetical protein PHAVU_002G226900g           50.1    2e-05   
ref|XP_006848184.1|  hypothetical protein AMTR_s00029p00237180        49.7    2e-05   
ref|XP_010923073.1|  PREDICTED: RNA polymerase II C-terminal doma...  49.7    2e-05   
gb|KCW49459.1|  hypothetical protein EUGRSUZ_K02985                   49.3    2e-05   
ref|XP_011096251.1|  PREDICTED: RNA polymerase II C-terminal doma...  49.7    3e-05   
ref|XP_011096253.1|  PREDICTED: RNA polymerase II C-terminal doma...  49.3    3e-05   
ref|XP_002869873.1|  hypothetical protein ARALYDRAFT_492708           49.3    3e-05   
ref|XP_008383778.1|  PREDICTED: RNA polymerase II C-terminal doma...  49.3    3e-05   
ref|XP_008809393.1|  PREDICTED: RNA polymerase II C-terminal doma...  49.3    3e-05   
ref|XP_004492424.1|  PREDICTED: LOW QUALITY PROTEIN: RNA polymera...  49.3    3e-05   
ref|XP_008809392.1|  PREDICTED: RNA polymerase II C-terminal doma...  49.3    3e-05   
ref|XP_008349250.1|  PREDICTED: RNA polymerase II C-terminal doma...  49.3    3e-05   
ref|XP_008383777.1|  PREDICTED: RNA polymerase II C-terminal doma...  49.3    3e-05   
ref|XP_006373979.1|  hypothetical protein POPTR_0016s12200g           48.9    4e-05   
ref|XP_011047440.1|  PREDICTED: RNA polymerase II C-terminal doma...  48.9    4e-05   
gb|KFK28749.1|  hypothetical protein AALP_AA7G041800                  48.9    4e-05   
ref|XP_011047439.1|  PREDICTED: RNA polymerase II C-terminal doma...  48.9    4e-05   
ref|XP_006373980.1|  hypothetical protein POPTR_0016s12200g           48.9    5e-05   
ref|XP_004953235.1|  PREDICTED: RNA polymerase II C-terminal doma...  48.9    5e-05   
ref|XP_006827806.1|  hypothetical protein AMTR_s00009p00267690        48.9    5e-05   
ref|XP_008371347.1|  PREDICTED: RNA polymerase II C-terminal doma...  48.5    6e-05   
ref|XP_008785372.1|  PREDICTED: RNA polymerase II C-terminal doma...  48.5    6e-05   
ref|XP_007214548.1|  hypothetical protein PRUPE_ppa000988mg           48.5    6e-05   
ref|XP_001758155.1|  predicted protein                                48.5    6e-05   
ref|XP_001760480.1|  predicted protein                                48.5    6e-05   
ref|XP_008225045.1|  PREDICTED: RNA polymerase II C-terminal doma...  48.5    6e-05   
dbj|BAD82046.1|  C-terminal domain phosphatase-like protein           48.1    7e-05   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006597420.1|  PREDICTED: RNA polymerase II C-terminal doma...  48.5    7e-05   
ref|XP_006597421.1|  PREDICTED: RNA polymerase II C-terminal doma...  48.5    7e-05   
ref|XP_003543063.1|  PREDICTED: RNA polymerase II C-terminal doma...  48.5    7e-05   
emb|CDY11208.1|  BnaA03g00440D                                        48.1    7e-05   
ref|NP_001044850.1|  Os01g0857000                                     48.1    7e-05   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003545893.1|  PREDICTED: RNA polymerase II C-terminal doma...  48.5    7e-05   
gb|KHN08543.1|  RNA polymerase II C-terminal domain phosphatase-l...  48.5    7e-05   
dbj|BAD94401.1|  putative protein                                     48.1    7e-05   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009130663.1|  PREDICTED: RNA polymerase II C-terminal doma...  48.1    7e-05   
ref|XP_008775881.1|  PREDICTED: LOW QUALITY PROTEIN: RNA polymera...  48.1    8e-05   
ref|XP_006646491.1|  PREDICTED: RNA polymerase II C-terminal doma...  48.1    8e-05   
gb|EMS59540.1|  RNA polymerase II C-terminal domain phosphatase-l...  47.8    9e-05   
ref|XP_003564644.2|  PREDICTED: RNA polymerase II C-terminal doma...  47.8    1e-04   
emb|CDM85065.1|  unnamed protein product                              47.8    1e-04   
dbj|BAF01152.1|  hypothetical protein                                 47.8    1e-04   Arabidopsis thaliana [mouse-ear cress]
emb|CAB36811.1|  putative protein                                     47.8    1e-04   Arabidopsis thaliana [mouse-ear cress]
ref|NP_193898.3|  RNA polymerase II C-terminal domain phosphatase...  47.8    1e-04   Arabidopsis thaliana [mouse-ear cress]
gb|EEC71832.1|  hypothetical protein OsI_04490                        47.4    1e-04   Oryza sativa Indica Group [Indian rice]
ref|XP_009135034.1|  PREDICTED: RNA polymerase II C-terminal doma...  47.4    2e-04   
emb|CDX79083.1|  BnaA01g11500D                                        47.4    2e-04   
gb|EMS45792.1|  RNA polymerase II C-terminal domain phosphatase-l...  47.4    2e-04   
ref|XP_003580187.1|  PREDICTED: RNA polymerase II C-terminal doma...  47.4    2e-04   
ref|XP_010240169.1|  PREDICTED: RNA polymerase II C-terminal doma...  47.0    2e-04   
dbj|BAJ93585.1|  predicted protein                                    47.0    2e-04   
ref|XP_008677623.1|  PREDICTED: uncharacterized protein LOC100383...  47.0    2e-04   
ref|XP_009413134.1|  PREDICTED: RNA polymerase II C-terminal doma...  46.6    3e-04   
ref|XP_009413132.1|  PREDICTED: RNA polymerase II C-terminal doma...  46.6    3e-04   
gb|EPS68977.1|  hypothetical protein M569_05791                       46.6    3e-04   
ref|XP_002446830.1|  hypothetical protein SORBIDRAFT_06g023330        46.2    4e-04   Sorghum bicolor [broomcorn]
ref|XP_004970633.1|  PREDICTED: RNA polymerase II C-terminal doma...  45.8    5e-04   
ref|XP_010538519.1|  PREDICTED: RNA polymerase II C-terminal doma...  45.8    5e-04   
ref|XP_006381242.1|  hypothetical protein POPTR_0006s10030g           45.4    5e-04   
ref|NP_001168634.1|  hypothetical protein                             45.4    6e-04   Zea mays [maize]
ref|XP_006283078.1|  hypothetical protein CARUB_v10004071mg           45.8    6e-04   
ref|XP_002458790.1|  hypothetical protein SORBIDRAFT_03g040355        45.4    6e-04   Sorghum bicolor [broomcorn]
ref|XP_008673132.1|  PREDICTED: hypothetical protein isoform X1       45.4    7e-04   



>ref|XP_009778045.1| PREDICTED: RNA polymerase II C-terminal domain phosphatase-like 
2 isoform X4 [Nicotiana sylvestris]
Length=653

 Score = 65.5 bits (158),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 30/39 (77%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = -3

Query  118  RNVACDVRSRFFKELDESLLQNTANISYEDEVVNLPSGP  2
            RNVACDVR RFFKE DESLL+  + I YEDEVVNLPS P
Sbjct  386  RNVACDVRGRFFKEFDESLLRKISEIFYEDEVVNLPSAP  424



>ref|XP_009778044.1| PREDICTED: RNA polymerase II C-terminal domain phosphatase-like 
2 isoform X3 [Nicotiana sylvestris]
Length=774

 Score = 65.5 bits (158),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 30/39 (77%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = -3

Query  118  RNVACDVRSRFFKELDESLLQNTANISYEDEVVNLPSGP  2
            RNVACDVR RFFKE DESLL+  + I YEDEVVNLPS P
Sbjct  386  RNVACDVRGRFFKEFDESLLRKISEIFYEDEVVNLPSAP  424



>ref|XP_009587695.1| PREDICTED: RNA polymerase II C-terminal domain phosphatase-like 
2 isoform X3 [Nicotiana tomentosiformis]
Length=774

 Score = 65.5 bits (158),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 30/39 (77%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = -3

Query  118  RNVACDVRSRFFKELDESLLQNTANISYEDEVVNLPSGP  2
            RNVACDVR RFFKE DESLL+  + I YEDEVVNLPS P
Sbjct  386  RNVACDVRGRFFKEFDESLLRKISEIFYEDEVVNLPSAP  424



>ref|XP_009587693.1| PREDICTED: RNA polymerase II C-terminal domain phosphatase-like 
2 isoform X1 [Nicotiana tomentosiformis]
Length=805

 Score = 65.5 bits (158),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 30/39 (77%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = -3

Query  118  RNVACDVRSRFFKELDESLLQNTANISYEDEVVNLPSGP  2
            RNVACDVR RFFKE DESLL+  + I YEDEVVNLPS P
Sbjct  386  RNVACDVRGRFFKEFDESLLRKISEIFYEDEVVNLPSAP  424



>ref|XP_009587694.1| PREDICTED: RNA polymerase II C-terminal domain phosphatase-like 
2 isoform X2 [Nicotiana tomentosiformis]
Length=804

 Score = 65.5 bits (158),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 30/39 (77%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = -3

Query  118  RNVACDVRSRFFKELDESLLQNTANISYEDEVVNLPSGP  2
            RNVACDVR RFFKE DESLL+  + I YEDEVVNLPS P
Sbjct  386  RNVACDVRGRFFKEFDESLLRKISEIFYEDEVVNLPSAP  424



>ref|XP_009778042.1| PREDICTED: RNA polymerase II C-terminal domain phosphatase-like 
2 isoform X1 [Nicotiana sylvestris]
Length=805

 Score = 65.5 bits (158),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 30/39 (77%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = -3

Query  118  RNVACDVRSRFFKELDESLLQNTANISYEDEVVNLPSGP  2
            RNVACDVR RFFKE DESLL+  + I YEDEVVNLPS P
Sbjct  386  RNVACDVRGRFFKEFDESLLRKISEIFYEDEVVNLPSAP  424



>ref|XP_009778043.1| PREDICTED: RNA polymerase II C-terminal domain phosphatase-like 
2 isoform X2 [Nicotiana sylvestris]
Length=804

 Score = 65.5 bits (158),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 30/39 (77%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = -3

Query  118  RNVACDVRSRFFKELDESLLQNTANISYEDEVVNLPSGP  2
            RNVACDVR RFFKE DESLL+  + I YEDEVVNLPS P
Sbjct  386  RNVACDVRGRFFKEFDESLLRKISEIFYEDEVVNLPSAP  424



>ref|XP_004246330.1| PREDICTED: RNA polymerase II C-terminal domain phosphatase-like 
2 [Solanum lycopersicum]
Length=808

 Score = 62.0 bits (149),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 28/39 (72%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = -3

Query  118  RNVACDVRSRFFKELDESLLQNTANISYEDEVVNLPSGP  2
            RNVACDVR+RFFKE DE LL+    I YEDE VNLPS P
Sbjct  386  RNVACDVRARFFKEFDEGLLRKICEIFYEDEAVNLPSAP  424



>ref|XP_006366356.1| PREDICTED: RNA polymerase II C-terminal domain phosphatase-like 
2-like [Solanum tuberosum]
Length=811

 Score = 62.0 bits (149),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 28/39 (72%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = -3

Query  118  RNVACDVRSRFFKELDESLLQNTANISYEDEVVNLPSGP  2
            RNVACDVR RFFKE DE LL+    I YEDE VNLPS P
Sbjct  386  RNVACDVRGRFFKEFDEGLLRKICEIFYEDEAVNLPSAP  424



>emb|CDP06497.1| unnamed protein product [Coffea canephora]
Length=810

 Score = 58.5 bits (140),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = -3

Query  118  RNVACDVRSRFFKELDESLLQNTANISYEDEVVNLPSGP  2
            RNVAC+VR  FFKE DE+LLQ  + + YEDEVV LPS P
Sbjct  387  RNVACNVRGGFFKEFDENLLQKISEVYYEDEVVTLPSAP  425



>ref|XP_010654171.1| PREDICTED: RNA polymerase II C-terminal domain phosphatase-like 
2 isoform X1 [Vitis vinifera]
Length=856

 Score = 57.8 bits (138),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = -3

Query  118  RNVACDVRSRFFKELDESLLQNTANISYEDEVVNLPSGP  2
            RNVAC+VR+ FFKE DE++L+  + + YEDEVVNLPS P
Sbjct  382  RNVACNVRAGFFKEFDENILRQISELFYEDEVVNLPSAP  420



>ref|XP_010654172.1| PREDICTED: RNA polymerase II C-terminal domain phosphatase-like 
2 isoform X2 [Vitis vinifera]
Length=855

 Score = 57.8 bits (138),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = -3

Query  118  RNVACDVRSRFFKELDESLLQNTANISYEDEVVNLPSGP  2
            RNVAC+VR+ FFKE DE++L+  + + YEDEVVNLPS P
Sbjct  382  RNVACNVRAGFFKEFDENILRQISELFYEDEVVNLPSAP  420



>emb|CBI30403.3| unnamed protein product [Vitis vinifera]
Length=853

 Score = 57.8 bits (138),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = -3

Query  118  RNVACDVRSRFFKELDESLLQNTANISYEDEVVNLPSGP  2
            RNVAC+VR+ FFKE DE++L+  + + YEDEVVNLPS P
Sbjct  382  RNVACNVRAGFFKEFDENILRQISELFYEDEVVNLPSAP  420



>ref|XP_011094992.1| PREDICTED: RNA polymerase II C-terminal domain phosphatase-like 
2 [Sesamum indicum]
Length=784

 Score = 56.2 bits (134),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = -3

Query  118  RNVACDVRSRFFKELDESLLQNTANISYEDEVVNLPSGP  2
            RNVAC+VR  FFKE DE+LL+  ++I YEDEVVNLP  P
Sbjct  388  RNVACNVRGGFFKEFDENLLRRISDIFYEDEVVNLPCPP  426



>ref|XP_009419735.1| PREDICTED: RNA polymerase II C-terminal domain phosphatase-like 
2 [Musa acuminata subsp. malaccensis]
Length=639

 Score = 55.8 bits (133),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 24/39 (62%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = -3

Query  118  RNVACDVRSRFFKELDESLLQNTANISYEDEVVNLPSGP  2
            RNVAC+VR  FFKE DE+LLQ    ++YE+E+V+LPS P
Sbjct  391  RNVACNVRGGFFKEFDENLLQKIYEVNYENEIVDLPSAP  429



>ref|XP_008388216.1| PREDICTED: RNA polymerase II C-terminal domain phosphatase-like 
2 [Malus domestica]
Length=539

 Score = 55.5 bits (132),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = -3

Query  118  RNVACDVRSRFFKELDESLLQNTANISYEDEVVNLPSGP  2
            RNVAC+VR  FFKE DE LL+  + + YEDEVVNLP  P
Sbjct  382  RNVACNVRGCFFKEFDEILLRRISGVFYEDEVVNLPPAP  420



>ref|XP_006481011.1| PREDICTED: RNA polymerase II C-terminal domain phosphatase-like 
2-like isoform X6 [Citrus sinensis]
Length=506

 Score = 55.1 bits (131),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 24/39 (62%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = -3

Query  118  RNVACDVRSRFFKELDESLLQNTANISYEDEVVNLPSGP  2
            RNVAC+VR  FFKE DE+LL++ + + YEDE VNLP+ P
Sbjct  100  RNVACNVRGCFFKEFDENLLRSISEVFYEDEAVNLPAAP  138



>gb|KDP24468.1| hypothetical protein JCGZ_25032 [Jatropha curcas]
Length=496

 Score = 55.1 bits (131),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 24/39 (62%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = -3

Query  118  RNVACDVRSRFFKELDESLLQNTANISYEDEVVNLPSGP  2
            RNVAC+VR  FFKE DE+LL+  + + YEDEV+NLP  P
Sbjct  47   RNVACNVRGCFFKEFDENLLRRISEVFYEDEVINLPPAP  85



>gb|KDO47720.1| hypothetical protein CISIN_1g003896mg [Citrus sinensis]
 gb|KDO47721.1| hypothetical protein CISIN_1g003896mg [Citrus sinensis]
 gb|KDO47722.1| hypothetical protein CISIN_1g003896mg [Citrus sinensis]
 gb|KDO47723.1| hypothetical protein CISIN_1g003896mg [Citrus sinensis]
 gb|KDO47724.1| hypothetical protein CISIN_1g003896mg [Citrus sinensis]
Length=771

 Score = 55.1 bits (131),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 24/39 (62%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = -3

Query  118  RNVACDVRSRFFKELDESLLQNTANISYEDEVVNLPSGP  2
            RNVAC+VR  FFKE DE+LL++ + + YEDE VNLP+ P
Sbjct  382  RNVACNVRGCFFKEFDENLLRSISEVFYEDEAVNLPAAP  420



>ref|XP_006429346.1| hypothetical protein CICLE_v10011105mg [Citrus clementina]
 ref|XP_006429347.1| hypothetical protein CICLE_v10011105mg [Citrus clementina]
 ref|XP_006429348.1| hypothetical protein CICLE_v10011105mg [Citrus clementina]
 gb|ESR42586.1| hypothetical protein CICLE_v10011105mg [Citrus clementina]
 gb|ESR42587.1| hypothetical protein CICLE_v10011105mg [Citrus clementina]
 gb|ESR42588.1| hypothetical protein CICLE_v10011105mg [Citrus clementina]
Length=771

 Score = 55.1 bits (131),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 24/39 (62%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = -3

Query  118  RNVACDVRSRFFKELDESLLQNTANISYEDEVVNLPSGP  2
            RNVAC+VR  FFKE DE+LL++ + + YEDE VNLP+ P
Sbjct  382  RNVACNVRGCFFKEFDENLLRSISEVFYEDEAVNLPAAP  420



>ref|XP_006429344.1| hypothetical protein CICLE_v10011105mg [Citrus clementina]
 ref|XP_006429345.1| hypothetical protein CICLE_v10011105mg [Citrus clementina]
 gb|ESR42584.1| hypothetical protein CICLE_v10011105mg [Citrus clementina]
 gb|ESR42585.1| hypothetical protein CICLE_v10011105mg [Citrus clementina]
Length=755

 Score = 55.1 bits (131),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 24/39 (62%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = -3

Query  118  RNVACDVRSRFFKELDESLLQNTANISYEDEVVNLPSGP  2
            RNVAC+VR  FFKE DE+LL++ + + YEDE VNLP+ P
Sbjct  382  RNVACNVRGCFFKEFDENLLRSISEVFYEDEAVNLPAAP  420



>ref|XP_006481007.1| PREDICTED: RNA polymerase II C-terminal domain phosphatase-like 
2-like isoform X2 [Citrus sinensis]
 ref|XP_006481008.1| PREDICTED: RNA polymerase II C-terminal domain phosphatase-like 
2-like isoform X3 [Citrus sinensis]
 ref|XP_006481009.1| PREDICTED: RNA polymerase II C-terminal domain phosphatase-like 
2-like isoform X4 [Citrus sinensis]
Length=771

 Score = 55.1 bits (131),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 24/39 (62%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = -3

Query  118  RNVACDVRSRFFKELDESLLQNTANISYEDEVVNLPSGP  2
            RNVAC+VR  FFKE DE+LL++ + + YEDE VNLP+ P
Sbjct  382  RNVACNVRGCFFKEFDENLLRSISEVFYEDEAVNLPAAP  420



>gb|KDO47719.1| hypothetical protein CISIN_1g003896mg [Citrus sinensis]
Length=788

 Score = 55.1 bits (131),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 24/39 (62%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = -3

Query  118  RNVACDVRSRFFKELDESLLQNTANISYEDEVVNLPSGP  2
            RNVAC+VR  FFKE DE+LL++ + + YEDE VNLP+ P
Sbjct  382  RNVACNVRGCFFKEFDENLLRSISEVFYEDEAVNLPAAP  420



>ref|XP_006429349.1| hypothetical protein CICLE_v10011105mg [Citrus clementina]
 gb|ESR42589.1| hypothetical protein CICLE_v10011105mg [Citrus clementina]
Length=788

 Score = 55.1 bits (131),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 24/39 (62%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = -3

Query  118  RNVACDVRSRFFKELDESLLQNTANISYEDEVVNLPSGP  2
            RNVAC+VR  FFKE DE+LL++ + + YEDE VNLP+ P
Sbjct  382  RNVACNVRGCFFKEFDENLLRSISEVFYEDEAVNLPAAP  420



>ref|XP_006481006.1| PREDICTED: RNA polymerase II C-terminal domain phosphatase-like 
2-like isoform X1 [Citrus sinensis]
Length=788

 Score = 55.1 bits (131),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 24/39 (62%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = -3

Query  118  RNVACDVRSRFFKELDESLLQNTANISYEDEVVNLPSGP  2
            RNVAC+VR  FFKE DE+LL++ + + YEDE VNLP+ P
Sbjct  382  RNVACNVRGCFFKEFDENLLRSISEVFYEDEAVNLPAAP  420



>ref|XP_006481010.1| PREDICTED: RNA polymerase II C-terminal domain phosphatase-like 
2-like isoform X5 [Citrus sinensis]
Length=770

 Score = 55.1 bits (131),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 24/39 (62%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = -3

Query  118  RNVACDVRSRFFKELDESLLQNTANISYEDEVVNLPSGP  2
            RNVAC+VR  FFKE DE+LL++ + + YEDE VNLP+ P
Sbjct  382  RNVACNVRGCFFKEFDENLLRSISEVFYEDEAVNLPAAP  420



>gb|KDO75880.1| hypothetical protein CISIN_1g002166mg [Citrus sinensis]
Length=862

 Score = 55.1 bits (131),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 24/39 (62%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = -3

Query  118  RNVACDVRSRFFKELDESLLQNTANISYEDEVVNLPSGP  2
            RN+AC+VR  FFKE DE LLQ    ISYED+V ++PS P
Sbjct  292  RNIACNVRGGFFKEFDEGLLQRIPEISYEDDVKDIPSPP  330



>ref|XP_009377793.1| PREDICTED: RNA polymerase II C-terminal domain phosphatase-like 
2 [Pyrus x bretschneideri]
Length=846

 Score = 55.1 bits (131),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = -3

Query  118  RNVACDVRSRFFKELDESLLQNTANISYEDEVVNLPSGP  2
            RNVAC+VR  FFKE DE LL+  + + YEDEVVNLP  P
Sbjct  382  RNVACNVRGCFFKEFDEILLRRISGVFYEDEVVNLPPAP  420



>ref|XP_011086104.1| PREDICTED: RNA polymerase II C-terminal domain phosphatase-like 
1 [Sesamum indicum]
Length=951

 Score = 55.1 bits (131),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 22/39 (56%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = -3

Query  118  RNVACDVRSRFFKELDESLLQNTANISYEDEVVNLPSGP  2
            RNVAC+VR  FFKE DESL+Q  + ++YED++ ++PS P
Sbjct  382  RNVACNVRGGFFKEFDESLIQRISGVAYEDDIKDMPSPP  420



>ref|XP_008449298.1| PREDICTED: RNA polymerase II C-terminal domain phosphatase-like 
2 isoform X1 [Cucumis melo]
Length=828

 Score = 55.1 bits (131),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = -3

Query  118  RNVACDVRSRFFKELDESLLQNTANISYEDEVVNLPSGP  2
            RNVAC+VR  +FKE DESLL+    ISYED+VV+LP  P
Sbjct  382  RNVACNVRGCYFKEFDESLLRRILEISYEDDVVDLPPAP  420



>ref|XP_008449306.1| PREDICTED: RNA polymerase II C-terminal domain phosphatase-like 
2 isoform X2 [Cucumis melo]
Length=825

 Score = 55.1 bits (131),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = -3

Query  118  RNVACDVRSRFFKELDESLLQNTANISYEDEVVNLPSGP  2
            RNVAC+VR  +FKE DESLL+    ISYED+VV+LP  P
Sbjct  382  RNVACNVRGCYFKEFDESLLRRILEISYEDDVVDLPPAP  420



>ref|XP_008370073.1| PREDICTED: RNA polymerase II C-terminal domain phosphatase-like 
2 [Malus domestica]
Length=850

 Score = 55.1 bits (131),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = -3

Query  118  RNVACDVRSRFFKELDESLLQNTANISYEDEVVNLPSGP  2
            RNVAC+VR  FFKE DE LL+  + + YEDEVVNLP  P
Sbjct  382  RNVACNVRGCFFKEFDEILLRRISGVFYEDEVVNLPPAP  420



>ref|XP_009344717.1| PREDICTED: RNA polymerase II C-terminal domain phosphatase-like 
2 isoform X2 [Pyrus x bretschneideri]
Length=814

 Score = 55.1 bits (131),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = -3

Query  118  RNVACDVRSRFFKELDESLLQNTANISYEDEVVNLPSGP  2
            RNVAC+VR  FFKE DE LL+  + + YEDEVVNLP  P
Sbjct  382  RNVACNVRGCFFKEFDEILLRRISGVFYEDEVVNLPPAP  420



>ref|XP_008359783.1| PREDICTED: RNA polymerase II C-terminal domain phosphatase-like 
2 isoform X1 [Malus domestica]
Length=814

 Score = 55.1 bits (131),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = -3

Query  118  RNVACDVRSRFFKELDESLLQNTANISYEDEVVNLPSGP  2
            RNVAC+VR  FFKE DE LL+  + + YEDEVVNLP  P
Sbjct  382  RNVACNVRGCFFKEFDEILLRRISGVFYEDEVVNLPPAP  420



>ref|XP_010256578.1| PREDICTED: RNA polymerase II C-terminal domain phosphatase-like 
2 isoform X3 [Nelumbo nucifera]
Length=841

 Score = 55.1 bits (131),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 23/39 (59%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = -3

Query  118  RNVACDVRSRFFKELDESLLQNTANISYEDEVVNLPSGP  2
            RNVAC+VR+ +FKE DE+LL+  + + YEDEV+NLP  P
Sbjct  383  RNVACNVRAGYFKEFDENLLRKISELRYEDEVINLPYAP  421



>ref|XP_006467834.1| PREDICTED: RNA polymerase II C-terminal domain phosphatase-like 
1-like [Citrus sinensis]
 gb|KDO75877.1| hypothetical protein CISIN_1g002166mg [Citrus sinensis]
Length=957

 Score = 55.1 bits (131),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 24/39 (62%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = -3

Query  118  RNVACDVRSRFFKELDESLLQNTANISYEDEVVNLPSGP  2
            RN+AC+VR  FFKE DE LLQ    ISYED+V ++PS P
Sbjct  387  RNIACNVRGGFFKEFDEGLLQRIPEISYEDDVKDIPSPP  425



>ref|XP_010256579.1| PREDICTED: RNA polymerase II C-terminal domain phosphatase-like 
2 isoform X4 [Nelumbo nucifera]
Length=832

 Score = 55.1 bits (131),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 23/39 (59%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = -3

Query  118  RNVACDVRSRFFKELDESLLQNTANISYEDEVVNLPSGP  2
            RNVAC+VR+ +FKE DE+LL+  + + YEDEV+NLP  P
Sbjct  383  RNVACNVRAGYFKEFDENLLRKISELRYEDEVINLPYAP  421



>ref|XP_009344716.1| PREDICTED: RNA polymerase II C-terminal domain phosphatase-like 
2 isoform X1 [Pyrus x bretschneideri]
Length=847

 Score = 55.1 bits (131),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = -3

Query  118  RNVACDVRSRFFKELDESLLQNTANISYEDEVVNLPSGP  2
            RNVAC+VR  FFKE DE LL+  + + YEDEVVNLP  P
Sbjct  382  RNVACNVRGCFFKEFDEILLRRISGVFYEDEVVNLPPAP  420



>ref|XP_010256580.1| PREDICTED: RNA polymerase II C-terminal domain phosphatase-like 
2 isoform X5 [Nelumbo nucifera]
 ref|XP_010256582.1| PREDICTED: RNA polymerase II C-terminal domain phosphatase-like 
2 isoform X5 [Nelumbo nucifera]
Length=817

 Score = 55.1 bits (131),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 23/39 (59%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = -3

Query  118  RNVACDVRSRFFKELDESLLQNTANISYEDEVVNLPSGP  2
            RNVAC+VR+ +FKE DE+LL+  + + YEDEV+NLP  P
Sbjct  383  RNVACNVRAGYFKEFDENLLRKISELRYEDEVINLPYAP  421



>ref|XP_010256577.1| PREDICTED: RNA polymerase II C-terminal domain phosphatase-like 
2 isoform X2 [Nelumbo nucifera]
Length=861

 Score = 55.1 bits (131),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 23/39 (59%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = -3

Query  118  RNVACDVRSRFFKELDESLLQNTANISYEDEVVNLPSGP  2
            RNVAC+VR+ +FKE DE+LL+  + + YEDEV+NLP  P
Sbjct  382  RNVACNVRAGYFKEFDENLLRKISELRYEDEVINLPYAP  420



>ref|XP_010256576.1| PREDICTED: RNA polymerase II C-terminal domain phosphatase-like 
2 isoform X1 [Nelumbo nucifera]
Length=862

 Score = 55.1 bits (131),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 23/39 (59%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = -3

Query  118  RNVACDVRSRFFKELDESLLQNTANISYEDEVVNLPSGP  2
            RNVAC+VR+ +FKE DE+LL+  + + YEDEV+NLP  P
Sbjct  383  RNVACNVRAGYFKEFDENLLRKISELRYEDEVINLPYAP  421



>gb|KDO75879.1| hypothetical protein CISIN_1g002166mg [Citrus sinensis]
Length=749

 Score = 55.1 bits (131),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 24/39 (62%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = -3

Query  118  RNVACDVRSRFFKELDESLLQNTANISYEDEVVNLPSGP  2
            RN+AC+VR  FFKE DE LLQ    ISYED+V ++PS P
Sbjct  387  RNIACNVRGGFFKEFDEGLLQRIPEISYEDDVKDIPSPP  425



>gb|KDO75878.1| hypothetical protein CISIN_1g002166mg [Citrus sinensis]
Length=911

 Score = 55.1 bits (131),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 24/39 (62%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = -3

Query  118  RNVACDVRSRFFKELDESLLQNTANISYEDEVVNLPSGP  2
            RN+AC+VR  FFKE DE LLQ    ISYED+V ++PS P
Sbjct  387  RNIACNVRGGFFKEFDEGLLQRIPEISYEDDVKDIPSPP  425



>ref|XP_008359784.1| PREDICTED: RNA polymerase II C-terminal domain phosphatase-like 
2 isoform X2 [Malus domestica]
Length=847

 Score = 55.1 bits (131),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = -3

Query  118  RNVACDVRSRFFKELDESLLQNTANISYEDEVVNLPSGP  2
            RNVAC+VR  FFKE DE LL+  + + YEDEVVNLP  P
Sbjct  382  RNVACNVRGCFFKEFDEILLRRISGVFYEDEVVNLPPAP  420



>ref|XP_010037703.1| PREDICTED: RNA polymerase II C-terminal domain phosphatase-like 
2 isoform X2 [Eucalyptus grandis]
 gb|KCW49460.1| hypothetical protein EUGRSUZ_K02986 [Eucalyptus grandis]
 gb|KCW49461.1| hypothetical protein EUGRSUZ_K02986 [Eucalyptus grandis]
 gb|KCW49462.1| hypothetical protein EUGRSUZ_K02986 [Eucalyptus grandis]
 gb|KCW49463.1| hypothetical protein EUGRSUZ_K02986 [Eucalyptus grandis]
Length=802

 Score = 54.7 bits (130),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 24/39 (62%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = -3

Query  118  RNVACDVRSRFFKELDESLLQNTANISYEDEVVNLPSGP  2
            RNVAC+VR  FFKE DE+LL+  + + YEDEVV LP  P
Sbjct  382  RNVACNVRGYFFKEFDENLLRKISEVFYEDEVVTLPHAP  420



>ref|XP_008243929.1| PREDICTED: RNA polymerase II C-terminal domain phosphatase-like 
2 isoform X3 [Prunus mume]
Length=806

 Score = 54.7 bits (130),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = -3

Query  118  RNVACDVRSRFFKELDESLLQNTANISYEDEVVNLPSGP  2
            RNVAC+VR  FFKE DE LL+  + + YEDEVVNLP  P
Sbjct  382  RNVACNVRGCFFKEFDEILLRRISEVFYEDEVVNLPPAP  420



>ref|XP_008243921.1| PREDICTED: RNA polymerase II C-terminal domain phosphatase-like 
2 isoform X2 [Prunus mume]
Length=821

 Score = 54.7 bits (130),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = -3

Query  118  RNVACDVRSRFFKELDESLLQNTANISYEDEVVNLPSGP  2
            RNVAC+VR  FFKE DE LL+  + + YEDEVVNLP  P
Sbjct  382  RNVACNVRGCFFKEFDEILLRRISEVFYEDEVVNLPPAP  420



>gb|KGN54371.1| hypothetical protein Csa_4G308610 [Cucumis sativus]
Length=770

 Score = 54.7 bits (130),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = -3

Query  118  RNVACDVRSRFFKELDESLLQNTANISYEDEVVNLPSGP  2
            RNVAC+VR  +FKE DESLL+    ISYED+VV+LP  P
Sbjct  382  RNVACNVRGCYFKEYDESLLRRILEISYEDDVVDLPPAP  420



>ref|XP_008243912.1| PREDICTED: RNA polymerase II C-terminal domain phosphatase-like 
2 isoform X1 [Prunus mume]
Length=856

 Score = 54.7 bits (130),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = -3

Query  118  RNVACDVRSRFFKELDESLLQNTANISYEDEVVNLPSGP  2
            RNVAC+VR  FFKE DE LL+  + + YEDEVVNLP  P
Sbjct  382  RNVACNVRGCFFKEFDEILLRRISEVFYEDEVVNLPPAP  420



>ref|XP_004147918.1| PREDICTED: RNA polymerase II C-terminal domain phosphatase-like 
2-like [Cucumis sativus]
Length=829

 Score = 54.7 bits (130),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = -3

Query  118  RNVACDVRSRFFKELDESLLQNTANISYEDEVVNLPSGP  2
            RNVAC+VR  +FKE DESLL+    ISYED+VV+LP  P
Sbjct  382  RNVACNVRGCYFKEYDESLLRRILEISYEDDVVDLPPAP  420



>ref|XP_004167060.1| PREDICTED: RNA polymerase II C-terminal domain phosphatase-like 
2-like [Cucumis sativus]
Length=837

 Score = 54.7 bits (130),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = -3

Query  118  RNVACDVRSRFFKELDESLLQNTANISYEDEVVNLPSGP  2
            RNVAC+VR  +FKE DESLL+    ISYED+VV+LP  P
Sbjct  382  RNVACNVRGCYFKEYDESLLRRILEISYEDDVVDLPPAP  420



>ref|XP_007204939.1| hypothetical protein PRUPE_ppa001155mg [Prunus persica]
 gb|EMJ06138.1| hypothetical protein PRUPE_ppa001155mg [Prunus persica]
Length=893

 Score = 54.7 bits (130),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = -3

Query  118  RNVACDVRSRFFKELDESLLQNTANISYEDEVVNLPSGP  2
            RNVAC+VR  FFKE DE LL+  + + YEDEVVNLP  P
Sbjct  382  RNVACNVRGCFFKEFDEILLRRISEVFYEDEVVNLPPAP  420



>ref|XP_006449302.1| hypothetical protein CICLE_v10014168mg [Citrus clementina]
 gb|ESR62542.1| hypothetical protein CICLE_v10014168mg [Citrus clementina]
Length=957

 Score = 54.7 bits (130),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 24/39 (62%), Positives = 28/39 (72%), Gaps = 0/39 (0%)
 Frame = -3

Query  118  RNVACDVRSRFFKELDESLLQNTANISYEDEVVNLPSGP  2
            RN+AC+VR  FFKE DE LLQ    ISYED+V  +PS P
Sbjct  387  RNIACNVRGGFFKEFDEGLLQRIPEISYEDDVKEIPSPP  425



>ref|XP_010037704.1| PREDICTED: RNA polymerase II C-terminal domain phosphatase-like 
2 isoform X3 [Eucalyptus grandis]
Length=727

 Score = 54.3 bits (129),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 24/39 (62%), Positives = 28/39 (72%), Gaps = 0/39 (0%)
 Frame = -3

Query  118  RNVACDVRSRFFKELDESLLQNTANISYEDEVVNLPSGP  2
            RNVAC VR  FFKE DE+LL+  + + YEDEVV LP  P
Sbjct  307  RNVACKVRGYFFKEFDENLLRKISEVFYEDEVVTLPHAP  345



>ref|XP_010037706.1| PREDICTED: RNA polymerase II C-terminal domain phosphatase-like 
2 isoform X4 [Eucalyptus grandis]
Length=697

 Score = 54.3 bits (129),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 24/39 (62%), Positives = 28/39 (72%), Gaps = 0/39 (0%)
 Frame = -3

Query  118  RNVACDVRSRFFKELDESLLQNTANISYEDEVVNLPSGP  2
            RNVAC VR  FFKE DE+LL+  + + YEDEVV LP  P
Sbjct  277  RNVACKVRGYFFKEFDENLLRKISEVFYEDEVVTLPHAP  315



>ref|XP_011006883.1| PREDICTED: RNA polymerase II C-terminal domain phosphatase-like 
1 [Populus euphratica]
 ref|XP_011006884.1| PREDICTED: RNA polymerase II C-terminal domain phosphatase-like 
1 [Populus euphratica]
 ref|XP_011006885.1| PREDICTED: RNA polymerase II C-terminal domain phosphatase-like 
1 [Populus euphratica]
Length=990

 Score = 54.3 bits (129),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 23/39 (59%), Positives = 28/39 (72%), Gaps = 0/39 (0%)
 Frame = -3

Query  118  RNVACDVRSRFFKELDESLLQNTANISYEDEVVNLPSGP  2
            RNVAC+VR  FFKE DE LLQ    ++YED+  N+PS P
Sbjct  400  RNVACNVRGGFFKEFDEGLLQKIPEVAYEDDTSNIPSPP  438



>ref|XP_006377325.1| hypothetical protein POPTR_0011s04910g [Populus trichocarpa]
 gb|ERP55122.1| hypothetical protein POPTR_0011s04910g [Populus trichocarpa]
Length=990

 Score = 54.3 bits (129),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 23/39 (59%), Positives = 28/39 (72%), Gaps = 0/39 (0%)
 Frame = -3

Query  118  RNVACDVRSRFFKELDESLLQNTANISYEDEVVNLPSGP  2
            RNVAC+VR  FFKE DE LLQ    ++YED+  N+PS P
Sbjct  400  RNVACNVRGGFFKEFDEGLLQKIPEVAYEDDTSNIPSPP  438



>gb|EYU41877.1| hypothetical protein MIMGU_mgv1a001645mg [Erythranthe guttata]
Length=779

 Score = 54.3 bits (129),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = -3

Query  118  RNVACDVRSRFFKELDESLLQNTANISYEDEVVNLPSGP  2
            RNVAC+VR  FFKE DE+LL+  ++I +EDEVVNLP  P
Sbjct  388  RNVACNVRGGFFKEYDENLLRRISDIFFEDEVVNLPCPP  426



>ref|XP_010037702.1| PREDICTED: RNA polymerase II C-terminal domain phosphatase-like 
2 isoform X1 [Eucalyptus grandis]
Length=883

 Score = 54.3 bits (129),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 24/39 (62%), Positives = 28/39 (72%), Gaps = 0/39 (0%)
 Frame = -3

Query  118  RNVACDVRSRFFKELDESLLQNTANISYEDEVVNLPSGP  2
            RNVAC VR  FFKE DE+LL+  + + YEDEVV LP  P
Sbjct  463  RNVACKVRGYFFKEFDENLLRKISEVFYEDEVVTLPHAP  501



>gb|KHG23066.1| RNA polymerase II C-terminal domain phosphatase-like 1 [Gossypium 
arboreum]
Length=918

 Score = 54.3 bits (129),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 23/39 (59%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = -3

Query  118  RNVACDVRSRFFKELDESLLQNTANISYEDEVVNLPSGP  2
            RNVAC+VR  FF+E DE LLQ    ISYED++ ++PS P
Sbjct  345  RNVACNVRGGFFREFDEGLLQKIPEISYEDDIKDIPSPP  383



>ref|XP_007025680.1| C-terminal domain phosphatase-like 1 isoform 1 [Theobroma cacao]
 gb|EOY28302.1| C-terminal domain phosphatase-like 1 isoform 1 [Theobroma cacao]
Length=978

 Score = 53.9 bits (128),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 23/39 (59%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = -3

Query  118  RNVACDVRSRFFKELDESLLQNTANISYEDEVVNLPSGP  2
            RNVAC+VR  FF+E DE LLQ    ISYED++ ++PS P
Sbjct  403  RNVACNVRGGFFREFDEGLLQRIPEISYEDDIKDIPSPP  441



>ref|XP_007025681.1| C-terminal domain phosphatase-like 1 isoform 2 [Theobroma cacao]
 gb|EOY28303.1| C-terminal domain phosphatase-like 1 isoform 2 [Theobroma cacao]
Length=984

 Score = 53.9 bits (128),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 23/39 (59%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = -3

Query  118  RNVACDVRSRFFKELDESLLQNTANISYEDEVVNLPSGP  2
            RNVAC+VR  FF+E DE LLQ    ISYED++ ++PS P
Sbjct  403  RNVACNVRGGFFREFDEGLLQRIPEISYEDDIKDIPSPP  441



>ref|XP_007026746.1| RNA polymerase II C-terminal domain phosphatase-like 2 isoform 
5, partial [Theobroma cacao]
 gb|EOY07248.1| RNA polymerase II C-terminal domain phosphatase-like 2 isoform 
5, partial [Theobroma cacao]
Length=719

 Score = 53.5 bits (127),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 23/39 (59%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = -3

Query  118  RNVACDVRSRFFKELDESLLQNTANISYEDEVVNLPSGP  2
            RNVAC+VR  FFKE DE++++  + + YEDEVVNLP  P
Sbjct  382  RNVACNVRGLFFKEFDENVIRKISEVFYEDEVVNLPLAP  420



>ref|XP_007025682.1| C-terminal domain phosphatase-like 1 isoform 3 [Theobroma cacao]
 gb|EOY28304.1| C-terminal domain phosphatase-like 1 isoform 3 [Theobroma cacao]
Length=870

 Score = 53.9 bits (128),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 23/39 (59%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = -3

Query  118  RNVACDVRSRFFKELDESLLQNTANISYEDEVVNLPSGP  2
            RNVAC+VR  FF+E DE LLQ    ISYED++ ++PS P
Sbjct  403  RNVACNVRGGFFREFDEGLLQRIPEISYEDDIKDIPSPP  441



>ref|XP_004134718.1| PREDICTED: RNA polymerase II C-terminal domain phosphatase-like 
1-like [Cucumis sativus]
 ref|XP_004155567.1| PREDICTED: LOW QUALITY PROTEIN: RNA polymerase II C-terminal 
domain phosphatase-like 1-like [Cucumis sativus]
 gb|KGN49212.1| hypothetical protein Csa_6G517200 [Cucumis sativus]
Length=803

 Score = 53.5 bits (127),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 24/39 (62%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = -3

Query  118  RNVACDVRSRFFKELDESLLQNTANISYEDEVVNLPSGP  2
            RNVAC+VR  FFKE D+ LLQ  ++ISYED+V ++PS P
Sbjct  382  RNVACNVRGGFFKEFDDILLQKISDISYEDDVNDIPSPP  420



>ref|XP_007026743.1| RNA polymerase II C-terminal domain phosphatase-like 2 isoform 
2 [Theobroma cacao]
 gb|EOY07245.1| RNA polymerase II C-terminal domain phosphatase-like 2 isoform 
2 [Theobroma cacao]
Length=840

 Score = 53.5 bits (127),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 23/39 (59%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = -3

Query  118  RNVACDVRSRFFKELDESLLQNTANISYEDEVVNLPSGP  2
            RNVAC+VR  FFKE DE++++  + + YEDEVVNLP  P
Sbjct  382  RNVACNVRGLFFKEFDENVIRKISEVFYEDEVVNLPLAP  420



>ref|XP_007026744.1| RNA polymerase II C-terminal domain phosphatase-like 2 isoform 
3 [Theobroma cacao]
 gb|EOY07246.1| RNA polymerase II C-terminal domain phosphatase-like 2 isoform 
3 [Theobroma cacao]
Length=841

 Score = 53.5 bits (127),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 23/39 (59%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = -3

Query  118  RNVACDVRSRFFKELDESLLQNTANISYEDEVVNLPSGP  2
            RNVAC+VR  FFKE DE++++  + + YEDEVVNLP  P
Sbjct  382  RNVACNVRGLFFKEFDENVIRKISEVFYEDEVVNLPLAP  420



>ref|XP_011027882.1| PREDICTED: RNA polymerase II C-terminal domain phosphatase-like 
1 [Populus euphratica]
 ref|XP_011027883.1| PREDICTED: RNA polymerase II C-terminal domain phosphatase-like 
1 [Populus euphratica]
Length=996

 Score = 53.5 bits (127),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 23/39 (59%), Positives = 28/39 (72%), Gaps = 0/39 (0%)
 Frame = -3

Query  118  RNVACDVRSRFFKELDESLLQNTANISYEDEVVNLPSGP  2
            RNVAC+VR  FFKE DE LLQ    ++YED+  N+PS P
Sbjct  399  RNVACNVRGGFFKEFDEGLLQKIPEVAYEDDTDNIPSPP  437



>ref|XP_007026745.1| RNA polymerase II C-terminal domain phosphatase-like 2 isoform 
4 [Theobroma cacao]
 gb|EOY07247.1| RNA polymerase II C-terminal domain phosphatase-like 2 isoform 
4 [Theobroma cacao]
Length=812

 Score = 53.5 bits (127),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 23/39 (59%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = -3

Query  118  RNVACDVRSRFFKELDESLLQNTANISYEDEVVNLPSGP  2
            RNVAC+VR  FFKE DE++++  + + YEDEVVNLP  P
Sbjct  382  RNVACNVRGLFFKEFDENVIRKISEVFYEDEVVNLPLAP  420



>ref|XP_002305017.2| hypothetical protein POPTR_0004s04010g [Populus trichocarpa]
 gb|EEE85528.2| hypothetical protein POPTR_0004s04010g [Populus trichocarpa]
Length=996

 Score = 53.5 bits (127),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 23/39 (59%), Positives = 28/39 (72%), Gaps = 0/39 (0%)
 Frame = -3

Query  118  RNVACDVRSRFFKELDESLLQNTANISYEDEVVNLPSGP  2
            RNVAC+VR  FFKE DE LLQ    ++YED+  N+PS P
Sbjct  399  RNVACNVRGGFFKEFDEGLLQKIPEVAYEDDTDNIPSPP  437



>ref|XP_007026742.1| RNA polymerase II C-terminal domain phosphatase-like 2 isoform 
1 [Theobroma cacao]
 gb|EOY07244.1| RNA polymerase II C-terminal domain phosphatase-like 2 isoform 
1 [Theobroma cacao]
Length=862

 Score = 53.5 bits (127),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 23/39 (59%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = -3

Query  118  RNVACDVRSRFFKELDESLLQNTANISYEDEVVNLPSGP  2
            RNVAC+VR  FFKE DE++++  + + YEDEVVNLP  P
Sbjct  382  RNVACNVRGLFFKEFDENVIRKISEVFYEDEVVNLPLAP  420



>ref|XP_004302639.1| PREDICTED: RNA polymerase II C-terminal domain phosphatase-like 
2-like [Fragaria vesca subsp. vesca]
Length=850

 Score = 53.5 bits (127),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 28/39 (72%), Gaps = 0/39 (0%)
 Frame = -3

Query  118  RNVACDVRSRFFKELDESLLQNTANISYEDEVVNLPSGP  2
            RNVAC+VR  FFKE DE  L+  + I YEDEVVNLP  P
Sbjct  382  RNVACNVRGCFFKEFDEIFLRRISEIFYEDEVVNLPPSP  420



>gb|KDP20941.1| hypothetical protein JCGZ_21412 [Jatropha curcas]
Length=970

 Score = 53.5 bits (127),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 24/39 (62%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = -3

Query  118  RNVACDVRSRFFKELDESLLQNTANISYEDEVVNLPSGP  2
            RNVAC+VR  FFKE DE LLQ   +ISYED+  ++PS P
Sbjct  392  RNVACNVRGGFFKEFDEGLLQRIPDISYEDDFNDIPSPP  430



>ref|XP_010100555.1| RNA polymerase II C-terminal domain phosphatase-like 1 [Morus 
notabilis]
 gb|EXB82798.1| RNA polymerase II C-terminal domain phosphatase-like 1 [Morus 
notabilis]
Length=998

 Score = 53.5 bits (127),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 22/39 (56%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = -3

Query  118  RNVACDVRSRFFKELDESLLQNTANISYEDEVVNLPSGP  2
            RNVAC+VR  FFKE D+ LLQ    +SYED++ ++PS P
Sbjct  386  RNVACNVRGGFFKEFDDGLLQKIPEVSYEDDIKHIPSPP  424



>emb|CDO99573.1| unnamed protein product [Coffea canephora]
Length=968

 Score = 53.1 bits (126),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 22/39 (56%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = -3

Query  118  RNVACDVRSRFFKELDESLLQNTANISYEDEVVNLPSGP  2
            RNVAC+VR  FFKE DE LLQ  + ++YED++  +PS P
Sbjct  391  RNVACNVRGGFFKEFDEGLLQRISEVAYEDDIKEIPSPP  429



>gb|KHG00173.1| RNA polymerase II C-terminal domain phosphatase-like 2 [Gossypium 
arboreum]
Length=861

 Score = 53.1 bits (126),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 23/39 (59%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = -3

Query  118  RNVACDVRSRFFKELDESLLQNTANISYEDEVVNLPSGP  2
            RNVAC+ R  FFKE DE++L+  + + YEDEVVNLP  P
Sbjct  382  RNVACNARGLFFKEFDENVLRKMSEVFYEDEVVNLPVAP  420



>ref|XP_010037707.1| PREDICTED: RNA polymerase II C-terminal domain phosphatase-like 
2 [Eucalyptus grandis]
 ref|XP_010037708.1| PREDICTED: RNA polymerase II C-terminal domain phosphatase-like 
2 [Eucalyptus grandis]
 ref|XP_010037709.1| PREDICTED: RNA polymerase II C-terminal domain phosphatase-like 
2 [Eucalyptus grandis]
 ref|XP_010037710.1| PREDICTED: RNA polymerase II C-terminal domain phosphatase-like 
2 [Eucalyptus grandis]
 ref|XP_010037711.1| PREDICTED: RNA polymerase II C-terminal domain phosphatase-like 
2 [Eucalyptus grandis]
 gb|KCW49457.1| hypothetical protein EUGRSUZ_K02984 [Eucalyptus grandis]
 gb|KCW49458.1| hypothetical protein EUGRSUZ_K02984 [Eucalyptus grandis]
Length=612

 Score = 52.8 bits (125),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 24/39 (62%), Positives = 27/39 (69%), Gaps = 0/39 (0%)
 Frame = -3

Query  118  RNVACDVRSRFFKELDESLLQNTANISYEDEVVNLPSGP  2
            RNV C+VR  FFKE DE+LL  T  + YEDEVV LP  P
Sbjct  382  RNVICNVRGSFFKEFDENLLHKTFELFYEDEVVALPPAP  420



>ref|XP_010109623.1| hypothetical protein L484_015578 [Morus notabilis]
 gb|EXC23668.1| hypothetical protein L484_015578 [Morus notabilis]
Length=740

 Score = 52.8 bits (125),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 23/39 (59%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = -3

Query  118  RNVACDVRSRFFKELDESLLQNTANISYEDEVVNLPSGP  2
            RNVAC+VR  FFKE DE+LL+    + YED+V+NLP  P
Sbjct  368  RNVACNVRGCFFKEFDENLLRRITEVFYEDDVLNLPPAP  406



>gb|EPS63357.1| hypothetical protein M569_11428, partial [Genlisea aurea]
Length=697

 Score = 52.8 bits (125),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 21/39 (54%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = -3

Query  118  RNVACDVRSRFFKELDESLLQNTANISYEDEVVNLPSGP  2
            RNVAC+VR+ FFKE D+++L   + + YEDE++NLP+ P
Sbjct  387  RNVACNVRTCFFKEFDDNILWRISGVFYEDEIINLPTPP  425



>ref|XP_009789678.1| PREDICTED: RNA polymerase II C-terminal domain phosphatase-like 
1 [Nicotiana sylvestris]
 ref|XP_009789679.1| PREDICTED: RNA polymerase II C-terminal domain phosphatase-like 
1 [Nicotiana sylvestris]
 ref|XP_009789680.1| PREDICTED: RNA polymerase II C-terminal domain phosphatase-like 
1 [Nicotiana sylvestris]
Length=965

 Score = 52.8 bits (125),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 21/39 (54%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = -3

Query  118  RNVACDVRSRFFKELDESLLQNTANISYEDEVVNLPSGP  2
            RNVAC+VR  FFK+ DE LLQ  + ++YED++  +PS P
Sbjct  390  RNVACNVRGGFFKDFDEGLLQRISEVAYEDDIKQVPSAP  428



>ref|XP_008439881.1| PREDICTED: RNA polymerase II C-terminal domain phosphatase-like 
1 [Cucumis melo]
Length=804

 Score = 52.4 bits (124),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 24/39 (62%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = -3

Query  118  RNVACDVRSRFFKELDESLLQNTANISYEDEVVNLPSGP  2
            RNVAC+VR  FFKE D+ LLQ  ++ISYED V ++PS P
Sbjct  382  RNVACNVRGGFFKEFDDILLQKISDISYEDGVNDIPSPP  420



>ref|XP_006347069.1| PREDICTED: RNA polymerase II C-terminal domain phosphatase-like 
1-like [Solanum tuberosum]
Length=953

 Score = 52.8 bits (125),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 21/39 (54%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = -3

Query  118  RNVACDVRSRFFKELDESLLQNTANISYEDEVVNLPSGP  2
            RNVAC+VR  FFK+ DE LLQ  + ++YED++  +PS P
Sbjct  382  RNVACNVRGGFFKDFDEGLLQRISEVAYEDDIKQVPSAP  420



>ref|XP_009623032.1| PREDICTED: RNA polymerase II C-terminal domain phosphatase-like 
1 [Nicotiana tomentosiformis]
 ref|XP_009623033.1| PREDICTED: RNA polymerase II C-terminal domain phosphatase-like 
1 [Nicotiana tomentosiformis]
Length=965

 Score = 52.8 bits (125),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 21/39 (54%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = -3

Query  118  RNVACDVRSRFFKELDESLLQNTANISYEDEVVNLPSGP  2
            RNVAC+VR  FFK+ DE LLQ  + ++YED++  +PS P
Sbjct  390  RNVACNVRGGFFKDFDEGLLQRISEVAYEDDIKQVPSAP  428



>ref|XP_004232844.1| PREDICTED: RNA polymerase II C-terminal domain phosphatase-like 
1 [Solanum lycopersicum]
Length=954

 Score = 52.8 bits (125),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 21/39 (54%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = -3

Query  118  RNVACDVRSRFFKELDESLLQNTANISYEDEVVNLPSGP  2
            RNVAC+VR  FFK+ DE LLQ  + ++YED++  +PS P
Sbjct  382  RNVACNVRGGFFKDFDEGLLQRISEVAYEDDIKQVPSAP  420



>ref|NP_001190199.1| RNA polymerase II C-terminal domain phosphatase-like 2 [Arabidopsis 
thaliana]
 gb|AED90321.1| RNA polymerase II C-terminal domain phosphatase-like 2 [Arabidopsis 
thaliana]
Length=774

 Score = 52.0 bits (123),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 23/39 (59%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = -3

Query  118  RNVACDVRSRFFKELDESLLQNTANISYEDEVVNLPSGP  2
            RNVAC+VR  FFKE DESL+ + + + YED+V NLP  P
Sbjct  383  RNVACNVRGYFFKEFDESLMSSISLVYYEDDVENLPPSP  421



>ref|XP_002870934.1| hypothetical protein ARALYDRAFT_486948 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47193.1| hypothetical protein ARALYDRAFT_486948 [Arabidopsis lyrata subsp. 
lyrata]
Length=770

 Score = 52.0 bits (123),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 23/39 (59%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = -3

Query  118  RNVACDVRSRFFKELDESLLQNTANISYEDEVVNLPSGP  2
            RNVAC+VR  FFKE DESL+ + + + YED+V NLP  P
Sbjct  383  RNVACNVRGYFFKEFDESLMSSISLVYYEDDVENLPPSP  421



>ref|XP_006287118.1| hypothetical protein CARUB_v10000279mg [Capsella rubella]
 gb|EOA20016.1| hypothetical protein CARUB_v10000279mg [Capsella rubella]
Length=769

 Score = 52.0 bits (123),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 23/39 (59%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = -3

Query  118  RNVACDVRSRFFKELDESLLQNTANISYEDEVVNLPSGP  2
            RNVAC+VR  FFKE DESL+ + + + YED+V NLP  P
Sbjct  383  RNVACNVRGYFFKEFDESLMSSISLVYYEDDVENLPPSP  421



>emb|CDX94046.1| BnaC07g36800D [Brassica napus]
Length=951

 Score = 52.4 bits (124),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 23/39 (59%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = -3

Query  118  RNVACDVRSRFFKELDESLLQNTANISYEDEVVNLPSGP  2
            RNVAC VR  FF++ D+SLLQ  A ISYE++V ++PS P
Sbjct  396  RNVACGVRGGFFRDFDDSLLQRIAQISYENDVEDIPSPP  434



>emb|CDX98696.1| BnaA03g44810D [Brassica napus]
Length=932

 Score = 52.4 bits (124),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 23/39 (59%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = -3

Query  118  RNVACDVRSRFFKELDESLLQNTANISYEDEVVNLPSGP  2
            RNVAC VR  FF++ D+SLLQ  A ISYE++V ++PS P
Sbjct  393  RNVACGVRGGFFRDFDDSLLQRIAQISYENDVEDIPSPP  431



>ref|XP_006398634.1| hypothetical protein EUTSA_v10012754mg [Eutrema salsugineum]
 gb|ESQ40087.1| hypothetical protein EUTSA_v10012754mg [Eutrema salsugineum]
Length=761

 Score = 52.0 bits (123),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 23/39 (59%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = -3

Query  118  RNVACDVRSRFFKELDESLLQNTANISYEDEVVNLPSGP  2
            RNVAC+VR  FFKE DESL+ + + + YED+V NLP  P
Sbjct  383  RNVACNVRGYFFKEFDESLMSSISLVYYEDDVENLPPSP  421



>ref|XP_009137204.1| PREDICTED: RNA polymerase II C-terminal domain phosphatase-like 
1 [Brassica rapa]
Length=947

 Score = 52.4 bits (124),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 23/39 (59%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = -3

Query  118  RNVACDVRSRFFKELDESLLQNTANISYEDEVVNLPSGP  2
            RNVAC VR  FF++ D+SLLQ  A ISYE++V ++PS P
Sbjct  393  RNVACGVRGGFFRDFDDSLLQRIAQISYENDVEDIPSPP  431



>ref|NP_195747.2| RNA polymerase II C-terminal domain phosphatase-like 2 [Arabidopsis 
thaliana]
 sp|Q5YDB5.3|CPL2_ARATH RecName: Full=RNA polymerase II C-terminal domain phosphatase-like 
2; Short=FCP-like 2; AltName: Full=Carboxyl-terminal phosphatase-like 
2; Short=AtCPL2; Short=CTD phosphatase-like 
2 [Arabidopsis thaliana]
 gb|AAT52023.1| C-terminal domain phosphatase-like 2 [Arabidopsis thaliana]
 gb|AED90320.1| RNA polymerase II C-terminal domain phosphatase-like 2 [Arabidopsis 
thaliana]
Length=770

 Score = 52.0 bits (123),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 23/39 (59%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = -3

Query  118  RNVACDVRSRFFKELDESLLQNTANISYEDEVVNLPSGP  2
            RNVAC+VR  FFKE DESL+ + + + YED+V NLP  P
Sbjct  383  RNVACNVRGYFFKEFDESLMSSISLVYYEDDVENLPPSP  421



>emb|CAB69855.1| hypothetical protein [Arabidopsis thaliana]
Length=771

 Score = 52.0 bits (123),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 23/39 (59%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = -3

Query  118  RNVACDVRSRFFKELDESLLQNTANISYEDEVVNLPSGP  2
            RNVAC+VR  FFKE DESL+ + + + YED+V NLP  P
Sbjct  384  RNVACNVRGYFFKEFDESLMSSISLVYYEDDVENLPPSP  422



>ref|XP_002519032.1| double-stranded RNA binding protein, putative [Ricinus communis]
 gb|EEF43243.1| double-stranded RNA binding protein, putative [Ricinus communis]
Length=978

 Score = 52.0 bits (123),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 23/39 (59%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = -3

Query  118  RNVACDVRSRFFKELDESLLQNTANISYEDEVVNLPSGP  2
            RNVAC+VR  FFKE DE LLQ    IS+ED++ ++PS P
Sbjct  401  RNVACNVRGGFFKEFDEGLLQRIPEISFEDDMNDIPSPP  439



>ref|XP_010543883.1| PREDICTED: RNA polymerase II C-terminal domain phosphatase-like 
2 [Tarenaya hassleriana]
Length=593

 Score = 52.0 bits (123),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 22/39 (56%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = -3

Query  118  RNVACDVRSRFFKELDESLLQNTANISYEDEVVNLPSGP  2
            RNVAC+VR  FFK+ DE+L+ + + + YEDEV NLP  P
Sbjct  382  RNVACNVRGYFFKDFDETLMSSISLVYYEDEVGNLPPAP  420



>ref|XP_002267987.3| PREDICTED: RNA polymerase II C-terminal domain phosphatase-like 
1 [Vitis vinifera]
Length=935

 Score = 52.0 bits (123),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 23/39 (59%), Positives = 28/39 (72%), Gaps = 0/39 (0%)
 Frame = -3

Query  118  RNVACDVRSRFFKELDESLLQNTANISYEDEVVNLPSGP  2
            RNVAC+VR  FFKE DE LLQ    ISYED++ ++ S P
Sbjct  379  RNVACNVRGGFFKEFDEGLLQRIPEISYEDDIKDIRSAP  417



>ref|XP_002528114.1| double-stranded RNA binding protein, putative [Ricinus communis]
 gb|EEF34293.1| double-stranded RNA binding protein, putative [Ricinus communis]
Length=786

 Score = 52.0 bits (123),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 24/39 (62%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = -3

Query  118  RNVACDVRSRFFKELDESLLQNTANISYEDEVVNLPSGP  2
            RNVAC+VR  FFKE DE+LL+  + + YEDEV NLP  P
Sbjct  345  RNVACNVRGCFFKEFDENLLRRISEVFYEDEVNNLPLAP  383



>ref|XP_006413748.1| hypothetical protein EUTSA_v10024324mg [Eutrema salsugineum]
 gb|ESQ55201.1| hypothetical protein EUTSA_v10024324mg [Eutrema salsugineum]
Length=952

 Score = 52.0 bits (123),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 23/39 (59%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = -3

Query  118  RNVACDVRSRFFKELDESLLQNTANISYEDEVVNLPSGP  2
            RNVAC VR  FF++ D+SLLQ  A ISYE++V ++PS P
Sbjct  397  RNVACGVRGGFFRDFDDSLLQRIAEISYENDVEDIPSPP  435



>ref|XP_006583810.1| PREDICTED: RNA polymerase II C-terminal domain phosphatase-like 
1-like isoform X2 [Glycine max]
Length=929

 Score = 52.0 bits (123),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 21/39 (54%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = -3

Query  118  RNVACDVRSRFFKELDESLLQNTANISYEDEVVNLPSGP  2
            RNVAC+VR  FFK+ D+ LLQ    I+YED++ ++PS P
Sbjct  380  RNVACNVRGGFFKDFDDGLLQKIPQIAYEDDIKDIPSPP  418



>ref|XP_006647581.1| PREDICTED: RNA polymerase II C-terminal domain phosphatase-like 
1-like [Oryza brachyantha]
Length=937

 Score = 52.0 bits (123),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 21/39 (54%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = -3

Query  118  RNVACDVRSRFFKELDESLLQNTANISYEDEVVNLPSGP  2
            RNVAC+VR  FFK+ D+ LL   +N+SYEDE+  +P+ P
Sbjct  386  RNVACNVRGGFFKDFDDGLLPRISNVSYEDEINEIPAAP  424



>ref|XP_003529311.2| PREDICTED: RNA polymerase II C-terminal domain phosphatase-like 
1-like isoform X1 [Glycine max]
 gb|KHN07275.1| RNA polymerase II C-terminal domain phosphatase-like 1 [Glycine 
soja]
Length=956

 Score = 52.0 bits (123),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 21/39 (54%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = -3

Query  118  RNVACDVRSRFFKELDESLLQNTANISYEDEVVNLPSGP  2
            RNVAC+VR  FFK+ D+ LLQ    I+YED++ ++PS P
Sbjct  380  RNVACNVRGGFFKDFDDGLLQKIPQIAYEDDIKDIPSPP  418



>ref|XP_006413749.1| hypothetical protein EUTSA_v10024324mg [Eutrema salsugineum]
 gb|ESQ55202.1| hypothetical protein EUTSA_v10024324mg [Eutrema salsugineum]
Length=963

 Score = 52.0 bits (123),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 23/39 (59%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = -3

Query  118  RNVACDVRSRFFKELDESLLQNTANISYEDEVVNLPSGP  2
            RNVAC VR  FF++ D+SLLQ  A ISYE++V ++PS P
Sbjct  397  RNVACGVRGGFFRDFDDSLLQRIAEISYENDVEDIPSPP  435



>ref|XP_010423929.1| PREDICTED: RNA polymerase II C-terminal domain phosphatase-like 
2 [Camelina sativa]
Length=769

 Score = 51.6 bits (122),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 23/39 (59%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = -3

Query  118  RNVACDVRSRFFKELDESLLQNTANISYEDEVVNLPSGP  2
            RNVAC+VR  FFKE DESL+ + + + YED+V NLP  P
Sbjct  381  RNVACNVRGYFFKEFDESLMNSISLVYYEDDVKNLPPPP  419



>ref|XP_010452007.1| PREDICTED: RNA polymerase II C-terminal domain phosphatase-like 
2 [Camelina sativa]
Length=776

 Score = 51.6 bits (122),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 23/39 (59%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = -3

Query  118  RNVACDVRSRFFKELDESLLQNTANISYEDEVVNLPSGP  2
            RNVAC+VR  FFKE DESL+ + + + YED+V NLP  P
Sbjct  381  RNVACNVRGYFFKEFDESLMNSISLVYYEDDVKNLPPPP  419



>emb|CAJ86376.1| OSIGBa0155K17.3 [Oryza sativa Indica Group]
Length=973

 Score = 51.6 bits (122),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 23/39 (59%), Positives = 27/39 (69%), Gaps = 0/39 (0%)
 Frame = -3

Query  118  RNVACDVRSRFFKELDESLLQNTANISYEDEVVNLPSGP  2
            RNVAC+VR  FFKE DE LL   + I YEDE+ + PS P
Sbjct  390  RNVACNVRGGFFKEFDEVLLPRISEIHYEDEINDFPSAP  428



>ref|NP_001047536.1| Os02g0639000 [Oryza sativa Japonica Group]
 dbj|BAD25346.1| double-stranded RNA-binding domain (DsRBD)-containing protein-like 
[Oryza sativa Japonica Group]
 dbj|BAD25901.1| double-stranded RNA-binding domain (DsRBD)-containing protein-like 
[Oryza sativa Japonica Group]
 dbj|BAF09450.1| Os02g0639000 [Oryza sativa Japonica Group]
 dbj|BAG90354.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE57450.1| hypothetical protein OsJ_07667 [Oryza sativa Japonica Group]
Length=940

 Score = 51.6 bits (122),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 22/39 (56%), Positives = 28/39 (72%), Gaps = 0/39 (0%)
 Frame = -3

Query  118  RNVACDVRSRFFKELDESLLQNTANISYEDEVVNLPSGP  2
            RNVAC+VR  FFK+ DE LL   +N+ YEDE+  +PS P
Sbjct  386  RNVACNVRGGFFKDFDEGLLPRISNVFYEDEINEIPSAP  424



>gb|EEC77684.1| hypothetical protein OsI_16738 [Oryza sativa Indica Group]
Length=905

 Score = 51.6 bits (122),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 23/39 (59%), Positives = 27/39 (69%), Gaps = 0/39 (0%)
 Frame = -3

Query  118  RNVACDVRSRFFKELDESLLQNTANISYEDEVVNLPSGP  2
            RNVAC+VR  FFKE DE LL   + I YEDE+ + PS P
Sbjct  322  RNVACNVRGGFFKEFDEVLLPRISEIHYEDEINDFPSAP  360



>gb|EEE61383.1| hypothetical protein OsJ_15551 [Oryza sativa Japonica Group]
Length=927

 Score = 51.6 bits (122),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 23/39 (59%), Positives = 27/39 (69%), Gaps = 0/39 (0%)
 Frame = -3

Query  118  RNVACDVRSRFFKELDESLLQNTANISYEDEVVNLPSGP  2
            RNVAC+VR  FFKE DE LL   + I YEDE+ + PS P
Sbjct  322  RNVACNVRGGFFKEFDEVLLPRISEIHYEDEINDFPSAP  360



>ref|XP_010490587.1| PREDICTED: RNA polymerase II C-terminal domain phosphatase-like 
2 [Camelina sativa]
Length=776

 Score = 51.6 bits (122),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 23/39 (59%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = -3

Query  118  RNVACDVRSRFFKELDESLLQNTANISYEDEVVNLPSGP  2
            RNVAC+VR  FFKE DESL+ + + + YED+V NLP  P
Sbjct  382  RNVACNVRGYFFKEFDESLMNSISLVYYEDDVKNLPPPP  420



>gb|EEC73671.1| hypothetical protein OsI_08218 [Oryza sativa Indica Group]
Length=937

 Score = 51.6 bits (122),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 22/39 (56%), Positives = 28/39 (72%), Gaps = 0/39 (0%)
 Frame = -3

Query  118  RNVACDVRSRFFKELDESLLQNTANISYEDEVVNLPSGP  2
            RNVAC+VR  FFK+ DE LL   +N+ YEDE+  +PS P
Sbjct  382  RNVACNVRGGFFKDFDEGLLPRISNVFYEDEINEIPSAP  420



>emb|CBI35690.3| unnamed protein product [Vitis vinifera]
Length=788

 Score = 51.6 bits (122),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 23/39 (59%), Positives = 28/39 (72%), Gaps = 0/39 (0%)
 Frame = -3

Query  118  RNVACDVRSRFFKELDESLLQNTANISYEDEVVNLPSGP  2
            RNVAC+VR  FFKE DE LLQ    ISYED++ ++ S P
Sbjct  379  RNVACNVRGGFFKEFDEGLLQRIPEISYEDDIKDIRSAP  417



>emb|CAN72816.1| hypothetical protein VITISV_004100 [Vitis vinifera]
Length=894

 Score = 51.6 bits (122),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 23/39 (59%), Positives = 28/39 (72%), Gaps = 0/39 (0%)
 Frame = -3

Query  118  RNVACDVRSRFFKELDESLLQNTANISYEDEVVNLPSGP  2
            RNVAC+VR  FFKE DE LLQ    ISYED++ ++ S P
Sbjct  360  RNVACNVRGGFFKEFDEGLLQRIPEISYEDBIKDIRSAP  398



>dbj|BAG91496.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG93185.1| unnamed protein product [Oryza sativa Japonica Group]
Length=758

 Score = 51.6 bits (122),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 23/39 (59%), Positives = 27/39 (69%), Gaps = 0/39 (0%)
 Frame = -3

Query  118  RNVACDVRSRFFKELDESLLQNTANISYEDEVVNLPSGP  2
            RNVAC+VR  FFKE DE LL   + I YEDE+ + PS P
Sbjct  203  RNVACNVRGGFFKEFDEVLLPRISEIHYEDEINDFPSAP  241



>emb|CAD41201.2| OSJNBa0074L08.12 [Oryza sativa Japonica Group]
Length=945

 Score = 51.6 bits (122),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 23/39 (59%), Positives = 27/39 (69%), Gaps = 0/39 (0%)
 Frame = -3

Query  118  RNVACDVRSRFFKELDESLLQNTANISYEDEVVNLPSGP  2
            RNVAC+VR  FFKE DE LL   + I YEDE+ + PS P
Sbjct  390  RNVACNVRGGFFKEFDEVLLPRISEIHYEDEINDFPSAP  428



>ref|NP_001053381.1| Os04g0529500 [Oryza sativa Japonica Group]
 dbj|BAF15295.1| Os04g0529500, partial [Oryza sativa Japonica Group]
Length=779

 Score = 51.6 bits (122),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 23/39 (59%), Positives = 27/39 (69%), Gaps = 0/39 (0%)
 Frame = -3

Query  118  RNVACDVRSRFFKELDESLLQNTANISYEDEVVNLPSGP  2
            RNVAC+VR  FFKE DE LL   + I YEDE+ + PS P
Sbjct  224  RNVACNVRGGFFKEFDEVLLPRISEIHYEDEINDFPSAP  262



>emb|CDY31421.1| BnaC03g64030D [Brassica napus]
Length=838

 Score = 51.6 bits (122),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 23/39 (59%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = -3

Query  118  RNVACDVRSRFFKELDESLLQNTANISYEDEVVNLPSGP  2
            RNVAC VR  FF++ D+SLLQ  A ISYE++V ++PS P
Sbjct  393  RNVACRVRGGFFRDFDDSLLQRIAEISYENDVEDIPSPP  431



>ref|XP_003542763.1| PREDICTED: RNA polymerase II C-terminal domain phosphatase-like 
1-like [Glycine max]
Length=960

 Score = 51.6 bits (122),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 21/39 (54%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = -3

Query  118  RNVACDVRSRFFKELDESLLQNTANISYEDEVVNLPSGP  2
            RNVAC+VR  FFK+ D+ LLQ    I+YED++ ++PS P
Sbjct  384  RNVACNVRGGFFKDFDDGLLQKIPQIAYEDDIKDVPSPP  422



>gb|KHN10024.1| RNA polymerase II C-terminal domain phosphatase-like 1 [Glycine 
soja]
Length=961

 Score = 51.6 bits (122),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 21/39 (54%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = -3

Query  118  RNVACDVRSRFFKELDESLLQNTANISYEDEVVNLPSGP  2
            RNVAC+VR  FFK+ D+ LLQ    I+YED++ ++PS P
Sbjct  385  RNVACNVRGGFFKDFDDGLLQKIPQIAYEDDIKDVPSPP  423



>ref|XP_009108487.1| PREDICTED: RNA polymerase II C-terminal domain phosphatase-like 
1 [Brassica rapa]
Length=847

 Score = 51.6 bits (122),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 23/39 (59%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = -3

Query  118  RNVACDVRSRFFKELDESLLQNTANISYEDEVVNLPSGP  2
            RNVAC VR  FF++ D+SLLQ  A ISYE++V ++PS P
Sbjct  396  RNVACRVRGGFFRDFDDSLLQRIAEISYENDVEDIPSPP  434



>gb|KHG27063.1| RNA polymerase II C-terminal domain phosphatase-like 1 [Gossypium 
arboreum]
Length=930

 Score = 51.6 bits (122),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 23/39 (59%), Positives = 28/39 (72%), Gaps = 0/39 (0%)
 Frame = -3

Query  118  RNVACDVRSRFFKELDESLLQNTANISYEDEVVNLPSGP  2
            RNVAC+VR  FF+E DE LLQ    ISYED+  ++PS P
Sbjct  387  RNVACNVRGGFFREYDEVLLQRIPEISYEDDTKDIPSPP  425



>emb|CDX76438.1| BnaA08g09620D [Brassica napus]
Length=847

 Score = 51.6 bits (122),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 23/39 (59%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = -3

Query  118  RNVACDVRSRFFKELDESLLQNTANISYEDEVVNLPSGP  2
            RNVAC VR  FF++ D+SLLQ  A ISYE++V ++PS P
Sbjct  396  RNVACRVRGGFFRDFDDSLLQRIAEISYENDVEDIPSPP  434



>ref|XP_010686545.1| PREDICTED: RNA polymerase II C-terminal domain phosphatase-like 
1 [Beta vulgaris subsp. vulgaris]
 ref|XP_010686546.1| PREDICTED: RNA polymerase II C-terminal domain phosphatase-like 
1 [Beta vulgaris subsp. vulgaris]
Length=1023

 Score = 51.6 bits (122),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 22/39 (56%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = -3

Query  118  RNVACDVRSRFFKELDESLLQNTANISYEDEVVNLPSGP  2
            RNVAC+VR  FFKE DE LLQ  + +S+ED+  ++PS P
Sbjct  401  RNVACNVRGGFFKEFDEGLLQRVSEVSFEDDPRDIPSPP  439



>emb|CBG76444.1| OO_Ba0013J05-OO_Ba0033A15.31 [Oryza officinalis]
Length=1333

 Score = 51.2 bits (121),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 23/39 (59%), Positives = 27/39 (69%), Gaps = 0/39 (0%)
 Frame = -3

Query  118  RNVACDVRSRFFKELDESLLQNTANISYEDEVVNLPSGP  2
            RNVAC+VR  FFKE DE LL   + I YEDE+ + PS P
Sbjct  388  RNVACNVRGGFFKEFDEVLLPRISEIHYEDELNDFPSAP  426



>ref|XP_010932999.1| PREDICTED: RNA polymerase II C-terminal domain phosphatase-like 
1 isoform X1 [Elaeis guineensis]
Length=954

 Score = 51.2 bits (121),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 23/39 (59%), Positives = 27/39 (69%), Gaps = 0/39 (0%)
 Frame = -3

Query  118  RNVACDVRSRFFKELDESLLQNTANISYEDEVVNLPSGP  2
            RNVAC+VR  FFKE DE LL   ++I YEDE  + PS P
Sbjct  380  RNVACNVRGGFFKEFDEGLLPRISDIFYEDEWKDFPSAP  418



>ref|XP_010933000.1| PREDICTED: RNA polymerase II C-terminal domain phosphatase-like 
1 isoform X2 [Elaeis guineensis]
Length=915

 Score = 51.2 bits (121),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 23/39 (59%), Positives = 27/39 (69%), Gaps = 0/39 (0%)
 Frame = -3

Query  118  RNVACDVRSRFFKELDESLLQNTANISYEDEVVNLPSGP  2
            RNVAC+VR  FFKE DE LL   ++I YEDE  + PS P
Sbjct  380  RNVACNVRGGFFKEFDEGLLPRISDIFYEDEWKDFPSAP  418



>gb|KEH31100.1| double-stranded RNA-binding motif protein [Medicago truncatula]
Length=958

 Score = 51.2 bits (121),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 20/39 (51%), Positives = 28/39 (72%), Gaps = 0/39 (0%)
 Frame = -3

Query  118  RNVACDVRSRFFKELDESLLQNTANISYEDEVVNLPSGP  2
            RNVAC+VR  FFK+ D+ LLQ    I+YED++ ++P  P
Sbjct  380  RNVACNVRGGFFKDFDDGLLQKIPQIAYEDDIKDIPPAP  418



>ref|XP_007140361.1| hypothetical protein PHAVU_008G105400g [Phaseolus vulgaris]
 gb|ESW12355.1| hypothetical protein PHAVU_008G105400g [Phaseolus vulgaris]
Length=802

 Score = 50.8 bits (120),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 24/39 (62%), Positives = 28/39 (72%), Gaps = 0/39 (0%)
 Frame = -3

Query  118  RNVACDVRSRFFKELDESLLQNTANISYEDEVVNLPSGP  2
            RNVAC+VR  FFKE DESLLQ  A I +ED++  LP  P
Sbjct  383  RNVACNVRGCFFKEFDESLLQRIAEIFFEDDIGILPHPP  421



>ref|XP_007140360.1| hypothetical protein PHAVU_008G105400g [Phaseolus vulgaris]
 gb|ESW12354.1| hypothetical protein PHAVU_008G105400g [Phaseolus vulgaris]
Length=806

 Score = 50.8 bits (120),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 24/39 (62%), Positives = 28/39 (72%), Gaps = 0/39 (0%)
 Frame = -3

Query  118  RNVACDVRSRFFKELDESLLQNTANISYEDEVVNLPSGP  2
            RNVAC+VR  FFKE DESLLQ  A I +ED++  LP  P
Sbjct  383  RNVACNVRGCFFKEFDESLLQRIAEIFFEDDIGILPHPP  421



>ref|XP_010241993.1| PREDICTED: RNA polymerase II C-terminal domain phosphatase-like 
1 [Nelumbo nucifera]
Length=948

 Score = 50.8 bits (120),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 23/39 (59%), Positives = 26/39 (67%), Gaps = 0/39 (0%)
 Frame = -3

Query  118  RNVACDVRSRFFKELDESLLQNTANISYEDEVVNLPSGP  2
            RNVAC+VR  FFKE DE LLQ    I YED++   PS P
Sbjct  379  RNVACNVRGGFFKEFDEVLLQRIPEIFYEDDMAGFPSPP  417



>ref|XP_007140362.1| hypothetical protein PHAVU_008G105400g [Phaseolus vulgaris]
 gb|ESW12356.1| hypothetical protein PHAVU_008G105400g [Phaseolus vulgaris]
Length=834

 Score = 50.8 bits (120),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/39 (62%), Positives = 28/39 (72%), Gaps = 0/39 (0%)
 Frame = -3

Query  118  RNVACDVRSRFFKELDESLLQNTANISYEDEVVNLPSGP  2
            RNVAC+VR  FFKE DESLLQ  A I +ED++  LP  P
Sbjct  383  RNVACNVRGCFFKEFDESLLQRIAEIFFEDDIGILPHPP  421



>ref|XP_010057454.1| PREDICTED: RNA polymerase II C-terminal domain phosphatase-like 
1 [Eucalyptus grandis]
 gb|KCW74624.1| hypothetical protein EUGRSUZ_E03350 [Eucalyptus grandis]
Length=976

 Score = 50.8 bits (120),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 21/39 (54%), Positives = 28/39 (72%), Gaps = 0/39 (0%)
 Frame = -3

Query  118  RNVACDVRSRFFKELDESLLQNTANISYEDEVVNLPSGP  2
            RNVAC+VR  FFKE DE LLQ  + ++YED+  ++P  P
Sbjct  402  RNVACNVRGGFFKEFDEGLLQRISEVAYEDDTRDIPCPP  440



>gb|KHN22742.1| RNA polymerase II C-terminal domain phosphatase-like 2 [Glycine 
soja]
Length=874

 Score = 50.8 bits (120),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/39 (62%), Positives = 28/39 (72%), Gaps = 0/39 (0%)
 Frame = -3

Query  118  RNVACDVRSRFFKELDESLLQNTANISYEDEVVNLPSGP  2
            RNVAC+VR  FFKE DESLLQ  A I +ED++  LP  P
Sbjct  390  RNVACNVRGCFFKEFDESLLQRIAEIFFEDDIGLLPHPP  428



>gb|KHN07491.1| RNA polymerase II C-terminal domain phosphatase-like 2 [Glycine 
soja]
Length=846

 Score = 50.8 bits (120),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/39 (62%), Positives = 28/39 (72%), Gaps = 0/39 (0%)
 Frame = -3

Query  118  RNVACDVRSRFFKELDESLLQNTANISYEDEVVNLPSGP  2
            RNVAC+VR  FFKE DESLLQ  A I +ED++  LP  P
Sbjct  393  RNVACNVRGCFFKEFDESLLQRIAEIFFEDDIGLLPHPP  431



>ref|XP_010918443.1| PREDICTED: RNA polymerase II C-terminal domain phosphatase-like 
1 isoform X3 [Elaeis guineensis]
Length=915

 Score = 50.8 bits (120),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 22/39 (56%), Positives = 28/39 (72%), Gaps = 0/39 (0%)
 Frame = -3

Query  118  RNVACDVRSRFFKELDESLLQNTANISYEDEVVNLPSGP  2
            RNVAC+VR  FFK+ DE LL   ++I YEDE+ + PS P
Sbjct  380  RNVACNVRGGFFKDFDEGLLPRISDIFYEDEMKDFPSAP  418



>ref|XP_010918442.1| PREDICTED: RNA polymerase II C-terminal domain phosphatase-like 
1 isoform X2 [Elaeis guineensis]
Length=941

 Score = 50.8 bits (120),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 22/39 (56%), Positives = 28/39 (72%), Gaps = 0/39 (0%)
 Frame = -3

Query  118  RNVACDVRSRFFKELDESLLQNTANISYEDEVVNLPSGP  2
            RNVAC+VR  FFK+ DE LL   ++I YEDE+ + PS P
Sbjct  380  RNVACNVRGGFFKDFDEGLLPRISDIFYEDEMKDFPSAP  418



>ref|XP_010918441.1| PREDICTED: RNA polymerase II C-terminal domain phosphatase-like 
1 isoform X1 [Elaeis guineensis]
Length=950

 Score = 50.8 bits (120),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 22/39 (56%), Positives = 28/39 (72%), Gaps = 0/39 (0%)
 Frame = -3

Query  118  RNVACDVRSRFFKELDESLLQNTANISYEDEVVNLPSGP  2
            RNVAC+VR  FFK+ DE LL   ++I YEDE+ + PS P
Sbjct  380  RNVACNVRGGFFKDFDEGLLPRISDIFYEDEMKDFPSAP  418



>ref|XP_010529411.1| PREDICTED: RNA polymerase II C-terminal domain phosphatase-like 
1 isoform X1 [Tarenaya hassleriana]
Length=961

 Score = 50.4 bits (119),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 21/39 (54%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = -3

Query  118  RNVACDVRSRFFKELDESLLQNTANISYEDEVVNLPSGP  2
            RNVAC+VR  FFK+ D+ LLQ    ISYE+++ ++PS P
Sbjct  399  RNVACNVRGGFFKDFDDGLLQKIGEISYENDIEDIPSPP  437



>ref|XP_003623236.1| RNA polymerase II C-terminal domain phosphatase-like protein 
[Medicago truncatula]
 gb|AES79454.1| double-stranded RNA-binding motif protein [Medicago truncatula]
Length=796

 Score = 50.4 bits (119),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/39 (62%), Positives = 28/39 (72%), Gaps = 0/39 (0%)
 Frame = -3

Query  118  RNVACDVRSRFFKELDESLLQNTANISYEDEVVNLPSGP  2
            RNVAC+VR  FFKE DE+ LQ  A I +EDEV +LP  P
Sbjct  382  RNVACNVRGCFFKEFDENYLQRIAEIFFEDEVGSLPHPP  420



>ref|XP_010235763.1| PREDICTED: RNA polymerase II C-terminal domain phosphatase-like 
1 isoform X3 [Brachypodium distachyon]
Length=677

 Score = 50.4 bits (119),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 21/39 (54%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = -3

Query  118  RNVACDVRSRFFKELDESLLQNTANISYEDEVVNLPSGP  2
            RNVAC+VR  FFK+ DE+LL   +N+ YED + ++PS P
Sbjct  136  RNVACNVRGGFFKDFDEALLPRISNVVYEDVIHDIPSAP  174



>ref|XP_010529412.1| PREDICTED: RNA polymerase II C-terminal domain phosphatase-like 
1 isoform X2 [Tarenaya hassleriana]
Length=923

 Score = 50.4 bits (119),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 21/39 (54%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = -3

Query  118  RNVACDVRSRFFKELDESLLQNTANISYEDEVVNLPSGP  2
            RNVAC+VR  FFK+ D+ LLQ    ISYE+++ ++PS P
Sbjct  399  RNVACNVRGGFFKDFDDGLLQKIGEISYENDIEDIPSPP  437



>ref|XP_010235762.1| PREDICTED: RNA polymerase II C-terminal domain phosphatase-like 
1 isoform X2 [Brachypodium distachyon]
Length=898

 Score = 50.4 bits (119),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 21/39 (54%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = -3

Query  118  RNVACDVRSRFFKELDESLLQNTANISYEDEVVNLPSGP  2
            RNVAC+VR  FFK+ DE+LL   +N+ YED + ++PS P
Sbjct  386  RNVACNVRGGFFKDFDEALLPRISNVVYEDVIHDIPSAP  424



>ref|XP_003569958.1| PREDICTED: RNA polymerase II C-terminal domain phosphatase-like 
1 isoform X1 [Brachypodium distachyon]
Length=927

 Score = 50.4 bits (119),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 21/39 (54%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = -3

Query  118  RNVACDVRSRFFKELDESLLQNTANISYEDEVVNLPSGP  2
            RNVAC+VR  FFK+ DE+LL   +N+ YED + ++PS P
Sbjct  386  RNVACNVRGGFFKDFDEALLPRISNVVYEDVIHDIPSAP  424



>ref|XP_004976316.1| PREDICTED: RNA polymerase II C-terminal domain phosphatase-like 
1-like [Setaria italica]
Length=944

 Score = 50.4 bits (119),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 21/39 (54%), Positives = 27/39 (69%), Gaps = 0/39 (0%)
 Frame = -3

Query  118  RNVACDVRSRFFKELDESLLQNTANISYEDEVVNLPSGP  2
            RNVAC+VR  FFKE DE +L   + + YEDE+  +PS P
Sbjct  384  RNVACNVRGGFFKEFDEGILPQISEVRYEDEMDGIPSAP  422



>gb|EYU27926.1| hypothetical protein MIMGU_mgv1a000848mg [Erythranthe guttata]
Length=962

 Score = 50.4 bits (119),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 20/39 (51%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = -3

Query  118  RNVACDVRSRFFKELDESLLQNTANISYEDEVVNLPSGP  2
            RNVAC+VR  FFK+ D+ LLQ  + ++YED++ ++PS P
Sbjct  382  RNVACNVRGGFFKDFDDGLLQLISGVAYEDDIKDVPSSP  420



>ref|XP_002452510.1| hypothetical protein SORBIDRAFT_04g027200 [Sorghum bicolor]
 gb|EES05486.1| hypothetical protein SORBIDRAFT_04g027200 [Sorghum bicolor]
Length=934

 Score = 50.4 bits (119),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/39 (56%), Positives = 28/39 (72%), Gaps = 0/39 (0%)
 Frame = -3

Query  118  RNVACDVRSRFFKELDESLLQNTANISYEDEVVNLPSGP  2
            RNVAC+VR  FFK+ DE LL   +N+ YEDEV ++ S P
Sbjct  388  RNVACNVRGGFFKDFDEGLLPRISNVHYEDEVNDISSAP  426



>gb|KFK24628.1| hypothetical protein AALP_AA8G004100 [Arabis alpina]
Length=762

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/39 (56%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = -3

Query  118  RNVACDVRSRFFKELDESLLQNTANISYEDEVVNLPSGP  2
            RNVAC+VR  FF+E DESL+ + + + YED+V NLP  P
Sbjct  383  RNVACNVRGCFFREFDESLMSSISLVYYEDDVENLPPSP  421



>emb|CDX80779.1| BnaC03g00330D [Brassica napus]
Length=790

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/39 (56%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = -3

Query  118  RNVACDVRSRFFKELDESLLQNTANISYEDEVVNLPSGP  2
            RNVAC+VR  FFKE DESL+ + + + +ED+V NLP  P
Sbjct  413  RNVACNVRGYFFKEFDESLMSSISLVYHEDDVENLPPSP  451



>ref|XP_009336327.1| PREDICTED: RNA polymerase II C-terminal domain phosphatase-like 
1 [Pyrus x bretschneideri]
Length=960

 Score = 50.4 bits (119),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = -3

Query  118  RNVACDVRSRFFKELDESLLQNTANISYEDEVVNLPS  8
            RNVAC+VR  FFKE D+SLLQ    I YED++ ++PS
Sbjct  387  RNVACNVRGGFFKEFDDSLLQKIPEIFYEDDIKDVPS  423



>ref|XP_010923074.1| PREDICTED: RNA polymerase II C-terminal domain phosphatase-like 
2 isoform X2 [Elaeis guineensis]
Length=611

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 21/39 (54%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = -3

Query  118  RNVACDVRSRFFKELDESLLQNTANISYEDEVVNLPSGP  2
            RNVAC+VR  FFKE DESLL+    + YE+++++LP  P
Sbjct  382  RNVACNVRGGFFKEFDESLLRKIFELCYENDILDLPYAP  420



>ref|XP_008643903.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
Length=934

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/39 (56%), Positives = 28/39 (72%), Gaps = 0/39 (0%)
 Frame = -3

Query  118  RNVACDVRSRFFKELDESLLQNTANISYEDEVVNLPSGP  2
            RNVAC+VR  FFK+ DE LL   +N+ YEDEV ++ S P
Sbjct  388  RNVACNVRGGFFKDFDEGLLPRISNVHYEDEVNDISSAP  426



>ref|XP_007159305.1| hypothetical protein PHAVU_002G226900g [Phaseolus vulgaris]
 gb|ESW31299.1| hypothetical protein PHAVU_002G226900g [Phaseolus vulgaris]
Length=964

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 20/39 (51%), Positives = 28/39 (72%), Gaps = 0/39 (0%)
 Frame = -3

Query  118  RNVACDVRSRFFKELDESLLQNTANISYEDEVVNLPSGP  2
            RNVAC+VR  FFKE D+ LLQ    ++YED++ ++P  P
Sbjct  377  RNVACNVRGGFFKEFDDGLLQKIPQVAYEDDIKDIPIPP  415



>ref|XP_006848184.1| hypothetical protein AMTR_s00029p00237180 [Amborella trichopoda]
 gb|ERN09765.1| hypothetical protein AMTR_s00029p00237180 [Amborella trichopoda]
Length=668

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/39 (56%), Positives = 28/39 (72%), Gaps = 0/39 (0%)
 Frame = -3

Query  118  RNVACDVRSRFFKELDESLLQNTANISYEDEVVNLPSGP  2
            RNVACDVR  FFKE DE++L+  + + YED V +LP  P
Sbjct  385  RNVACDVRGGFFKEFDENILRRVSIMYYEDNVADLPYTP  423



>ref|XP_010923073.1| PREDICTED: RNA polymerase II C-terminal domain phosphatase-like 
2 isoform X1 [Elaeis guineensis]
Length=726

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 21/39 (54%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = -3

Query  118  RNVACDVRSRFFKELDESLLQNTANISYEDEVVNLPSGP  2
            RNVAC+VR  FFKE DESLL+    + YE+++++LP  P
Sbjct  382  RNVACNVRGGFFKEFDESLLRKIFELCYENDILDLPYAP  420



>gb|KCW49459.1| hypothetical protein EUGRSUZ_K02985 [Eucalyptus grandis]
Length=525

 Score = 49.3 bits (116),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 21/39 (54%), Positives = 27/39 (69%), Gaps = 0/39 (0%)
 Frame = -3

Query  118  RNVACDVRSRFFKELDESLLQNTANISYEDEVVNLPSGP  2
            RNVAC VR  FF + D++LL+  + + YEDEVV LP  P
Sbjct  382  RNVACKVRGYFFNDFDKNLLRKISEVFYEDEVVTLPHAP  420



>ref|XP_011096251.1| PREDICTED: RNA polymerase II C-terminal domain phosphatase-like 
1 isoform X1 [Sesamum indicum]
Length=951

 Score = 49.7 bits (117),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 20/39 (51%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = -3

Query  118  RNVACDVRSRFFKELDESLLQNTANISYEDEVVNLPSGP  2
            RNVAC+VR  FFKE D+ LL   + ++YED++ ++PS P
Sbjct  381  RNVACNVRGGFFKEFDDGLLPRISGVAYEDDMRDVPSSP  419



>ref|XP_011096253.1| PREDICTED: RNA polymerase II C-terminal domain phosphatase-like 
1 isoform X2 [Sesamum indicum]
Length=768

 Score = 49.3 bits (116),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 20/39 (51%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = -3

Query  118  RNVACDVRSRFFKELDESLLQNTANISYEDEVVNLPSGP  2
            RNVAC+VR  FFKE D+ LL   + ++YED++ ++PS P
Sbjct  381  RNVACNVRGGFFKEFDDGLLPRISGVAYEDDMRDVPSSP  419



>ref|XP_002869873.1| hypothetical protein ARALYDRAFT_492708 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH46132.1| hypothetical protein ARALYDRAFT_492708 [Arabidopsis lyrata subsp. 
lyrata]
Length=965

 Score = 49.3 bits (116),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 22/39 (56%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = -3

Query  118  RNVACDVRSRFFKELDESLLQNTANISYEDEVVNLPSGP  2
            RNVAC VR  FF++ D+SLL   A ISYE++V ++PS P
Sbjct  400  RNVACGVRGGFFRDFDDSLLPRIAEISYENDVEDIPSPP  438



>ref|XP_008383778.1| PREDICTED: RNA polymerase II C-terminal domain phosphatase-like 
1 isoform X2 [Malus domestica]
Length=927

 Score = 49.3 bits (116),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 21/37 (57%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = -3

Query  118  RNVACDVRSRFFKELDESLLQNTANISYEDEVVNLPS  8
            RNVAC+VR  FF+E D+SLLQ    I YED++ ++PS
Sbjct  356  RNVACNVRGGFFREFDDSLLQKIPEIFYEDDIKDVPS  392



>ref|XP_008809393.1| PREDICTED: RNA polymerase II C-terminal domain phosphatase-like 
1 isoform X2 [Phoenix dactylifera]
Length=950

 Score = 49.3 bits (116),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 21/39 (54%), Positives = 28/39 (72%), Gaps = 0/39 (0%)
 Frame = -3

Query  118  RNVACDVRSRFFKELDESLLQNTANISYEDEVVNLPSGP  2
            RNVAC+VR  FFK+ DE +L   ++I YEDE+ + PS P
Sbjct  380  RNVACNVRGGFFKDFDEGVLPRISDIFYEDEMKDFPSAP  418



>ref|XP_004492424.1| PREDICTED: LOW QUALITY PROTEIN: RNA polymerase II C-terminal 
domain phosphatase-like 2-like [Cicer arietinum]
Length=795

 Score = 49.3 bits (116),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = -3

Query  118  RNVACDVRSRFFKELDESLLQNTANISYEDEVVNLP  11
            RNVAC+VR  FFKE DE+ LQ  A I +EDEV +LP
Sbjct  382  RNVACNVRGCFFKEFDENFLQRIAEIFFEDEVGSLP  417



>ref|XP_008809392.1| PREDICTED: RNA polymerase II C-terminal domain phosphatase-like 
1 isoform X1 [Phoenix dactylifera]
Length=962

 Score = 49.3 bits (116),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 21/39 (54%), Positives = 28/39 (72%), Gaps = 0/39 (0%)
 Frame = -3

Query  118  RNVACDVRSRFFKELDESLLQNTANISYEDEVVNLPSGP  2
            RNVAC+VR  FFK+ DE +L   ++I YEDE+ + PS P
Sbjct  380  RNVACNVRGGFFKDFDEGVLPRISDIFYEDEMKDFPSAP  418



>ref|XP_008349250.1| PREDICTED: RNA polymerase II C-terminal domain phosphatase-like 
1, partial [Malus domestica]
Length=801

 Score = 49.3 bits (116),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 21/37 (57%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = -3

Query  118  RNVACDVRSRFFKELDESLLQNTANISYEDEVVNLPS  8
            RNVAC+VR  FF+E D+SLLQ    I YED++ ++PS
Sbjct  256  RNVACNVRGGFFREFDDSLLQKIPEIFYEDDIKDVPS  292



>ref|XP_008383777.1| PREDICTED: RNA polymerase II C-terminal domain phosphatase-like 
1 isoform X1 [Malus domestica]
Length=956

 Score = 49.3 bits (116),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 21/37 (57%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = -3

Query  118  RNVACDVRSRFFKELDESLLQNTANISYEDEVVNLPS  8
            RNVAC+VR  FF+E D+SLLQ    I YED++ ++PS
Sbjct  385  RNVACNVRGGFFREFDDSLLQKIPEIFYEDDIKDVPS  421



>ref|XP_006373979.1| hypothetical protein POPTR_0016s12200g [Populus trichocarpa]
 gb|ERP51776.1| hypothetical protein POPTR_0016s12200g [Populus trichocarpa]
Length=765

 Score = 48.9 bits (115),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 22/39 (56%), Positives = 28/39 (72%), Gaps = 0/39 (0%)
 Frame = -3

Query  118  RNVACDVRSRFFKELDESLLQNTANISYEDEVVNLPSGP  2
            RNVAC+VR  FFKE DE L++  + + YEDEV +LP  P
Sbjct  382  RNVACNVRGCFFKEFDEILIRRISEVFYEDEVKSLPPTP  420



>ref|XP_011047440.1| PREDICTED: RNA polymerase II C-terminal domain phosphatase-like 
2 isoform X2 [Populus euphratica]
Length=763

 Score = 48.9 bits (115),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 22/39 (56%), Positives = 28/39 (72%), Gaps = 0/39 (0%)
 Frame = -3

Query  118  RNVACDVRSRFFKELDESLLQNTANISYEDEVVNLPSGP  2
            RNVAC+VR  FFKE DE L++  + + YEDEV +LP  P
Sbjct  382  RNVACNVRGCFFKEFDEILIRRISEVFYEDEVKSLPPTP  420



>gb|KFK28749.1| hypothetical protein AALP_AA7G041800 [Arabis alpina]
Length=961

 Score = 48.9 bits (115),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 21/39 (54%), Positives = 28/39 (72%), Gaps = 0/39 (0%)
 Frame = -3

Query  118  RNVACDVRSRFFKELDESLLQNTANISYEDEVVNLPSGP  2
            RNVAC VR  FF++ D+SLLQ    ISYE++  ++PS P
Sbjct  402  RNVACGVRGGFFRDFDDSLLQRIGEISYENDAEDIPSPP  440



>ref|XP_011047439.1| PREDICTED: RNA polymerase II C-terminal domain phosphatase-like 
2 isoform X1 [Populus euphratica]
Length=828

 Score = 48.9 bits (115),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 22/39 (56%), Positives = 28/39 (72%), Gaps = 0/39 (0%)
 Frame = -3

Query  118  RNVACDVRSRFFKELDESLLQNTANISYEDEVVNLPSGP  2
            RNVAC+VR  FFKE DE L++  + + YEDEV +LP  P
Sbjct  382  RNVACNVRGCFFKEFDEILIRRISEVFYEDEVKSLPPTP  420



>ref|XP_006373980.1| hypothetical protein POPTR_0016s12200g [Populus trichocarpa]
 gb|ERP51777.1| hypothetical protein POPTR_0016s12200g [Populus trichocarpa]
Length=830

 Score = 48.9 bits (115),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 22/39 (56%), Positives = 28/39 (72%), Gaps = 0/39 (0%)
 Frame = -3

Query  118  RNVACDVRSRFFKELDESLLQNTANISYEDEVVNLPSGP  2
            RNVAC+VR  FFKE DE L++  + + YEDEV +LP  P
Sbjct  382  RNVACNVRGCFFKEFDEILIRRISEVFYEDEVKSLPPTP  420



>ref|XP_004953235.1| PREDICTED: RNA polymerase II C-terminal domain phosphatase-like 
1-like isoform X1 [Setaria italica]
 ref|XP_004953236.1| PREDICTED: RNA polymerase II C-terminal domain phosphatase-like 
1-like isoform X2 [Setaria italica]
Length=937

 Score = 48.9 bits (115),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 20/39 (51%), Positives = 28/39 (72%), Gaps = 0/39 (0%)
 Frame = -3

Query  118  RNVACDVRSRFFKELDESLLQNTANISYEDEVVNLPSGP  2
            RNVAC+VR  FFK+ DE LL   +N+ YEDE+ ++ + P
Sbjct  388  RNVACNVRGGFFKDFDEGLLPRISNVHYEDEINDISTAP  426



>ref|XP_006827806.1| hypothetical protein AMTR_s00009p00267690 [Amborella trichopoda]
 gb|ERM95222.1| hypothetical protein AMTR_s00009p00267690 [Amborella trichopoda]
Length=942

 Score = 48.9 bits (115),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 21/39 (54%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = -3

Query  118  RNVACDVRSRFFKELDESLLQNTANISYEDEVVNLPSGP  2
            RNVAC+VRS FFK+ D+ LL+   ++ YED++  LPS P
Sbjct  381  RNVACNVRSGFFKDFDDVLLKRIPDVFYEDDISCLPSAP  419



>ref|XP_008371347.1| PREDICTED: RNA polymerase II C-terminal domain phosphatase-like 
1 [Malus domestica]
Length=960

 Score = 48.5 bits (114),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 21/37 (57%), Positives = 27/37 (73%), Gaps = 0/37 (0%)
 Frame = -3

Query  118  RNVACDVRSRFFKELDESLLQNTANISYEDEVVNLPS  8
            RNVAC+VR  FFKE D+SLLQ      YED++ ++PS
Sbjct  387  RNVACNVRGGFFKEFDDSLLQKIPEFFYEDDIKDVPS  423



>ref|XP_008785372.1| PREDICTED: RNA polymerase II C-terminal domain phosphatase-like 
2 [Phoenix dactylifera]
Length=737

 Score = 48.5 bits (114),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 20/39 (51%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = -3

Query  118  RNVACDVRSRFFKELDESLLQNTANISYEDEVVNLPSGP  2
            RNVAC+VR  FFKE DE+LL+    + YE+++++LP  P
Sbjct  382  RNVACNVRGGFFKEFDENLLRKIFELCYENDILDLPYAP  420



>ref|XP_007214548.1| hypothetical protein PRUPE_ppa000988mg [Prunus persica]
 gb|EMJ15747.1| hypothetical protein PRUPE_ppa000988mg [Prunus persica]
Length=940

 Score = 48.5 bits (114),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 20/37 (54%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = -3

Query  118  RNVACDVRSRFFKELDESLLQNTANISYEDEVVNLPS  8
            RNVAC+VR  FF+E D+SLLQ    + YED++ ++PS
Sbjct  387  RNVACNVRGGFFREFDDSLLQKIPEVFYEDDIKDVPS  423



>ref|XP_001758155.1| predicted protein [Physcomitrella patens]
 gb|EDQ76977.1| predicted protein [Physcomitrella patens]
Length=893

 Score = 48.5 bits (114),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 20/39 (51%), Positives = 27/39 (69%), Gaps = 0/39 (0%)
 Frame = -3

Query  118  RNVACDVRSRFFKELDESLLQNTANISYEDEVVNLPSGP  2
            RN+AC+VR  FFKELDE+L Q    + ++ EV +LP  P
Sbjct  391  RNIACNVRGYFFKELDETLTQQMLEVKFDTEVHSLPKAP  429



>ref|XP_001760480.1| predicted protein [Physcomitrella patens]
 gb|EDQ74871.1| predicted protein [Physcomitrella patens]
Length=704

 Score = 48.5 bits (114),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 20/39 (51%), Positives = 26/39 (67%), Gaps = 0/39 (0%)
 Frame = -3

Query  118  RNVACDVRSRFFKELDESLLQNTANISYEDEVVNLPSGP  2
            RN+AC+VR  FFKELDE+L Q    + ++ EV  LP  P
Sbjct  407  RNIACNVRGYFFKELDETLTQQMLEVKFDTEVHTLPKAP  445



>ref|XP_008225045.1| PREDICTED: RNA polymerase II C-terminal domain phosphatase-like 
1 [Prunus mume]
Length=959

 Score = 48.5 bits (114),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 20/37 (54%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = -3

Query  118  RNVACDVRSRFFKELDESLLQNTANISYEDEVVNLPS  8
            RNVAC+VR  FF+E D+SLLQ    + YED++ ++PS
Sbjct  387  RNVACNVRGGFFREFDDSLLQKIPEVFYEDDIKDVPS  423



>dbj|BAD82046.1| C-terminal domain phosphatase-like protein [Oryza sativa Japonica 
Group]
 dbj|BAD82317.1| C-terminal domain phosphatase-like protein [Oryza sativa Japonica 
Group]
Length=524

 Score = 48.1 bits (113),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 20/39 (51%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = -3

Query  118  RNVACDVRSRFFKELDESLLQNTANISYEDEVVNLPSGP  2
            RNVAC+VR  FF+E DE+LL+    + YE+E+++LP  P
Sbjct  403  RNVACNVRGGFFREFDENLLRKVFELMYENELLDLPYAP  441



>ref|XP_006597420.1| PREDICTED: RNA polymerase II C-terminal domain phosphatase-like 
1-like isoform X2 [Glycine max]
Length=937

 Score = 48.5 bits (114),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 20/39 (51%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = -3

Query  118  RNVACDVRSRFFKELDESLLQNTANISYEDEVVNLPSGP  2
            R+VAC+VR  FFK+ D+ LLQ    I+YED++ ++PS P
Sbjct  379  RSVACNVRGGFFKDFDDGLLQKIPLIAYEDDIKDIPSPP  417



>ref|XP_006597421.1| PREDICTED: RNA polymerase II C-terminal domain phosphatase-like 
1-like isoform X3 [Glycine max]
Length=932

 Score = 48.5 bits (114),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 20/39 (51%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = -3

Query  118  RNVACDVRSRFFKELDESLLQNTANISYEDEVVNLPSGP  2
            R+VAC+VR  FFK+ D+ LLQ    I+YED++ ++PS P
Sbjct  379  RSVACNVRGGFFKDFDDGLLQKIPLIAYEDDIKDIPSPP  417



>ref|XP_003543063.1| PREDICTED: RNA polymerase II C-terminal domain phosphatase-like 
1-like isoform X1 [Glycine max]
 ref|XP_006594604.1| PREDICTED: RNA polymerase II C-terminal domain phosphatase-like 
1-like isoform X2 [Glycine max]
Length=960

 Score = 48.5 bits (114),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 20/37 (54%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = -3

Query  118  RNVACDVRSRFFKELDESLLQNTANISYEDEVVNLPS  8
            RNVAC+VR  FFK+ D+ LLQ    I+YED++ ++PS
Sbjct  379  RNVACNVRGGFFKDFDDGLLQKIPLIAYEDDIKDIPS  415



>emb|CDY11208.1| BnaA03g00440D [Brassica napus]
Length=790

 Score = 48.1 bits (113),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 21/39 (54%), Positives = 28/39 (72%), Gaps = 0/39 (0%)
 Frame = -3

Query  118  RNVACDVRSRFFKELDESLLQNTANISYEDEVVNLPSGP  2
            RNVAC+VR  FFKE DESL+ + + + +ED+V  LP  P
Sbjct  416  RNVACNVRGYFFKEFDESLMSSISLVYHEDDVETLPPSP  454



>ref|NP_001044850.1| Os01g0857000 [Oryza sativa Japonica Group]
 dbj|BAD82045.1| C-terminal domain phosphatase-like protein [Oryza sativa Japonica 
Group]
 dbj|BAD82316.1| C-terminal domain phosphatase-like protein [Oryza sativa Japonica 
Group]
 dbj|BAF06764.1| Os01g0857000 [Oryza sativa Japonica Group]
 gb|EEE55696.1| hypothetical protein OsJ_04124 [Oryza sativa Japonica Group]
Length=756

 Score = 48.1 bits (113),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 20/39 (51%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = -3

Query  118  RNVACDVRSRFFKELDESLLQNTANISYEDEVVNLPSGP  2
            RNVAC+VR  FF+E DE+LL+    + YE+E+++LP  P
Sbjct  403  RNVACNVRGGFFREFDENLLRKVFELMYENELLDLPYAP  441



>ref|XP_003545893.1| PREDICTED: RNA polymerase II C-terminal domain phosphatase-like 
1-like isoform X1 [Glycine max]
Length=958

 Score = 48.5 bits (114),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 20/39 (51%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = -3

Query  118  RNVACDVRSRFFKELDESLLQNTANISYEDEVVNLPSGP  2
            R+VAC+VR  FFK+ D+ LLQ    I+YED++ ++PS P
Sbjct  379  RSVACNVRGGFFKDFDDGLLQKIPLIAYEDDIKDIPSPP  417



>gb|KHN08543.1| RNA polymerase II C-terminal domain phosphatase-like 1 [Glycine 
soja]
Length=960

 Score = 48.5 bits (114),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 20/37 (54%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = -3

Query  118  RNVACDVRSRFFKELDESLLQNTANISYEDEVVNLPS  8
            RNVAC+VR  FFK+ D+ LLQ    I+YED++ ++PS
Sbjct  379  RNVACNVRGGFFKDFDDGLLQKIPLIAYEDDIKDIPS  415



>dbj|BAD94401.1| putative protein [Arabidopsis thaliana]
Length=614

 Score = 48.1 bits (113),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 21/39 (54%), Positives = 28/39 (72%), Gaps = 0/39 (0%)
 Frame = -3

Query  118  RNVACDVRSRFFKELDESLLQNTANISYEDEVVNLPSGP  2
            RNVAC VR  FF++ D+SLL   A ISYE++  ++PS P
Sbjct  46   RNVACGVRGGFFRDFDDSLLPRIAEISYENDAEDIPSPP  84



>ref|XP_009130663.1| PREDICTED: RNA polymerase II C-terminal domain phosphatase-like 
2 [Brassica rapa]
Length=763

 Score = 48.1 bits (113),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 21/39 (54%), Positives = 28/39 (72%), Gaps = 0/39 (0%)
 Frame = -3

Query  118  RNVACDVRSRFFKELDESLLQNTANISYEDEVVNLPSGP  2
            RNVAC+VR  FFKE DESL+ + + + +ED+V  LP  P
Sbjct  386  RNVACNVRGYFFKEFDESLMSSISLVYHEDDVETLPPSP  424



>ref|XP_008775881.1| PREDICTED: LOW QUALITY PROTEIN: RNA polymerase II C-terminal 
domain phosphatase-like 1 [Phoenix dactylifera]
Length=945

 Score = 48.1 bits (113),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 22/39 (56%), Positives = 26/39 (67%), Gaps = 0/39 (0%)
 Frame = -3

Query  118  RNVACDVRSRFFKELDESLLQNTANISYEDEVVNLPSGP  2
            RNVAC+VR  FFKE DE LL   ++  YEDE  + PS P
Sbjct  380  RNVACNVRGGFFKEFDEGLLPRISDSFYEDEWKDFPSAP  418



>ref|XP_006646491.1| PREDICTED: RNA polymerase II C-terminal domain phosphatase-like 
2-like [Oryza brachyantha]
Length=819

 Score = 48.1 bits (113),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 20/39 (51%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = -3

Query  118  RNVACDVRSRFFKELDESLLQNTANISYEDEVVNLPSGP  2
            RNVAC+VR  FF+E DE+LL+    + YE+E+++LP  P
Sbjct  378  RNVACNVRGGFFREFDENLLRKVFELMYENELLDLPYAP  416



>gb|EMS59540.1| RNA polymerase II C-terminal domain phosphatase-like 2 [Triticum 
urartu]
Length=601

 Score = 47.8 bits (112),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 20/39 (51%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = -3

Query  118  RNVACDVRSRFFKELDESLLQNTANISYEDEVVNLPSGP  2
            RNVAC+VR  FF+E DE+LL+    + YE+E+++LP  P
Sbjct  277  RNVACNVRGGFFREFDENLLKKVFELLYENELLDLPYAP  315



>ref|XP_003564644.2| PREDICTED: RNA polymerase II C-terminal domain phosphatase-like 
2 [Brachypodium distachyon]
Length=732

 Score = 47.8 bits (112),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/39 (51%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = -3

Query  118  RNVACDVRSRFFKELDESLLQNTANISYEDEVVNLPSGP  2
            RNVAC+VR  FF+E DE+LL+    + YE+E+++LP  P
Sbjct  397  RNVACNVRGGFFREFDENLLKKVFELLYENELLDLPYAP  435



>emb|CDM85065.1| unnamed protein product [Triticum aestivum]
Length=739

 Score = 47.8 bits (112),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/39 (51%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = -3

Query  118  RNVACDVRSRFFKELDESLLQNTANISYEDEVVNLPSGP  2
            RNVAC+VR  FF+E DE+LL+    + YE+E+++LP  P
Sbjct  405  RNVACNVRGGFFREFDENLLKKVFELLYENELLDLPYAP  443



>dbj|BAF01152.1| hypothetical protein [Arabidopsis thaliana]
Length=967

 Score = 47.8 bits (112),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/39 (54%), Positives = 28/39 (72%), Gaps = 0/39 (0%)
 Frame = -3

Query  118  RNVACDVRSRFFKELDESLLQNTANISYEDEVVNLPSGP  2
            RNVAC VR  FF++ D+SLL   A ISYE++  ++PS P
Sbjct  399  RNVACGVRGGFFRDFDDSLLPRIAEISYENDAEDIPSPP  437



>emb|CAB36811.1| putative protein [Arabidopsis thaliana]
 emb|CAB81274.1| putative protein [Arabidopsis thaliana]
Length=995

 Score = 47.8 bits (112),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/39 (54%), Positives = 28/39 (72%), Gaps = 0/39 (0%)
 Frame = -3

Query  118  RNVACDVRSRFFKELDESLLQNTANISYEDEVVNLPSGP  2
            RNVAC VR  FF++ D+SLL   A ISYE++  ++PS P
Sbjct  413  RNVACGVRGGFFRDFDDSLLPRIAEISYENDAEDIPSPP  451



>ref|NP_193898.3| RNA polymerase II C-terminal domain phosphatase-like 1 [Arabidopsis 
thaliana]
 sp|Q5YDB6.1|CPL1_ARATH RecName: Full=RNA polymerase II C-terminal domain phosphatase-like 
1; Short=FCP-like 1; AltName: Full=Carboxyl-terminal phosphatase-like 
1; Short=AtCPL1; Short=CTD phosphatase-like 
1; AltName: Full=Protein FIERY 2; AltName: Full=Protein JASMONATE 
OVEREXPRESSING 1 [Arabidopsis thaliana]
 gb|AAT52022.1| C-terminal domain phosphatase-like 1 [Arabidopsis thaliana]
 gb|AEE84488.1| RNA polymerase II C-terminal domain phosphatase-like 1 [Arabidopsis 
thaliana]
Length=967

 Score = 47.8 bits (112),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/39 (54%), Positives = 28/39 (72%), Gaps = 0/39 (0%)
 Frame = -3

Query  118  RNVACDVRSRFFKELDESLLQNTANISYEDEVVNLPSGP  2
            RNVAC VR  FF++ D+SLL   A ISYE++  ++PS P
Sbjct  399  RNVACGVRGGFFRDFDDSLLPRIAEISYENDAEDIPSPP  437



>gb|EEC71832.1| hypothetical protein OsI_04490 [Oryza sativa Indica Group]
Length=745

 Score = 47.4 bits (111),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/39 (51%), Positives = 28/39 (72%), Gaps = 0/39 (0%)
 Frame = -3

Query  118  RNVACDVRSRFFKELDESLLQNTANISYEDEVVNLPSGP  2
            RNVAC+VR  FF+E DE+LL+    + YE+E ++LP  P
Sbjct  403  RNVACNVRGGFFREFDENLLRKVFELMYENEFLDLPYAP  441



>ref|XP_009135034.1| PREDICTED: RNA polymerase II C-terminal domain phosphatase-like 
1 [Brassica rapa]
Length=908

 Score = 47.4 bits (111),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/39 (54%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = -3

Query  118  RNVACDVRSRFFKELDESLLQNTANISYEDEVVNLPSGP  2
            +N+AC VR+ FFK  D+SLL   A ISYE++V ++PS P
Sbjct  391  KNLACVVRTGFFKHFDDSLLPRIAEISYENDVEDIPSPP  429



>emb|CDX79083.1| BnaA01g11500D [Brassica napus]
Length=859

 Score = 47.4 bits (111),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/39 (54%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = -3

Query  118  RNVACDVRSRFFKELDESLLQNTANISYEDEVVNLPSGP  2
            +N+AC VR+ FFK  D+SLL   A ISYE++V ++PS P
Sbjct  393  KNLACVVRTGFFKHFDDSLLPRIAEISYENDVEDIPSPP  431



>gb|EMS45792.1| RNA polymerase II C-terminal domain phosphatase-like 1 [Triticum 
urartu]
Length=859

 Score = 47.4 bits (111),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/39 (51%), Positives = 27/39 (69%), Gaps = 0/39 (0%)
 Frame = -3

Query  118  RNVACDVRSRFFKELDESLLQNTANISYEDEVVNLPSGP  2
            RNVAC+VR  FFK+ DE LL    ++ YEDE+ ++ S P
Sbjct  382  RNVACNVRGGFFKDFDEGLLPRITSVLYEDEIQDISSAP  420



>ref|XP_003580187.1| PREDICTED: RNA polymerase II C-terminal domain phosphatase-like 
1 isoform X1 [Brachypodium distachyon]
Length=937

 Score = 47.4 bits (111),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 19/39 (49%), Positives = 28/39 (72%), Gaps = 0/39 (0%)
 Frame = -3

Query  118  RNVACDVRSRFFKELDESLLQNTANISYEDEVVNLPSGP  2
            RN+AC+VR  FFKE DE LL   + + ++DE+ ++PS P
Sbjct  384  RNIACNVRGGFFKEFDEGLLPWISEVHFDDELNHVPSAP  422



>ref|XP_010240169.1| PREDICTED: RNA polymerase II C-terminal domain phosphatase-like 
1 isoform X2 [Brachypodium distachyon]
Length=832

 Score = 47.0 bits (110),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 19/39 (49%), Positives = 28/39 (72%), Gaps = 0/39 (0%)
 Frame = -3

Query  118  RNVACDVRSRFFKELDESLLQNTANISYEDEVVNLPSGP  2
            RN+AC+VR  FFKE DE LL   + + ++DE+ ++PS P
Sbjct  279  RNIACNVRGGFFKEFDEGLLPWISEVHFDDELNHVPSAP  317



>dbj|BAJ93585.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=932

 Score = 47.0 bits (110),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/39 (51%), Positives = 27/39 (69%), Gaps = 0/39 (0%)
 Frame = -3

Query  118  RNVACDVRSRFFKELDESLLQNTANISYEDEVVNLPSGP  2
            RNVAC+VR  FFK+ DE LL    ++ YEDE+ ++ S P
Sbjct  385  RNVACNVRGGFFKDFDEGLLPRITSVLYEDEIQDISSAP  423



>ref|XP_008677623.1| PREDICTED: uncharacterized protein LOC100383723 isoform X1 [Zea 
mays]
 gb|AFW63149.1| hypothetical protein ZEAMMB73_795279 [Zea mays]
Length=932

 Score = 47.0 bits (110),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/32 (63%), Positives = 24/32 (75%), Gaps = 0/32 (0%)
 Frame = -3

Query  118  RNVACDVRSRFFKELDESLLQNTANISYEDEV  23
            RNVAC+VR  FFK+ DE LL   +N+ YEDEV
Sbjct  387  RNVACNVRGGFFKDFDEGLLPRISNVHYEDEV  418



>ref|XP_009413134.1| PREDICTED: RNA polymerase II C-terminal domain phosphatase-like 
1 isoform X2 [Musa acuminata subsp. malaccensis]
Length=814

 Score = 46.6 bits (109),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 19/39 (49%), Positives = 26/39 (67%), Gaps = 0/39 (0%)
 Frame = -3

Query  118  RNVACDVRSRFFKELDESLLQNTANISYEDEVVNLPSGP  2
            RNVAC+VR  FFK+ DE +L   + + YEDE+ + P  P
Sbjct  245  RNVACNVRGGFFKDFDEGILPRISEVLYEDEMKDFPPAP  283



>ref|XP_009413132.1| PREDICTED: RNA polymerase II C-terminal domain phosphatase-like 
1 isoform X1 [Musa acuminata subsp. malaccensis]
 ref|XP_009413133.1| PREDICTED: RNA polymerase II C-terminal domain phosphatase-like 
1 isoform X1 [Musa acuminata subsp. malaccensis]
Length=949

 Score = 46.6 bits (109),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 19/39 (49%), Positives = 26/39 (67%), Gaps = 0/39 (0%)
 Frame = -3

Query  118  RNVACDVRSRFFKELDESLLQNTANISYEDEVVNLPSGP  2
            RNVAC+VR  FFK+ DE +L   + + YEDE+ + P  P
Sbjct  380  RNVACNVRGGFFKDFDEGILPRISEVLYEDEMKDFPPAP  418



>gb|EPS68977.1| hypothetical protein M569_05791, partial [Genlisea aurea]
Length=714

 Score = 46.6 bits (109),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 18/39 (46%), Positives = 28/39 (72%), Gaps = 0/39 (0%)
 Frame = -3

Query  118  RNVACDVRSRFFKELDESLLQNTANISYEDEVVNLPSGP  2
            RNVAC+VR  FFK+ D+ LL   + +++ED+  ++PS P
Sbjct  382  RNVACNVRGSFFKDFDDGLLPRISEVAFEDDAKDMPSTP  420



>ref|XP_002446830.1| hypothetical protein SORBIDRAFT_06g023330 [Sorghum bicolor]
 gb|EES11158.1| hypothetical protein SORBIDRAFT_06g023330 [Sorghum bicolor]
Length=879

 Score = 46.2 bits (108),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 19/39 (49%), Positives = 27/39 (69%), Gaps = 0/39 (0%)
 Frame = -3

Query  118  RNVACDVRSRFFKELDESLLQNTANISYEDEVVNLPSGP  2
            RNVAC+VR+ FFKE DE ++     + YEDE+ ++ S P
Sbjct  384  RNVACNVRAGFFKEFDEGIIPRITEVCYEDELDDIASAP  422



>ref|XP_004970633.1| PREDICTED: RNA polymerase II C-terminal domain phosphatase-like 
2-like [Setaria italica]
Length=748

 Score = 45.8 bits (107),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 18/39 (46%), Positives = 28/39 (72%), Gaps = 0/39 (0%)
 Frame = -3

Query  118  RNVACDVRSRFFKELDESLLQNTANISYEDEVVNLPSGP  2
            RNVAC++R  FF+E DE+LL+    + YE+ +++LP  P
Sbjct  411  RNVACNIRGGFFREFDENLLKKVFELHYENGLLDLPYAP  449



>ref|XP_010538519.1| PREDICTED: RNA polymerase II C-terminal domain phosphatase-like 
1 [Tarenaya hassleriana]
Length=970

 Score = 45.8 bits (107),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 20/39 (51%), Positives = 28/39 (72%), Gaps = 0/39 (0%)
 Frame = -3

Query  118  RNVACDVRSRFFKELDESLLQNTANISYEDEVVNLPSGP  2
            RNVAC+VR  FFK+ D+ LLQ    ISYE+++ ++ S P
Sbjct  405  RNVACNVRGGFFKDFDDCLLQRIGEISYENDIEDIHSPP  443



>ref|XP_006381242.1| hypothetical protein POPTR_0006s10030g [Populus trichocarpa]
 gb|ERP59039.1| hypothetical protein POPTR_0006s10030g [Populus trichocarpa]
Length=444

 Score = 45.4 bits (106),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 21/39 (54%), Positives = 27/39 (69%), Gaps = 0/39 (0%)
 Frame = -3

Query  118  RNVACDVRSRFFKELDESLLQNTANISYEDEVVNLPSGP  2
            RNVAC+VR  FFKE  E L++  + + YEDEV +LP  P
Sbjct  104  RNVACNVRGCFFKEFVEILIRRMSEVFYEDEVKSLPPPP  142



>ref|NP_001168634.1| hypothetical protein [Zea mays]
 gb|ACN28944.1| unknown [Zea mays]
 tpg|DAA56754.1| TPA: hypothetical protein ZEAMMB73_254643 [Zea mays]
Length=623

 Score = 45.4 bits (106),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 19/39 (49%), Positives = 28/39 (72%), Gaps = 0/39 (0%)
 Frame = -3

Query  118  RNVACDVRSRFFKELDESLLQNTANISYEDEVVNLPSGP  2
            RNVAC+VR  FF+E DE+LL+    + YE+ +++LP  P
Sbjct  411  RNVACNVRGGFFREFDENLLRKVFELYYENGLLDLPYAP  449



>ref|XP_006283078.1| hypothetical protein CARUB_v10004071mg [Capsella rubella]
 gb|EOA15976.1| hypothetical protein CARUB_v10004071mg [Capsella rubella]
Length=971

 Score = 45.8 bits (107),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 20/39 (51%), Positives = 27/39 (69%), Gaps = 0/39 (0%)
 Frame = -3

Query  118  RNVACDVRSRFFKELDESLLQNTANISYEDEVVNLPSGP  2
            RNVAC VR  FF++ D+ LL   A ISYE++  ++PS P
Sbjct  403  RNVACGVRGGFFRDFDDCLLPRIAEISYENDAEDIPSPP  441



>ref|XP_002458790.1| hypothetical protein SORBIDRAFT_03g040355 [Sorghum bicolor]
 gb|EES03910.1| hypothetical protein SORBIDRAFT_03g040355 [Sorghum bicolor]
Length=718

 Score = 45.4 bits (106),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 19/39 (49%), Positives = 28/39 (72%), Gaps = 0/39 (0%)
 Frame = -3

Query  118  RNVACDVRSRFFKELDESLLQNTANISYEDEVVNLPSGP  2
            RNVAC+VR  FF+E DE+LL+    + YE+ +++LP  P
Sbjct  382  RNVACNVRGGFFREFDENLLRKVFELYYENGLLDLPYAP  420



>ref|XP_008673132.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 tpg|DAA56753.1| TPA: hypothetical protein ZEAMMB73_254643 [Zea mays]
Length=749

 Score = 45.4 bits (106),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 19/39 (49%), Positives = 28/39 (72%), Gaps = 0/39 (0%)
 Frame = -3

Query  118  RNVACDVRSRFFKELDESLLQNTANISYEDEVVNLPSGP  2
            RNVAC+VR  FF+E DE+LL+    + YE+ +++LP  P
Sbjct  411  RNVACNVRGGFFREFDENLLRKVFELYYENGLLDLPYAP  449



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 518182412384